5C82A

Crystal structure of nourseothricin acetyltransferase
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
183
structure length
170
Chain Sequence
TAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTLREVPVDPPLTKVFPDDPDSRTFVAYGDDGDLAGFVVVSYSGWNRRLTVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTLCGLDTALYDGTASDGEQALYMSMPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nourseothricin acetyltransferase
publication title Crystal structure of Nourseothricin acetyltransferase
rcsb
source organism Streptomyces noursei
molecule tags Transferase
total genus 39
structure length 170
sequence length 183
ec nomenclature
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c82A00
2ATRA 4DNCA 2PR1A 2VBQA 2B5GB 3TOAA 3TOBA 2QMLA 4HNWB 1BOBA 2ZW5A 2FCKA 1IB1E 3FIXA 3FRMA 1YR0A 4HNXB 3FNCA 2B4DB 1KZFA 2VQYA 3CXSA 2PQ8A 3R95A 1S5KA 4MBUA 2B3UA 2CNTA 4L8AA 1L0CA 2ZXVA 2Q44A 5H84A 2OZHA 3I3GA 1XF8A 2ZW4A 2OU2A 1CJWA 1J4JA 3H4QA 4B5PB 4XPKA 2P0WA 3T90A 1M44A 1K4JA 3R9GA 4Y49C 4NEXA 2R98A 4PSXA 3KKWA 5IV0A 3R1KA 1KUXA 5FVJA 4YRHA 4E0AA 2AJ6A 5IX3A 3D3SA 1IYKA 4B5OA 1M4GA 1B6BA 4F6AA 4Y49B 2H5MA 4EVYA 3S6FA 3TCVA 1M1DA 4HNYB 2OB0A 3IGRA 4YFJA 4KZTA 4R3KA 5E96A 1PU9A 2GE3A 5C82A 1VHSA 2PR8A 1XEBA 3VWEA 4L89A 2PC1A 5I0CA 1Y7RA 5ISVA 1YGHA 1P0HA 4M85A 1WWZA 3LODA 1IICA 3S6HA 1IIDA 4IUSA 4CRZB 3TT2A 4KVOE 2FS5A 4K30A 1Y9WA 5DWNA 4MHDA 4KOYA 5EC4A 5F47A 3P2FA 4MY0A 1YK3A 3SXNA 4NSQA 2VZYA 4E2AA 2F5IA 3JUWA 1Z4EA 1GHEA 1YLEA 2HQYA 2REEA 3W6SA 1CM0A 4JJXA 4X5KA 4AG9A 4KORA 2HUZA 4U5YA 2PSWA 3W91A 4KOUA 1I12A 1WK4A 2Z10A 5H86A 4U9YA 3EC4A 4XNHB 3BJ7A 4KUAA 4JXRA 2Q4YA 3SXOA 5EBVA 2JDDA 1S7NA 3TTHA 2P6EA 3QB8A 1S7FA 1Q2YA 3D2MA 3K9UA 2Q7BA 3BJ8A 3GYAA 4J3GA 1YVOA 4RI1A 3DDDA 1YVKA 4PV6A 5KTCA 2O28A 4ONUA 1TIQA 2J8MA 2ZW6A 3G3SA 2R7HA 2G3TA 3NE7A 4U9ZA 5F46A 2VEZA 5IB0A 2B5GA 2FT0A 4NF1A 3E0KA 1S7LA 3DR6A 1VKCA 4QB9A 2I00A 1OZPA 4OAEA 4HKFA 2B4DA 4MY3A 4R9MA 3SHPA 4FD6A 4ZBGA 1R57A 1ON0A 4KUBA 3BLNA 2R8VA 3DR8A 2JEVA 1QSTA 2GANA 4CRYB 1RO5A 5F48A 4AVBA 2PDOA 4KOTA 4KOWA 4M3SA 3VWDA 3R9EA 1QSMA 3CXQA 1I1DA 2OH1A 2K5TA 4B5PA 1NSLA 2FXFA 4QC6A 2IL4A 4H89A 1N71A 1M4IA 1PUAA 5C88A 2B3VA 3S6GA 5HMNA 4KOSA 2I79A 2G3AA 2JLMA 4KLVA 4CAXA 2FL4A 3F8KA 2CNMA 4UA3A 4JLYA 2G0BA 2D4PA 2VZZA 4AB7A 1U6MA 5F49A 1NE9A 2A4NA 2R1IA 2GIVA 4LUAA 4XPLA 1MK4A 2P6FA 1MJBA 4KOXA 3TO6A 3GKRA 4E8OA 3DSBA 4AVCA 2Z11A 3EFAA 3UY5A 4R3LA 4F0YA 1LRZA 2DXQA 3S6KA 1BO4A 1Q2CA 1M4DA 3WR7A 2P6GA 2VI7A 2REFA 3R9FA 2Q04A 1KUVA 4JWPA 3PP9A 5J8CA 2PRBA 1Z9UA 1MJ9A 3G8WA 2NMTA 4QVTA 5JQ4A 1NMTA 1XE4A 4H6ZA 2ARHA 1SQHA 4H6UA 1XMTA 4XPDC 5GCNA 4KLWA 2HV2A 3I9SA 3IWGA 2JDCA 3MGDA 1QSNA 3EO4A 2J8NA 4PK2A 1S7KA 1S3ZA 2B4BA 4I49A 4JD6A 2QIRA 3P2HA 4XPDB 4II9A 1B87A 1QSRA 4KVXA 3ZZIA 1V0CA 3JVNA 4MJ8A 3C26A 2BSWA 2D4OA 1XIXA 2Y0MA 3W6XA 4UBRA 2ZPAA 3TO7A 3B8GA 1Q2DA 1P4NA 3PGPA 2Q4VA 2CY2A 1QSOA 2FE7A 2J8RA 3OWCA 3EXNA 4FD7A 3RYOA 2VXKA 2QECA 4JXQA 3FBUA 2FIAA 4OLLA 1IYLA 3EY5A 4YGOA 2Z0ZA 3LD2A 3TE4A 5HH1A 1YX0A 3FXTA 4CAVA 4FD4A 4QUSA 2C27A 3GY9A 4LX9A 1Z4RA 2FIWA 4NCZA 3TFYA 3R96A 5KTDA 4FD5A 4UWJA 1UFHA 1MJAA 2ZW7A 4CS0B 4BMHA 1YREA 2EVNA 4NXYA 4PK3A 1KUYA 5DWMA 1FY7A 4QBJA 5CNPA 4R57A 2EUIA 2OZGA 3ZJ0A 3V8IA 4GS4A 2CNSA 1Y9KA 4ORFA 3FB3A 2OZUA 2X7BA 1RXTA 2KCWA 5KTAA 2RC4A 3CXPA 5JPHA 1S60A 2BEIA 2Q0YA 2WPWA 4MI4A 2B58A 3T9YA 3F5BA 3FYNA 2AE6A 2BUEA 4KOVA 2BL1A 4IF5A 4AG7A 4XNHC 4OADA 3PZJA 4RS2A 3F0AA 2FSRA 3D2PA 4KVME 4PSWA 3N7ZA 4R87A 4CAWA 5J8FA 2WPXA 4AVAA 3D8PA 4UWIA 3TO9A 1I21A 3QAHA 3DNSA
chains in the Genus database with same CATH superfamily
2ATRA 4DNCA 2PR1A 2VBQA 2B5GB 3TOAA 5A27A 3TOBA 1FT7A 2QMLA 3B3TA 4HNWB 1BOBA 3TC8A 4ZX9A 2DPTA 3PRTA 4H2KA 4MHPA 1ZO0A 2Z3KA 2ZW5A 3GUXA 2FCKA 2ZEFA 4FAIA 2XEIA 4P44A 1XRYA 1RTQA 5G20A 1IB1E 4DYOA 3FIXA 3FRMA 3H8FA 1YR0A 2O53A 3PB8X 4HNXB 3FNCA 2B4DB 1KZFA 3IU1A 2VQYA 3CXSA 1ELLP 1X12A 4MMOA 2PQ8A 3R95A 1S5KA 2GU2A 2V8DA 4JZ0A 4MBUA 1DTDA 5IB9A 5JM6A 5AG7A 2B3UA 3WC6A 2CNTA 4L8AA 1L0CA 2ZXVA 2PJ0A 2Q44A 5H84A 1A2ZA 4W9YA 3PEIA 2OZHA 3I3GA 4GXHA 4WJBA 5AG6A 1XF8A 2ZW4A 3MRUA 4OC1A 2OU2A 2EBJA 3DGVA 3FECA 5K8NA 4CRZB 3CDXA 1CJWA 2PIZA 1J4JA 3H4QA 3BXMA 3LWUA 4MFQA 4B5PB 3LMSA 4XPKA 1F2OA 2P0WA 2Z3NA 3JRUA 4MFJA 2OOTA 3T90A 2AFMA 4B11A 1M44A 1K4JA 1AYEA 3R9GA 4ZGYB 4NGQA 4Y49C 3T8WA 4OC5A 4F8ZA 4NEXA 4CYOA 4LQGA 2R98A 4PSXA 2J9AA 1Q7LA 3H5ZA 2XEGA 3KKWA 4UEEA 3R1KA 1KUXA 5FVJA 4A95A 4YRHA 4HPSA 4PXCA 4E0AA 2AJ6A 1CG2A 3KR4A 5IX3A 2PJ2A 3D3SA 1IYKA 4B5OA 1M4GA 5HVGA 2ZENA 5ELYA 1B6BA 3HUVA 2HC9A 2ZEDA 5CPAA 3SI0A 4F6AA 4Y49B 1EE3P 4NGTA 2H5MA 2ZOGA 4EVYA 4UEFA 2PRQA 3S6FA 4MHYA 3TCVA 1M1DA 4HNYB 3WC5A 2OB0A 2F8HA 2CXAA 3IGRA 4IHMA 4YFJA 4KZTA 4R3KA 1AMPA 2YGWA 5E96A 1PU9A 5LRKA 2GE3A 5C82A 1YQEA 2NYQA 1VHSA 2PR8A 3BI0A 1Z8LA 4MXUA 1XEBA 3V38A 4FBEA 3D7DA 4YWYA 3VWEA 3NH8A 4P45A 3KI9A 4L89A 5I4MA 2C6GA 2QYVA 3SI2A 4CPAA 3CZXA 2PC1A 5I0CA 1Y7RA 5ISVA 4A32A 4A2ZA 1YGHA 1HEEA 1P0HA 2RFHA 4M85A 1Y7EA 1WWZA 4MCSA 5JH9A 3L2NA 3LODA 1IICA 2V8GA 1IIDA 4IUSA 3S6HA 3TT2A 4BINA 4KVOE 1HDQA 2FS5A 3KGQA 4K30A 3SJGA 4CGOA 1YMEA 1Y9WA 3IWWA 1M4LA 4MHDA 4KOYA 5DWNA 5EC4A 3P2FA 5F47A 4MY0A 1R43A 1YK3A 2EO8A 3NH5A 2BOAA 2VZYA 4NSQA 3SXNA 3FF3A 3KHZA 4IK2A 4E2AA 3S9LA 2QVPA 2F5IA 3KZWA 3JUWA 1Z4EA 2PJ9A 1GHEA 5K8PA 1YLEA 4OC0A 2HQYA 2PJ4A 4DJLA 2REEA 2PVWA 2Q7SA 3W6SA 1CM0A 3LACA 4JJXA 4X5KA 4AG9A 4KORA 2HUZA 4U5YA 2PSWA 3W91A 2Z3MA 1I12A 3NE8A 4KOUA 2C6PA 4M6GA 1WK4A 2PJ5A 3PB9X 1DE4C 3IC1A 2Z10A 2JBKA 5H86A 3D4UA 4F9UA 4U9YA 3VH9A 3EC4A 3H8GA 4UFWA 3BJ7A 4XNHB 1QMUA 4EMEA 4KUAA 4B13A 1XMBA 1Z8XA 1UWYA 4MFPA 1KWMA 4JXRA 2Q4YA 3SXOA 1ZG9A 3IFEA 4R7MA 5EBVA 2JDDA 1S7NA 3TTHA 5AG5A 2P6EA 3QB8A 1S7FA 2WSAA 4X8IA 1Q2YA 1TKJA 2ZEMA 5K8OA 2WYRA 3D2MA 3K9UA 4MHZA 4PQAA 2PVVA 1X10A 2Q7BA 3A9LA 3BJ8A 3KL9A 3B2YA 3GYAA 4J3GA 4OKOA 1YVOA 4RI1A 3DDDA 2RB7A 1YVKA 4CYQA 4PV6A 5KTCA 2O28A 4ONUA 1TIQA 2J8MA 2ZW6A 4EFDA 1LAMA 1XFOA 3KASA 2AFSA 3G3SA 2ZELA 2R7HA 2G3TA 3NE7A 4U9ZA 5F46A 3TX8A 1TF9A 2EWBA 4R76A 2VEZA 5IB0A 4MHNA 4P4BA 5G22A 4G1PA 2B5GA 2FT0A 4NF1A 3E0KA 1S7LA 3D66A 3DLJA 4OC2A 3DR6A 4B12A 1VKCA 1Z2LA 2ANPA 2I3CA 3N5FA 1TXRA 2GFQA 2PE3A 3D7GA 4QB9A 2I00A 1OZPA 4OAEA 4UF4A 1TKFA 4HKFA 2B4DA 4UFXA 4M6IA 1BPMA 3B35A 4MY3A 4R9MA 3RO0A 3SHPA 2PJBA 4FD6A 4ZBGA 1R57A 1ON0A 4KUBA 1ZLIA 2O4HA 3BLNA 3BHXA 3CT9A 2R8VA 3DR8A 2JEVA 1Z5RA 1CP7A 1QSTA 1LFWA 2GANA 2ZEOA 3JTKA 4FUUA 4MCQA 1RO5A 4CRYB 2PJAA 4P6YA 5F48A 4A30A 4ZYQA 4AVBA 2DEAA 3S9NA 3PFOA 4C68A 2CTCA 2PDOA 4KOTA 4B6ZA 4CAEA 4A31A 4ZI6A 2POKA 4KOWA 4M3SA 4O23A 3R9EA 3VWDA 1QSMA 2AFUA 3CXQA 1I1DA 4MFZA 4P10A 4Q7AA 2BO9A 2K5TA 2OH1A 4B5PA 5HVHA 1NSLA 2FXFA 5BWAB 4QC6A 2IL4A 1ARLA 4H89A 4NGRA 1N71A 1M4IA 1R3NA 1PUAA 4PXEA 2B3VA 4KS9A 3FVLA 3S6GA 5C88A 4KOSA 2I79A 4ZY1A 4OIDA 5HMNA 2G3AA 2JLMA 3D7FA 4KLVA 3H8EA 2PJ8A 4CAXA 4C7IA 2FL4A 2AFOA 3F8KA 1ARMA 4ONWA 2GREA 3WT4A 4R6TA 2CNMA 1CPXA 1OBRA 3HLPA 4A94A 4UA3A 4JLYA 2Z3LA 5AG4A 4MCPA 2G0BA 2D4PA 3CPAA 2XEJA 3ISZA 2VZZA 4AB7A 1BPNA 1U6MA 5EMIA 1ELMP 3B7IA 5F49A 3RAMA 3D68A 4C2ZA 2VL1A 1NE9A 3SI1A 8CPAA 2A4NA 2QJ8A 2GIVA 2R1IA 4LUAA 2YNDA 4XPLA 1XOVA 1MK4A 4ZY2A 2P6FA 1MJBA 2XEFA 2CIJA 4KOXA 3TO6A 3GKRA 1IGBA 2EK9A 2ZEGA 2DPSA 2YNCA 2Z11A 3DSBA 4AVCA 4E8OA 4F9VA 2OR4A 4KSIA 3EFAA 3UY5A 2JEWA 1CPSA 4P4DA 1LOKA 4R3LA 5DS0A 4F0YA 3PB6X 4NJRA 1LRZA 2DXQA 3S6KA 4CGMA 4X3RA 1BO4A 1FNOA 3IEHA 1Q2CA 1M4DA 3WR7A 1IOIA 2PJ6A 2P6GA 3MN8A 3PB7X 2VI7A 1IOFA 2PJ3A 1VHOA 4Z65A 2REFA 4NJQA 3R9FA 2Q04A 3K9TA 4NGMA 1KUVA 1TKHA 3FEEA 5JGFA 4B10A 3SJXA 5LYFA 4JWPA 4ZY0A 1XJOA 1HDUA 3PP9A 4OP4A 5J8CA 2C1CA 2ODFA 2PRBA 1Z9UA 2AFZA 3NA6A 3PFEA 1MJ9A 2FVGA 3B3WA 2NMTA 2C6CA 3G8WA 4QVTA 5JQ4A 3NFZA 1NMTA 1XE4A 4H6ZA 2ARHA 1SQHA 3IIBA 3KQZA 4NGNA 2CF4A 4H6UA 1XMTA 3IU2A 5LRGA 1Z8WA 4XPDC 3QAYA 5GCNA 4OC3A 4KLWA 2HV2A 3I9SA 3IWGA 1H8LA 4P4FA 2JBJA 2JDCA 4CGPA 3MGDA 1QSNA 4GM5A 2Q4ZA 4EWTA 4BBHA 3EO4A 4Q36A 2J8NA 4PK2A 2IQ6A 2ZEEA 2GLFA 2PIYA 4LQ6A 1VGYA 4UCMA 1S7KA 1S3ZA 2B4BA 4I49A 4JD6A 2QIRA 3WC7A 3P2HA 4C7HA 4CGNA 4XPDB 3IWEA 4II9A 1B87A 5AGEA 1QSRA 4P4JA 2BCOA 4KVXA 3FX6A 4TNUA 4C2YA 4UFVA 3D7HA 1V0CA 3BI1A 3JVNA 4KSAA 4MFLA 3ZZIA 4MJ8A 3C26A 2BSWA 4PXBA 1ZG8A 1IY7A 2D4OA 2Q51A 4PXDA 3FJUA 1XIXA 1VHEA 2Y0MA 2G9DA 3W6XA 3IO1A 4DUKA 4F0XA 4UBRA 4UIBA 3S9MA 2ZPAA 4R8FA 3IJ3A 5CBMA 2ZEHA 3TO7A 4MFKA 2IJZA 2Q43A 3B8GA 4P4EA 5THWA 1AUGA 5J1QA 1Q2DA 1ZG7A 4B14A 1P4NA 4UCPA 3PGPA 6CPAA 2Q4VA 1LANA 2CY2A 1QSOA 2V8VA 4PPZA 2FE7A 2J8RA 4RUHA 3OWCA 4OMEA 3EXNA 4FD7A 4YU9A 2ABZA 4NGPA 5A28A 3PBEA 3RYOA 4KSFA 2VXKA 2QECA 1BAVA 2ZOFA 4JXQA 3GB0A 2WZNA 4P4IA 3FEDA 5HVFA 3FBUA 2FIAA 1LCPA 4OLLA 1F2PA 3V7ZA 1IYLA 3EY5A 2Z3OA 4YGOA 2Z0ZA 3LD2A 1ZLHA 4K3NA 4TWEA 4CAFA 5D29A 3VARA 3TE4A 5HH1A 3SJFA 7CPAA 1LAPA 1YX0A 2YNCC 3FXTA 1JWQA 4FD4A 4CAVA 2WUUA 1Z8TA 4QUSA 2PJCA 4ZX8A 2PCUA 2C27A 4UCNA 3GY9A 4UIAA 3CPXA 5LYIA 4LX9A 1Z4RA 2FIWA 4NCZA 3TFYA 2IMOA 3RBUA 3R96A 3B3VA 5KTDA 4FD5A 4IAVA 3VATA 5F09A 4UWJA 1Y0YA 5G21A 1UFHA 4RN7A 1MJAA 2AFXA 2CTBA 2YNEA 2ZW7A 3FMCA 4CS0B 4MRIA 4BMHA 1VIXA 1YREA 2EVNA 2EK8A 4A37A 4NXYA 2DF5A 2V77A 4PK3A 1KUYA 5DWMA 1FY7A 4QBJA 2F7VA 5CNPA 5LYLA 1GYTA 2GLJA 2PJ7A 2EUIA 2OZGA 4R57A 3SJEA 3ZJ0A 4AXVA 3V8IA 5K8MA 4GS4A 2CNSA 1Y9KA 1YSJA 5HXDA 4UEZA 3KQXA 5LYDA 4ORFA 3FB3A 3FH4A 1PYTB 5IV0A 2OZUA 4CGLA 2X7BA 3K2KA 1CX8A 4A39A 1YW4A 1RXTA 3QNVA 4NGSA 2KCWA 1TF8A 3GIUA 5KTAA 5LRJA 3KR5A 2RC4A 4CYNA 4A38A 3CXPA 1JQGA 5JPHA 3B3SA 4Q38A 1S60A 2BEIA 4OIWA 1YW6A 3PBBA 2Q0YA 1F57A 2WPWA 4MI4A 3WABA 2B58A 3NH4A 3PB4X 3F5BA 3FYNA 3T9YA 4WWVA 2AE6A 2BUEA 2Z3PA 3GLJA 2AFWA 4KOVA 2BL1A 4IF5A 1XBUA 4AG7A 2ZEPA 4JYWA 1PCAA 2V8HA 4XNHC 4OADA 3D67A 3ISXA 3RZAA 1CBXA 3KHXA 3PZJA 1Y0RA 4RS2A 4BD9A 3F0AA 1CP6A 2HB6A 5D8NA 4C2XA 2FSRA 3D2PA 3RNZA 4KVME 4PSWA 3N7ZA 4R87A 5G1ZA 4CAWA 2NSMA 2WPXA 4OC4A 5J8FA 1IU8A 4CYPA 4FWUA 4AVAA 4X2TA 3D8PA 4A33A 3B3CA 4M6HA 4UWIA 4MCRA 3TO9A 4NFRA 1BLLE 1YLOA 3I1UA 2PJ1A 1I21A 3QAHA 1QQ9A 3DNSA 1NSAA
chains in the Genus database with same CATH topology
2ATRA 4DNCA 2PR1A 2VBQA 2B5GB 3TOAA 5A27A 3TOBA 2QMLA 4HNWB 1BOBA 2DPTA 1ZO0A 2Z3KA 2ZW5A 2FCKA 5G20A 1IB1E 3FIXA 3FRMA 1YR0A 4HNXB 3FNCA 2B4DB 1KZFA 3IU1A 2VQYA 3CXSA 2PQ8A 3R95A 1S5KA 4MBUA 5AG7A 2B3UA 2CNTA 4L8AA 1L0CA 2ZXVA 2Q44A 5H84A 2OZHA 3I3GA 5AG6A 1XF8A 2ZW4A 2OU2A 1CJWA 1J4JA 3H4QA 4MFQA 4B5PB 4XPKA 2P0WA 2Z3NA 4MFJA 3T90A 4B11A 1M44A 1K4JA 3R9GA 4ZGYB 4Y49C 4NEXA 4CYOA 2R98A 4PSXA 3KKWA 4CGOA 3H5ZA 5IV0A 3R1KA 1KUXA 5FVJA 4A95A 4YRHA 4E0AA 2AJ6A 5IX3A 3D3SA 1IYKA 4B5OA 1M4GA 1B6BA 4F6AA 4Y49B 2H5MA 4EVYA 3S6FA 3TCVA 1M1DA 4HNYB 2OB0A 2CXAA 3IGRA 4YFJA 4KZTA 4R3KA 2YGWA 5E96A 1PU9A 2GE3A 5C82A 1VHSA 2PR8A 1XEBA 3VWEA 4L89A 2PC1A 5I0CA 1Y7RA 5ISVA 4A32A 4A2ZA 1YGHA 1P0HA 4M85A 1WWZA 3LODA 1IICA 3S6HA 1IIDA 4IUSA 4CRZB 3TT2A 4KVOE 2FS5A 4K30A 1Y9WA 5DWNA 4MHDA 4KOYA 5EC4A 5F47A 3P2FA 4MY0A 1YK3A 3SXNA 4NSQA 2VZYA 4E2AA 2F5IA 3JUWA 1Z4EA 1GHEA 1YLEA 2HQYA 2REEA 3W6SA 1CM0A 4JJXA 4X5KA 4AG9A 4KORA 2HUZA 4U5YA 2PSWA 3W91A 2Z3MA 1I12A 4KOUA 1WK4A 2Z10A 5H86A 4U9YA 3EC4A 4UFWA 4XNHB 3BJ7A 4KUAA 4B13A 4MFPA 4JXRA 2Q4YA 3SXOA 5EBVA 2JDDA 1S7NA 3TTHA 5AG5A 2P6EA 3QB8A 1S7FA 2WSAA 1Q2YA 3D2MA 3K9UA 2Q7BA 3A9LA 3BJ8A 3GYAA 4J3GA 1YVOA 4RI1A 3DDDA 1YVKA 4CYQA 4PV6A 5KTCA 2O28A 4ONUA 1TIQA 2J8MA 2ZW6A 3G3SA 2R7HA 2G3TA 3NE7A 4U9ZA 5F46A 2VEZA 5IB0A 5G22A 2B5GA 2FT0A 4NF1A 3E0KA 1S7LA 3DR6A 4B12A 1VKCA 4QB9A 2I00A 1OZPA 4OAEA 4HKFA 2B4DA 4UFXA 4MY3A 4R9MA 3SHPA 4FD6A 4ZBGA 1R57A 1ON0A 4KUBA 3BLNA 2R8VA 3DR8A 2JEVA 1QSTA 2GANA 3JTKA 4CRYB 1RO5A 5F48A 4A30A 4AVBA 4C68A 2PDOA 4KOTA 4CAEA 4A31A 4KOWA 4M3SA 3VWDA 3R9EA 1QSMA 3CXQA 4MFZA 1I1DA 2OH1A 2K5TA 4B5PA 1NSLA 2FXFA 5BWAB 4QC6A 2IL4A 4H89A 1N71A 1M4IA 1PUAA 5C88A 2B3VA 4KS9A 3S6GA 5HMNA 4KOSA 2I79A 2G3AA 2JLMA 4KLVA 4CAXA 4C7IA 2FL4A 3F8KA 2CNMA 4UA3A 4JLYA 2Z3LA 5AG4A 2G0BA 2D4PA 2VZZA 4AB7A 1U6MA 5F49A 4C2ZA 1NE9A 2A4NA 2R1IA 2GIVA 4LUAA 2YNDA 4XPLA 1MK4A 2P6FA 1MJBA 4KOXA 3TO6A 3GKRA 4E8OA 3DSBA 2DPSA 2YNCA 2Z11A 4AVCA 3EFAA 3UY5A 4R3LA 4F0YA 1LRZA 2DXQA 3S6KA 4CGMA 1BO4A 1Q2CA 1M4DA 3WR7A 2P6GA 2VI7A 2REFA 3R9FA 2Q04A 1KUVA 4B10A 4JWPA 3PP9A 5J8CA 2PRBA 1Z9UA 1MJ9A 3G8WA 2NMTA 4QVTA 5JQ4A 1NMTA 1XE4A 4H6ZA 2ARHA 1SQHA 4H6UA 1XMTA 3IU2A 4XPDC 5GCNA 4KLWA 2HV2A 3I9SA 3IWGA 2JDCA 4CGPA 3MGDA 1QSNA 4BBHA 3EO4A 4Q36A 2J8NA 4PK2A 4UCMA 1S7KA 1S3ZA 2B4BA 4I49A 4JD6A 2QIRA 4C7HA 3P2HA 4CGNA 4XPDB 3IWEA 4II9A 1B87A 5AGEA 1QSRA 4KVXA 4C2YA 4UFVA 4MFLA 1V0CA 3JVNA 4KSAA 3ZZIA 4MJ8A 3C26A 2BSWA 2D4OA 1XIXA 2Y0MA 3W6XA 4F0XA 4UBRA 2ZPAA 3TO7A 4MFKA 3B8GA 1Q2DA 4B14A 1P4NA 4UCPA 3PGPA 2Q4VA 2CY2A 1QSOA 2FE7A 2J8RA 3OWCA 3EXNA 4FD7A 5A28A 3RYOA 4KSFA 2VXKA 2QECA 4JXQA 3FBUA 2FIAA 4OLLA 1IYLA 3EY5A 2Z3OA 4YGOA 2Z0ZA 3LD2A 4CAFA 3TE4A 5HH1A 1YX0A 2YNCC 3FXTA 4CAVA 4FD4A 2WUUA 4QUSA 2C27A 4UCNA 3GY9A 4LX9A 1Z4RA 2FIWA 4NCZA 3TFYA 3R96A 5KTDA 4FD5A 4UWJA 5G21A 1UFHA 1MJAA 2ZW7A 2YNEA 4CS0B 4BMHA 1YREA 2EVNA 4NXYA 4PK3A 1KUYA 5DWMA 1FY7A 4QBJA 5CNPA 4R57A 2EUIA 2OZGA 3ZJ0A 3V8IA 4GS4A 2CNSA 1Y9KA 4ORFA 3FB3A 2OZUA 4CGLA 2X7BA 1RXTA 2KCWA 5KTAA 2RC4A 4CYNA 3CXPA 5JPHA 4Q38A 1S60A 2BEIA 2Q0YA 2WPWA 4MI4A 2B58A 3T9YA 3F5BA 3FYNA 2AE6A 2BUEA 2Z3PA 4KOVA 2BL1A 4IF5A 4AG7A 4XNHC 4OADA 3PZJA 4RS2A 3F0AA 4C2XA 2FSRA 3D2PA 4KVME 4PSWA 3N7ZA 4R87A 5G1ZA 4CAWA 5J8FA 2WPXA 4CYPA 4AVAA 3D8PA 4A33A 4UWIA 3TO9A 1I21A 3QAHA 3DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATR A;  4DNC A;  2PR1 A;  2VBQ A;  2B5G B;  3TOA A;  3TOB A;  2QML A;  4HNW B;  1BOB A;  2ZW5 A;  2FCK A;  1IB1 E;  3FIX A;  3FRM A;  1YR0 A;  4HNX B;  3FNC A;  2B4D B;  1KZF A;  2VQY A;  3CXS A;  2PQ8 A;  3R95 A;  1S5K A;  4MBU A;  2B3U A;  2CNT A;  4L8A A;  1L0C A;  2ZXV A;  2Q44 A;  5H84 A;  2OZH A;  3I3G A;  1XF8 A;  2ZW4 A;  2OU2 A;  1CJW A;  1J4J A;  3H4Q A;  4B5P B;  4XPK A;  2P0W A;  3T90 A;  1M44 A;  1K4J A;  3R9G A;  4Y49 C;  4NEX A;  2R98 A;  4PSX A;  3KKW A;  5IV0 A;  3R1K A;  1KUX A;  5FVJ A;  4YRH A;  4E0A A;  2AJ6 A;  5IX3 A;  3D3S A;  1IYK A;  4B5O A;  1M4G A;  1B6B A;  4F6A A;  4Y49 B;  2H5M A;  4EVY A;  3S6F A;  3TCV A;  1M1D A;  4HNY B;  2OB0 A;  3IGR A;  4YFJ A;  4KZT A;  4R3K A;  5E96 A;  1PU9 A;  2GE3 A;  5C82 A;  1VHS A;  2PR8 A;  1XEB A;  3VWE A;  4L89 A;  2PC1 A;  5I0C A;  1Y7R A;  5ISV A;  1YGH A;  1P0H A;  4M85 A;  1WWZ A;  3LOD A;  1IIC A;  3S6H A;  1IID A;  4IUS A;  4CRZ B;  3TT2 A;  4KVO E;  2FS5 A;  4K30 A;  1Y9W A;  5DWN A;  4MHD A;  4KOY A;  5EC4 A;  5F47 A;  3P2F A;  4MY0 A;  1YK3 A;  3SXN A;  4NSQ A;  2VZY A;  4E2A A;  2F5I A;  3JUW A;  1Z4E A;  1GHE A;  1YLE A;  2HQY A;  2REE A;  3W6S A;  1CM0 A;  4JJX A;  4X5K A;  4AG9 A;  4KOR A;  2HUZ A;  4U5Y A;  2PSW A;  3W91 A;  4KOU A;  1I12 A;  1WK4 A;  2Z10 A;  5H86 A;  4U9Y A;  3EC4 A;  4XNH B;  3BJ7 A;  4KUA A;  4JXR A;  2Q4Y A;  3SXO A;  5EBV A;  2JDD A;  1S7N A;  3TTH A;  2P6E A;  3QB8 A;  1S7F A;  1Q2Y A;  3D2M A;  3K9U A;  2Q7B A;  3BJ8 A;  3GYA A;  4J3G A;  1YVO A;  4RI1 A;  3DDD A;  1YVK A;  4PV6 A;  5KTC A;  2O28 A;  4ONU A;  1TIQ A;  2J8M A;  2ZW6 A;  3G3S A;  2R7H A;  2G3T A;  3NE7 A;  4U9Z A;  5F46 A;  2VEZ A;  5IB0 A;  2B5G A;  2FT0 A;  4NF1 A;  3E0K A;  1S7L A;  3DR6 A;  1VKC A;  4QB9 A;  2I00 A;  1OZP A;  4OAE A;  4HKF A;  2B4D A;  4MY3 A;  4R9M A;  3SHP A;  4FD6 A;  4ZBG A;  1R57 A;  1ON0 A;  4KUB A;  3BLN A;  2R8V A;  3DR8 A;  2JEV A;  1QST A;  2GAN A;  4CRY B;  1RO5 A;  5F48 A;  4AVB A;  2PDO A;  4KOT A;  4KOW A;  4M3S A;  3VWD A;  3R9E A;  1QSM A;  3CXQ A;  1I1D A;  2OH1 A;  2K5T A;  4B5P A;  1NSL A;  2FXF A;  4QC6 A;  2IL4 A;  4H89 A;  1N71 A;  1M4I A;  1PUA A;  5C88 A;  2B3V A;  3S6G A;  5HMN A;  4KOS A;  2I79 A;  2G3A A;  2JLM A;  4KLV A;  4CAX A;  2FL4 A;  3F8K A;  2CNM A;  4UA3 A;  4JLY A;  2G0B A;  2D4P A;  2VZZ A;  4AB7 A;  1U6M A;  5F49 A;  1NE9 A;  2A4N A;  2R1I A;  2GIV A;  4LUA A;  4XPL A;  1MK4 A;  2P6F A;  1MJB A;  4KOX A;  3TO6 A;  3GKR A;  4E8O A;  3DSB A;  4AVC A;  2Z11 A;  3EFA A;  3UY5 A;  4R3L A;  4F0Y A;  1LRZ A;  2DXQ A;  3S6K A;  1BO4 A;  1Q2C A;  1M4D A;  3WR7 A;  2P6G A;  2VI7 A;  2REF A;  3R9F A;  2Q04 A;  1KUV A;  4JWP A;  3PP9 A;  5J8C A;  2PRB A;  1Z9U A;  1MJ9 A;  3G8W A;  2NMT A;  4QVT A;  5JQ4 A;  1NMT A;  1XE4 A;  4H6Z A;  2ARH A;  1SQH A;  4H6U A;  1XMT A;  4XPD C;  5GCN A;  4KLW A;  2HV2 A;  3I9S A;  3IWG A;  2JDC A;  3MGD A;  1QSN A;  3EO4 A;  2J8N A;  4PK2 A;  1S7K A;  1S3Z A;  2B4B A;  4I49 A;  4JD6 A;  2QIR A;  3P2H A;  4XPD B;  4II9 A;  1B87 A;  1QSR A;  4KVX A;  3ZZI A;  1V0C A;  3JVN A;  4MJ8 A;  3C26 A;  2BSW A;  2D4O A;  1XIX A;  2Y0M A;  3W6X A;  4UBR A;  2ZPA A;  3TO7 A;  3B8G A;  1Q2D A;  1P4N A;  3PGP A;  2Q4V A;  2CY2 A;  1QSO A;  2FE7 A;  2J8R A;  3OWC A;  3EXN A;  4FD7 A;  3RYO A;  2VXK A;  2QEC A;  4JXQ A;  3FBU A;  2FIA A;  4OLL A;  1IYL A;  3EY5 A;  4YGO A;  2Z0Z A;  3LD2 A;  3TE4 A;  5HH1 A;  1YX0 A;  3FXT A;  4CAV A;  4FD4 A;  4QUS A;  2C27 A;  3GY9 A;  4LX9 A;  1Z4R A;  2FIW A;  4NCZ A;  3TFY A;  3R96 A;  5KTD A;  4FD5 A;  4UWJ A;  1UFH A;  1MJA A;  2ZW7 A;  4CS0 B;  4BMH A;  1YRE A;  2EVN A;  4NXY A;  4PK3 A;  1KUY A;  5DWM A;  1FY7 A;  4QBJ A;  5CNP A;  4R57 A;  2EUI A;  2OZG A;  3ZJ0 A;  3V8I A;  4GS4 A;  2CNS A;  1Y9K A;  4ORF A;  3FB3 A;  2OZU A;  2X7B A;  1RXT A;  2KCW A;  5KTA A;  2RC4 A;  3CXP A;  5JPH A;  1S60 A;  2BEI A;  2Q0Y A;  2WPW A;  4MI4 A;  2B58 A;  3T9Y A;  3F5B A;  3FYN A;  2AE6 A;  2BUE A;  4KOV A;  2BL1 A;  4IF5 A;  4AG7 A;  4XNH C;  4OAD A;  3PZJ A;  4RS2 A;  3F0A A;  2FSR A;  3D2P A;  4KVM E;  4PSW A;  3N7Z A;  4R87 A;  4CAW A;  5J8F A;  2WPX A;  4AVA A;  3D8P A;  4UWI A;  3TO9 A;  1I21 A;  3QAH A;  3DNS A; 
#chains in the Genus database with same CATH topology
 2ATR A;  4DNC A;  2PR1 A;  2VBQ A;  2B5G B;  3TOA A;  5A27 A;  3TOB A;  1FT7 A;  2QML A;  3B3T A;  4HNW B;  1BOB A;  3TC8 A;  4ZX9 A;  2DPT A;  3PRT A;  4H2K A;  4MHP A;  1ZO0 A;  2Z3K A;  2ZW5 A;  3GUX A;  2FCK A;  2ZEF A;  4FAI A;  2XEI A;  4P44 A;  1XRY A;  1RTQ A;  5G20 A;  1IB1 E;  4DYO A;  3FIX A;  3FRM A;  3H8F A;  1YR0 A;  2O53 A;  3PB8 X;  4HNX B;  3FNC A;  2B4D B;  1KZF A;  3IU1 A;  2VQY A;  3CXS A;  1ELL P;  1X12 A;  4MMO A;  2PQ8 A;  3R95 A;  1S5K A;  2GU2 A;  2V8D A;  4JZ0 A;  4MBU A;  1DTD A;  5IB9 A;  5JM6 A;  5AG7 A;  2B3U A;  3WC6 A;  2CNT A;  4L8A A;  1L0C A;  2ZXV A;  2PJ0 A;  2Q44 A;  5H84 A;  1A2Z A;  4W9Y A;  3PEI A;  2OZH A;  3I3G A;  4GXH A;  4WJB A;  5AG6 A;  1XF8 A;  2ZW4 A;  3MRU A;  4OC1 A;  2OU2 A;  2EBJ A;  3DGV A;  3FEC A;  5K8N A;  4CRZ B;  3CDX A;  1CJW A;  2PIZ A;  1J4J A;  3H4Q A;  3BXM A;  3LWU A;  4MFQ A;  4B5P B;  3LMS A;  4XPK A;  1F2O A;  2P0W A;  2Z3N A;  3JRU A;  4MFJ A;  2OOT A;  3T90 A;  2AFM A;  4B11 A;  1M44 A;  1K4J A;  1AYE A;  3R9G A;  4ZGY B;  4NGQ A;  4Y49 C;  3T8W A;  4OC5 A;  4F8Z A;  4NEX A;  4CYO A;  4LQG A;  2R98 A;  4PSX A;  2J9A A;  1Q7L A;  3H5Z A;  2XEG A;  3KKW A;  4UEE A;  3R1K A;  1KUX A;  5FVJ A;  4A95 A;  4YRH A;  4HPS A;  4PXC A;  4E0A A;  2AJ6 A;  1CG2 A;  3KR4 A;  5IX3 A;  2PJ2 A;  3D3S A;  1IYK A;  4B5O A;  1M4G A;  5HVG A;  2ZEN A;  5ELY A;  1B6B A;  3HUV A;  2HC9 A;  2ZED A;  5CPA A;  3SI0 A;  4F6A A;  4Y49 B;  1EE3 P;  4NGT A;  2H5M A;  2ZOG A;  4EVY A;  4UEF A;  2PRQ A;  3S6F A;  4MHY A;  3TCV A;  1M1D A;  4HNY B;  3WC5 A;  2OB0 A;  2F8H A;  2CXA A;  3IGR A;  4IHM A;  4YFJ A;  4KZT A;  4R3K A;  1AMP A;  2YGW A;  5E96 A;  1PU9 A;  5LRK A;  2GE3 A;  5C82 A;  1YQE A;  2NYQ A;  1VHS A;  2PR8 A;  3BI0 A;  1Z8L A;  4MXU A;  1XEB A;  3V38 A;  4FBE A;  3D7D A;  4YWY A;  3VWE A;  3NH8 A;  4P45 A;  3KI9 A;  4L89 A;  5I4M A;  2C6G A;  2QYV A;  3SI2 A;  4CPA A;  3CZX A;  2PC1 A;  5I0C A;  1Y7R A;  5ISV A;  4A32 A;  4A2Z A;  1YGH A;  1HEE A;  1P0H A;  2RFH A;  4M85 A;  1Y7E A;  1WWZ A;  4MCS A;  5JH9 A;  3L2N A;  3LOD A;  1IIC A;  2V8G A;  1IID A;  4IUS A;  3S6H A;  3TT2 A;  4BIN A;  4KVO E;  1HDQ A;  2FS5 A;  3KGQ A;  4K30 A;  3SJG A;  4CGO A;  1YME A;  1Y9W A;  3IWW A;  1M4L A;  4MHD A;  4KOY A;  5DWN A;  5EC4 A;  3P2F A;  5F47 A;  4MY0 A;  1R43 A;  1YK3 A;  2EO8 A;  3NH5 A;  2BOA A;  2VZY A;  4NSQ A;  3SXN A;  3FF3 A;  3KHZ A;  4IK2 A;  4E2A A;  3S9L A;  2QVP A;  2F5I A;  3KZW A;  3JUW A;  1Z4E A;  2PJ9 A;  1GHE A;  5K8P A;  1YLE A;  4OC0 A;  2HQY A;  2PJ4 A;  4DJL A;  2REE A;  2PVW A;  2Q7S A;  3W6S A;  1CM0 A;  3LAC A;  4JJX A;  4X5K A;  4AG9 A;  4KOR A;  2HUZ A;  4U5Y A;  2PSW A;  3W91 A;  2Z3M A;  1I12 A;  3NE8 A;  4KOU A;  2C6P A;  4M6G A;  1WK4 A;  2PJ5 A;  3PB9 X;  1DE4 C;  3IC1 A;  2Z10 A;  2JBK A;  5H86 A;  3D4U A;  4F9U A;  4U9Y A;  3VH9 A;  3EC4 A;  3H8G A;  4UFW A;  3BJ7 A;  4XNH B;  1QMU A;  4EME A;  4KUA A;  4B13 A;  1XMB A;  1Z8X A;  1UWY A;  4MFP A;  1KWM A;  4JXR A;  2Q4Y A;  3SXO A;  1ZG9 A;  3IFE A;  4R7M A;  5EBV A;  2JDD A;  1S7N A;  3TTH A;  5AG5 A;  2P6E A;  3QB8 A;  1S7F A;  2WSA A;  4X8I A;  1Q2Y A;  1TKJ A;  2ZEM A;  5K8O A;  2WYR A;  3D2M A;  3K9U A;  4MHZ A;  4PQA A;  2PVV A;  1X10 A;  2Q7B A;  3A9L A;  3BJ8 A;  3KL9 A;  3B2Y A;  3GYA A;  4J3G A;  4OKO A;  1YVO A;  4RI1 A;  3DDD A;  2RB7 A;  1YVK A;  4CYQ A;  4PV6 A;  5KTC A;  2O28 A;  4ONU A;  1TIQ A;  2J8M A;  2ZW6 A;  4EFD A;  1LAM A;  1XFO A;  3KAS A;  2AFS A;  3G3S A;  2ZEL A;  2R7H A;  2G3T A;  3NE7 A;  4U9Z A;  5F46 A;  3TX8 A;  1TF9 A;  2EWB A;  4R76 A;  2VEZ A;  5IB0 A;  4MHN A;  4P4B A;  5G22 A;  4G1P A;  2B5G A;  2FT0 A;  4NF1 A;  3E0K A;  1S7L A;  3D66 A;  3DLJ A;  4OC2 A;  3DR6 A;  4B12 A;  1VKC A;  1Z2L A;  2ANP A;  2I3C A;  3N5F A;  1TXR A;  2GFQ A;  2PE3 A;  3D7G A;  4QB9 A;  2I00 A;  1OZP A;  4OAE A;  4UF4 A;  1TKF A;  4HKF A;  2B4D A;  4UFX A;  4M6I A;  1BPM A;  3B35 A;  4MY3 A;  4R9M A;  3RO0 A;  3SHP A;  2PJB A;  4FD6 A;  4ZBG A;  1R57 A;  1ON0 A;  4KUB A;  1ZLI A;  2O4H A;  3BLN A;  3BHX A;  3CT9 A;  2R8V A;  3DR8 A;  2JEV A;  1Z5R A;  1CP7 A;  1QST A;  1LFW A;  2GAN A;  2ZEO A;  3JTK A;  4FUU A;  4MCQ A;  1RO5 A;  4CRY B;  2PJA A;  4P6Y A;  5F48 A;  4A30 A;  4ZYQ A;  4AVB A;  2DEA A;  3S9N A;  3PFO A;  4C68 A;  2CTC A;  2PDO A;  4KOT A;  4B6Z A;  4CAE A;  4A31 A;  4ZI6 A;  2POK A;  4KOW A;  4M3S A;  4O23 A;  3R9E A;  3VWD A;  1QSM A;  2AFU A;  3CXQ A;  1I1D A;  4MFZ A;  4P10 A;  4Q7A A;  2BO9 A;  2K5T A;  2OH1 A;  4B5P A;  5HVH A;  1NSL A;  2FXF A;  5BWA B;  4QC6 A;  2IL4 A;  1ARL A;  4H89 A;  4NGR A;  1N71 A;  1M4I A;  1R3N A;  1PUA A;  4PXE A;  2B3V A;  4KS9 A;  3FVL A;  3S6G A;  5C88 A;  4KOS A;  2I79 A;  4ZY1 A;  4OID A;  5HMN A;  2G3A A;  2JLM A;  3D7F A;  4KLV A;  3H8E A;  2PJ8 A;  4CAX A;  4C7I A;  2FL4 A;  2AFO A;  3F8K A;  1ARM A;  4ONW A;  2GRE A;  3WT4 A;  4R6T A;  2CNM A;  1CPX A;  1OBR A;  3HLP A;  4A94 A;  4UA3 A;  4JLY A;  2Z3L A;  5AG4 A;  4MCP A;  2G0B A;  2D4P A;  3CPA A;  2XEJ A;  3ISZ A;  2VZZ A;  4AB7 A;  1BPN A;  1U6M A;  5EMI A;  1ELM P;  3B7I A;  5F49 A;  3RAM A;  3D68 A;  4C2Z A;  2VL1 A;  1NE9 A;  3SI1 A;  8CPA A;  2A4N A;  2QJ8 A;  2GIV A;  2R1I A;  4LUA A;  2YND A;  4XPL A;  1XOV A;  1MK4 A;  4ZY2 A;  2P6F A;  1MJB A;  2XEF A;  2CIJ A;  4KOX A;  3TO6 A;  3GKR A;  1IGB A;  2EK9 A;  2ZEG A;  2DPS A;  2YNC A;  2Z11 A;  3DSB A;  4AVC A;  4E8O A;  4F9V A;  2OR4 A;  4KSI A;  3EFA A;  3UY5 A;  2JEW A;  1CPS A;  4P4D A;  1LOK A;  4R3L A;  5DS0 A;  4F0Y A;  3PB6 X;  4NJR A;  1LRZ A;  2DXQ A;  3S6K A;  4CGM A;  4X3R A;  1BO4 A;  1FNO A;  3IEH A;  1Q2C A;  1M4D A;  3WR7 A;  1IOI A;  2PJ6 A;  2P6G A;  3MN8 A;  3PB7 X;  2VI7 A;  1IOF A;  2PJ3 A;  1VHO A;  4Z65 A;  2REF A;  4NJQ A;  3R9F A;  2Q04 A;  3K9T A;  4NGM A;  1KUV A;  1TKH A;  3FEE A;  5JGF A;  4B10 A;  3SJX A;  5LYF A;  4JWP A;  4ZY0 A;  1XJO A;  1HDU A;  3PP9 A;  4OP4 A;  5J8C A;  2C1C A;  2ODF A;  2PRB A;  1Z9U A;  2AFZ A;  3NA6 A;  3PFE A;  1MJ9 A;  2FVG A;  3B3W A;  2NMT A;  2C6C A;  3G8W A;  4QVT A;  5JQ4 A;  3NFZ A;  1NMT A;  1XE4 A;  4H6Z A;  2ARH A;  1SQH A;  3IIB A;  3KQZ A;  4NGN A;  2CF4 A;  4H6U A;  1XMT A;  3IU2 A;  5LRG A;  1Z8W A;  4XPD C;  3QAY A;  5GCN A;  4OC3 A;  4KLW A;  2HV2 A;  3I9S A;  3IWG A;  1H8L A;  4P4F A;  2JBJ A;  2JDC A;  4CGP A;  3MGD A;  1QSN A;  4GM5 A;  2Q4Z A;  4EWT A;  4BBH A;  3EO4 A;  4Q36 A;  2J8N A;  4PK2 A;  2IQ6 A;  2ZEE A;  2GLF A;  2PIY A;  4LQ6 A;  1VGY A;  4UCM A;  1S7K A;  1S3Z A;  2B4B A;  4I49 A;  4JD6 A;  2QIR A;  3WC7 A;  3P2H A;  4C7H A;  4CGN A;  4XPD B;  3IWE A;  4II9 A;  1B87 A;  5AGE A;  1QSR A;  4P4J A;  2BCO A;  4KVX A;  3FX6 A;  4TNU A;  4C2Y A;  4UFV A;  3D7H A;  1V0C A;  3BI1 A;  3JVN A;  4KSA A;  4MFL A;  3ZZI A;  4MJ8 A;  3C26 A;  2BSW A;  4PXB A;  1ZG8 A;  1IY7 A;  2D4O A;  2Q51 A;  4PXD A;  3FJU A;  1XIX A;  1VHE A;  2Y0M A;  2G9D A;  3W6X A;  3IO1 A;  4DUK A;  4F0X A;  4UBR A;  4UIB A;  3S9M A;  2ZPA A;  4R8F A;  3IJ3 A;  5CBM A;  2ZEH A;  3TO7 A;  4MFK A;  2IJZ A;  2Q43 A;  3B8G A;  4P4E A;  5THW A;  1AUG A;  5J1Q A;  1Q2D A;  1ZG7 A;  4B14 A;  1P4N A;  4UCP A;  3PGP A;  6CPA A;  2Q4V A;  1LAN A;  2CY2 A;  1QSO A;  2V8V A;  4PPZ A;  2FE7 A;  2J8R A;  4RUH A;  3OWC A;  4OME A;  3EXN A;  4FD7 A;  4YU9 A;  2ABZ A;  4NGP A;  5A28 A;  3PBE A;  3RYO A;  4KSF A;  2VXK A;  2QEC A;  1BAV A;  2ZOF A;  4JXQ A;  3GB0 A;  2WZN A;  4P4I A;  3FED A;  5HVF A;  3FBU A;  2FIA A;  1LCP A;  4OLL A;  1F2P A;  3V7Z A;  1IYL A;  3EY5 A;  2Z3O A;  4YGO A;  2Z0Z A;  3LD2 A;  1ZLH A;  4K3N A;  4TWE A;  4CAF A;  5D29 A;  3VAR A;  3TE4 A;  5HH1 A;  3SJF A;  7CPA A;  1LAP A;  1YX0 A;  2YNC C;  3FXT A;  1JWQ A;  4FD4 A;  4CAV A;  2WUU A;  1Z8T A;  4QUS A;  2PJC A;  4ZX8 A;  2PCU A;  2C27 A;  4UCN A;  3GY9 A;  4UIA A;  3CPX A;  5LYI A;  4LX9 A;  1Z4R A;  2FIW A;  4NCZ A;  3TFY A;  2IMO A;  3RBU A;  3R96 A;  3B3V A;  5KTD A;  4FD5 A;  4IAV A;  3VAT A;  5F09 A;  4UWJ A;  1Y0Y A;  5G21 A;  1UFH A;  4RN7 A;  1MJA A;  2AFX A;  2CTB A;  2YNE A;  2ZW7 A;  3FMC A;  4CS0 B;  4MRI A;  4BMH A;  1VIX A;  1YRE A;  2EVN A;  2EK8 A;  4A37 A;  4NXY A;  2DF5 A;  2V77 A;  4PK3 A;  1KUY A;  5DWM A;  1FY7 A;  4QBJ A;  2F7V A;  5CNP A;  5LYL A;  1GYT A;  2GLJ A;  2PJ7 A;  2EUI A;  2OZG A;  4R57 A;  3SJE A;  3ZJ0 A;  4AXV A;  3V8I A;  5K8M A;  4GS4 A;  2CNS A;  1Y9K A;  1YSJ A;  5HXD A;  4UEZ A;  3KQX A;  5LYD A;  4ORF A;  3FB3 A;  3FH4 A;  1PYT B;  5IV0 A;  2OZU A;  4CGL A;  2X7B A;  3K2K A;  1CX8 A;  4A39 A;  1YW4 A;  1RXT A;  3QNV A;  4NGS A;  2KCW A;  1TF8 A;  3GIU A;  5KTA A;  5LRJ A;  3KR5 A;  2RC4 A;  4CYN A;  4A38 A;  3CXP A;  1JQG A;  5JPH A;  3B3S A;  4Q38 A;  1S60 A;  2BEI A;  4OIW A;  1YW6 A;  3PBB A;  2Q0Y A;  1F57 A;  2WPW A;  4MI4 A;  3WAB A;  2B58 A;  3NH4 A;  3PB4 X;  3F5B A;  3FYN A;  3T9Y A;  4WWV A;  2AE6 A;  2BUE A;  2Z3P A;  3GLJ A;  2AFW A;  4KOV A;  2BL1 A;  4IF5 A;  1XBU A;  4AG7 A;  2ZEP A;  4JYW A;  1PCA A;  2V8H A;  4XNH C;  4OAD A;  3D67 A;  3ISX A;  3RZA A;  1CBX A;  3KHX A;  3PZJ A;  1Y0R A;  4RS2 A;  4BD9 A;  3F0A A;  1CP6 A;  2HB6 A;  5D8N A;  4C2X A;  2FSR A;  3D2P A;  3RNZ A;  4KVM E;  4PSW A;  3N7Z A;  4R87 A;  5G1Z A;  4CAW A;  2NSM A;  2WPX A;  4OC4 A;  5J8F A;  1IU8 A;  4CYP A;  4FWU A;  4AVA A;  4X2T A;  3D8P A;  4A33 A;  3B3C A;  4M6H A;  4UWI A;  4MCR A;  3TO9 A;  4NFR A;  1BLL E;  1YLO A;  3I1U A;  2PJ1 A;  1I21 A;  3QAH A;  1QQ9 A;  3DNS A;  1NSA A; 
#chains in the Genus database with same CATH homology
 2ATR A;  4DNC A;  2PR1 A;  2VBQ A;  2B5G B;  3TOA A;  5A27 A;  3TOB A;  2QML A;  4HNW B;  1BOB A;  2DPT A;  1ZO0 A;  2Z3K A;  2ZW5 A;  2FCK A;  5G20 A;  1IB1 E;  3FIX A;  3FRM A;  1YR0 A;  4HNX B;  3FNC A;  2B4D B;  1KZF A;  3IU1 A;  2VQY A;  3CXS A;  2PQ8 A;  3R95 A;  1S5K A;  4MBU A;  5AG7 A;  2B3U A;  2CNT A;  4L8A A;  1L0C A;  2ZXV A;  2Q44 A;  5H84 A;  2OZH A;  3I3G A;  5AG6 A;  1XF8 A;  2ZW4 A;  2OU2 A;  1CJW A;  1J4J A;  3H4Q A;  4MFQ A;  4B5P B;  4XPK A;  2P0W A;  2Z3N A;  4MFJ A;  3T90 A;  4B11 A;  1M44 A;  1K4J A;  3R9G A;  4ZGY B;  4Y49 C;  4NEX A;  4CYO A;  2R98 A;  4PSX A;  3KKW A;  4CGO A;  3H5Z A;  5IV0 A;  3R1K A;  1KUX A;  5FVJ A;  4A95 A;  4YRH A;  4E0A A;  2AJ6 A;  5IX3 A;  3D3S A;  1IYK A;  4B5O A;  1M4G A;  1B6B A;  4F6A A;  4Y49 B;  2H5M A;  4EVY A;  3S6F A;  3TCV A;  1M1D A;  4HNY B;  2OB0 A;  2CXA A;  3IGR A;  4YFJ A;  4KZT A;  4R3K A;  2YGW A;  5E96 A;  1PU9 A;  2GE3 A;  5C82 A;  1VHS A;  2PR8 A;  1XEB A;  3VWE A;  4L89 A;  2PC1 A;  5I0C A;  1Y7R A;  5ISV A;  4A32 A;  4A2Z A;  1YGH A;  1P0H A;  4M85 A;  1WWZ A;  3LOD A;  1IIC A;  3S6H A;  1IID A;  4IUS A;  4CRZ B;  3TT2 A;  4KVO E;  2FS5 A;  4K30 A;  1Y9W A;  5DWN A;  4MHD A;  4KOY A;  5EC4 A;  5F47 A;  3P2F A;  4MY0 A;  1YK3 A;  3SXN A;  4NSQ A;  2VZY A;  4E2A A;  2F5I A;  3JUW A;  1Z4E A;  1GHE A;  1YLE A;  2HQY A;  2REE A;  3W6S A;  1CM0 A;  4JJX A;  4X5K A;  4AG9 A;  4KOR A;  2HUZ A;  4U5Y A;  2PSW A;  3W91 A;  2Z3M A;  1I12 A;  4KOU A;  1WK4 A;  2Z10 A;  5H86 A;  4U9Y A;  3EC4 A;  4UFW A;  4XNH B;  3BJ7 A;  4KUA A;  4B13 A;  4MFP A;  4JXR A;  2Q4Y A;  3SXO A;  5EBV A;  2JDD A;  1S7N A;  3TTH A;  5AG5 A;  2P6E A;  3QB8 A;  1S7F A;  2WSA A;  1Q2Y A;  3D2M A;  3K9U A;  2Q7B A;  3A9L A;  3BJ8 A;  3GYA A;  4J3G A;  1YVO A;  4RI1 A;  3DDD A;  1YVK A;  4CYQ A;  4PV6 A;  5KTC A;  2O28 A;  4ONU A;  1TIQ A;  2J8M A;  2ZW6 A;  3G3S A;  2R7H A;  2G3T A;  3NE7 A;  4U9Z A;  5F46 A;  2VEZ A;  5IB0 A;  5G22 A;  2B5G A;  2FT0 A;  4NF1 A;  3E0K A;  1S7L A;  3DR6 A;  4B12 A;  1VKC A;  4QB9 A;  2I00 A;  1OZP A;  4OAE A;  4HKF A;  2B4D A;  4UFX A;  4MY3 A;  4R9M A;  3SHP A;  4FD6 A;  4ZBG A;  1R57 A;  1ON0 A;  4KUB A;  3BLN A;  2R8V A;  3DR8 A;  2JEV A;  1QST A;  2GAN A;  3JTK A;  4CRY B;  1RO5 A;  5F48 A;  4A30 A;  4AVB A;  4C68 A;  2PDO A;  4KOT A;  4CAE A;  4A31 A;  4KOW A;  4M3S A;  3VWD A;  3R9E A;  1QSM A;  3CXQ A;  4MFZ A;  1I1D A;  2OH1 A;  2K5T A;  4B5P A;  1NSL A;  2FXF A;  5BWA B;  4QC6 A;  2IL4 A;  4H89 A;  1N71 A;  1M4I A;  1PUA A;  5C88 A;  2B3V A;  4KS9 A;  3S6G A;  5HMN A;  4KOS A;  2I79 A;  2G3A A;  2JLM A;  4KLV A;  4CAX A;  4C7I A;  2FL4 A;  3F8K A;  2CNM A;  4UA3 A;  4JLY A;  2Z3L A;  5AG4 A;  2G0B A;  2D4P A;  2VZZ A;  4AB7 A;  1U6M A;  5F49 A;  4C2Z A;  1NE9 A;  2A4N A;  2R1I A;  2GIV A;  4LUA A;  2YND A;  4XPL A;  1MK4 A;  2P6F A;  1MJB A;  4KOX A;  3TO6 A;  3GKR A;  4E8O A;  3DSB A;  2DPS A;  2YNC A;  2Z11 A;  4AVC A;  3EFA A;  3UY5 A;  4R3L A;  4F0Y A;  1LRZ A;  2DXQ A;  3S6K A;  4CGM A;  1BO4 A;  1Q2C A;  1M4D A;  3WR7 A;  2P6G A;  2VI7 A;  2REF A;  3R9F A;  2Q04 A;  1KUV A;  4B10 A;  4JWP A;  3PP9 A;  5J8C A;  2PRB A;  1Z9U A;  1MJ9 A;  3G8W A;  2NMT A;  4QVT A;  5JQ4 A;  1NMT A;  1XE4 A;  4H6Z A;  2ARH A;  1SQH A;  4H6U A;  1XMT A;  3IU2 A;  4XPD C;  5GCN A;  4KLW A;  2HV2 A;  3I9S A;  3IWG A;  2JDC A;  4CGP A;  3MGD A;  1QSN A;  4BBH A;  3EO4 A;  4Q36 A;  2J8N A;  4PK2 A;  4UCM A;  1S7K A;  1S3Z A;  2B4B A;  4I49 A;  4JD6 A;  2QIR A;  4C7H A;  3P2H A;  4CGN A;  4XPD B;  3IWE A;  4II9 A;  1B87 A;  5AGE A;  1QSR A;  4KVX A;  4C2Y A;  4UFV A;  4MFL A;  1V0C A;  3JVN A;  4KSA A;  3ZZI A;  4MJ8 A;  3C26 A;  2BSW A;  2D4O A;  1XIX A;  2Y0M A;  3W6X A;  4F0X A;  4UBR A;  2ZPA A;  3TO7 A;  4MFK A;  3B8G A;  1Q2D A;  4B14 A;  1P4N A;  4UCP A;  3PGP A;  2Q4V A;  2CY2 A;  1QSO A;  2FE7 A;  2J8R A;  3OWC A;  3EXN A;  4FD7 A;  5A28 A;  3RYO A;  4KSF A;  2VXK A;  2QEC A;  4JXQ A;  3FBU A;  2FIA A;  4OLL A;  1IYL A;  3EY5 A;  2Z3O A;  4YGO A;  2Z0Z A;  3LD2 A;  4CAF A;  3TE4 A;  5HH1 A;  1YX0 A;  2YNC C;  3FXT A;  4CAV A;  4FD4 A;  2WUU A;  4QUS A;  2C27 A;  4UCN A;  3GY9 A;  4LX9 A;  1Z4R A;  2FIW A;  4NCZ A;  3TFY A;  3R96 A;  5KTD A;  4FD5 A;  4UWJ A;  5G21 A;  1UFH A;  1MJA A;  2ZW7 A;  2YNE A;  4CS0 B;  4BMH A;  1YRE A;  2EVN A;  4NXY A;  4PK3 A;  1KUY A;  5DWM A;  1FY7 A;  4QBJ A;  5CNP A;  4R57 A;  2EUI A;  2OZG A;  3ZJ0 A;  3V8I A;  4GS4 A;  2CNS A;  1Y9K A;  4ORF A;  3FB3 A;  2OZU A;  4CGL A;  2X7B A;  1RXT A;  2KCW A;  5KTA A;  2RC4 A;  4CYN A;  3CXP A;  5JPH A;  4Q38 A;  1S60 A;  2BEI A;  2Q0Y A;  2WPW A;  4MI4 A;  2B58 A;  3T9Y A;  3F5B A;  3FYN A;  2AE6 A;  2BUE A;  2Z3P A;  4KOV A;  2BL1 A;  4IF5 A;  4AG7 A;  4XNH C;  4OAD A;  3PZJ A;  4RS2 A;  3F0A A;  4C2X A;  2FSR A;  3D2P A;  4KVM E;  4PSW A;  3N7Z A;  4R87 A;  5G1Z A;  4CAW A;  5J8F A;  2WPX A;  4CYP A;  4AVA A;  3D8P A;  4A33 A;  4UWI A;  3TO9 A;  1I21 A;  3QAH A;  3DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...