5C82A

Crystal structure of nourseothricin acetyltransferase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
170
Chain Sequence
TAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDPDSRTFVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTLCGLDTALYDGTASDGEQALYMSMPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nourseothricin acetyltransferase
publication title Crystal structure of Nourseothricin acetyltransferase
rcsb
source organism Streptomyces noursei
total genus 39
structure length 170
sequence length 183
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c82A00
1CJWA 1WWZA 2IL4A 1IB1E 2CNSA 2AJ6A 4H6UA 1WK4A 1R57A 1Q2CA 1PU9A 4UA3A 5H84A 1MJBA 3G3SA 4PK2A 4PSXA 4Y49B 4NEXA 2JDDA 4OLLA 1UFHA 1NE9A 2CNTA 3WR7A 1Y7RA 5HH1A 3SHPA 4L89A 3S6FA 4KOSA 1Y9WA 1RXTA 1Y9KA 3R1KA 1QSMA 4AG9A 4KVME 4AB7A 1YR0A 1YVKA 3TO6A 1XE4A 4QBJA 2GE3A 2X7BA 3GKRA 3JUWA 1KZFA 1I1DA 1U6MA 4MY3A 3C26A 1KUXA 4NF1A 1YREA 2BL1A 2VEZA 4JLYA 4RI1A 4YRHA 1TIQA 2O28A 3ZZIA 4JD6A 3R96A 4XPDC 5H86A 3TOBA 2D4OA 5J8CA 3I3GA 1Z4EA 1YVOA 3TTHA 2A4NA 4Y49C 2HQYA 2J8MA 3F5BA 4MY0A 1BOBA 4J3GA 4KUBA 4LUAA 1OZPA 3T9YA 2VQYA 4OAEA 3R95A 1YX0A 2QECA 4KVOE 4E2AA 3TT2A 2R7HA 3QAHA 2B3UA 5IX3A 1N71A 1S60A 4JXQA 2BEIA 4AVAA 3PZJA 3D8PA 2REFA 2G3TA 4GS4A 1YK3A 2JEVA 2ZXVA 2VZYA 2I00A 3P2HA 1YGHA 1M1DA 5KTAA 2B5GB 4F6AA 4BMHA 1S7LA 2H5MA 2ZW7A 2OZUA 5DWMA 4UWJA 4U9ZA 3DNSA 4AG7A 3S6HA 1L0CA 4JXRA 2WPXA 1Q2YA 5F49A 3NE7A 1KUVA 3F0AA 3RYOA 2OZGA 2ZW4A 2Y0MA 2BUEA 1S7KA 2Z0ZA 4XPDB 1FY7A 2JLMA 1SQHA 3FRMA 3EO4A 1XF8A 2HV2A 3EC4A 4MI4A 2B4DB 2CY2A 4PSWA 4IF5A 3F8KA 4AVCA 2KCWA 4IUSA 4FD7A 1S5KA 2NMTA 4MBUA 2OB0A 3DR8A 5GCNA 2F5IA 3EY5A 3PP9A 2P6GA 2RC4A 1I12A 4QVTA 1B87A 5J8FA 3R9GA 2FL4A 3DDDA 4U5YA 2WPWA 3R9EA 3H4QA 5KTDA 5F48A 2J8NA 4QC6A 5EC4A 1MK4A 2B5GA 2OZHA 1S7FA 4CAXA 4KOYA 2PC1A 3DR6A 2OH1A 3VWDA 3FYNA 2VBQA 2ARHA 1K4JA 4KOUA 3B8GA 2B3VA 2PQ8A 2D4PA 3MGDA 5JPHA 5I0CA 5IV0A 3E0KA 3QB8A 4XPLA 1QSOA 2QIRA 3W6XA 4R3LA 2B58A 2EUIA 4HNWB 3IGRA 1B6BA 1P4NA 3LODA 1IICA 4PV6A 2B4DA 1QSRA 1YLEA 2Q44A 1M4DA 5KTCA 2K5TA 5HMNA 3CXQA 2G3AA 2OU2A 2FIWA 2GIVA 2I79A 4CRZB 4HKFA 2BSWA 4NCZA 5EBVA 2R8VA 3D3SA 4LX9A 2EVNA 4MJ8A 1M4GA 4PK3A 2AE6A 3JVNA 4YFJA 3GY9A 1RO5A 3N7ZA 2FXFA 1XEBA 4FD4A 4U9YA 1IYKA 2C27A 4OADA 4ORFA 4KZTA 3EFAA 4KORA 3VWEA 2Q04A 4YGOA 3K9UA 2G0BA 5IB0A 2Q0YA 4M3SA 4B5PB 3PGPA 3UY5A 4ONUA 3SXNA 4DNCA 2GANA 3OWCA 1GHEA 4XPKA 4UWIA 3FNCA 1CM0A 4KOTA 1QSTA 4FD6A 2PDOA 1LRZA 2PR8A 1I21A 3FIXA 2HUZA 4EVYA 1Q2DA 4F0YA 1IYLA 3S6GA 4AVBA 2Q7BA 4H89A 2FSRA 1PUAA 2Z11A 4ZBGA 5ISVA 3D2MA 2FIAA 3KKWA 2FCKA 3D2PA 1ON0A 2FS5A 5C88A 4QB9A 5E96A 2ZW5A 4KLVA 2P0WA 2JDCA 4XNHB 3LD2A 2FT0A 3BJ8A 2FE7A 4KOWA 3GYAA 5JQ4A 5FVJA 4X5KA 3R9FA 2CNMA 2VXKA 4KVXA 1V0CA 3P2FA 3ZJ0A 2P6FA 1M44A 1MJAA 5F46A 1MJ9A 2P6EA 4UBRA 4B5PA 2Q4VA 5C82A 3CXSA 2PR1A 1IIDA 3TOAA 2DXQA 3FB3A 3BJ7A 1P0HA 1Z9UA 2B4BA 1J4JA 4CS0B 3TO9A 1M4IA 1S7NA 3CXPA 2ZW6A 5CNPA 1XMTA 2ZPAA 2R1IA 3BLNA 3S6KA 3W91A 3V8IA 3I9SA 4RS2A 2Z10A 3IWGA 4KOXA 4E0AA 3DSBA 1S3ZA 4XNHC 2R98A 4FD5A 2PSWA 2QMLA 3T90A 3FXTA 4K30A 2ATRA 4CAVA 4NSQA 1NMTA 4B5OA 1VKCA 3FBUA 3TO7A 4II9A 2REEA 4R3KA 4CRYB 3TFYA 4KLWA 4R57A 3TCVA 4QUSA 1Z4RA 4KOVA 2VI7A 4R9MA 3SXOA 1VHSA 1KUYA 1NSLA 4NXYA 4KUAA 4HNYB 3W6SA 1QSNA 4E8OA 4JJXA 4MHDA 3EXNA 1BO4A 4I49A 5F47A 4L8AA 2VZZA 2Q4YA 3TE4A 4H6ZA 4JWPA 4CAWA 3G8WA 2J8RA 4HNXB 5DWNA 1XIXA 4R87A 2PRBA 4M85A
chains in the Genus database with same CATH superfamily
4A33A 3B3WA 1CJWA 1WWZA 3WC7A 2IL4A 1IB1E 2CNSA 2V8DA 2AJ6A 4H6UA 1WK4A 1R57A 1Q2CA 1PU9A 4UA3A 5H84A 3D7DA 1MJBA 3G3SA 5KTDA 4PK2A 4PSXA 4DJLA 4Y49B 4FUUA 4NEXA 2GFQA 2JDDA 4P4EA 4OLLA 1CBXA 2ZENA 3IEHA 2PIZA 1UFHA 1NE9A 2POKA 2CNTA 3WR7A 2ZEGA 2FVGA 4DYOA 1Y7RA 2YNDA 4P4DA 5HH1A 3SHPA 2PJCA 4L89A 3S6FA 1GYTA 4O23A 4F8ZA 4KOSA 5ELYA 2PRQA 3LACA 3PB6X 1Y9WA 2CIJA 1FNOA 4DUKA 2GU2A 1RXTA 2Z3OA 4UCNA 4P4BA 4H2KA 3CZXA 4OC5A 1Y9KA 4NJRA 3R1KA 1QSMA 4NGMA 4UEFA 4OC4A 4R8FA 4AG9A 1XMBA 2VL1A 4KVME 4AB7A 1YR0A 1YVKA 1ZLIA 2F7VA 3TO6A 1XE4A 4Q36A 3KQXA 3FEDA 5AGEA 2GE3A 2X7BA 4QBJA 2EBJA 2Z3KA 3GKRA 3JUWA 1HDUA 1KZFA 3PB8X 1I1DA 2ZOFA 4JYWA 4G1PA 3NFZA 1U6MA 3IU1A 4MY3A 3C26A 2YNEA 3WABA 1KUXA 3NH8A 4NF1A 3D66A 2F8HA 1IOIA 1R3NA 3KL9A 1YW4A 4CYOA 1QMUA 1YREA 2BL1A 2AFOA 2VEZA 4JLYA 4MMOA 4RI1A 4OKOA 5THWA 3IWEA 4YRHA 3SI2A 1IY7A 1TIQA 1PYTB 2O28A 3ZZIA 3FH4A 3NH5A 2O4HA 4JD6A 1Z2LA 3R96A 4CGNA 2AFUA 1XOVA 4XPDC 5H86A 3TOBA 6CPAA 4NGTA 2PJ0A 2D4OA 2PJAA 2PJ6A 4R7MA 3I3GA 5J8CA 1IU8A 1Z4EA 1YVOA 3H8FA 4ZX8A 3V7ZA 3TTHA 7CPAA 2A4NA 5LRGA 4Y49C 4UIAA 2HQYA 2J8MA 3F5BA 3SI1A 2DEAA 4CYNA 3T8WA 4MY0A 1BOBA 4J3GA 4KUBA 4NGSA 1CP7A 4IAVA 4LUAA 4M6HA 3TC8A 3B3CA 4B14A 3SJGA 1OZPA 3T9YA 4K3NA 4NGPA 4C2XA 2VQYA 4OAEA 3R95A 1RTQA 1YX0A 2ANPA 2QECA 2NSMA 3KR5A 3VH9A 4KVOE 4E2AA 4UCMA 3RBUA 3TT2A 4YWYA 2BO9A 2J9AA 2R7HA 2B3UA 3QAHA 4NGRA 5IX3A 3KGQA 1N71A 1Q7LA 1S60A 4Q7AA 3RO0A 4JXQA 2WUUA 2BEIA 3LMSA 4AVAA 3CDXA 3PZJA 4A2ZA 3D8PA 4C7HA 2Q7SA 2REFA 1M4LA 2G3TA 2CXAA 4B11A 1CPXA 4GS4A 1YK3A 2JEVA 2ZXVA 3JTKA 2VZYA 4UFXA 2I00A 3P2HA 3VARA 1YGHA 1M1DA 1LAPA 2DF5A 3FF3A 5K8MA 5KTAA 4B6ZA 3B3VA 2B5GB 2EWBA 2NYQA 3SJXA 3VATA 4F6AA 4BMHA 4X2TA 4NGNA 1S7LA 2H5MA 4MCRA 2ZW7A 5HVGA 4CGMA 2OZUA 2ZEPA 4R76A 5DWMA 4UWJA 2PJ2A 4U9ZA 3DNSA 5J1QA 4KSIA 4AG7A 1F2OA 3S6HA 2V8VA 2Z3NA 1L0CA 3WC6A 4JXRA 1YW6A 2WPXA 3IC1A 1Q2YA 4EWTA 5F49A 3NE7A 1KUVA 4UFWA 3F0AA 4P4FA 3RYOA 2OZGA 2ZW4A 2RFHA 4NGQA 2Y0MA 2WSAA 4TNUA 1UWYA 3QNVA 1LOKA 2BUEA 4KSAA 4EFDA 2PE3A 1S7KA 5K8NA 1ARMA 4LQ6A 2Z0ZA 4XPDB 3A9LA 4RN7A 1FY7A 4ZX9A 2JLMA 4MCPA 1ZG9A 1SQHA 3FRMA 2AFZA 3EO4A 1XF8A 5LYIA 3H8GA 2HV2A 4W9YA 3RAMA 3EC4A 4MI4A 4MFPA 2B4DB 4MFZA 2CY2A 4R6TA 2ZEFA 2ZEHA 2PIYA 5AG4A 4PSWA 4IF5A 2O53A 1LAMA 3F8KA 4IHMA 4OC2A 2KCWA 3GB0A 4IUSA 4AVCA 4FD7A 1S5KA 2NMTA 1H8LA 4MBUA 4NFRA 2OB0A 1TKHA 3DR8A 2DPTA 4OIWA 5GCNA 2PJ7A 4X8IA 4A37A 2ABZA 2C6GA 2F5IA 3EY5A 4IK2A 2HB6A 1YMEA 3PP9A 2P6GA 2RC4A 1Z8TA 1I12A 4PQAA 4QVTA 1IGBA 3D4UA 1Y0RA 3KQZA 1B87A 3LWUA 5J8FA 3MN8A 3R9GA 2Z3PA 2FL4A 4Z65A 3DDDA 4U5YA 2WPWA 4WWVA 3H4QA 3H5ZA 3R9EA 2AFSA 1LCPA 2IJZA 2J8NA 4M6GA 4MHPA 4MRIA 4QC6A 5EC4A 1MK4A 4CGPA 1XFOA 4OC3A 3GUXA 1JQGA 3IFEA 8CPAA 4OIDA 2B5GA 1TF9A 2Z3MA 2OZHA 4FWUA 4OP4A 1JWQA 4Q38A 1S7FA 3CT9A 4CAXA 2Q4ZA 3PFOA 4CYQA 4KOYA 2PC1A 3CPAA 3IU2A 3D67A 3DR6A 5K8PA 5G20A 4UEZA 4X3RA 2OH1A 1HEEA 4MFJA 3VWDA 4YU9A 4FBEA 3FYNA 5D8NA 2VBQA 1ELLP 2ARHA 4FAIA 1K4JA 4UIBA 4KOUA 3GIUA 1YLOA 3B8GA 4CAEA 1A2ZA 2PVVA 2B3VA 2PQ8A 2D4PA 3MGDA 5JPHA 5AG7A 5I0CA 5F09A 5IV0A 1XRYA 3E0KA 3QB8A 4XPLA 3D7HA 2PJ1A 1QSOA 3IWWA 2BCOA 4MXUA 4MHZA 2V8HA 4CAFA 2GLFA 2QIRA 3W6XA 4R3LA 2B58A 1CP6A 3SJEA 1XBUA 2EUIA 3KZWA 4NJQA 4PXDA 4ZY1A 4MFQA 4HNWB 3IGRA 1P4NA 1B6BA 3PBBA 2PVWA 3LODA 3D68A 4ONWA 1Z8WA 1IICA 4PV6A 1ARLA 2B4DA 4MFKA 1QSRA 3BI1A 2EK9A 4C2YA 3CPXA 4C2ZA 1YLEA 4EMEA 4C68A 2Q44A 1M4DA 5KTCA 2K5TA 3PRTA 5HMNA 3CXQA 2G3AA 3FVLA 2OU2A 2FIWA 1OBRA 4WJBA 2GIVA 2I79A 4CRZB 5A28A 4A30A 4CPAA 4P45A 4HKFA 4KS9A 2ZOGA 2BSWA 4NCZA 5EBVA 2R8VA 3D3SA 3L2NA 4PPZA 4LX9A 2EVNA 4MJ8A 1M4GA 4PK3A 2AE6A 3JVNA 3DLJA 4YFJA 2OOTA 3GY9A 2ZEOA 2ODFA 1RO5A 3DGVA 3N7ZA 5G1ZA 2RB7A 4MCQA 4MCSA 2FXFA 4A39A 1XEBA 3MRUA 4FD4A 1IYKA 2C27A 4U9YA 4BBHA 4OADA 4F0XA 2BOAA 3GLJA 4A95A 1CPSA 2AFWA 2V8GA 4ORFA 4KZTA 5LYFA 3EFAA 3HLPA 1ZLHA 3JRUA 3B7IA 4KORA 3VWEA 5EMIA 2Q04A 3D7FA 1Y0YA 3K9UA 4JZ0A 2G0BA 3K2KA 4YGOA 5HVFA 4A32A 5LRKA 4UFVA 2JBKA 5AG6A 4A31A 2PCUA 5IB0A 2Q0YA 4M3SA 3PB7X 4B5PB 1TKJA 1IOFA 3PGPA 2IMOA 3UY5A 2Q51A 1Z8LA 1VGYA 5LRJA 2YNCC 4ONUA 3SXNA 3BHXA 3FEEA 4DNCA 2GANA 3OWCA 5JGFA 3IJ3A 2WZNA 2XEIA 2QVPA 1GHEA 4XPKA 4UWIA 5A27A 3FNCA 5IB9A 2YGWA 1CM0A 2WYRA 1LANA 1QSTA 4FD6A 4KOTA 2AFMA 2PDOA 1F57A 4CGLA 1LRZA 1PCAA 1BLLE 2PR8A 1I21A 3FIXA 1Z5RA 2HUZA 4A94A 4EVYA 1Q2DA 4F0YA 1IYLA 3S6GA 4AVBA 2Q7BA 1BPNA 4H89A 4OMEA 2FSRA 4MHNA 4P4JA 1PUAA 2Z11A 2CTBA 3B3SA 4P44A 4ZBGA 5HXDA 5JH9A 5ISVA 3D2MA 4UF4A 2FIAA 1Z8XA 3KKWA 2FCKA 3D2PA 1ON0A 3SI0A 3BXMA 4B13A 2FS5A 1YSJA 5C88A 4QB9A 5D29A 4CGOA 4HPSA 5E96A 3S9MA 2ZW5A 4KLVA 3TX8A 4ZYQA 2P0WA 4ZI6A 2ZEMA 3SJFA 2EO8A 2JDCA 2QJ8A 2G9DA 2PJ3A 4XNHB 4UCPA 3KHXA 3LD2A 4B12A 2FT0A 4P6YA 3BJ8A 3QAYA 2FE7A 3ISXA 2CF4A 3GYAA 4KOWA 4ZY0A 5JQ4A 5FVJA 3NH4A 4BD9A 3H8EA 4RUHA 4X5KA 3KASA 3B2YA 3R9FA 2CNMA 2VXKA 4KVXA 1BAVA 3RZAA 1VHEA 5DS0A 1V0CA 5I4MA 3P2FA 2XEGA 1F2PA 2JEWA 5F48A 1R43A 1X12A 1VHOA 4UEEA 3ZJ0A 2P6FA 1TXRA 5BWAB 1M44A 5AG5A 1MJAA 4PXEA 5F46A 3TCVA 1MJ9A 2AFXA 2P6EA 4UBRA 2PJBA 4B5PA 2Q4VA 4BINA 5C82A 3CXSA 1ZO0A 2PR1A 2V77A 4P4IA 1IIDA 3TOAA 2PJ5A 1ZG8A 2ZEEA 3WC5A 2DXQA 4F9UA 2Q43A 3FB3A 3BJ7A 1P0HA 3HUVA 1Z9UA 2B4BA 3WT4A 5JM6A 5K8OA 3IO1A 4C7IA 4MHYA 1J4JA 4CS0B 3KI9A 2C6PA 4KSFA 5G22A 3TO9A 1AMPA 1M4IA 1BPMA 1S7NA 1ELMP 1YQEA 3B3TA 1TF8A 4GM5A 3CXPA 2ZW6A 5CNPA 1AYEA 1XMTA 3FJUA 2ZPAA 2R1IA 3BLNA 3S6KA 3W91A 1QQ9A 3V8IA 2XEFA 3FECA 2ZELA 3I9SA 4RS2A 5LYDA 2ZEDA 2Z10A 2C6CA 3IWGA 3FMCA 4KOXA 4A38A 2IQ6A 4B10A 3PB9X 1DTDA 4E0AA 4PXCA 3RNZA 3DSBA 1S3ZA 4XNHC 1FT7A 2R98A 4FD5A 3K9TA 2PSWA 3N5FA 2QMLA 3T90A 1CG2A 3FXTA 3PEIA 2C1CA 4K30A 2ATRA 4CAVA 4NSQA 1NMTA 4OC0A 4B5OA 1CX8A 1VKCA 3FBUA 3TO7A 4PXBA 3I1UA 4OC1A 1EE3P 2PJ4A 3S9LA 1NSAA 4LQGA 4II9A 2REEA 2GLJA 4R3KA 4CRYB 3TFYA 2PJ9A 1HDQA 3FX6A 4KLWA 2GREA 2I3CA 2Z3LA 3PBEA 4R57A 4QUSA 1Z4RA 4KOVA 3NE8A 5G21A 4MFLA 2DPSA 5CBMA 4GXHA 2VI7A 4F9VA 4R9MA 4ZGYB 3SXOA 1VHSA 1KUYA 1ZG7A 2PJ8A 3ISZA 4NXYA 1NSLA 1TKFA 1KWMA 1XJOA 3PFEA 3BI0A 4M6IA 3B35A 4KUAA 4HNYB 5CPAA 5LYLA 3W6SA 1QSNA 4AXVA 3KHZA 2CTCA 2HC9A 3D7GA 4CYPA 1Y7EA 4E8OA 3NA6A 1X10A 2JBJA 2EK8A 1DE4C 4JJXA 4MHDA 2OR4A 1BO4A 3EXNA 4I49A 4ZY2A 4TWEA 1LFWA 4P10A 5F47A 3KR4A 3PB4X 4L8AA 2VZZA 2Q4YA 3IIBA 2YNCA 3TE4A 1AUGA 4H6ZA 4JWPA 4CAWA 3V38A 3G8WA 2XEJA 2J8RA 2QYVA 4HNXB 1VIXA 5DWNA 3S9NA 1XIXA 5HVHA 4R87A 2PRBA 4M85A
chains in the Genus database with same CATH topology
4A33A 1CJWA 1WWZA 2IL4A 1IB1E 2CNSA 2AJ6A 4H6UA 1WK4A 1R57A 1Q2CA 1PU9A 4UA3A 5H84A 1MJBA 3G3SA 4PK2A 4PSXA 4Y49B 4NEXA 2JDDA 4OLLA 1UFHA 1NE9A 2CNTA 3WR7A 1Y7RA 2YNDA 5HH1A 3SHPA 4L89A 3S6FA 4KOSA 1Y9WA 1RXTA 2Z3OA 4UCNA 1Y9KA 3R1KA 1QSMA 4AG9A 4KVME 4AB7A 1YR0A 1YVKA 3TO6A 1XE4A 4Q36A 5AGEA 4QBJA 2GE3A 2X7BA 2Z3KA 3GKRA 3JUWA 1KZFA 1I1DA 1U6MA 3IU1A 4MY3A 3C26A 2YNEA 1KUXA 4NF1A 4CYOA 1YREA 2BL1A 2VEZA 4JLYA 4RI1A 3IWEA 4YRHA 1TIQA 2O28A 3ZZIA 4JD6A 3R96A 4CGNA 4XPDC 5H86A 3TOBA 2D4OA 5J8CA 3I3GA 1Z4EA 1YVOA 3TTHA 2A4NA 4Y49C 2HQYA 2J8MA 3F5BA 4CYNA 4MY0A 1BOBA 4J3GA 4KUBA 4LUAA 4B14A 1OZPA 3T9YA 4C2XA 2VQYA 4OAEA 3R95A 1YX0A 2QECA 4KVOE 4E2AA 4UCMA 3TT2A 2R7HA 3QAHA 2B3UA 5IX3A 1N71A 1S60A 4JXQA 2WUUA 2BEIA 4AVAA 4A2ZA 3PZJA 3D8PA 4C7HA 2REFA 2G3TA 2CXAA 4B11A 4GS4A 1YK3A 2JEVA 2ZXVA 3JTKA 2VZYA 4UFXA 2I00A 3P2HA 1YGHA 1M1DA 5KTAA 2B5GB 4F6AA 4BMHA 1S7LA 2H5MA 2ZW7A 4CGMA 2OZUA 5DWMA 4UWJA 4U9ZA 3DNSA 4AG7A 3S6HA 2Z3NA 1L0CA 4JXRA 2WPXA 1Q2YA 5F49A 3NE7A 1KUVA 4UFWA 3F0AA 3RYOA 2OZGA 2ZW4A 2Y0MA 2WSAA 2BUEA 4KSAA 1S7KA 2Z0ZA 4XPDB 3A9LA 1FY7A 2JLMA 1SQHA 3FRMA 3EO4A 1XF8A 2HV2A 3EC4A 4MI4A 4MFPA 2B4DB 4MFZA 2CY2A 5AG4A 4PSWA 4IF5A 3F8KA 4AVCA 2KCWA 4IUSA 4FD7A 1S5KA 2NMTA 4MBUA 2OB0A 3DR8A 2DPTA 5GCNA 2F5IA 3EY5A 3PP9A 2P6GA 2RC4A 1I12A 4QVTA 1B87A 5J8FA 3R9GA 2Z3PA 2FL4A 3DDDA 4U5YA 2WPWA 3R9EA 3H4QA 3H5ZA 5KTDA 5F48A 2J8NA 4QC6A 4CGPA 5EC4A 1MK4A 2B5GA 2Z3MA 2OZHA 4Q38A 1S7FA 4CAXA 4CYQA 4KOYA 2PC1A 3IU2A 3DR6A 5G20A 2OH1A 4MFJA 3VWDA 3FYNA 2VBQA 2ARHA 1K4JA 4KOUA 4CAEA 3B8GA 2B3VA 2PQ8A 2D4PA 3MGDA 5JPHA 5AG7A 5I0CA 5IV0A 3E0KA 3QB8A 4XPLA 1QSOA 4CAFA 2QIRA 3W6XA 4R3LA 2B58A 2EUIA 4MFQA 4HNWB 3IGRA 1B6BA 1P4NA 3LODA 1IICA 4PV6A 2B4DA 4MFKA 1QSRA 4C2YA 4C2ZA 1YLEA 4C68A 2Q44A 1M4DA 5KTCA 2K5TA 5HMNA 3CXQA 2G3AA 2OU2A 2FIWA 2GIVA 2I79A 4CRZB 5A28A 4A30A 4HKFA 4KS9A 2BSWA 4NCZA 5EBVA 2R8VA 3D3SA 4LX9A 2EVNA 4MJ8A 1M4GA 4PK3A 2AE6A 3JVNA 4YFJA 3GY9A 1RO5A 3N7ZA 5G1ZA 2FXFA 1XEBA 4FD4A 4U9YA 1IYKA 2C27A 4BBHA 4OADA 4F0XA 4A95A 4ORFA 4KZTA 3EFAA 4KORA 3VWEA 2Q04A 4YGOA 3K9UA 2G0BA 4A32A 4UFVA 5AG6A 4A31A 5IB0A 2Q0YA 4M3SA 4B5PB 3PGPA 3UY5A 2YNCC 4ONUA 3SXNA 4DNCA 2GANA 3OWCA 1GHEA 4XPKA 4UWIA 5A27A 3FNCA 2YGWA 1CM0A 4KOTA 1QSTA 4FD6A 2PDOA 4CGLA 1LRZA 2PR8A 1I21A 3FIXA 2HUZA 4EVYA 1Q2DA 4F0YA 1IYLA 3S6GA 4AVBA 2Q7BA 4H89A 2FSRA 1PUAA 2Z11A 4ZBGA 5ISVA 3D2MA 2FIAA 3KKWA 2FCKA 3D2PA 1ON0A 4B13A 2FS5A 5C88A 4QB9A 4CGOA 5E96A 2ZW5A 4KLVA 2P0WA 2JDCA 4XNHB 4UCPA 3LD2A 4B12A 2FT0A 3BJ8A 2FE7A 3GYAA 4KOWA 5JQ4A 5FVJA 4X5KA 3R9FA 2CNMA 2VXKA 4KVXA 1V0CA 3P2FA 3ZJ0A 2P6FA 5BWAB 1M44A 5AG5A 1MJAA 5F46A 1MJ9A 2P6EA 4UBRA 4B5PA 2Q4VA 5C82A 3CXSA 1ZO0A 2PR1A 1IIDA 3TOAA 2DXQA 3FB3A 3BJ7A 1P0HA 1Z9UA 2B4BA 4C7IA 1J4JA 4CS0B 4KSFA 5G22A 3TO9A 1M4IA 1S7NA 3CXPA 2ZW6A 5CNPA 1XMTA 2ZPAA 2R1IA 3BLNA 3S6KA 3W91A 3V8IA 3I9SA 4RS2A 2Z10A 3IWGA 4KOXA 4B10A 4E0AA 3DSBA 1S3ZA 4XNHC 2R98A 4FD5A 2PSWA 2QMLA 3T90A 3FXTA 4K30A 2ATRA 4CAVA 4NSQA 1NMTA 4B5OA 1VKCA 3FBUA 3TO7A 4II9A 2REEA 4R3KA 4CRYB 3TFYA 4KLWA 4R57A 3TCVA 2Z3LA 4QUSA 1Z4RA 4KOVA 5G21A 4MFLA 2DPSA 2VI7A 4R9MA 4ZGYB 3SXOA 1VHSA 1KUYA 1NSLA 4NXYA 4KUAA 4HNYB 3W6SA 1QSNA 4CYPA 4E8OA 4JJXA 4MHDA 3EXNA 1BO4A 4I49A 5F47A 4L8AA 2VZZA 2Q4YA 2YNCA 3TE4A 4H6ZA 4JWPA 4CAWA 3G8WA 2J8RA 4HNXB 5DWNA 1XIXA 4R87A 2PRBA 4M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJW A;  1WWZ A;  2IL4 A;  1IB1 E;  2CNS A;  2AJ6 A;  4H6U A;  1WK4 A;  1R57 A;  1Q2C A;  1PU9 A;  4UA3 A;  5H84 A;  1MJB A;  3G3S A;  4PK2 A;  4PSX A;  4Y49 B;  4NEX A;  2JDD A;  4OLL A;  1UFH A;  1NE9 A;  2CNT A;  3WR7 A;  1Y7R A;  5HH1 A;  3SHP A;  4L89 A;  3S6F A;  4KOS A;  1Y9W A;  1RXT A;  1Y9K A;  3R1K A;  1QSM A;  4AG9 A;  4KVM E;  4AB7 A;  1YR0 A;  1YVK A;  3TO6 A;  1XE4 A;  4QBJ A;  2GE3 A;  2X7B A;  3GKR A;  3JUW A;  1KZF A;  1I1D A;  1U6M A;  4MY3 A;  3C26 A;  1KUX A;  4NF1 A;  1YRE A;  2BL1 A;  2VEZ A;  4JLY A;  4RI1 A;  4YRH A;  1TIQ A;  2O28 A;  3ZZI A;  4JD6 A;  3R96 A;  4XPD C;  5H86 A;  3TOB A;  2D4O A;  5J8C A;  3I3G A;  1Z4E A;  1YVO A;  3TTH A;  2A4N A;  4Y49 C;  2HQY A;  2J8M A;  3F5B A;  4MY0 A;  1BOB A;  4J3G A;  4KUB A;  4LUA A;  1OZP A;  3T9Y A;  2VQY A;  4OAE A;  3R95 A;  1YX0 A;  2QEC A;  4KVO E;  4E2A A;  3TT2 A;  2R7H A;  3QAH A;  2B3U A;  5IX3 A;  1N71 A;  1S60 A;  4JXQ A;  2BEI A;  4AVA A;  3PZJ A;  3D8P A;  2REF A;  2G3T A;  4GS4 A;  1YK3 A;  2JEV A;  2ZXV A;  2VZY A;  2I00 A;  3P2H A;  1YGH A;  1M1D A;  5KTA A;  2B5G B;  4F6A A;  4BMH A;  1S7L A;  2H5M A;  2ZW7 A;  2OZU A;  5DWM A;  4UWJ A;  4U9Z A;  3DNS A;  4AG7 A;  3S6H A;  1L0C A;  4JXR A;  2WPX A;  1Q2Y A;  5F49 A;  3NE7 A;  1KUV A;  3F0A A;  3RYO A;  2OZG A;  2ZW4 A;  2Y0M A;  2BUE A;  1S7K A;  2Z0Z A;  4XPD B;  1FY7 A;  2JLM A;  1SQH A;  3FRM A;  3EO4 A;  1XF8 A;  2HV2 A;  3EC4 A;  4MI4 A;  2B4D B;  2CY2 A;  4PSW A;  4IF5 A;  3F8K A;  4AVC A;  2KCW A;  4IUS A;  4FD7 A;  1S5K A;  2NMT A;  4MBU A;  2OB0 A;  3DR8 A;  5GCN A;  2F5I A;  3EY5 A;  3PP9 A;  2P6G A;  2RC4 A;  1I12 A;  4QVT A;  1B87 A;  5J8F A;  3R9G A;  2FL4 A;  3DDD A;  4U5Y A;  2WPW A;  3R9E A;  3H4Q A;  5KTD A;  5F48 A;  2J8N A;  4QC6 A;  5EC4 A;  1MK4 A;  2B5G A;  2OZH A;  1S7F A;  4CAX A;  4KOY A;  2PC1 A;  3DR6 A;  2OH1 A;  3VWD A;  3FYN A;  2VBQ A;  2ARH A;  1K4J A;  4KOU A;  3B8G A;  2B3V A;  2PQ8 A;  2D4P A;  3MGD A;  5JPH A;  5I0C A;  5IV0 A;  3E0K A;  3QB8 A;  4XPL A;  1QSO A;  2QIR A;  3W6X A;  4R3L A;  2B58 A;  2EUI A;  4HNW B;  3IGR A;  1B6B A;  1P4N A;  3LOD A;  1IIC A;  4PV6 A;  2B4D A;  1QSR A;  1YLE A;  2Q44 A;  1M4D A;  5KTC A;  2K5T A;  5HMN A;  3CXQ A;  2G3A A;  2OU2 A;  2FIW A;  2GIV A;  2I79 A;  4CRZ B;  4HKF A;  2BSW A;  4NCZ A;  5EBV A;  2R8V A;  3D3S A;  4LX9 A;  2EVN A;  4MJ8 A;  1M4G A;  4PK3 A;  2AE6 A;  3JVN A;  4YFJ A;  3GY9 A;  1RO5 A;  3N7Z A;  2FXF A;  1XEB A;  4FD4 A;  4U9Y A;  1IYK A;  2C27 A;  4OAD A;  4ORF A;  4KZT A;  3EFA A;  4KOR A;  3VWE A;  2Q04 A;  4YGO A;  3K9U A;  2G0B A;  5IB0 A;  2Q0Y A;  4M3S A;  4B5P B;  3PGP A;  3UY5 A;  4ONU A;  3SXN A;  4DNC A;  2GAN A;  3OWC A;  1GHE A;  4XPK A;  4UWI A;  3FNC A;  1CM0 A;  4KOT A;  1QST A;  4FD6 A;  2PDO A;  1LRZ A;  2PR8 A;  1I21 A;  3FIX A;  2HUZ A;  4EVY A;  1Q2D A;  4F0Y A;  1IYL A;  3S6G A;  4AVB A;  2Q7B A;  4H89 A;  2FSR A;  1PUA A;  2Z11 A;  4ZBG A;  5ISV A;  3D2M A;  2FIA A;  3KKW A;  2FCK A;  3D2P A;  1ON0 A;  2FS5 A;  5C88 A;  4QB9 A;  5E96 A;  2ZW5 A;  4KLV A;  2P0W A;  2JDC A;  4XNH B;  3LD2 A;  2FT0 A;  3BJ8 A;  2FE7 A;  4KOW A;  3GYA A;  5JQ4 A;  5FVJ A;  4X5K A;  3R9F A;  2CNM A;  2VXK A;  4KVX A;  1V0C A;  3P2F A;  3ZJ0 A;  2P6F A;  1M44 A;  1MJA A;  5F46 A;  1MJ9 A;  2P6E A;  4UBR A;  4B5P A;  2Q4V A;  5C82 A;  3CXS A;  2PR1 A;  1IID A;  3TOA A;  2DXQ A;  3FB3 A;  3BJ7 A;  1P0H A;  1Z9U A;  2B4B A;  1J4J A;  4CS0 B;  3TO9 A;  1M4I A;  1S7N A;  3CXP A;  2ZW6 A;  5CNP A;  1XMT A;  2ZPA A;  2R1I A;  3BLN A;  3S6K A;  3W91 A;  3V8I A;  3I9S A;  4RS2 A;  2Z10 A;  3IWG A;  4KOX A;  4E0A A;  3DSB A;  1S3Z A;  4XNH C;  2R98 A;  4FD5 A;  2PSW A;  2QML A;  3T90 A;  3FXT A;  4K30 A;  2ATR A;  4CAV A;  4NSQ A;  1NMT A;  4B5O A;  1VKC A;  3FBU A;  3TO7 A;  4II9 A;  2REE A;  4R3K A;  4CRY B;  3TFY A;  4KLW A;  4R57 A;  3TCV A;  4QUS A;  1Z4R A;  4KOV A;  2VI7 A;  4R9M A;  3SXO A;  1VHS A;  1KUY A;  1NSL A;  4NXY A;  4KUA A;  4HNY B;  3W6S A;  1QSN A;  4E8O A;  4JJX A;  4MHD A;  3EXN A;  1BO4 A;  4I49 A;  5F47 A;  4L8A A;  2VZZ A;  2Q4Y A;  3TE4 A;  4H6Z A;  4JWP A;  4CAW A;  3G8W A;  2J8R A;  4HNX B;  5DWN A;  1XIX A;  4R87 A;  2PRB A;  4M85 A; 
#chains in the Genus database with same CATH topology
 4A33 A;  3B3W A;  1CJW A;  1WWZ A;  3WC7 A;  2IL4 A;  1IB1 E;  2CNS A;  2V8D A;  2AJ6 A;  4H6U A;  1WK4 A;  1R57 A;  1Q2C A;  1PU9 A;  4UA3 A;  5H84 A;  3D7D A;  1MJB A;  3G3S A;  5KTD A;  4PK2 A;  4PSX A;  4DJL A;  4Y49 B;  4FUU A;  4NEX A;  2GFQ A;  2JDD A;  4P4E A;  4OLL A;  1CBX A;  2ZEN A;  3IEH A;  2PIZ A;  1UFH A;  1NE9 A;  2POK A;  2CNT A;  3WR7 A;  2ZEG A;  2FVG A;  4DYO A;  1Y7R A;  2YND A;  4P4D A;  5HH1 A;  3SHP A;  2PJC A;  4L89 A;  3S6F A;  1GYT A;  4O23 A;  4F8Z A;  4KOS A;  5ELY A;  2PRQ A;  3LAC A;  3PB6 X;  1Y9W A;  2CIJ A;  1FNO A;  4DUK A;  2GU2 A;  1RXT A;  2Z3O A;  4UCN A;  4P4B A;  4H2K A;  3CZX A;  4OC5 A;  1Y9K A;  4NJR A;  3R1K A;  1QSM A;  4NGM A;  4UEF A;  4OC4 A;  4R8F A;  4AG9 A;  1XMB A;  2VL1 A;  4KVM E;  4AB7 A;  1YR0 A;  1YVK A;  1ZLI A;  2F7V A;  3TO6 A;  1XE4 A;  4Q36 A;  3KQX A;  3FED A;  5AGE A;  2GE3 A;  2X7B A;  4QBJ A;  2EBJ A;  2Z3K A;  3GKR A;  3JUW A;  1HDU A;  1KZF A;  3PB8 X;  1I1D A;  2ZOF A;  4JYW A;  4G1P A;  3NFZ A;  1U6M A;  3IU1 A;  4MY3 A;  3C26 A;  2YNE A;  3WAB A;  1KUX A;  3NH8 A;  4NF1 A;  3D66 A;  2F8H A;  1IOI A;  1R3N A;  3KL9 A;  1YW4 A;  4CYO A;  1QMU A;  1YRE A;  2BL1 A;  2AFO A;  2VEZ A;  4JLY A;  4MMO A;  4RI1 A;  4OKO A;  5THW A;  3IWE A;  4YRH A;  3SI2 A;  1IY7 A;  1TIQ A;  1PYT B;  2O28 A;  3ZZI A;  3FH4 A;  3NH5 A;  2O4H A;  4JD6 A;  1Z2L A;  3R96 A;  4CGN A;  2AFU A;  1XOV A;  4XPD C;  5H86 A;  3TOB A;  6CPA A;  4NGT A;  2PJ0 A;  2D4O A;  2PJA A;  2PJ6 A;  4R7M A;  3I3G A;  5J8C A;  1IU8 A;  1Z4E A;  1YVO A;  3H8F A;  4ZX8 A;  3V7Z A;  3TTH A;  7CPA A;  2A4N A;  5LRG A;  4Y49 C;  4UIA A;  2HQY A;  2J8M A;  3F5B A;  3SI1 A;  2DEA A;  4CYN A;  3T8W A;  4MY0 A;  1BOB A;  4J3G A;  4KUB A;  4NGS A;  1CP7 A;  4IAV A;  4LUA A;  4M6H A;  3TC8 A;  3B3C A;  4B14 A;  3SJG A;  1OZP A;  3T9Y A;  4K3N A;  4NGP A;  4C2X A;  2VQY A;  4OAE A;  3R95 A;  1RTQ A;  1YX0 A;  2ANP A;  2QEC A;  2NSM A;  3KR5 A;  3VH9 A;  4KVO E;  4E2A A;  4UCM A;  3RBU A;  3TT2 A;  4YWY A;  2BO9 A;  2J9A A;  2R7H A;  2B3U A;  3QAH A;  4NGR A;  5IX3 A;  3KGQ A;  1N71 A;  1Q7L A;  1S60 A;  4Q7A A;  3RO0 A;  4JXQ A;  2WUU A;  2BEI A;  3LMS A;  4AVA A;  3CDX A;  3PZJ A;  4A2Z A;  3D8P A;  4C7H A;  2Q7S A;  2REF A;  1M4L A;  2G3T A;  2CXA A;  4B11 A;  1CPX A;  4GS4 A;  1YK3 A;  2JEV A;  2ZXV A;  3JTK A;  2VZY A;  4UFX A;  2I00 A;  3P2H A;  3VAR A;  1YGH A;  1M1D A;  1LAP A;  2DF5 A;  3FF3 A;  5K8M A;  5KTA A;  4B6Z A;  3B3V A;  2B5G B;  2EWB A;  2NYQ A;  3SJX A;  3VAT A;  4F6A A;  4BMH A;  4X2T A;  4NGN A;  1S7L A;  2H5M A;  4MCR A;  2ZW7 A;  5HVG A;  4CGM A;  2OZU A;  2ZEP A;  4R76 A;  5DWM A;  4UWJ A;  2PJ2 A;  4U9Z A;  3DNS A;  5J1Q A;  4KSI A;  4AG7 A;  1F2O A;  3S6H A;  2V8V A;  2Z3N A;  1L0C A;  3WC6 A;  4JXR A;  1YW6 A;  2WPX A;  3IC1 A;  1Q2Y A;  4EWT A;  5F49 A;  3NE7 A;  1KUV A;  4UFW A;  3F0A A;  4P4F A;  3RYO A;  2OZG A;  2ZW4 A;  2RFH A;  4NGQ A;  2Y0M A;  2WSA A;  4TNU A;  1UWY A;  3QNV A;  1LOK A;  2BUE A;  4KSA A;  4EFD A;  2PE3 A;  1S7K A;  5K8N A;  1ARM A;  4LQ6 A;  2Z0Z A;  4XPD B;  3A9L A;  4RN7 A;  1FY7 A;  4ZX9 A;  2JLM A;  4MCP A;  1ZG9 A;  1SQH A;  3FRM A;  2AFZ A;  3EO4 A;  1XF8 A;  5LYI A;  3H8G A;  2HV2 A;  4W9Y A;  3RAM A;  3EC4 A;  4MI4 A;  4MFP A;  2B4D B;  4MFZ A;  2CY2 A;  4R6T A;  2ZEF A;  2ZEH A;  2PIY A;  5AG4 A;  4PSW A;  4IF5 A;  2O53 A;  1LAM A;  3F8K A;  4IHM A;  4OC2 A;  2KCW A;  3GB0 A;  4IUS A;  4AVC A;  4FD7 A;  1S5K A;  2NMT A;  1H8L A;  4MBU A;  4NFR A;  2OB0 A;  1TKH A;  3DR8 A;  2DPT A;  4OIW A;  5GCN A;  2PJ7 A;  4X8I A;  4A37 A;  2ABZ A;  2C6G A;  2F5I A;  3EY5 A;  4IK2 A;  2HB6 A;  1YME A;  3PP9 A;  2P6G A;  2RC4 A;  1Z8T A;  1I12 A;  4PQA A;  4QVT A;  1IGB A;  3D4U A;  1Y0R A;  3KQZ A;  1B87 A;  3LWU A;  5J8F A;  3MN8 A;  3R9G A;  2Z3P A;  2FL4 A;  4Z65 A;  3DDD A;  4U5Y A;  2WPW A;  4WWV A;  3H4Q A;  3H5Z A;  3R9E A;  2AFS A;  1LCP A;  2IJZ A;  2J8N A;  4M6G A;  4MHP A;  4MRI A;  4QC6 A;  5EC4 A;  1MK4 A;  4CGP A;  1XFO A;  4OC3 A;  3GUX A;  1JQG A;  3IFE A;  8CPA A;  4OID A;  2B5G A;  1TF9 A;  2Z3M A;  2OZH A;  4FWU A;  4OP4 A;  1JWQ A;  4Q38 A;  1S7F A;  3CT9 A;  4CAX A;  2Q4Z A;  3PFO A;  4CYQ A;  4KOY A;  2PC1 A;  3CPA A;  3IU2 A;  3D67 A;  3DR6 A;  5K8P A;  5G20 A;  4UEZ A;  4X3R A;  2OH1 A;  1HEE A;  4MFJ A;  3VWD A;  4YU9 A;  4FBE A;  3FYN A;  5D8N A;  2VBQ A;  1ELL P;  2ARH A;  4FAI A;  1K4J A;  4UIB A;  4KOU A;  3GIU A;  1YLO A;  3B8G A;  4CAE A;  1A2Z A;  2PVV A;  2B3V A;  2PQ8 A;  2D4P A;  3MGD A;  5JPH A;  5AG7 A;  5I0C A;  5F09 A;  5IV0 A;  1XRY A;  3E0K A;  3QB8 A;  4XPL A;  3D7H A;  2PJ1 A;  1QSO A;  3IWW A;  2BCO A;  4MXU A;  4MHZ A;  2V8H A;  4CAF A;  2GLF A;  2QIR A;  3W6X A;  4R3L A;  2B58 A;  1CP6 A;  3SJE A;  1XBU A;  2EUI A;  3KZW A;  4NJQ A;  4PXD A;  4ZY1 A;  4MFQ A;  4HNW B;  3IGR A;  1P4N A;  1B6B A;  3PBB A;  2PVW A;  3LOD A;  3D68 A;  4ONW A;  1Z8W A;  1IIC A;  4PV6 A;  1ARL A;  2B4D A;  4MFK A;  1QSR A;  3BI1 A;  2EK9 A;  4C2Y A;  3CPX A;  4C2Z A;  1YLE A;  4EME A;  4C68 A;  2Q44 A;  1M4D A;  5KTC A;  2K5T A;  3PRT A;  5HMN A;  3CXQ A;  2G3A A;  3FVL A;  2OU2 A;  2FIW A;  1OBR A;  4WJB A;  2GIV A;  2I79 A;  4CRZ B;  5A28 A;  4A30 A;  4CPA A;  4P45 A;  4HKF A;  4KS9 A;  2ZOG A;  2BSW A;  4NCZ A;  5EBV A;  2R8V A;  3D3S A;  3L2N A;  4PPZ A;  4LX9 A;  2EVN A;  4MJ8 A;  1M4G A;  4PK3 A;  2AE6 A;  3JVN A;  3DLJ A;  4YFJ A;  2OOT A;  3GY9 A;  2ZEO A;  2ODF A;  1RO5 A;  3DGV A;  3N7Z A;  5G1Z A;  2RB7 A;  4MCQ A;  4MCS A;  2FXF A;  4A39 A;  1XEB A;  3MRU A;  4FD4 A;  1IYK A;  2C27 A;  4U9Y A;  4BBH A;  4OAD A;  4F0X A;  2BOA A;  3GLJ A;  4A95 A;  1CPS A;  2AFW A;  2V8G A;  4ORF A;  4KZT A;  5LYF A;  3EFA A;  3HLP A;  1ZLH A;  3JRU A;  3B7I A;  4KOR A;  3VWE A;  5EMI A;  2Q04 A;  3D7F A;  1Y0Y A;  3K9U A;  4JZ0 A;  2G0B A;  3K2K A;  4YGO A;  5HVF A;  4A32 A;  5LRK A;  4UFV A;  2JBK A;  5AG6 A;  4A31 A;  2PCU A;  5IB0 A;  2Q0Y A;  4M3S A;  3PB7 X;  4B5P B;  1TKJ A;  1IOF A;  3PGP A;  2IMO A;  3UY5 A;  2Q51 A;  1Z8L A;  1VGY A;  5LRJ A;  2YNC C;  4ONU A;  3SXN A;  3BHX A;  3FEE A;  4DNC A;  2GAN A;  3OWC A;  5JGF A;  3IJ3 A;  2WZN A;  2XEI A;  2QVP A;  1GHE A;  4XPK A;  4UWI A;  5A27 A;  3FNC A;  5IB9 A;  2YGW A;  1CM0 A;  2WYR A;  1LAN A;  1QST A;  4FD6 A;  4KOT A;  2AFM A;  2PDO A;  1F57 A;  4CGL A;  1LRZ A;  1PCA A;  1BLL E;  2PR8 A;  1I21 A;  3FIX A;  1Z5R A;  2HUZ A;  4A94 A;  4EVY A;  1Q2D A;  4F0Y A;  1IYL A;  3S6G A;  4AVB A;  2Q7B A;  1BPN A;  4H89 A;  4OME A;  2FSR A;  4MHN A;  4P4J A;  1PUA A;  2Z11 A;  2CTB A;  3B3S A;  4P44 A;  4ZBG A;  5HXD A;  5JH9 A;  5ISV A;  3D2M A;  4UF4 A;  2FIA A;  1Z8X A;  3KKW A;  2FCK A;  3D2P A;  1ON0 A;  3SI0 A;  3BXM A;  4B13 A;  2FS5 A;  1YSJ A;  5C88 A;  4QB9 A;  5D29 A;  4CGO A;  4HPS A;  5E96 A;  3S9M A;  2ZW5 A;  4KLV A;  3TX8 A;  4ZYQ A;  2P0W A;  4ZI6 A;  2ZEM A;  3SJF A;  2EO8 A;  2JDC A;  2QJ8 A;  2G9D A;  2PJ3 A;  4XNH B;  4UCP A;  3KHX A;  3LD2 A;  4B12 A;  2FT0 A;  4P6Y A;  3BJ8 A;  3QAY A;  2FE7 A;  3ISX A;  2CF4 A;  3GYA A;  4KOW A;  4ZY0 A;  5JQ4 A;  5FVJ A;  3NH4 A;  4BD9 A;  3H8E A;  4RUH A;  4X5K A;  3KAS A;  3B2Y A;  3R9F A;  2CNM A;  2VXK A;  4KVX A;  1BAV A;  3RZA A;  1VHE A;  5DS0 A;  1V0C A;  5I4M A;  3P2F A;  2XEG A;  1F2P A;  2JEW A;  5F48 A;  1R43 A;  1X12 A;  1VHO A;  4UEE A;  3ZJ0 A;  2P6F A;  1TXR A;  5BWA B;  1M44 A;  5AG5 A;  1MJA A;  4PXE A;  5F46 A;  3TCV A;  1MJ9 A;  2AFX A;  2P6E A;  4UBR A;  2PJB A;  4B5P A;  2Q4V A;  4BIN A;  5C82 A;  3CXS A;  1ZO0 A;  2PR1 A;  2V77 A;  4P4I A;  1IID A;  3TOA A;  2PJ5 A;  1ZG8 A;  2ZEE A;  3WC5 A;  2DXQ A;  4F9U A;  2Q43 A;  3FB3 A;  3BJ7 A;  1P0H A;  3HUV A;  1Z9U A;  2B4B A;  3WT4 A;  5JM6 A;  5K8O A;  3IO1 A;  4C7I A;  4MHY A;  1J4J A;  4CS0 B;  3KI9 A;  2C6P A;  4KSF A;  5G22 A;  3TO9 A;  1AMP A;  1M4I A;  1BPM A;  1S7N A;  1ELM P;  1YQE A;  3B3T A;  1TF8 A;  4GM5 A;  3CXP A;  2ZW6 A;  5CNP A;  1AYE A;  1XMT A;  3FJU A;  2ZPA A;  2R1I A;  3BLN A;  3S6K A;  3W91 A;  1QQ9 A;  3V8I A;  2XEF A;  3FEC A;  2ZEL A;  3I9S A;  4RS2 A;  5LYD A;  2ZED A;  2Z10 A;  2C6C A;  3IWG A;  3FMC A;  4KOX A;  4A38 A;  2IQ6 A;  4B10 A;  3PB9 X;  1DTD A;  4E0A A;  4PXC A;  3RNZ A;  3DSB A;  1S3Z A;  4XNH C;  1FT7 A;  2R98 A;  4FD5 A;  3K9T A;  2PSW A;  3N5F A;  2QML A;  3T90 A;  1CG2 A;  3FXT A;  3PEI A;  2C1C A;  4K30 A;  2ATR A;  4CAV A;  4NSQ A;  1NMT A;  4OC0 A;  4B5O A;  1CX8 A;  1VKC A;  3FBU A;  3TO7 A;  4PXB A;  3I1U A;  4OC1 A;  1EE3 P;  2PJ4 A;  3S9L A;  1NSA A;  4LQG A;  4II9 A;  2REE A;  2GLJ A;  4R3K A;  4CRY B;  3TFY A;  2PJ9 A;  1HDQ A;  3FX6 A;  4KLW A;  2GRE A;  2I3C A;  2Z3L A;  3PBE A;  4R57 A;  4QUS A;  1Z4R A;  4KOV A;  3NE8 A;  5G21 A;  4MFL A;  2DPS A;  5CBM A;  4GXH A;  2VI7 A;  4F9V A;  4R9M A;  4ZGY B;  3SXO A;  1VHS A;  1KUY A;  1ZG7 A;  2PJ8 A;  3ISZ A;  4NXY A;  1NSL A;  1TKF A;  1KWM A;  1XJO A;  3PFE A;  3BI0 A;  4M6I A;  3B35 A;  4KUA A;  4HNY B;  5CPA A;  5LYL A;  3W6S A;  1QSN A;  4AXV A;  3KHZ A;  2CTC A;  2HC9 A;  3D7G A;  4CYP A;  1Y7E A;  4E8O A;  3NA6 A;  1X10 A;  2JBJ A;  2EK8 A;  1DE4 C;  4JJX A;  4MHD A;  2OR4 A;  1BO4 A;  3EXN A;  4I49 A;  4ZY2 A;  4TWE A;  1LFW A;  4P10 A;  5F47 A;  3KR4 A;  3PB4 X;  4L8A A;  2VZZ A;  2Q4Y A;  3IIB A;  2YNC A;  3TE4 A;  1AUG A;  4H6Z A;  4JWP A;  4CAW A;  3V38 A;  3G8W A;  2XEJ A;  2J8R A;  2QYV A;  4HNX B;  1VIX A;  5DWN A;  3S9N A;  1XIX A;  5HVH A;  4R87 A;  2PRB A;  4M85 A; 
#chains in the Genus database with same CATH homology
 4A33 A;  1CJW A;  1WWZ A;  2IL4 A;  1IB1 E;  2CNS A;  2AJ6 A;  4H6U A;  1WK4 A;  1R57 A;  1Q2C A;  1PU9 A;  4UA3 A;  5H84 A;  1MJB A;  3G3S A;  4PK2 A;  4PSX A;  4Y49 B;  4NEX A;  2JDD A;  4OLL A;  1UFH A;  1NE9 A;  2CNT A;  3WR7 A;  1Y7R A;  2YND A;  5HH1 A;  3SHP A;  4L89 A;  3S6F A;  4KOS A;  1Y9W A;  1RXT A;  2Z3O A;  4UCN A;  1Y9K A;  3R1K A;  1QSM A;  4AG9 A;  4KVM E;  4AB7 A;  1YR0 A;  1YVK A;  3TO6 A;  1XE4 A;  4Q36 A;  5AGE A;  4QBJ A;  2GE3 A;  2X7B A;  2Z3K A;  3GKR A;  3JUW A;  1KZF A;  1I1D A;  1U6M A;  3IU1 A;  4MY3 A;  3C26 A;  2YNE A;  1KUX A;  4NF1 A;  4CYO A;  1YRE A;  2BL1 A;  2VEZ A;  4JLY A;  4RI1 A;  3IWE A;  4YRH A;  1TIQ A;  2O28 A;  3ZZI A;  4JD6 A;  3R96 A;  4CGN A;  4XPD C;  5H86 A;  3TOB A;  2D4O A;  5J8C A;  3I3G A;  1Z4E A;  1YVO A;  3TTH A;  2A4N A;  4Y49 C;  2HQY A;  2J8M A;  3F5B A;  4CYN A;  4MY0 A;  1BOB A;  4J3G A;  4KUB A;  4LUA A;  4B14 A;  1OZP A;  3T9Y A;  4C2X A;  2VQY A;  4OAE A;  3R95 A;  1YX0 A;  2QEC A;  4KVO E;  4E2A A;  4UCM A;  3TT2 A;  2R7H A;  3QAH A;  2B3U A;  5IX3 A;  1N71 A;  1S60 A;  4JXQ A;  2WUU A;  2BEI A;  4AVA A;  4A2Z A;  3PZJ A;  3D8P A;  4C7H A;  2REF A;  2G3T A;  2CXA A;  4B11 A;  4GS4 A;  1YK3 A;  2JEV A;  2ZXV A;  3JTK A;  2VZY A;  4UFX A;  2I00 A;  3P2H A;  1YGH A;  1M1D A;  5KTA A;  2B5G B;  4F6A A;  4BMH A;  1S7L A;  2H5M A;  2ZW7 A;  4CGM A;  2OZU A;  5DWM A;  4UWJ A;  4U9Z A;  3DNS A;  4AG7 A;  3S6H A;  2Z3N A;  1L0C A;  4JXR A;  2WPX A;  1Q2Y A;  5F49 A;  3NE7 A;  1KUV A;  4UFW A;  3F0A A;  3RYO A;  2OZG A;  2ZW4 A;  2Y0M A;  2WSA A;  2BUE A;  4KSA A;  1S7K A;  2Z0Z A;  4XPD B;  3A9L A;  1FY7 A;  2JLM A;  1SQH A;  3FRM A;  3EO4 A;  1XF8 A;  2HV2 A;  3EC4 A;  4MI4 A;  4MFP A;  2B4D B;  4MFZ A;  2CY2 A;  5AG4 A;  4PSW A;  4IF5 A;  3F8K A;  4AVC A;  2KCW A;  4IUS A;  4FD7 A;  1S5K A;  2NMT A;  4MBU A;  2OB0 A;  3DR8 A;  2DPT A;  5GCN A;  2F5I A;  3EY5 A;  3PP9 A;  2P6G A;  2RC4 A;  1I12 A;  4QVT A;  1B87 A;  5J8F A;  3R9G A;  2Z3P A;  2FL4 A;  3DDD A;  4U5Y A;  2WPW A;  3R9E A;  3H4Q A;  3H5Z A;  5KTD A;  5F48 A;  2J8N A;  4QC6 A;  4CGP A;  5EC4 A;  1MK4 A;  2B5G A;  2Z3M A;  2OZH A;  4Q38 A;  1S7F A;  4CAX A;  4CYQ A;  4KOY A;  2PC1 A;  3IU2 A;  3DR6 A;  5G20 A;  2OH1 A;  4MFJ A;  3VWD A;  3FYN A;  2VBQ A;  2ARH A;  1K4J A;  4KOU A;  4CAE A;  3B8G A;  2B3V A;  2PQ8 A;  2D4P A;  3MGD A;  5JPH A;  5AG7 A;  5I0C A;  5IV0 A;  3E0K A;  3QB8 A;  4XPL A;  1QSO A;  4CAF A;  2QIR A;  3W6X A;  4R3L A;  2B58 A;  2EUI A;  4MFQ A;  4HNW B;  3IGR A;  1B6B A;  1P4N A;  3LOD A;  1IIC A;  4PV6 A;  2B4D A;  4MFK A;  1QSR A;  4C2Y A;  4C2Z A;  1YLE A;  4C68 A;  2Q44 A;  1M4D A;  5KTC A;  2K5T A;  5HMN A;  3CXQ A;  2G3A A;  2OU2 A;  2FIW A;  2GIV A;  2I79 A;  4CRZ B;  5A28 A;  4A30 A;  4HKF A;  4KS9 A;  2BSW A;  4NCZ A;  5EBV A;  2R8V A;  3D3S A;  4LX9 A;  2EVN A;  4MJ8 A;  1M4G A;  4PK3 A;  2AE6 A;  3JVN A;  4YFJ A;  3GY9 A;  1RO5 A;  3N7Z A;  5G1Z A;  2FXF A;  1XEB A;  4FD4 A;  4U9Y A;  1IYK A;  2C27 A;  4BBH A;  4OAD A;  4F0X A;  4A95 A;  4ORF A;  4KZT A;  3EFA A;  4KOR A;  3VWE A;  2Q04 A;  4YGO A;  3K9U A;  2G0B A;  4A32 A;  4UFV A;  5AG6 A;  4A31 A;  5IB0 A;  2Q0Y A;  4M3S A;  4B5P B;  3PGP A;  3UY5 A;  2YNC C;  4ONU A;  3SXN A;  4DNC A;  2GAN A;  3OWC A;  1GHE A;  4XPK A;  4UWI A;  5A27 A;  3FNC A;  2YGW A;  1CM0 A;  4KOT A;  1QST A;  4FD6 A;  2PDO A;  4CGL A;  1LRZ A;  2PR8 A;  1I21 A;  3FIX A;  2HUZ A;  4EVY A;  1Q2D A;  4F0Y A;  1IYL A;  3S6G A;  4AVB A;  2Q7B A;  4H89 A;  2FSR A;  1PUA A;  2Z11 A;  4ZBG A;  5ISV A;  3D2M A;  2FIA A;  3KKW A;  2FCK A;  3D2P A;  1ON0 A;  4B13 A;  2FS5 A;  5C88 A;  4QB9 A;  4CGO A;  5E96 A;  2ZW5 A;  4KLV A;  2P0W A;  2JDC A;  4XNH B;  4UCP A;  3LD2 A;  4B12 A;  2FT0 A;  3BJ8 A;  2FE7 A;  3GYA A;  4KOW A;  5JQ4 A;  5FVJ A;  4X5K A;  3R9F A;  2CNM A;  2VXK A;  4KVX A;  1V0C A;  3P2F A;  3ZJ0 A;  2P6F A;  5BWA B;  1M44 A;  5AG5 A;  1MJA A;  5F46 A;  1MJ9 A;  2P6E A;  4UBR A;  4B5P A;  2Q4V A;  5C82 A;  3CXS A;  1ZO0 A;  2PR1 A;  1IID A;  3TOA A;  2DXQ A;  3FB3 A;  3BJ7 A;  1P0H A;  1Z9U A;  2B4B A;  4C7I A;  1J4J A;  4CS0 B;  4KSF A;  5G22 A;  3TO9 A;  1M4I A;  1S7N A;  3CXP A;  2ZW6 A;  5CNP A;  1XMT A;  2ZPA A;  2R1I A;  3BLN A;  3S6K A;  3W91 A;  3V8I A;  3I9S A;  4RS2 A;  2Z10 A;  3IWG A;  4KOX A;  4B10 A;  4E0A A;  3DSB A;  1S3Z A;  4XNH C;  2R98 A;  4FD5 A;  2PSW A;  2QML A;  3T90 A;  3FXT A;  4K30 A;  2ATR A;  4CAV A;  4NSQ A;  1NMT A;  4B5O A;  1VKC A;  3FBU A;  3TO7 A;  4II9 A;  2REE A;  4R3K A;  4CRY B;  3TFY A;  4KLW A;  4R57 A;  3TCV A;  2Z3L A;  4QUS A;  1Z4R A;  4KOV A;  5G21 A;  4MFL A;  2DPS A;  2VI7 A;  4R9M A;  4ZGY B;  3SXO A;  1VHS A;  1KUY A;  1NSL A;  4NXY A;  4KUA A;  4HNY B;  3W6S A;  1QSN A;  4CYP A;  4E8O A;  4JJX A;  4MHD A;  3EXN A;  1BO4 A;  4I49 A;  5F47 A;  4L8A A;  2VZZ A;  2Q4Y A;  2YNC A;  3TE4 A;  4H6Z A;  4JWP A;  4CAW A;  3G8W A;  2J8R A;  4HNX B;  5DWN A;  1XIX A;  4R87 A;  2PRB A;  4M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...