2WUUA

Structure of n-myristoyltransferase from l. donovani
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
402
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVESMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-MYRISTOYLTRANSFERASE
publication title N-Myristoyltransferase from Leishmania Donovani: Structural and Functional Characterisation of a Potential Drug Target for Visceral Leishmaniasis.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
total genus 125
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wuuA00
4B12A 5A28A 4UCMA 5AG6A 5G22A 2YNCA 4UFVA 4C2XA 2WUUA 4UFXA 5G21A 2YNDA 4A2ZA 5G20A 4C2ZA 4CYNA 4A95A 4CGLA 4CAFA 4A33A 4UCPA 4CYQA 4CGNA 5AG7A 5AG4A 2WSAA 2YNEA 4B11A 4B14A 3IWEA 3H5ZA 4C7HA 4A30A 4B13A 4UCNA 5G1ZA 4CAEA 4C2YA 4A32A 4C68A 5AGEA 4CYPA 3IU1A 4A31A 4B10A 3IU2A 4UFWA 4C7IA 3JTKA 5AG5A 4BBHA 5A27A 4CGMA 4CYOA 2YNCC 4CGOA 4CGPA
chains in the Genus database with same CATH superfamily
4R76A 2C6PA 2BL1A 4HNYB 2GLFA 4MCSA 3D7GA 4P4FA 1IIDA 5IV0A 4H6ZA 3NH5A 2DXQA 3FEEA 4A2ZA 3N5FA 4NF1A 3B8GA 4FD7A 4W9YA 4CAFA 2ZPAA 5BWAB 3PFEA 1YW4A 1PYTB 1QSRA 1S3ZA 2Q0YA 3IFEA 2BSWA 4CAVA 2QIRA 1Y9WA 1OZPA 1U6MA 3PB4X 1I21A 1TIQA 1VHSA 2QECA 3FJUA 4OC4A 3D7HA 4XPLA 4GXHA 2Q7SA 3T8WA 2BCOA 4NJQA 4JYWA 2C27A 4KSIA 4U5YA 3EXNA 2PRQA 5HVHA 1S7FA 1IYLA 2I79A 1IOIA 2AFOA 2C6GA 1S5KA 4CGPA 1IOFA 3DDDA 1QQ9A 1Y0YA 5HXDA 4FD5A 2CXAA 2R8VA 4C2XA 4AG9A 1X10A 2OH1A 1AUGA 3F8KA 1IYKA 2CF4A 4LQGA 4B5OA 5C82A 2GE3A 3L2NA 2PJ0A 3MN8A 1VHOA 3G8WA 4M6HA 4OKOA 4MHPA 4NGSA 2PR1A 3PZJA 4IHMA 1TKJA 3LWUA 4R3LA 2JDDA 1YW6A 2ZEGA 4MFQA 2AFZA 3E0KA 1F2OA 2PJ8A 2ZEOA 3CPXA 5CPAA 4B10A 5JH9A 3PFOA 1YVKA 3WC6A 2WPWA 4UEEA 1EE3P 2CIJA 4NXYA 1HDUA 5DS0A 4CRYB 1ELLP 3FRMA 2VQYA 3CZXA 4JLYA 3D66A 1S60A 4UIAA 4CYNA 4A94A 2R7HA 3B3VA 4CAWA 5LRKA 3GLJA 4NCZA 4LX9A 3B7IA 3MRUA 4H89A 1Q2CA 2ZW4A 5FVJA 2AFMA 1XEBA 3DGVA 3QAYA 3H8GA 1GYTA 2PJBA 3GIUA 3IWEA 2ZW5A 4AXVA 4B13A 5ISVA 2VXKA 1KZFA 3KL9A 4JXRA 1YMEA 4IK2A 4C2YA 4U9YA 3TC8A 1FY7A 3F5BA 3RYOA 1YLEA 2B58A 1XBUA 1YVOA 2PJ5A 3EFAA 3IIBA 4MFJA 4ONUA 1UWYA 3S9NA 1Y9KA 5JQ4A 4II9A 1A2ZA 2A4NA 2H5MA 2PVVA 2I00A 2GIVA 2YNCC 4L8AA 3TT2A 2Z3NA 2PRBA 5IX3A 1Q2YA 3IGRA 3D3SA 3LMSA 1XMTA 4NGTA 3FIXA 4EFDA 3ISXA 4ZGYB 4KOSA 3T9YA 4CRZB 3FBUA 2ABZA 3D8PA 4UWJA 4OIWA 4YU9A 5D29A 1S7KA 1VIXA 2EVNA 1LANA 5AG4A 4B14A 4HNWB 4FWUA 3KHZA 2CNTA 2JBKA 4KVXA 2ZELA 5EMIA 3S6GA 3D7FA 3SI0A 4JWPA 1QSNA 1CP7A 5IB9A 3I1UA 3NA6A 5AGEA 2PR8A 3TO6A 5DWNA 3GY9A 1Q2DA 5EC4A 3FX6A 5KTCA 1JQGA 5ELYA 1Q7LA 1PUAA 2B5GB 1XE4A 5HVGA 4M6GA 2Q7BA 4FD4A 2V8DA 4KSFA 2I3CA 3D67A 3PRTA 1Z2LA 2ZEDA 3DR8A 2Q4ZA 5F48A 2G3TA 5G21A 4A38A 4KLVA 3FECA 4MJ8A 4O23A 3HUVA 3KZWA 4OC5A 4BD9A 4OC1A 1SQHA 4Y49C 1K4JA 2J8MA 2DPTA 2EBJA 2B4BA 1YLOA 3CXSA 4A39A 1ZG7A 4E0AA 1YX0A 1VKCA 1Y0RA 2PJ2A 2D4OA 2VZZA 2ZEHA 1V0CA 5F47A 5F49A 3H8FA 2Z3MA 4GM5A 4A31A 1WWZA 4Y49B 4FUUA 3QAHA 3JTKA 3VWEA 2B4DB 4ZY0A 1DE4C 2B3UA 4CGOA 4KVOE 5D8NA 4JJXA 4NFRA 2XEIA 4KLWA 4C2ZA 3NFZA 3B3CA 2ZOFA 4MBUA 3RO0A 4CGLA 4OAEA 5JM6A 2OOTA 1OBRA 3TOAA 2R98A 1S7LA 2PC1A 3EY5A 4QB9A 1HDQA 4R3KA 4OIDA 1ZO0A 2EWBA 3H5ZA 3VATA 2KCWA 4OP4A 5JGFA 2DPSA 8CPAA 3CT9A 4PXBA 1YR0A 3IEHA 4KOUA 4TNUA 4A32A 4FAIA 4KOYA 3PEIA 1LAPA 2F5IA 3H8EA 1QMUA 1M1DA 1N71A 1Y7RA 2C6CA 1QSOA 2QJ8A 3DNSA 3KQXA 2FT0A 4M85A 4UFWA 1LCPA 3TCVA 3B3TA 1KUYA 2CY2A 3NH4A 4UCMA 2OB0A 2J8NA 2JBJA 4X8IA 2WUUA 2Z10A 3T90A 2HB6A 4JZ0A 4Z65A 2CNSA 1IU8A 2OR4A 3DLJA 3GB0A 3P2FA 5F46A 1M4DA 4KSAA 1B6BA 3FEDA 1HEEA 3WR7A 1B87A 1M4IA 5H86A 5LYFA 4BINA 2YGWA 1ZLHA 3V38A 2P0WA 5I0CA 3WT4A 3KKWA 4MHZA 3D4UA 2G9DA 4AG7A 3KGQA 3W91A 1IY7A 4IAVA 2ZEPA 2XEFA 3BHXA 4C7IA 5AG5A 2Z3LA 1CPSA 3BI0A 1BOBA 5J8FA 2BEIA 2QYVA 3NH8A 2FCKA 3I3GA 1Z4RA 4R7MA 4UFVA 5G22A 3IWGA 4OADA 3R9GA 4CPAA 4KOXA 4NEXA 4R8FA 1Z5RA 1RO5A 4JD6A 1KUVA 4ZBGA 3SJXA 2P6EA 4FBEA 4IF5A 1YGHA 1TKHA 3DR6A 4K3NA 4MY3A 5HH1A 3KR5A 6CPAA 2EK8A 4NGMA 1Z8XA 3BI1A 1XFOA 1Z8WA 4PK3A 4PQAA 4B11A 5KTDA 4C7HA 2IQ6A 4XNHC 2ZW6A 3TTHA 2B3VA 1QSTA 3BLNA 3CXPA 2NMTA 1M4GA 1MJBA 4MFKA 1PCAA 3PGPA 5KTAA 3GUXA 1TF9A 4E2AA 3B3SA 4KOTA 3PP9A 2V8GA 2Q43A 2QVPA 4OMEA 2ZEFA 4Q38A 4X2TA 3IJ3A 4B12A 2JEWA 2EUIA 4UEFA 1XF8A 2CTBA 1KUXA 4MFZA 3HLPA 1BAVA 1IICA 2XEGA 4PXCA 2K5TA 4MCPA 2GREA 2BOAA 4MRIA 4XPKA 2RB7A 4ZI6A 1VGYA 3B3WA 2V8VA 5J8CA 4UWIA 1BLLE 4UEZA 3PB8X 1MJAA 2GLJA 3IO1A 1DTDA 3FNCA 3SXNA 3SJEA 5G1ZA 4CAEA 4HKFA 3BJ7A 1ARLA 1YQEA 2Q4YA 1XOVA 3QB8A 3W6XA 4K30A 3S6KA 1XJOA 2X7BA 3PBBA 1P0HA 2IJZA 4PPZA 2PJCA 4EVYA 5K8OA 3R1KA 4AVBA 4CYOA 4F9UA 2F8HA 3PBEA 2FE7A 1F57A 2O28A 4LUAA 4PSXA 4XPDC 1XIXA 2YNCA 3IC1A 2WYRA 3K9TA 1S7NA 3DSBA 2DF5A 4GS4A 1TXRA 3BXMA 3PB9X 1X12A 4A37A 2J8RA 1Z8LA 4R9MA 4NGRA 2POKA 3GYAA 3H4QA 4RS2A 4L89A 5HVFA 2Q4VA 4RN7A 3SXOA 4B5PB 4F0YA 4TWEA 1YSJA 1WK4A 1I12A 4P45A 1RXTA 1XRYA 1NSLA 4NJRA 5GCNA 2B5GA 4P4BA 5LYDA 2Z0ZA 2Z3OA 4CYPA 2PE3A 1Z4EA 2FVGA 4ONWA 2HQYA 1Z9UA 3FYNA 4DJLA 4CGMA 4WWVA 2FXFA 4ZY1A 1M4LA 2AFWA 4KOVA 4B5PA 4PXEA 2VI7A 3W6SA 3KI9A 4DUKA 3IWWA 3LD2A 2OU2A 4F6AA 4UFXA 4MCQA 4YGOA 4YRHA 2J9AA 3TO7A 4ZYQA 4HNXB 1ZG8A 4A33A 3EC4A 1Y7EA 4PV6A 2Z3PA 4OC2A 3MGDA 4EWTA 3S9MA 4KS9A 3S6HA 1RTQA 2B4DA 2G0BA 2GFQA 4QBJA 3SI1A 2NYQA 5K8PA 1AMPA 4R57A 4ZX8A 2ZW7A 2OZGA 1UFHA 4C68A 4F9VA 4UF4A 1YK3A 3KQZA 4J3GA 2FSRA 3D2PA 4H6UA 4KUBA 2NSMA 4OC3A 3ISZA 2Q51A 5A28A 2VEZA 3G3SA 5E96A 4M6IA 3FVLA 1CJWA 4EMEA 3B35A 4KZTA 1BPNA 1ON0A 1IB1E 4NGPA 2BO9A 1L0CA 5AG7A 3UY5A 4UIBA 3TOBA 2ZENA 2BUEA 2JLMA 3CDXA 4QUSA 3SI2A 3ZZIA 4P44A 3FB3A 4BMHA 4F8ZA 4MCRA 1P4NA 1NSAA 1R57A 2O4HA 1CX8A 2REFA 3K2KA 1J4JA 2REEA 1ZLIA 2V8HA 3FH4A 3IU1A 4LQ6A 5THWA 2OZHA 2PJAA 2IL4A 2ZOGA 3SHPA 3SJGA 1BO4A 2CNMA 1F2PA 4FD6A 3FF3A 2PJ7A 3PB6X 4HPSA 3KR4A 1LFWA 5H84A 5I4MA 4IUSA 5AG6A 4YFJA 4U9ZA 3OWCA 2AFUA 2XEJA 4OC0A 4AB7A 3LACA 5K8NA 4CYQA 4AVAA 4QC6A 5DWMA 2WPXA 4CGNA 3B2YA 3D68A 2VBQA 1CPXA 4JXQA 2GANA 3QNVA 4MHDA 2ODFA 3VWDA 1KWMA 2C1CA 1NMTA 3SJFA 4PXDA 2Q04A 3WABA 1MJ9A 4X5KA 3TO9A 2ATRA 3FXTA 3VH9A 4H2KA 1Z8TA 4UBRA 3JVNA 3A9LA 2AE6A 2HC9A 2HUZA 4Q36A 5LYLA 1YREA 3KASA 3ZJ0A 4NSQA 3NE8A 1H8LA 2ZEEA 4KVME 2Z3KA 3RNZA 1CM0A 1FT7A 3FMCA 2PJ4A 4XNHB 2G3AA 4CS0B 2P6GA 3S9LA 3S6FA 1TF8A 4P4IA 5F09A 4QVTA 4UCPA 5K8MA 4G1PA 2FIAA 2P6FA 4MY0A 2F7VA 2EO8A 3GKRA 3TFYA 3R9FA 4P4EA 3RZAA 1CP6A 2PJ1A 5JPHA 1AYEA 1ELMP 1I1DA 1QSMA 5LYIA 2PJ6A 7CPAA 2V77A 2JDCA 2PJ9A 1MK4A 1CBXA 1LAMA 1CG2A 1TKFA 3WC5A 4KUAA 4KORA 2IMOA 2ANPA 4I49A 4AVCA 2FIWA 2PIYA 2CTCA 4MFLA 4P10A 1R43A 3K9UA 3P2HA 5CBMA 2YNDA 1NE9A 5G20A 2ZXVA 4CAXA 4P6YA 4ORFA 4Q7AA 3JRUA 5C88A 4PSWA 1ARMA 2PQ8A 2YNEA 1M44A 4WJBA 3R9EA 2AFXA 3D7DA 5IB0A 1VHEA 2PVWA 3D2MA 4A30A 3TE4A 2AJ6A 3N7ZA 3RAMA 2PSWA 4XPDB 3KHXA 4PK2A 4B6ZA 2JEVA 5EBVA 1JWQA 3EO4A 2DEAA 2Q44A 2Y0MA 3LODA 4YWYA 3IU2A 4NGQA 2PCUA 5J1QA 2RC4A 4P4JA 4BBHA 3C26A 4UA3A 1IGBA 3F0AA 4ZY2A 3BJ8A 2RFHA 4X3RA 3VARA 4ZX9A 2OZUA 4MFPA 4DYOA 3RBUA 1FNOA 4DNCA 1R3NA 1LRZA 1XMBA 3CXQA 5CNPA 3R96A 4RUHA 4A95A 3JUWA 2D4PA 4OLLA 4RI1A 3V7ZA 5HMNA 2QMLA 2R1IA 2WSAA 1BPMA 2FS5A 4R6TA 2HV2A 4MHYA 1ZG9A 2PIZA 2VL1A 4UCNA 1LOKA 4M3SA 1GHEA 2PJ3A 3I9SA 4MMOA 5LRJA 4R87A 2GU2A 1PU9A 3V8IA 2AFSA 2FL4A 4MI4A 2O53A 2Z11A 3PB7X 2WZNA 4F0XA 2PDOA 4NGNA 3WC7A 2ZEMA 4KOWA 4MHNA 4MXUA 4E8OA 3R95A 2EK9A 5LRGA 2VZYA 3CPAA 3TX8A 3NE7A 2ARHA 5A27A 4P4DA
chains in the Genus database with same CATH topology
2BL1A 4HNYB 1IIDA 5IV0A 4H6ZA 4A2ZA 2DXQA 5JQ4A 4NF1A 3B8GA 4FD7A 4CAFA 2ZPAA 5BWAB 1QSRA 1S3ZA 2Q0YA 2BSWA 4CAVA 2QIRA 1Y9WA 1OZPA 1U6MA 1I21A 1TIQA 1VHSA 2QECA 4XPLA 2C27A 4U5YA 3EXNA 1S7FA 1IYLA 2I79A 1S5KA 4CGPA 3DDDA 4FD5A 2CXAA 2R8VA 4C2XA 4AG9A 2OH1A 3F8KA 1IYKA 4B5OA 5C82A 2GE3A 3G8WA 2PR1A 3PZJA 4R3LA 2JDDA 4MFQA 3E0KA 4B10A 1YVKA 2WPWA 4NXYA 4CRYB 3FRMA 2VQYA 4JLYA 1S60A 4CYNA 2R7HA 4CAWA 4NCZA 4LX9A 4H89A 1Q2CA 2ZW4A 5FVJA 4JD6A 1XEBA 3IWEA 5ISVA 2ZW5A 4B13A 2VXKA 1KZFA 4JXRA 4C2YA 4U9YA 1FY7A 3F5BA 3RYOA 1YLEA 2B58A 3EFAA 1YVOA 4MFJA 4ONUA 1Y9KA 4II9A 2A4NA 2H5MA 3TT2A 2I00A 2GIVA 2YNCC 4L8AA 2Z3NA 2PRBA 5IX3A 1Q2YA 3IGRA 3D3SA 1XMTA 3FIXA 4ZGYB 4KOSA 3T9YA 4CRZB 3FBUA 3D8PA 4UWJA 1S7KA 2EVNA 5AG4A 4B14A 4HNWB 2CNTA 4KVXA 3S6GA 4JWPA 1QSNA 5AGEA 2PR8A 3TO6A 5DWNA 3GY9A 1Q2DA 5EC4A 5KTCA 1PUAA 2B5GB 1XE4A 2Q7BA 4FD4A 4KSFA 5F48A 3DR8A 5G21A 2G3TA 4KLVA 4MJ8A 1SQHA 4Y49C 1K4JA 2J8MA 2DPTA 2B4BA 3CXSA 4E0AA 1YX0A 1VKCA 2D4OA 2VZZA 5F47A 1V0CA 5F49A 2Z3MA 4A31A 1WWZA 4Y49B 3QAHA 3JTKA 3VWEA 2B4DB 2B3UA 4CGOA 4KVOE 4JJXA 4KLWA 4C2ZA 4CGLA 4MBUA 4OAEA 3TOAA 2R98A 1S7LA 2PC1A 3EY5A 4QB9A 4R3KA 1ZO0A 3H5ZA 2KCWA 2DPSA 1YR0A 4KOUA 4A32A 4KOYA 2F5IA 1M1DA 1N71A 1Y7RA 4M85A 1QSOA 3DNSA 4UFWA 2FT0A 3TCVA 1KUYA 2CY2A 4UCMA 2OB0A 2J8NA 2WUUA 2Z10A 3T90A 2CNSA 3P2FA 5F46A 1M4DA 4KSAA 1B6BA 3WR7A 1B87A 1M4IA 5H86A 2YGWA 2P0WA 5I0CA 3KKWA 4AG7A 3W91A 4C7IA 5AG5A 2Z3LA 1BOBA 5J8FA 2BEIA 2FCKA 3I3GA 1Z4RA 4UFVA 5G22A 3IWGA 4OADA 3R9GA 4KOXA 4NEXA 4ZBGA 1RO5A 1KUVA 2P6EA 4IF5A 1YGHA 3DR6A 4MY3A 5HH1A 4B11A 5KTDA 4PK3A 4C7HA 4XNHC 2ZW6A 3TTHA 2B3VA 1QSTA 3BLNA 3CXPA 2NMTA 1M4GA 1MJBA 4MFKA 3PGPA 5KTAA 4E2AA 4KOTA 3PP9A 4Q38A 4B12A 2EUIA 1XF8A 1KUXA 4MFZA 1IICA 2K5TA 4XPKA 5J8CA 4UWIA 1MJAA 3FNCA 3SXNA 5G1ZA 4CAEA 4HKFA 3BJ7A 2Q4YA 3QB8A 3W6XA 4K30A 3S6KA 2X7BA 1P0HA 4EVYA 3R1KA 4AVBA 4CYOA 2FE7A 2O28A 4LUAA 4PSXA 4XPDC 1XIXA 2YNCA 1S7NA 3DSBA 4GS4A 2J8RA 4R9MA 4RS2A 3GYAA 3H4QA 3SXOA 4B5PB 4L89A 2Q4VA 4F0YA 1WK4A 1I12A 1RXTA 1NSLA 5GCNA 2B5GA 2Z0ZA 2Z3OA 4CYPA 1Z4EA 2HQYA 1Z9UA 3FYNA 4CGMA 2FXFA 4KOVA 4B5PA 2VI7A 3W6SA 3LD2A 2OU2A 4F6AA 4UFXA 4YGOA 4YRHA 3TO7A 4HNXB 4A33A 3EC4A 4PV6A 2Z3PA 3MGDA 4KS9A 3S6HA 4QBJA 2B4DA 2G0BA 4R57A 2ZW7A 2OZGA 1UFHA 4C68A 1YK3A 4J3GA 2FSRA 3D2PA 4H6UA 4KUBA 5A28A 2VEZA 3G3SA 5E96A 1CJWA 4KZTA 1ON0A 1IB1E 1L0CA 5AG7A 3UY5A 3TOBA 4QUSA 2BUEA 2JLMA 3ZZIA 4BMHA 3FB3A 1P4NA 1R57A 2REFA 1J4JA 2REEA 3IU1A 3SHPA 2OZHA 2IL4A 1BO4A 2CNMA 4FD6A 5H84A 4IUSA 5AG6A 4YFJA 4U9ZA 3OWCA 4AB7A 4CYQA 4AVAA 4QC6A 5DWMA 2WPXA 4CGNA 2VBQA 4JXQA 2GANA 4MHDA 3VWDA 1NMTA 2Q04A 1MJ9A 4X5KA 3TO9A 2ATRA 3FXTA 4UBRA 3JVNA 3A9LA 2AE6A 2HUZA 4Q36A 1YREA 3ZJ0A 4NSQA 4KVME 2Z3KA 1CM0A 4XNHB 2G3AA 4CS0B 2P6GA 3S6FA 4QVTA 4UCPA 2FIAA 2P6FA 4MY0A 3TFYA 3GKRA 3R9FA 5JPHA 1QSMA 1I1DA 2JDCA 1MK4A 4KUAA 4KORA 4I49A 4AVCA 2FIWA 4MFLA 3K9UA 3P2HA 2YNDA 1NE9A 5G20A 2ZXVA 4CAXA 4ORFA 5C88A 4PSWA 2PQ8A 2YNEA 1M44A 3R9EA 5IB0A 3D2MA 3TE4A 4A30A 2AJ6A 3N7ZA 2PSWA 4XPDB 4PK2A 2JEVA 5EBVA 3EO4A 2Q44A 2Y0MA 3LODA 3IU2A 2RC4A 4BBHA 3C26A 4UA3A 3F0AA 3BJ8A 2OZUA 4MFPA 4DNCA 3CXQA 1LRZA 3R96A 5CNPA 4A95A 3JUWA 2D4PA 4OLLA 4RI1A 5HMNA 2QMLA 2R1IA 2WSAA 2FS5A 2HV2A 4UCNA 4M3SA 1GHEA 3I9SA 4R87A 1PU9A 3V8IA 2FL4A 4MI4A 2Z11A 4F0XA 2PDOA 4KOWA 4E8OA 3R95A 5A27A 2VZYA 3NE7A 2ARHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B12 A;  5A28 A;  4UCM A;  5AG6 A;  5G22 A;  2YNC A;  4UFV A;  4C2X A;  2WUU A;  4UFX A;  5G21 A;  2YND A;  4A2Z A;  5G20 A;  4C2Z A;  4CYN A;  4A95 A;  4CGL A;  4CAF A;  4A33 A;  4UCP A;  4CYQ A;  4CGN A;  5AG7 A;  5AG4 A;  2WSA A;  2YNE A;  4B11 A;  4B14 A;  3IWE A;  3H5Z A;  4C7H A;  4A30 A;  4B13 A;  4UCN A;  5G1Z A;  4CAE A;  4C2Y A;  4A32 A;  4C68 A;  5AGE A;  4CYP A;  3IU1 A;  4A31 A;  4B10 A;  3IU2 A;  4UFW A;  4C7I A;  3JTK A;  5AG5 A;  4BBH A;  5A27 A;  4CGM A;  4CYO A;  2YNC C;  4CGO A;  4CGP A; 
#chains in the Genus database with same CATH topology
 4R76 A;  2C6P A;  2BL1 A;  4HNY B;  2GLF A;  4MCS A;  3D7G A;  4P4F A;  1IID A;  5IV0 A;  4H6Z A;  3NH5 A;  2DXQ A;  3FEE A;  4A2Z A;  3N5F A;  4NF1 A;  3B8G A;  4FD7 A;  4W9Y A;  4CAF A;  2ZPA A;  5BWA B;  3PFE A;  1YW4 A;  1PYT B;  1QSR A;  1S3Z A;  2Q0Y A;  3IFE A;  2BSW A;  4CAV A;  2QIR A;  1Y9W A;  1OZP A;  1U6M A;  3PB4 X;  1I21 A;  1TIQ A;  1VHS A;  2QEC A;  3FJU A;  4OC4 A;  3D7H A;  4XPL A;  4GXH A;  2Q7S A;  3T8W A;  2BCO A;  4NJQ A;  4JYW A;  2C27 A;  4KSI A;  4U5Y A;  3EXN A;  2PRQ A;  5HVH A;  1S7F A;  1IYL A;  2I79 A;  1IOI A;  2AFO A;  2C6G A;  1S5K A;  4CGP A;  1IOF A;  3DDD A;  1QQ9 A;  1Y0Y A;  5HXD A;  4FD5 A;  2CXA A;  2R8V A;  4C2X A;  4AG9 A;  1X10 A;  2OH1 A;  1AUG A;  3F8K A;  1IYK A;  2CF4 A;  4LQG A;  4B5O A;  5C82 A;  2GE3 A;  3L2N A;  2PJ0 A;  3MN8 A;  1VHO A;  3G8W A;  4M6H A;  4OKO A;  4MHP A;  4NGS A;  2PR1 A;  3PZJ A;  4IHM A;  1TKJ A;  3LWU A;  4R3L A;  2JDD A;  1YW6 A;  2ZEG A;  4MFQ A;  2AFZ A;  3E0K A;  1F2O A;  2PJ8 A;  2ZEO A;  3CPX A;  5CPA A;  4B10 A;  5JH9 A;  3PFO A;  1YVK A;  3WC6 A;  2WPW A;  4UEE A;  1EE3 P;  2CIJ A;  4NXY A;  1HDU A;  5DS0 A;  4CRY B;  1ELL P;  3FRM A;  2VQY A;  3CZX A;  4JLY A;  3D66 A;  1S60 A;  4UIA A;  4CYN A;  4A94 A;  2R7H A;  3B3V A;  4CAW A;  5LRK A;  3GLJ A;  4NCZ A;  4LX9 A;  3B7I A;  3MRU A;  4H89 A;  1Q2C A;  2ZW4 A;  5FVJ A;  2AFM A;  1XEB A;  3DGV A;  3QAY A;  3H8G A;  1GYT A;  2PJB A;  3GIU A;  3IWE A;  2ZW5 A;  4AXV A;  4B13 A;  5ISV A;  2VXK A;  1KZF A;  3KL9 A;  4JXR A;  1YME A;  4IK2 A;  4C2Y A;  4U9Y A;  3TC8 A;  1FY7 A;  3F5B A;  3RYO A;  1YLE A;  2B58 A;  1XBU A;  1YVO A;  2PJ5 A;  3EFA A;  3IIB A;  4MFJ A;  4ONU A;  1UWY A;  3S9N A;  1Y9K A;  5JQ4 A;  4II9 A;  1A2Z A;  2A4N A;  2H5M A;  2PVV A;  2I00 A;  2GIV A;  2YNC C;  4L8A A;  3TT2 A;  2Z3N A;  2PRB A;  5IX3 A;  1Q2Y A;  3IGR A;  3D3S A;  3LMS A;  1XMT A;  4NGT A;  3FIX A;  4EFD A;  3ISX A;  4ZGY B;  4KOS A;  3T9Y A;  4CRZ B;  3FBU A;  2ABZ A;  3D8P A;  4UWJ A;  4OIW A;  4YU9 A;  5D29 A;  1S7K A;  1VIX A;  2EVN A;  1LAN A;  5AG4 A;  4B14 A;  4HNW B;  4FWU A;  3KHZ A;  2CNT A;  2JBK A;  4KVX A;  2ZEL A;  5EMI A;  3S6G A;  3D7F A;  3SI0 A;  4JWP A;  1QSN A;  1CP7 A;  5IB9 A;  3I1U A;  3NA6 A;  5AGE A;  2PR8 A;  3TO6 A;  5DWN A;  3GY9 A;  1Q2D A;  5EC4 A;  3FX6 A;  5KTC A;  1JQG A;  5ELY A;  1Q7L A;  1PUA A;  2B5G B;  1XE4 A;  5HVG A;  4M6G A;  2Q7B A;  4FD4 A;  2V8D A;  4KSF A;  2I3C A;  3D67 A;  3PRT A;  1Z2L A;  2ZED A;  3DR8 A;  2Q4Z A;  5F48 A;  2G3T A;  5G21 A;  4A38 A;  4KLV A;  3FEC A;  4MJ8 A;  4O23 A;  3HUV A;  3KZW A;  4OC5 A;  4BD9 A;  4OC1 A;  1SQH A;  4Y49 C;  1K4J A;  2J8M A;  2DPT A;  2EBJ A;  2B4B A;  1YLO A;  3CXS A;  4A39 A;  1ZG7 A;  4E0A A;  1YX0 A;  1VKC A;  1Y0R A;  2PJ2 A;  2D4O A;  2VZZ A;  2ZEH A;  1V0C A;  5F47 A;  5F49 A;  3H8F A;  2Z3M A;  4GM5 A;  4A31 A;  1WWZ A;  4Y49 B;  4FUU A;  3QAH A;  3JTK A;  3VWE A;  2B4D B;  4ZY0 A;  1DE4 C;  2B3U A;  4CGO A;  4KVO E;  5D8N A;  4JJX A;  4NFR A;  2XEI A;  4KLW A;  4C2Z A;  3NFZ A;  3B3C A;  2ZOF A;  4MBU A;  3RO0 A;  4CGL A;  4OAE A;  5JM6 A;  2OOT A;  1OBR A;  3TOA A;  2R98 A;  1S7L A;  2PC1 A;  3EY5 A;  4QB9 A;  1HDQ A;  4R3K A;  4OID A;  1ZO0 A;  2EWB A;  3H5Z A;  3VAT A;  2KCW A;  4OP4 A;  5JGF A;  2DPS A;  8CPA A;  3CT9 A;  4PXB A;  1YR0 A;  3IEH A;  4KOU A;  4TNU A;  4A32 A;  4FAI A;  4KOY A;  3PEI A;  1LAP A;  2F5I A;  3H8E A;  1QMU A;  1M1D A;  1N71 A;  1Y7R A;  2C6C A;  1QSO A;  2QJ8 A;  3DNS A;  3KQX A;  2FT0 A;  4M85 A;  4UFW A;  1LCP A;  3TCV A;  3B3T A;  1KUY A;  2CY2 A;  3NH4 A;  4UCM A;  2OB0 A;  2J8N A;  2JBJ A;  4X8I A;  2WUU A;  2Z10 A;  3T90 A;  2HB6 A;  4JZ0 A;  4Z65 A;  2CNS A;  1IU8 A;  2OR4 A;  3DLJ A;  3GB0 A;  3P2F A;  5F46 A;  1M4D A;  4KSA A;  1B6B A;  3FED A;  1HEE A;  3WR7 A;  1B87 A;  1M4I A;  5H86 A;  5LYF A;  4BIN A;  2YGW A;  1ZLH A;  3V38 A;  2P0W A;  5I0C A;  3WT4 A;  3KKW A;  4MHZ A;  3D4U A;  2G9D A;  4AG7 A;  3KGQ A;  3W91 A;  1IY7 A;  4IAV A;  2ZEP A;  2XEF A;  3BHX A;  4C7I A;  5AG5 A;  2Z3L A;  1CPS A;  3BI0 A;  1BOB A;  5J8F A;  2BEI A;  2QYV A;  3NH8 A;  2FCK A;  3I3G A;  1Z4R A;  4R7M A;  4UFV A;  5G22 A;  3IWG A;  4OAD A;  3R9G A;  4CPA A;  4KOX A;  4NEX A;  4R8F A;  1Z5R A;  1RO5 A;  4JD6 A;  1KUV A;  4ZBG A;  3SJX A;  2P6E A;  4FBE A;  4IF5 A;  1YGH A;  1TKH A;  3DR6 A;  4K3N A;  4MY3 A;  5HH1 A;  3KR5 A;  6CPA A;  2EK8 A;  4NGM A;  1Z8X A;  3BI1 A;  1XFO A;  1Z8W A;  4PK3 A;  4PQA A;  4B11 A;  5KTD A;  4C7H A;  2IQ6 A;  4XNH C;  2ZW6 A;  3TTH A;  2B3V A;  1QST A;  3BLN A;  3CXP A;  2NMT A;  1M4G A;  1MJB A;  4MFK A;  1PCA A;  3PGP A;  5KTA A;  3GUX A;  1TF9 A;  4E2A A;  3B3S A;  4KOT A;  3PP9 A;  2V8G A;  2Q43 A;  2QVP A;  4OME A;  2ZEF A;  4Q38 A;  4X2T A;  3IJ3 A;  4B12 A;  2JEW A;  2EUI A;  4UEF A;  1XF8 A;  2CTB A;  1KUX A;  4MFZ A;  3HLP A;  1BAV A;  1IIC A;  2XEG A;  4PXC A;  2K5T A;  4MCP A;  2GRE A;  2BOA A;  4MRI A;  4XPK A;  2RB7 A;  4ZI6 A;  1VGY A;  3B3W A;  2V8V A;  5J8C A;  4UWI A;  1BLL E;  4UEZ A;  3PB8 X;  1MJA A;  2GLJ A;  3IO1 A;  1DTD A;  3FNC A;  3SXN A;  3SJE A;  5G1Z A;  4CAE A;  4HKF A;  3BJ7 A;  1ARL A;  1YQE A;  2Q4Y A;  1XOV A;  3QB8 A;  3W6X A;  4K30 A;  3S6K A;  1XJO A;  2X7B A;  3PBB A;  1P0H A;  2IJZ A;  4PPZ A;  2PJC A;  4EVY A;  5K8O A;  3R1K A;  4AVB A;  4CYO A;  4F9U A;  2F8H A;  3PBE A;  2FE7 A;  1F57 A;  2O28 A;  4LUA A;  4PSX A;  4XPD C;  1XIX A;  2YNC A;  3IC1 A;  2WYR A;  3K9T A;  1S7N A;  3DSB A;  2DF5 A;  4GS4 A;  1TXR A;  3BXM A;  3PB9 X;  1X12 A;  4A37 A;  2J8R A;  1Z8L A;  4R9M A;  4NGR A;  2POK A;  3GYA A;  3H4Q A;  4RS2 A;  4L89 A;  5HVF A;  2Q4V A;  4RN7 A;  3SXO A;  4B5P B;  4F0Y A;  4TWE A;  1YSJ A;  1WK4 A;  1I12 A;  4P45 A;  1RXT A;  1XRY A;  1NSL A;  4NJR A;  5GCN A;  2B5G A;  4P4B A;  5LYD A;  2Z0Z A;  2Z3O A;  4CYP A;  2PE3 A;  1Z4E A;  2FVG A;  4ONW A;  2HQY A;  1Z9U A;  3FYN A;  4DJL A;  4CGM A;  4WWV A;  2FXF A;  4ZY1 A;  1M4L A;  2AFW A;  4KOV A;  4B5P A;  4PXE A;  2VI7 A;  3W6S A;  3KI9 A;  4DUK A;  3IWW A;  3LD2 A;  2OU2 A;  4F6A A;  4UFX A;  4MCQ A;  4YGO A;  4YRH A;  2J9A A;  3TO7 A;  4ZYQ A;  4HNX B;  1ZG8 A;  4A33 A;  3EC4 A;  1Y7E A;  4PV6 A;  2Z3P A;  4OC2 A;  3MGD A;  4EWT A;  3S9M A;  4KS9 A;  3S6H A;  1RTQ A;  2B4D A;  2G0B A;  2GFQ A;  4QBJ A;  3SI1 A;  2NYQ A;  5K8P A;  1AMP A;  4R57 A;  4ZX8 A;  2ZW7 A;  2OZG A;  1UFH A;  4C68 A;  4F9V A;  4UF4 A;  1YK3 A;  3KQZ A;  4J3G A;  2FSR A;  3D2P A;  4H6U A;  4KUB A;  2NSM A;  4OC3 A;  3ISZ A;  2Q51 A;  5A28 A;  2VEZ A;  3G3S A;  5E96 A;  4M6I A;  3FVL A;  1CJW A;  4EME A;  3B35 A;  4KZT A;  1BPN A;  1ON0 A;  1IB1 E;  4NGP A;  2BO9 A;  1L0C A;  5AG7 A;  3UY5 A;  4UIB A;  3TOB A;  2ZEN A;  2BUE A;  2JLM A;  3CDX A;  4QUS A;  3SI2 A;  3ZZI A;  4P44 A;  3FB3 A;  4BMH A;  4F8Z A;  4MCR A;  1P4N A;  1NSA A;  1R57 A;  2O4H A;  1CX8 A;  2REF A;  3K2K A;  1J4J A;  2REE A;  1ZLI A;  2V8H A;  3FH4 A;  3IU1 A;  4LQ6 A;  5THW A;  2OZH A;  2PJA A;  2IL4 A;  2ZOG A;  3SHP A;  3SJG A;  1BO4 A;  2CNM A;  1F2P A;  4FD6 A;  3FF3 A;  2PJ7 A;  3PB6 X;  4HPS A;  3KR4 A;  1LFW A;  5H84 A;  5I4M A;  4IUS A;  5AG6 A;  4YFJ A;  4U9Z A;  3OWC A;  2AFU A;  2XEJ A;  4OC0 A;  4AB7 A;  3LAC A;  5K8N A;  4CYQ A;  4AVA A;  4QC6 A;  5DWM A;  2WPX A;  4CGN A;  3B2Y A;  3D68 A;  2VBQ A;  1CPX A;  4JXQ A;  2GAN A;  3QNV A;  4MHD A;  2ODF A;  3VWD A;  1KWM A;  2C1C A;  1NMT A;  3SJF A;  4PXD A;  2Q04 A;  3WAB A;  1MJ9 A;  4X5K A;  3TO9 A;  2ATR A;  3FXT A;  3VH9 A;  4H2K A;  1Z8T A;  4UBR A;  3JVN A;  3A9L A;  2AE6 A;  2HC9 A;  2HUZ A;  4Q36 A;  5LYL A;  1YRE A;  3KAS A;  3ZJ0 A;  4NSQ A;  3NE8 A;  1H8L A;  2ZEE A;  4KVM E;  2Z3K A;  3RNZ A;  1CM0 A;  1FT7 A;  3FMC A;  2PJ4 A;  4XNH B;  2G3A A;  4CS0 B;  2P6G A;  3S9L A;  3S6F A;  1TF8 A;  4P4I A;  5F09 A;  4QVT A;  4UCP A;  5K8M A;  4G1P A;  2FIA A;  2P6F A;  4MY0 A;  2F7V A;  2EO8 A;  3GKR A;  3TFY A;  3R9F A;  4P4E A;  3RZA A;  1CP6 A;  2PJ1 A;  5JPH A;  1AYE A;  1ELM P;  1I1D A;  1QSM A;  5LYI A;  2PJ6 A;  7CPA A;  2V77 A;  2JDC A;  2PJ9 A;  1MK4 A;  1CBX A;  1LAM A;  1CG2 A;  1TKF A;  3WC5 A;  4KUA A;  4KOR A;  2IMO A;  2ANP A;  4I49 A;  4AVC A;  2FIW A;  2PIY A;  2CTC A;  4MFL A;  4P10 A;  1R43 A;  3K9U A;  3P2H A;  5CBM A;  2YND A;  1NE9 A;  5G20 A;  2ZXV A;  4CAX A;  4P6Y A;  4ORF A;  4Q7A A;  3JRU A;  5C88 A;  4PSW A;  1ARM A;  2PQ8 A;  2YNE A;  1M44 A;  4WJB A;  3R9E A;  2AFX A;  3D7D A;  5IB0 A;  1VHE A;  2PVW A;  3D2M A;  4A30 A;  3TE4 A;  2AJ6 A;  3N7Z A;  3RAM A;  2PSW A;  4XPD B;  3KHX A;  4PK2 A;  4B6Z A;  2JEV A;  5EBV A;  1JWQ A;  3EO4 A;  2DEA A;  2Q44 A;  2Y0M A;  3LOD A;  4YWY A;  3IU2 A;  4NGQ A;  2PCU A;  5J1Q A;  2RC4 A;  4P4J A;  4BBH A;  3C26 A;  4UA3 A;  1IGB A;  3F0A A;  4ZY2 A;  3BJ8 A;  2RFH A;  4X3R A;  3VAR A;  4ZX9 A;  2OZU A;  4MFP A;  4DYO A;  3RBU A;  1FNO A;  4DNC A;  1R3N A;  1LRZ A;  1XMB A;  3CXQ A;  5CNP A;  3R96 A;  4RUH A;  4A95 A;  3JUW A;  2D4P A;  4OLL A;  4RI1 A;  3V7Z A;  5HMN A;  2QML A;  2R1I A;  2WSA A;  1BPM A;  2FS5 A;  4R6T A;  2HV2 A;  4MHY A;  1ZG9 A;  2PIZ A;  2VL1 A;  4UCN A;  1LOK A;  4M3S A;  1GHE A;  2PJ3 A;  3I9S A;  4MMO A;  5LRJ A;  4R87 A;  2GU2 A;  1PU9 A;  3V8I A;  2AFS A;  2FL4 A;  4MI4 A;  2O53 A;  2Z11 A;  3PB7 X;  2WZN A;  4F0X A;  2PDO A;  4NGN A;  3WC7 A;  2ZEM A;  4KOW A;  4MHN A;  4MXU A;  4E8O A;  3R95 A;  2EK9 A;  5LRG A;  2VZY A;  3CPA A;  3TX8 A;  3NE7 A;  2ARH A;  5A27 A;  4P4D A; 
#chains in the Genus database with same CATH homology
 2BL1 A;  4HNY B;  1IID A;  5IV0 A;  4H6Z A;  4A2Z A;  2DXQ A;  5JQ4 A;  4NF1 A;  3B8G A;  4FD7 A;  4CAF A;  2ZPA A;  5BWA B;  1QSR A;  1S3Z A;  2Q0Y A;  2BSW A;  4CAV A;  2QIR A;  1Y9W A;  1OZP A;  1U6M A;  1I21 A;  1TIQ A;  1VHS A;  2QEC A;  4XPL A;  2C27 A;  4U5Y A;  3EXN A;  1S7F A;  1IYL A;  2I79 A;  1S5K A;  4CGP A;  3DDD A;  4FD5 A;  2CXA A;  2R8V A;  4C2X A;  4AG9 A;  2OH1 A;  3F8K A;  1IYK A;  4B5O A;  5C82 A;  2GE3 A;  3G8W A;  2PR1 A;  3PZJ A;  4R3L A;  2JDD A;  4MFQ A;  3E0K A;  4B10 A;  1YVK A;  2WPW A;  4NXY A;  4CRY B;  3FRM A;  2VQY A;  4JLY A;  1S60 A;  4CYN A;  2R7H A;  4CAW A;  4NCZ A;  4LX9 A;  4H89 A;  1Q2C A;  2ZW4 A;  5FVJ A;  4JD6 A;  1XEB A;  3IWE A;  5ISV A;  2ZW5 A;  4B13 A;  2VXK A;  1KZF A;  4JXR A;  4C2Y A;  4U9Y A;  1FY7 A;  3F5B A;  3RYO A;  1YLE A;  2B58 A;  3EFA A;  1YVO A;  4MFJ A;  4ONU A;  1Y9K A;  4II9 A;  2A4N A;  2H5M A;  3TT2 A;  2I00 A;  2GIV A;  2YNC C;  4L8A A;  2Z3N A;  2PRB A;  5IX3 A;  1Q2Y A;  3IGR A;  3D3S A;  1XMT A;  3FIX A;  4ZGY B;  4KOS A;  3T9Y A;  4CRZ B;  3FBU A;  3D8P A;  4UWJ A;  1S7K A;  2EVN A;  5AG4 A;  4B14 A;  4HNW B;  2CNT A;  4KVX A;  3S6G A;  4JWP A;  1QSN A;  5AGE A;  2PR8 A;  3TO6 A;  5DWN A;  3GY9 A;  1Q2D A;  5EC4 A;  5KTC A;  1PUA A;  2B5G B;  1XE4 A;  2Q7B A;  4FD4 A;  4KSF A;  5F48 A;  3DR8 A;  5G21 A;  2G3T A;  4KLV A;  4MJ8 A;  1SQH A;  4Y49 C;  1K4J A;  2J8M A;  2DPT A;  2B4B A;  3CXS A;  4E0A A;  1YX0 A;  1VKC A;  2D4O A;  2VZZ A;  5F47 A;  1V0C A;  5F49 A;  2Z3M A;  4A31 A;  1WWZ A;  4Y49 B;  3QAH A;  3JTK A;  3VWE A;  2B4D B;  2B3U A;  4CGO A;  4KVO E;  4JJX A;  4KLW A;  4C2Z A;  4CGL A;  4MBU A;  4OAE A;  3TOA A;  2R98 A;  1S7L A;  2PC1 A;  3EY5 A;  4QB9 A;  4R3K A;  1ZO0 A;  3H5Z A;  2KCW A;  2DPS A;  1YR0 A;  4KOU A;  4A32 A;  4KOY A;  2F5I A;  1M1D A;  1N71 A;  1Y7R A;  4M85 A;  1QSO A;  3DNS A;  4UFW A;  2FT0 A;  3TCV A;  1KUY A;  2CY2 A;  4UCM A;  2OB0 A;  2J8N A;  2WUU A;  2Z10 A;  3T90 A;  2CNS A;  3P2F A;  5F46 A;  1M4D A;  4KSA A;  1B6B A;  3WR7 A;  1B87 A;  1M4I A;  5H86 A;  2YGW A;  2P0W A;  5I0C A;  3KKW A;  4AG7 A;  3W91 A;  4C7I A;  5AG5 A;  2Z3L A;  1BOB A;  5J8F A;  2BEI A;  2FCK A;  3I3G A;  1Z4R A;  4UFV A;  5G22 A;  3IWG A;  4OAD A;  3R9G A;  4KOX A;  4NEX A;  4ZBG A;  1RO5 A;  1KUV A;  2P6E A;  4IF5 A;  1YGH A;  3DR6 A;  4MY3 A;  5HH1 A;  4B11 A;  5KTD A;  4PK3 A;  4C7H A;  4XNH C;  2ZW6 A;  3TTH A;  2B3V A;  1QST A;  3BLN A;  3CXP A;  2NMT A;  1M4G A;  1MJB A;  4MFK A;  3PGP A;  5KTA A;  4E2A A;  4KOT A;  3PP9 A;  4Q38 A;  4B12 A;  2EUI A;  1XF8 A;  1KUX A;  4MFZ A;  1IIC A;  2K5T A;  4XPK A;  5J8C A;  4UWI A;  1MJA A;  3FNC A;  3SXN A;  5G1Z A;  4CAE A;  4HKF A;  3BJ7 A;  2Q4Y A;  3QB8 A;  3W6X A;  4K30 A;  3S6K A;  2X7B A;  1P0H A;  4EVY A;  3R1K A;  4AVB A;  4CYO A;  2FE7 A;  2O28 A;  4LUA A;  4PSX A;  4XPD C;  1XIX A;  2YNC A;  1S7N A;  3DSB A;  4GS4 A;  2J8R A;  4R9M A;  4RS2 A;  3GYA A;  3H4Q A;  3SXO A;  4B5P B;  4L89 A;  2Q4V A;  4F0Y A;  1WK4 A;  1I12 A;  1RXT A;  1NSL A;  5GCN A;  2B5G A;  2Z0Z A;  2Z3O A;  4CYP A;  1Z4E A;  2HQY A;  1Z9U A;  3FYN A;  4CGM A;  2FXF A;  4KOV A;  4B5P A;  2VI7 A;  3W6S A;  3LD2 A;  2OU2 A;  4F6A A;  4UFX A;  4YGO A;  4YRH A;  3TO7 A;  4HNX B;  4A33 A;  3EC4 A;  4PV6 A;  2Z3P A;  3MGD A;  4KS9 A;  3S6H A;  4QBJ A;  2B4D A;  2G0B A;  4R57 A;  2ZW7 A;  2OZG A;  1UFH A;  4C68 A;  1YK3 A;  4J3G A;  2FSR A;  3D2P A;  4H6U A;  4KUB A;  5A28 A;  2VEZ A;  3G3S A;  5E96 A;  1CJW A;  4KZT A;  1ON0 A;  1IB1 E;  1L0C A;  5AG7 A;  3UY5 A;  3TOB A;  4QUS A;  2BUE A;  2JLM A;  3ZZI A;  4BMH A;  3FB3 A;  1P4N A;  1R57 A;  2REF A;  1J4J A;  2REE A;  3IU1 A;  3SHP A;  2OZH A;  2IL4 A;  1BO4 A;  2CNM A;  4FD6 A;  5H84 A;  4IUS A;  5AG6 A;  4YFJ A;  4U9Z A;  3OWC A;  4AB7 A;  4CYQ A;  4AVA A;  4QC6 A;  5DWM A;  2WPX A;  4CGN A;  2VBQ A;  4JXQ A;  2GAN A;  4MHD A;  3VWD A;  1NMT A;  2Q04 A;  1MJ9 A;  4X5K A;  3TO9 A;  2ATR A;  3FXT A;  4UBR A;  3JVN A;  3A9L A;  2AE6 A;  2HUZ A;  4Q36 A;  1YRE A;  3ZJ0 A;  4NSQ A;  4KVM E;  2Z3K A;  1CM0 A;  4XNH B;  2G3A A;  4CS0 B;  2P6G A;  3S6F A;  4QVT A;  4UCP A;  2FIA A;  2P6F A;  4MY0 A;  3TFY A;  3GKR A;  3R9F A;  5JPH A;  1QSM A;  1I1D A;  2JDC A;  1MK4 A;  4KUA A;  4KOR A;  4I49 A;  4AVC A;  2FIW A;  4MFL A;  3K9U A;  3P2H A;  2YND A;  1NE9 A;  5G20 A;  2ZXV A;  4CAX A;  4ORF A;  5C88 A;  4PSW A;  2PQ8 A;  2YNE A;  1M44 A;  3R9E A;  5IB0 A;  3D2M A;  3TE4 A;  4A30 A;  2AJ6 A;  3N7Z A;  2PSW A;  4XPD B;  4PK2 A;  2JEV A;  5EBV A;  3EO4 A;  2Q44 A;  2Y0M A;  3LOD A;  3IU2 A;  2RC4 A;  4BBH A;  3C26 A;  4UA3 A;  3F0A A;  3BJ8 A;  2OZU A;  4MFP A;  4DNC A;  3CXQ A;  1LRZ A;  3R96 A;  5CNP A;  4A95 A;  3JUW A;  2D4P A;  4OLL A;  4RI1 A;  5HMN A;  2QML A;  2R1I A;  2WSA A;  2FS5 A;  2HV2 A;  4UCN A;  4M3S A;  1GHE A;  3I9S A;  4R87 A;  1PU9 A;  3V8I A;  2FL4 A;  4MI4 A;  2Z11 A;  4F0X A;  2PDO A;  4KOW A;  4E8O A;  3R95 A;  5A27 A;  2VZY A;  3NE7 A;  2ARH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...