2B4BA

Ssat+coa+be-3-3-3, k6r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
168
structure length
168
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b4bA00
3BJ7A 2J8RA 5KTDA 1K4JA 1MJBA 2FL4A 4FD7A 1Q2DA 5E96A 2HV2A 4L8AA 4AG9A 5IB0A 4KOYA 4UBRA 5F47A 1MJ9A 1QSMA 4U9YA 1Q2YA 4CAWA 4J3GA 4MY0A 2P6EA 2JDDA 1XF8A 1M4GA 1IIDA 5GCNA 2QMLA 3P2HA 4MJ8A 4NXYA 3TOAA 4M3SA 4B5PB 5CNPA 4K30A 2JEVA 2PR1A 1OZPA 1B6BA 3TFYA 2Y0MA 3ZZIA 3IWGA 4H89A 2GE3A 3SHPA 5HMNA 2FXFA 1L0CA 2Q04A 2VXKA 2R98A 5H84A 3K9UA 3IGRA 3B8GA 1QSRA 5C82A 3CXSA 2ZW5A 4HKFA 4RI1A 5KTAA 5EC4A 4PSXA 2BL1A 1M44A 1YGHA 1QSNA 4CS0B 4YFJA 2QIRA 2O28A 4ORFA 1S7FA 4AVAA 2FT0A 2Q0YA 1R57A 3GYAA 2B58A 1J4JA 3PP9A 4E2AA 4EVYA 4CRZB 1WK4A 2PSWA 4XPDC 2H5MA 1Y7RA 2J8NA 3C26A 1FY7A 2G3TA 4QB9A 2FCKA 3QAHA 2BUEA 4LX9A 3R1KA 3DSBA 5JQ4A 4HNYB 4MBUA 2R7HA 1UFHA 1CJWA 2OZUA 2P6GA 4JLYA 2OZHA 4OADA 3DR6A 2HQYA 2B4BA 4FD6A 2RC4A 1VHSA 3DNSA 4AVBA 4X5KA 2B3VA 4FD4A 3TTHA 4HNXB 4FD5A 2GIVA 4KVOE 4KLWA 2KCWA 2ZXVA 1M1DA 4H6UA 2JLMA 1KZFA 1Z9UA 3LD2A 4XPKA 4KUAA 4DNCA 1YR0A 4OLLA 3RYOA 4IF5A 2PDOA 3EXNA 3F8KA 4MHDA 1S7LA 3KKWA 2D4PA 4R57A 4AVCA 4H6ZA 2VQYA 2ZW4A 1KUXA 1M4IA 4KOUA 3TO9A 2HUZA 4KORA 4LUAA 3TE4A 3W6SA 2EVNA 2FIWA 4GS4A 1I21A 3FXTA 4R87A 2IL4A 3SXOA 1Z4EA 2ARHA 3I9SA 3FYNA 4QUSA 4YRHA 3D3SA 1S3ZA 4KOTA 4QVTA 2VEZA 3GKRA 2FS5A 4QC6A 2K5TA 4ONUA 2VZZA 2QECA 3D8PA 4CRYB 4KOXA 3P2FA 4PK3A 4KOWA 2B3UA 2J8MA 2VBQA 3R9FA 1BOBA 2CNSA 1IICA 3EFAA 1NSLA 4JXQA 1N71A 1Y9KA 1U6MA 4AB7A 5HH1A 2B4DB 4M85A 2R8VA 4MY3A 1XE4A 1V0CA 1GHEA 2DXQA 5H86A 3TCVA 2AJ6A 2I79A 3E0KA 1IYKA 2EUIA 1KUVA 4U9ZA 1QSOA 4PSWA 3CXPA 4QBJA 5FVJA 5J8FA 1TIQA 3S6GA 3W91A 1LRZA 3S6FA 2Z10A 4B5OA 1XEBA 3FRMA 4PV6A 2OZGA 4ZBGA 3I3GA 2CNMA 3JUWA 1S7NA 1M4DA 5DWMA 4HNWB 1XIXA 2REFA 5F48A 4B5PA 3FBUA 3W6XA 2B5GB 1YLEA 3FB3A 3G8WA 1ON0A 2Q44A 1CM0A 2OB0A 4Y49B 4R9MA 3R9EA 3UY5A 2Q7BA 3SXNA 2Q4YA 4RS2A 3R9GA 5EBVA 3G3SA 1IYLA 4U5YA 1YX0A 1RXTA 2Q4VA 3EY5A 2ATRA 5DWNA 3BLNA 4E0AA 1I12A 2ZW6A 4NF1A 2WPXA 3NE7A 1MJAA 4JWPA 1BO4A 4XNHB 2JDCA 4XPLA 3EO4A 3D2MA 2FIAA 1KUYA 1PU9A 4JXRA 2CNTA 2WPWA 3S6KA 2P6FA 4R3KA 5JPHA 2ZPAA 3EC4A 2P0WA 4CAXA 1Y9WA 1WWZA 4L89A 3FNCA 1NE9A 1RO5A 3WR7A 2F5IA 3F0AA 3R95A 5J8CA 2D4OA 3GY9A 4AG7A 5KTCA 2VZYA 2B5GA 2Z11A 2G3AA 2REEA 2R1IA 4KVXA 3V8IA 2PC1A 2FSRA 3D2PA 2ZW7A 4MI4A 2VI7A 1MK4A 1QSTA 2BSWA 3LODA 3T90A 3T9YA 1YVOA 4KOVA 4F6AA 5IV0A 1XMTA 2OU2A 1Z4RA 4NEXA 3N7ZA 5F49A 4OAEA 3F5BA 3QB8A 1VKCA 3MGDA 5I0CA 4CAVA 1NMTA 5C88A 4KUBA 1IB1E 4YGOA 3FIXA 2FE7A 4KOSA 1PUAA 1S5KA 3CXQA 3TT2A 1B87A 1YK3A 2PRBA 5F46A 4UWJA 3JVNA 4Y49C 4II9A 3R96A 2CY2A 3PZJA 5IX3A 4KZTA 2A4NA 3ZJ0A 2PQ8A 4F0YA 1S60A 4R3LA 2X7BA 3OWCA 4KVME 4JD6A 2PR8A 1P0HA 4E8OA 3TO6A 1YVKA 2C27A 4UA3A 3TOBA 3H4QA 3TO7A 4PK2A 1P4NA 1I1DA 4XNHC 2BEIA 4UWIA 4XPDB 3VWEA 2Z0ZA 2I00A 4NCZA 5ISVA 2NMTA 1Q2CA 1YREA 2G0BA 2B4DA 1SQHA 2AE6A 3VWDA 3BJ8A 4BMHA 2GANA 3PGPA 4IUSA 4I49A 3S6HA 4JJXA 4KLVA 1S7KA 2OH1A 3DDDA 4NSQA 3DR8A
chains in the Genus database with same CATH superfamily
3NH8A 4B10A 3WC5A 3D7FA 3IEHA 3BJ7A 3TC8A 2J8RA 3WABA 1ARMA 5KTDA 1K4JA 1MJBA 3B3WA 2FL4A 4FD7A 8CPAA 1Q2DA 5E96A 2HV2A 1HDUA 2XEFA 4L8AA 4ZY0A 4AG9A 5IB0A 4KOYA 4UBRA 2PJ2A 2O4HA 1MJ9A 3PBEA 5F47A 1QSMA 4U9YA 4ZY1A 5A28A 1Q2YA 2Q4ZA 3LACA 4CAWA 4J3GA 1ARLA 4ZGYB 2ZELA 2IJZA 1LAPA 3S9LA 3BI0A 3CDXA 2ODFA 3BI1A 3PB4X 4MY0A 5LYDA 2P6EA 1VHOA 4A37A 2DPTA 2JDDA 1XF8A 2YNCA 3SI0A 1IY7A 1M4GA 1IIDA 1LOKA 3KI9A 5GCNA 2QMLA 4P4BA 3P2HA 2AFUA 4MJ8A 4NXYA 5AG6A 1Z8TA 2ZEDA 4M3SA 4K30A 5CNPA 2JEVA 4UCMA 4B5PB 4DUKA 4R6TA 2PR1A 3JRUA 5AG5A 3B3CA 4B11A 5HVGA 3FX6A 5JM6A 1LCPA 5K8NA 4RN7A 1OBRA 1OZPA 1B6BA 1XFOA 4MCRA 2Y0MA 1ZG9A 3TFYA 3ZZIA 3IWGA 4H89A 3SJFA 2GE3A 2ZOGA 2WZNA 4P4FA 3SHPA 2DEAA 3CT9A 2XEGA 4FAIA 5HMNA 2FXFA 1L0CA 2Q04A 1AYEA 1TXRA 1UWYA 4O23A 2VXKA 2R98A 4OC0A 5H84A 2ZEFA 3K9UA 2HC9A 4NGNA 3IGRA 3N5FA 3B8GA 5LYLA 4UFWA 1QSRA 5DS0A 5C82A 2JBJA 3IO1A 3CXSA 4GM5A 2ABZA 2ZEEA 2ZW5A 4HKFA 2F8HA 4RI1A 5CPAA 2QVPA 5KTAA 2PVVA 2PJ7A 4LQGA 4OC2A 2YNCC 3FMCA 5EC4A 3FJUA 4Z65A 4PSXA 4ZX9A 2PJ6A 1F57A 4NJQA 4MXUA 5K8OA 1TF9A 4ZI6A 4FBEA 1CP6A 2BL1A 2PJ0A 5K8PA 1M44A 3SJEA 1CBXA 4C2ZA 1CX8A 1YGHA 2AFMA 1QSNA 4OC3A 4KSIA 4CS0B 4YFJA 4MCPA 1YW6A 2QIRA 2V77A 2AFXA 2O28A 4NGQA 4ORFA 1S7FA 4R8FA 1Q7LA 1IU8A 4AVAA 2EK9A 2FT0A 2Q0YA 1R57A 3GYAA 4CYOA 4A39A 2B58A 2CXAA 4P10A 1J4JA 3PP9A 1AMPA 4E2AA 1XBUA 2BCOA 3ISZA 1Y0RA 4EVYA 4CRZB 1WK4A 2PSWA 2ZEHA 4MRIA 4XPDC 5F09A 2H5MA 1GYTA 1Y7RA 2J8NA 4F9VA 3IU1A 4G1PA 3C26A 1FY7A 2G3TA 4QB9A 2Z3NA 2FCKA 3WT4A 3QAHA 2BUEA 4LX9A 3R1KA 3TX8A 2DF5A 3DSBA 4GXHA 3B3SA 5JQ4A 4HNYB 2Z3MA 1JWQA 4MBUA 2R7HA 1UFHA 1CJWA 2OZUA 3WC6A 2P6GA 4JLYA 2OZHA 3D7HA 4UEEA 3KASA 1ZLHA 4OADA 3DR6A 4CYPA 5HVHA 2HQYA 1XRYA 2B4BA 1EE3P 2FVGA 4A95A 1ELMP 4FD6A 2RC4A 3VATA 1DE4C 2WYRA 1VHSA 1ZLIA 2GU2A 4BBHA 3DNSA 4AVBA 3D67A 4AXVA 2C6CA 4KSAA 4X5KA 2B3VA 2G9DA 4FD4A 3K2KA 4HNXB 3TTHA 4FD5A 4CGLA 4UCPA 2GIVA 3DLJA 4CGOA 1CPSA 3GIUA 4KVOE 5ELYA 3H5ZA 1Z2LA 5I4MA 4KLWA 2PJ4A 4P4EA 2KCWA 1BPMA 4F0XA 4MFKA 2ZXVA 2V8DA 1M1DA 4H6UA 4A33A 2JLMA 1KZFA 1LANA 1Z9UA 3B3TA 3LD2A 1TKFA 3MN8A 4KUAA 2YGWA 1YR0A 4IAVA 4OLLA 4XPKA 3RYOA 4DNCA 3IU2A 4IF5A 2PDOA 3EXNA 3F8KA 3H8EA 3PB6X 4MHDA 4B6ZA 4P4IA 1S7LA 2GFQA 3RAMA 3KKWA 3NH4A 2D4PA 2Q43A 3GLJA 3KR5A 4A94A 4R57A 4AVCA 2CF4A 3I1UA 4H6ZA 4C2YA 2PJ5A 2CTCA 2VQYA 3H8GA 2ZW4A 3KZWA 1KUXA 4MMOA 3JTKA 4CPAA 4CAEA 1M4IA 4MFQA 2O53A 4ZX8A 2F7VA 3BXMA 4KOUA 4MFZA 2HUZA 3TO9A 3V38A 4KORA 3KHXA 4LUAA 3TE4A 3W6SA 2XEJA 3FVLA 2EVNA 2Z3LA 3KL9A 4UEZA 2FIWA 1ZG8A 3SI1A 4GS4A 1I21A 3FXTA 4R87A 4C7IA 2IL4A 3SXOA 1CP7A 1VIXA 1Z4EA 2ARHA 2JEWA 3I9SA 3FYNA 1YMEA 2VL1A 4QUSA 4YRHA 3D3SA 1S3ZA 4KOTA 4QVTA 2ZENA 2VEZA 3GKRA 2FS5A 2IQ6A 2PJAA 4QC6A 2K5TA 4ONUA 4NSQA 4OMEA 2VZZA 2J9AA 2QECA 3D8PA 4NFRA 4CRYB 4KOXA 2PJ8A 3P2FA 4NGTA 2PE3A 4PK3A 3SJXA 4CGNA 4EFDA 4KOWA 3HUVA 1HDQA 2B3UA 5JH9A 4Q36A 4A30A 2PRQA 3D4UA 2J8MA 2VBQA 3R9FA 1BOBA 5J1QA 1IGBA 3HLPA 4RUHA 3FECA 6CPAA 3B2YA 2CNSA 1IICA 3EFAA 1NSLA 4JXQA 1N71A 2IMOA 1Y9KA 2CIJA 1U6MA 4AB7A 5HH1A 2B4DB 3IJ3A 2R8VA 3PRTA 4M85A 4UIAA 4MY3A 1XE4A 1V0CA 1GHEA 2DXQA 2EBJA 5H86A 2AJ6A 2I79A 2C6GA 4Q38A 3TCVA 3E0KA 3NH5A 1IYKA 4A38A 4MFJA 2EUIA 1KUVA 2CTBA 1IOIA 4U9ZA 4CGMA 1QSOA 1JQGA 4PSWA 2XEIA 1KWMA 1IOFA 3BHXA 3CXPA 3PB8X 4IHMA 5FVJA 5G1ZA 4QBJA 5J8FA 5JGFA 3LWUA 1TIQA 4HPSA 4K3NA 4B12A 3S6GA 1LFWA 5EMIA 5LRJA 1Y7EA 3W91A 4UF4A 1LRZA 3S6FA 1XOVA 2Z10A 4ZYQA 4WWVA 4NGSA 3D68A 1XEBA 4TWEA 3FRMA 4B5OA 4PV6A 2BOAA 2OZGA 4PXCA 3I3GA 1F2OA 4X3RA 2CNMA 4ZBGA 1QMUA 3LMSA 4B13A 2C6PA 2Z3KA 3D7DA 3JUWA 3PFOA 4C7HA 1S7NA 1ELLP 1M4DA 5DWMA 4HNWB 2I3CA 3CPXA 1XIXA 5LRKA 2REFA 5F48A 1DTDA 4B5PA 4CYQA 3FBUA 4A2ZA 1XJOA 3W6XA 3RNZA 2B5GB 2WUUA 1YLEA 1CG2A 1TF8A 3V7ZA 2C1CA 3FB3A 3G8WA 1ON0A 2Q44A 1CM0A 2Z3OA 3T8WA 2OB0A 4P6YA 7CPAA 3PBBA 2Q51A 4FWUA 5D29A 2PJCA 5IB9A 4Y49B 5LYFA 4R9MA 4M6GA 3R9EA 3UY5A 4PPZA 2GLFA 2Q7BA 3SXNA 2Q4YA 4RS2A 3R9GA 5EBVA 3G3SA 1R3NA 1ZG7A 3IWWA 5CBMA 1IYLA 4U5YA 2RFHA 5HVFA 2AFWA 1YX0A 1RXTA 4W9YA 4X2TA 2Q4VA 3EY5A 2Q7SA 2ATRA 3GB0A 2AFZA 3PFEA 4WJBA 1YLOA 5DWNA 1X10A 2PIYA 2YNEA 5G20A 3BLNA 4E0AA 5AG4A 2EWBA 1I12A 3FEEA 4ZY2A 2ZW6A 3IC1A 4NF1A 4MHPA 3MRUA 2WPXA 4EWTA 3D66A 2AFSA 5D8NA 4JYWA 2NSMA 4F8ZA 1BLLE 2Z3PA 3NE7A 4MHYA 1Z8LA 2V8VA 1MJAA 2YNDA 2OR4A 4JWPA 5THWA 3RZAA 1Z8XA 4R76A 2PJ3A 1BO4A 4PXBA 4DYOA 4XNHB 1Z8WA 3IFEA 2JDCA 4XPLA 4M6IA 3EO4A 3D2MA 2FIAA 5K8MA 1M4LA 4MCQA 2ZEPA 5AGEA 1KUYA 2DPSA 1PU9A 4JXRA 2CNTA 2WPWA 2WSAA 3S6KA 3FH4A 2P6FA 4R3KA 4P4DA 1F2PA 5JPHA 1HEEA 4DJLA 1PCAA 4UFXA 2ZPAA 3EC4A 2P0WA 4CAXA 1FT7A 1Y9WA 1WWZA 2RB7A 4IK2A 4L89A 4Q7AA 3FNCA 4YWYA 5A27A 3QAYA 1NE9A 1VHEA 1RO5A 1CPXA 1YSJA 3WR7A 2F5IA 3F0AA 3R95A 2EO8A 5J8CA 2PVWA 3B7IA 5LRGA 2D4OA 3IWEA 4OC1A 2ZEMA 3GY9A 3GUXA 4MFLA 4ONWA 4OC4A 4AG7A 5KTCA 1BAVA 2VZYA 2PJBA 2B5GA 2Z11A 3CPAA 2G3AA 2REEA 4MCSA 2R1IA 4KVXA 3IIBA 2GREA 1FNOA 1R43A 2ZEGA 2QJ8A 3V8IA 5G21A 2PC1A 2FSRA 3D2PA 4P44A 1RTQA 3KQXA 4C2XA 2AFOA 4CAFA 2ZW7A 1QQ9A 3PB7X 4MI4A 2PJ1A 2VI7A 1MK4A 4P45A 1QSTA 2BSWA 4B14A 3LODA 3T90A 3T9YA 3FEDA 1TKJA 4OIDA 1YVOA 4KOVA 4F6AA 4MHZA 2PIZA 1PYTB 4JZ0A 1XMTA 5IV0A 1XMBA 3L2NA 4UCNA 3NFZA 2V8HA 2OU2A 1Z4RA 4UFVA 4NEXA 3WC7A 2BO9A 2V8GA 2ZEOA 3A9LA 3N7ZA 4KSFA 3S9NA 4R7MA 3D7GA 4UEFA 5F49A 1ZO0A 3KHZA 4OAEA 3F5BA 3QB8A 1VKCA 3SJGA 3KR4A 3S9MA 3MGDA 5I0CA 3KQZA 4CAVA 1NMTA 5C88A 1YW4A 4KUBA 1IB1E 4YGOA 3FIXA 4C68A 3ISXA 2FE7A 4KOSA 4TNUA 4NGMA 1PUAA 1S5KA 2ZOFA 5AG7A 3KGQA 3CXQA 3NA6A 4YU9A 3TT2A 1NSAA 1B87A 1YK3A 2PRBA 4CYNA 5BWAB 4M6HA 5F46A 4UWJA 3JVNA 4Y49C 4FUUA 4II9A 3PEIA 3R96A 2CY2A 4PXDA 3PZJA 5IX3A 4KZTA 4OC5A 5G22A 2A4NA 3ZJ0A 2PQ8A 2HB6A 4F0YA 4F9UA 4OKOA 1S60A 2POKA 3H8FA 4R3LA 2X7BA 3OWCA 1X12A 4A31A 4NGRA 4KVME 1LAMA 4JD6A 2ANPA 2EK8A 2PR8A 1AUGA 1P0HA 3TOAA 4CGPA 4E8OA 2JBKA 3RBUA 3TO6A 2OOTA 1YVKA 2C27A 2QYVA 4LQ6A 4UA3A 3RO0A 4EMEA 3PB9X 4NGPA 4PXEA 4BD9A 1VGYA 3TOBA 4BINA 2PJ9A 1BPNA 3H4QA 4P4JA 3TO7A 3NE8A 1A2ZA 4PK2A 1P4NA 1H8LA 5HXDA 1I1DA 4XNHC 2BEIA 4UWIA 1YQEA 4XPDB 4UIBA 2NYQA 3VWEA 2Z0ZA 2I00A 3SI2A 4MHNA 3B35A 4NCZA 5ISVA 2NMTA 1Q2CA 1YREA 1TKHA 3CZXA 2G0BA 3DGVA 1Z5RA 3QNVA 2B4DA 4KS9A 1SQHA 4OP4A 2AE6A 5LYIA 1Y0YA 4MFPA 3VARA 3VWDA 3BJ8A 4BMHA 2GANA 3PGPA 4IUSA 4NJRA 4I49A 2GLJA 3S6HA 4JJXA 4KLVA 4A32A 4PQAA 1S7KA 3B3VA 3K9TA 2OH1A 4OIWA 4X8IA 3DDDA 3VH9A 3FF3A 4H2KA 3DR8A 2PCUA
chains in the Genus database with same CATH topology
4B10A 3BJ7A 2J8RA 5KTDA 1K4JA 1MJBA 2FL4A 4FD7A 1Q2DA 5E96A 2HV2A 4L8AA 4AG9A 5IB0A 4KOYA 4UBRA 5F47A 1MJ9A 1QSMA 4U9YA 5A28A 1Q2YA 4CAWA 4J3GA 4MY0A 2P6EA 2DPTA 2JDDA 1XF8A 2YNCA 1M4GA 1IIDA 5GCNA 2QMLA 3P2HA 4MJ8A 4NXYA 5AG6A 3TOAA 4M3SA 4B5PB 5CNPA 4K30A 2JEVA 4UCMA 2PR1A 5AG5A 4B11A 1OZPA 1B6BA 3TFYA 2Y0MA 3ZZIA 3IWGA 4H89A 2GE3A 3SHPA 5HMNA 2FXFA 1L0CA 2Q04A 2VXKA 2R98A 5H84A 3K9UA 3IGRA 3B8GA 4UFWA 1QSRA 5C82A 3CXSA 2ZW5A 4HKFA 4RI1A 5KTAA 2YNCC 5EC4A 4PSXA 2BL1A 1M44A 4C2ZA 1YGHA 1QSNA 4CS0B 4YFJA 2QIRA 2O28A 4ORFA 1S7FA 4AVAA 2FT0A 2Q0YA 4CYOA 1R57A 3GYAA 2B58A 2CXAA 1J4JA 3PP9A 4E2AA 4EVYA 4CRZB 1WK4A 2PSWA 4XPDC 2H5MA 1Y7RA 2J8NA 3IU1A 3C26A 1FY7A 2G3TA 4QB9A 2Z3NA 2FCKA 3QAHA 2BUEA 4LX9A 3R1KA 3DSBA 5JQ4A 4HNYB 2Z3MA 4MBUA 2R7HA 1UFHA 1CJWA 2OZUA 2P6GA 4JLYA 2OZHA 4CYPA 4OADA 3DR6A 2HQYA 2B4BA 4A95A 4FD6A 2RC4A 1VHSA 4BBHA 3DNSA 4AVBA 4KSAA 4X5KA 2B3VA 4FD4A 3TTHA 4HNXB 4CGLA 4FD5A 4UCPA 2GIVA 4CGOA 4KVOE 3H5ZA 4KLWA 2KCWA 4F0XA 4MFKA 2ZXVA 1M1DA 4H6UA 4A33A 2JLMA 1KZFA 1Z9UA 3LD2A 4XPKA 4KUAA 2YGWA 1YR0A 4DNCA 4OLLA 3RYOA 3IU2A 4IF5A 2PDOA 3EXNA 3F8KA 4MHDA 1S7LA 3KKWA 2D4PA 4R57A 4AVCA 4H6ZA 4C2YA 2VQYA 2ZW4A 1KUXA 3JTKA 4CAEA 1M4IA 4MFQA 4KOUA 4MFZA 3TO9A 2HUZA 4KORA 4LUAA 3TE4A 3W6SA 2EVNA 2Z3LA 2FIWA 4GS4A 1I21A 3FXTA 4R87A 4C7IA 2IL4A 3SXOA 1Z4EA 2ARHA 3I9SA 3FYNA 4QUSA 4YRHA 3D3SA 1S3ZA 4KOTA 4QVTA 2VEZA 3GKRA 2FS5A 4QC6A 2K5TA 4ONUA 2VZZA 2QECA 3D8PA 4CRYB 4KOXA 3P2FA 4CGNA 4PK3A 4KOWA 2B3UA 4Q36A 4A30A 2J8MA 2VBQA 3R9FA 1BOBA 2CNSA 1IICA 3EFAA 1NSLA 4JXQA 1N71A 1Y9KA 1U6MA 4AB7A 5HH1A 2B4DB 4M85A 2R8VA 4MY3A 1XE4A 1V0CA 1GHEA 2DXQA 5H86A 3TCVA 2AJ6A 2I79A 4Q38A 3E0KA 1IYKA 4MFJA 2EUIA 1KUVA 4U9ZA 4CGMA 1QSOA 4PSWA 3CXPA 4QBJA 5FVJA 5G1ZA 5J8FA 1TIQA 4B12A 3S6GA 3W91A 1LRZA 3S6FA 2Z10A 4B5OA 1XEBA 3FRMA 4PV6A 2OZGA 4ZBGA 3I3GA 2CNMA 4B13A 2Z3KA 3JUWA 4C7HA 1S7NA 1M4DA 5DWMA 4HNWB 1XIXA 2REFA 5F48A 4B5PA 4CYQA 3FBUA 4A2ZA 3W6XA 2B5GB 2WUUA 1YLEA 3FB3A 3G8WA 1ON0A 2Q44A 1CM0A 2Z3OA 2OB0A 4Y49B 4R9MA 3R9EA 3UY5A 2Q7BA 3SXNA 2Q4YA 4RS2A 3R9GA 5EBVA 3G3SA 1IYLA 4U5YA 1YX0A 1RXTA 2Q4VA 3EY5A 2ATRA 5DWNA 2YNEA 5G20A 3BLNA 4E0AA 5AG4A 1I12A 2ZW6A 4NF1A 2WPXA 2Z3PA 3NE7A 2YNDA 1MJAA 4JWPA 1BO4A 4XNHB 2JDCA 4XPLA 3EO4A 3D2MA 2FIAA 5AGEA 1KUYA 2DPSA 1PU9A 4JXRA 2CNTA 2WPWA 2WSAA 3S6KA 2P6FA 4R3KA 5JPHA 4UFXA 2ZPAA 3EC4A 2P0WA 4CAXA 1Y9WA 1WWZA 4L89A 3FNCA 5A27A 1NE9A 1RO5A 3WR7A 2F5IA 3F0AA 3R95A 5J8CA 2D4OA 3IWEA 3GY9A 4MFLA 4AG7A 5KTCA 2VZYA 2B5GA 2Z11A 2G3AA 2REEA 2R1IA 4KVXA 3V8IA 5G21A 2PC1A 2FSRA 3D2PA 4C2XA 4CAFA 2ZW7A 4MI4A 2VI7A 1MK4A 1QSTA 2BSWA 4B14A 3LODA 3T90A 3T9YA 1YVOA 4KOVA 4F6AA 5IV0A 1XMTA 4UCNA 2OU2A 1Z4RA 4UFVA 4NEXA 3A9LA 3N7ZA 4KSFA 5F49A 1ZO0A 4OAEA 3F5BA 3QB8A 1VKCA 3MGDA 5I0CA 4CAVA 1NMTA 5C88A 4KUBA 1IB1E 4YGOA 3FIXA 4C68A 2FE7A 4KOSA 1PUAA 1S5KA 5AG7A 3CXQA 3TT2A 1B87A 1YK3A 2PRBA 4CYNA 5BWAB 5F46A 4UWJA 3JVNA 4Y49C 4II9A 3R96A 2CY2A 3PZJA 5IX3A 4KZTA 5G22A 2A4NA 3ZJ0A 2PQ8A 4F0YA 1S60A 4R3LA 2X7BA 3OWCA 4A31A 4KVME 4JD6A 2PR8A 1P0HA 4CGPA 4E8OA 3TO6A 1YVKA 2C27A 4UA3A 3TOBA 3H4QA 3TO7A 4PK2A 1P4NA 1I1DA 4XNHC 2BEIA 4UWIA 4XPDB 3VWEA 2Z0ZA 2I00A 4NCZA 5ISVA 2NMTA 1Q2CA 1YREA 2G0BA 2B4DA 4KS9A 1SQHA 2AE6A 4MFPA 3VWDA 3BJ8A 4BMHA 2GANA 3PGPA 4IUSA 4I49A 3S6HA 4JJXA 4KLVA 4A32A 1S7KA 2OH1A 3DDDA 4ZGYB 4NSQA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJ7 A;  2J8R A;  5KTD A;  1K4J A;  1MJB A;  2FL4 A;  4FD7 A;  1Q2D A;  5E96 A;  2HV2 A;  4L8A A;  4AG9 A;  5IB0 A;  4KOY A;  4UBR A;  5F47 A;  1MJ9 A;  1QSM A;  4U9Y A;  1Q2Y A;  4CAW A;  4J3G A;  4MY0 A;  2P6E A;  2JDD A;  1XF8 A;  1M4G A;  1IID A;  5GCN A;  2QML A;  3P2H A;  4MJ8 A;  4NXY A;  3TOA A;  4M3S A;  4B5P B;  5CNP A;  4K30 A;  2JEV A;  2PR1 A;  1OZP A;  1B6B A;  3TFY A;  2Y0M A;  3ZZI A;  3IWG A;  4H89 A;  2GE3 A;  3SHP A;  5HMN A;  2FXF A;  1L0C A;  2Q04 A;  2VXK A;  2R98 A;  5H84 A;  3K9U A;  3IGR A;  3B8G A;  1QSR A;  5C82 A;  3CXS A;  2ZW5 A;  4HKF A;  4RI1 A;  5KTA A;  5EC4 A;  4PSX A;  2BL1 A;  1M44 A;  1YGH A;  1QSN A;  4CS0 B;  4YFJ A;  2QIR A;  2O28 A;  4ORF A;  1S7F A;  4AVA A;  2FT0 A;  2Q0Y A;  1R57 A;  3GYA A;  2B58 A;  1J4J A;  3PP9 A;  4E2A A;  4EVY A;  4CRZ B;  1WK4 A;  2PSW A;  4XPD C;  2H5M A;  1Y7R A;  2J8N A;  3C26 A;  1FY7 A;  2G3T A;  4QB9 A;  2FCK A;  3QAH A;  2BUE A;  4LX9 A;  3R1K A;  3DSB A;  5JQ4 A;  4HNY B;  4MBU A;  2R7H A;  1UFH A;  1CJW A;  2OZU A;  2P6G A;  4JLY A;  2OZH A;  4OAD A;  3DR6 A;  2HQY A;  2B4B A;  4FD6 A;  2RC4 A;  1VHS A;  3DNS A;  4AVB A;  4X5K A;  2B3V A;  4FD4 A;  3TTH A;  4HNX B;  4FD5 A;  2GIV A;  4KVO E;  4KLW A;  2KCW A;  2ZXV A;  1M1D A;  4H6U A;  2JLM A;  1KZF A;  1Z9U A;  3LD2 A;  4XPK A;  4KUA A;  4DNC A;  1YR0 A;  4OLL A;  3RYO A;  4IF5 A;  2PDO A;  3EXN A;  3F8K A;  4MHD A;  1S7L A;  3KKW A;  2D4P A;  4R57 A;  4AVC A;  4H6Z A;  2VQY A;  2ZW4 A;  1KUX A;  1M4I A;  4KOU A;  3TO9 A;  2HUZ A;  4KOR A;  4LUA A;  3TE4 A;  3W6S A;  2EVN A;  2FIW A;  4GS4 A;  1I21 A;  3FXT A;  4R87 A;  2IL4 A;  3SXO A;  1Z4E A;  2ARH A;  3I9S A;  3FYN A;  4QUS A;  4YRH A;  3D3S A;  1S3Z A;  4KOT A;  4QVT A;  2VEZ A;  3GKR A;  2FS5 A;  4QC6 A;  2K5T A;  4ONU A;  2VZZ A;  2QEC A;  3D8P A;  4CRY B;  4KOX A;  3P2F A;  4PK3 A;  4KOW A;  2B3U A;  2J8M A;  2VBQ A;  3R9F A;  1BOB A;  2CNS A;  1IIC A;  3EFA A;  1NSL A;  4JXQ A;  1N71 A;  1Y9K A;  1U6M A;  4AB7 A;  5HH1 A;  2B4D B;  4M85 A;  2R8V A;  4MY3 A;  1XE4 A;  1V0C A;  1GHE A;  2DXQ A;  5H86 A;  3TCV A;  2AJ6 A;  2I79 A;  3E0K A;  1IYK A;  2EUI A;  1KUV A;  4U9Z A;  1QSO A;  4PSW A;  3CXP A;  4QBJ A;  5FVJ A;  5J8F A;  1TIQ A;  3S6G A;  3W91 A;  1LRZ A;  3S6F A;  2Z10 A;  4B5O A;  1XEB A;  3FRM A;  4PV6 A;  2OZG A;  4ZBG A;  3I3G A;  2CNM A;  3JUW A;  1S7N A;  1M4D A;  5DWM A;  4HNW B;  1XIX A;  2REF A;  5F48 A;  4B5P A;  3FBU A;  3W6X A;  2B5G B;  1YLE A;  3FB3 A;  3G8W A;  1ON0 A;  2Q44 A;  1CM0 A;  2OB0 A;  4Y49 B;  4R9M A;  3R9E A;  3UY5 A;  2Q7B A;  3SXN A;  2Q4Y A;  4RS2 A;  3R9G A;  5EBV A;  3G3S A;  1IYL A;  4U5Y A;  1YX0 A;  1RXT A;  2Q4V A;  3EY5 A;  2ATR A;  5DWN A;  3BLN A;  4E0A A;  1I12 A;  2ZW6 A;  4NF1 A;  2WPX A;  3NE7 A;  1MJA A;  4JWP A;  1BO4 A;  4XNH B;  2JDC A;  4XPL A;  3EO4 A;  3D2M A;  2FIA A;  1KUY A;  1PU9 A;  4JXR A;  2CNT A;  2WPW A;  3S6K A;  2P6F A;  4R3K A;  5JPH A;  2ZPA A;  3EC4 A;  2P0W A;  4CAX A;  1Y9W A;  1WWZ A;  4L89 A;  3FNC A;  1NE9 A;  1RO5 A;  3WR7 A;  2F5I A;  3F0A A;  3R95 A;  5J8C A;  2D4O A;  3GY9 A;  4AG7 A;  5KTC A;  2VZY A;  2B5G A;  2Z11 A;  2G3A A;  2REE A;  2R1I A;  4KVX A;  3V8I A;  2PC1 A;  2FSR A;  3D2P A;  2ZW7 A;  4MI4 A;  2VI7 A;  1MK4 A;  1QST A;  2BSW A;  3LOD A;  3T90 A;  3T9Y A;  1YVO A;  4KOV A;  4F6A A;  5IV0 A;  1XMT A;  2OU2 A;  1Z4R A;  4NEX A;  3N7Z A;  5F49 A;  4OAE A;  3F5B A;  3QB8 A;  1VKC A;  3MGD A;  5I0C A;  4CAV A;  1NMT A;  5C88 A;  4KUB A;  1IB1 E;  4YGO A;  3FIX A;  2FE7 A;  4KOS A;  1PUA A;  1S5K A;  3CXQ A;  3TT2 A;  1B87 A;  1YK3 A;  2PRB A;  5F46 A;  4UWJ A;  3JVN A;  4Y49 C;  4II9 A;  3R96 A;  2CY2 A;  3PZJ A;  5IX3 A;  4KZT A;  2A4N A;  3ZJ0 A;  2PQ8 A;  4F0Y A;  1S60 A;  4R3L A;  2X7B A;  3OWC A;  4KVM E;  4JD6 A;  2PR8 A;  1P0H A;  4E8O A;  3TO6 A;  1YVK A;  2C27 A;  4UA3 A;  3TOB A;  3H4Q A;  3TO7 A;  4PK2 A;  1P4N A;  1I1D A;  4XNH C;  2BEI A;  4UWI A;  4XPD B;  3VWE A;  2Z0Z A;  2I00 A;  4NCZ A;  5ISV A;  2NMT A;  1Q2C A;  1YRE A;  2G0B A;  2B4D A;  1SQH A;  2AE6 A;  3VWD A;  3BJ8 A;  4BMH A;  2GAN A;  3PGP A;  4IUS A;  4I49 A;  3S6H A;  4JJX A;  4KLV A;  1S7K A;  2OH1 A;  3DDD A;  4NSQ A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 3NH8 A;  4B10 A;  3WC5 A;  3D7F A;  3IEH A;  3BJ7 A;  3TC8 A;  2J8R A;  3WAB A;  1ARM A;  5KTD A;  1K4J A;  1MJB A;  3B3W A;  2FL4 A;  4FD7 A;  8CPA A;  1Q2D A;  5E96 A;  2HV2 A;  1HDU A;  2XEF A;  4L8A A;  4ZY0 A;  4AG9 A;  5IB0 A;  4KOY A;  4UBR A;  2PJ2 A;  2O4H A;  1MJ9 A;  3PBE A;  5F47 A;  1QSM A;  4U9Y A;  4ZY1 A;  5A28 A;  1Q2Y A;  2Q4Z A;  3LAC A;  4CAW A;  4J3G A;  1ARL A;  4ZGY B;  2ZEL A;  2IJZ A;  1LAP A;  3S9L A;  3BI0 A;  3CDX A;  2ODF A;  3BI1 A;  3PB4 X;  4MY0 A;  5LYD A;  2P6E A;  1VHO A;  4A37 A;  2DPT A;  2JDD A;  1XF8 A;  2YNC A;  3SI0 A;  1IY7 A;  1M4G A;  1IID A;  1LOK A;  3KI9 A;  5GCN A;  2QML A;  4P4B A;  3P2H A;  2AFU A;  4MJ8 A;  4NXY A;  5AG6 A;  1Z8T A;  2ZED A;  4M3S A;  4K30 A;  5CNP A;  2JEV A;  4UCM A;  4B5P B;  4DUK A;  4R6T A;  2PR1 A;  3JRU A;  5AG5 A;  3B3C A;  4B11 A;  5HVG A;  3FX6 A;  5JM6 A;  1LCP A;  5K8N A;  4RN7 A;  1OBR A;  1OZP A;  1B6B A;  1XFO A;  4MCR A;  2Y0M A;  1ZG9 A;  3TFY A;  3ZZI A;  3IWG A;  4H89 A;  3SJF A;  2GE3 A;  2ZOG A;  2WZN A;  4P4F A;  3SHP A;  2DEA A;  3CT9 A;  2XEG A;  4FAI A;  5HMN A;  2FXF A;  1L0C A;  2Q04 A;  1AYE A;  1TXR A;  1UWY A;  4O23 A;  2VXK A;  2R98 A;  4OC0 A;  5H84 A;  2ZEF A;  3K9U A;  2HC9 A;  4NGN A;  3IGR A;  3N5F A;  3B8G A;  5LYL A;  4UFW A;  1QSR A;  5DS0 A;  5C82 A;  2JBJ A;  3IO1 A;  3CXS A;  4GM5 A;  2ABZ A;  2ZEE A;  2ZW5 A;  4HKF A;  2F8H A;  4RI1 A;  5CPA A;  2QVP A;  5KTA A;  2PVV A;  2PJ7 A;  4LQG A;  4OC2 A;  2YNC C;  3FMC A;  5EC4 A;  3FJU A;  4Z65 A;  4PSX A;  4ZX9 A;  2PJ6 A;  1F57 A;  4NJQ A;  4MXU A;  5K8O A;  1TF9 A;  4ZI6 A;  4FBE A;  1CP6 A;  2BL1 A;  2PJ0 A;  5K8P A;  1M44 A;  3SJE A;  1CBX A;  4C2Z A;  1CX8 A;  1YGH A;  2AFM A;  1QSN A;  4OC3 A;  4KSI A;  4CS0 B;  4YFJ A;  4MCP A;  1YW6 A;  2QIR A;  2V77 A;  2AFX A;  2O28 A;  4NGQ A;  4ORF A;  1S7F A;  4R8F A;  1Q7L A;  1IU8 A;  4AVA A;  2EK9 A;  2FT0 A;  2Q0Y A;  1R57 A;  3GYA A;  4CYO A;  4A39 A;  2B58 A;  2CXA A;  4P10 A;  1J4J A;  3PP9 A;  1AMP A;  4E2A A;  1XBU A;  2BCO A;  3ISZ A;  1Y0R A;  4EVY A;  4CRZ B;  1WK4 A;  2PSW A;  2ZEH A;  4MRI A;  4XPD C;  5F09 A;  2H5M A;  1GYT A;  1Y7R A;  2J8N A;  4F9V A;  3IU1 A;  4G1P A;  3C26 A;  1FY7 A;  2G3T A;  4QB9 A;  2Z3N A;  2FCK A;  3WT4 A;  3QAH A;  2BUE A;  4LX9 A;  3R1K A;  3TX8 A;  2DF5 A;  3DSB A;  4GXH A;  3B3S A;  5JQ4 A;  4HNY B;  2Z3M A;  1JWQ A;  4MBU A;  2R7H A;  1UFH A;  1CJW A;  2OZU A;  3WC6 A;  2P6G A;  4JLY A;  2OZH A;  3D7H A;  4UEE A;  3KAS A;  1ZLH A;  4OAD A;  3DR6 A;  4CYP A;  5HVH A;  2HQY A;  1XRY A;  2B4B A;  1EE3 P;  2FVG A;  4A95 A;  1ELM P;  4FD6 A;  2RC4 A;  3VAT A;  1DE4 C;  2WYR A;  1VHS A;  1ZLI A;  2GU2 A;  4BBH A;  3DNS A;  4AVB A;  3D67 A;  4AXV A;  2C6C A;  4KSA A;  4X5K A;  2B3V A;  2G9D A;  4FD4 A;  3K2K A;  4HNX B;  3TTH A;  4FD5 A;  4CGL A;  4UCP A;  2GIV A;  3DLJ A;  4CGO A;  1CPS A;  3GIU A;  4KVO E;  5ELY A;  3H5Z A;  1Z2L A;  5I4M A;  4KLW A;  2PJ4 A;  4P4E A;  2KCW A;  1BPM A;  4F0X A;  4MFK A;  2ZXV A;  2V8D A;  1M1D A;  4H6U A;  4A33 A;  2JLM A;  1KZF A;  1LAN A;  1Z9U A;  3B3T A;  3LD2 A;  1TKF A;  3MN8 A;  4KUA A;  2YGW A;  1YR0 A;  4IAV A;  4OLL A;  4XPK A;  3RYO A;  4DNC A;  3IU2 A;  4IF5 A;  2PDO A;  3EXN A;  3F8K A;  3H8E A;  3PB6 X;  4MHD A;  4B6Z A;  4P4I A;  1S7L A;  2GFQ A;  3RAM A;  3KKW A;  3NH4 A;  2D4P A;  2Q43 A;  3GLJ A;  3KR5 A;  4A94 A;  4R57 A;  4AVC A;  2CF4 A;  3I1U A;  4H6Z A;  4C2Y A;  2PJ5 A;  2CTC A;  2VQY A;  3H8G A;  2ZW4 A;  3KZW A;  1KUX A;  4MMO A;  3JTK A;  4CPA A;  4CAE A;  1M4I A;  4MFQ A;  2O53 A;  4ZX8 A;  2F7V A;  3BXM A;  4KOU A;  4MFZ A;  2HUZ A;  3TO9 A;  3V38 A;  4KOR A;  3KHX A;  4LUA A;  3TE4 A;  3W6S A;  2XEJ A;  3FVL A;  2EVN A;  2Z3L A;  3KL9 A;  4UEZ A;  2FIW A;  1ZG8 A;  3SI1 A;  4GS4 A;  1I21 A;  3FXT A;  4R87 A;  4C7I A;  2IL4 A;  3SXO A;  1CP7 A;  1VIX A;  1Z4E A;  2ARH A;  2JEW A;  3I9S A;  3FYN A;  1YME A;  2VL1 A;  4QUS A;  4YRH A;  3D3S A;  1S3Z A;  4KOT A;  4QVT A;  2ZEN A;  2VEZ A;  3GKR A;  2FS5 A;  2IQ6 A;  2PJA A;  4QC6 A;  2K5T A;  4ONU A;  4NSQ A;  4OME A;  2VZZ A;  2J9A A;  2QEC A;  3D8P A;  4NFR A;  4CRY B;  4KOX A;  2PJ8 A;  3P2F A;  4NGT A;  2PE3 A;  4PK3 A;  3SJX A;  4CGN A;  4EFD A;  4KOW A;  3HUV A;  1HDQ A;  2B3U A;  5JH9 A;  4Q36 A;  4A30 A;  2PRQ A;  3D4U A;  2J8M A;  2VBQ A;  3R9F A;  1BOB A;  5J1Q A;  1IGB A;  3HLP A;  4RUH A;  3FEC A;  6CPA A;  3B2Y A;  2CNS A;  1IIC A;  3EFA A;  1NSL A;  4JXQ A;  1N71 A;  2IMO A;  1Y9K A;  2CIJ A;  1U6M A;  4AB7 A;  5HH1 A;  2B4D B;  3IJ3 A;  2R8V A;  3PRT A;  4M85 A;  4UIA A;  4MY3 A;  1XE4 A;  1V0C A;  1GHE A;  2DXQ A;  2EBJ A;  5H86 A;  2AJ6 A;  2I79 A;  2C6G A;  4Q38 A;  3TCV A;  3E0K A;  3NH5 A;  1IYK A;  4A38 A;  4MFJ A;  2EUI A;  1KUV A;  2CTB A;  1IOI A;  4U9Z A;  4CGM A;  1QSO A;  1JQG A;  4PSW A;  2XEI A;  1KWM A;  1IOF A;  3BHX A;  3CXP A;  3PB8 X;  4IHM A;  5FVJ A;  5G1Z A;  4QBJ A;  5J8F A;  5JGF A;  3LWU A;  1TIQ A;  4HPS A;  4K3N A;  4B12 A;  3S6G A;  1LFW A;  5EMI A;  5LRJ A;  1Y7E A;  3W91 A;  4UF4 A;  1LRZ A;  3S6F A;  1XOV A;  2Z10 A;  4ZYQ A;  4WWV A;  4NGS A;  3D68 A;  1XEB A;  4TWE A;  3FRM A;  4B5O A;  4PV6 A;  2BOA A;  2OZG A;  4PXC A;  3I3G A;  1F2O A;  4X3R A;  2CNM A;  4ZBG A;  1QMU A;  3LMS A;  4B13 A;  2C6P A;  2Z3K A;  3D7D A;  3JUW A;  3PFO A;  4C7H A;  1S7N A;  1ELL P;  1M4D A;  5DWM A;  4HNW B;  2I3C A;  3CPX A;  1XIX A;  5LRK A;  2REF A;  5F48 A;  1DTD A;  4B5P A;  4CYQ A;  3FBU A;  4A2Z A;  1XJO A;  3W6X A;  3RNZ A;  2B5G B;  2WUU A;  1YLE A;  1CG2 A;  1TF8 A;  3V7Z A;  2C1C A;  3FB3 A;  3G8W A;  1ON0 A;  2Q44 A;  1CM0 A;  2Z3O A;  3T8W A;  2OB0 A;  4P6Y A;  7CPA A;  3PBB A;  2Q51 A;  4FWU A;  5D29 A;  2PJC A;  5IB9 A;  4Y49 B;  5LYF A;  4R9M A;  4M6G A;  3R9E A;  3UY5 A;  4PPZ A;  2GLF A;  2Q7B A;  3SXN A;  2Q4Y A;  4RS2 A;  3R9G A;  5EBV A;  3G3S A;  1R3N A;  1ZG7 A;  3IWW A;  5CBM A;  1IYL A;  4U5Y A;  2RFH A;  5HVF A;  2AFW A;  1YX0 A;  1RXT A;  4W9Y A;  4X2T A;  2Q4V A;  3EY5 A;  2Q7S A;  2ATR A;  3GB0 A;  2AFZ A;  3PFE A;  4WJB A;  1YLO A;  5DWN A;  1X10 A;  2PIY A;  2YNE A;  5G20 A;  3BLN A;  4E0A A;  5AG4 A;  2EWB A;  1I12 A;  3FEE A;  4ZY2 A;  2ZW6 A;  3IC1 A;  4NF1 A;  4MHP A;  3MRU A;  2WPX A;  4EWT A;  3D66 A;  2AFS A;  5D8N A;  4JYW A;  2NSM A;  4F8Z A;  1BLL E;  2Z3P A;  3NE7 A;  4MHY A;  1Z8L A;  2V8V A;  1MJA A;  2YND A;  2OR4 A;  4JWP A;  5THW A;  3RZA A;  1Z8X A;  4R76 A;  2PJ3 A;  1BO4 A;  4PXB A;  4DYO A;  4XNH B;  1Z8W A;  3IFE A;  2JDC A;  4XPL A;  4M6I A;  3EO4 A;  3D2M A;  2FIA A;  5K8M A;  1M4L A;  4MCQ A;  2ZEP A;  5AGE A;  1KUY A;  2DPS A;  1PU9 A;  4JXR A;  2CNT A;  2WPW A;  2WSA A;  3S6K A;  3FH4 A;  2P6F A;  4R3K A;  4P4D A;  1F2P A;  5JPH A;  1HEE A;  4DJL A;  1PCA A;  4UFX A;  2ZPA A;  3EC4 A;  2P0W A;  4CAX A;  1FT7 A;  1Y9W A;  1WWZ A;  2RB7 A;  4IK2 A;  4L89 A;  4Q7A A;  3FNC A;  4YWY A;  5A27 A;  3QAY A;  1NE9 A;  1VHE A;  1RO5 A;  1CPX A;  1YSJ A;  3WR7 A;  2F5I A;  3F0A A;  3R95 A;  2EO8 A;  5J8C A;  2PVW A;  3B7I A;  5LRG A;  2D4O A;  3IWE A;  4OC1 A;  2ZEM A;  3GY9 A;  3GUX A;  4MFL A;  4ONW A;  4OC4 A;  4AG7 A;  5KTC A;  1BAV A;  2VZY A;  2PJB A;  2B5G A;  2Z11 A;  3CPA A;  2G3A A;  2REE A;  4MCS A;  2R1I A;  4KVX A;  3IIB A;  2GRE A;  1FNO A;  1R43 A;  2ZEG A;  2QJ8 A;  3V8I A;  5G21 A;  2PC1 A;  2FSR A;  3D2P A;  4P44 A;  1RTQ A;  3KQX A;  4C2X A;  2AFO A;  4CAF A;  2ZW7 A;  1QQ9 A;  3PB7 X;  4MI4 A;  2PJ1 A;  2VI7 A;  1MK4 A;  4P45 A;  1QST A;  2BSW A;  4B14 A;  3LOD A;  3T90 A;  3T9Y A;  3FED A;  1TKJ A;  4OID A;  1YVO A;  4KOV A;  4F6A A;  4MHZ A;  2PIZ A;  1PYT B;  4JZ0 A;  1XMT A;  5IV0 A;  1XMB A;  3L2N A;  4UCN A;  3NFZ A;  2V8H A;  2OU2 A;  1Z4R A;  4UFV A;  4NEX A;  3WC7 A;  2BO9 A;  2V8G A;  2ZEO A;  3A9L A;  3N7Z A;  4KSF A;  3S9N A;  4R7M A;  3D7G A;  4UEF A;  5F49 A;  1ZO0 A;  3KHZ A;  4OAE A;  3F5B A;  3QB8 A;  1VKC A;  3SJG A;  3KR4 A;  3S9M A;  3MGD A;  5I0C A;  3KQZ A;  4CAV A;  1NMT A;  5C88 A;  1YW4 A;  4KUB A;  1IB1 E;  4YGO A;  3FIX A;  4C68 A;  3ISX A;  2FE7 A;  4KOS A;  4TNU A;  4NGM A;  1PUA A;  1S5K A;  2ZOF A;  5AG7 A;  3KGQ A;  3CXQ A;  3NA6 A;  4YU9 A;  3TT2 A;  1NSA A;  1B87 A;  1YK3 A;  2PRB A;  4CYN A;  5BWA B;  4M6H A;  5F46 A;  4UWJ A;  3JVN A;  4Y49 C;  4FUU A;  4II9 A;  3PEI A;  3R96 A;  2CY2 A;  4PXD A;  3PZJ A;  5IX3 A;  4KZT A;  4OC5 A;  5G22 A;  2A4N A;  3ZJ0 A;  2PQ8 A;  2HB6 A;  4F0Y A;  4F9U A;  4OKO A;  1S60 A;  2POK A;  3H8F A;  4R3L A;  2X7B A;  3OWC A;  1X12 A;  4A31 A;  4NGR A;  4KVM E;  1LAM A;  4JD6 A;  2ANP A;  2EK8 A;  2PR8 A;  1AUG A;  1P0H A;  3TOA A;  4CGP A;  4E8O A;  2JBK A;  3RBU A;  3TO6 A;  2OOT A;  1YVK A;  2C27 A;  2QYV A;  4LQ6 A;  4UA3 A;  3RO0 A;  4EME A;  3PB9 X;  4NGP A;  4PXE A;  4BD9 A;  1VGY A;  3TOB A;  4BIN A;  2PJ9 A;  1BPN A;  3H4Q A;  4P4J A;  3TO7 A;  3NE8 A;  1A2Z A;  4PK2 A;  1P4N A;  1H8L A;  5HXD A;  1I1D A;  4XNH C;  2BEI A;  4UWI A;  1YQE A;  4XPD B;  4UIB A;  2NYQ A;  3VWE A;  2Z0Z A;  2I00 A;  3SI2 A;  4MHN A;  3B35 A;  4NCZ A;  5ISV A;  2NMT A;  1Q2C A;  1YRE A;  1TKH A;  3CZX A;  2G0B A;  3DGV A;  1Z5R A;  3QNV A;  2B4D A;  4KS9 A;  1SQH A;  4OP4 A;  2AE6 A;  5LYI A;  1Y0Y A;  4MFP A;  3VAR A;  3VWD A;  3BJ8 A;  4BMH A;  2GAN A;  3PGP A;  4IUS A;  4NJR A;  4I49 A;  2GLJ A;  3S6H A;  4JJX A;  4KLV A;  4A32 A;  4PQA A;  1S7K A;  3B3V A;  3K9T A;  2OH1 A;  4OIW A;  4X8I A;  3DDD A;  3VH9 A;  3FF3 A;  4H2K A;  3DR8 A;  2PCU A; 
#chains in the Genus database with same CATH homology
 4B10 A;  3BJ7 A;  2J8R A;  5KTD A;  1K4J A;  1MJB A;  2FL4 A;  4FD7 A;  1Q2D A;  5E96 A;  2HV2 A;  4L8A A;  4AG9 A;  5IB0 A;  4KOY A;  4UBR A;  5F47 A;  1MJ9 A;  1QSM A;  4U9Y A;  5A28 A;  1Q2Y A;  4CAW A;  4J3G A;  4MY0 A;  2P6E A;  2DPT A;  2JDD A;  1XF8 A;  2YNC A;  1M4G A;  1IID A;  5GCN A;  2QML A;  3P2H A;  4MJ8 A;  4NXY A;  5AG6 A;  3TOA A;  4M3S A;  4B5P B;  5CNP A;  4K30 A;  2JEV A;  4UCM A;  2PR1 A;  5AG5 A;  4B11 A;  1OZP A;  1B6B A;  3TFY A;  2Y0M A;  3ZZI A;  3IWG A;  4H89 A;  2GE3 A;  3SHP A;  5HMN A;  2FXF A;  1L0C A;  2Q04 A;  2VXK A;  2R98 A;  5H84 A;  3K9U A;  3IGR A;  3B8G A;  4UFW A;  1QSR A;  5C82 A;  3CXS A;  2ZW5 A;  4HKF A;  4RI1 A;  5KTA A;  2YNC C;  5EC4 A;  4PSX A;  2BL1 A;  1M44 A;  4C2Z A;  1YGH A;  1QSN A;  4CS0 B;  4YFJ A;  2QIR A;  2O28 A;  4ORF A;  1S7F A;  4AVA A;  2FT0 A;  2Q0Y A;  4CYO A;  1R57 A;  3GYA A;  2B58 A;  2CXA A;  1J4J A;  3PP9 A;  4E2A A;  4EVY A;  4CRZ B;  1WK4 A;  2PSW A;  4XPD C;  2H5M A;  1Y7R A;  2J8N A;  3IU1 A;  3C26 A;  1FY7 A;  2G3T A;  4QB9 A;  2Z3N A;  2FCK A;  3QAH A;  2BUE A;  4LX9 A;  3R1K A;  3DSB A;  5JQ4 A;  4HNY B;  2Z3M A;  4MBU A;  2R7H A;  1UFH A;  1CJW A;  2OZU A;  2P6G A;  4JLY A;  2OZH A;  4CYP A;  4OAD A;  3DR6 A;  2HQY A;  2B4B A;  4A95 A;  4FD6 A;  2RC4 A;  1VHS A;  4BBH A;  3DNS A;  4AVB A;  4KSA A;  4X5K A;  2B3V A;  4FD4 A;  3TTH A;  4HNX B;  4CGL A;  4FD5 A;  4UCP A;  2GIV A;  4CGO A;  4KVO E;  3H5Z A;  4KLW A;  2KCW A;  4F0X A;  4MFK A;  2ZXV A;  1M1D A;  4H6U A;  4A33 A;  2JLM A;  1KZF A;  1Z9U A;  3LD2 A;  4XPK A;  4KUA A;  2YGW A;  1YR0 A;  4DNC A;  4OLL A;  3RYO A;  3IU2 A;  4IF5 A;  2PDO A;  3EXN A;  3F8K A;  4MHD A;  1S7L A;  3KKW A;  2D4P A;  4R57 A;  4AVC A;  4H6Z A;  4C2Y A;  2VQY A;  2ZW4 A;  1KUX A;  3JTK A;  4CAE A;  1M4I A;  4MFQ A;  4KOU A;  4MFZ A;  3TO9 A;  2HUZ A;  4KOR A;  4LUA A;  3TE4 A;  3W6S A;  2EVN A;  2Z3L A;  2FIW A;  4GS4 A;  1I21 A;  3FXT A;  4R87 A;  4C7I A;  2IL4 A;  3SXO A;  1Z4E A;  2ARH A;  3I9S A;  3FYN A;  4QUS A;  4YRH A;  3D3S A;  1S3Z A;  4KOT A;  4QVT A;  2VEZ A;  3GKR A;  2FS5 A;  4QC6 A;  2K5T A;  4ONU A;  2VZZ A;  2QEC A;  3D8P A;  4CRY B;  4KOX A;  3P2F A;  4CGN A;  4PK3 A;  4KOW A;  2B3U A;  4Q36 A;  4A30 A;  2J8M A;  2VBQ A;  3R9F A;  1BOB A;  2CNS A;  1IIC A;  3EFA A;  1NSL A;  4JXQ A;  1N71 A;  1Y9K A;  1U6M A;  4AB7 A;  5HH1 A;  2B4D B;  4M85 A;  2R8V A;  4MY3 A;  1XE4 A;  1V0C A;  1GHE A;  2DXQ A;  5H86 A;  3TCV A;  2AJ6 A;  2I79 A;  4Q38 A;  3E0K A;  1IYK A;  4MFJ A;  2EUI A;  1KUV A;  4U9Z A;  4CGM A;  1QSO A;  4PSW A;  3CXP A;  4QBJ A;  5FVJ A;  5G1Z A;  5J8F A;  1TIQ A;  4B12 A;  3S6G A;  3W91 A;  1LRZ A;  3S6F A;  2Z10 A;  4B5O A;  1XEB A;  3FRM A;  4PV6 A;  2OZG A;  4ZBG A;  3I3G A;  2CNM A;  4B13 A;  2Z3K A;  3JUW A;  4C7H A;  1S7N A;  1M4D A;  5DWM A;  4HNW B;  1XIX A;  2REF A;  5F48 A;  4B5P A;  4CYQ A;  3FBU A;  4A2Z A;  3W6X A;  2B5G B;  2WUU A;  1YLE A;  3FB3 A;  3G8W A;  1ON0 A;  2Q44 A;  1CM0 A;  2Z3O A;  2OB0 A;  4Y49 B;  4R9M A;  3R9E A;  3UY5 A;  2Q7B A;  3SXN A;  2Q4Y A;  4RS2 A;  3R9G A;  5EBV A;  3G3S A;  1IYL A;  4U5Y A;  1YX0 A;  1RXT A;  2Q4V A;  3EY5 A;  2ATR A;  5DWN A;  2YNE A;  5G20 A;  3BLN A;  4E0A A;  5AG4 A;  1I12 A;  2ZW6 A;  4NF1 A;  2WPX A;  2Z3P A;  3NE7 A;  2YND A;  1MJA A;  4JWP A;  1BO4 A;  4XNH B;  2JDC A;  4XPL A;  3EO4 A;  3D2M A;  2FIA A;  5AGE A;  1KUY A;  2DPS A;  1PU9 A;  4JXR A;  2CNT A;  2WPW A;  2WSA A;  3S6K A;  2P6F A;  4R3K A;  5JPH A;  4UFX A;  2ZPA A;  3EC4 A;  2P0W A;  4CAX A;  1Y9W A;  1WWZ A;  4L89 A;  3FNC A;  5A27 A;  1NE9 A;  1RO5 A;  3WR7 A;  2F5I A;  3F0A A;  3R95 A;  5J8C A;  2D4O A;  3IWE A;  3GY9 A;  4MFL A;  4AG7 A;  5KTC A;  2VZY A;  2B5G A;  2Z11 A;  2G3A A;  2REE A;  2R1I A;  4KVX A;  3V8I A;  5G21 A;  2PC1 A;  2FSR A;  3D2P A;  4C2X A;  4CAF A;  2ZW7 A;  4MI4 A;  2VI7 A;  1MK4 A;  1QST A;  2BSW A;  4B14 A;  3LOD A;  3T90 A;  3T9Y A;  1YVO A;  4KOV A;  4F6A A;  5IV0 A;  1XMT A;  4UCN A;  2OU2 A;  1Z4R A;  4UFV A;  4NEX A;  3A9L A;  3N7Z A;  4KSF A;  5F49 A;  1ZO0 A;  4OAE A;  3F5B A;  3QB8 A;  1VKC A;  3MGD A;  5I0C A;  4CAV A;  1NMT A;  5C88 A;  4KUB A;  1IB1 E;  4YGO A;  3FIX A;  4C68 A;  2FE7 A;  4KOS A;  1PUA A;  1S5K A;  5AG7 A;  3CXQ A;  3TT2 A;  1B87 A;  1YK3 A;  2PRB A;  4CYN A;  5BWA B;  5F46 A;  4UWJ A;  3JVN A;  4Y49 C;  4II9 A;  3R96 A;  2CY2 A;  3PZJ A;  5IX3 A;  4KZT A;  5G22 A;  2A4N A;  3ZJ0 A;  2PQ8 A;  4F0Y A;  1S60 A;  4R3L A;  2X7B A;  3OWC A;  4A31 A;  4KVM E;  4JD6 A;  2PR8 A;  1P0H A;  4CGP A;  4E8O A;  3TO6 A;  1YVK A;  2C27 A;  4UA3 A;  3TOB A;  3H4Q A;  3TO7 A;  4PK2 A;  1P4N A;  1I1D A;  4XNH C;  2BEI A;  4UWI A;  4XPD B;  3VWE A;  2Z0Z A;  2I00 A;  4NCZ A;  5ISV A;  2NMT A;  1Q2C A;  1YRE A;  2G0B A;  2B4D A;  4KS9 A;  1SQH A;  2AE6 A;  4MFP A;  3VWD A;  3BJ8 A;  4BMH A;  2GAN A;  3PGP A;  4IUS A;  4I49 A;  3S6H A;  4JJX A;  4KLV A;  4A32 A;  1S7K A;  2OH1 A;  3DDD A;  4ZGY B;  4NSQ A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...