2WUUA

Structure of n-myristoyltransferase from l. donovani
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
411
structure length
402
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVESMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-MYRISTOYLTRANSFERASE
publication title N-Myristoyltransferase from Leishmania Donovani: Structural and Functional Characterisation of a Potential Drug Target for Visceral Leishmaniasis.
pubmed doi rcsb
source organism Leishmania donovani
molecule tags Transferase
total genus 125
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2009-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wuuA00
4A95A 4CYPA 4UCPA 4A33A 4A32A 3IU1A 5G1ZA 4B11A 4UCNA 2WSAA 4A30A 4UFWA 4CGOA 4CGLA 5A27A 4UFXA 5AG4A 4CYNA 4A2ZA 4CGMA 5G22A 3H5ZA 4C2YA 4CAFA 4A31A 5AG6A 4C2XA 3JTKA 5G21A 5AG5A 5G20A 2YNCC 3IU2A 4B13A 2YNDA 2WUUA 2YNEA 4UCMA 4C2ZA 4CYOA 4CYQA 4C7IA 4C68A 4B12A 4CGPA 4B10A 4BBHA 5A28A 5AGEA 4C7HA 4CGNA 5AG7A 4CAEA 4UFVA 4B14A 2YNCA 3IWEA
chains in the Genus database with same CATH superfamily
4A95A 4A94A 2PIZA 1IYLA 3IO1A 4E8OA 5G1ZA 2OZGA 2H5MA 2YGWA 1S7LA 3ZZIA 3FMCA 3B8GA 2FVGA 3JUWA 2PSWA 3NE8A 5C82A 1TKJA 4M3SA 2VQYA 3GLJA 5G22A 2ZXVA 4MFLA 5EC4A 2OU2A 4I49A 3NA6A 1RO5A 1PUAA 3QAYA 1UWYA 4R57A 5D29A 5G20A 3IU2A 2REEA 1VIXA 2PJ9A 4OC1A 5E96A 2QYVA 4MFZA 4EWTA 4MY0A 3NH5A 1NSLA 4CYOA 3D8PA 2VZZA 2ZEDA 4C68A 1IYKA 2CIJA 4YU9A 3W6SA 2OH1A 4RN7A 4KSFA 1X12A 2AFXA 1Y0RA 5LYDA 3BI1A 5AG7A 1RXTA 2FIAA 3LD2A 2EUIA 3D68A 1XJOA 2Q51A 4UCNA 5K8PA 4R8FA 4ZY1A 1PYTB 2PC1A 2OR4A 4PXEA 3PFOA 3KL9A 1Q7LA 3B3SA 5EMIA 3SI2A 5F46A 3H5ZA 2I79A 1F2PA 1ZG7A 3B3TA 4A31A 4FBEA 2VEZA 3JTKA 2J8NA 2PJ4A 4KORA 4UEEA 5EBVA 2EK8A 2G0BA 4II9A 4XNHB 3FBUA 4BD9A 5HVHA 4CAWA 4KSIA 4ZBGA 4R3KA 4P44A 4PV6A 5DWNA 2FIWA 4PXDA 1KZFA 4CYQA 4XPDB 4NGNA 2PJ8A 4JWPA 2OOTA 4CGNA 1TF9A 4JJXA 1YSJA 4BINA 1M4GA 2DEAA 1CP7A 1HDUA 1L0CA 4MCSA 2J8RA 1VHOA 3PZJA 1MJBA 5F09A 5LRGA 4FWUA 5GCNA 4OP4A 4CRYB 2GFQA 1YW6A 1LFWA 4ORFA 3N5FA 2VBQA 2C6GA 4QC6A 3PGPA 3B3WA 3CXSA 3PP9A 3F0AA 1ELMP 3QAHA 4O23A 3TO9A 1XF8A 3A9LA 3I9SA 5J1QA 1BPNA 3FF3A 3GB0A 4X2TA 4XPKA 3ISZA 4JZ0A 1BLLE 2Z3LA 4U9ZA 4Y49C 1MJ9A 2PIYA 2Q43A 4OIDA 4F6AA 2B3UA 2ZEEA 4R76A 1IOIA 1LRZA 4HPSA 4P45A 4DYOA 3PRTA 3N7ZA 2RB7A 4K30A 5F49A 3P2FA 3CZXA 4M85A 4WWVA 4B11A 1LOKA 2A4NA 1Z4RA 4CGLA 4KOYA 4UFWA 3DLJA 2B4BA 1BPMA 4GM5A 7CPAA 4YFJA 1CBXA 4UWIA 2Q0YA 2OZHA 1ARMA 4AB7A 1Y9KA 3EXNA 2HQYA 2QMLA 2FCKA 1LAMA 1UFHA 2FXFA 2V8DA 3PEIA 4AVCA 1LCPA 3GIUA 3PB8X 1B87A 2PJCA 2BCOA 4MHZA 3RZAA 4CPAA 2P6EA 4QBJA 2F5IA 2IL4A 2PJ5A 1Q2CA 1Y7RA 3TO7A 3KHXA 1GHEA 4MBUA 4UFVA 1S7KA 3VARA 4R9MA 2YNCA 1QQ9A 3DSBA 1ZO0A 4MHYA 4CYPA 1S60A 3SXNA 3SJXA 4MRIA 4F0XA 1DTDA 1Y0YA 2JBKA 2DF5A 3D67A 4OC0A 2CTBA 3K9TA 3SJFA 1KUYA 2XEJA 3PBEA 4MI4A 4NGRA 4HKFA 2Q7BA 2AE6A 4ZYQA 3ISXA 4HNYB 3T90A 4NFRA 1KWMA 1M44A 4PK3A 2IJZA 4X5KA 3HLPA 4U5YA 3LACA 4NSQA 2FT0A 1DE4C 1F2OA 2DXQA 4HNWB 4BBHA 1TKFA 3EC4A 1I21A 2BSWA 4EVYA 1Q2YA 4XNHC 3PFEA 5AGEA 4C7HA 3KHZA 3CXPA 2B5GB 3QB8A 3WC6A 2AFMA 2CNMA 4LUAA 4MJ8A 4KVME 2GE3A 3FECA 4QB9A 2WZNA 4MFQA 4A33A 3G8WA 3D7HA 4ZY2A 3GUXA 2GIVA 3CPXA 4XPDC 5HVGA 5A27A 3SXOA 4KLVA 4K3NA 4UFXA 4WJBA 4CYNA 2PJAA 1QSMA 2V8GA 1YLEA 2ZW4A 2ZW7A 4JD6A 4M6IA 4ZGYB 3H4QA 2X7BA 2JLMA 1CX8A 2Q4VA 4C2XA 1QMUA 1FT7A 4ZX9A 1SQHA 3EFAA 4GXHA 4NGMA 2O4HA 5K8MA 3TOAA 1TXRA 1BOBA 1ARLA 3V8IA 2J8MA 4KOXA 2Z3KA 1YVKA 1CPSA 4PXBA 1S7NA 1Y7EA 4CGPA 2G9DA 5LYFA 3TOBA 4F0YA 5CNPA 4OADA 2F8HA 4NGQA 1IIDA 2NYQA 2BOAA 3B3CA 1Z8WA 2PDOA 3EO4A 4MHDA 4B6ZA 5K8OA 4KUBA 4U9YA 1VHSA 1ZLIA 1JWQA 2P6FA 4KOVA 4CGOA 1QSRA 4M6GA 3KZWA 1HEEA 3ZJ0A 2AFZA 5JGFA 2PRQA 3S9MA 1YREA 3VH9A 4F9VA 3RNZA 1CP6A 1R57A 2B4DA 3KR4A 2ZEOA 1YGHA 2PCUA 5J8CA 1BAVA 3LODA 4PK2A 1GYTA 1IGBA 3SHPA 4C2ZA 5IX3A 3IWGA 4OC5A 2WPXA 3JRUA 4CAVA 2FE7A 3S6HA 1Z8LA 5LYIA 4OAEA 3PB6X 2D4OA 4B5PB 4NGSA 2ZENA 2Z0ZA 3W91A 1XEBA 2ABZA 5HH1A 4OLLA 1X10A 2I3CA 4RI1A 2DPSA 2ZEHA 5DWMA 2GLJA 2POKA 3IC1A 2Z10A 4FUUA 3NE7A 4H2KA 4DJLA 4M6HA 2WPWA 4CAFA 4F8ZA 4NXYA 4IF5A 3UY5A 4CRZB 1KUVA 3S6KA 4NEXA 5THWA 3E0KA 3K2KA 4TWEA 2QIRA 5H84A 4MMOA 4OC2A 3SJGA 3DGVA 3K9UA 2CNTA 2I00A 4B12A 3KR5A 1QSNA 2K5TA 2Z3PA 4OC4A 1P4NA 1FNOA 2QVPA 2O53A 3FEDA 4MFJA 2B58A 1IB1E 2FSRA 4JYWA 2HUZA 2QECA 4A32A 1IOFA 1M4DA 3S9LA 4KVOE 1S3ZA 3D3SA 3D7DA 2Z3OA 5KTDA 2ZPAA 1B6BA 1NSAA 3KI9A 3FJUA 1R3NA 2PJBA 2V77A 3R9EA 1Z2LA 2V8HA 1P0HA 4L89A 2Z3NA 2Q4YA 8CPAA 2C6CA 5CPAA 5CBMA 2BUEA 5HXDA 5ELYA 2JEVA 2RC4A 2AFWA 3SJEA 1Z8XA 2GANA 3BXMA 1ON0A 2NMTA 4MFPA 4PXCA 5J8FA 4KOTA 2Q4ZA 2JDDA 2ZELA 3FXTA 2ARHA 3CXQA 1LAPA 2J9AA 2XEFA 2XEGA 3BLNA 3RO0A 4C7IA 5LRKA 4FD5A 4KVXA 3R9FA 3EY5A 3NH4A 3S6FA 4R6TA 4CAEA 2ZEPA 3G3SA 4OMEA 3KKWA 6CPAA 2Q04A 4JXQA 2GU2A 2AFUA 4MCPA 4MCQA 4QUSA 1AUGA 2P0WA 1K4JA 4AG7A 2PVWA 5DS0A 4AVBA 1YW4A 1YR0A 4B5OA 4P10A 2Q44A 2OB0A 4P4IA 1CPXA 2ANPA 3I1UA 2B3VA 4ONWA 5FVJA 3S9NA 2IQ6A 4FD6A 3D7GA 2PJ1A 1HDQA 3LWUA 4RS2A 4CAXA 3B7IA 1LANA 5F47A 3PB7X 3NH8A 1ZG8A 4MHNA 3R95A 2R98A 4UCMA 4Q7AA 5C88A 1V0CA 2ZOGA 3MGDA 3PB4X 3R1KA 2F7VA 2IMOA 3FEEA 4KS9A 3T9YA 4NGPA 3FNCA 4UA3A 4NGTA 2FS5A 3WC7A 3T8WA 2CY2A 2KCWA 4IUSA 3D4UA 3IWEA 4BMHA 3IFEA 1F57A 1AYEA 4HNXB 4MHPA 3P2HA 2GREA 1XMTA 2AFOA 3SI0A 3H8GA 2G3TA 1CJWA 5H86A 2JBJA 2PJ2A 4FD7A 2EK9A 3BHXA 3L2NA 1OBRA 1XIXA 3IWWA 4KZTA 5AG5A 4E2AA 2PJ0A 2DPTA 4B13A 5KTCA 2OZUA 5HVFA 2JEWA 3FB3A 4MCRA 1WWZA 1XBUA 1IY7A 1IU8A 3D7FA 2PR1A 4UEFA 3D2MA 5JQ4A 3IJ3A 3TE4A 1YK3A 2EBJA 3H8FA 1WK4A 2JDCA 2VI7A 1MJAA 4P4FA 2CNSA 1MK4A 3RBUA 3VATA 4RUHA 4ZY0A 4UCPA 2C27A 3CT9A 1TF8A 3DR6A 4P4EA 4R87A 2ZOFA 3HUVA 3KQZA 3WR7A 3GYAA 5ISVA 3B35A 2Q7SA 2PR8A 4Z65A 4KSAA 3TO6A 4ZX8A 4CGMA 2HV2A 2C6PA 2PJ6A 2EWBA 2V8VA 2Z11A 3FIXA 4P4BA 3DDDA 4CS0B 3DNSA 1YQEA 4KOSA 4R7MA 3IIBA 2WUUA 3MN8A 4IK2A 3TT2A 1I12A 3CPAA 1S7FA 3WT4A 4G1PA 4MY3A 3IGRA 3C26A 4AG9A 1Y9WA 4KUAA 4PQAA 4IHMA 3MRUA 4ZI6A 1IICA 3WABA 3FH4A 2G3AA 1XFOA 4IAVA 4KLWA 4F9UA 4DNCA 1AMPA 4Q38A 3S6GA 2ZEFA 3IU1A 5IB9A 4KOUA 1I1DA 1XOVA 2O28A 4LQGA 1ZLHA 1VGYA 4UEZA 1R43A 3KGQA 3B3VA 2P6GA 3RYOA 5I4MA 4W9YA 3JVNA 4UWJA 3CDXA 4XPLA 4NCZA 5AG6A 1YMEA 4AXVA 4LX9A 4UIAA 3R9GA 3IEHA 3VWDA 1CG2A 3DR8A 4LQ6A 4EFDA 2EVNA 5HMNA 5IV0A 3TCVA 3RAMA 3TTHA 3PBBA 3TFYA 5A28A 3D2PA 3GY9A 4PSWA 4A37A 1M4LA 3FX6A 5F48A 2D4PA 1H8LA 1PU9A 2PQ8A 3F5BA 1CM0A 4KOWA 4NJQA 4A30A 1M4IA 1Z5RA 5AG4A 1NMTA 4OIWA 2BEIA 2VL1A 1YX0A 1U6MA 2ATRA 2CF4A 2CXAA 2HC9A 2PJ3A 3OWCA 3F8KA 4C2YA 5JPHA 5KTAA 2HB6A 4JLYA 3W6XA 3FRMA 3FYNA 5G21A 4X8IA 2PJ7A 2C1CA 1M1DA 4FAIA 1QSOA 2B4DB 2ZW5A 1XMBA 1EE3P 4P4JA 2ODFA 4J3GA 2BO9A 3QNVA 1JQGA 3PB9X 5JH9A 4A38A 3KASA 2B5GA 4B10A 4Q36A 4P6YA 2XEIA 4H6UA 4YGOA 4YWYA 1VHEA 4OKOA 4B14A 1ZG9A 2FL4A 1YLOA 3GKRA 4MXUA 4GS4A 4P4DA 2CTCA 1XE4A 1OZPA 2Z3MA 2WSAA 4QVTA 4AVAA 4TNUA 5LRJA 5D8NA 4NF1A 1XRYA 3SI1A 5JM6A 2ZW6A 1NE9A 2YNCC 4NJRA 1S5KA 4DUKA 4EMEA 1Z9UA 2YNEA 3I3GA 5LYLA 1VKCA 2Y0MA 3WC5A 4YRHA 4UF4A 1QSTA 4H89A 2WYRA 4FD4A 4UIBA 2BL1A 1TKHA 2VXKA 4X3RA 5BWAB 4JXRA 1BO4A 3H8EA 5I0CA 2ZEMA 1Q2DA 2R7HA 5IB0A 3TC8A 2NSMA 2VZYA 3BI0A 3FVLA 2ZEGA 2RFHA 4OC3A 1Z4EA 4A2ZA 1A2ZA 3D66A 1Z8TA 3R96A 4E0AA 2EO8A 4PPZA 1N71A 4R3LA 2AJ6A 1RTQA 4H6ZA 1TIQA 4Y49B 4PSXA 2R1IA 2R8VA 3BJ8A 4A39A 2REFA 4MFKA 2YNDA 2GLFA 1ELLP 1FY7A 2PRBA 3B2YA 1J4JA 2AFSA 4B5PA 2QJ8A 2PE3A 4UBRA 4L8AA 3V38A 5K8NA 1YVOA 2PVVA 3NFZA 1PCAA 3V7ZA 3BJ7A 3KQXA 1KUXA 3LMSA 3TX8A 3VWEA 4ONUA
chains in the Genus database with same CATH topology
4A95A 1IYLA 4E8OA 5G1ZA 2OZGA 2H5MA 2YGWA 1S7LA 3ZZIA 3JUWA 3B8GA 2PSWA 5C82A 4M3SA 2VQYA 5G22A 2ZXVA 4MFLA 5EC4A 2OU2A 4I49A 1RO5A 1PUAA 4R57A 5G20A 3IU2A 2REEA 5E96A 4MFZA 4MY0A 1NSLA 4CYOA 3D8PA 2VZZA 4C68A 1IYKA 3W6SA 2OH1A 4KSFA 5AG7A 1RXTA 2FIAA 3LD2A 2EUIA 4UCNA 2PC1A 5F46A 3H5ZA 2I79A 4A31A 2VEZA 3JTKA 2J8NA 4KORA 5EBVA 4II9A 2G0BA 4XNHB 3FBUA 4CAWA 4ZBGA 4R3KA 4PV6A 5DWNA 2FIWA 1KZFA 4CYQA 4XPDB 4JWPA 4CGNA 4JJXA 1M4GA 1L0CA 2J8RA 3PZJA 1MJBA 5GCNA 4CRYB 4ORFA 2VBQA 4QC6A 3PGPA 3CXSA 3PP9A 3F0AA 3QAHA 3TO9A 1XF8A 3A9LA 3I9SA 4XPKA 2Z3LA 4U9ZA 4Y49C 1MJ9A 4F6AA 2B3UA 1LRZA 3N7ZA 4K30A 5F49A 3P2FA 4M85A 4B11A 2A4NA 1Z4RA 4CGLA 4KOYA 4UFWA 2B4BA 4YFJA 4UWIA 2Q0YA 2OZHA 4AB7A 1Y9KA 3EXNA 2HQYA 2QMLA 2FCKA 1UFHA 2FXFA 4AVCA 1B87A 2P6EA 4QBJA 2F5IA 2IL4A 1Q2CA 1Y7RA 3TO7A 1GHEA 4MBUA 4UFVA 1S7KA 4R9MA 2YNCA 3DSBA 1ZO0A 4CYPA 1S60A 3SXNA 4F0XA 1KUYA 4MI4A 4HKFA 2Q7BA 2AE6A 4HNYB 3T90A 1M44A 4PK3A 4X5KA 4U5YA 4NSQA 2FT0A 2DXQA 4HNWB 4BBHA 3EC4A 1I21A 2BSWA 4EVYA 1Q2YA 4XNHC 5AGEA 4C7HA 3CXPA 2B5GB 3QB8A 2CNMA 4LUAA 4MJ8A 4KVME 2GE3A 4QB9A 4MFQA 4A33A 3G8WA 4XPDC 2GIVA 5A27A 3SXOA 4KLVA 4UFXA 4CYNA 2ZW4A 1QSMA 2ZW7A 1YLEA 4JD6A 4ZGYB 3H4QA 2X7BA 2JLMA 2Q4VA 4C2XA 1SQHA 3EFAA 3TOAA 1BOBA 3V8IA 2J8MA 4KOXA 2Z3KA 1YVKA 4CGPA 1S7NA 3TOBA 4F0YA 5CNPA 4OADA 1IIDA 2PDOA 3EO4A 4MHDA 4KUBA 4U9YA 1VHSA 2P6FA 4KOVA 4CGOA 1QSRA 3ZJ0A 1YREA 2B4DA 1R57A 1YGHA 5J8CA 3LODA 4PK2A 3SHPA 4C2ZA 5IX3A 3IWGA 2WPXA 4CAVA 2FE7A 3S6HA 4OAEA 2D4OA 4B5PB 2Z0ZA 3W91A 1XEBA 5HH1A 4OLLA 4RI1A 2DPSA 5DWMA 2Z10A 3NE7A 4CAFA 2WPWA 4NXYA 4IF5A 3UY5A 4CRZB 1KUVA 3S6KA 4NEXA 3E0KA 2QIRA 5H84A 3K9UA 2CNTA 2I00A 4B12A 1QSNA 2K5TA 2Z3PA 1P4NA 4MFJA 2B58A 1IB1E 2FSRA 2HUZA 2QECA 4A32A 1M4DA 4KVOE 1S3ZA 3D3SA 2Z3OA 5KTDA 2ZPAA 1B6BA 3R9EA 4L89A 1P0HA 2Z3NA 2Q4YA 2BUEA 2JEVA 2RC4A 2GANA 4MFPA 1ON0A 2NMTA 5J8FA 4KOTA 2JDDA 3FXTA 2ARHA 3CXQA 4C7IA 3BLNA 4FD5A 4KVXA 3R9FA 3EY5A 3S6FA 4CAEA 3G3SA 3KKWA 2Q04A 4JXQA 4QUSA 2P0WA 1K4JA 4AG7A 4AVBA 1YR0A 4B5OA 2Q44A 2OB0A 2B3VA 5FVJA 4FD6A 4RS2A 4CAXA 5F47A 3R95A 2R98A 4UCMA 5C88A 1V0CA 3MGDA 3R1KA 3T9YA 4KS9A 3FNCA 4UA3A 2FS5A 2CY2A 2KCWA 4IUSA 3IWEA 4BMHA 4HNXB 3P2HA 1XMTA 2G3TA 1CJWA 5H86A 4FD7A 4KZTA 5AG5A 4E2AA 1XIXA 5KTCA 2DPTA 4B13A 2OZUA 3FB3A 1WWZA 2PR1A 3D2MA 5JQ4A 3TE4A 1YK3A 1WK4A 2JDCA 2VI7A 1MJAA 2CNSA 1MK4A 4UCPA 2C27A 3DR6A 4R87A 3WR7A 3GYAA 5ISVA 2PR8A 4KSAA 3TO6A 4CGMA 2HV2A 3FIXA 2Z11A 3DDDA 4CS0B 3DNSA 4KOSA 2WUUA 3TT2A 1I12A 1S7FA 4MY3A 3IGRA 3C26A 4AG9A 1Y9WA 4KUAA 1IICA 2G3AA 4KLWA 4DNCA 4Q38A 3S6GA 3IU1A 4KOUA 1I1DA 2O28A 2P6GA 3RYOA 3JVNA 4UWJA 5AG6A 4XPLA 4NCZA 4LX9A 3R9GA 3VWDA 3DR8A 2EVNA 5HMNA 5IV0A 3TCVA 3TTHA 3TFYA 5A28A 3D2PA 3GY9A 4PSWA 5F48A 2D4PA 1PU9A 2PQ8A 4KOWA 3F5BA 1CM0A 4A30A 1M4IA 5AG4A 1NMTA 2BEIA 1YX0A 1U6MA 3OWCA 2ATRA 2CXAA 5JPHA 4C2YA 3F8KA 5KTAA 4JLYA 3W6XA 3FRMA 3FYNA 5G21A 1M1DA 1QSOA 2B4DB 2ZW5A 4J3GA 2B5GA 4B10A 4Q36A 4H6UA 4YGOA 4B14A 2FL4A 3GKRA 4GS4A 1XE4A 1OZPA 2Z3MA 2WSAA 4QVTA 4AVAA 4NF1A 2ZW6A 1NE9A 2YNCC 1S5KA 1Z9UA 2YNEA 3I3GA 1VKCA 2Y0MA 4YRHA 1QSTA 4H89A 4FD4A 2BL1A 2VXKA 5BWAB 4JXRA 1BO4A 5I0CA 1Q2DA 2R7HA 5IB0A 2VZYA 1Z4EA 4A2ZA 4E0AA 3R96A 1N71A 4R3LA 2AJ6A 4H6ZA 4Y49B 1TIQA 4PSXA 2R1IA 2R8VA 3BJ8A 2REFA 4MFKA 2YNDA 1FY7A 2PRBA 1J4JA 4B5PA 4UBRA 4L8AA 1YVOA 3BJ7A 1KUXA 3VWEA 4ONUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A95 A;  4CYP A;  4UCP A;  4A33 A;  4A32 A;  3IU1 A;  5G1Z A;  4B11 A;  4UCN A;  2WSA A;  4A30 A;  4UFW A;  4CGO A;  4CGL A;  5A27 A;  4UFX A;  5AG4 A;  4CYN A;  4A2Z A;  4CGM A;  5G22 A;  3H5Z A;  4C2Y A;  4CAF A;  4A31 A;  5AG6 A;  4C2X A;  3JTK A;  5G21 A;  5AG5 A;  5G20 A;  2YNC C;  3IU2 A;  4B13 A;  2YND A;  2WUU A;  2YNE A;  4UCM A;  4C2Z A;  4CYO A;  4CYQ A;  4C7I A;  4C68 A;  4B12 A;  4CGP A;  4B10 A;  4BBH A;  5A28 A;  5AGE A;  4C7H A;  4CGN A;  5AG7 A;  4CAE A;  4UFV A;  4B14 A;  2YNC A;  3IWE A; 
#chains in the Genus database with same CATH topology
 4A95 A;  4A94 A;  2PIZ A;  1IYL A;  3IO1 A;  4E8O A;  5G1Z A;  2OZG A;  2H5M A;  2YGW A;  1S7L A;  3ZZI A;  3FMC A;  3B8G A;  2FVG A;  3JUW A;  2PSW A;  3NE8 A;  5C82 A;  1TKJ A;  4M3S A;  2VQY A;  3GLJ A;  5G22 A;  2ZXV A;  4MFL A;  5EC4 A;  2OU2 A;  4I49 A;  3NA6 A;  1RO5 A;  1PUA A;  3QAY A;  1UWY A;  4R57 A;  5D29 A;  5G20 A;  3IU2 A;  2REE A;  1VIX A;  2PJ9 A;  4OC1 A;  5E96 A;  2QYV A;  4MFZ A;  4EWT A;  4MY0 A;  3NH5 A;  1NSL A;  4CYO A;  3D8P A;  2VZZ A;  2ZED A;  4C68 A;  1IYK A;  2CIJ A;  4YU9 A;  3W6S A;  2OH1 A;  4RN7 A;  4KSF A;  1X12 A;  2AFX A;  1Y0R A;  5LYD A;  3BI1 A;  5AG7 A;  1RXT A;  2FIA A;  3LD2 A;  2EUI A;  3D68 A;  1XJO A;  2Q51 A;  4UCN A;  5K8P A;  4R8F A;  4ZY1 A;  1PYT B;  2PC1 A;  2OR4 A;  4PXE A;  3PFO A;  3KL9 A;  1Q7L A;  3B3S A;  5EMI A;  3SI2 A;  5F46 A;  3H5Z A;  2I79 A;  1F2P A;  1ZG7 A;  3B3T A;  4A31 A;  4FBE A;  2VEZ A;  3JTK A;  2J8N A;  2PJ4 A;  4KOR A;  4UEE A;  5EBV A;  2EK8 A;  2G0B A;  4II9 A;  4XNH B;  3FBU A;  4BD9 A;  5HVH A;  4CAW A;  4KSI A;  4ZBG A;  4R3K A;  4P44 A;  4PV6 A;  5DWN A;  2FIW A;  4PXD A;  1KZF A;  4CYQ A;  4XPD B;  4NGN A;  2PJ8 A;  4JWP A;  2OOT A;  4CGN A;  1TF9 A;  4JJX A;  1YSJ A;  4BIN A;  1M4G A;  2DEA A;  1CP7 A;  1HDU A;  1L0C A;  4MCS A;  2J8R A;  1VHO A;  3PZJ A;  1MJB A;  5F09 A;  5LRG A;  4FWU A;  5GCN A;  4OP4 A;  4CRY B;  2GFQ A;  1YW6 A;  1LFW A;  4ORF A;  3N5F A;  2VBQ A;  2C6G A;  4QC6 A;  3PGP A;  3B3W A;  3CXS A;  3PP9 A;  3F0A A;  1ELM P;  3QAH A;  4O23 A;  3TO9 A;  1XF8 A;  3A9L A;  3I9S A;  5J1Q A;  1BPN A;  3FF3 A;  3GB0 A;  4X2T A;  4XPK A;  3ISZ A;  4JZ0 A;  1BLL E;  2Z3L A;  4U9Z A;  4Y49 C;  1MJ9 A;  2PIY A;  2Q43 A;  4OID A;  4F6A A;  2B3U A;  2ZEE A;  4R76 A;  1IOI A;  1LRZ A;  4HPS A;  4P45 A;  4DYO A;  3PRT A;  3N7Z A;  2RB7 A;  4K30 A;  5F49 A;  3P2F A;  3CZX A;  4M85 A;  4WWV A;  4B11 A;  1LOK A;  2A4N A;  1Z4R A;  4CGL A;  4KOY A;  4UFW A;  3DLJ A;  2B4B A;  1BPM A;  4GM5 A;  7CPA A;  4YFJ A;  1CBX A;  4UWI A;  2Q0Y A;  2OZH A;  1ARM A;  4AB7 A;  1Y9K A;  3EXN A;  2HQY A;  2QML A;  2FCK A;  1LAM A;  1UFH A;  2FXF A;  2V8D A;  3PEI A;  4AVC A;  1LCP A;  3GIU A;  3PB8 X;  1B87 A;  2PJC A;  2BCO A;  4MHZ A;  3RZA A;  4CPA A;  2P6E A;  4QBJ A;  2F5I A;  2IL4 A;  2PJ5 A;  1Q2C A;  1Y7R A;  3TO7 A;  3KHX A;  1GHE A;  4MBU A;  4UFV A;  1S7K A;  3VAR A;  4R9M A;  2YNC A;  1QQ9 A;  3DSB A;  1ZO0 A;  4MHY A;  4CYP A;  1S60 A;  3SXN A;  3SJX A;  4MRI A;  4F0X A;  1DTD A;  1Y0Y A;  2JBK A;  2DF5 A;  3D67 A;  4OC0 A;  2CTB A;  3K9T A;  3SJF A;  1KUY A;  2XEJ A;  3PBE A;  4MI4 A;  4NGR A;  4HKF A;  2Q7B A;  2AE6 A;  4ZYQ A;  3ISX A;  4HNY B;  3T90 A;  4NFR A;  1KWM A;  1M44 A;  4PK3 A;  2IJZ A;  4X5K A;  3HLP A;  4U5Y A;  3LAC A;  4NSQ A;  2FT0 A;  1DE4 C;  1F2O A;  2DXQ A;  4HNW B;  4BBH A;  1TKF A;  3EC4 A;  1I21 A;  2BSW A;  4EVY A;  1Q2Y A;  4XNH C;  3PFE A;  5AGE A;  4C7H A;  3KHZ A;  3CXP A;  2B5G B;  3QB8 A;  3WC6 A;  2AFM A;  2CNM A;  4LUA A;  4MJ8 A;  4KVM E;  2GE3 A;  3FEC A;  4QB9 A;  2WZN A;  4MFQ A;  4A33 A;  3G8W A;  3D7H A;  4ZY2 A;  3GUX A;  2GIV A;  3CPX A;  4XPD C;  5HVG A;  5A27 A;  3SXO A;  4KLV A;  4K3N A;  4UFX A;  4WJB A;  4CYN A;  2PJA A;  1QSM A;  2V8G A;  1YLE A;  2ZW4 A;  2ZW7 A;  4JD6 A;  4M6I A;  4ZGY B;  3H4Q A;  2X7B A;  2JLM A;  1CX8 A;  2Q4V A;  4C2X A;  1QMU A;  1FT7 A;  4ZX9 A;  1SQH A;  3EFA A;  4GXH A;  4NGM A;  2O4H A;  5K8M A;  3TOA A;  1TXR A;  1BOB A;  1ARL A;  3V8I A;  2J8M A;  4KOX A;  2Z3K A;  1YVK A;  1CPS A;  4PXB A;  1S7N A;  1Y7E A;  4CGP A;  2G9D A;  5LYF A;  3TOB A;  4F0Y A;  5CNP A;  4OAD A;  2F8H A;  4NGQ A;  1IID A;  2NYQ A;  2BOA A;  3B3C A;  1Z8W A;  2PDO A;  3EO4 A;  4MHD A;  4B6Z A;  5K8O A;  4KUB A;  4U9Y A;  1VHS A;  1ZLI A;  1JWQ A;  2P6F A;  4KOV A;  4CGO A;  1QSR A;  4M6G A;  3KZW A;  1HEE A;  3ZJ0 A;  2AFZ A;  5JGF A;  2PRQ A;  3S9M A;  1YRE A;  3VH9 A;  4F9V A;  3RNZ A;  1CP6 A;  1R57 A;  2B4D A;  3KR4 A;  2ZEO A;  1YGH A;  2PCU A;  5J8C A;  1BAV A;  3LOD A;  4PK2 A;  1GYT A;  1IGB A;  3SHP A;  4C2Z A;  5IX3 A;  3IWG A;  4OC5 A;  2WPX A;  3JRU A;  4CAV A;  2FE7 A;  3S6H A;  1Z8L A;  5LYI A;  4OAE A;  3PB6 X;  2D4O A;  4B5P B;  4NGS A;  2ZEN A;  2Z0Z A;  3W91 A;  1XEB A;  2ABZ A;  5HH1 A;  4OLL A;  1X10 A;  2I3C A;  4RI1 A;  2DPS A;  2ZEH A;  5DWM A;  2GLJ A;  2POK A;  3IC1 A;  2Z10 A;  4FUU A;  3NE7 A;  4H2K A;  4DJL A;  4M6H A;  2WPW A;  4CAF A;  4F8Z A;  4NXY A;  4IF5 A;  3UY5 A;  4CRZ B;  1KUV A;  3S6K A;  4NEX A;  5THW A;  3E0K A;  3K2K A;  4TWE A;  2QIR A;  5H84 A;  4MMO A;  4OC2 A;  3SJG A;  3DGV A;  3K9U A;  2CNT A;  2I00 A;  4B12 A;  3KR5 A;  1QSN A;  2K5T A;  2Z3P A;  4OC4 A;  1P4N A;  1FNO A;  2QVP A;  2O53 A;  3FED A;  4MFJ A;  2B58 A;  1IB1 E;  2FSR A;  4JYW A;  2HUZ A;  2QEC A;  4A32 A;  1IOF A;  1M4D A;  3S9L A;  4KVO E;  1S3Z A;  3D3S A;  3D7D A;  2Z3O A;  5KTD A;  2ZPA A;  1B6B A;  1NSA A;  3KI9 A;  3FJU A;  1R3N A;  2PJB A;  2V77 A;  3R9E A;  1Z2L A;  2V8H A;  1P0H A;  4L89 A;  2Z3N A;  2Q4Y A;  8CPA A;  2C6C A;  5CPA A;  5CBM A;  2BUE A;  5HXD A;  5ELY A;  2JEV A;  2RC4 A;  2AFW A;  3SJE A;  1Z8X A;  2GAN A;  3BXM A;  1ON0 A;  2NMT A;  4MFP A;  4PXC A;  5J8F A;  4KOT A;  2Q4Z A;  2JDD A;  2ZEL A;  3FXT A;  2ARH A;  3CXQ A;  1LAP A;  2J9A A;  2XEF A;  2XEG A;  3BLN A;  3RO0 A;  4C7I A;  5LRK A;  4FD5 A;  4KVX A;  3R9F A;  3EY5 A;  3NH4 A;  3S6F A;  4R6T A;  4CAE A;  2ZEP A;  3G3S A;  4OME A;  3KKW A;  6CPA A;  2Q04 A;  4JXQ A;  2GU2 A;  2AFU A;  4MCP A;  4MCQ A;  4QUS A;  1AUG A;  2P0W A;  1K4J A;  4AG7 A;  2PVW A;  5DS0 A;  4AVB A;  1YW4 A;  1YR0 A;  4B5O A;  4P10 A;  2Q44 A;  2OB0 A;  4P4I A;  1CPX A;  2ANP A;  3I1U A;  2B3V A;  4ONW A;  5FVJ A;  3S9N A;  2IQ6 A;  4FD6 A;  3D7G A;  2PJ1 A;  1HDQ A;  3LWU A;  4RS2 A;  4CAX A;  3B7I A;  1LAN A;  5F47 A;  3PB7 X;  3NH8 A;  1ZG8 A;  4MHN A;  3R95 A;  2R98 A;  4UCM A;  4Q7A A;  5C88 A;  1V0C A;  2ZOG A;  3MGD A;  3PB4 X;  3R1K A;  2F7V A;  2IMO A;  3FEE A;  4KS9 A;  3T9Y A;  4NGP A;  3FNC A;  4UA3 A;  4NGT A;  2FS5 A;  3WC7 A;  3T8W A;  2CY2 A;  2KCW A;  4IUS A;  3D4U A;  3IWE A;  4BMH A;  3IFE A;  1F57 A;  1AYE A;  4HNX B;  4MHP A;  3P2H A;  2GRE A;  1XMT A;  2AFO A;  3SI0 A;  3H8G A;  2G3T A;  1CJW A;  5H86 A;  2JBJ A;  2PJ2 A;  4FD7 A;  2EK9 A;  3BHX A;  3L2N A;  1OBR A;  1XIX A;  3IWW A;  4KZT A;  5AG5 A;  4E2A A;  2PJ0 A;  2DPT A;  4B13 A;  5KTC A;  2OZU A;  5HVF A;  2JEW A;  3FB3 A;  4MCR A;  1WWZ A;  1XBU A;  1IY7 A;  1IU8 A;  3D7F A;  2PR1 A;  4UEF A;  3D2M A;  5JQ4 A;  3IJ3 A;  3TE4 A;  1YK3 A;  2EBJ A;  3H8F A;  1WK4 A;  2JDC A;  2VI7 A;  1MJA A;  4P4F A;  2CNS A;  1MK4 A;  3RBU A;  3VAT A;  4RUH A;  4ZY0 A;  4UCP A;  2C27 A;  3CT9 A;  1TF8 A;  3DR6 A;  4P4E A;  4R87 A;  2ZOF A;  3HUV A;  3KQZ A;  3WR7 A;  3GYA A;  5ISV A;  3B35 A;  2Q7S A;  2PR8 A;  4Z65 A;  4KSA A;  3TO6 A;  4ZX8 A;  4CGM A;  2HV2 A;  2C6P A;  2PJ6 A;  2EWB A;  2V8V A;  2Z11 A;  3FIX A;  4P4B A;  3DDD A;  4CS0 B;  3DNS A;  1YQE A;  4KOS A;  4R7M A;  3IIB A;  2WUU A;  3MN8 A;  4IK2 A;  3TT2 A;  1I12 A;  3CPA A;  1S7F A;  3WT4 A;  4G1P A;  4MY3 A;  3IGR A;  3C26 A;  4AG9 A;  1Y9W A;  4KUA A;  4PQA A;  4IHM A;  3MRU A;  4ZI6 A;  1IIC A;  3WAB A;  3FH4 A;  2G3A A;  1XFO A;  4IAV A;  4KLW A;  4F9U A;  4DNC A;  1AMP A;  4Q38 A;  3S6G A;  2ZEF A;  3IU1 A;  5IB9 A;  4KOU A;  1I1D A;  1XOV A;  2O28 A;  4LQG A;  1ZLH A;  1VGY A;  4UEZ A;  1R43 A;  3KGQ A;  3B3V A;  2P6G A;  3RYO A;  5I4M A;  4W9Y A;  3JVN A;  4UWJ A;  3CDX A;  4XPL A;  4NCZ A;  5AG6 A;  1YME A;  4AXV A;  4LX9 A;  4UIA A;  3R9G A;  3IEH A;  3VWD A;  1CG2 A;  3DR8 A;  4LQ6 A;  4EFD A;  2EVN A;  5HMN A;  5IV0 A;  3TCV A;  3RAM A;  3TTH A;  3PBB A;  3TFY A;  5A28 A;  3D2P A;  3GY9 A;  4PSW A;  4A37 A;  1M4L A;  3FX6 A;  5F48 A;  2D4P A;  1H8L A;  1PU9 A;  2PQ8 A;  3F5B A;  1CM0 A;  4KOW A;  4NJQ A;  4A30 A;  1M4I A;  1Z5R A;  5AG4 A;  1NMT A;  4OIW A;  2BEI A;  2VL1 A;  1YX0 A;  1U6M A;  2ATR A;  2CF4 A;  2CXA A;  2HC9 A;  2PJ3 A;  3OWC A;  3F8K A;  4C2Y A;  5JPH A;  5KTA A;  2HB6 A;  4JLY A;  3W6X A;  3FRM A;  3FYN A;  5G21 A;  4X8I A;  2PJ7 A;  2C1C A;  1M1D A;  4FAI A;  1QSO A;  2B4D B;  2ZW5 A;  1XMB A;  1EE3 P;  4P4J A;  2ODF A;  4J3G A;  2BO9 A;  3QNV A;  1JQG A;  3PB9 X;  5JH9 A;  4A38 A;  3KAS A;  2B5G A;  4B10 A;  4Q36 A;  4P6Y A;  2XEI A;  4H6U A;  4YGO A;  4YWY A;  1VHE A;  4OKO A;  4B14 A;  1ZG9 A;  2FL4 A;  1YLO A;  3GKR A;  4MXU A;  4GS4 A;  4P4D A;  2CTC A;  1XE4 A;  1OZP A;  2Z3M A;  2WSA A;  4QVT A;  4AVA A;  4TNU A;  5LRJ A;  5D8N A;  4NF1 A;  1XRY A;  3SI1 A;  5JM6 A;  2ZW6 A;  1NE9 A;  2YNC C;  4NJR A;  1S5K A;  4DUK A;  4EME A;  1Z9U A;  2YNE A;  3I3G A;  5LYL A;  1VKC A;  2Y0M A;  3WC5 A;  4YRH A;  4UF4 A;  1QST A;  4H89 A;  2WYR A;  4FD4 A;  4UIB A;  2BL1 A;  1TKH A;  2VXK A;  4X3R A;  5BWA B;  4JXR A;  1BO4 A;  3H8E A;  5I0C A;  2ZEM A;  1Q2D A;  2R7H A;  5IB0 A;  3TC8 A;  2NSM A;  2VZY A;  3BI0 A;  3FVL A;  2ZEG A;  2RFH A;  4OC3 A;  1Z4E A;  4A2Z A;  1A2Z A;  3D66 A;  1Z8T A;  3R96 A;  4E0A A;  2EO8 A;  4PPZ A;  1N71 A;  4R3L A;  2AJ6 A;  1RTQ A;  4H6Z A;  1TIQ A;  4Y49 B;  4PSX A;  2R1I A;  2R8V A;  3BJ8 A;  4A39 A;  2REF A;  4MFK A;  2YND A;  2GLF A;  1ELL P;  1FY7 A;  2PRB A;  3B2Y A;  1J4J A;  2AFS A;  4B5P A;  2QJ8 A;  2PE3 A;  4UBR A;  4L8A A;  3V38 A;  5K8N A;  1YVO A;  2PVV A;  3NFZ A;  1PCA A;  3V7Z A;  3BJ7 A;  3KQX A;  1KUX A;  3LMS A;  3TX8 A;  3VWE A;  4ONU A; 
#chains in the Genus database with same CATH homology
 4A95 A;  1IYL A;  4E8O A;  5G1Z A;  2OZG A;  2H5M A;  2YGW A;  1S7L A;  3ZZI A;  3JUW A;  3B8G A;  2PSW A;  5C82 A;  4M3S A;  2VQY A;  5G22 A;  2ZXV A;  4MFL A;  5EC4 A;  2OU2 A;  4I49 A;  1RO5 A;  1PUA A;  4R57 A;  5G20 A;  3IU2 A;  2REE A;  5E96 A;  4MFZ A;  4MY0 A;  1NSL A;  4CYO A;  3D8P A;  2VZZ A;  4C68 A;  1IYK A;  3W6S A;  2OH1 A;  4KSF A;  5AG7 A;  1RXT A;  2FIA A;  3LD2 A;  2EUI A;  4UCN A;  2PC1 A;  5F46 A;  3H5Z A;  2I79 A;  4A31 A;  2VEZ A;  3JTK A;  2J8N A;  4KOR A;  5EBV A;  4II9 A;  2G0B A;  4XNH B;  3FBU A;  4CAW A;  4ZBG A;  4R3K A;  4PV6 A;  5DWN A;  2FIW A;  1KZF A;  4CYQ A;  4XPD B;  4JWP A;  4CGN A;  4JJX A;  1M4G A;  1L0C A;  2J8R A;  3PZJ A;  1MJB A;  5GCN A;  4CRY B;  4ORF A;  2VBQ A;  4QC6 A;  3PGP A;  3CXS A;  3PP9 A;  3F0A A;  3QAH A;  3TO9 A;  1XF8 A;  3A9L A;  3I9S A;  4XPK A;  2Z3L A;  4U9Z A;  4Y49 C;  1MJ9 A;  4F6A A;  2B3U A;  1LRZ A;  3N7Z A;  4K30 A;  5F49 A;  3P2F A;  4M85 A;  4B11 A;  2A4N A;  1Z4R A;  4CGL A;  4KOY A;  4UFW A;  2B4B A;  4YFJ A;  4UWI A;  2Q0Y A;  2OZH A;  4AB7 A;  1Y9K A;  3EXN A;  2HQY A;  2QML A;  2FCK A;  1UFH A;  2FXF A;  4AVC A;  1B87 A;  2P6E A;  4QBJ A;  2F5I A;  2IL4 A;  1Q2C A;  1Y7R A;  3TO7 A;  1GHE A;  4MBU A;  4UFV A;  1S7K A;  4R9M A;  2YNC A;  3DSB A;  1ZO0 A;  4CYP A;  1S60 A;  3SXN A;  4F0X A;  1KUY A;  4MI4 A;  4HKF A;  2Q7B A;  2AE6 A;  4HNY B;  3T90 A;  1M44 A;  4PK3 A;  4X5K A;  4U5Y A;  4NSQ A;  2FT0 A;  2DXQ A;  4HNW B;  4BBH A;  3EC4 A;  1I21 A;  2BSW A;  4EVY A;  1Q2Y A;  4XNH C;  5AGE A;  4C7H A;  3CXP A;  2B5G B;  3QB8 A;  2CNM A;  4LUA A;  4MJ8 A;  4KVM E;  2GE3 A;  4QB9 A;  4MFQ A;  4A33 A;  3G8W A;  4XPD C;  2GIV A;  5A27 A;  3SXO A;  4KLV A;  4UFX A;  4CYN A;  2ZW4 A;  1QSM A;  2ZW7 A;  1YLE A;  4JD6 A;  4ZGY B;  3H4Q A;  2X7B A;  2JLM A;  2Q4V A;  4C2X A;  1SQH A;  3EFA A;  3TOA A;  1BOB A;  3V8I A;  2J8M A;  4KOX A;  2Z3K A;  1YVK A;  4CGP A;  1S7N A;  3TOB A;  4F0Y A;  5CNP A;  4OAD A;  1IID A;  2PDO A;  3EO4 A;  4MHD A;  4KUB A;  4U9Y A;  1VHS A;  2P6F A;  4KOV A;  4CGO A;  1QSR A;  3ZJ0 A;  1YRE A;  2B4D A;  1R57 A;  1YGH A;  5J8C A;  3LOD A;  4PK2 A;  3SHP A;  4C2Z A;  5IX3 A;  3IWG A;  2WPX A;  4CAV A;  2FE7 A;  3S6H A;  4OAE A;  2D4O A;  4B5P B;  2Z0Z A;  3W91 A;  1XEB A;  5HH1 A;  4OLL A;  4RI1 A;  2DPS A;  5DWM A;  2Z10 A;  3NE7 A;  4CAF A;  2WPW A;  4NXY A;  4IF5 A;  3UY5 A;  4CRZ B;  1KUV A;  3S6K A;  4NEX A;  3E0K A;  2QIR A;  5H84 A;  3K9U A;  2CNT A;  2I00 A;  4B12 A;  1QSN A;  2K5T A;  2Z3P A;  1P4N A;  4MFJ A;  2B58 A;  1IB1 E;  2FSR A;  2HUZ A;  2QEC A;  4A32 A;  1M4D A;  4KVO E;  1S3Z A;  3D3S A;  2Z3O A;  5KTD A;  2ZPA A;  1B6B A;  3R9E A;  4L89 A;  1P0H A;  2Z3N A;  2Q4Y A;  2BUE A;  2JEV A;  2RC4 A;  2GAN A;  4MFP A;  1ON0 A;  2NMT A;  5J8F A;  4KOT A;  2JDD A;  3FXT A;  2ARH A;  3CXQ A;  4C7I A;  3BLN A;  4FD5 A;  4KVX A;  3R9F A;  3EY5 A;  3S6F A;  4CAE A;  3G3S A;  3KKW A;  2Q04 A;  4JXQ A;  4QUS A;  2P0W A;  1K4J A;  4AG7 A;  4AVB A;  1YR0 A;  4B5O A;  2Q44 A;  2OB0 A;  2B3V A;  5FVJ A;  4FD6 A;  4RS2 A;  4CAX A;  5F47 A;  3R95 A;  2R98 A;  4UCM A;  5C88 A;  1V0C A;  3MGD A;  3R1K A;  3T9Y A;  4KS9 A;  3FNC A;  4UA3 A;  2FS5 A;  2CY2 A;  2KCW A;  4IUS A;  3IWE A;  4BMH A;  4HNX B;  3P2H A;  1XMT A;  2G3T A;  1CJW A;  5H86 A;  4FD7 A;  4KZT A;  5AG5 A;  4E2A A;  1XIX A;  5KTC A;  2DPT A;  4B13 A;  2OZU A;  3FB3 A;  1WWZ A;  2PR1 A;  3D2M A;  5JQ4 A;  3TE4 A;  1YK3 A;  1WK4 A;  2JDC A;  2VI7 A;  1MJA A;  2CNS A;  1MK4 A;  4UCP A;  2C27 A;  3DR6 A;  4R87 A;  3WR7 A;  3GYA A;  5ISV A;  2PR8 A;  4KSA A;  3TO6 A;  4CGM A;  2HV2 A;  3FIX A;  2Z11 A;  3DDD A;  4CS0 B;  3DNS A;  4KOS A;  2WUU A;  3TT2 A;  1I12 A;  1S7F A;  4MY3 A;  3IGR A;  3C26 A;  4AG9 A;  1Y9W A;  4KUA A;  1IIC A;  2G3A A;  4KLW A;  4DNC A;  4Q38 A;  3S6G A;  3IU1 A;  4KOU A;  1I1D A;  2O28 A;  2P6G A;  3RYO A;  3JVN A;  4UWJ A;  5AG6 A;  4XPL A;  4NCZ A;  4LX9 A;  3R9G A;  3VWD A;  3DR8 A;  2EVN A;  5HMN A;  5IV0 A;  3TCV A;  3TTH A;  3TFY A;  5A28 A;  3D2P A;  3GY9 A;  4PSW A;  5F48 A;  2D4P A;  1PU9 A;  2PQ8 A;  4KOW A;  3F5B A;  1CM0 A;  4A30 A;  1M4I A;  5AG4 A;  1NMT A;  2BEI A;  1YX0 A;  1U6M A;  3OWC A;  2ATR A;  2CXA A;  5JPH A;  4C2Y A;  3F8K A;  5KTA A;  4JLY A;  3W6X A;  3FRM A;  3FYN A;  5G21 A;  1M1D A;  1QSO A;  2B4D B;  2ZW5 A;  4J3G A;  2B5G A;  4B10 A;  4Q36 A;  4H6U A;  4YGO A;  4B14 A;  2FL4 A;  3GKR A;  4GS4 A;  1XE4 A;  1OZP A;  2Z3M A;  2WSA A;  4QVT A;  4AVA A;  4NF1 A;  2ZW6 A;  1NE9 A;  2YNC C;  1S5K A;  1Z9U A;  2YNE A;  3I3G A;  1VKC A;  2Y0M A;  4YRH A;  1QST A;  4H89 A;  4FD4 A;  2BL1 A;  2VXK A;  5BWA B;  4JXR A;  1BO4 A;  5I0C A;  1Q2D A;  2R7H A;  5IB0 A;  2VZY A;  1Z4E A;  4A2Z A;  4E0A A;  3R96 A;  1N71 A;  4R3L A;  2AJ6 A;  4H6Z A;  4Y49 B;  1TIQ A;  4PSX A;  2R1I A;  2R8V A;  3BJ8 A;  2REF A;  4MFK A;  2YND A;  1FY7 A;  2PRB A;  1J4J A;  4B5P A;  4UBR A;  4L8A A;  1YVO A;  3BJ7 A;  1KUX A;  3VWE A;  4ONU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...