5C82A

Crystal structure of nourseothricin acetyltransferase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
170
Chain Sequence
TAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDPDSRTFVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTLCGLDTALYDGTASDGEQALYMSMPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Nourseothricin acetyltransferase
rcsb
source organism Streptomyces noursei
molecule tags Transferase
molecule keywords Nourseothricin acetyltransferase
total genus 39
structure length 170
sequence length 183
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c82A00
2Y0MA 1YGHA 3R9GA 4KVOE 1CM0A 1MJBA 2R98A 1VKCA 4KOUA 4CRZB 4E2AA 5FVJA 2J8MA 4KOTA 4B5PB 1PU9A 2GE3A 1XIXA 2REEA 4B5PA 1GHEA 2CY2A 3EC4A 2JDDA 5JPHA 2R7HA 3OWCA 3R96A 2P6EA 4AG9A 4ORFA 3SXOA 3T9YA 3F0AA 5DWMA 3VWDA 4CAWA 5JQ4A 4R3KA 4HNXB 3EY5A 2GIVA 3R1KA 2REFA 4F0YA 3H4QA 5GCNA 2OZUA 4JXQA 5J8FA 1QSRA 4MHDA 2K5TA 4AVBA 2Q0YA 1BOBA 2QIRA 4EVYA 3IWGA 1YX0A 1Y9WA 4PK2A 3CXQA 4AVAA 2G0BA 2D4OA 1S7FA 2OU2A 4FD5A 2AJ6A 4QUSA 2FCKA 1YVOA 5IX3A 4B5OA 5CNPA 4NSQA 2O28A 3N7ZA 5DWNA 4R87A 4II9A 1M4DA 3ZJ0A 1L0CA 2BL1A 1CJWA 3TT2A 4HNYB 3R95A 2FIAA 5C88A 1KUVA 3DNSA 1XMTA 1YLEA 3DSBA 1TIQA 4IF5A 1LRZA 3UY5A 3W6XA 4NF1A 2FL4A 1YK3A 2P0WA 4KVXA 3FIXA 3VWEA 1B87A 2PC1A 3TOBA 1WK4A 3FBUA 4RS2A 4JWPA 4J3GA 2EVNA 2ARHA 2JDCA 2JLMA 3S6HA 4MY3A 2Z11A 2GANA 3I9SA 2B5GA 4FD6A 1Y7RA 4XNHB 2OZHA 5HH1A 1XEBA 2Z0ZA 3W6SA 3S6GA 2FXFA 3MGDA 3JVNA 2Z10A 4L89A 3R9EA 2ZXVA 5EBVA 5IB0A 3TO7A 4NXYA 1QSMA 2ZW7A 1NSLA 2CNMA 3TCVA 2PQ8A 1M44A 1Q2CA 3RYOA 1Z4EA 4UA3A 4ONUA 1I12A 1IYLA 2X7BA 5KTAA 4HNWB 3S6FA 4ZBGA 3F8KA 2FT0A 2B3VA 1Y9KA 1WWZA 1I21A 3F5BA 1FY7A 2J8NA 5IV0A 1MK4A 2B5GB 3BLNA 4CAVA 4Y49B 4AVCA 2HV2A 4PSWA 1S7LA 1RXTA 4UBRA 4F6AA 3CXPA 4KORA 4NCZA 1MJAA 1S7KA 4KOYA 4KOSA 1XF8A 2D4PA 3FNCA 3EXNA 2ZW6A 4CAXA 2RC4A 2Q4VA 4H6UA 3CXSA 3QAHA 4MI4A 2H5MA 1IICA 1Q2DA 3TFYA 3EO4A 2G3AA 4CS0B 2VZZA 4QB9A 4AG7A 4KOWA 5F49A 1S60A 3B8GA 1S5KA 3TE4A 3BJ7A 2VBQA 3GKRA 2G3TA 4PSXA 2B3UA 2PDOA 4MBUA 3TTHA 2PRBA 5F48A 2QECA 3W91A 1Z9UA 3D2MA 2HUZA 2I00A 3LODA 4R9MA 3BJ8A 4MJ8A 2QMLA 2BEIA 1YVKA 4X5KA 4XPDB 1M1DA 2P6FA 1Z4RA 2A4NA 2B4BA 2CNSA 3C26A 2ZW4A 2OZGA 2B4DA 3IGRA 3K9UA 1Q2YA 1MJ9A 1UFHA 4DNCA 4H89A 5F46A 3FXTA 2EUIA 1P0HA 3PP9A 2DXQA 5C82A 3QB8A 4LUAA 2Q7BA 4CRYB 4GS4A 3KKWA 4E0AA 3D8PA 4IUSA 4MY0A 2Q04A 4XNHC 2BUEA 1ON0A 4PV6A 1S3ZA 1RO5A 4AB7A 1R57A 1U6MA 1YREA 2I79A 2VZYA 4Y49C 2J8RA 3LD2A 1QSTA 4PK3A 3FRMA 4R57A 1IYKA 4FD7A 2JEVA 3TOAA 3P2FA 3D3SA 3PGPA 5H86A 1V0CA 1KUXA 2CNTA 2NMTA 4I49A 1XE4A 1OZPA 4KVME 4BMHA 1KUYA 2B4DB 5HMNA 3R9FA 4KOVA 5KTDA 3FB3A 4YFJA 3I3GA 4K30A 3WR7A 2OB0A 2WPWA 2BSWA 2Q4YA 3G3SA 1NMTA 3GYAA 1NE9A 2VQYA 4JXRA 4KOXA 2IL4A 2PSWA 4KLWA 1P4NA 3S6KA 4FD4A 3JUWA 4OLLA 3TO6A 2PR1A 4L8AA 4KLVA 3FYNA 4HKFA 1M4IA 2R1IA 4XPKA 2OH1A 4XPDC 5KTCA 2WPXA 4KZTA 2VEZA 2VI7A 3PZJA 1IIDA 4UWJA 4KUAA 3TO9A 2FSRA 4JD6A 4JLYA 3EFAA 4U9YA 2FE7A 3SHPA 1M4GA 4RI1A 4R3LA 1J4JA 4UWIA 2C27A 5E96A 3V8IA 2KCWA 5I0CA 3NE7A 2PR8A 2B58A 2VXKA 3G8WA 3P2HA 1YR0A 4LX9A 3DR8A 4M85A 2FS5A 2ZW5A 5H84A 4OAEA 3DR6A 1QSNA 2HQYA 1KZFA 5J8CA 1K4JA 1QSOA 5EC4A 4M3SA 4E8OA 1IB1E 1PUAA 4QC6A 1N71A 2R8VA 4QVTA 4H6ZA 4U5YA 3SXNA 1S7NA 4YGOA 1VHSA 3E0KA 1BO4A 4OADA 4KUBA 2ATRA 1SQHA 3DDDA 3T90A 2Q44A 4QBJA 5ISVA 4XPLA 3ZZIA 2F5IA 4NEXA 4U9ZA 4JJXA 2ZPAA 3GY9A 5F47A 2FIWA 3D2PA 1I1DA 2P6GA 4YRHA 1B6BA 2AE6A
chains in the Genus database with same CATH superfamily
2Y0MA 4KSFA 3D7DA 1YGHA 4BBHA 3R9GA 1YW4A 3KHXA 2EBJA 4KVOE 1CM0A 4ZGYB 3FVLA 1MJBA 2R98A 2J9AA 1IOIA 5HVFA 1VKCA 4KOUA 4MFLA 4CRZB 5FVJA 4E2AA 1LFWA 5K8PA 5G22A 4B11A 3SI2A 2J8MA 3CZXA 4KOTA 4B5PB 4MCRA 1LCPA 1PU9A 2VL1A 2GE3A 1XIXA 2REEA 2WZNA 4B5PA 4KSAA 1GHEA 3LMSA 5HVGA 3WABA 2CY2A 3EC4A 1ZG7A 2JDDA 2O53A 5LRJA 5JPHA 1YQEA 2R7HA 5D29A 4NGRA 3OWCA 3PB8X 1FNOA 3K2KA 3R96A 2XEFA 3D66A 3PB6X 3RNZA 1CBXA 2ANPA 2P6EA 3IEHA 4AG9A 4ORFA 4P10A 3SXOA 3T9YA 3F0AA 5DWMA 2PJ4A 3VWDA 4CAWA 4MCPA 4R3KA 4CGNA 4HNXB 1DE4C 4MMOA 5IB9A 5JQ4A 1R43A 3EY5A 2F8HA 4OC4A 2GIVA 3R1KA 2REFA 4F0YA 3H4QA 1F2PA 5GCNA 2PJ5A 2OZUA 4JXQA 5J8FA 1QSRA 2PJCA 4A38A 4MHDA 2ZOFA 2K5TA 4GM5A 3FX6A 4AVBA 2Q0YA 1BOBA 2QIRA 4EVYA 1YLOA 3QNVA 3IWGA 3PBBA 1YX0A 1Y9WA 3H8FA 4PK2A 4OP4A 1TKJA 3CXQA 1AYEA 3LWUA 4AVAA 2G0BA 2Z3NA 2D4OA 1S7FA 2OU2A 2ZEEA 2AJ6A 3FF3A 3KZWA 4FD5A 4FUUA 4QUSA 4CAFA 4CYNA 2FCKA 2QVPA 2YNDA 1YVOA 2Q4ZA 5IX3A 4B5OA 5CNPA 4NSQA 2O28A 3N7ZA 5DWNA 3PB9X 2PVWA 3NA6A 4R87A 4O23A 5A27A 4P4BA 1Z8WA 2ZEHA 5DS0A 4II9A 5A28A 1JWQA 3IFEA 4UFVA 1M4DA 3ZJ0A 1L0CA 2BL1A 1CJWA 3VATA 3TT2A 3TC8A 4HNYB 3R95A 2FIAA 5C88A 1KUVA 3DNSA 2PJ7A 4MFKA 4MFQA 2FVGA 1XMTA 1YLEA 3DSBA 3JRUA 1TIQA 2WSAA 1LRZA 4IF5A 4NGTA 3UY5A 3W6XA 2XEIA 3BI1A 2ABZA 2FL4A 1YK3A 4NF1A 2P0WA 3D68A 3KHZA 2PJ1A 5JGFA 1GYTA 3NH5A 4KVXA 3FIXA 1LAPA 3VWEA 1B87A 2PC1A 1QMUA 3TOBA 1WK4A 3FECA 3FBUA 4PPZA 2Q51A 1HDUA 4RS2A 4JWPA 2AFMA 4J3GA 2EVNA 1F2OA 2GREA 2AFZA 2ARHA 3H8EA 4LQGA 4A94A 5LRKA 2JDCA 3S9NA 2JLMA 4A37A 4G1PA 1R3NA 5AG7A 3S6HA 4MY3A 3H8GA 4EFDA 2G9DA 2WYRA 2QJ8A 2Z11A 1Y7EA 2GANA 4FBEA 2B5GA 3I9SA 4A30A 4FD6A 4LQ6A 1AMPA 4A33A 1Y7RA 4XNHB 2OZHA 2CTCA 5HH1A 4DYOA 4R76A 2OR4A 1XEBA 3DLJA 4CGPA 2Z0ZA 4PXEA 5AG4A 3NH8A 4YU9A 3W6SA 3S6GA 4B12A 4UCPA 2FXFA 1BLLE 3MGDA 3JVNA 3WC6A 4F8ZA 4P6YA 2Z10A 4L89A 3R9EA 3D4UA 2ZXVA 1VHEA 3PBEA 4MCQA 5AGEA 4CGOA 5EBVA 4F9VA 1PYTB 5IB0A 3D7FA 4K3NA 1JQGA 4UFWA 3VH9A 3TO7A 2XEJA 4NXYA 1QSMA 4C2XA 2ZW7A 3RAMA 2ZEDA 2EK8A 1NSLA 2EK9A 2CNMA 3BXMA 2BO9A 3SI1A 3TCVA 2PQ8A 4OC3A 5G20A 1M44A 2BCOA 1Q2CA 4B14A 4WJBA 2PRQA 4UEFA 1Z2LA 3RYOA 1Z4EA 4UA3A 2WUUA 4ONUA 4P45A 1I12A 1IYLA 2X7BA 5KTAA 5K8NA 4HNWB 3S6FA 4ZBGA 3F8KA 2FT0A 3V38A 4UIAA 5D8NA 2B3VA 1Y9KA 1WWZA 4X2TA 4OIWA 2CIJA 1I21A 1NSAA 3F5BA 4DJLA 1FY7A 1CPXA 2J8NA 5IV0A 3WT4A 1MK4A 2CF4A 1ARMA 6CPAA 2B5GB 3BLNA 4CAVA 4Y49B 4AVCA 3B3TA 4JYWA 2HV2A 4PSWA 3B2YA 1QQ9A 1S7LA 1BAVA 1RXTA 2PCUA 4OKOA 4UBRA 3CXPA 4KORA 2Q7SA 4F6AA 4NCZA 1MJAA 7CPAA 1S7KA 4KOYA 3S9MA 4KOSA 3WC5A 5AG5A 1XF8A 2D4PA 1ZLHA 3FNCA 3EXNA 2ZW6A 3CDXA 4ZX8A 4CAXA 3V7ZA 2RC4A 5THWA 2Q4VA 4H6UA 3CXSA 3QAHA 2CXAA 4MI4A 2H5MA 2PJ8A 4MXUA 1IICA 2C1CA 4UFXA 2C6CA 2PJ9A 3ISXA 4OC2A 5K8MA 1Q2DA 4MHZA 2GLJA 5CPAA 3TFYA 4CYQA 3EO4A 2G3AA 4OC1A 4CS0B 2IQ6A 4EMEA 2VZZA 3ISZA 4QB9A 4KOWA 2ODFA 4AG7A 3GIUA 1VGYA 1Q7LA 3PRTA 4CPAA 1UWYA 5F49A 1S60A 4Z65A 3B8GA 1Z8TA 2CTBA 3CPXA 4UEZA 5LRGA 1S5KA 3D7HA 3TE4A 4R6TA 3RO0A 4A2ZA 2O4HA 2POKA 2DF5A 2VBQA 2RB7A 2ZEMA 3BJ7A 3GKRA 2G3TA 2ZEPA 4FAIA 3IIBA 4NJQA 4PSXA 2B3UA 2NYQA 4ZX9A 2ZEOA 2PIYA 4EWTA 2PDOA 4MBUA 3TTHA 4TNUA 2PE3A 3BHXA 2PRBA 2F7VA 5K8OA 3IC1A 1X12A 5F48A 2AFUA 1TKHA 2QECA 4MFZA 5G1ZA 4P44A 3W91A 2HC9A 1Z9UA 2BOAA 3B3VA 1XFOA 3D2MA 2HUZA 2I00A 2PJAA 3LODA 4R9MA 3MN8A 3BJ8A 4MJ8A 4UIBA 2QMLA 2BEIA 1YVKA 4X5KA 2Z3OA 4XPDB 1M1DA 4ZYQA 1H8LA 1VIXA 4P4IA 2HB6A 2P6FA 4Q7AA 1Z4RA 2A4NA 2B4BA 2CNSA 4CYPA 3C26A 2ZW4A 3B3WA 2OZGA 4C7IA 2PJ2A 4IAVA 1Y0YA 2B4DA 3IGRA 3K9UA 4P4DA 1Q2YA 3NFZA 1MJ9A 1UFHA 4DNCA 1YMEA 4HPSA 2V8GA 2I3CA 4H89A 2C6GA 1YSJA 1XRYA 2PJBA 5F46A 5HVHA 2AFXA 2EWBA 2V8HA 3FXTA 5F09A 2JBKA 4MFPA 2JBJA 3RZAA 1PCAA 4Q38A 2EUIA 1P0HA 3NE8A 3KQZA 4B10A 1A2ZA 3PP9A 2DXQA 4UF4A 5C82A 3GB0A 3RBUA 3QB8A 4LUAA 1RTQA 2Q7BA 4C7HA 1ZLIA 4CRYB 1IU8A 4GS4A 4M6HA 3KKWA 4E0AA 1DTDA 4CGMA 4A32A 2QYVA 3L2NA 4OC0A 1HDQA 2AFWA 3SJGA 2EO8A 3D8PA 4IUSA 1X10A 4MY0A 2Q04A 3D67A 4XNHC 2BUEA 3CT9A 1ON0A 1TXRA 1F57A 2V8DA 1ARLA 4PV6A 4AXVA 1S3ZA 1AUGA 5LYDA 4M6GA 3FJUA 1RO5A 4AB7A 1R57A 4BD9A 2DPSA 2Z3MA 4A39A 1U6MA 1Z8LA 1YREA 3B3CA 1LANA 1TF8A 2I79A 2VZYA 4PXBA 4Y49C 5LYIA 2PJ3A 1Y0RA 4CYOA 1ZG9A 2J8RA 3LD2A 1QSTA 4PK3A 3FRMA 4A95A 2AFSA 3FEDA 4R57A 1IYKA 3KL9A 4FD7A 3SJEA 2JEVA 3TOAA 3P2FA 2YNCC 3D3SA 1Z8XA 3PGPA 4OMEA 4GXHA 2JEWA 3DGVA 2NSMA 5H86A 1V0CA 1KUXA 2CNTA 2NMTA 4I49A 1XE4A 1OZPA 4KVME 3KR5A 2ZEFA 4MHNA 4UEEA 4BMHA 3IU1A 1KUYA 1EE3P 3JTKA 2Z3LA 3K9TA 2B4DB 2ZEGA 3KQXA 3IWWA 4W9YA 1ZG8A 5HMNA 3R9FA 4KOVA 5KTDA 3PEIA 5JH9A 5LYLA 4NGNA 2Z3KA 3FB3A 2IJZA 4B6ZA 2PJ0A 5J1QA 4TWEA 4YFJA 3I3GA 4K30A 2PVVA 3WR7A 2OB0A 3WC7A 3KASA 2WPWA 2BSWA 2Q4YA 3G3SA 1NMTA 3GYAA 4C2YA 5CBMA 4C68A 1NE9A 2PIZA 4M6IA 2VQYA 4NJRA 4PXDA 4JXRA 2DPTA 1CX8A 1XOVA 2RFHA 4KOXA 3KGQA 2IL4A 3N5FA 4ZY0A 2PSWA 3PFEA 4MFJA 4RN7A 5AG6A 4KLWA 1P4NA 4KSIA 2ZENA 3S6KA 4FD4A 4ZI6A 3CPAA 3B3SA 3B35A 3LACA 4A31A 3JUWA 4OLLA 1ELLP 3VARA 3IWEA 3IO1A 3TX8A 2V8VA 2C6PA 2ZOGA 3TO6A 4WWVA 2PR1A 3QAYA 4OC5A 1CG2A 4R8FA 4L8AA 4RUHA 5HXDA 1M4LA 4KLVA 1BPMA 1IY7A 3FYNA 4ONWA 4CAEA 4F9UA 2GLFA 5I4MA 4HKFA 1M4IA 2R1IA 4R7MA 1CP6A 3HLPA 4XPKA 2YNEA 4X8IA 2OH1A 4XPDC 2Z3PA 2WPXA 5KTCA 4KZTA 1FT7A 2VEZA 2VI7A 3FMCA 3PZJA 4X3RA 1IIDA 2ZELA 4UWJA 4KUAA 3TO9A 5BWAB 4NGSA 2FSRA 4JD6A 4JLYA 3GLJA 4CGLA 3EFAA 4U9YA 2FE7A 3FEEA 5ELYA 4MHYA 3SHPA 1M4GA 3S9LA 2AFOA 5LYFA 4NFRA 1CPSA 4RI1A 4R3LA 1J4JA 4UWIA 2C27A 4OIDA 4MHPA 5E96A 1XBUA 4ZY2A 2KCWA 2YNCA 3V8IA 5I0CA 3D7GA 3H5ZA 4P4EA 4IK2A 1XJOA 2PR8A 3NE7A 2B58A 4P4FA 2V77A 2VXKA 3NH4A 1ELMP 1VHOA 2GU2A 3G8WA 3P2HA 1YR0A 4LX9A 3SJFA 1TF9A 3DR8A 4M85A 2FS5A 2ZW5A 5H84A 4OAEA 3DR6A 1QSNA 3IJ3A 4IHMA 4FWUA 4YWYA 3IU2A 1TKFA 4BINA 3KR4A 3GUXA 1IOFA 1CP7A 1HEEA 1KZFA 1LOKA 2HQYA 5G21A 5J8CA 4UCMA 1K4JA 4B13A 1QSOA 4KS9A 5EC4A 3I1UA 4M3SA 4Q36A 2IMOA 2DEAA 4PQAA 4UCNA 2OOTA 4E8OA 1IB1E 4H2KA 3PFOA 4MCSA 1PUAA 4QC6A 1N71A 2XEGA 2R8VA 1KWMA 4QVTA 4NGPA 3B7IA 8CPAA 4H6ZA 4U5YA 3SXNA 1S7NA 4YGOA 1VHSA 1ZO0A 3SI0A 3E0KA 1BO4A 1Z5RA 1XMBA 4OADA 4JZ0A 4KUBA 4DUKA 2ATRA 3T8WA 1SQHA 3PB4X 4NGQA 3DDDA 3SJXA 2YGWA 4MRIA 5JM6A 3T90A 2Q44A 3BI0A 4QBJA 1IGBA 3FH4A 4F0XA 5ISVA 4XPLA 3ZZIA 1YW6A 2GFQA 2F5IA 2Q43A 3PB7X 4NEXA 4C2ZA 4U9ZA 1LAMA 3A9LA 3HUVA 4JJXA 2ZPAA 3GY9A 5F47A 2PJ6A 2FIWA 3D2PA 3MRUA 4P4JA 3KI9A 1I1DA 1BPNA 4ZY1A 2P6GA 4YRHA 1B6BA 2AE6A 1OBRA 4NGMA 4PXCA 5EMIA
chains in the Genus database with same CATH topology
2Y0MA 4KSFA 1YGHA 4BBHA 3R9GA 4ZGYB 4KVOE 1CM0A 1MJBA 2R98A 1VKCA 4KOUA 4MFLA 4CRZB 5FVJA 4E2AA 5G22A 4B11A 2J8MA 4KOTA 4B5PB 1PU9A 2GE3A 1XIXA 2REEA 4B5PA 4KSAA 1GHEA 2CY2A 3EC4A 2JDDA 5JPHA 2R7HA 3OWCA 3R96A 2P6EA 4AG9A 4ORFA 3SXOA 3T9YA 3F0AA 5DWMA 3VWDA 4CAWA 5JQ4A 4CGNA 4R3KA 4HNXB 3EY5A 2GIVA 3R1KA 2REFA 4F0YA 3H4QA 5GCNA 2OZUA 4JXQA 5J8FA 1QSRA 4MHDA 2K5TA 4AVBA 2Q0YA 1BOBA 2QIRA 4EVYA 3IWGA 1YX0A 1Y9WA 4PK2A 3CXQA 4AVAA 2G0BA 2Z3NA 2D4OA 1S7FA 2OU2A 4FD5A 2AJ6A 5G1ZA 4QUSA 4CAFA 4CYNA 2FCKA 2YNDA 1YVOA 5IX3A 4B5OA 5CNPA 4NSQA 2O28A 3N7ZA 5DWNA 4R87A 5A27A 4II9A 5A28A 4UFVA 1M4DA 3ZJ0A 1L0CA 2BL1A 1CJWA 3TT2A 4HNYB 3R95A 2FIAA 5C88A 1KUVA 3DNSA 4MFKA 4MFQA 1XMTA 1YLEA 3DSBA 1TIQA 2WSAA 1LRZA 4IF5A 3UY5A 3W6XA 4NF1A 2FL4A 1YK3A 2P0WA 4KVXA 3FIXA 3VWEA 1B87A 2PC1A 3TOBA 1WK4A 3FBUA 4RS2A 4JWPA 4J3GA 2EVNA 2ARHA 2JDCA 2JLMA 5AG7A 3S6HA 4MY3A 2Z11A 2GANA 3I9SA 2B5GA 4A30A 4FD6A 4A33A 1Y7RA 4XNHB 2OZHA 5HH1A 1XEBA 4CGPA 2Z0ZA 5AG4A 3W6SA 3S6GA 4B12A 4UCPA 2FXFA 3MGDA 3JVNA 2Z10A 4L89A 3R9EA 2ZXVA 5AGEA 4CGOA 5EBVA 5IB0A 4UFWA 3TO7A 4NXYA 1QSMA 4C2XA 2ZW7A 1NSLA 2CNMA 3TCVA 2PQ8A 5G20A 1M44A 1Q2CA 4B14A 3RYOA 1Z4EA 4UA3A 2WUUA 4ONUA 1I12A 1IYLA 2X7BA 5KTAA 4HNWB 3S6FA 4ZBGA 3F8KA 2FT0A 2B3VA 1Y9KA 1WWZA 1I21A 3F5BA 1FY7A 2J8NA 5IV0A 1MK4A 2B5GB 3BLNA 4CAVA 4Y49B 4AVCA 2HV2A 4PSWA 1S7LA 1RXTA 4UBRA 4F6AA 3CXPA 4KORA 4NCZA 1MJAA 1S7KA 4KOYA 4KOSA 5AG5A 1XF8A 2D4PA 3FNCA 3EXNA 2ZW6A 4CAXA 2RC4A 2Q4VA 4H6UA 3CXSA 3QAHA 2CXAA 4MI4A 2H5MA 1IICA 4UFXA 1Q2DA 3TFYA 4CYQA 3EO4A 2G3AA 4CS0B 2VZZA 4QB9A 4AG7A 4KOWA 5F49A 1S60A 3B8GA 1S5KA 3TE4A 4A2ZA 3BJ7A 2VBQA 3GKRA 2G3TA 4PSXA 2B3UA 2PDOA 4MBUA 3TTHA 2PRBA 5F48A 4MFZA 2QECA 3W91A 1Z9UA 3D2MA 2HUZA 2I00A 3LODA 4R9MA 3BJ8A 4MJ8A 2QMLA 2BEIA 1YVKA 4X5KA 2Z3OA 4XPDB 1M1DA 2P6FA 4CYPA 1Z4RA 2A4NA 2B4BA 2CNSA 3C26A 2ZW4A 2OZGA 4C7IA 2B4DA 3IGRA 3K9UA 1Q2YA 1MJ9A 1UFHA 4DNCA 4H89A 5F46A 3FXTA 4MFPA 4Q38A 2EUIA 1P0HA 4B10A 3PP9A 2DXQA 5C82A 3QB8A 4LUAA 4C7HA 2Q7BA 4CRYB 4GS4A 3KKWA 4E0AA 4CGMA 4A32A 3D8PA 4IUSA 4MY0A 2Q04A 4XNHC 2BUEA 1ON0A 4PV6A 1S3ZA 1RO5A 4AB7A 1R57A 2DPSA 2Z3MA 1U6MA 1YREA 2I79A 2VZYA 4Y49C 4CYOA 2J8RA 3LD2A 1QSTA 4PK3A 3FRMA 4A95A 4R57A 1IYKA 4FD7A 2JEVA 3TOAA 3P2FA 2YNCC 3D3SA 3PGPA 5H86A 1V0CA 1KUXA 2CNTA 2NMTA 4I49A 1XE4A 1OZPA 4KVME 4BMHA 3IU1A 1KUYA 3JTKA 2Z3LA 2B4DB 5HMNA 3R9FA 4KOVA 5KTDA 2Z3KA 3FB3A 4YFJA 3I3GA 4K30A 3WR7A 2OB0A 2WPWA 2BSWA 2Q4YA 3G3SA 1NMTA 3GYAA 4C2YA 4C68A 1NE9A 2VQYA 4JXRA 2DPTA 4KOXA 2IL4A 2PSWA 4MFJA 5AG6A 4KLWA 1P4NA 3S6KA 4FD4A 4A31A 3JUWA 4OLLA 3IWEA 3TO6A 2PR1A 4L8AA 4KLVA 3FYNA 4CAEA 4HKFA 1M4IA 2R1IA 4XPKA 2YNEA 2OH1A 4XPDC 2Z3PA 2WPXA 5KTCA 4KZTA 2VEZA 2VI7A 3PZJA 1IIDA 4UWJA 4KUAA 3TO9A 5BWAB 2FSRA 4JD6A 4JLYA 4CGLA 3EFAA 4U9YA 2FE7A 3SHPA 1M4GA 4RI1A 4R3LA 1J4JA 4UWIA 2C27A 5E96A 3V8IA 2KCWA 2YNCA 5I0CA 3H5ZA 3NE7A 2PR8A 2B58A 2VXKA 3G8WA 3P2HA 1YR0A 4LX9A 3DR8A 4M85A 2FS5A 2ZW5A 5H84A 4OAEA 3DR6A 1QSNA 3IU2A 2HQYA 1KZFA 5J8CA 5G21A 4UCMA 1K4JA 4B13A 1QSOA 4KS9A 5EC4A 4M3SA 4Q36A 4UCNA 4E8OA 1IB1E 1PUAA 4QC6A 1N71A 2R8VA 4QVTA 4H6ZA 4U5YA 3SXNA 1S7NA 4YGOA 1VHSA 1ZO0A 3E0KA 1BO4A 4OADA 4KUBA 2ATRA 1SQHA 3DDDA 2YGWA 3T90A 2Q44A 4QBJA 4F0XA 5ISVA 4XPLA 3ZZIA 2F5IA 4NEXA 4C2ZA 4U9ZA 3A9LA 4JJXA 2ZPAA 3GY9A 5F47A 2FIWA 3D2PA 1I1DA 2P6GA 4YRHA 1B6BA 2AE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0M A;  1YGH A;  3R9G A;  4KVO E;  1CM0 A;  1MJB A;  2R98 A;  1VKC A;  4KOU A;  4CRZ B;  4E2A A;  5FVJ A;  2J8M A;  4KOT A;  4B5P B;  1PU9 A;  2GE3 A;  1XIX A;  2REE A;  4B5P A;  1GHE A;  2CY2 A;  3EC4 A;  2JDD A;  5JPH A;  2R7H A;  3OWC A;  3R96 A;  2P6E A;  4AG9 A;  4ORF A;  3SXO A;  3T9Y A;  3F0A A;  5DWM A;  3VWD A;  4CAW A;  5JQ4 A;  4R3K A;  4HNX B;  3EY5 A;  2GIV A;  3R1K A;  2REF A;  4F0Y A;  3H4Q A;  5GCN A;  2OZU A;  4JXQ A;  5J8F A;  1QSR A;  4MHD A;  2K5T A;  4AVB A;  2Q0Y A;  1BOB A;  2QIR A;  4EVY A;  3IWG A;  1YX0 A;  1Y9W A;  4PK2 A;  3CXQ A;  4AVA A;  2G0B A;  2D4O A;  1S7F A;  2OU2 A;  4FD5 A;  2AJ6 A;  4QUS A;  2FCK A;  1YVO A;  5IX3 A;  4B5O A;  5CNP A;  4NSQ A;  2O28 A;  3N7Z A;  5DWN A;  4R87 A;  4II9 A;  1M4D A;  3ZJ0 A;  1L0C A;  2BL1 A;  1CJW A;  3TT2 A;  4HNY B;  3R95 A;  2FIA A;  5C88 A;  1KUV A;  3DNS A;  1XMT A;  1YLE A;  3DSB A;  1TIQ A;  4IF5 A;  1LRZ A;  3UY5 A;  3W6X A;  4NF1 A;  2FL4 A;  1YK3 A;  2P0W A;  4KVX A;  3FIX A;  3VWE A;  1B87 A;  2PC1 A;  3TOB A;  1WK4 A;  3FBU A;  4RS2 A;  4JWP A;  4J3G A;  2EVN A;  2ARH A;  2JDC A;  2JLM A;  3S6H A;  4MY3 A;  2Z11 A;  2GAN A;  3I9S A;  2B5G A;  4FD6 A;  1Y7R A;  4XNH B;  2OZH A;  5HH1 A;  1XEB A;  2Z0Z A;  3W6S A;  3S6G A;  2FXF A;  3MGD A;  3JVN A;  2Z10 A;  4L89 A;  3R9E A;  2ZXV A;  5EBV A;  5IB0 A;  3TO7 A;  4NXY A;  1QSM A;  2ZW7 A;  1NSL A;  2CNM A;  3TCV A;  2PQ8 A;  1M44 A;  1Q2C A;  3RYO A;  1Z4E A;  4UA3 A;  4ONU A;  1I12 A;  1IYL A;  2X7B A;  5KTA A;  4HNW B;  3S6F A;  4ZBG A;  3F8K A;  2FT0 A;  2B3V A;  1Y9K A;  1WWZ A;  1I21 A;  3F5B A;  1FY7 A;  2J8N A;  5IV0 A;  1MK4 A;  2B5G B;  3BLN A;  4CAV A;  4Y49 B;  4AVC A;  2HV2 A;  4PSW A;  1S7L A;  1RXT A;  4UBR A;  4F6A A;  3CXP A;  4KOR A;  4NCZ A;  1MJA A;  1S7K A;  4KOY A;  4KOS A;  1XF8 A;  2D4P A;  3FNC A;  3EXN A;  2ZW6 A;  4CAX A;  2RC4 A;  2Q4V A;  4H6U A;  3CXS A;  3QAH A;  4MI4 A;  2H5M A;  1IIC A;  1Q2D A;  3TFY A;  3EO4 A;  2G3A A;  4CS0 B;  2VZZ A;  4QB9 A;  4AG7 A;  4KOW A;  5F49 A;  1S60 A;  3B8G A;  1S5K A;  3TE4 A;  3BJ7 A;  2VBQ A;  3GKR A;  2G3T A;  4PSX A;  2B3U A;  2PDO A;  4MBU A;  3TTH A;  2PRB A;  5F48 A;  2QEC A;  3W91 A;  1Z9U A;  3D2M A;  2HUZ A;  2I00 A;  3LOD A;  4R9M A;  3BJ8 A;  4MJ8 A;  2QML A;  2BEI A;  1YVK A;  4X5K A;  4XPD B;  1M1D A;  2P6F A;  1Z4R A;  2A4N A;  2B4B A;  2CNS A;  3C26 A;  2ZW4 A;  2OZG A;  2B4D A;  3IGR A;  3K9U A;  1Q2Y A;  1MJ9 A;  1UFH A;  4DNC A;  4H89 A;  5F46 A;  3FXT A;  2EUI A;  1P0H A;  3PP9 A;  2DXQ A;  5C82 A;  3QB8 A;  4LUA A;  2Q7B A;  4CRY B;  4GS4 A;  3KKW A;  4E0A A;  3D8P A;  4IUS A;  4MY0 A;  2Q04 A;  4XNH C;  2BUE A;  1ON0 A;  4PV6 A;  1S3Z A;  1RO5 A;  4AB7 A;  1R57 A;  1U6M A;  1YRE A;  2I79 A;  2VZY A;  4Y49 C;  2J8R A;  3LD2 A;  1QST A;  4PK3 A;  3FRM A;  4R57 A;  1IYK A;  4FD7 A;  2JEV A;  3TOA A;  3P2F A;  3D3S A;  3PGP A;  5H86 A;  1V0C A;  1KUX A;  2CNT A;  2NMT A;  4I49 A;  1XE4 A;  1OZP A;  4KVM E;  4BMH A;  1KUY A;  2B4D B;  5HMN A;  3R9F A;  4KOV A;  5KTD A;  3FB3 A;  4YFJ A;  3I3G A;  4K30 A;  3WR7 A;  2OB0 A;  2WPW A;  2BSW A;  2Q4Y A;  3G3S A;  1NMT A;  3GYA A;  1NE9 A;  2VQY A;  4JXR A;  4KOX A;  2IL4 A;  2PSW A;  4KLW A;  1P4N A;  3S6K A;  4FD4 A;  3JUW A;  4OLL A;  3TO6 A;  2PR1 A;  4L8A A;  4KLV A;  3FYN A;  4HKF A;  1M4I A;  2R1I A;  4XPK A;  2OH1 A;  4XPD C;  5KTC A;  2WPX A;  4KZT A;  2VEZ A;  2VI7 A;  3PZJ A;  1IID A;  4UWJ A;  4KUA A;  3TO9 A;  2FSR A;  4JD6 A;  4JLY A;  3EFA A;  4U9Y A;  2FE7 A;  3SHP A;  1M4G A;  4RI1 A;  4R3L A;  1J4J A;  4UWI A;  2C27 A;  5E96 A;  3V8I A;  2KCW A;  5I0C A;  3NE7 A;  2PR8 A;  2B58 A;  2VXK A;  3G8W A;  3P2H A;  1YR0 A;  4LX9 A;  3DR8 A;  4M85 A;  2FS5 A;  2ZW5 A;  5H84 A;  4OAE A;  3DR6 A;  1QSN A;  2HQY A;  1KZF A;  5J8C A;  1K4J A;  1QSO A;  5EC4 A;  4M3S A;  4E8O A;  1IB1 E;  1PUA A;  4QC6 A;  1N71 A;  2R8V A;  4QVT A;  4H6Z A;  4U5Y A;  3SXN A;  1S7N A;  4YGO A;  1VHS A;  3E0K A;  1BO4 A;  4OAD A;  4KUB A;  2ATR A;  1SQH A;  3DDD A;  3T90 A;  2Q44 A;  4QBJ A;  5ISV A;  4XPL A;  3ZZI A;  2F5I A;  4NEX A;  4U9Z A;  4JJX A;  2ZPA A;  3GY9 A;  5F47 A;  2FIW A;  3D2P A;  1I1D A;  2P6G A;  4YRH A;  1B6B A;  2AE6 A; 
#chains in the Genus database with same CATH topology
 2Y0M A;  4KSF A;  3D7D A;  1YGH A;  4BBH A;  3R9G A;  1YW4 A;  3KHX A;  2EBJ A;  4KVO E;  1CM0 A;  4ZGY B;  3FVL A;  1MJB A;  2R98 A;  2J9A A;  1IOI A;  5HVF A;  1VKC A;  4KOU A;  4MFL A;  4CRZ B;  5FVJ A;  4E2A A;  1LFW A;  5K8P A;  5G22 A;  4B11 A;  3SI2 A;  2J8M A;  3CZX A;  4KOT A;  4B5P B;  4MCR A;  1LCP A;  1PU9 A;  2VL1 A;  2GE3 A;  1XIX A;  2REE A;  2WZN A;  4B5P A;  4KSA A;  1GHE A;  3LMS A;  5HVG A;  3WAB A;  2CY2 A;  3EC4 A;  1ZG7 A;  2JDD A;  2O53 A;  5LRJ A;  5JPH A;  1YQE A;  2R7H A;  5D29 A;  4NGR A;  3OWC A;  3PB8 X;  1FNO A;  3K2K A;  3R96 A;  2XEF A;  3D66 A;  3PB6 X;  3RNZ A;  1CBX A;  2ANP A;  2P6E A;  3IEH A;  4AG9 A;  4ORF A;  4P10 A;  3SXO A;  3T9Y A;  3F0A A;  5DWM A;  2PJ4 A;  3VWD A;  4CAW A;  4MCP A;  4R3K A;  4CGN A;  4HNX B;  1DE4 C;  4MMO A;  5IB9 A;  5JQ4 A;  1R43 A;  3EY5 A;  2F8H A;  4OC4 A;  2GIV A;  3R1K A;  2REF A;  4F0Y A;  3H4Q A;  1F2P A;  5GCN A;  2PJ5 A;  2OZU A;  4JXQ A;  5J8F A;  1QSR A;  2PJC A;  4A38 A;  4MHD A;  2ZOF A;  2K5T A;  4GM5 A;  3FX6 A;  4AVB A;  2Q0Y A;  1BOB A;  2QIR A;  4EVY A;  1YLO A;  3QNV A;  3IWG A;  3PBB A;  1YX0 A;  1Y9W A;  3H8F A;  4PK2 A;  4OP4 A;  1TKJ A;  3CXQ A;  1AYE A;  3LWU A;  4AVA A;  2G0B A;  2Z3N A;  2D4O A;  1S7F A;  2OU2 A;  2ZEE A;  2AJ6 A;  3FF3 A;  3KZW A;  4FD5 A;  4FUU A;  4QUS A;  4CAF A;  4CYN A;  2FCK A;  2QVP A;  2YND A;  1YVO A;  2Q4Z A;  5IX3 A;  4B5O A;  5CNP A;  4NSQ A;  2O28 A;  3N7Z A;  5DWN A;  3PB9 X;  2PVW A;  3NA6 A;  4R87 A;  4O23 A;  5A27 A;  4P4B A;  1Z8W A;  2ZEH A;  5DS0 A;  4II9 A;  5A28 A;  1JWQ A;  3IFE A;  4UFV A;  1M4D A;  3ZJ0 A;  1L0C A;  2BL1 A;  1CJW A;  3VAT A;  3TT2 A;  3TC8 A;  4HNY B;  3R95 A;  2FIA A;  5C88 A;  1KUV A;  3DNS A;  2PJ7 A;  4MFK A;  4MFQ A;  2FVG A;  1XMT A;  1YLE A;  3DSB A;  3JRU A;  1TIQ A;  2WSA A;  1LRZ A;  4IF5 A;  4NGT A;  3UY5 A;  3W6X A;  2XEI A;  3BI1 A;  2ABZ A;  2FL4 A;  1YK3 A;  4NF1 A;  2P0W A;  3D68 A;  3KHZ A;  2PJ1 A;  5JGF A;  1GYT A;  3NH5 A;  4KVX A;  3FIX A;  1LAP A;  3VWE A;  1B87 A;  2PC1 A;  1QMU A;  3TOB A;  1WK4 A;  3FEC A;  3FBU A;  4PPZ A;  2Q51 A;  1HDU A;  4RS2 A;  4JWP A;  2AFM A;  4J3G A;  2EVN A;  1F2O A;  2GRE A;  2AFZ A;  2ARH A;  3H8E A;  4LQG A;  4A94 A;  5LRK A;  2JDC A;  3S9N A;  2JLM A;  4A37 A;  4G1P A;  1R3N A;  5AG7 A;  3S6H A;  4MY3 A;  3H8G A;  4EFD A;  2G9D A;  2WYR A;  2QJ8 A;  2Z11 A;  1Y7E A;  2GAN A;  4FBE A;  2B5G A;  3I9S A;  4A30 A;  4FD6 A;  4LQ6 A;  1AMP A;  4A33 A;  1Y7R A;  4XNH B;  2OZH A;  2CTC A;  5HH1 A;  4DYO A;  4R76 A;  2OR4 A;  1XEB A;  3DLJ A;  4CGP A;  2Z0Z A;  4PXE A;  5AG4 A;  3NH8 A;  4YU9 A;  3W6S A;  3S6G A;  4B12 A;  4UCP A;  2FXF A;  1BLL E;  3MGD A;  3JVN A;  3WC6 A;  4F8Z A;  4P6Y A;  2Z10 A;  4L89 A;  3R9E A;  3D4U A;  2ZXV A;  1VHE A;  3PBE A;  4MCQ A;  5AGE A;  4CGO A;  5EBV A;  4F9V A;  1PYT B;  5IB0 A;  3D7F A;  4K3N A;  1JQG A;  4UFW A;  3VH9 A;  3TO7 A;  2XEJ A;  4NXY A;  1QSM A;  4C2X A;  2ZW7 A;  3RAM A;  2ZED A;  2EK8 A;  1NSL A;  2EK9 A;  2CNM A;  3BXM A;  2BO9 A;  3SI1 A;  3TCV A;  2PQ8 A;  4OC3 A;  5G20 A;  1M44 A;  2BCO A;  1Q2C A;  4B14 A;  4WJB A;  2PRQ A;  4UEF A;  1Z2L A;  3RYO A;  1Z4E A;  4UA3 A;  2WUU A;  4ONU A;  4P45 A;  1I12 A;  1IYL A;  2X7B A;  5KTA A;  5K8N A;  4HNW B;  3S6F A;  4ZBG A;  3F8K A;  2FT0 A;  3V38 A;  4UIA A;  5D8N A;  2B3V A;  1Y9K A;  1WWZ A;  4X2T A;  4OIW A;  2CIJ A;  1I21 A;  1NSA A;  3F5B A;  4DJL A;  1FY7 A;  1CPX A;  2J8N A;  5IV0 A;  3WT4 A;  1MK4 A;  2CF4 A;  1ARM A;  6CPA A;  2B5G B;  3BLN A;  4CAV A;  4Y49 B;  4AVC A;  3B3T A;  4JYW A;  2HV2 A;  4PSW A;  3B2Y A;  1QQ9 A;  1S7L A;  1BAV A;  1RXT A;  2PCU A;  4OKO A;  4UBR A;  3CXP A;  4KOR A;  2Q7S A;  4F6A A;  4NCZ A;  1MJA A;  7CPA A;  1S7K A;  4KOY A;  3S9M A;  4KOS A;  3WC5 A;  5AG5 A;  1XF8 A;  2D4P A;  1ZLH A;  3FNC A;  3EXN A;  2ZW6 A;  3CDX A;  4ZX8 A;  4CAX A;  3V7Z A;  2RC4 A;  5THW A;  2Q4V A;  4H6U A;  3CXS A;  3QAH A;  2CXA A;  4MI4 A;  2H5M A;  2PJ8 A;  4MXU A;  1IIC A;  2C1C A;  4UFX A;  2C6C A;  2PJ9 A;  3ISX A;  4OC2 A;  5K8M A;  1Q2D A;  4MHZ A;  2GLJ A;  5CPA A;  3TFY A;  4CYQ A;  3EO4 A;  2G3A A;  4OC1 A;  4CS0 B;  2IQ6 A;  4EME A;  2VZZ A;  3ISZ A;  4QB9 A;  4KOW A;  2ODF A;  4AG7 A;  3GIU A;  1VGY A;  1Q7L A;  3PRT A;  4CPA A;  1UWY A;  5F49 A;  1S60 A;  4Z65 A;  3B8G A;  1Z8T A;  2CTB A;  3CPX A;  4UEZ A;  5LRG A;  1S5K A;  3D7H A;  3TE4 A;  4R6T A;  3RO0 A;  4A2Z A;  2O4H A;  2POK A;  2DF5 A;  2VBQ A;  2RB7 A;  2ZEM A;  3BJ7 A;  3GKR A;  2G3T A;  2ZEP A;  4FAI A;  3IIB A;  4NJQ A;  4PSX A;  2B3U A;  2NYQ A;  4ZX9 A;  2ZEO A;  2PIY A;  4EWT A;  2PDO A;  4MBU A;  3TTH A;  4TNU A;  2PE3 A;  3BHX A;  2PRB A;  2F7V A;  5K8O A;  3IC1 A;  1X12 A;  5F48 A;  2AFU A;  1TKH A;  2QEC A;  4MFZ A;  5G1Z A;  4P44 A;  3W91 A;  2HC9 A;  1Z9U A;  2BOA A;  3B3V A;  1XFO A;  3D2M A;  2HUZ A;  2I00 A;  2PJA A;  3LOD A;  4R9M A;  3MN8 A;  3BJ8 A;  4MJ8 A;  4UIB A;  2QML A;  2BEI A;  1YVK A;  4X5K A;  2Z3O A;  4XPD B;  1M1D A;  4ZYQ A;  1H8L A;  1VIX A;  4P4I A;  2HB6 A;  2P6F A;  4Q7A A;  1Z4R A;  2A4N A;  2B4B A;  2CNS A;  4CYP A;  3C26 A;  2ZW4 A;  3B3W A;  2OZG A;  4C7I A;  2PJ2 A;  4IAV A;  1Y0Y A;  2B4D A;  3IGR A;  3K9U A;  4P4D A;  1Q2Y A;  3NFZ A;  1MJ9 A;  1UFH A;  4DNC A;  1YME A;  4HPS A;  2V8G A;  2I3C A;  4H89 A;  2C6G A;  1YSJ A;  1XRY A;  2PJB A;  5F46 A;  5HVH A;  2AFX A;  2EWB A;  2V8H A;  3FXT A;  5F09 A;  2JBK A;  4MFP A;  2JBJ A;  3RZA A;  1PCA A;  4Q38 A;  2EUI A;  1P0H A;  3NE8 A;  3KQZ A;  4B10 A;  1A2Z A;  3PP9 A;  2DXQ A;  4UF4 A;  5C82 A;  3GB0 A;  3RBU A;  3QB8 A;  4LUA A;  1RTQ A;  2Q7B A;  4C7H A;  1ZLI A;  4CRY B;  1IU8 A;  4GS4 A;  4M6H A;  3KKW A;  4E0A A;  1DTD A;  4CGM A;  4A32 A;  2QYV A;  3L2N A;  4OC0 A;  1HDQ A;  2AFW A;  3SJG A;  2EO8 A;  3D8P A;  4IUS A;  1X10 A;  4MY0 A;  2Q04 A;  3D67 A;  4XNH C;  2BUE A;  3CT9 A;  1ON0 A;  1TXR A;  1F57 A;  2V8D A;  1ARL A;  4PV6 A;  4AXV A;  1S3Z A;  1AUG A;  5LYD A;  4M6G A;  3FJU A;  1RO5 A;  4AB7 A;  1R57 A;  4BD9 A;  2DPS A;  2Z3M A;  4A39 A;  1U6M A;  1Z8L A;  1YRE A;  3B3C A;  1LAN A;  1TF8 A;  2I79 A;  2VZY A;  4PXB A;  4Y49 C;  5LYI A;  2PJ3 A;  1Y0R A;  4CYO A;  1ZG9 A;  2J8R A;  3LD2 A;  1QST A;  4PK3 A;  3FRM A;  4A95 A;  2AFS A;  3FED A;  4R57 A;  1IYK A;  3KL9 A;  4FD7 A;  3SJE A;  2JEV A;  3TOA A;  3P2F A;  2YNC C;  3D3S A;  1Z8X A;  3PGP A;  4OME A;  4GXH A;  2JEW A;  3DGV A;  2NSM A;  5H86 A;  1V0C A;  1KUX A;  2CNT A;  2NMT A;  4I49 A;  1XE4 A;  1OZP A;  4KVM E;  3KR5 A;  2ZEF A;  4MHN A;  4UEE A;  4BMH A;  3IU1 A;  1KUY A;  1EE3 P;  3JTK A;  2Z3L A;  3K9T A;  2B4D B;  2ZEG A;  3KQX A;  3IWW A;  4W9Y A;  1ZG8 A;  5HMN A;  3R9F A;  4KOV A;  5KTD A;  3PEI A;  5JH9 A;  5LYL A;  4NGN A;  2Z3K A;  3FB3 A;  2IJZ A;  4B6Z A;  2PJ0 A;  5J1Q A;  4TWE A;  4YFJ A;  3I3G A;  4K30 A;  2PVV A;  3WR7 A;  2OB0 A;  3WC7 A;  3KAS A;  2WPW A;  2BSW A;  2Q4Y A;  3G3S A;  1NMT A;  3GYA A;  4C2Y A;  5CBM A;  4C68 A;  1NE9 A;  2PIZ A;  4M6I A;  2VQY A;  4NJR A;  4PXD A;  4JXR A;  2DPT A;  1CX8 A;  1XOV A;  2RFH A;  4KOX A;  3KGQ A;  2IL4 A;  3N5F A;  4ZY0 A;  2PSW A;  3PFE A;  4MFJ A;  4RN7 A;  5AG6 A;  4KLW A;  1P4N A;  4KSI A;  2ZEN A;  3S6K A;  4FD4 A;  4ZI6 A;  3CPA A;  3B3S A;  3B35 A;  3LAC A;  4A31 A;  3JUW A;  4OLL A;  1ELL P;  3VAR A;  3IWE A;  3IO1 A;  3TX8 A;  2V8V A;  2C6P A;  2ZOG A;  3TO6 A;  4WWV A;  2PR1 A;  3QAY A;  4OC5 A;  1CG2 A;  4R8F A;  4L8A A;  4RUH A;  5HXD A;  1M4L A;  4KLV A;  1BPM A;  1IY7 A;  3FYN A;  4ONW A;  4CAE A;  4F9U A;  2GLF A;  5I4M A;  4HKF A;  1M4I A;  2R1I A;  4R7M A;  1CP6 A;  3HLP A;  4XPK A;  2YNE A;  4X8I A;  2OH1 A;  4XPD C;  2Z3P A;  2WPX A;  5KTC A;  4KZT A;  1FT7 A;  2VEZ A;  2VI7 A;  3FMC A;  3PZJ A;  4X3R A;  1IID A;  2ZEL A;  4UWJ A;  4KUA A;  3TO9 A;  5BWA B;  4NGS A;  2FSR A;  4JD6 A;  4JLY A;  3GLJ A;  4CGL A;  3EFA A;  4U9Y A;  2FE7 A;  3FEE A;  5ELY A;  4MHY A;  3SHP A;  1M4G A;  3S9L A;  2AFO A;  5LYF A;  4NFR A;  1CPS A;  4RI1 A;  4R3L A;  1J4J A;  4UWI A;  2C27 A;  4OID A;  4MHP A;  5E96 A;  1XBU A;  4ZY2 A;  2KCW A;  2YNC A;  3V8I A;  5I0C A;  3D7G A;  3H5Z A;  4P4E A;  4IK2 A;  1XJO A;  2PR8 A;  3NE7 A;  2B58 A;  4P4F A;  2V77 A;  2VXK A;  3NH4 A;  1ELM P;  1VHO A;  2GU2 A;  3G8W A;  3P2H A;  1YR0 A;  4LX9 A;  3SJF A;  1TF9 A;  3DR8 A;  4M85 A;  2FS5 A;  2ZW5 A;  5H84 A;  4OAE A;  3DR6 A;  1QSN A;  3IJ3 A;  4IHM A;  4FWU A;  4YWY A;  3IU2 A;  1TKF A;  4BIN A;  3KR4 A;  3GUX A;  1IOF A;  1CP7 A;  1HEE A;  1KZF A;  1LOK A;  2HQY A;  5G21 A;  5J8C A;  4UCM A;  1K4J A;  4B13 A;  1QSO A;  4KS9 A;  5EC4 A;  3I1U A;  4M3S A;  4Q36 A;  2IMO A;  2DEA A;  4PQA A;  4UCN A;  2OOT A;  4E8O A;  1IB1 E;  4H2K A;  3PFO A;  4MCS A;  1PUA A;  4QC6 A;  1N71 A;  2XEG A;  2R8V A;  1KWM A;  4QVT A;  4NGP A;  3B7I A;  8CPA A;  4H6Z A;  4U5Y A;  3SXN A;  1S7N A;  4YGO A;  1VHS A;  1ZO0 A;  3SI0 A;  3E0K A;  1BO4 A;  1Z5R A;  1XMB A;  4OAD A;  4JZ0 A;  4KUB A;  4DUK A;  2ATR A;  3T8W A;  1SQH A;  3PB4 X;  4NGQ A;  3DDD A;  3SJX A;  2YGW A;  4MRI A;  5JM6 A;  3T90 A;  2Q44 A;  3BI0 A;  4QBJ A;  1IGB A;  3FH4 A;  4F0X A;  5ISV A;  4XPL A;  3ZZI A;  1YW6 A;  2GFQ A;  2F5I A;  2Q43 A;  3PB7 X;  4NEX A;  4C2Z A;  4U9Z A;  1LAM A;  3A9L A;  3HUV A;  4JJX A;  2ZPA A;  3GY9 A;  5F47 A;  2PJ6 A;  2FIW A;  3D2P A;  3MRU A;  4P4J A;  3KI9 A;  1I1D A;  1BPN A;  4ZY1 A;  2P6G A;  4YRH A;  1B6B A;  2AE6 A;  1OBR A;  4NGM A;  4PXC A;  5EMI A; 
#chains in the Genus database with same CATH homology
 2Y0M A;  4KSF A;  1YGH A;  4BBH A;  3R9G A;  4ZGY B;  4KVO E;  1CM0 A;  1MJB A;  2R98 A;  1VKC A;  4KOU A;  4MFL A;  4CRZ B;  5FVJ A;  4E2A A;  5G22 A;  4B11 A;  2J8M A;  4KOT A;  4B5P B;  1PU9 A;  2GE3 A;  1XIX A;  2REE A;  4B5P A;  4KSA A;  1GHE A;  2CY2 A;  3EC4 A;  2JDD A;  5JPH A;  2R7H A;  3OWC A;  3R96 A;  2P6E A;  4AG9 A;  4ORF A;  3SXO A;  3T9Y A;  3F0A A;  5DWM A;  3VWD A;  4CAW A;  5JQ4 A;  4CGN A;  4R3K A;  4HNX B;  3EY5 A;  2GIV A;  3R1K A;  2REF A;  4F0Y A;  3H4Q A;  5GCN A;  2OZU A;  4JXQ A;  5J8F A;  1QSR A;  4MHD A;  2K5T A;  4AVB A;  2Q0Y A;  1BOB A;  2QIR A;  4EVY A;  3IWG A;  1YX0 A;  1Y9W A;  4PK2 A;  3CXQ A;  4AVA A;  2G0B A;  2Z3N A;  2D4O A;  1S7F A;  2OU2 A;  4FD5 A;  2AJ6 A;  5G1Z A;  4QUS A;  4CAF A;  4CYN A;  2FCK A;  2YND A;  1YVO A;  5IX3 A;  4B5O A;  5CNP A;  4NSQ A;  2O28 A;  3N7Z A;  5DWN A;  4R87 A;  5A27 A;  4II9 A;  5A28 A;  4UFV A;  1M4D A;  3ZJ0 A;  1L0C A;  2BL1 A;  1CJW A;  3TT2 A;  4HNY B;  3R95 A;  2FIA A;  5C88 A;  1KUV A;  3DNS A;  4MFK A;  4MFQ A;  1XMT A;  1YLE A;  3DSB A;  1TIQ A;  2WSA A;  1LRZ A;  4IF5 A;  3UY5 A;  3W6X A;  4NF1 A;  2FL4 A;  1YK3 A;  2P0W A;  4KVX A;  3FIX A;  3VWE A;  1B87 A;  2PC1 A;  3TOB A;  1WK4 A;  3FBU A;  4RS2 A;  4JWP A;  4J3G A;  2EVN A;  2ARH A;  2JDC A;  2JLM A;  5AG7 A;  3S6H A;  4MY3 A;  2Z11 A;  2GAN A;  3I9S A;  2B5G A;  4A30 A;  4FD6 A;  4A33 A;  1Y7R A;  4XNH B;  2OZH A;  5HH1 A;  1XEB A;  4CGP A;  2Z0Z A;  5AG4 A;  3W6S A;  3S6G A;  4B12 A;  4UCP A;  2FXF A;  3MGD A;  3JVN A;  2Z10 A;  4L89 A;  3R9E A;  2ZXV A;  5AGE A;  4CGO A;  5EBV A;  5IB0 A;  4UFW A;  3TO7 A;  4NXY A;  1QSM A;  4C2X A;  2ZW7 A;  1NSL A;  2CNM A;  3TCV A;  2PQ8 A;  5G20 A;  1M44 A;  1Q2C A;  4B14 A;  3RYO A;  1Z4E A;  4UA3 A;  2WUU A;  4ONU A;  1I12 A;  1IYL A;  2X7B A;  5KTA A;  4HNW B;  3S6F A;  4ZBG A;  3F8K A;  2FT0 A;  2B3V A;  1Y9K A;  1WWZ A;  1I21 A;  3F5B A;  1FY7 A;  2J8N A;  5IV0 A;  1MK4 A;  2B5G B;  3BLN A;  4CAV A;  4Y49 B;  4AVC A;  2HV2 A;  4PSW A;  1S7L A;  1RXT A;  4UBR A;  4F6A A;  3CXP A;  4KOR A;  4NCZ A;  1MJA A;  1S7K A;  4KOY A;  4KOS A;  5AG5 A;  1XF8 A;  2D4P A;  3FNC A;  3EXN A;  2ZW6 A;  4CAX A;  2RC4 A;  2Q4V A;  4H6U A;  3CXS A;  3QAH A;  2CXA A;  4MI4 A;  2H5M A;  1IIC A;  4UFX A;  1Q2D A;  3TFY A;  4CYQ A;  3EO4 A;  2G3A A;  4CS0 B;  2VZZ A;  4QB9 A;  4AG7 A;  4KOW A;  5F49 A;  1S60 A;  3B8G A;  1S5K A;  3TE4 A;  4A2Z A;  3BJ7 A;  2VBQ A;  3GKR A;  2G3T A;  4PSX A;  2B3U A;  2PDO A;  4MBU A;  3TTH A;  2PRB A;  5F48 A;  4MFZ A;  2QEC A;  3W91 A;  1Z9U A;  3D2M A;  2HUZ A;  2I00 A;  3LOD A;  4R9M A;  3BJ8 A;  4MJ8 A;  2QML A;  2BEI A;  1YVK A;  4X5K A;  2Z3O A;  4XPD B;  1M1D A;  2P6F A;  4CYP A;  1Z4R A;  2A4N A;  2B4B A;  2CNS A;  3C26 A;  2ZW4 A;  2OZG A;  4C7I A;  2B4D A;  3IGR A;  3K9U A;  1Q2Y A;  1MJ9 A;  1UFH A;  4DNC A;  4H89 A;  5F46 A;  3FXT A;  4MFP A;  4Q38 A;  2EUI A;  1P0H A;  4B10 A;  3PP9 A;  2DXQ A;  5C82 A;  3QB8 A;  4LUA A;  4C7H A;  2Q7B A;  4CRY B;  4GS4 A;  3KKW A;  4E0A A;  4CGM A;  4A32 A;  3D8P A;  4IUS A;  4MY0 A;  2Q04 A;  4XNH C;  2BUE A;  1ON0 A;  4PV6 A;  1S3Z A;  1RO5 A;  4AB7 A;  1R57 A;  2DPS A;  2Z3M A;  1U6M A;  1YRE A;  2I79 A;  2VZY A;  4Y49 C;  4CYO A;  2J8R A;  3LD2 A;  1QST A;  4PK3 A;  3FRM A;  4A95 A;  4R57 A;  1IYK A;  4FD7 A;  2JEV A;  3TOA A;  3P2F A;  2YNC C;  3D3S A;  3PGP A;  5H86 A;  1V0C A;  1KUX A;  2CNT A;  2NMT A;  4I49 A;  1XE4 A;  1OZP A;  4KVM E;  4BMH A;  3IU1 A;  1KUY A;  3JTK A;  2Z3L A;  2B4D B;  5HMN A;  3R9F A;  4KOV A;  5KTD A;  2Z3K A;  3FB3 A;  4YFJ A;  3I3G A;  4K30 A;  3WR7 A;  2OB0 A;  2WPW A;  2BSW A;  2Q4Y A;  3G3S A;  1NMT A;  3GYA A;  4C2Y A;  4C68 A;  1NE9 A;  2VQY A;  4JXR A;  2DPT A;  4KOX A;  2IL4 A;  2PSW A;  4MFJ A;  5AG6 A;  4KLW A;  1P4N A;  3S6K A;  4FD4 A;  4A31 A;  3JUW A;  4OLL A;  3IWE A;  3TO6 A;  2PR1 A;  4L8A A;  4KLV A;  3FYN A;  4CAE A;  4HKF A;  1M4I A;  2R1I A;  4XPK A;  2YNE A;  2OH1 A;  4XPD C;  2Z3P A;  2WPX A;  5KTC A;  4KZT A;  2VEZ A;  2VI7 A;  3PZJ A;  1IID A;  4UWJ A;  4KUA A;  3TO9 A;  5BWA B;  2FSR A;  4JD6 A;  4JLY A;  4CGL A;  3EFA A;  4U9Y A;  2FE7 A;  3SHP A;  1M4G A;  4RI1 A;  4R3L A;  1J4J A;  4UWI A;  2C27 A;  5E96 A;  3V8I A;  2KCW A;  2YNC A;  5I0C A;  3H5Z A;  3NE7 A;  2PR8 A;  2B58 A;  2VXK A;  3G8W A;  3P2H A;  1YR0 A;  4LX9 A;  3DR8 A;  4M85 A;  2FS5 A;  2ZW5 A;  5H84 A;  4OAE A;  3DR6 A;  1QSN A;  3IU2 A;  2HQY A;  1KZF A;  5J8C A;  5G21 A;  4UCM A;  1K4J A;  4B13 A;  1QSO A;  4KS9 A;  5EC4 A;  4M3S A;  4Q36 A;  4UCN A;  4E8O A;  1IB1 E;  1PUA A;  4QC6 A;  1N71 A;  2R8V A;  4QVT A;  4H6Z A;  4U5Y A;  3SXN A;  1S7N A;  4YGO A;  1VHS A;  1ZO0 A;  3E0K A;  1BO4 A;  4OAD A;  4KUB A;  2ATR A;  1SQH A;  3DDD A;  2YGW A;  3T90 A;  2Q44 A;  4QBJ A;  4F0X A;  5ISV A;  4XPL A;  3ZZI A;  2F5I A;  4NEX A;  4C2Z A;  4U9Z A;  3A9L A;  4JJX A;  2ZPA A;  3GY9 A;  5F47 A;  2FIW A;  3D2P A;  1I1D A;  2P6G A;  4YRH A;  1B6B A;  2AE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...