2WUUA

Structure of n-myristoyltransferase from l. donovani
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
402
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVESMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-MYRISTOYLTRANSFERASE
publication title N-Myristoyltransferase from Leishmania Donovani: Structural and Functional Characterisation of a Potential Drug Target for Visceral Leishmaniasis.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
total genus 125
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wuuA00
3IWEA 4A33A 4A30A 4CYOA 4A2ZA 4C68A 4CYNA 5AG5A 4CGPA 3IU2A 4BBHA 4UFWA 5AG7A 4B12A 3JTKA 4CGNA 2WUUA 2YNCC 3IU1A 3H5ZA 4UFXA 4UCPA 4CGLA 4A32A 4UCNA 4C7IA 5AG4A 5AGEA 4B14A 2YNCA 4CYQA 4CGMA 2YNDA 5G21A 4A31A 5A27A 4UCMA 2WSAA 4C2YA 4CGOA 4B10A 4A95A 4C7HA 4UFVA 4C2XA 5G22A 5G1ZA 4CAFA 4CAEA 5G20A 4B13A 5A28A 5AG6A 2YNEA 4CYPA 4B11A 4C2ZA
chains in the Genus database with same CATH superfamily
2EUIA 3NA6A 5GCNA 4BMHA 3B3TA 3F8KA 2PJBA 4NGMA 4XPLA 3ZZIA 4L8AA 4QVTA 2V8VA 4B5OA 3D7FA 3CPXA 1CG2A 2ODFA 1Y7RA 2POKA 2Q4YA 2ZOFA 2AFUA 4IHMA 1UFHA 4MI4A 4CGNA 1L0CA 4K3NA 3NH8A 2Z3LA 2C1CA 1M4DA 3IIBA 4B5PB 1B6BA 2PE3A 1YSJA 2FL4A 2CNSA 4H6UA 3H4QA 1JWQA 3DR8A 4HNXB 2D4OA 3IWGA 3IJ3A 4WJBA 2H5MA 2ZXVA 1HDQA 4JYWA 4X5KA 3TT2A 4CAFA 4EVYA 4TWEA 3FIXA 1M44A 1EE3P 4PXDA 5ELYA 2YGWA 2PJ5A 2AE6A 5I0CA 4R9MA 2PCUA 2Q7BA 5F46A 2XEFA 3D4UA 2RFHA 3B3SA 4NJRA 4ZY0A 4AG7A 1YREA 2Z11A 4OIDA 4WWVA 3IU1A 4R3KA 4CAWA 3CZXA 2PJ0A 1N71A 1ZLHA 1BLLE 2V8HA 4P45A 4ZY2A 2Z3PA 4ZYQA 3S9LA 2PJ6A 1QSOA 5H86A 3PB8X 2PJ7A 4CPAA 2IQ6A 4JLYA 1YQEA 5BWAB 3D68A 4Q38A 2Y0MA 4UIAA 1QSTA 3K9TA 4CGOA 1Z9UA 2ZEOA 2FXFA 2BSWA 2OOTA 5G1ZA 1CPXA 1S5KA 4KLVA 4QC6A 2YNEA 5EMIA 3SJXA 4CAEA 1X12A 2FVGA 4P6YA 3F5BA 4AVCA 1CP7A 1ARMA 2REFA 4FWUA 3UY5A 2BCOA 1KUXA 3H8FA 3KQXA 1SQHA 3PRTA 1LCPA 5HVFA 3FX6A 1M4LA 2B3VA 1VIXA 4KVOE 1S7NA 4YFJA 1IB1E 4P4JA 4OC4A 5HVGA 2HQYA 1CP6A 1QSMA 2EK8A 2YNDA 1A2ZA 5G21A 4UWIA 5LYFA 3FEEA 1WK4A 2IJZA 2Z3MA 3PZJA 3PB6X 1ARLA 2ZEEA 2G0BA 2JBJA 2IMOA 1Z4EA 2XEJA 3B3CA 3QB8A 1HDUA 4G1PA 5G20A 1CJWA 2GREA 4ORFA 3S6GA 2C27A 5C88A 4MRIA 2WZNA 3FXTA 2PC1A 4A39A 4UA3A 4PK2A 2Q04A 4KOSA 3DDDA 2ZEDA 3FJUA 4X8IA 3SJFA 3P2FA 3TOAA 2FT0A 4BBHA 3DNSA 3JRUA 1IYKA 1YLOA 4EWTA 1CBXA 4NGQA 3GYAA 4HNWB 5D29A 3R9GA 4LX9A 3RYOA 4HPSA 4UF4A 5DWNA 2FCKA 3KR4A 4MFQA 1Z8XA 1TXRA 5CPAA 3H8GA 3ZJ0A 1F2PA 1LAPA 4MCQA 2B5GB 2PDOA 2AFOA 4O23A 3SHPA 2Q0YA 4DYOA 4ZGYB 4IUSA 4C2ZA 2OZHA 2ZENA 4RI1A 4J3GA 5KTDA 3N5FA 4KVME 4X3RA 3KL9A 4QB9A 4NGNA 1VHOA 1I21A 2GLFA 1XRYA 4B12A 1RO5A 1KZFA 1XF8A 3NFZA 4UFXA 2PJ8A 3QNVA 4NXYA 5CNPA 4PXBA 2PJCA 2AFMA 2ZEHA 3TO7A 3WC6A 3I1UA 2G9DA 4KOWA 1Q7LA 1Y0YA 3H8EA 4R8FA 2F7VA 4X2TA 1ON0A 2I00A 2VQYA 3TCVA 2CY2A 4PPZA 4MCSA 2ZEPA 2ATRA 1XFOA 1WWZA 2GU2A 2PR8A 4R7MA 3B2YA 4Y49C 4A2ZA 1TKJA 3CDXA 2CTCA 4FD7A 1K4JA 2CTBA 4H6ZA 4MHPA 3G8WA 2Z10A 3NH5A 1Q2YA 5JPHA 5IX3A 2EO8A 4KSAA 2V8GA 4KSIA 1CPSA 4R76A 4PSWA 3EC4A 3R96A 2JEWA 3T9YA 2EK9A 3D7HA 4Y49B 1CM0A 4MCRA 4RN7A 3SI1A 2EBJA 4MHNA 1PU9A 4NEXA 1M1DA 3E0KA 3IEHA 5DS0A 4XPKA 3G3SA 3QAYA 2CNMA 2WYRA 4PK3A 5D8NA 5F47A 1IIDA 3SI0A 2BL1A 3BJ7A 4RUHA 4HKFA 3FF3A 1KUYA 3IFEA 3B3VA 1BAVA 1NE9A 1XMTA 4JXRA 4A94A 5LRJA 3D8PA 1ELLP 3VWEA 2Z3KA 3GB0A 1MJAA 3KQZA 3SJGA 5K8PA 2HUZA 1Q2CA 4FD4A 1PUAA 3BJ8A 5KTCA 3PBEA 4AB7A 2NYQA 2PVWA 1ZG8A 1ZLIA 4KOUA 2CF4A 4JZ0A 4A31A 3ISZA 3IWWA 3KASA 2QMLA 2WSAA 2O4HA 2OZGA 3BI1A 3MGDA 4K30A 1IOFA 4MMOA 4A95A 4C7HA 4M6GA 1LAMA 4P4EA 5A28A 1KUVA 1AUGA 1IGBA 3WT4A 2GFQA 3FRMA 4MFLA 1IICA 4OAEA 1LOKA 4MBUA 2QIRA 3TX8A 2A4NA 1TF8A 4PXEA 3D7GA 4MFJA 4H2KA 4P10A 4Q7AA 4NGTA 1XJOA 4OC5A 2X7BA 2J8RA 3PFOA 4MY3A 4XNHC 4OC1A 5HH1A 1QMUA 1I1DA 5CBMA 2G3TA 3PGPA 4M6IA 3GUXA 3CPAA 2Q43A 3D2PA 4E0AA 4MY0A 3S6FA 4AXVA 4JWPA 4NGRA 4JD6A 3LWUA 3RO0A 2VI7A 4XNHB 1F2OA 2V77A 4ONWA 2GE3A 1YW4A 2C6CA 4P4BA 3PB4X 4MFKA 1S7FA 3KZWA 2P6EA 4FD5A 2PVVA 2OU2A 1LANA 5E96A 4OP4A 2EVNA 3CT9A 2DPSA 4GM5A 3T8WA 1RXTA 4CYOA 2OB0A 2P6FA 3B8GA 2HV2A 2BO9A 3VH9A 3W91A 3L2NA 3V8IA 1AYEA 3BI0A 3I3GA 4ZI6A 3B35A 2WPWA 2B4DA 2Q7SA 4F9VA 4MCPA 4YRHA 2VEZA 4W9YA 1X10A 1Y9WA 2QECA 2JBKA 2QJ8A 2ZEMA 3LMSA 4P4IA 4U9YA 1TKHA 1YW6A 3SXOA 1QSRA 5DWMA 3T90A 1TKFA 1FNOA 4OC2A 3FECA 4KORA 4PQAA 3CXPA 4LQ6A 5JH9A 2JDDA 2PJ2A 3CXQA 4YGOA 4KOVA 4CAXA 1UWYA 5J1QA 3DR6A 1Z4RA 4NFRA 2D4PA 3FYNA 4NSQA 2Q44A 2Z3OA 3JVNA 3KHXA 1Z8WA 3IO1A 3PP9A 4KLWA 5LRGA 7CPAA 4XPDC 4JXQA 2B58A 4KS9A 2DEAA 2JEVA 3VARA 3TOBA 3PB9X 4A32A 3WABA 2YNCA 2K5TA 1YVOA 4PXCA 2FIWA 1P0HA 1R3NA 3EO4A 4ZY1A 4M3SA 2OH1A 3RNZA 3DLJA 4RS2A 4KZTA 2DXQA 4UCMA 4MFZA 4XPDB 3W6XA 4KUBA 5K8OA 2VBQA 4P4DA 2NSMA 5G22A 3GY9A 4R6TA 1XEBA 4B13A 5HVHA 2JLMA 3S9NA 5AG6A 1Y7EA 3FMCA 3NH4A 1H8LA 3KGQA 2RB7A 4DNCA 4OLLA 2PSWA 4CRZB 3FBUA 5IB9A 4UEFA 4Q36A 4FUUA 2J8NA 3B7IA 2PJ9A 3CXSA 3PFEA 4OMEA 4ZX8A 4YU9A 4AVBA 2ZW6A 4E8OA 4P44A 2KCWA 1S7LA 2FSRA 2VL1A 1ZO0A 2XEGA 4U9ZA 4UCNA 4B14A 4CYQA 2HC9A 2J8MA 4Z65A 4OC0A 2AFSA 3BLNA 1VHSA 4L89A 3K2KA 4MFPA 1XBUA 2R1IA 4OKOA 2PQ8A 5LYDA 3HUVA 1QSNA 1YX0A 2BEIA 3FEDA 2PRQA 3EY5A 4H89A 4QBJA 4KSFA 4MHDA 1I12A 1LRZA 2BOAA 2ZW7A 1VKCA 3S6HA 1IU8A 3HLPA 1M4GA 1Q2DA 3V38A 3PBBA 3R95A 4FBEA 1DE4C 3OWCA 2ZEGA 2PJ1A 5IB0A 4II9A 1YK3A 4UEZA 4ZBGA 4UFWA 5FVJA 4B5PA 5ISVA 4LQGA 3D67A 3WC7A 4NJQA 5F49A 8CPAA 5JGFA 1MJBA 4CGLA 1Z8LA 5K8NA 1YVKA 3EFAA 2J9AA 4PV6A 4CGMA 1NMTA 4NCZA 3IGRA 2JDCA 4F6AA 4C2YA 4CS0B 1TF9A 4FAIA 2O53A 1S7KA 2G3AA 6CPAA 2B3UA 5LYIA 3FVLA 4F9UA 2VZZA 4MHZA 1ELMP 1YGHA 3C26A 1NSLA 1RTQA 5HXDA 2ZOGA 2V8DA 5LRKA 1BOBA 1TIQA 1FT7A 2NMTA 3LD2A 4FD6A 5EBVA 4QUSA 1ZG9A 1OZPA 4F0YA 1AMPA 4F8ZA 1V0CA 2AJ6A 4UIBA 4DUKA 5AG7A 2ZW5A 5K8MA 4A37A 1PCAA 4TNUA 1R57A 2CXAA 4I49A 2C6PA 4M6HA 4OC3A 3WR7A 5JM6A 1VGYA 4KOXA 1CX8A 2Q4VA 3N7ZA 3D66A 3RBUA 3KI9A 3F0AA 2C6GA 3IC1A 3DSBA 2CIJA 1XE4A 4NGSA 3R1KA 1XMBA 4NGPA 2F5IA 1J4JA 4UFVA 2OZUA 2DPTA 1GHEA 4B6ZA 4C2XA 3GIUA 1KWMA 1P4NA 1LFWA 2O28A 2OR4A 1R43A 2B4BA 3MN8A 4KOYA 4MJ8A 2HB6A 2VZYA 3K9UA 2AFZA 5EC4A 3IWEA 4OADA 2ZPAA 4IAVA 5KTAA 3GLJA 4PSXA 3TTHA 2P6GA 4E2AA 1HEEA 2F8HA 5THWA 4CGPA 2Q51A 3BXMA 3W6SA 4DJLA 3TC8A 2GIVA 3PEIA 3BHXA 2R8VA 4U5YA 4LUAA 4R3LA 5H84A 5JQ4A 4KUAA 4NF1A 1Z2LA 2EWBA 2FS5A 4CRYB 2PR1A 4ZX9A 5A27A 2PJ4A 3RAMA 3JUWA 1IY7A 1B87A 2ABZA 2ZEFA 4UWJA 3V7ZA 5F48A 2ANPA 2B4DB 3KKWA 3B3WA 2FE7A 3LODA 4A38A 1PYTB 5F09A 2PIYA 2QYVA 1GYTA 1FY7A 1YR0A 2REEA 3EXNA 2PJAA 2ARHA 2BUEA 4F0XA 4B11A 1NSAA 1S3ZA 4A33A 3FNCA 5J8FA 3TE4A 4A30A 3TO6A 4KOTA 5LYLA 5AG5A 4UEEA 3KHZA 3TFYA 4EMEA 1BPMA 4UBRA 3JTKA 4KVXA 2YNCC 3NE7A 3P2HA 1ZG7A 3D2MA 2R98A 4P4FA 4C7IA 2I79A 4HNYB 1F57A 2B5GA 1MK4A 1IYLA 3MRUA 3NE8A 3R9EA 4AG9A 3TO9A 4R87A 5C82A 3R9FA 3I9SA 3S6KA 2PJ3A 2FIAA 1MJ9A 2GANA 4MHYA 3WC5A 4R57A 1Y0RA 3FB3A 1XIXA 4JJXA 4ONUA 3D3SA 4CAVA 1BPNA 3FH4A 5IV0A 3RZAA 2IL4A 1S60A 2Z3NA 2DF5A 2ZW4A 4BINA 2P0WA 2WPXA 4C68A 4CYNA 2ZELA 3QAHA 5J8CA 1BO4A 3IU2A 2Q4ZA 2AFXA 3SI2A 1M4IA 4YWYA 3SJEA 1Y9KA 2WUUA 1YLEA 3A9LA 3GKRA 3H5ZA 1IOIA 2Z0ZA 1DTDA 1JQGA 1U6MA 4UCPA 4EFDA 5AG4A 4GS4A 5AGEA 2AFWA 4OIWA 3PB7X 1Z8TA 3VWDA 5I4MA 4BD9A 1QQ9A 4AVAA 3ISXA 4MXUA 1YMEA 2CNTA 3S9MA 2VXKA 4GXHA 3VATA 4B10A 2I3CA 2PRBA 4IF5A 2QVPA 1VHEA 3LACA 1XOVA 2XEIA 3KR5A 5HMNA 1Z5RA 4IK2A 3DGVA 4M85A 3D7DA 2PIZA 2R7HA 3SXNA 1OBRA 4CYPA 2RC4A 2GLJA
chains in the Genus database with same CATH topology
2EUIA 5GCNA 4BMHA 3F8KA 4XPLA 3ZZIA 4L8AA 4QVTA 4B5OA 1Y7RA 4CGNA 2Q4YA 4CRYB 1UFHA 4MI4A 1L0CA 2Z3LA 1M4DA 4B5PB 1B6BA 2FL4A 2CNSA 4H6UA 3H4QA 3DR8A 4HNXB 2D4OA 3IWGA 3TT2A 2H5MA 2ZXVA 4CAFA 4EVYA 4X5KA 3FIXA 1M44A 2YGWA 2AE6A 5I0CA 4R9MA 2Q7BA 5F46A 4AG7A 1YREA 2Z11A 3IU1A 4R3KA 4CAWA 1N71A 2Z3PA 1QSOA 5H86A 4JLYA 5BWAB 4Q38A 2Y0MA 1QSTA 4CGOA 1Z9UA 2FXFA 2BSWA 5G1ZA 1S5KA 4KLVA 4QC6A 2YNEA 4CAEA 3F5BA 4AVCA 2REFA 3UY5A 1KUXA 1SQHA 2B3VA 4KVOE 1S7NA 4YFJA 1IB1E 2HQYA 1QSMA 2YNDA 5G21A 4UWIA 1WK4A 2Z3MA 3PZJA 2G0BA 1Z4EA 3QB8A 5G20A 1CJWA 4ORFA 3S6GA 2C27A 5C88A 3FXTA 2PC1A 4UA3A 4PK2A 2Q04A 4KOSA 3DDDA 3P2FA 3TOAA 2FT0A 4BBHA 3DNSA 1IYKA 3GYAA 4HNWB 3R9GA 4LX9A 3RYOA 5DWNA 2FCKA 4MFQA 3ZJ0A 2B5GB 2PDOA 3SHPA 2Q0YA 4ZGYB 4IUSA 4C2ZA 2OZHA 5KTDA 4RI1A 4J3GA 4KVME 4QB9A 1I21A 4B12A 1RO5A 1KZFA 1XF8A 4UFXA 4NXYA 5CNPA 3TO7A 4KOWA 3TCVA 1ON0A 2I00A 2VQYA 2CY2A 2ATRA 2PR8A 1WWZA 4Y49C 4A2ZA 4FD7A 1K4JA 4H6ZA 3G8WA 2Z10A 1Q2YA 5JPHA 5IX3A 4KSAA 4PSWA 3EC4A 3R96A 3T9YA 4Y49B 1CM0A 1PU9A 4NEXA 1M1DA 3E0KA 4XPKA 3G3SA 4PK3A 2CNMA 5F47A 1IIDA 2BL1A 3BJ7A 4HKFA 1KUYA 1NE9A 1XMTA 4JXRA 3D8PA 3VWEA 2Z3KA 1MJAA 2HUZA 1Q2CA 4FD4A 1PUAA 3BJ8A 5KTCA 4AB7A 4KOUA 4A31A 2QMLA 3MGDA 2WSAA 2OZGA 4K30A 4A95A 4C7HA 5A28A 1KUVA 4MFLA 3FRMA 1IICA 4OAEA 4MBUA 2QIRA 2A4NA 4MFJA 2X7BA 2J8RA 4MY3A 4XNHC 5HH1A 1I1DA 2G3TA 3PGPA 3D2PA 4E0AA 4MY0A 3S6FA 4JWPA 4JD6A 2VI7A 4XNHB 2GE3A 4MFKA 1S7FA 4FD5A 2P6EA 2OU2A 5E96A 2EVNA 2DPSA 1RXTA 4CYOA 2OB0A 2P6FA 3B8GA 2HV2A 3W91A 3V8IA 3I3GA 2WPWA 2B4DA 4YRHA 2VEZA 1Y9WA 2QECA 4U9YA 3SXOA 1QSRA 5DWMA 3T90A 4KORA 3CXPA 2JDDA 3CXQA 4YGOA 4KOVA 4CAXA 3DR6A 1Z4RA 2D4PA 3FYNA 4NSQA 2Q44A 2Z3OA 3JVNA 3PP9A 4KLWA 4XPDC 4JXQA 2B58A 4KS9A 2JEVA 3TOBA 4A32A 2YNCA 2K5TA 1YVOA 2FIWA 1P0HA 3EO4A 4M3SA 2OH1A 4UCMA 4RS2A 4KZTA 2DXQA 4XPDB 4MFZA 3W6XA 4KUBA 2VBQA 5G22A 3GY9A 1XEBA 4B13A 2JLMA 5AG6A 4DNCA 4OLLA 2PSWA 4CRZB 3FBUA 4Q36A 2J8NA 3CXSA 4AVBA 2ZW6A 2KCWA 1S7LA 2FSRA 1ZO0A 4U9ZA 4UCNA 4B14A 4CYQA 2J8MA 3BLNA 1VHSA 4L89A 4MFPA 2R1IA 2PQ8A 1QSNA 1YX0A 2BEIA 3EY5A 4H89A 4QBJA 4KSFA 4MHDA 1I12A 1LRZA 2ZW7A 1VKCA 3S6HA 1M4GA 1Q2DA 3R95A 3OWCA 5IB0A 4II9A 1YK3A 4ZBGA 4UFWA 5FVJA 4B5PA 5ISVA 5F49A 1MJBA 4CGLA 1YVKA 3EFAA 4PV6A 4CGMA 1NMTA 4NCZA 3IGRA 2JDCA 4F6AA 4C2YA 4CS0B 1S7KA 2G3AA 2B3UA 2VZZA 1YGHA 3C26A 1NSLA 1BOBA 1TIQA 2NMTA 3LD2A 4FD6A 5EBVA 4QUSA 1OZPA 4F0YA 1V0CA 2AJ6A 5AG7A 2ZW5A 1R57A 2CXAA 4I49A 3WR7A 4KOXA 2Q4VA 3N7ZA 3F0AA 3DSBA 1XE4A 3R1KA 4UFVA 4C2XA 2F5IA 1J4JA 2OZUA 2DPTA 1GHEA 4KOYA 1P4NA 2O28A 4R87A 2B4BA 4MJ8A 2VZYA 3K9UA 5EC4A 3IWEA 4OADA 2ZPAA 5KTAA 4E2AA 4PSXA 3TTHA 2P6GA 4CGPA 3W6SA 2GIVA 2R8VA 4U5YA 4LUAA 4R3LA 5H84A 5JQ4A 4KUAA 4NF1A 2FS5A 2PR1A 5A27A 3JUWA 4UWJA 1B87A 5F48A 2B4DB 3KKWA 3LODA 2FE7A 3EXNA 1FY7A 1YR0A 2REEA 2ARHA 2BUEA 4F0XA 4B11A 1S3ZA 4A33A 3FNCA 5J8FA 3TE4A 4A30A 3TO6A 4KOTA 5AG5A 3TFYA 4UBRA 3JTKA 4KVXA 3P2HA 2YNCC 3NE7A 3D2MA 2R98A 4C7IA 2I79A 4HNYB 2B5GA 1MK4A 1IYLA 3R9EA 4AG9A 3TO9A 5C82A 3R9FA 3I9SA 3S6KA 2FIAA 1MJ9A 2GANA 4R57A 3FB3A 1XIXA 4JJXA 4ONUA 3D3SA 4CAVA 5IV0A 2IL4A 1S60A 2Z3NA 2ZW4A 2P0WA 2WPXA 4C68A 4CYNA 3QAHA 5J8CA 1BO4A 3IU2A 1M4IA 1Y9KA 2WUUA 1YLEA 3A9LA 3GKRA 3H5ZA 2Z0ZA 4UCPA 1U6MA 5AG4A 4GS4A 5AGEA 3VWDA 4AVAA 2CNTA 2VXKA 4B10A 2PRBA 4IF5A 5HMNA 4M85A 2R7HA 3SXNA 4CYPA 4E8OA 2RC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWE A;  4A33 A;  4A30 A;  4CYO A;  4A2Z A;  4C68 A;  4CYN A;  5AG5 A;  4CGP A;  3IU2 A;  4BBH A;  4UFW A;  5AG7 A;  4B12 A;  3JTK A;  4CGN A;  2WUU A;  2YNC C;  3IU1 A;  3H5Z A;  4UFX A;  4UCP A;  4CGL A;  4A32 A;  4UCN A;  4C7I A;  5AG4 A;  5AGE A;  4B14 A;  2YNC A;  4CYQ A;  4CGM A;  2YND A;  5G21 A;  4A31 A;  5A27 A;  4UCM A;  2WSA A;  4C2Y A;  4CGO A;  4B10 A;  4A95 A;  4C7H A;  4UFV A;  4C2X A;  5G22 A;  5G1Z A;  4CAF A;  4CAE A;  5G20 A;  4B13 A;  5A28 A;  5AG6 A;  2YNE A;  4CYP A;  4B11 A;  4C2Z A; 
#chains in the Genus database with same CATH topology
 2EUI A;  3NA6 A;  5GCN A;  4BMH A;  3B3T A;  3F8K A;  2PJB A;  4NGM A;  4XPL A;  3ZZI A;  4L8A A;  4QVT A;  2V8V A;  4B5O A;  3D7F A;  3CPX A;  1CG2 A;  2ODF A;  1Y7R A;  2POK A;  2Q4Y A;  2ZOF A;  2AFU A;  4IHM A;  1UFH A;  4MI4 A;  4CGN A;  1L0C A;  4K3N A;  3NH8 A;  2Z3L A;  2C1C A;  1M4D A;  3IIB A;  4B5P B;  1B6B A;  2PE3 A;  1YSJ A;  2FL4 A;  2CNS A;  4H6U A;  3H4Q A;  1JWQ A;  3DR8 A;  4HNX B;  2D4O A;  3IWG A;  3IJ3 A;  4WJB A;  2H5M A;  2ZXV A;  1HDQ A;  4JYW A;  4X5K A;  3TT2 A;  4CAF A;  4EVY A;  4TWE A;  3FIX A;  1M44 A;  1EE3 P;  4PXD A;  5ELY A;  2YGW A;  2PJ5 A;  2AE6 A;  5I0C A;  4R9M A;  2PCU A;  2Q7B A;  5F46 A;  2XEF A;  3D4U A;  2RFH A;  3B3S A;  4NJR A;  4ZY0 A;  4AG7 A;  1YRE A;  2Z11 A;  4OID A;  4WWV A;  3IU1 A;  4R3K A;  4CAW A;  3CZX A;  2PJ0 A;  1N71 A;  1ZLH A;  1BLL E;  2V8H A;  4P45 A;  4ZY2 A;  2Z3P A;  4ZYQ A;  3S9L A;  2PJ6 A;  1QSO A;  5H86 A;  3PB8 X;  2PJ7 A;  4CPA A;  2IQ6 A;  4JLY A;  1YQE A;  5BWA B;  3D68 A;  4Q38 A;  2Y0M A;  4UIA A;  1QST A;  3K9T A;  4CGO A;  1Z9U A;  2ZEO A;  2FXF A;  2BSW A;  2OOT A;  5G1Z A;  1CPX A;  1S5K A;  4KLV A;  4QC6 A;  2YNE A;  5EMI A;  3SJX A;  4CAE A;  1X12 A;  2FVG A;  4P6Y A;  3F5B A;  4AVC A;  1CP7 A;  1ARM A;  2REF A;  4FWU A;  3UY5 A;  2BCO A;  1KUX A;  3H8F A;  3KQX A;  1SQH A;  3PRT A;  1LCP A;  5HVF A;  3FX6 A;  1M4L A;  2B3V A;  1VIX A;  4KVO E;  1S7N A;  4YFJ A;  1IB1 E;  4P4J A;  4OC4 A;  5HVG A;  2HQY A;  1CP6 A;  1QSM A;  2EK8 A;  2YND A;  1A2Z A;  5G21 A;  4UWI A;  5LYF A;  3FEE A;  1WK4 A;  2IJZ A;  2Z3M A;  3PZJ A;  3PB6 X;  1ARL A;  2ZEE A;  2G0B A;  2JBJ A;  2IMO A;  1Z4E A;  2XEJ A;  3B3C A;  3QB8 A;  1HDU A;  4G1P A;  5G20 A;  1CJW A;  2GRE A;  4ORF A;  3S6G A;  2C27 A;  5C88 A;  4MRI A;  2WZN A;  3FXT A;  2PC1 A;  4A39 A;  4UA3 A;  4PK2 A;  2Q04 A;  4KOS A;  3DDD A;  2ZED A;  3FJU A;  4X8I A;  3SJF A;  3P2F A;  3TOA A;  2FT0 A;  4BBH A;  3DNS A;  3JRU A;  1IYK A;  1YLO A;  4EWT A;  1CBX A;  4NGQ A;  3GYA A;  4HNW B;  5D29 A;  3R9G A;  4LX9 A;  3RYO A;  4HPS A;  4UF4 A;  5DWN A;  2FCK A;  3KR4 A;  4MFQ A;  1Z8X A;  1TXR A;  5CPA A;  3H8G A;  3ZJ0 A;  1F2P A;  1LAP A;  4MCQ A;  2B5G B;  2PDO A;  2AFO A;  4O23 A;  3SHP A;  2Q0Y A;  4DYO A;  4ZGY B;  4IUS A;  4C2Z A;  2OZH A;  2ZEN A;  4RI1 A;  4J3G A;  5KTD A;  3N5F A;  4KVM E;  4X3R A;  3KL9 A;  4QB9 A;  4NGN A;  1VHO A;  1I21 A;  2GLF A;  1XRY A;  4B12 A;  1RO5 A;  1KZF A;  1XF8 A;  3NFZ A;  4UFX A;  2PJ8 A;  3QNV A;  4NXY A;  5CNP A;  4PXB A;  2PJC A;  2AFM A;  2ZEH A;  3TO7 A;  3WC6 A;  3I1U A;  2G9D A;  4KOW A;  1Q7L A;  1Y0Y A;  3H8E A;  4R8F A;  2F7V A;  4X2T A;  1ON0 A;  2I00 A;  2VQY A;  3TCV A;  2CY2 A;  4PPZ A;  4MCS A;  2ZEP A;  2ATR A;  1XFO A;  1WWZ A;  2GU2 A;  2PR8 A;  4R7M A;  3B2Y A;  4Y49 C;  4A2Z A;  1TKJ A;  3CDX A;  2CTC A;  4FD7 A;  1K4J A;  2CTB A;  4H6Z A;  4MHP A;  3G8W A;  2Z10 A;  3NH5 A;  1Q2Y A;  5JPH A;  5IX3 A;  2EO8 A;  4KSA A;  2V8G A;  4KSI A;  1CPS A;  4R76 A;  4PSW A;  3EC4 A;  3R96 A;  2JEW A;  3T9Y A;  2EK9 A;  3D7H A;  4Y49 B;  1CM0 A;  4MCR A;  4RN7 A;  3SI1 A;  2EBJ A;  4MHN A;  1PU9 A;  4NEX A;  1M1D A;  3E0K A;  3IEH A;  5DS0 A;  4XPK A;  3G3S A;  3QAY A;  2CNM A;  2WYR A;  4PK3 A;  5D8N A;  5F47 A;  1IID A;  3SI0 A;  2BL1 A;  3BJ7 A;  4RUH A;  4HKF A;  3FF3 A;  1KUY A;  3IFE A;  3B3V A;  1BAV A;  1NE9 A;  1XMT A;  4JXR A;  4A94 A;  5LRJ A;  3D8P A;  1ELL P;  3VWE A;  2Z3K A;  3GB0 A;  1MJA A;  3KQZ A;  3SJG A;  5K8P A;  2HUZ A;  1Q2C A;  4FD4 A;  1PUA A;  3BJ8 A;  5KTC A;  3PBE A;  4AB7 A;  2NYQ A;  2PVW A;  1ZG8 A;  1ZLI A;  4KOU A;  2CF4 A;  4JZ0 A;  4A31 A;  3ISZ A;  3IWW A;  3KAS A;  2QML A;  2WSA A;  2O4H A;  2OZG A;  3BI1 A;  3MGD A;  4K30 A;  1IOF A;  4MMO A;  4A95 A;  4C7H A;  4M6G A;  1LAM A;  4P4E A;  5A28 A;  1KUV A;  1AUG A;  1IGB A;  3WT4 A;  2GFQ A;  3FRM A;  4MFL A;  1IIC A;  4OAE A;  1LOK A;  4MBU A;  2QIR A;  3TX8 A;  2A4N A;  1TF8 A;  4PXE A;  3D7G A;  4MFJ A;  4H2K A;  4P10 A;  4Q7A A;  4NGT A;  1XJO A;  4OC5 A;  2X7B A;  2J8R A;  3PFO A;  4MY3 A;  4XNH C;  4OC1 A;  5HH1 A;  1QMU A;  1I1D A;  5CBM A;  2G3T A;  3PGP A;  4M6I A;  3GUX A;  3CPA A;  2Q43 A;  3D2P A;  4E0A A;  4MY0 A;  3S6F A;  4AXV A;  4JWP A;  4NGR A;  4JD6 A;  3LWU A;  3RO0 A;  2VI7 A;  4XNH B;  1F2O A;  2V77 A;  4ONW A;  2GE3 A;  1YW4 A;  2C6C A;  4P4B A;  3PB4 X;  4MFK A;  1S7F A;  3KZW A;  2P6E A;  4FD5 A;  2PVV A;  2OU2 A;  1LAN A;  5E96 A;  4OP4 A;  2EVN A;  3CT9 A;  2DPS A;  4GM5 A;  3T8W A;  1RXT A;  4CYO A;  2OB0 A;  2P6F A;  3B8G A;  2HV2 A;  2BO9 A;  3VH9 A;  3W91 A;  3L2N A;  3V8I A;  1AYE A;  3BI0 A;  3I3G A;  4ZI6 A;  3B35 A;  2WPW A;  2B4D A;  2Q7S A;  4F9V A;  4MCP A;  4YRH A;  2VEZ A;  4W9Y A;  1X10 A;  1Y9W A;  2QEC A;  2JBK A;  2QJ8 A;  2ZEM A;  3LMS A;  4P4I A;  4U9Y A;  1TKH A;  1YW6 A;  3SXO A;  1QSR A;  5DWM A;  3T90 A;  1TKF A;  1FNO A;  4OC2 A;  3FEC A;  4KOR A;  4PQA A;  3CXP A;  4LQ6 A;  5JH9 A;  2JDD A;  2PJ2 A;  3CXQ A;  4YGO A;  4KOV A;  4CAX A;  1UWY A;  5J1Q A;  3DR6 A;  1Z4R A;  4NFR A;  2D4P A;  3FYN A;  4NSQ A;  2Q44 A;  2Z3O A;  3JVN A;  3KHX A;  1Z8W A;  3IO1 A;  3PP9 A;  4KLW A;  5LRG A;  7CPA A;  4XPD C;  4JXQ A;  2B58 A;  4KS9 A;  2DEA A;  2JEV A;  3VAR A;  3TOB A;  3PB9 X;  4A32 A;  3WAB A;  2YNC A;  2K5T A;  1YVO A;  4PXC A;  2FIW A;  1P0H A;  1R3N A;  3EO4 A;  4ZY1 A;  4M3S A;  2OH1 A;  3RNZ A;  3DLJ A;  4RS2 A;  4KZT A;  2DXQ A;  4UCM A;  4MFZ A;  4XPD B;  3W6X A;  4KUB A;  5K8O A;  2VBQ A;  4P4D A;  2NSM A;  5G22 A;  3GY9 A;  4R6T A;  1XEB A;  4B13 A;  5HVH A;  2JLM A;  3S9N A;  5AG6 A;  1Y7E A;  3FMC A;  3NH4 A;  1H8L A;  3KGQ A;  2RB7 A;  4DNC A;  4OLL A;  2PSW A;  4CRZ B;  3FBU A;  5IB9 A;  4UEF A;  4Q36 A;  4FUU A;  2J8N A;  3B7I A;  2PJ9 A;  3CXS A;  3PFE A;  4OME A;  4ZX8 A;  4YU9 A;  4AVB A;  2ZW6 A;  4E8O A;  4P44 A;  2KCW A;  1S7L A;  2FSR A;  2VL1 A;  1ZO0 A;  2XEG A;  4U9Z A;  4UCN A;  4B14 A;  4CYQ A;  2HC9 A;  2J8M A;  4Z65 A;  4OC0 A;  2AFS A;  3BLN A;  1VHS A;  4L89 A;  3K2K A;  4MFP A;  1XBU A;  2R1I A;  4OKO A;  2PQ8 A;  5LYD A;  3HUV A;  1QSN A;  1YX0 A;  2BEI A;  3FED A;  2PRQ A;  3EY5 A;  4H89 A;  4QBJ A;  4KSF A;  4MHD A;  1I12 A;  1LRZ A;  2BOA A;  2ZW7 A;  1VKC A;  3S6H A;  1IU8 A;  3HLP A;  1M4G A;  1Q2D A;  3V38 A;  3PBB A;  3R95 A;  4FBE A;  1DE4 C;  3OWC A;  2ZEG A;  2PJ1 A;  5IB0 A;  4II9 A;  1YK3 A;  4UEZ A;  4ZBG A;  4UFW A;  5FVJ A;  4B5P A;  5ISV A;  4LQG A;  3D67 A;  3WC7 A;  4NJQ A;  5F49 A;  8CPA A;  5JGF A;  1MJB A;  4CGL A;  1Z8L A;  5K8N A;  1YVK A;  3EFA A;  2J9A A;  4PV6 A;  4CGM A;  1NMT A;  4NCZ A;  3IGR A;  2JDC A;  4F6A A;  4C2Y A;  4CS0 B;  1TF9 A;  4FAI A;  2O53 A;  1S7K A;  2G3A A;  6CPA A;  2B3U A;  5LYI A;  3FVL A;  4F9U A;  2VZZ A;  4MHZ A;  1ELM P;  1YGH A;  3C26 A;  1NSL A;  1RTQ A;  5HXD A;  2ZOG A;  2V8D A;  5LRK A;  1BOB A;  1TIQ A;  1FT7 A;  2NMT A;  3LD2 A;  4FD6 A;  5EBV A;  4QUS A;  1ZG9 A;  1OZP A;  4F0Y A;  1AMP A;  4F8Z A;  1V0C A;  2AJ6 A;  4UIB A;  4DUK A;  5AG7 A;  2ZW5 A;  5K8M A;  4A37 A;  1PCA A;  4TNU A;  1R57 A;  2CXA A;  4I49 A;  2C6P A;  4M6H A;  4OC3 A;  3WR7 A;  5JM6 A;  1VGY A;  4KOX A;  1CX8 A;  2Q4V A;  3N7Z A;  3D66 A;  3RBU A;  3KI9 A;  3F0A A;  2C6G A;  3IC1 A;  3DSB A;  2CIJ A;  1XE4 A;  4NGS A;  3R1K A;  1XMB A;  4NGP A;  2F5I A;  1J4J A;  4UFV A;  2OZU A;  2DPT A;  1GHE A;  4B6Z A;  4C2X A;  3GIU A;  1KWM A;  1P4N A;  1LFW A;  2O28 A;  2OR4 A;  1R43 A;  2B4B A;  3MN8 A;  4KOY A;  4MJ8 A;  2HB6 A;  2VZY A;  3K9U A;  2AFZ A;  5EC4 A;  3IWE A;  4OAD A;  2ZPA A;  4IAV A;  5KTA A;  3GLJ A;  4PSX A;  3TTH A;  2P6G A;  4E2A A;  1HEE A;  2F8H A;  5THW A;  4CGP A;  2Q51 A;  3BXM A;  3W6S A;  4DJL A;  3TC8 A;  2GIV A;  3PEI A;  3BHX A;  2R8V A;  4U5Y A;  4LUA A;  4R3L A;  5H84 A;  5JQ4 A;  4KUA A;  4NF1 A;  1Z2L A;  2EWB A;  2FS5 A;  4CRY B;  2PR1 A;  4ZX9 A;  5A27 A;  2PJ4 A;  3RAM A;  3JUW A;  1IY7 A;  1B87 A;  2ABZ A;  2ZEF A;  4UWJ A;  3V7Z A;  5F48 A;  2ANP A;  2B4D B;  3KKW A;  3B3W A;  2FE7 A;  3LOD A;  4A38 A;  1PYT B;  5F09 A;  2PIY A;  2QYV A;  1GYT A;  1FY7 A;  1YR0 A;  2REE A;  3EXN A;  2PJA A;  2ARH A;  2BUE A;  4F0X A;  4B11 A;  1NSA A;  1S3Z A;  4A33 A;  3FNC A;  5J8F A;  3TE4 A;  4A30 A;  3TO6 A;  4KOT A;  5LYL A;  5AG5 A;  4UEE A;  3KHZ A;  3TFY A;  4EME A;  1BPM A;  4UBR A;  3JTK A;  4KVX A;  2YNC C;  3NE7 A;  3P2H A;  1ZG7 A;  3D2M A;  2R98 A;  4P4F A;  4C7I A;  2I79 A;  4HNY B;  1F57 A;  2B5G A;  1MK4 A;  1IYL A;  3MRU A;  3NE8 A;  3R9E A;  4AG9 A;  3TO9 A;  4R87 A;  5C82 A;  3R9F A;  3I9S A;  3S6K A;  2PJ3 A;  2FIA A;  1MJ9 A;  2GAN A;  4MHY A;  3WC5 A;  4R57 A;  1Y0R A;  3FB3 A;  1XIX A;  4JJX A;  4ONU A;  3D3S A;  4CAV A;  1BPN A;  3FH4 A;  5IV0 A;  3RZA A;  2IL4 A;  1S60 A;  2Z3N A;  2DF5 A;  2ZW4 A;  4BIN A;  2P0W A;  2WPX A;  4C68 A;  4CYN A;  2ZEL A;  3QAH A;  5J8C A;  1BO4 A;  3IU2 A;  2Q4Z A;  2AFX A;  3SI2 A;  1M4I A;  4YWY A;  3SJE A;  1Y9K A;  2WUU A;  1YLE A;  3A9L A;  3GKR A;  3H5Z A;  1IOI A;  2Z0Z A;  1DTD A;  1JQG A;  1U6M A;  4UCP A;  4EFD A;  5AG4 A;  4GS4 A;  5AGE A;  2AFW A;  4OIW A;  3PB7 X;  1Z8T A;  3VWD A;  5I4M A;  4BD9 A;  1QQ9 A;  4AVA A;  3ISX A;  4MXU A;  1YME A;  2CNT A;  3S9M A;  2VXK A;  4GXH A;  3VAT A;  4B10 A;  2I3C A;  2PRB A;  4IF5 A;  2QVP A;  1VHE A;  3LAC A;  1XOV A;  2XEI A;  3KR5 A;  5HMN A;  1Z5R A;  4IK2 A;  3DGV A;  4M85 A;  3D7D A;  2PIZ A;  2R7H A;  3SXN A;  1OBR A;  4CYP A;  2RC4 A;  2GLJ A; 
#chains in the Genus database with same CATH homology
 2EUI A;  5GCN A;  4BMH A;  3F8K A;  4XPL A;  3ZZI A;  4L8A A;  4QVT A;  4B5O A;  1Y7R A;  4CGN A;  2Q4Y A;  4CRY B;  1UFH A;  4MI4 A;  1L0C A;  2Z3L A;  1M4D A;  4B5P B;  1B6B A;  2FL4 A;  2CNS A;  4H6U A;  3H4Q A;  3DR8 A;  4HNX B;  2D4O A;  3IWG A;  3TT2 A;  2H5M A;  2ZXV A;  4CAF A;  4EVY A;  4X5K A;  3FIX A;  1M44 A;  2YGW A;  2AE6 A;  5I0C A;  4R9M A;  2Q7B A;  5F46 A;  4AG7 A;  1YRE A;  2Z11 A;  3IU1 A;  4R3K A;  4CAW A;  1N71 A;  2Z3P A;  1QSO A;  5H86 A;  4JLY A;  5BWA B;  4Q38 A;  2Y0M A;  1QST A;  4CGO A;  1Z9U A;  2FXF A;  2BSW A;  5G1Z A;  1S5K A;  4KLV A;  4QC6 A;  2YNE A;  4CAE A;  3F5B A;  4AVC A;  2REF A;  3UY5 A;  1KUX A;  1SQH A;  2B3V A;  4KVO E;  1S7N A;  4YFJ A;  1IB1 E;  2HQY A;  1QSM A;  2YND A;  5G21 A;  4UWI A;  1WK4 A;  2Z3M A;  3PZJ A;  2G0B A;  1Z4E A;  3QB8 A;  5G20 A;  1CJW A;  4ORF A;  3S6G A;  2C27 A;  5C88 A;  3FXT A;  2PC1 A;  4UA3 A;  4PK2 A;  2Q04 A;  4KOS A;  3DDD A;  3P2F A;  3TOA A;  2FT0 A;  4BBH A;  3DNS A;  1IYK A;  3GYA A;  4HNW B;  3R9G A;  4LX9 A;  3RYO A;  5DWN A;  2FCK A;  4MFQ A;  3ZJ0 A;  2B5G B;  2PDO A;  3SHP A;  2Q0Y A;  4ZGY B;  4IUS A;  4C2Z A;  2OZH A;  5KTD A;  4RI1 A;  4J3G A;  4KVM E;  4QB9 A;  1I21 A;  4B12 A;  1RO5 A;  1KZF A;  1XF8 A;  4UFX A;  4NXY A;  5CNP A;  3TO7 A;  4KOW A;  3TCV A;  1ON0 A;  2I00 A;  2VQY A;  2CY2 A;  2ATR A;  2PR8 A;  1WWZ A;  4Y49 C;  4A2Z A;  4FD7 A;  1K4J A;  4H6Z A;  3G8W A;  2Z10 A;  1Q2Y A;  5JPH A;  5IX3 A;  4KSA A;  4PSW A;  3EC4 A;  3R96 A;  3T9Y A;  4Y49 B;  1CM0 A;  1PU9 A;  4NEX A;  1M1D A;  3E0K A;  4XPK A;  3G3S A;  4PK3 A;  2CNM A;  5F47 A;  1IID A;  2BL1 A;  3BJ7 A;  4HKF A;  1KUY A;  1NE9 A;  1XMT A;  4JXR A;  3D8P A;  3VWE A;  2Z3K A;  1MJA A;  2HUZ A;  1Q2C A;  4FD4 A;  1PUA A;  3BJ8 A;  5KTC A;  4AB7 A;  4KOU A;  4A31 A;  2QML A;  3MGD A;  2WSA A;  2OZG A;  4K30 A;  4A95 A;  4C7H A;  5A28 A;  1KUV A;  4MFL A;  3FRM A;  1IIC A;  4OAE A;  4MBU A;  2QIR A;  2A4N A;  4MFJ A;  2X7B A;  2J8R A;  4MY3 A;  4XNH C;  5HH1 A;  1I1D A;  2G3T A;  3PGP A;  3D2P A;  4E0A A;  4MY0 A;  3S6F A;  4JWP A;  4JD6 A;  2VI7 A;  4XNH B;  2GE3 A;  4MFK A;  1S7F A;  4FD5 A;  2P6E A;  2OU2 A;  5E96 A;  2EVN A;  2DPS A;  1RXT A;  4CYO A;  2OB0 A;  2P6F A;  3B8G A;  2HV2 A;  3W91 A;  3V8I A;  3I3G A;  2WPW A;  2B4D A;  4YRH A;  2VEZ A;  1Y9W A;  2QEC A;  4U9Y A;  3SXO A;  1QSR A;  5DWM A;  3T90 A;  4KOR A;  3CXP A;  2JDD A;  3CXQ A;  4YGO A;  4KOV A;  4CAX A;  3DR6 A;  1Z4R A;  2D4P A;  3FYN A;  4NSQ A;  2Q44 A;  2Z3O A;  3JVN A;  3PP9 A;  4KLW A;  4XPD C;  4JXQ A;  2B58 A;  4KS9 A;  2JEV A;  3TOB A;  4A32 A;  2YNC A;  2K5T A;  1YVO A;  2FIW A;  1P0H A;  3EO4 A;  4M3S A;  2OH1 A;  4UCM A;  4RS2 A;  4KZT A;  2DXQ A;  4XPD B;  4MFZ A;  3W6X A;  4KUB A;  2VBQ A;  5G22 A;  3GY9 A;  1XEB A;  4B13 A;  2JLM A;  5AG6 A;  4DNC A;  4OLL A;  2PSW A;  4CRZ B;  3FBU A;  4Q36 A;  2J8N A;  3CXS A;  4AVB A;  2ZW6 A;  2KCW A;  1S7L A;  2FSR A;  1ZO0 A;  4U9Z A;  4UCN A;  4B14 A;  4CYQ A;  2J8M A;  3BLN A;  1VHS A;  4L89 A;  4MFP A;  2R1I A;  2PQ8 A;  1QSN A;  1YX0 A;  2BEI A;  3EY5 A;  4H89 A;  4QBJ A;  4KSF A;  4MHD A;  1I12 A;  1LRZ A;  2ZW7 A;  1VKC A;  3S6H A;  1M4G A;  1Q2D A;  3R95 A;  3OWC A;  5IB0 A;  4II9 A;  1YK3 A;  4ZBG A;  4UFW A;  5FVJ A;  4B5P A;  5ISV A;  5F49 A;  1MJB A;  4CGL A;  1YVK A;  3EFA A;  4PV6 A;  4CGM A;  1NMT A;  4NCZ A;  3IGR A;  2JDC A;  4F6A A;  4C2Y A;  4CS0 B;  1S7K A;  2G3A A;  2B3U A;  2VZZ A;  1YGH A;  3C26 A;  1NSL A;  1BOB A;  1TIQ A;  2NMT A;  3LD2 A;  4FD6 A;  5EBV A;  4QUS A;  1OZP A;  4F0Y A;  1V0C A;  2AJ6 A;  5AG7 A;  2ZW5 A;  1R57 A;  2CXA A;  4I49 A;  3WR7 A;  4KOX A;  2Q4V A;  3N7Z A;  3F0A A;  3DSB A;  1XE4 A;  3R1K A;  4UFV A;  4C2X A;  2F5I A;  1J4J A;  2OZU A;  2DPT A;  1GHE A;  4KOY A;  1P4N A;  2O28 A;  4R87 A;  2B4B A;  4MJ8 A;  2VZY A;  3K9U A;  5EC4 A;  3IWE A;  4OAD A;  2ZPA A;  5KTA A;  4E2A A;  4PSX A;  3TTH A;  2P6G A;  4CGP A;  3W6S A;  2GIV A;  2R8V A;  4U5Y A;  4LUA A;  4R3L A;  5H84 A;  5JQ4 A;  4KUA A;  4NF1 A;  2FS5 A;  2PR1 A;  5A27 A;  3JUW A;  4UWJ A;  1B87 A;  5F48 A;  2B4D B;  3KKW A;  3LOD A;  2FE7 A;  3EXN A;  1FY7 A;  1YR0 A;  2REE A;  2ARH A;  2BUE A;  4F0X A;  4B11 A;  1S3Z A;  4A33 A;  3FNC A;  5J8F A;  3TE4 A;  4A30 A;  3TO6 A;  4KOT A;  5AG5 A;  3TFY A;  4UBR A;  3JTK A;  4KVX A;  3P2H A;  2YNC C;  3NE7 A;  3D2M A;  2R98 A;  4C7I A;  2I79 A;  4HNY B;  2B5G A;  1MK4 A;  1IYL A;  3R9E A;  4AG9 A;  3TO9 A;  5C82 A;  3R9F A;  3I9S A;  3S6K A;  2FIA A;  1MJ9 A;  2GAN A;  4R57 A;  3FB3 A;  1XIX A;  4JJX A;  4ONU A;  3D3S A;  4CAV A;  5IV0 A;  2IL4 A;  1S60 A;  2Z3N A;  2ZW4 A;  2P0W A;  2WPX A;  4C68 A;  4CYN A;  3QAH A;  5J8C A;  1BO4 A;  3IU2 A;  1M4I A;  1Y9K A;  2WUU A;  1YLE A;  3A9L A;  3GKR A;  3H5Z A;  2Z0Z A;  4UCP A;  1U6M A;  5AG4 A;  4GS4 A;  5AGE A;  3VWD A;  4AVA A;  2CNT A;  2VXK A;  4B10 A;  2PRB A;  4IF5 A;  5HMN A;  4M85 A;  2R7H A;  3SXN A;  4CYP A;  4E8O A;  2RC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...