2WUUA

Structure of n-myristoyltransferase from l. donovani
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
402
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVESMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Myristoyltransferase from Leishmania Donovani: Structural and Functional Characterisation of a Potential Drug Target for Visceral Leishmaniasis.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
molecule keywords N-MYRISTOYLTRANSFERASE
total genus 125
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wuuA00
4C7HA 4CGLA 4A32A 3IWEA 2YNCA 5G22A 4CYNA 5A27A 4UCPA 5G21A 2YNDA 4A2ZA 2WUUA 4UFXA 5AG4A 4B10A 4CYQA 5G1ZA 4C68A 4UCMA 5AG5A 5A28A 2YNCC 4B14A 4C2ZA 4C2XA 4B13A 4CAFA 3IU1A 4CGNA 4B11A 4CAEA 4A30A 4B12A 4CYPA 4CGOA 4UFWA 4C7IA 4C2YA 2YNEA 2WSAA 4BBHA 4A31A 3H5ZA 4CGPA 4UCNA 5AG7A 4UFVA 5AG6A 4CGMA 4CYOA 4A33A 4A95A 3IU2A 5G20A 3JTKA 5AGEA
chains in the Genus database with same CATH superfamily
2Z0ZA 3D68A 3PRTA 4MHYA 2PQ8A 4OIWA 4MBUA 2HB6A 2NYQA 2ODFA 2WZNA 3RNZA 5IB0A 5LRGA 4A2ZA 5D8NA 3SJXA 3N7ZA 2C1CA 3IC1A 3JRUA 4IF5A 4OC1A 4MCPA 2CNSA 2D4PA 2Q4ZA 4A37A 4ZGYB 3LACA 2JBJA 4LQGA 4GXHA 1BPMA 5C88A 2HV2A 3IEHA 3I1UA 4FD6A 2JBKA 4QUSA 2PJ4A 2WSAA 1VHSA 4M6HA 1CBXA 3SJGA 2C27A 3BJ8A 1YLOA 3B3SA 3QAYA 2DPTA 4R76A 4A95A 3IIBA 3IWWA 2C6CA 2ZEFA 1AMPA 5LYFA 3NE8A 4NFRA 1YR0A 2QJ8A 1RO5A 1ZG9A 3G3SA 4P45A 4XPDC 4AVBA 2B3UA 2PJ5A 5F46A 3MRUA 4MHNA 3TX8A 2QIRA 3ZZIA 1MJ9A 2J8NA 4KUAA 2PJ3A 1S60A 2DEAA 3BHXA 2GU2A 2BSWA 4MRIA 1XJOA 2Z3LA 1S7LA 1NE9A 1QSRA 2PRBA 4U9YA 4CRYB 4KSFA 3NFZA 5K8OA 3BJ7A 3FX6A 2OZGA 3PB7X 2H5MA 1DE4C 2I3CA 4OMEA 1S3ZA 3KR4A 2CF4A 3H8GA 1ON0A 3FB3A 2AFZA 1S7NA 4MY0A 5AG7A 1IIDA 3ISXA 1YSJA 4NJRA 2F7VA 2FT0A 1Y7RA 4L89A 4XPKA 4UEFA 2GREA 3S9MA 3D7FA 2V8VA 2G3TA 3P2FA 4IAVA 1LFWA 5G21A 4P44A 3JUWA 4A39A 2AJ6A 1ZG7A 4NGQA 1CP7A 3WT4A 2ZOFA 3N5FA 3CPAA 4UFXA 5F48A 5LRJA 3D66A 4IK2A 3H4QA 4B5OA 1N71A 1YLEA 2ZEDA 3IU1A 4CGNA 4CGOA 5I4MA 2HQYA 2Z11A 3MN8A 4JJXA 4MFPA 8CPAA 1BLLE 4CRZB 3LODA 4H6UA 1VKCA 2BCOA 5LYLA 1MJAA 4DUKA 3ZJ0A 2I00A 5JPHA 1I12A 1XEBA 4XPDB 2XEFA 4R3LA 4EMEA 1I1DA 1Q2DA 2Q4VA 1XIXA 4CYNA 4UA3A 4KSAA 4FD7A 3S6FA 5F09A 3PB6X 4P10A 4BINA 3D2PA 4CGMA 4YGOA 2Z3NA 4BD9A 2VZZA 3FH4A 5AG5A 2BEIA 2YNCC 3VWDA 4E0AA 4B13A 2DXQA 4MFLA 4P4IA 3PB8X 1LOKA 2P6GA 4NGRA 1Z5RA 2RC4A 3IJ3A 4M85A 4MFJA 3T8WA 4MJ8A 4KZTA 1Z2LA 3SI0A 2ZW5A 2Q51A 4JLYA 3FVLA 3GYAA 3KR5A 3NE7A 4B5PA 4RS2A 2P0WA 2FIWA 1NSLA 1Q2CA 5E96A 4EVYA 4NGMA 4RUHA 1LAMA 1M4DA 1QMUA 2ZW7A 4OC5A 1QSOA 3KQXA 4UCPA 1LRZA 3KZWA 5IX3A 4A94A 5ELYA 1IOFA 2ABZA 4NGPA 1Z9UA 2V8HA 1VGYA 1I21A 4CAFA 3PBEA 4IHMA 5J8CA 5JQ4A 2Y0MA 5KTCA 2IMOA 1M4GA 5THWA 1Z8LA 1WWZA 4H6ZA 3D67A 1TF9A 2HC9A 4UFVA 3B3WA 2D4OA 5J1QA 1IY7A 1Z8WA 4UIBA 1P4NA 2P6FA 2AE6A 2KCWA 3S6HA 4M6IA 1Y0RA 2Z3PA 3SXOA 2Q0YA 4AVAA 3B3VA 2B58A 2CNTA 3QAHA 3V8IA 3DR8A 4TWEA 3D7HA 1XF8A 1F2PA 3FECA 4J3GA 5GCNA 2CNMA 2BOAA 3CDXA 1X12A 3IFEA 4Y49B 3PBBA 3EFAA 3B3CA 4HKFA 3R9FA 1XFOA 1IICA 2VL1A 3RO0A 5JH9A 4C2XA 2CIJA 2ANPA 3R9EA 4NJQA 3ISZA 3CPXA 2ZELA 1TF8A 3DDDA 5LYDA 3TC8A 4YWYA 3B7IA 4JWPA 3VATA 4EFDA 3I3GA 3K9UA 2JDDA 3CXQA 1RTQA 4Q36A 3S9LA 3PP9A 4NGSA 3TOBA 1Y9KA 2PRQA 3EO4A 2BL1A 3IU2A 4U5YA 4XNHB 3WR7A 4OC2A 1IGBA 5HVFA 2PJ8A 4AG9A 3GB0A 3SJFA 4F0YA 4P4BA 1HDQA 3B3TA 3KASA 2PJ2A 5HVGA 3F0AA 2CTBA 1M44A 1M4IA 3CT9A 1YREA 1GYTA 2Q04A 1CG2A 2FXFA 3OWCA 3C26A 2C6GA 4HPSA 4MCQA 2OZUA 4MMOA 4CAVA 2ZPAA 2YGWA 2AFSA 2OZHA 3K9TA 4KOSA 4C68A 3BLNA 4UCMA 4Y49C 4YRHA 4H2KA 4FWUA 4W9YA 3PZJA 2Q44A 4B12A 4R3KA 1XMTA 3CXPA 4K3NA 4A31A 1ZLHA 4YU9A 3FEDA 4PV6A 3T9YA 2O4HA 2QVPA 4F9UA 3WC7A 1B6BA 1YMEA 4KOVA 1YGHA 3IGRA 2FCKA 1R43A 4PSWA 3GIUA 3SXNA 2ZXVA 2QMLA 4AVCA 2Z10A 2G9DA 2GANA 2IL4A 2WPXA 1Z8XA 4PK3A 5LYIA 4R57A 2REEA 3WC6A 5HVHA 1L0CA 4CYQA 3RZAA 5FVJA 5EMIA 5F47A 1Q2YA 3DGVA 2FIAA 4KOXA 4A38A 1FT7A 2ZW6A 2GIVA 3I9SA 4A30A 5CPAA 3EXNA 3SI1A 1QSNA 2Q43A 2ZEGA 3MGDA 1KUXA 4UFWA 1R3NA 1YVKA 2G3AA 4RI1A 4CGPA 5JM6A 3B35A 2PR8A 5I0CA 4KS9A 4TNUA 1TXRA 2B5GA 3H8EA 3B2YA 3CXSA 1F2OA 2IJZA 4HNWB 2I79A 1VHOA 2XEGA 4PQAA 5A27A 3PB4X 3FYNA 4E2AA 4PXCA 2YNDA 4PXBA 3UY5A 4AXVA 1EE3P 2V8DA 2WUUA 1HDUA 4PXEA 4X5KA 1VIXA 4X3RA 2GE3A 1ARLA 2FSRA 1CX8A 2JDCA 2VZYA 5G1ZA 4MI4A 3FMCA 2XEIA 4G1PA 1PUAA 2PJCA 4B11A 1LANA 2OH1A 4CAEA 2NSMA 1PCAA 2Q7SA 3S6GA 1U6MA 2PVVA 3L2NA 3VH9A 3TFYA 2GLJA 4MFQA 1QQ9A 2O53A 2R1IA 3H5ZA 4R87A 3TT2A 4IUSA 5AG6A 2PVWA 1SQHA 1Z8TA 4OKOA 2JLMA 4MXUA 2VBQA 4YFJA 4LUAA 5CNPA 2C6PA 4MHPA 3K2KA 1HEEA 2Z3MA 4KOUA 1V0CA 4R6TA 2BO9A 5DWMA 4CGLA 1P0HA 1S7FA 1JQGA 2F8HA 2PJ6A 1RXTA 1ARMA 3D3SA 4NGNA 4QB9A 2VI7A 2FS5A 1ELLP 2V8GA 2JEWA 1ZO0A 3D2MA 3V7ZA 3R9GA 3FEEA 4NXYA 3DR6A 2FVGA 4JD6A 2PJ1A 4K30A 2PDOA 3R96A 4F9VA 3KL9A 3LMSA 2REFA 1X10A 3TO7A 3NA6A 1TKJA 4ZI6A 4C2YA 2ZEEA 2V77A 4NCZA 4ONUA 4F0XA 3EY5A 4X2TA 1DTDA 1VHEA 1MJBA 1WK4A 2Z3OA 4CYOA 4FBEA 2R98A 2NMTA 2PIZA 1YVOA 4UF4A 4FAIA 3JTKA 1BAVA 1TIQA 1KUVA 2QYVA 2J9AA 4OC4A 1Y0YA 2ZEPA 4ONWA 3D7GA 3QNVA 5EBVA 3TO9A 2R7HA 3D8PA 1UFHA 4HNYB 1TKFA 3R95A 4KLVA 4OC0A 3P2HA 2DF5A 2HUZA 3DSBA 4KOYA 2B4BA 4X8IA 5HMNA 3S6KA 1OZPA 2PJAA 2PIYA 1J4JA 4P6YA 3E0KA 2CXAA 4E8OA 5A28A 3W91A 3KKWA 2RFHA 4Q38A 1F57A 5ISVA 2B4DB 4ZY2A 3EC4A 2PCUA 1UWYA 4O23A 4DJLA 3PFOA 4GS4A 3VARA 2YNEA 4FD4A 1H8LA 1BO4A 5F49A 3PB9X 3TTHA 5EC4A 3F5BA 2PSWA 1K4JA 2EWBA 1NMTA 3B8GA 4PSXA 1MK4A 4KOWA 2AFUA 4UWJA 2X7BA 2OR4A 1ZLIA 1FY7A 2XEJA 4AG7A 1Y7EA 1CP6A 3BI1A 3NH8A 3RBUA 4PPZA 1NSAA 1BOBA 2AFWA 2PJ0A 4Z65A 3H8FA 2GLFA 3SHPA 2ZW4A 4OLLA 4OAEA 2JEVA 2EK9A 2POKA 5H86A 4B14A 4XPLA 1M4LA 4CS0B 2PJ9A 4NEXA 4NSQA 1FNOA 5HH1A 3KI9A 4CYPA 4KORA 1BPNA 1CJWA 2OB0A 1AYEA 1XRYA 5HXDA 2WPWA 1XMBA 1QSTA 4F8ZA 4KLWA 4QVTA 2P6EA 2B3VA 4MHZA 2VXKA 4P4JA 1PU9A 4OC3A 5LRKA 4A32A 1XBUA 3D7DA 4UIAA 3W6XA 4ZY1A 2YNCA 3BI0A 4R7MA 6CPAA 2AFXA 1JWQA 3SI2A 4QBJA 2EUIA 1LAPA 4ZX9A 2ZEHA 2ZENA 2QECA 1OBRA 3TCVA 3V38A 1PYTB 4B10A 4UEZA 2EK8A 2PC1A 5D29A 4C2ZA 3KQZA 4JXRA 2PJBA 3GY9A 3HUVA 4KVXA 4CAWA 4KOTA 2ZEMA 2F5IA 2DPSA 2ARHA 4WWVA 4FD5A 4ORFA 4OP4A 3T90A 4BMHA 2AFOA 1B87A 2WYRA 1XE4A 3FRMA 1S7KA 4KUBA 4MY3A 4QC6A 2A4NA 2VQYA 4H89A 4C7HA 2O28A 4U9ZA 7CPAA 2Q4YA 4JXQA 3NH4A 1GHEA 2OOTA 4M3SA 4B6ZA 3FF3A 4PXDA 3PGPA 4LQ6A 1IYKA 1R57A 3TO6A 1Q7LA 1YQEA 1Y9WA 2OU2A 1Z4RA 3KHZA 1ELMP 4ZX8A 4P4FA 2BUEA 3PEIA 1ZG8A 4R8FA 1Z4EA 3KHXA 4C7IA 2IQ6A 3WC5A 4DYOA 3TE4A 5JGFA 4ZY0A 1YW6A 4UWIA 3W6SA 3TOAA 1KUYA 1YX0A 4I49A 3LD2A 1XOVA 4MHDA 3CZXA 3D4UA 4II9A 2EO8A 3FXTA 3GKRA 4KVOE 2PE3A 4OADA 2AFMA 4JYWA 3KGQA 2ZOGA 4M6GA 4P4DA 5KTAA 2GFQA 3FJUA 3RYOA 4AB7A 1TKHA 4ZBGA 3SJEA 3LWUA 1YW4A 5K8PA 4XNHC 2PJ7A 1CPSA 1QSMA 4R9MA 4F6AA 1IOIA 4GM5A 5BWAB 4P4EA 3HLPA 3JVNA 4FUUA 4NGTA 5K8NA 4ZYQA 4NF1A 3GLJA 3VWEA 5J8FA 2RB7A 4KVME 3A9LA 2PR1A 3R1KA 4BBHA 2Q7BA 1LCPA 5DS0A 1M1DA 3S9NA 1IB1E 4UEEA 4MCRA 2G0BA 1CM0A 2J8RA 3F8KA 4DNCA 3DLJA 2FL4A 2ATRA 1IYLA 1KZFA 3GUXA 2EBJA 4WJBA 5C82A 5IB9A 1S5KA 3IWEA 2B5GB 2FE7A 4PK2A 3IO1A 5G22A 4LX9A 4MFKA 5H84A 4EWTA 5KTDA 4B5PB 4UBRA 5DWNA 4CPAA 3DNSA 4MCSA 2J8MA 4JZ0A 3RAMA 4HNXB 2EVNA 2R8VA 2ZEOA 3QB8A 3FIXA 5AG4A 3FBUA 4OIDA 4KSIA 1KWMA 2CY2A 3IWGA 3PFEA 1AUGA 4MFZA 3NH5A 1YK3A 2VEZA 2CTCA 5CBMA 5IV0A 2K5TA 3FNCA 3WABA 1CPXA 2Z3KA 2B4DA 3G8WA 4UCNA 4CAXA 1IU8A 3BXMA 4A33A 1A2ZA 4L8AA 4Q7AA 4RN7A 5AGEA 5G20A 5K8MA
chains in the Genus database with same CATH topology
2Z0ZA 2PQ8A 4MBUA 5IB0A 4A2ZA 3N7ZA 4IF5A 2CNSA 2D4PA 4ZGYB 5C88A 2HV2A 4FD6A 4QUSA 2WSAA 1VHSA 2C27A 3BJ8A 2DPTA 4A95A 1YR0A 3G3SA 1RO5A 5F46A 4XPDC 4AVBA 2B3UA 2QIRA 3ZZIA 1MJ9A 2J8NA 4KUAA 1S60A 2BSWA 2Z3LA 1S7LA 1NE9A 1QSRA 2PRBA 4U9YA 4CRYB 4KSFA 3BJ7A 2OZGA 2H5MA 1S3ZA 1ON0A 3FB3A 4MY0A 1S7NA 5AG7A 1IIDA 2FT0A 1Y7RA 4L89A 4XPKA 2G3TA 3P2FA 5G21A 3JUWA 2AJ6A 5F48A 4UFXA 3H4QA 4B5OA 1N71A 1YLEA 3IU1A 4CGNA 4CGOA 4MFPA 2HQYA 2Z11A 4JJXA 4CRZB 3LODA 4H6UA 1VKCA 1MJAA 3ZJ0A 2I00A 5JPHA 1I12A 1XEBA 4XPDB 4R3LA 1I1DA 1Q2DA 2Q4VA 1XIXA 4CYNA 4UA3A 4KSAA 4FD7A 3S6FA 3D2PA 4YGOA 2Z3NA 2VZZA 5AG5A 2BEIA 2YNCC 3VWDA 4E0AA 4B13A 2DXQA 4MFLA 2P6GA 4M85A 2RC4A 4MFJA 4MJ8A 4KZTA 2ZW5A 4JLYA 3GYAA 3NE7A 4B5PA 4RS2A 2P0WA 2FIWA 1NSLA 1Q2CA 5E96A 4EVYA 1M4DA 2ZW7A 4UCPA 5IX3A 1QSOA 1LRZA 1Z9UA 1I21A 4CAFA 5J8CA 5JQ4A 2Y0MA 5KTCA 1M4GA 4H6ZA 1WWZA 4UFVA 2D4OA 1P4NA 2P6FA 2AE6A 2KCWA 3S6HA 2Z3PA 3SXOA 2Q0YA 4AVAA 2B58A 2CNTA 3QAHA 3V8IA 3DR8A 1XF8A 4J3GA 5GCNA 2CNMA 4Y49B 3EFAA 4HKFA 3R9FA 1IICA 4C2XA 3R9EA 3DDDA 4JWPA 3I3GA 3K9UA 2JDDA 3CXQA 4Q36A 3PP9A 3TOBA 1Y9KA 4U5YA 3EO4A 2BL1A 3IU2A 4XNHB 3WR7A 4AG9A 4F0YA 3F0AA 1M44A 1M4IA 1YREA 2FXFA 2Q04A 3OWCA 3C26A 2OZUA 4CAVA 2ZPAA 2YGWA 2OZHA 4KOSA 4C68A 3BLNA 4UCMA 4Y49C 4YRHA 3PZJA 2Q44A 4B12A 4R3KA 1XMTA 3CXPA 4A31A 4PV6A 3T9YA 1B6BA 4KOVA 1YGHA 3IGRA 2FCKA 4PSWA 3SXNA 2ZXVA 2QMLA 4AVCA 2Z10A 2GANA 2IL4A 2WPXA 4PK3A 4R57A 2REEA 1L0CA 4CYQA 5FVJA 5F47A 1Q2YA 2FIAA 4KOXA 4A30A 2ZW6A 2GIVA 3I9SA 3EXNA 1QSNA 3MGDA 4UFWA 1KUXA 1YVKA 2G3AA 4RI1A 5I0CA 2PR8A 4KS9A 2B5GA 3CXSA 4HNWB 2I79A 5A27A 3FYNA 4E2AA 2YNDA 3UY5A 2WUUA 4X5KA 2GE3A 2VZYA 2FSRA 2JDCA 5G1ZA 4MI4A 1PUAA 4B11A 4CAEA 2OH1A 3S6GA 1U6MA 3TFYA 4MFQA 2R1IA 4R87A 3H5ZA 3TT2A 4IUSA 5AG6A 1SQHA 4YFJA 2JLMA 2VBQA 4LUAA 5CNPA 2Z3MA 4KOUA 1V0CA 5DWMA 4CGLA 1P0HA 1S7FA 3D3SA 1RXTA 4QB9A 2VI7A 2FS5A 1ZO0A 3D2MA 3R9GA 4NXYA 3DR6A 4JD6A 4K30A 3R96A 2PDOA 2REFA 3TO7A 4C2YA 4NCZA 4ONUA 4F0XA 3EY5A 1MJBA 1WK4A 2Z3OA 4CYOA 2R98A 2NMTA 1YVOA 3JTKA 1TIQA 1KUVA 5EBVA 3TO9A 2R7HA 3D8PA 1UFHA 4HNYB 3R95A 4KLVA 3P2HA 2HUZA 3DSBA 4KOYA 5HMNA 2B4BA 3S6KA 1OZPA 1J4JA 4E8OA 3E0KA 2CXAA 5A28A 3W91A 3KKWA 4Q38A 5ISVA 2B4DB 3EC4A 4GS4A 2YNEA 4FD4A 1BO4A 5F49A 3TTHA 5EC4A 3F5BA 1K4JA 2PSWA 1NMTA 3B8GA 4PSXA 1MK4A 4KOWA 4UWJA 2X7BA 1FY7A 4AG7A 1BOBA 3SHPA 2ZW4A 4OLLA 4OAEA 2JEVA 5H86A 4B14A 4XPLA 4CS0B 4NEXA 4NSQA 5HH1A 4CYPA 4KORA 1CJWA 2OB0A 2WPWA 1QSTA 4KLWA 4QVTA 2P6EA 2B3VA 2VXKA 1PU9A 4A32A 3W6XA 2YNCA 4QBJA 2EUIA 2QECA 3TCVA 4B10A 2PC1A 4C2ZA 4JXRA 3GY9A 4KVXA 4CAWA 4KOTA 2F5IA 2DPSA 2ARHA 4FD5A 4ORFA 3T90A 4BMHA 1B87A 1XE4A 3FRMA 1S7KA 4KUBA 4MY3A 4QC6A 2A4NA 2VQYA 4H89A 4C7HA 2O28A 4U9ZA 2Q4YA 4JXQA 1GHEA 4M3SA 3PGPA 1IYKA 1R57A 3TO6A 2OU2A 1Y9WA 1Z4RA 2BUEA 1Z4EA 4C7IA 3TE4A 4UWIA 3W6SA 4CGMA 3TOAA 1KUYA 1YX0A 4I49A 3LD2A 4MHDA 4CGPA 4II9A 3FXTA 3GKRA 4KVOE 4OADA 5KTAA 3RYOA 4AB7A 4ZBGA 4XNHC 1QSMA 4R9MA 4F6AA 5BWAB 3JVNA 4NF1A 5J8FA 3VWEA 4KVME 3A9LA 2PR1A 3R1KA 4BBHA 2Q7BA 1M1DA 1IB1E 2G0BA 1CM0A 2J8RA 3F8KA 4DNCA 2FL4A 2ATRA 1IYLA 1KZFA 5C82A 1S5KA 3IWEA 2B5GB 2FE7A 4PK2A 5G22A 5H84A 4LX9A 4MFKA 5KTDA 4B5PB 4UBRA 5DWNA 3DNSA 2J8MA 4HNXB 2EVNA 2R8VA 3QB8A 5AG4A 3FIXA 3FBUA 2CY2A 3IWGA 4MFZA 1YK3A 2VEZA 5IV0A 2K5TA 3FNCA 2Z3KA 2B4DA 3G8WA 4UCNA 4CAXA 4A33A 4L8AA 5G20A 5AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7H A;  4CGL A;  4A32 A;  3IWE A;  2YNC A;  5G22 A;  4CYN A;  5A27 A;  4UCP A;  5G21 A;  2YND A;  4A2Z A;  2WUU A;  4UFX A;  5AG4 A;  4B10 A;  4CYQ A;  5G1Z A;  4C68 A;  4UCM A;  5AG5 A;  5A28 A;  2YNC C;  4B14 A;  4C2Z A;  4C2X A;  4B13 A;  4CAF A;  3IU1 A;  4CGN A;  4B11 A;  4CAE A;  4A30 A;  4B12 A;  4CYP A;  4CGO A;  4UFW A;  4C7I A;  4C2Y A;  2YNE A;  2WSA A;  4BBH A;  4A31 A;  3H5Z A;  4CGP A;  4UCN A;  5AG7 A;  4UFV A;  5AG6 A;  4CGM A;  4CYO A;  4A33 A;  4A95 A;  3IU2 A;  5G20 A;  3JTK A;  5AGE A; 
#chains in the Genus database with same CATH topology
 2Z0Z A;  3D68 A;  3PRT A;  4MHY A;  2PQ8 A;  4OIW A;  4MBU A;  2HB6 A;  2NYQ A;  2ODF A;  2WZN A;  3RNZ A;  5IB0 A;  5LRG A;  4A2Z A;  5D8N A;  3SJX A;  3N7Z A;  2C1C A;  3IC1 A;  3JRU A;  4IF5 A;  4OC1 A;  4MCP A;  2CNS A;  2D4P A;  2Q4Z A;  4A37 A;  4ZGY B;  3LAC A;  2JBJ A;  4LQG A;  4GXH A;  1BPM A;  5C88 A;  2HV2 A;  3IEH A;  3I1U A;  4FD6 A;  2JBK A;  4QUS A;  2PJ4 A;  2WSA A;  1VHS A;  4M6H A;  1CBX A;  3SJG A;  2C27 A;  3BJ8 A;  1YLO A;  3B3S A;  3QAY A;  2DPT A;  4R76 A;  4A95 A;  3IIB A;  3IWW A;  2C6C A;  2ZEF A;  1AMP A;  5LYF A;  3NE8 A;  4NFR A;  1YR0 A;  2QJ8 A;  1RO5 A;  1ZG9 A;  3G3S A;  4P45 A;  4XPD C;  4AVB A;  2B3U A;  2PJ5 A;  5F46 A;  3MRU A;  4MHN A;  3TX8 A;  2QIR A;  3ZZI A;  1MJ9 A;  2J8N A;  4KUA A;  2PJ3 A;  1S60 A;  2DEA A;  3BHX A;  2GU2 A;  2BSW A;  4MRI A;  1XJO A;  2Z3L A;  1S7L A;  1NE9 A;  1QSR A;  2PRB A;  4U9Y A;  4CRY B;  4KSF A;  3NFZ A;  5K8O A;  3BJ7 A;  3FX6 A;  2OZG A;  3PB7 X;  2H5M A;  1DE4 C;  2I3C A;  4OME A;  1S3Z A;  3KR4 A;  2CF4 A;  3H8G A;  1ON0 A;  3FB3 A;  2AFZ A;  1S7N A;  4MY0 A;  5AG7 A;  1IID A;  3ISX A;  1YSJ A;  4NJR A;  2F7V A;  2FT0 A;  1Y7R A;  4L89 A;  4XPK A;  4UEF A;  2GRE A;  3S9M A;  3D7F A;  2V8V A;  2G3T A;  3P2F A;  4IAV A;  1LFW A;  5G21 A;  4P44 A;  3JUW A;  4A39 A;  2AJ6 A;  1ZG7 A;  4NGQ A;  1CP7 A;  3WT4 A;  2ZOF A;  3N5F A;  3CPA A;  4UFX A;  5F48 A;  5LRJ A;  3D66 A;  4IK2 A;  3H4Q A;  4B5O A;  1N71 A;  1YLE A;  2ZED A;  3IU1 A;  4CGN A;  4CGO A;  5I4M A;  2HQY A;  2Z11 A;  3MN8 A;  4JJX A;  4MFP A;  8CPA A;  1BLL E;  4CRZ B;  3LOD A;  4H6U A;  1VKC A;  2BCO A;  5LYL A;  1MJA A;  4DUK A;  3ZJ0 A;  2I00 A;  5JPH A;  1I12 A;  1XEB A;  4XPD B;  2XEF A;  4R3L A;  4EME A;  1I1D A;  1Q2D A;  2Q4V A;  1XIX A;  4CYN A;  4UA3 A;  4KSA A;  4FD7 A;  3S6F A;  5F09 A;  3PB6 X;  4P10 A;  4BIN A;  3D2P A;  4CGM A;  4YGO A;  2Z3N A;  4BD9 A;  2VZZ A;  3FH4 A;  5AG5 A;  2BEI A;  2YNC C;  3VWD A;  4E0A A;  4B13 A;  2DXQ A;  4MFL A;  4P4I A;  3PB8 X;  1LOK A;  2P6G A;  4NGR A;  1Z5R A;  2RC4 A;  3IJ3 A;  4M85 A;  4MFJ A;  3T8W A;  4MJ8 A;  4KZT A;  1Z2L A;  3SI0 A;  2ZW5 A;  2Q51 A;  4JLY A;  3FVL A;  3GYA A;  3KR5 A;  3NE7 A;  4B5P A;  4RS2 A;  2P0W A;  2FIW A;  1NSL A;  1Q2C A;  5E96 A;  4EVY A;  4NGM A;  4RUH A;  1LAM A;  1M4D A;  1QMU A;  2ZW7 A;  4OC5 A;  1QSO A;  3KQX A;  4UCP A;  1LRZ A;  3KZW A;  5IX3 A;  4A94 A;  5ELY A;  1IOF A;  2ABZ A;  4NGP A;  1Z9U A;  2V8H A;  1VGY A;  1I21 A;  4CAF A;  3PBE A;  4IHM A;  5J8C A;  5JQ4 A;  2Y0M A;  5KTC A;  2IMO A;  1M4G A;  5THW A;  1Z8L A;  1WWZ A;  4H6Z A;  3D67 A;  1TF9 A;  2HC9 A;  4UFV A;  3B3W A;  2D4O A;  5J1Q A;  1IY7 A;  1Z8W A;  4UIB A;  1P4N A;  2P6F A;  2AE6 A;  2KCW A;  3S6H A;  4M6I A;  1Y0R A;  2Z3P A;  3SXO A;  2Q0Y A;  4AVA A;  3B3V A;  2B58 A;  2CNT A;  3QAH A;  3V8I A;  3DR8 A;  4TWE A;  3D7H A;  1XF8 A;  1F2P A;  3FEC A;  4J3G A;  5GCN A;  2CNM A;  2BOA A;  3CDX A;  1X12 A;  3IFE A;  4Y49 B;  3PBB A;  3EFA A;  3B3C A;  4HKF A;  3R9F A;  1XFO A;  1IIC A;  2VL1 A;  3RO0 A;  5JH9 A;  4C2X A;  2CIJ A;  2ANP A;  3R9E A;  4NJQ A;  3ISZ A;  3CPX A;  2ZEL A;  1TF8 A;  3DDD A;  5LYD A;  3TC8 A;  4YWY A;  3B7I A;  4JWP A;  3VAT A;  4EFD A;  3I3G A;  3K9U A;  2JDD A;  3CXQ A;  1RTQ A;  4Q36 A;  3S9L A;  3PP9 A;  4NGS A;  3TOB A;  1Y9K A;  2PRQ A;  3EO4 A;  2BL1 A;  3IU2 A;  4U5Y A;  4XNH B;  3WR7 A;  4OC2 A;  1IGB A;  5HVF A;  2PJ8 A;  4AG9 A;  3GB0 A;  3SJF A;  4F0Y A;  4P4B A;  1HDQ A;  3B3T A;  3KAS A;  2PJ2 A;  5HVG A;  3F0A A;  2CTB A;  1M44 A;  1M4I A;  3CT9 A;  1YRE A;  1GYT A;  2Q04 A;  1CG2 A;  2FXF A;  3OWC A;  3C26 A;  2C6G A;  4HPS A;  4MCQ A;  2OZU A;  4MMO A;  4CAV A;  2ZPA A;  2YGW A;  2AFS A;  2OZH A;  3K9T A;  4KOS A;  4C68 A;  3BLN A;  4UCM A;  4Y49 C;  4YRH A;  4H2K A;  4FWU A;  4W9Y A;  3PZJ A;  2Q44 A;  4B12 A;  4R3K A;  1XMT A;  3CXP A;  4K3N A;  4A31 A;  1ZLH A;  4YU9 A;  3FED A;  4PV6 A;  3T9Y A;  2O4H A;  2QVP A;  4F9U A;  3WC7 A;  1B6B A;  1YME A;  4KOV A;  1YGH A;  3IGR A;  2FCK A;  1R43 A;  4PSW A;  3GIU A;  3SXN A;  2ZXV A;  2QML A;  4AVC A;  2Z10 A;  2G9D A;  2GAN A;  2IL4 A;  2WPX A;  1Z8X A;  4PK3 A;  5LYI A;  4R57 A;  2REE A;  3WC6 A;  5HVH A;  1L0C A;  4CYQ A;  3RZA A;  5FVJ A;  5EMI A;  5F47 A;  1Q2Y A;  3DGV A;  2FIA A;  4KOX A;  4A38 A;  1FT7 A;  2ZW6 A;  2GIV A;  3I9S A;  4A30 A;  5CPA A;  3EXN A;  3SI1 A;  1QSN A;  2Q43 A;  2ZEG A;  3MGD A;  1KUX A;  4UFW A;  1R3N A;  1YVK A;  2G3A A;  4RI1 A;  4CGP A;  5JM6 A;  3B35 A;  2PR8 A;  5I0C A;  4KS9 A;  4TNU A;  1TXR A;  2B5G A;  3H8E A;  3B2Y A;  3CXS A;  1F2O A;  2IJZ A;  4HNW B;  2I79 A;  1VHO A;  2XEG A;  4PQA A;  5A27 A;  3PB4 X;  3FYN A;  4E2A A;  4PXC A;  2YND A;  4PXB A;  3UY5 A;  4AXV A;  1EE3 P;  2V8D A;  2WUU A;  1HDU A;  4PXE A;  4X5K A;  1VIX A;  4X3R A;  2GE3 A;  1ARL A;  2FSR A;  1CX8 A;  2JDC A;  2VZY A;  5G1Z A;  4MI4 A;  3FMC A;  2XEI A;  4G1P A;  1PUA A;  2PJC A;  4B11 A;  1LAN A;  2OH1 A;  4CAE A;  2NSM A;  1PCA A;  2Q7S A;  3S6G A;  1U6M A;  2PVV A;  3L2N A;  3VH9 A;  3TFY A;  2GLJ A;  4MFQ A;  1QQ9 A;  2O53 A;  2R1I A;  3H5Z A;  4R87 A;  3TT2 A;  4IUS A;  5AG6 A;  2PVW A;  1SQH A;  1Z8T A;  4OKO A;  2JLM A;  4MXU A;  2VBQ A;  4YFJ A;  4LUA A;  5CNP A;  2C6P A;  4MHP A;  3K2K A;  1HEE A;  2Z3M A;  4KOU A;  1V0C A;  4R6T A;  2BO9 A;  5DWM A;  4CGL A;  1P0H A;  1S7F A;  1JQG A;  2F8H A;  2PJ6 A;  1RXT A;  1ARM A;  3D3S A;  4NGN A;  4QB9 A;  2VI7 A;  2FS5 A;  1ELL P;  2V8G A;  2JEW A;  1ZO0 A;  3D2M A;  3V7Z A;  3R9G A;  3FEE A;  4NXY A;  3DR6 A;  2FVG A;  4JD6 A;  2PJ1 A;  4K30 A;  2PDO A;  3R96 A;  4F9V A;  3KL9 A;  3LMS A;  2REF A;  1X10 A;  3TO7 A;  3NA6 A;  1TKJ A;  4ZI6 A;  4C2Y A;  2ZEE A;  2V77 A;  4NCZ A;  4ONU A;  4F0X A;  3EY5 A;  4X2T A;  1DTD A;  1VHE A;  1MJB A;  1WK4 A;  2Z3O A;  4CYO A;  4FBE A;  2R98 A;  2NMT A;  2PIZ A;  1YVO A;  4UF4 A;  4FAI A;  3JTK A;  1BAV A;  1TIQ A;  1KUV A;  2QYV A;  2J9A A;  4OC4 A;  1Y0Y A;  2ZEP A;  4ONW A;  3D7G A;  3QNV A;  5EBV A;  3TO9 A;  2R7H A;  3D8P A;  1UFH A;  4HNY B;  1TKF A;  3R95 A;  4KLV A;  4OC0 A;  3P2H A;  2DF5 A;  2HUZ A;  3DSB A;  4KOY A;  2B4B A;  4X8I A;  5HMN A;  3S6K A;  1OZP A;  2PJA A;  2PIY A;  1J4J A;  4P6Y A;  3E0K A;  2CXA A;  4E8O A;  5A28 A;  3W91 A;  3KKW A;  2RFH A;  4Q38 A;  1F57 A;  5ISV A;  2B4D B;  4ZY2 A;  3EC4 A;  2PCU A;  1UWY A;  4O23 A;  4DJL A;  3PFO A;  4GS4 A;  3VAR A;  2YNE A;  4FD4 A;  1H8L A;  1BO4 A;  5F49 A;  3PB9 X;  3TTH A;  5EC4 A;  3F5B A;  2PSW A;  1K4J A;  2EWB A;  1NMT A;  3B8G A;  4PSX A;  1MK4 A;  4KOW A;  2AFU A;  4UWJ A;  2X7B A;  2OR4 A;  1ZLI A;  1FY7 A;  2XEJ A;  4AG7 A;  1Y7E A;  1CP6 A;  3BI1 A;  3NH8 A;  3RBU A;  4PPZ A;  1NSA A;  1BOB A;  2AFW A;  2PJ0 A;  4Z65 A;  3H8F A;  2GLF A;  3SHP A;  2ZW4 A;  4OLL A;  4OAE A;  2JEV A;  2EK9 A;  2POK A;  5H86 A;  4B14 A;  4XPL A;  1M4L A;  4CS0 B;  2PJ9 A;  4NEX A;  4NSQ A;  1FNO A;  5HH1 A;  3KI9 A;  4CYP A;  4KOR A;  1BPN A;  1CJW A;  2OB0 A;  1AYE A;  1XRY A;  5HXD A;  2WPW A;  1XMB A;  1QST A;  4F8Z A;  4KLW A;  4QVT A;  2P6E A;  2B3V A;  4MHZ A;  2VXK A;  4P4J A;  1PU9 A;  4OC3 A;  5LRK A;  4A32 A;  1XBU A;  3D7D A;  4UIA A;  3W6X A;  4ZY1 A;  2YNC A;  3BI0 A;  4R7M A;  6CPA A;  2AFX A;  1JWQ A;  3SI2 A;  4QBJ A;  2EUI A;  1LAP A;  4ZX9 A;  2ZEH A;  2ZEN A;  2QEC A;  1OBR A;  3TCV A;  3V38 A;  1PYT B;  4B10 A;  4UEZ A;  2EK8 A;  2PC1 A;  5D29 A;  4C2Z A;  3KQZ A;  4JXR A;  2PJB A;  3GY9 A;  3HUV A;  4KVX A;  4CAW A;  4KOT A;  2ZEM A;  2F5I A;  2DPS A;  2ARH A;  4WWV A;  4FD5 A;  4ORF A;  4OP4 A;  3T90 A;  4BMH A;  2AFO A;  1B87 A;  2WYR A;  1XE4 A;  3FRM A;  1S7K A;  4KUB A;  4MY3 A;  4QC6 A;  2A4N A;  2VQY A;  4H89 A;  4C7H A;  2O28 A;  4U9Z A;  7CPA A;  2Q4Y A;  4JXQ A;  3NH4 A;  1GHE A;  2OOT A;  4M3S A;  4B6Z A;  3FF3 A;  4PXD A;  3PGP A;  4LQ6 A;  1IYK A;  1R57 A;  3TO6 A;  1Q7L A;  1YQE A;  1Y9W A;  2OU2 A;  1Z4R A;  3KHZ A;  1ELM P;  4ZX8 A;  4P4F A;  2BUE A;  3PEI A;  1ZG8 A;  4R8F A;  1Z4E A;  3KHX A;  4C7I A;  2IQ6 A;  3WC5 A;  4DYO A;  3TE4 A;  5JGF A;  4ZY0 A;  1YW6 A;  4UWI A;  3W6S A;  3TOA A;  1KUY A;  1YX0 A;  4I49 A;  3LD2 A;  1XOV A;  4MHD A;  3CZX A;  3D4U A;  4II9 A;  2EO8 A;  3FXT A;  3GKR A;  4KVO E;  2PE3 A;  4OAD A;  2AFM A;  4JYW A;  3KGQ A;  2ZOG A;  4M6G A;  4P4D A;  5KTA A;  2GFQ A;  3FJU A;  3RYO A;  4AB7 A;  1TKH A;  4ZBG A;  3SJE A;  3LWU A;  1YW4 A;  5K8P A;  4XNH C;  2PJ7 A;  1CPS A;  1QSM A;  4R9M A;  4F6A A;  1IOI A;  4GM5 A;  5BWA B;  4P4E A;  3HLP A;  3JVN A;  4FUU A;  4NGT A;  5K8N A;  4ZYQ A;  4NF1 A;  3GLJ A;  3VWE A;  5J8F A;  2RB7 A;  4KVM E;  3A9L A;  2PR1 A;  3R1K A;  4BBH A;  2Q7B A;  1LCP A;  5DS0 A;  1M1D A;  3S9N A;  1IB1 E;  4UEE A;  4MCR A;  2G0B A;  1CM0 A;  2J8R A;  3F8K A;  4DNC A;  3DLJ A;  2FL4 A;  2ATR A;  1IYL A;  1KZF A;  3GUX A;  2EBJ A;  4WJB A;  5C82 A;  5IB9 A;  1S5K A;  3IWE A;  2B5G B;  2FE7 A;  4PK2 A;  3IO1 A;  5G22 A;  4LX9 A;  4MFK A;  5H84 A;  4EWT A;  5KTD A;  4B5P B;  4UBR A;  5DWN A;  4CPA A;  3DNS A;  4MCS A;  2J8M A;  4JZ0 A;  3RAM A;  4HNX B;  2EVN A;  2R8V A;  2ZEO A;  3QB8 A;  3FIX A;  5AG4 A;  3FBU A;  4OID A;  4KSI A;  1KWM A;  2CY2 A;  3IWG A;  3PFE A;  1AUG A;  4MFZ A;  3NH5 A;  1YK3 A;  2VEZ A;  2CTC A;  5CBM A;  5IV0 A;  2K5T A;  3FNC A;  3WAB A;  1CPX A;  2Z3K A;  2B4D A;  3G8W A;  4UCN A;  4CAX A;  1IU8 A;  3BXM A;  4A33 A;  1A2Z A;  4L8A A;  4Q7A A;  4RN7 A;  5AGE A;  5G20 A;  5K8M A; 
#chains in the Genus database with same CATH homology
 2Z0Z A;  2PQ8 A;  4MBU A;  5IB0 A;  4A2Z A;  3N7Z A;  4IF5 A;  2CNS A;  2D4P A;  4ZGY B;  5C88 A;  2HV2 A;  4FD6 A;  4QUS A;  2WSA A;  1VHS A;  2C27 A;  3BJ8 A;  2DPT A;  4A95 A;  1YR0 A;  3G3S A;  1RO5 A;  5F46 A;  4XPD C;  4AVB A;  2B3U A;  2QIR A;  3ZZI A;  1MJ9 A;  2J8N A;  4KUA A;  1S60 A;  2BSW A;  2Z3L A;  1S7L A;  1NE9 A;  1QSR A;  2PRB A;  4U9Y A;  4CRY B;  4KSF A;  3BJ7 A;  2OZG A;  2H5M A;  1S3Z A;  1ON0 A;  3FB3 A;  4MY0 A;  1S7N A;  5AG7 A;  1IID A;  2FT0 A;  1Y7R A;  4L89 A;  4XPK A;  2G3T A;  3P2F A;  5G21 A;  3JUW A;  2AJ6 A;  5F48 A;  4UFX A;  3H4Q A;  4B5O A;  1N71 A;  1YLE A;  3IU1 A;  4CGN A;  4CGO A;  4MFP A;  2HQY A;  2Z11 A;  4JJX A;  4CRZ B;  3LOD A;  4H6U A;  1VKC A;  1MJA A;  3ZJ0 A;  2I00 A;  5JPH A;  1I12 A;  1XEB A;  4XPD B;  4R3L A;  1I1D A;  1Q2D A;  2Q4V A;  1XIX A;  4CYN A;  4UA3 A;  4KSA A;  4FD7 A;  3S6F A;  3D2P A;  4YGO A;  2Z3N A;  2VZZ A;  5AG5 A;  2BEI A;  2YNC C;  3VWD A;  4E0A A;  4B13 A;  2DXQ A;  4MFL A;  2P6G A;  4M85 A;  2RC4 A;  4MFJ A;  4MJ8 A;  4KZT A;  2ZW5 A;  4JLY A;  3GYA A;  3NE7 A;  4B5P A;  4RS2 A;  2P0W A;  2FIW A;  1NSL A;  1Q2C A;  5E96 A;  4EVY A;  1M4D A;  2ZW7 A;  4UCP A;  5IX3 A;  1QSO A;  1LRZ A;  1Z9U A;  1I21 A;  4CAF A;  5J8C A;  5JQ4 A;  2Y0M A;  5KTC A;  1M4G A;  4H6Z A;  1WWZ A;  4UFV A;  2D4O A;  1P4N A;  2P6F A;  2AE6 A;  2KCW A;  3S6H A;  2Z3P A;  3SXO A;  2Q0Y A;  4AVA A;  2B58 A;  2CNT A;  3QAH A;  3V8I A;  3DR8 A;  1XF8 A;  4J3G A;  5GCN A;  2CNM A;  4Y49 B;  3EFA A;  4HKF A;  3R9F A;  1IIC A;  4C2X A;  3R9E A;  3DDD A;  4JWP A;  3I3G A;  3K9U A;  2JDD A;  3CXQ A;  4Q36 A;  3PP9 A;  3TOB A;  1Y9K A;  4U5Y A;  3EO4 A;  2BL1 A;  3IU2 A;  4XNH B;  3WR7 A;  4AG9 A;  4F0Y A;  3F0A A;  1M44 A;  1M4I A;  1YRE A;  2FXF A;  2Q04 A;  3OWC A;  3C26 A;  2OZU A;  4CAV A;  2ZPA A;  2YGW A;  2OZH A;  4KOS A;  4C68 A;  3BLN A;  4UCM A;  4Y49 C;  4YRH A;  3PZJ A;  2Q44 A;  4B12 A;  4R3K A;  1XMT A;  3CXP A;  4A31 A;  4PV6 A;  3T9Y A;  1B6B A;  4KOV A;  1YGH A;  3IGR A;  2FCK A;  4PSW A;  3SXN A;  2ZXV A;  2QML A;  4AVC A;  2Z10 A;  2GAN A;  2IL4 A;  2WPX A;  4PK3 A;  4R57 A;  2REE A;  1L0C A;  4CYQ A;  5FVJ A;  5F47 A;  1Q2Y A;  2FIA A;  4KOX A;  4A30 A;  2ZW6 A;  2GIV A;  3I9S A;  3EXN A;  1QSN A;  3MGD A;  4UFW A;  1KUX A;  1YVK A;  2G3A A;  4RI1 A;  5I0C A;  2PR8 A;  4KS9 A;  2B5G A;  3CXS A;  4HNW B;  2I79 A;  5A27 A;  3FYN A;  4E2A A;  2YND A;  3UY5 A;  2WUU A;  4X5K A;  2GE3 A;  2VZY A;  2FSR A;  2JDC A;  5G1Z A;  4MI4 A;  1PUA A;  4B11 A;  4CAE A;  2OH1 A;  3S6G A;  1U6M A;  3TFY A;  4MFQ A;  2R1I A;  4R87 A;  3H5Z A;  3TT2 A;  4IUS A;  5AG6 A;  1SQH A;  4YFJ A;  2JLM A;  2VBQ A;  4LUA A;  5CNP A;  2Z3M A;  4KOU A;  1V0C A;  5DWM A;  4CGL A;  1P0H A;  1S7F A;  3D3S A;  1RXT A;  4QB9 A;  2VI7 A;  2FS5 A;  1ZO0 A;  3D2M A;  3R9G A;  4NXY A;  3DR6 A;  4JD6 A;  4K30 A;  3R96 A;  2PDO A;  2REF A;  3TO7 A;  4C2Y A;  4NCZ A;  4ONU A;  4F0X A;  3EY5 A;  1MJB A;  1WK4 A;  2Z3O A;  4CYO A;  2R98 A;  2NMT A;  1YVO A;  3JTK A;  1TIQ A;  1KUV A;  5EBV A;  3TO9 A;  2R7H A;  3D8P A;  1UFH A;  4HNY B;  3R95 A;  4KLV A;  3P2H A;  2HUZ A;  3DSB A;  4KOY A;  5HMN A;  2B4B A;  3S6K A;  1OZP A;  1J4J A;  4E8O A;  3E0K A;  2CXA A;  5A28 A;  3W91 A;  3KKW A;  4Q38 A;  5ISV A;  2B4D B;  3EC4 A;  4GS4 A;  2YNE A;  4FD4 A;  1BO4 A;  5F49 A;  3TTH A;  5EC4 A;  3F5B A;  1K4J A;  2PSW A;  1NMT A;  3B8G A;  4PSX A;  1MK4 A;  4KOW A;  4UWJ A;  2X7B A;  1FY7 A;  4AG7 A;  1BOB A;  3SHP A;  2ZW4 A;  4OLL A;  4OAE A;  2JEV A;  5H86 A;  4B14 A;  4XPL A;  4CS0 B;  4NEX A;  4NSQ A;  5HH1 A;  4CYP A;  4KOR A;  1CJW A;  2OB0 A;  2WPW A;  1QST A;  4KLW A;  4QVT A;  2P6E A;  2B3V A;  2VXK A;  1PU9 A;  4A32 A;  3W6X A;  2YNC A;  4QBJ A;  2EUI A;  2QEC A;  3TCV A;  4B10 A;  2PC1 A;  4C2Z A;  4JXR A;  3GY9 A;  4KVX A;  4CAW A;  4KOT A;  2F5I A;  2DPS A;  2ARH A;  4FD5 A;  4ORF A;  3T90 A;  4BMH A;  1B87 A;  1XE4 A;  3FRM A;  1S7K A;  4KUB A;  4MY3 A;  4QC6 A;  2A4N A;  2VQY A;  4H89 A;  4C7H A;  2O28 A;  4U9Z A;  2Q4Y A;  4JXQ A;  1GHE A;  4M3S A;  3PGP A;  1IYK A;  1R57 A;  3TO6 A;  2OU2 A;  1Y9W A;  1Z4R A;  2BUE A;  1Z4E A;  4C7I A;  3TE4 A;  4UWI A;  3W6S A;  4CGM A;  3TOA A;  1KUY A;  1YX0 A;  4I49 A;  3LD2 A;  4MHD A;  4CGP A;  4II9 A;  3FXT A;  3GKR A;  4KVO E;  4OAD A;  5KTA A;  3RYO A;  4AB7 A;  4ZBG A;  4XNH C;  1QSM A;  4R9M A;  4F6A A;  5BWA B;  3JVN A;  4NF1 A;  5J8F A;  3VWE A;  4KVM E;  3A9L A;  2PR1 A;  3R1K A;  4BBH A;  2Q7B A;  1M1D A;  1IB1 E;  2G0B A;  1CM0 A;  2J8R A;  3F8K A;  4DNC A;  2FL4 A;  2ATR A;  1IYL A;  1KZF A;  5C82 A;  1S5K A;  3IWE A;  2B5G B;  2FE7 A;  4PK2 A;  5G22 A;  5H84 A;  4LX9 A;  4MFK A;  5KTD A;  4B5P B;  4UBR A;  5DWN A;  3DNS A;  2J8M A;  4HNX B;  2EVN A;  2R8V A;  3QB8 A;  5AG4 A;  3FIX A;  3FBU A;  2CY2 A;  3IWG A;  4MFZ A;  1YK3 A;  2VEZ A;  5IV0 A;  2K5T A;  3FNC A;  2Z3K A;  2B4D A;  3G8W A;  4UCN A;  4CAX A;  4A33 A;  4L8A A;  5G20 A;  5AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...