3IC1A

Crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
376
structure length
370
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIQYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 120
structure length 370
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ic1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ic1A01
3H8EA 2PJ6A 3PB6X 2PIYA 4MHZA 4UEEA 5THWA 2IMOA 1LFWA 4G1PA 2QYVA 2EK9A 3RAMA 3SJEA 4EWTA 2PIZA 3HLPA 3ISZA 3LMSA 4YWYA 3V7ZA 2V77A 3FECA 4DYOA 2EK8A 4F8ZA 5I4MA 3FEEA 2ANPA 3MN8A 2GREA 2CTCA 2PJCA 3WC7A 4IHMA 3GUXA 5LRGA 1YLOA 2WZNA 3CPAA 4NGNA 4P4DA 2C1CA 2PCUA 3D4UA 4A39A 2FVGA 2POKA 1IY7A 2QVPA 1RTQA 4PXBA 3S9LA 4FUUA 1VHEA 2BOAA 4MXUA 3D7FA 2JEWA 4W9YA 5LYIA 2ZEFA 3GB0A 2ZENA 3TX8A 3WT4A 1HDQA 2AFXA 1PCAA 1YW4A 1BPNA 3S9NA 1AMPA 2BCOA 1VHOA 4AXVA 4WWVA 2CTBA 3KL9A 2I3CA 1XMBA 1DTDA 4DJLA 3KQXA 2VL1A 3SI1A 3FVLA 4OC4A 1R3NA 2JBKA 2G9DA 3B3VA 1CBXA 4BD9A 1KWMA 3NFZA 4NGQA 2XEJA 3IEHA 4OC1A 3PB4X 4ZX9A 2O4HA 3FJUA 2BO9A 2PJ5A 3B3SA 1HEEA 2XEGA 3SI0A 4P4BA 5D8NA 2ZEEA 5LRJA 3HUVA 2V8GA 1R43A 4PXDA 3ISXA 4UF4A 4IK2A 1ELMP 3BI0A 3TC8A 4F9UA 2AFSA 4P4EA 1DE4C 1TKJA 5JH9A 3FH4A 3FMCA 4OIDA 1EE3P 1ARLA 5LYDA 6CPAA 4NGTA 2CF4A 4R8FA 1XBUA 3D7DA 4FWUA 3L2NA 1LOKA 2AFOA 2ZOFA 2AFZA 4X3RA 4KSIA 7CPAA 4ZI6A 4OIWA 2OOTA 3KQZA 1XRYA 3BXMA 4P4FA 3H8GA 4MCSA 5DS0A 3SJGA 2ZEPA 3D68A 4MCPA 3KASA 3SJFA 2ABZA 2C6CA 4K3NA 4IAVA 4PPZA 3LWUA 2HB6A 4NGRA 1Y0RA 2ZEHA 4OC5A 5J1QA 2PJ9A 4OC0A 5HXDA 3VH9A 1LANA 3B3TA 4NJQA 2PJ8A 4P6YA 3KR5A 4UIBA 3D67A 1Z5RA 4MHYA 4NGMA 4OC2A 5K8MA 5K8NA 4LQGA 2PVWA 1TKHA 3NA6A 1Q7LA 3BHXA 3PRTA 2AFMA 5LYFA 3KR4A 4X2TA 1OBRA 4X8IA 4B6ZA 3K2KA 2Q51A 2QJ8A 2V8HA 4P45A 4ZY2A 3MRUA 1ZLHA 1BAVA 3VATA 3CT9A 3VARA 5LRKA 5K8OA 2PJAA 3GLJA 2HC9A 1ARMA 4A94A 1TXRA 3S9MA 1ELLP 3IC1A 3BI1A 2PJ0A 2Q43A 5CBMA 2ZEGA 2AFWA 2JBJA 1LAPA 1QQ9A 4ZX8A 1QMUA 1FNOA 3SJXA 2C6PA 3B7IA 1VIXA 3CPXA 4CPAA 1TF9A 3D7HA 5F09A 3DLJA 4NJRA 3KGQA 1BLLE 3IFEA 3K9TA 2O53A 3NH8A 2PJBA 3D7GA 1CP6A 4NGSA 3D66A 4P4IA 3NH5A 4MHPA 5JGFA 3QNVA 4PXEA 4MHNA 4OC3A 3IIBA 3B35A 3I1UA 1Z2LA 8CPAA 2WYRA 3IO1A 3PEIA 5ELYA 4O23A 3B2YA 1YW6A 2ZEMA 2DEAA 4ZY1A 4TWEA 3KZWA 2EWBA 2C6GA 4OKOA 2ZEDA 3NH4A 1CG2A 1LCPA 3H8FA 4NFRA 2IQ6A 2PRQA 1XJOA 4P10A 5CPAA 3IWWA 4R76A 4UEZA 3T8WA 4ZY0A 2IJZA 4H2KA 3KHZA 2PJ2A 4PXCA 2GU2A 5HVHA 2GLFA 2RB7A 1ZG7A 3B3WA 3PB8X 4YU9A 5LYLA 1H8LA 3FF3A 2Q4ZA 4A38A 1PYTB 4EFDA 4Z65A 2PE3A 1F2OA 2V8VA 4TNUA 1F57A 3IJ3A 4Q7AA 3N5FA 2RFHA 4A37A 4RUHA 3WC5A 1AYEA 4R7MA 3FEDA 5JM6A 1FT7A 2OR4A 2PJ4A 3PB7X 3PBEA 4OP4A 1CPSA 4JYWA 1GYTA 1BPMA 1CX8A 2NYQA 2F8HA 1LAMA 3RZAA 2XEIA 2V8DA 1CP7A 4P44A 4MMOA 4MRIA 1VGYA 4JZ0A 1M4LA 4UIAA 1ZG8A 1HDUA 3V38A 1ZG9A 2F7VA 3PB9X 1UWYA 3KI9A 1ZLIA 1NSAA 1TKFA 4ONWA 4F9VA 3DGVA 2AFUA 2ZEOA 4NGPA 1Y0YA 3FX6A 4MCQA 1CPXA 2ZELA 2PVVA 5D29A 4P4JA 4FBEA 1TF8A 4FAIA 3CDXA 2PJ3A 2XEFA 3KHXA 1YSJA 1JQGA 4MCRA 3PFOA 3JRUA 1Y7EA 1IGBA 3B3CA 1XFOA 3WC6A 4WJBA 2ZOGA 5K8PA 3WABA 2GLJA 4UEFA 3SI2A 5HVFA 5IB9A 2PJ7A 2CIJA 4R6TA 4DUKA 4ZYQA 3PFEA 3PBBA 2J9AA 2PJ1A 1F2PA 3RBUA 5HVGA 4PQAA 1YMEA 1Z8LA 4GM5A 4OMEA 2NSMA 4EMEA
chains in the Genus database with same CATH superfamily
4LF5F 5KFLA 4OI6A 2AD9A 3RBXA 4GC7A 2EK9A 3QGIA 4OI4A 3D8PA 3HLPA 2RF2A 1F9EB 5E3PA 4IR9A 2EKYA 4PG8A 3GFHA 2BQUA 1HD0A 2MSSA 1Q8KA 1KEKA 3MR7A 3MM5B 3EZOA 1FD8A 3BO2A 4DV3F 3MM8B 1YJ9S 4H4OB 1HR0J 2QSFA 2KHCA 4CQ1A 4LSZB 4RW9B 4ETZA 1EX8A 1N34J 1RLDA 2XLIA 1CM0A 2V94A 2FVCA 2JEIA 1F0XA 2VPWB 1Q7YT 4EFAC 3MTKA 2JFDA 2B51A 2J0QD 4AQYJ 1ZM2A 5KFVA 1WC3A 1WC1A 3RBDA 4CTAA 6FDRA 2G3TA 2OKQA 1I94J 4FF2A 3CC2S 4ZVFA 2VICA 1H7XA 5L1KA 1QSNA 2LQBA 1TR0A 3NE8A 4GKJF 1UZHA 4DJLA 1G3OA 4X4PA 4RKUC 4QJVA 1O8BA 2RKIA 4B08A 3FBCA 1N36J 1B87A 2CQIA 3HHLB 4BD9A 3RRHA 1H38A 4ZX9A 5HMNA 1VKCA 5LMUJ 4ZLLA 2P9GA 2CJBA 2PEHA 2XC9A 2VFVA 3HHEA 3FZ2A 4WPAA 4PG7A 5IM0A 3M30A 2N3LA 2D3OR 1Y3JA 3G86A 4KKOB 4F9UA 4MFKA 2CPDA 3TA0A 2BE9B 2UUTA 2I9SA 9ATCB 2GV1A 2ZBQA 1HWLA 1VK8A 2XEXA 2PI4A 1LOKA 1NSPA 1KFDA 4B9MA 2MZQA 4I0WA 3G82A 4KOVA 4DR3J 3ZXWA 2VFTA 2DR5A 1XRYA 1FDDA 1E6YA 4P4FA 1RT1B 3I56S 3U1NA 5D0HA 4IFVA 4KHRA 2VOOA 1N33J 1UW4A 1PYSB 3AJ2A 1QAYA 5ETQA 3LF0A 1F60B 3T90A 5L1IA 2WK4A 1S9EB 3G8SA 2W4CA 2PJ8A 3Q8UA 4NRTA 2UXDF 4P6YA 3VHQA 4CLZA 4CRJA 2RSQA 5KG0A 1WI6A 5B0CA 2HFVA 3FXTA 1WC5A 1R8CA 3MGJA 3F0AA 1WG4A 4LSNA 1RCOB 2DJWA 3K2KA 5C82A 4ECUA 1YDLA 2ZKUA 3HFVA 4AXJA 3I4PA 3TRGA 1PGZA 1CJUA 4X66F 3RW6A 4B3TJ 2ZHBA 1TXRA 2NUHA 2HQGA 2KFZA 2ZEGA 3HLUA 2FCKA 4M95A 1R0BG 4Y2CA 2YWKA 1YJNS 4CCHA 3W2VA 2AJ0A 4Q45A 1BQNB 3IG1B 3KG0A 4F25A 1ZA1B 2DNQA 4QYZJ 2MQNA 2ZDOA 3BBCA 4B3OA 3A13A 3TQ1A 2MKHA 3QZ7A 1Z2ZA 3MXHP 2OFGX 1BQMA 2JEFA 3Q8VA 2B0GA 3I31A 2QA4G 1HR0F 4CLLA 2Z8QA 4LF1A 4CRYB 5KT6A 5JQ4A 1N34F 2ZEDA 4CLPA 4A33A 2W9CA 4DL7A 2B5GB 3WX8A 2AYGA 4AQYF 1TAUA 1I94F 5HJXA 2OZGA 3MURP 3E0KA 1TKTB 1S1UB 4HLBA 1ZG7A 4DQSA 2BX6A 2OD6A 3H5YA 1SPBP 1QUPA 5D4OA 4EO6A 5CZXA 1NSQA 2WW4A 2JEVA 3B78A 5DG7A 3IXQA 4JP8A 5BYQA 4J9KA 1HMVB 2MKYA 4DLEA 3UN3A 4IQXA 2XMTA 5LMUF 4LQ3A 3W91A 3KLHB 1JMTA 1N0VC 4NCAA 5IB0A 1MJAA 4CNYA 4FBUA 2HHQA 4JZ0A 1I21A 5HJYA 1FD2A 2RAQA 3DMJB 4MKAA 4KHPF 2ZHOA 4F4ZA 2WSCC 4KB7A 2DGQA 3DGVA 1YX0A 2AFUA 3H2LA 2ZDPA 3M2RB 1Q79A 1CPXA 4RUBA 2E44A 5GADI 3D3BJ 1YK3A 3UPFA 4DR3F 4UCMA 5C25A 2H65B 3JSMA 5A6PA 1N33F 1SKRA 1K73T 3LALA 2LEPA 3HSJA 4OZLA 1I1GA 3BPDA 2NZ4A 2PEBA 1F2PA 1ZH5A 3SDEB 1S1XB 2FVPA 3UCUP 5J1PA 2Q66A 2Z58B 5DWMA 3HT3A 2EW9A 3NBPA 1S0MA 1EKSA 4GC6A 4PG4A 2AZ1A 1XR5A 3VGVA 1AROP 4ITSA 4B3RJ 4DDFA 1FK9B 2Y0MA 3FECA 2DNOA 4GKKF 3LACA 1FRXA 2F8EX 3DLEA 5GAEI 4USUA 4YHHF 1ZETA 2HURA 4GO7X 2VQFJ 3JQJA 3CPAA 4OYZA 2QMLA 1IBMJ 4I7FA 2ASYA 2KYXA 3D5MA 2C1CA 4UQGA 4B3TF 1IVZA 1U1PA 2XSJB 3RB6A 2H5MA 4BS2A 3LP2A 2R2RA 4TY8A 1LW2A 4F50A 2Y8YA 4USWA 5HL7Q 1UFKA 1R0AA 3TX8A 3N28A 3OV7A 4FD7A 1VDHA 3HXMA 2E9RX 3M2VA 2YWHA 4DV1F 2YPYA 1DTTA 3JXOA 2M9KA 1RTJB 1AFJA 1C1CA 2G9DA 3KLEB 1U1NA 5ETOA 2DXDA 5E3RA 1APSA 2VOPA 1N71A 4LFAJ 1RE1B 1H0HB 2BUEA 2J8AA 1AZSA 3ET6B 3LPYA 2M5YA 2E7WA 3FIXA 2VJUA 3SCKE 2Q3PA 4IO9Q 2UVVA 2DNMA 1TK5A 1NK4A 4AVCA 3KTQA 2HZVA 3QRRA 2ADBA 4KOYA 2H4WB 1QVFR 5GVQA 3QGGA 2AFSA 4KUBA 1D1UA 1DE4C 3RB3A 4WP8A 2GGPA 5I3QA 4OIDA 3CWJA 1EE3P 2DY1A 2MZJA 4NGTA 1FJCA 4A8FA 3HD1A 2C2EA 4LQ6A 1XIQA 4AT1B 4KSIA 1NLKL 2BJ9A 3QWPA 2QA1A 2CADA 4CS0B 2L48A 5DZ7A 5L1LA 3IBFB 3GJQB 3SQGA 5KTDA 1Z4EA 2XNRA 3KQZA 1MSWD 2F5GA 4JYAF 2DHHA 3P8BB 1LWEA 4QIWD 1WTBA 3T6JA 4IAVA 2PN6A 4LF4J 4JV5J 2XS2A 2XHWA 3MF5A 3KMQA 4OC0A 4NI2A 1R6YA 2BJ3A 4H54A 2J9CA 2AE6A 1D09B 1LKZA 2B56A 4DR1F 2CWXA 3KR5A 3EO4A 4QBJA 4WIIA 3PDNA 1YKWA 8ATCB 3D4JA 3PJXA 4DR6F 3JYTB 1JLFA 4Y49C 2W4PA 3GYXB 3NMAA 3QT7A 4AE5A 3OHBA 1N5YB 1FRIA 2V4JB 3W8GA 1YHQS 1ICEB 4WXOA 2WSEC 2QLWA 1EB0A 5HQ8A 1L3VA 2HC9A 3QAYA 5I42A 3R9FA 1R89A 3VTIA 4USIA 5CYMA 2PJ0A 4MH8A 1N5VA 1KBRA 1QQ9A 2YTCA 3QAHA 4X65J 3B7IA 3ZTPA 4NL5A 1SH2A 3W66A 2IM0A 3DLGB 2Z2ZA 2ZH5A 3DLJA 4MI4A 4ZVRB 1RJJA 1GFWB 3R2CJ 3C14A 2WBMA 4RW4A 3D7GA 4TN2A 2RU9A 4B3RF 5JGFA 4H4KC 2C1EB 5AT1B 1YITS 2G13A 2G1DA 3VVTA 1C0UB 4YN3B 2COLA 1Z2LA 3LP1B 2CJ9A 2VQFF 2RU3A 3NGUA 1D9DA 4TWEA 2BMBA 1IBMF 4XPDC 2C6GA 3OL6A 1XMOF 3NOCA 4ID5B 4K4VA 3EY5A 4NLQA 4DX5A 4ZPBA 2GU2A 4ECZA 2BJDA 3SSQA 2D3UA 1JJ4A 4N8OA 2OGUA 1NXIA 1FDNA 5C88A 1Q16B 4UWIA 1IWGA 1F5AA 4JI0J 2FIAA 5B09A 2CPZA 2ZH3A 2R2UA 4F26A 4LFAF 1GMUA 5T41A 4NCGA 3BPSP 2IDLA 4DL0C 5I0CA 3TO8A 4RN7A 2IC3B 5J2MB 3BJYA 1LFPA 2XHCA 5KFRA 2GC8A 2N4DA 4PRFA 1VRQC 3OJUA 2HFSA 2IJNA 4GMKA 2CQ2A 1JLGB 2C3OA 3OXLA 4MRIA 3PACA 3C15B 3CCMS 1Y11A 2FVSA 1JLEB 1ZLIA 3MMBA 3D0HE 2KG1A 4NGPA 4ZS6A 4WTYA 1MMLA 2E5JA 1HBNB 4DQIA 4LRAA 5KFUA 3IM9A 2RS2A 1Z9UA 2B4UA 4BHQA 1OS5A 3PFOA 2DB1A 3NY0A 1Y7EA 2HQ3A 4LFBF 1BGXT 2GHVC 2OPQB 3B3CA 4IR1A 4HDGA 4ED6A 1TVRB 5K8PA 4JV5F 4LF4F 1UVMA 2OJ3A 4ZMMA 3DRRA 3FRYA 4JI8J 4LF8J 2J9AA 5F9LA 2FXFA 1SC3B 1SIZA 1GQEA 4Y6IA 4TLRA 2DCUB 3HHLC 1IKYA 1NKBA 3M8PB 2EI5A 3IGVA 2IA6A 2NYHA 4MK7A 3QWUA 4J3GA 3UN2A 3H4BA 4BWMA 2ATLA 2WSFC 4YWYA 2WVCA 2CJQA 2W8LA 1GK8A 2D1CA 2VG7B 1C1BA 2BW7A 2YWGA 4PWUA 3M32B 1RAIB 1WUUA 2B7CB 2E29A 3FC9A 3I0SA 4KSFA 3ZTRA 1S6PB 4DSLA 2CPEA 5C42B 5KFHA 4CYOA 4X65F 2ATCB 5FVJA 3H98A 3PZPA 4ZN1A 2VKZG 5AXLA 4QR2A 2VEZA 4ILMA 4DV4J 2XWXA 4C8MA 3NP5A 5IT9Y 2V2ZA 1RK8A 2ZKTA 5MLCV 3TUZC 3KJNB 4DV6F 2R8VA 4OYAA 1T9YA 1QM9A 3LGNA 5T7LA 1Y10A 1N5SA 2C2NA 4GVBB 2K3IA 2C2ZB 3CIMA 3AB2B 1VHIA 2B3UA 3UCGA 4IF5A 1U8SA 3DHXA 1S1WB 4DSKA 5D8NA 5LRJA 2FT0A 4AYBD 3PW0A 3IMQJ 4AFFA 1FKOB 2DRDA 1GHEA 2CQ4A 1KHWA 2V2VA 1BE4A 4I2PA 2PMWA 4KOSA 3O6QA 2AU0A 2IRUA 5LYDA 3NKYA 1OY9A 4DEZA 2ZOFA 4WTOB 3F8KA 4E2FB 3MFHA 5CD4H 2VBQA 1L3KA 4FD6A 4P2SA 4MFZA 4RU9A 5EC4A 2WOMA 3OTEA 2P6EA 2CNSA 5D78A 2ZBIA 3Q83A 1MU2B 1HBMB 1Z8TA 4OI3A 3IGNA 2CDRB 3LODA 1KD1T 2MQ8A 2LQ8A 4PV6A 1B0TA 1IWAA 3ZJ0A 1NHVA 2DGTA 3AODA 5L38A 2Z2MA 3RB4A 2ROEA 5M2PA 2MQLA 1IM6A 4WK3A 1KS2A 2V34A 5CH7B 4IG3B 2HGMA 5KFZA 3EZUA 1H74A 3PR4A 2YWFA 2QFIA 1SBRA 4WE1B 1S9GA 2BE2A 1SQFA 4OYBA 3D7SB 2F9JA 2OZHA 2XY6A 5GCNA 2J76E 3M6XA 3CCZA 3MRUA 2PGCA 2H3EB 2WONB 3O3LA 3LWLA 2B9XA 1WEYA 2ZH1A 2WB1D 2AJFE 1KP6A 1ZA2B 5KT7A 3VWEA 4A94A 3C6UA 3S9MA 3WQPA 1KUXA 1J5OB 2O67A 2XGPA 4JI8F 3V81B 3UCZP 4CGPA 2W4DA 1FY7A 3M8YA 1RT7A 1A7GE 1SXLA 3GP9A 2BKNA 1JKHB 4ELVA 4OLPA 2E5IA 4NGSA 2ZM6J 1P4NA 4UZCA 5JUMA 3CXPA 3QLHB 2CNNB 1M4DA 4Y2KA 4X4QA 2GIFA 2DGOA 4K59A 3CZXA 4WZQA 4KUAA 2ZC4A 2M70A 4K8RA 2RS8A 4DZDA 1M5VC 2DEAA 5KG2A 4ES1A 4ZY1A 5F0UA 1RI7A 1S1TB 1AA1B 3FSIA 3FEYB 4ICLA 4JI7J 3J7AN 4YR2A 3D0GE 3AXKA 2KT5A 2R7RA 4LIRA 2W2QP 1XJOA 4Q0BB 4KORA 5D4PA 4DV5J 3KHLA 3GE9A 2NREA 4FS2A 1XMQJ 3ENAA 2DXEA 5D8HB 2ZITA 5AE1A 3KHZA 3RRKA 3GV8B 2WVBA 3MM7B 1FE0A 3QJJA 3CCES 1F5BA 3FQKA 4A32A 1ZZFA 1NMEB 2CVEA 1B0PA 3CDUA 2I8EA 2QN6B 1RWOB 3EWGA 3R7BB 4WKRA 4M5GA 3RBZA 3GR0A 4HNXB 3L7PA 1PO6A 1T3OA 3FFIB 4OP4A 1QSOA 3HK2A 3MR3A 4F8RA 3Q8RB 4JYWA 2HFUA 3AOBA 1XE4A 2PFDA 4IG0B 1B64A 1RQ0A 3KLFB 3PW7A 4OX9J 1GMWA 1QSYA 3MM6A 4B5OA 1TV6A 2YNIB 4EZ6A 2DIVA 2AIRB 4DN9A 5BWAB 3EXYA 2DXFA 1U48A 3I6PA 2VG6A 3QYYA 1UPPA 5DG8A 2ZFHA 3B6BA 2CQDA 3SCIE 2DPSA 5HVFA 1OZPA 3D6FB 1HNIB 3EFAA 2JLMA 3ICLA 4ELUA 2HHXA 3FCVA 4X4TA 5ETMA 4RW6B 3KHGA 3I96A 1IQZA 2I1RA 1SL0A 1FX2A 2PIYA 4LFCJ 2DNGA 5D6GA 2MKJA 5K14A 4ANCA 3CCWA 2Y3YA 2MKSA 2JX2A 1X8DA 1LFWA 2IPOB 4JI1F 4QYZK 4CLYA 3AAWB 4OHVA 2F3JA 2VG5A 2JNJA 4QWEA 3WC7A 4MTPA 4YB5A 4AB7A 2QLBB 4ZVUB 3HCXA 2V68A 5J2QB 2GQCA 2KXFA 4A39A 4WP3A 4KLWA 3MR2A 1VRUA 5H9FJ 4ATNA 2R7UA 5D3GB 2ZE2B 3FBEA 1VC5A 5IV3A 2REEA 1CJKA 2HBZB 2XMMA 4WKYA 3SFUA 3QIDA 2KHDA 5FDLA 1HDQA 1EHWA 4PUOA 2F4VJ 1BPNA 3DOKA 4ETXA 1AMPA 4JI3J 4A8WA 4B9SA 4X84A 2DVIA 2IMWP 5JVGQ 4MIBA 2Z3MA 3H40A 3UVJB 1VRTA 3KK2B 2YQ1A 1E6YB 4AUKA 3UD3P 2FGOA 5H1SV 3R1LA 4OC1A 2M2BA 5CCLA 1IKVB 1HEEA 4HHJA 2H9ZA 3D6TB 4JI2F 3DDDA 4DQRA 4PZVA 4Y2AA 1S7FA 5RUBA 2DT9A 4JI7F 3Q89A 4KGZB 3V6DB 2YNCC 2Y0BB 1T03B 5M2RA 2R9LA 3CJSA 2AGPA 2CQPA 4AVAA 3K0JA 2D7SA 3FH4A 1T9TA 3W9JA 2ZJQQ 3RUBL 1K4JA 5HQLA 1ARLA 3QAUA 6CPAA 3CJ0A 3D28A 4FWUA 1JLQA 2DHAA 4X3RA 1HIYA 2NR0A 4I56A 4PG6A 2KZZA 1NO8A 4ZCLA 5G20A 1TL5A 3ZTQA 2HLUA 2UVUA 2C27A 1SKUB 1D3WA 4PPZA 5L39A 4FVMA 2HMIB 1Q8IA 4USVA 1JNZB 3S7RA 3GFXA 1RO5A 2A10A 2HQDA 2DR8A 2A6MA 1FWKA 4KV8B 4JV0A 1F6TA 2CNOB 2OB0A 2E1MC 2X7BA 3U27A 3N4WA 3GU0A 5GAEU 2OSQA 4JI6J 4LQGA 2CQBA 4OZ3A 2K3KA 1VBXA 5H9EJ 4G1QA 2G9OA 1S4FA 4WYWA 3DRXA 4OQJA 2MGZA 4P52A 1ZAXA 4IUSA 4B6ZA 4F3MA 4M1KA 2HS3A 4F3QA 4MHDA 1S5KA 5LRKA 2VKRA 4ZVGA 1D9FA 3HJVA 2VZZA 1K47A 3DGPA 3Q8QB 1Z4RA 4OYXA 4LF2A 4UOFA 1VBKA 4ES2A 2XLKA 4QYRA 1WHVA 1PJ5A 1ZO0A 5AG4A 5EX0A 3VQTA 2J7WA 3ETOA 1L0CA 2MQOA 3LTOA 4P4IA 4C8LA 2X51A 1NJZA 3I87A 3EXNA 1RWPB 3FQLA 2DRBA 2FY1A 1Y00A 4OHXA 4XNHB 1VQ6S 2OEMA 4K4TA 1IM4A 3IIBA 3T9ZA 5ISVA 1TZ0A 2RJZA 3H20A 1I3OB 2BVZA 4H4KA 2A0FB 3NG8A 3OUYB 2VJVA 3T1YJ 3H5UA 4PWDB 5A8KB 2ZJPQ 2R8IA 1LCPA 5F8IA 5E0OA 3HVTA 4ECYA 4V19J 2VDIA 3IRWP 3SV3A 3I0RA 2BOPA 5DM6Q 2HZAA 3DOLA 4R0EA 2KM8B 1OMSA 4RPFA 3EVMA 3W9HA 2QGFB 4RLEA 4JI3F 4DX7A 1LWCB 2FUG9 2PE3A 2OLWA 3TCVA 4NLDA 3JTNA 4MYUA 3F41A 5J2PA 3N0VA 1OYEA 1KQFB 2Z3OA 2EG1A 1QDUB 4B17A 3QGHA 2OAUA 3MEDB 1Z8WA 1YRXA 3OD2A 2B6AA 2OR4A 4JB8B 3UDCA 3OHAA 1QTNB 4F4YA 3PHEA 1QSSA 2JLEA 3BYRA 1LAMA 2UXBJ 4PQUB 3RZAA 5KFPA 2DHXA 2NYIA 2EFQA 2RH3A 3DRYA 2OP5A 4M5DB 3RG6A 4J9OA 3BBBA 4HL9A 1U26A 4ZITA 3KJVB 3QQCD 3MM5A 3C3LA 2PD1A 3MM8A 1S7HA 2QTWA 4H4OA 1FKAF 4V19X 3M6VA 4RW9A 1YJTA 2A4NA 2PE8A 2NCKL 2NSBA 2WBRA 4I7FB 4QIFA 2GAHC 2QMXA 5AJ3J 5DETA 1IBKJ 3WC6A 4USHA 5GAGI 3FZBA 3R5CA 2PJ7A 2YNGB 2GJFA 5K9FA 4UFVA 4GM5A 4OMEA 1IR1A 5KFGA 2AYMA 3PB6X 2O1PA 2PMZD 3VCDA 4K4WA 1I6JA 3A1YG 2EXUA 3HHLA 2C3PA 1NK5A 1UFLA 4X64J 2GREA 3HX9A 1M1DA 1KN6A 4O4RA 3M05A 5CZVA 5LRGA 1JIHA 1WOPA 3M9OB 1HHTP 2I0XA 3D6MB 1RAJA 4ZN3A 1WSVA 3CXCR 1M44A 2Q1LA 2M4MA 4KKOA 5CABA 2Z3LA 4M5JA 2JEWA 2DGUA 1SC6A 4ZPTR 3PRBA 3GB0A 2HBYB 1ROFA 1Q78A 1OSCA 2FZCB 1VBZA 3NS7B 1H7WA 5DLGA 2WUUA 4AXVA 2ZUGA 1C4CA 1VLYA 3RTVA 4ECXA 4JD6A 2IFXA 4OC4A 1RT1A 1P6TA 3B3VA 3QGPA 3G6XA 2MLYA 1JXEA 3BSAA 1NRKA 1B0VA 5FJ4A 1X4DA 1QE1A 2PJ5A 3K5NA 2IVMA 4X4NA 2K7JA 1NK8A 1SKWA 1S9EA 3OQ2A 4IK2A 1TMJA 5J2NA 5LM7E 2VFRA 5CQGA 4FZVA 2RILA 1WI8A 5I3UB 2XYHB 2EFNA 1TKJA 4NXNJ 1JK9B 4S0MA 3G6ES 1JLFB 2PSWA 3HZEA 4U67Q 1RBOB 2G0JA 3MMCB 1RTHB 2GIRA 1HNWJ 4FXWA 2RQCA 2BKPA 4FKXA 4CAWA 5DS0A 4NLGA 3HPOA 5I42B 3AHPA 3SJFA 5CYMB 2DR9A 3BJ8A 2N4CA 3PZJA 2C3UA 3NAHA 4ZIWA 1T0TV 4WIQA 4O0IA 4DSIA 4PAAA 1BQNA 3DI6B 5U47A 3IG1A 4MKBA 4UT4A 3IR5B 3TARA 4FBTA 5F8MA 4C11B 1IU8A 4CNZA 1NB2A 4P73A 4P2FA 2R7TA 3DFEA 4PWWA 3S6EA 1XR6A 4XTTA 1W7WA 3S6KA 3BHXA 5B0BA 2B4BA 3OFHA 4C0OC 3JSBA 3N6MA 1T9XA 4B5PA 1XR7A 2LKZA 4J9RA 2W1BA 1L5UA 1EP4B 3TO9A 3GKRA 2PJAA 4Y00A 1VC0A 5AJ3F 1CJTB 1IBKF 4OZ2A 4YGOA 2BJ1A 1S6UA 4F4AA 2B5GA 1UEKA 2M88A 1NK7A 5CBMA 3R97A 3JUWA 3GJRB 1FNOA 3UDVA 4QOTA 1S9FA 1AW0A 3Q2SC 1TKTA 1S1UA 1RT5A 4R25A 1AUGA 3D7HA 2WZ1A 2GFFA 2HQCA 1BLLE 1MN9A 4NLRA 3IFEA 1KR4A 4OAEA 2P2CB 4K30A 4ID8A 4MHPA 4YQWA 1FJ7A 3PYFA 3PVXA 3H42A 4X64F 3QIPB 3DOMB 4NCGB 3BKTA 2EBJA 2QG9B 3ISNC 4R87A 2DGXA 3NH4A 2DGVA 1NPRA 1YZ6A 4ZDNA 4WFZA 2XULA 3IWWA 3CIZA 2YNHB 2VC0A 3DMJA 1NJYA 1YBTA 2DXQA 3FMBA 2YKQA 4CP5A 1U2FA 4R0JA 5ETPA 3DHWC 3MMAB 3VR1A 1PYTB 5DDPC 4MFBB 4A2ZA 2WCXA 3C2PA 2W24A 1WDTA 3UN5A 5JXSA 2FB0A 3EGZA 3P2HA 1M5OC 2FHJA 2KRBA 1FT7A 2F1FA 3OVAA 1EAYC 1K8AT 4V1Ak 5EWGA 1IIDA 4NEYA 3K5MA 3SDEA 2ZC3A 2CNKB 1KTVA 1S1XA 4LT6A 3ZFVA 5L8RC 3RYLA 4IH6A 2X7IA 3A8IA 2RDDA 2GAGC 4B12A 4NXNF 1R6VA 3OW2R 2YX4A 4DPXA 1FK9A 2G1HA 2GHPA 4F4KA 3FX6A 3MUTP 4IFYB 4LF9J 1FDBA 4XO0A 1FEEA 3B82A 3LD2A 2CVIA 4C8YA 1WORA 3VZHA 2DNZA 2P6TA 1VYAA 2OH1A 2H5EA 1S6QB 4JV2A 4K4UA 5IB9A 1J5EJ 3WC2A 4R6TA 1U02A 3L09A 1KQSR 3K7RA 2I00A 4X5KA 4O44B 4LSLB 5AGEA 2FLNA 1S48A 1TK0A 3CJQA 4P6QA 4ZLPA 1RTJA 2DIUA 5DDRC 4IRDA 3J81Y 5AXKA 3JVNA 3HFZB 4ZPVR 1QUVA 3QB8A 4G65A 3I32A 3KLEA 4UZBA 5I4MA 1X60A 3QSIA 3BQ0A 3AOCA 2LXIA 1VQYA 2NPFA 4C7IA 3ET6A 3T6BA 3HKZD 3KG4A 3ZC4A 1UW9A 2NXEA 3GSIA 1PAEX 2HFZA 2ZW6A 1KVJA 2V8PA 1SC1B 3Q8PB 3MCMA 2L9WA 3MR6A 3UNGC 1YGHA 4MXUA 3R95A 2FGCA 5D0EA 3ILOA 2J0XA 2LXFA 4A8QA 1AT1B 3MM9B 4F0MA 3I9SA 4KBIA 2NXUA 3K58A 1VHOA 5SUHA 1TKZB 3CDWA 3MAAB 1DTDA 3FVLA 5GAHU 2JBKA 1NEEA 1VQ7S 2HLTA 2ACYA 3TVYA 2EKNA 1R7IA 1HNVB 2ZW5A 1OPZA 2ZBCA 1HD1A 2RRAA 1UPMB 4UY85 3AFGA 4PXDA 5DQHA 2OTJS 3MAHA 1FE4A 2PC6A 3BI0A 2EK6A 4KAIA 2DEJA 2UVWA 1ITPA 3HFKA 4J9SA 3A3NB 3JYTA 1CS4B 3FVYA 2YNCA 1T9VA 1U7LA 2B9EA 3V6HA 4LMZA 3FJ2A 2AF6A 1XBUA 1N5YA 3OVSA 4A46A 2V4JA 4ZVQB 4ZI6A 2LDIA 3BR8A 4U8YA 4L75A 1GXUA 2EC0A 2YKAA 4Y3CA 1I5OB 1MWZA 3Q2TC 1F3FA 4E8OA 4ZCIA 1JLCB 1RKIA 2XMAA 5JMNA 1P27B 3KASA 2A2DA 5JVHQ 1S99A 1WWHA 2F40A 5HANA 4CYUB 2FTRA 4OC5A 2ABYA 1UZDA 3IAM9 3FNCA 2N7CA 5HXDA 4C2XA 1VK3A 2ASLA 2IRXA 4OI1A 4E2AA 3X3UA 3DLGA 3B3TA 4QWAA 1UWBB 3BYPA 1FFSB 3EGNA 3R3TA 1HBUB 2VQEJ 3WIVA 2Q4VA 2CQ3A 1NKCA 4B02A 1SJQA 2CIMA 1C0UA 2HIYA 3PP9A 4KHMA 1UA0A 3LP1A 2YH0A 3R5DA 4ZY2A 2ROPA 3AOAA 4PYDA 1K9MT 4CO0A 4ICLB 2MQMA 2HHPA 5KTQA 1WF0A 3KJFB 4RO0A 2D41A 3K8WA 1KLMA 4HH1A 3RRGA 4JWPA 2FZGB 1HBOB 4K4ZA 2EBEA 4CPAA 3HI9A 2YNEA 3G2XA 5IC4B 1RABB 3W1YC 2VA3A 2EVNA 4B11A 1KSPA 3TEGA 2JEGA 1YRUA 1RT2B 3THTA 3LH2S 4QR0A 1WSRA 2IY5B 2FC9A 2H5JB 1R8BA 4PKDB 8CPAA 4O3SA 4I6YA 2Q4YA 3OXGA 2ZH7A 2IM2A 5KAKA 5A6WA 1JLGA 2D9PA 3ZZIA 1DRZA 2UXCJ 2JLFA 2OUGA 4RNFA 3OR1B 3PX4A 3C15A 2RDJA 2AW0A 4M5IA 2C2DA 2W2MP 2IM1A 1YWXA 3IR6B 3ZTSA 2X1AA 2DGWA 3MM6B 1HBNA 3V4IB 1XERA 2ARHA 3PY8A 3EYZA 4NYPA 5EBVA 1D9AA 1IBLJ 1T02A 2P6SA 4QVTA 4Q7AA 1JLAA 2OPQA 3CMAS 3GYGA 4A8KA 4NF1A 1TVRA 1O5JA 3EE3A 2VXKA 1MJ9A 2Z57B 3CF5Q 1UJ6A 4C3MA 4DUZJ 1U2CA 4CYQA 2NYQA 1HPZB 3G96A 4CO5A 5LMNJ 2HQIA 2C2KB 4MMOA 4C97A 4WFNQ 3M8PA 4H89A 4RBVA 2RQKA 3I82A 2I38A 2XY7A 3W5ZA 3I5CA 2BABA 2HK3A 4C2YA 5H9EK 2IAJB 3R6GB 2VG7A 4MCQA 2O01C 4LUBA 2ZELA 1OO0B 2W7PA 3MCNA 1XK8A 3CMQA 4UFWA 1GMWD 3NNHA 2AHOB 3TTHA 4LR9A 3L95X 1FVQA 2ZD1B 2DNNA 4K5RA 5KFEA 2YNFB 3OL9A 2UUBF 3TJ8A 1HQEB 2JZ5A 5DQGA 4DUKA 3KDNA 4ZYQA 1FWLA 2RIJA 2M52A 2CZVC 2MKKA 3RNZA 3H25A 2Z2LA 2NSMA 6AT1B 5FDLB 2YWEA 2NSCA 3A8KA 5HLFB 1IUJA 3J7Z5 4UOHA 2VHGA 1FFGB 2VQEF 3NLCA 1VQ5S 2BZ2A 3RAMA 2BJ8A 4LF6J 1VRTB 2QEXS 4PCQA 4GVBA 4CM0A 4F8ZA 1CULB 3D3SA 2CDQA 2HQYA 5KTAA 1UKUA 4O0NA 4ZCMA 2CPHA 1C0TA 1T95A 3J7A1 4I69A 3U7JA 1FKOA 2F4FA 1SQGA 3D4UA 1S7NA 1K0TA 4WFXA 5AXMA 3CC4S 5B0GA 3R8YA 3S9LA 3GCXP 4FUUA 1U6FA 1CJWA 1S7IA 1RDRA 3CD5A 1DLOB 4LVOP 1NSLA 3KOAA 4LX9A 3S9NA 1TL4A 2ASJA 3PCOB 1RAEB 4ZVPB 3R9EA 3SI1A 4RX6A 4DR4J 2RUSA 3DLKA 4DL4A 1M5KC 2HRYA 3B4DA 1X9SA 5E2QA 2BUNA 1MU2A 2BO9A 4AL7A 1SKSA 2VQYA 1YQEA 1J4JA 4FYWB 2ZEEA 2E5LF 4KOTA 1Q2DA 4HACB 1JLBB 3GWCA 1ELMP 3DLLQ 1NSKL 1T3NA 3E3XA 3IN5A 1NZ8A 3HVAA 3KYLA 4ED7A 4ERDA 3GYNA 3BKFA 5DM7Q 4BBHA 1TL3B 4IG3A 1UCNA 2BA9A 1GAOA 5JH9A 3AH6A 2BQRA 3JTOA 1AFIA 2J5AA 4G1QB 3L2NA 3QT8A 3SYZA 1ZS6A 5F47A 4RUCA 1IBLF 2NXNA 2FLPA 5GAGU 5A8RA 4EYIB 3SEOA 1NZAA 4N56A 4Q2MA 1V9OA 5AG6A 1U45A 2UUWA 1J5OA 3DGPB 3CD7A 3CJ2A 2HHHJ 4OLOA 1KUYA 2HGLA 4KZTA 4DUZF 4WBFA 3KK3A 3DDIA 1PU9A 2EBGA 4HPSA 3N6LA 2FY8A 2P6GA 4NXYA 5LMNF 3GZ7A 1JKHA 4MKYA 2DYAA 2V0NA 4YY3J 3QLHA 3PRTA 3L4BC 4R3LA 4LRFA 4TQRA 2Q51A 3PM9A 1Y5NB 4OI2A 4DCOB 3NNAA 1S1TA 4DOZA 4M5LA 3K5PA 4P71A 5AE2A 2J9DE 1S7KA 3GYAA 4NASA 3FMWA 1EJ7L 3TVKA 4DPUA 1FTCA 4TXSA 3N01A 3HULA 4Q0BA 3RAQA 2XI3A 2G0IA 1LAPA 3H2UB 4DUYJ 1U24A 3R5GA 4DPTA 3M8ZA 3TZYA 5IQ6A 3DOLB 2MDAA 1VQSA 1N54B 3MM7A 4Q43A 4LUAA 1KFSA 5HMXA 2W7AA 4TKTA 2RT3A 1SJRA 3QATA 5DJBA 1XBWA 2FJWA 4X2BA 1Q7LB 3J7YU 3BDEA 4ECVA 1U6MA 4PXEA 1T11A 4J9VA 2YGWA 4MK8A 3M8SA 1XC9A 3PEIA 2ATRA 1YW6A 2YWWA 3NAIA 2GHWA 4DG1A 3KZWA 4OHWA 4WFBQ 2X3GA 4UW2A 3CXSA 3H4QA 1X10A 3EVOA 1UA1A 3CE8A 2GE3A 4IG0A 4LR7A 4KOWA 1ZYQA 2O5DA 4OL8A 5KG1A 3KLFA 1EZZB 4NLPA 4R76A 4ZY0A 4RW7B 3IBWA 1UJ5A 2JC0A 4H2KA 3D0IE 1Y7PA 2F63A 4LRCA 3WR7A 2MSTA 1QY7A 1YGYA 3KXDA 1NJXA 2F9DA 2YNIA 5DG9A 1NB7A 3T9NA 2M0GB 3CB4A 1F2OA 1W25A 4DR4F 3OLBA 4K4SA 5K20B 4DV2J 4WU2A 4DF4A 4LF7F 4EZ9A 1JB0C 3OXFA 4W4MA 1LEOA 2PJ4A 1HNIA 4AL5A 2YKOA 3U1LA 2GJ2A 4UFXA 2H1YA 4RW6A 3MPUB 2OTLS 2RHQB 4DR7F 4C8ZA 3H90A 4LRDA 3HSDA 1MNEA 4ZIVA 2JOQA 3R1HA 2ZVSA 5KTCA 1REVA 1S76D 5E41A 1QSMA 1FXLA 4ZPAA 4C8OA 1TKFA 5A2QY 3NGTA 2Y1JA 2EC2A 2BL1A 5KG6A 1Y0YA 1YK9A 4NZ7A 1XQIA 4FBEA 5HP1B 1BC6A 4JI5J 1P1TA 2RQ4A 4KPCA 1YSJA 3C26A 4TU8A 5J2QA 5EUHA 4ECWA 3PX6A 3R7NB 2PDAA 3P49B 1XFOA 1OQ3A 3M9NB 4DXLA 2HYIB 2C2RA 5D3GA 2ZE2A 1Y5LB 3D6HB 3SXLA 2BJ7A 2R7VA 1VHSA 3OFEA 3H8EA 3GJTB 2AKWB 4M6IA 1X4CA 2BXJA 1OQ6A 4OYIA 5THWA 3SXNA 1LWFB 3PO4A 4FS1A 3UVJA 5FD1A 3KK2A 4ANDA 4YY3F 3SHPA 2V77A 4M3SA 3VVUA 2D4OA 2KL8A 5IWAJ 1IKVA 4ZHRB 3MN8A 1N5TA 1QE1B 4Y2IA 5EHHA 2DEIA 2EFGA 1YLOA 4NGNA 2ZHAA 1Q2CA 3HHLD 5ETTA 5KFAA 5J2NB 3V6DA 2J8SA 1T03A 5EN1A 4H6ZA 2FVGA 3I4HX 5A8WB 4DUYF 1B7FA 4UA3A 1YRTA 2KN4A 2WSAA 3I3GA 4NPOA 3M8QB 3IBCB 4FNIA 1JX4A 4O3PA 3T3FA 4WWVA 2CTBA 4LVNP 2J9EA 1VISA 1W2BR 4DJBA 3KQXA 2VL1A 1QVGR 4FF3A 1BWVA 3QMQA 1NMTA 4KLVA 4RU2A 3G87A 2FJVA 3SI8A 4NYZA 4PPDA 2XEJA 4CH1A 2O4HA 2E5HA 4LR8A 3JB9k 3B3SA 4FD4A 4GRSA 2HMIA 4RNOA 2V8GA 3P45B 4HVZA 4KV8A 3ISXA 5B0AA 4A47A 4M85A 3CUNA 4YRHA 1B3TA 9RUBA 3PO5A 3P3DA 5IX3A 3T5JA 7CPAA 3UDEA 1RWXB 1D8ZA 4OZNA 4B5PB 4ZLJA 2OPRB 3LOUA 5KT3A 4I4BA 2MQPA 4KSAA 2NXCA 1XNRJ 5KG5A 2Q04A 3AJDA 3NEKA 3SJGA 2OO4A 4MFQA 5F3ZA 1CVJA 3D68A 5KFFA 4IYQA 3PNIA 1M1GA 3PJ9A 4ENOA 2WW8A 1S57A 1JXVA 3D9BA 4N41A 2PJ9A 4O3OA 3HVWA 5ETLA 2W2OP 5CCMA 3F5BA 2DO4A 1X0FA 1WG1A 2OPSB 4UQTA 1X4AA 1RT5B 2FVRA 1H2VZ 1PSDA 1N0UA 5K8NA 2DPIA 1X7VA 1N36F 5LSLA 3O5TB 3CCVS 3KR4A 4MKVA 4JI5F 2HK2A 2KDOA 3OUYA 2CXEA 2ALYB 2FQQB 2KG0A 4PWDA 5A8KA 4OJ3A 1XEZA 2XB2D 3IC1A 3BI1A 1MROB 2Q43A 4KGXB 2AFWA 2DGSA 1PBUA 3SJXA 4F04B 2ZW4A 3VWSA 3C8YA 1VQMS 4IDKB 4C7QA 5F09A 2CQHA 3GMGA 3M1VB 2J7KA 4NJRA 5CYQB 3D54A 3K9UA 5D15A 1LWCA 2ZNYA 3FB3A 2UU9J 2CXAA 3N79A 3NH8A 3T41A 3D66A 3NH5A 3ENQA 4PR6A 3T5HA 3CCQS 2DBBA 4I67A 5IWAF 4M5MA 3MEDA 2DKOB 2D74B 1FA0A 2ACMA 2ADCA 2ZEMA 4CIOA 3FUYA 2EWBA 4PQUA 3CDEA 2DH7A 4FNHA 1FCAA 3I9ZA 1KDNA 4M5DA 3TOBA 1Y5IB 3KDOA 4USMA 3W62A 3KJVA 3BGRB 4PXCA 1BOBA 2Z0GA 2RB7A 3PG9A 3Q24A 1YTYA 3GCWP 5LYLA 3AY0A 3DSBA 3ITHB 5HO4A 3NNCA 4A38A 4U5YA 1IKXB 3FDSA 4Z65A 2KCWA 5D0RA 1N6QB 4HHUA 2VC1A 1RADB 4DR5J 1U6BA 4YS2A 3OTBA 2IL4A 3FEDA 5IZHA 2LA6A 2JVOA 4AG7A 4ZKAA 2Y1IA 2YNGA 3PB7X 4OV1A 2Z3PA 1DAXA 4OYMA 5KFTA 3IS9B 1FDAA 1B99A 1LK7A 2FHJD 1U1LA 1X4BA 5M2UA 3SFGA 4L89A 4CO3A 2VZ9A 2BACA 3M9MB 4UUXA 3KI9A 3MR5A 2GCFA 3PV8A 1SV5B 4ONWA 1DJ0A 1N5QA 1G6BA 3WX4A 3DXBA 5C2CA 4EBEA 2PC1A 3MEKA 2WPXA 5E3QA 4ZJQA 4PYAA 1CQMA 1XNRF 1JQGA 2YH1A 3EGWB 3V2UC 5FLXY 3AD9C 3TQEA 1H72C 1BY9A 1P0HA 2FIUA 3HM9A 4UEFA 4B3MJ 1T9UA 2AYEA 2PJ1A 2HBQB 2C28A 4ONUA 2ZPAA 1LQ9A 3GQCA 2VZYA 1YI2S 4UOCA 1CEZA 2MKIA 2QYVA 4F0XA 4DV0J 2JSXA 2BYCA 1RHUB 4A95A 2V9WA 2CQ1A 4UCPA 2ZWPA 1VQ8S 4KJIA 3G6VA 2R8KA 3PXGa 1RYSA 2OIHA 3R6LB 3X1LB 1MMDA 1NPKA 1MW7A 2EVZA 1V3RA 2AJ1A 1BD6A 1NDLA 3QT6A 2WVEA 2CJXB 1YBUA 1R8HA 2PCUA 1HQUB 4F4WA 4E0AA 2VH7A 2IBKA 1Y7RA 4A8XA 5I3UA 1TMMA 1KLNA 4FYVB 3D7FA 1RUSA 4UOGA 2VPYB 1OY8A 3VWDA 3I5AA 1DY3A 3MHYA 2U1AA 3P96A 2CWKA 3SXOA 1PIEA 3MMCA 1RTHA 4CAEA 2JJ4D 5L46A 2PRBA 3CVKA 2BCOA 3DM2A 2AYBA 2Y1RI 1H2TZ 1CBXA 4O4GB 2ZVIA 3IEHA 3TT2A 3F56A 1SCJB 2CNTA 4A8YA 1HNZJ 1FNMA 4G3IA 3OTCA 3UQSA 2OPPB 1PILA 1UVJA 3W60A 3DI6A 3TOAA 2AMCB 3VALA 1URNA 2JL9A 3TOQA 4C11A 3CDAA 4IH5A 1UWAA 2AEFA 3NE7A 2LECA 1N56A 4QW9A 3K8VA 2B9WA 3QO9B 2C2MB 3D7DA 2MLXA 4ZK7M 4Q8FA 2MPUA 2QZ8A 2RC4A 2LP4A 4WXWA 1EP4A 3LAKA 3BGUA 1WOOA 4KO0B 1HI1A 3KUGA 4DR5F 4MCSA 1CJTA 3P5TL 2P9CA 3VAMA 2JC1A 3OR2A 1RWNB 4NLWA 2LQJA 3ETMA 3LWUA 4OIXA 1J27A 4K5SA 1TFYA 1KLMB 2NUUG 1R27B 3ZZ0A 2HAFA 4I2QB 2QMWA 2VBXA 1PG5B 2B4PA 3BO3A 4JUZA 4MAKA 4NGMA 4U8VA 1Q8BA 1S4EA 4OC2A 3VQSA 1NK0A 2OHDA 4NLXA 2OELA 1IJEB 4Z7CA 3QIPA 2MKCA 3BGLA 3DOMA 4L6V3 5DGAA 1Q4RA 3VARA 4QWDA 3I55S 2BEFA 3HDSA 2UUAJ 3MEGB 3PW5A 4KS9A 2YPZA 1IR2A 3M4XA 2L08A 2YNHA 4ZLNA 3BB5A 3AQOA 4USJC 2DNRA 3CPXA 2OFHX 3MMAA 1PYTA 4NLOA 2FJAB 1VQNS 4MFBA 2CQGA 2XCPA 5HMYA 3CCRS 4TU7A 2PJBA 3GY9A 4DV0F 2AV5A 1JLAB 4H4MB 2XCAA 4MK9A 3ULHA 1XF8A 3BH6B 1O51A 4KFBB 4C0HA 2V4QA 5KFNA 3JSRA 1TL7B 5J1NA 3NGKA 5EWFA 2P8IA 2PIIA 2G2ZA 4MIAA 4XAKA 1X9MA 2I2YA 3L3CA 1M5HA 1X5SA 1X4FA 4LF5J 4DFJA 3M2UB 4IFYA 4EFDA 2XQCA 3AXMA 5CXTA 2FHMA 2VU5A 4EO8A 3MD1A 2CY2A 2QLXA 2Y9HA 3CJTA 2APOA 1S6QA 1RTZA 1MMNA 3KLGB 1K1QA 2OMLA 2YBVA 2BRLA 5CHCB 3CCJS 1CPSA 4O44A 5G21A 4R8UB 4EEYA 4LSLA 2BRKA 1E6VB 1FHTA 2HHWA 1V0CA 1VQPS 3CD6S 2QMUB 1M4LA 1FESA 1ZG9A 3BEGB 2G2OA 2GMJA 2DNHA 2EG2A 2VODA 4DX6A 5ETRA 3D1HA 2G0BA 1Z8XA 3P4UB 1W2IA 4GKJJ 1X9WA 1C0TB 4FP9A 1KQGB 3TO7A 2JWNA 1U0SA 3M6UA 2GLJA 1M1KT 1HL6A 1NNDA 2D3O1 3PFEA 1TFWA 1M5PC 2MY8A 2HBRB 1O0PA 3CCTA 2ZH2A 3MM9A 1QLNA 3DLBA 3W65A 4J9QA 3GFZA 2YKMB 4WYLA 1TKZA 1P9YA 3MAAA 2CZ4A 4B9TA 3NL0A 3QRQA 1RWWB 1Q8LA 1GXLA 2BANA 3MCOA 3SJEA 4JI0F 3DLKB 2MMYA 3LMSA 1ULRA 3V7ZA 1F5CA 1QAIA 2CPXA 3FEEA 3PTWA 4LJMA 1HNVA 1NCLA 2CTCA 4KYZA 2KXHA 3TANA 1WWZA 2AGQA 3N9UC 1YJRA 4CYNA 2UUAF 1DZ5A 4U9ZA 1H2UX 4NXMJ 1CC8A 1RXOB 3IWGA 3THPA 5E96A 1CS4A 2KU7A 4W9YA 3DCAA 3MUVP 2ZEFA 1YREA 2ASDA 3BSNA 1UTAA 3E01B 4ED4A 3VAFA 1NU4A 1U25A 2UUCJ 4XPDB 4OHZA 4TVAB 5A8RB 4L3KA 3J81U 2HVZA 1JLCA 1X12A 1FXDA 2BM0A 4WWSA 4OYPA 3PB4X 2G0CA 1VHFA 2WAQD 2ZH6A 1FKPB 4CYUA 3K5OA 2HSEB 2R4FA 3CJ4A 4LF8F 4B9UA 5IFMA 3KK3B 4X66J 1UWBA 4B3SJ 1HBUA 1V5IB 1NAQA 3MTJA 1RHQB 1DQAA 1L3TA 4ZPWR 3TUJC 1XEBA 1VJQA 4Z7YA 3BZQA 3HZGA 3CD0A 1RT4B 3I5BA 2YX1A 3AJ1A 3H8GA 4MFLA 1SJ3P 3DNCA 1VQKS 2Q7SA 4M8LA 3G8TA 4OADA 2ABZA 2MTLA 5L1JA 3RR7A 2FJBB 1ELOA 3CEDA 1EQ0A 1H98A 1HBOA 2ZJRQ 4DV4F 4KPYA 1RU2A 2O28A 4ZBGA 1WHYA 3D67A 1VMBA 4NE9C 1QSTA 4RZRA 5LJ5Y 5AXNA 3CO9A 1L3UA 4QPTA 4MHYA 3NA6A 1RT2A 2Z2YB 3G8WA 5KOWA 3KHHA 3C16B 4UTGA 3RJMB 3D2PA 2O3DA 3V6KA 2V63A 1WELA 4DL5A 2XI2A 5F8NA 1U1KA 5GAHI 2QIRA 3ILLA 4J7CA 1TKXB 1ZLHA 4DG1B 2DCLA 1ARMA 3OR1A 1ZTWA 2KT3A 2EUIA 4GVLA 2JBJA 2C3YA 4B9VA 1YZ7A 1OWXA 5KG7A 4LBHA 4R3KA 2GX8A 1ZOTA 1Q5VA 2QV6A 3V4IA 4YDXA 2XMWA 2HWHA 1IXKA 2RRNA 3K9TA 4HI1A 4WK1A 4XPEA 2NXJA 4KHPJ 1HNXJ 3HHDA 3KKFA 5HBMB 4MHNA 2QRRA 4OJGA 1KVIA 4AD6A 2EEYA 3IO1A 3W6SA 2Q7BA 3NMRA 2YKPA 3J80Y 1HPZA 5HATA 5CA5A 4EYHB 1SH3A 4NXMF 2RDIA 1X4EA 3OL7A 2LEBA 1TK8A 3TUIC 3T8WA 4KGKA 3A8EA 1RHMB 1REVB 2IJZA 4FPIA 5AE3A 1FWPA 3PHTA 4R5PB 2PJ2A 3IWNC 2LXUA 2GVDB 4U9YA 2MHEA 3V5RA 2IAJA 4B9NA 3OJSA 4YFUA 1H8LA 3CO0P 3CJKB 1HYSB 1LXJA 2WTFA 2UUCF 4CZCA 3ISND 3KLIB 1RA6A 2P9EA 2FIWA 4M6GA 3N5FA 4D3HA 3AA8A 1WNEA 3PKYA 2MZRA 4GKKJ 3WHIA 2ZD1A 4FD5A 1V3SA 2YNFA 5DDQC 5JM6A 3A9LA 1HQEA 4YHHJ 5SZTA 1ZPVA 2ILYA 1T94A 4CGNA 2HPUA 1U0HB 1V5VA 3WDOA 1CX8A 1FJGJ 2GQQA 4QQBA 5K5MA 5HLFA 4B3SF 3H59A 4PABA 3OLAA 4P2MA 3DU5A 5HH1A 4DQQA 4ECQA 3V38A 1RT3B 3FKBA 1K1SA 4UY8T 1L3SA 1UWYA 2ZM6F 1SVDA 2VFSA 3ENWA 4C8NA 1CULA 2E7XA 3BS9A 4J90A 4NCZA 4DV1J 1XN9A 2HHSA 2IRYA 3JRUA 2CUYA 1FEHA 4PK2A 3HSZA 4U7CA 4UWJA 4WJBA 4F0YA 4DV5F 5EMIA 3H4DA 1XMQF 2R3VA 3NS6A 4ORFA 3PBBA 4YR3A 1DLOA 2K7KA 3RO0A 1X4GA 2CAJA 4C4WA 1Y4ZB 5HK4A 1F1BB 4HKFA 1SUQA 2W7OA 3EGVA 3GTYX 2LLZA 4FXVA 3TEHB 4KVXA 2IMOA 4G1PA 1S1VA 2JVRA 4J91A 2W8KA 2XMVA 2DR7A 1CPZA 3DRSB 2J6SA 1K0VA 2R7WA 3EICA 3PIPQ 4HACA 1JLBA 2V67A 4JYAJ 2REFA 2QO3A 4KH1B 1P8GA 2KI2A 1DHMA 2POKA 2ZZNA 1IY7A 4ILLA 4UBRA 1TL3A 2DITA 1RTQA 4PXBA 3DR6A 2HS0A 1SJFA 4A30A 4LRBA 3SZ2A 3CC7S 3FRMA 2K1RB 4OX9F 1N4LA 4CO4A 4DNCA 1GMVA 4MFPA 1YW4A 1RCXB 2HWTA 5DO2A 3LA0A 4DR1J 2W2NP 3DKDA 2NMTA 2SXLA 4FN5A 3MI7X 4F4XA 1GTEA 1X5TA 1U1MA 1NH7A 4TQSA 2IJFA 2YKNB 1AB8A 4DR6J 2GO8A 2Z3KA 1A0OB 2KVIA 3JSYA 1HNXF 1F3VA 3FRZA 1S0NA 3FEXB 2FLLA 4OMFG 4KOUA 4JJXA 3MPDA 2HEKA 1B70B 3CPWR 3VAKA 4CLWA 3W9IA 4UF4A 4W90B 3TC8A 2ZZMA 3PRVA 1B6BA 3O44A 1N88A 3UI3A 4LFCF 4A8MP 2VBWA 1UEUA 3VGUA 5IT4A 1HWUA 1LWXA 4IO1A 3KNGA 2VA2A 1WF1A 3R1KA 2AFOA 2G4BA 1SL2A 4RL1A 1ZM4A 2OOTA 1RT6B 5GMKa 3KK1B 4DFKA 3T19A 2KFYA 5BJRA 3D3CJ 2HVIA 2DY9A 3TJAA 1FF2A 1ZZNA 4ED1A 4AXIA 2FHOB 3MPVA 4L3NA 2E9ZA 4P2XA 1HFEL 2FC8A 4M5KA 4G6VB 2HNYB 5J1QA 1YQHA 4RS2A 1FJGF 3QFHA 3O8WA 1XMOJ 2J7UA 2F4VF 2PA3A 1LXNA 1VIOA 4XIUA 3IU2A 1YVFA 4CO1A 1D0EA 4QU7A 2HW3A 4K2XA 4IRKA 1Q7LA 3W5XA 2M3DA 3TYTA 2RRBA 3ZZTA 5LYFA 4HKQA 1HHQA 4XDCA 4CT9A 4X2TA 1FRMA 3AD8C 1OBRA 2QL7B 2QJ8A 2V8HA 1P1LA 2R7XA 1OIAA 3KLVA 1V6HA 4X4UA 1N32J 2HIQA 7FD1A 1HI8A 4CRZB 5F3TA 3MWBA 3C66A 1S59A 4RW7A 4ZX8A 1UMJA 1QMUA 2H51B 3A12A 4HH0A 3H2VE 3FGVA 1XJWB 3ILIA 4TNOA 1X0PA 2FSRA 3ADAC 2DO0A 4QZVB 1TF9A 4XPLA 1Q0NA 4CLFA 3BO4A 3KGQA 3TAMB 1MG7A 4ZVSB 4B13A 1NUEA 1Q5YA 5LXYA 2O53A 5A0YB 2GZOA 2PDOA 4B10A 4MT1A 4KGVB 3J7ZT 5G0RA 1KTQA 1HQ2A 4ZJLA 4CYPA 5ELYA 4P9SA 2Q6BA 2EK1A 2CNLB 2B4OA 5HROB 2JDDA 2B9YA 3GONA 4QB9A 2R98A 4IOAQ 4MYTA 1TQLA 3FSXA 4LFBJ 4IKAA 3ZZRA 1LNQA 4CLKA 1U1QA 2PRQA 3GIRA 4CLTA 4J9PA 4P7TA 4P10A 2VONA 4KVME 5LSOA 4JI6F 1F9HA 4DSEA 2B3VA 1ZTTA 5B08A 3B54A 4RUAA 2DD8S 2JRSA 3POTA 2AJ4A 4YU9A 2W9BB 3L7UA 5HP1A 1F2GA 3N6NA 3P6YC 1RU1A 2V8VA 2KKHA 3IJ3A 2CQ0A 1BXNA 3BN7A 5GMEA 3CJ8A 4R7MA 1NBEB 5EWEA 1VOMA 2M7SA 5GMDA 3DU6A 4MJ8A 3LWMA 3TVZA 4NZ6A 4X62J 2IYGA 2DRAA 4WU3A 2F8HA 4OX7A 4EU0A 3M7VA 2BJEA 4P44A 1W26A 1FRHA 5HI7A 5AG5A 1S6OA 2X1FA 2LU2A 1HDUA 3IRXB 1LWFA 3FCHA 4DPOA 2F7VA 2AEJA 2RD5C 1LW0B 2KZMA 4N7TA 2DH8A 3BBFA 2W25A 4USKA 7FDRA 4LBPA 1FRKA 1TU0B 4ZHRA 4UCNA 5D29A 3HSGA 2L9NA 4PG5A 4FAIA 1WD6A 4DV6J 1N8RT 3J7YI 3MEEB 3KHXA 3T1YF 1CC7A 4CH0S 1FJEB 1EIYB 2FDNA 2GA7A 4BMHA 5A8WA 1MWYA 2PR8A 1PBAA 2HNDB 3L9ZA 2HHTA 5CAAA 2FLOA 3M8QA 1QSRA 2QX0A 1Z8LA 3S1TA 4EMEA 2VDHA 3DXSX 2HZCA 2GW8A 1RKJA 1VQ4S 1RA7A 1N48A 3TJ9A 2DK2A 3DM2B 4OJ1A 4HDHA 1GEHA 3EJMA 2HNZB 3FK4A 1RAHB 3C6TB 3HKWA 1YJ7A 4EWTA 3P5BP 3ISZA 2CG4A 4DYOA 1FX4A 5A2QU 1Q82T 1RP5A 5KT5A 4Q44A 3EDRB 1JJ2R 1N32F 2WZNA 2OMOA 3NOGA 1LK5A 2UXBF 3TZZA 2J6UA 3VGSA 3W7BA 5D0GA 2XGQA 1IYLA 3CXQA 2HRUA 2H5IB 2DTJA 8AT1B 2J9DA 3BQ2A 4NLYA 3FEZA 5B0EA 4ECRA 4WFAQ 2OPRA 1KOHA 3KL9A 3FCWA 3S8SA 1KOOA 4N47A 2R2SA 5ETVA 4OX6A 1H73A 3TP2A 3GILA 5F8LA 5G1ZA 1KWMA 4A8OA 2CRLA 3VGTA 4OZJA 1WC6A 1P9QC 5CYJA 1YJVA 3FJUA 3EUNA 3OR2B 1M5SA 2XEGA 3HUVA 2PSZA 4KVOE 4KQZA 4BDPA 2OPSA 2YXLA 4CGLA 5DRKA 4JOUA 4BC9A 3BGFA 4PK3A 4E8UA 3G9CA 3JTPA 3UWTA 3HVRA 2XY5A 4LIWA 2KJVA 2ZBPA 4CO2A 5B0FA 3EPIA 2ODFA 3R9GA 4DI6A 4WP9A 3KWMA 5C24B 3FBUA 4OV6A 4PEOA 4WF9Q 4Z37A 3DN9A 3DYAB 3UDLA 1Y9OA 4OI0A 2V9KA 3ZZOA 2BR0A 3W61A 4YUDA 3EXCX 5EX3A 1MROA 4MCPA 4ZP8A 2C6CA 2P0WA 2I5JB 5KFJA 1VQLS 4NGRA 2WVFA 1UEVA 4X62F 1IN0A 2LYVA 4IDKA 4NLVA 1PJ6A 2PFFB 4ZOSA 3M1VA 3RAXA 2FJXA 5CYQA 2EFOA 1KNZA 4Q5VA 5IOLA 4CH7A 1UAWA 1DTQB 2J0WA 4JXRA 3L7OA 2ZH8A 1I1DA 2ZH4A 4P75A 3OSPA 3W64A 2Z30B 2EFVA 1S0OA 2PVWA 5J1EB 4L74A 2FJEB 4ES3A 1JWQA 2VV5A 2D3ZA 2VFUA 2QA4S 4X8IA 2B4DA 4C7HA 2AQ4A 1NDCA 2KB2A 1WTFA 3ZNUA 3F73A 3ZO7A 3K89A 2HVEA 1ELLP 4DV7J 1NHKL 3MECB 3K5LA 3EC4A 4HI2A 5KFKA 3BDPA 3VAGA 3OTOJ 3BGRA 4NX9A 2WVDA 1FT8A 4XDDA 1IB1E 2QA2A 3ITHA 1HNWF 1IKXA 2VI7A 2XLJA 2WPWA 4Q8EA 1N6QA 3GIUA 1S49A 1DFDA 3WBZA 3FBFA 2AZ3A 3MPWA 4ED5A 5IT0A 4NZ0A 3LW5C 3PYGA 4MBUA 4C48A 2QL5B 2J8MA 4O23A 4QC6A 4GO5X 2KT2A 4BWJA 1OSDA 2LQ5A 3LP0B 3IS9A 2Q0YA 4OKOA 2ALZA 2IQ6A 3NCQA 1H3DA 2N3OA 4KGMA 3JAMY 2AX1A 4RJVA 1NE9A 2LDYA 1IKWB 1RAGB 4DSFA 1SV5A 1FO1A 1PAUB 1Q1KA 1PYOB 5HVHA 1RTIA 2QFJA 2RE1A 4DU8A 4F67A 4M6HA 2DH9A 2GO9A 3EX7B 1U1RA 1R0CB 5KFXA 2GS8A 3K17A 4KT0C 4JI1J 2C3MA 1S0VA 1SQHA 3NWGA 4M5HA 4JLYA 5C7PA 1XNQJ 4TYBA 1ZM3A 5I3PA 5DZ6A 2CNMA 1GH8A 2GVZB 3MUMP 3J81j 1HLWA 5CNPA 4XPCA 2ZNZA 4DL2A 1BPMA 3VAIA 1NHUA 3ELHA 2B3TB 3HP6A 2B43A 2XEIA 2E1PA 5F8GA 4K0KJ 5BYRA 4MY3A 3QPIA 4A4JA 2KH9A 2WRMA 5KFOA 1Q86T 2BANB 5DGBA 2AEMA 1IQTA 4Q36A 1IJFB 4L72B 2Q6CA 1VR6A 3SCJE 1A9NB 4P4JA 4R57A 3W2WA 2B5JB 4DWIA 2HV2A 3CDXA 1UFWA 2CKWA 3TFYA 3QJPA 1ZPWX 4FYXB 1U1OA 4I1TA 4E0DA 1RWKB 1HQUA 2VD3A 4EVYA 4DR2J 3ILJA 3SI2A 3IWLA 4Q38A 3GJSB 4JI2J 3IM8A 5HMZA 1RBAA 3PYDA 3R9LA 4QBUA 1VQ9S 2FD2A 3GR1A 4HTIA 3H0PA 2CPIA 1SC4B 4O3RA 3DRPB 4MHZA 4UEEA 1YX2A 3A3PB 2PQ8A 3PEHA 2R2TA 4N76A 2NLWA 1T05A 2QYCA 4ZVEA 1KQKA 3CCLS 1RTDA 5BYSA 4O4GA 3FYNA 2EK8A 3M6WA 1RAOA 2DPJA 4QIVA 1PUAA 2DISA 2QL9B 1HW8A 2OPPA 5KT2A 2D4PA 2H54B 3GUXA 3SQOP 2CJYB 4LQ9A 2A2CA 4XPKA 5FLXU 4DV7F 4XNHC 3H7HB 4EUVA 2QVPA 4EBCA 4ER8A 1VHEA 4RWWA 2R8GA 1HA1A 5LYIA 1A2ZA 3OTOF 4K50A 2CPJA 2ILZA 3QO9A 2E1RA 2ZUAA 4C6AA 4JI4J 2AX0A 3TZWA 2HWIA 4QUSA 4RI1A 1UVIA 2NPIA 3BH7B 4FXDA 4LF9F 1NK9A 1Y3KA 4QW8A 4JV1A 3MPYA 2W2PP 2FE7A 4KO0A 2QLFB 2FYXA 2BEIA 1YJUA 2E5GA 1FVSA 2RF2B 5G22A 1UP1A 3NFZA 3GIMA 3NCRA 3OPKA 2B58A 3B4MA 1NK6A 2KM8C 1PKUA 1S12A 1J5EF 2ZWOA 2U2FA 2XSFA 2V2KA 3KUHA 3VV2B 4X4SA 4NA1A 4I2QA 4CGMA 1S60A 3GIIA 3H5SA 2DF5A 1BMQB 3F0NA 3IP0A 3DDKA 1HHSA 5HSPA 4KR0B 5HMWA 4IOCQ 4M5NA 3Q8YA 2HS4A 4CTAB 2KO1A 1U8WA 1URRA 2UVRA 3F44A 2Z3NA 1NJIT 3OL8A 4MJKA 3TZXA 3IR7B 2C22A 1RHRB 2BQ3A 2A6OA 1WKLA 3MAQA 1HWKA 3AB4B 2RKIB 2OU2A 4ZGYB 5KOXA 2QT7A 2L41A 3MEGA 1XNQF 2ZEPA 4YEAA 1YR0A 2A3JA 1I51B 1WF2A 2ZOMA 3RGIA 4M94A 1TAQA 5IM0B 3M30B 4EK2A 1YIJS 4K0KF 4KSEB 1S72S 1QSLA 4TYAA 4DS5A 4LREA 2KFNA 2XZDB 3HHKA 1UJ4A 2N7YA 5K8MA 2F65A 2QYGA 3SSSA 1IR0A 2UV8G 4H4MA 1U4BA 2MYFA 3QFWA 2F5IA 3LO3A 4QPXA 4KFBA 2HUZA 5T14A 3B8GA 4P45A 3G82B 2XNQA 1TL7A 3CMES 1FFWB 1KVKA 2C2OB 4CLSA 4C2ZA 2CJAA 4QWBA 3CNQP 4IFVB 3IWEA 4DR2F 1Z1ZA 4OFZA 5LSRA 5DDOC 3IAS9 3G8QA 3PW4A 4F2RA 3R2DJ 5KT4A 4HYKA 3M2UA 2MZ1A 4ECSA 3JTKA 3CTRA 3MMJA 2P5VA 2IIHA 1RHKB 1JWWA 1SQEA 1CP6A 5GADU 1QD1A 1YVKA 3V4MA 4WFYA 5KG3A 2B7BB 4DFPA 4G1IA 4LSNB 3KLGA 3E51A 1X31C 1BUXA 2AP6A 3DR8A 2K8GA 2BBEA 2PR1A 4RNNA 4NA2A 3BGOP 4IRCA 4R8UA 3THVA 1CJUB 4B14A 1E6VA 4KE5A 2WB4A 2R7SA 1MJBA 1QJHA 5ETKA 4NFRA 4KIAA 4Y34A 4QR1A 5CPAA 2FPHX 7AT1B 5DS7A 3I9V9 4L8AA 4FDFA 3W2VB 3AA9A 4ILRA 3GFYA 3TA2A 4JI4F 3ZTOA 4ZPDA 3PB8X 3TE4A 1PC4A 3NRBA 4XK8C 3HT0A 2QE5A 3ZNJ1 1VBYA 3SSRA 4BINA 4B3OB 2VB6A 2RFHA 5F46A 4RUHA 2D69A 1BQMB 2AJQA 5KFBA 1NH8A 2VBYA 3WC0A 4RW8A 2MZSA 3TW0A 3QNWB 4OYOA 1GYTA 1CJVA 1WK4A 2GMHA 2Z56B 4W92B 3D2MA 1XWLA 4NOHA 3RB0A 2YKMA 3CJ5A 1VGYA 2W9CB 1SUQB 2LEAA 4AVBA 3PGPA 4YB1P 1TTHB 2H4YB 1S1VB 4A48A 3V6JA 2RQMA 4F9VA 3LANA 3S6HA 4O3QA 4DZ6A 3R5AA 2E1CA 2C42A 1TF8A 1TKDA 3TO6A 3Q86A 3T1HJ 2HFNA 1JNRB 5CD4A 4B9LA 3E2EA 4HR2A 2IVFB 1WOSA 2CFXA 5E3AA 3W8PA 2UXCF 3QJLA 4ED8A 4NMXA 1CQNA 1EETA 1QAXA 2CIJA 1RAFB 2KRRA 4HT5A 4Z2XA 3UFCX 2JDJA 3E01A 3HO1A 3D1OA 2M8HA 5ITHA 2LFVA 2YQ3A 1SB6A 1TL1A 1WC0A 4RWXA 2EO8A 1S3ZA 4K7QA 5BR8J 3MDFA 1DQ8A 2PIZA 1NPPA 3ZZPA 2GIVA 4PSWA 2GNKA 2LA4A 1VQOS 3OBIA 2J0SD 1FKPA 2FJDB 2JEJA 2QLJB 3Q23A 2XZTB 3QT5A 3C19A 5C25B 4RNMA 2MJNA 2AT1B 2HKEA 3JSMB 1S10A 4PSXA 1WEZA 3LUYA 1B4SA 4OYWA 3OFGA 3IGRA 1KC8T 4EBDA 3MOZA 5KFMA 2HG4A 2ZENA 3TWZA 2AFXA 3RBEA 1Q53A 4QWCA 4P7VA 4HNYB 4YB6A 2PI5A 3LAMA 1RT4A 3UY5A 3GSDA 2I3CA 3NBPB 1XMBA 4X4VA 4ZVOB 2MXYA 1M90T 3O1LA 1DURA 4II9A 1VC6A 5F49A 3W5YA 4KTQA 4NGQA 3EMTA 4I64A 4DS4A 4F3OA 3KNAA 2E1AA 4KH0B 2K06A 3DLEB 2HGNA 1F9FA 3UE2A 2I79A 1FTRA 1R43A 3RYOA 3Q0AA 4YDDB 2HAIA 1ACMB 4P4EA 1GX5A 3LP2B 2IHR1 4TY8B 1LW2B 4LF6F 5KFSA 1XTZA 2KYZA 3C16A 4DSJA 2CF4A 1R0AB 5KFWA 3MOJB 3BQ1A 3P2FA 2DNKA 2G2YA 4OIWA 2HVHA 3M2VB 4KY3A 1F2HA 1TKXA 4I49A 4NLTA 1DTTB 4J9UE 2KXNB 4I6WA 2QJ3A 5ETSA 1C1CB 2HQFA 3CGIA 2LU1A 4U7UD 2XMUA 1HWJA 5EDWA 3ZZYA 5IS2A 4K3NA 2FZKB 1O6XA 3KG1A 4NEZA 3GIJA 2X3DA 4URGA 1AZSB 4CGOA 2CJKA 3TAQA 4DL3A 3VH9A 3OVBA 2JHEA 4ED3A 2W01A 4NJQA 1GT8A 2XMJA 4ZCKA 4A31A 3N5BA 2GGPB 1LRZA 1U2RA 1TKHA 5HN0A 3K57A 4ZVHA 5LL6d 1R8PA 1LOUA 5HBMA 5KFYA 3ENVA 3G3SA 4X4OA 4X4RA 1QAJA 5E33A 5G0RB 4ELTA 2DR6A 3T1HF 5BXIA 4QU6A 2BW2A 1YG0A 3VATA 3G71S 3BF4A 3SQGB 3CT9A 1UVNA 5K8OA 3UR3C 4KOXA 4FKYA 4WCEQ 1R8AA 2D9OA 5E7OB 2HVDA 2AGOA 1LWEB 4RNHA 1R57A 2PT0A 1J2VA 2R7OA 2C6PA 3CCSS 4R5PA 4NI2B 1VIXA 2GVDA 3FNNA 2ZW7A 4UUWA 4ZPCA 5A28A 3POTB 5KFQA 1KKHA 3CJKA 1HYSA 3KJQB 1QTMA 5BR8F 3KLIA 4D3GA 4OHYA 3A4TA 4U6PA 4ZJOA 3M8WA 1RAAB 1SIWB 1SL1A 1MWQA 3LGMA 4DF8A 1H6KX 1S7LA 3B35A 4FYYB 4CAFA 4OZ1A 2HHHF 3BM7A 1RISA 2BSWA 2B8PA 2V2QA 1U0HA 2KJWA 3HHNB 1BQXA 4TY9A 1Q81T 4F7VA 2X1GA 3OFFA 1RT3A 3BLNA 4F36A 3LQVA 3SMZA 1VI7A 3BJ7A 2Q4ZA 3OSNA 3CJ3A 4YFJA 3K2YA 4A8SA 3C14B 1R31A 4AL6A 4RW4B 2GQ2A 2CA9A 2JH3A 2NQPA 4NYOA 4F0KA 4RR5A 3H5XA 5KG4A 1SH0A 3PW2A 1G7CB 1YLEA 1S5ZA 3MD3A 4JXQA 2VPXB 3MZIA 1T7PA 3CW2C 3J80U 3VZIA 5IXUA 4YP3A 3D2WA 2I6WA 4DMZA 2V8DA 3KUEA 3H8YA 2LQ9A 2Z4PA 2X1BA 3EVWA 3SIPB 1TUWA 1IOFA 5F48A 2ZEOA 5B0DA 8RUCA 3DRSA 3MGDA 2ZH9A 2LMIA 3V8IA 2UZAA 4NRUA 2MQQA 3GV7B 4MCRA 3QZ8A 1HMVA 2XBPA 1SJ4P 3PR5B 4NEXA 1IGBA 2CQCA 4U7UK 3R7SB 5KFDA 1CSJA 1UVLA 3WABA 3VAJA 1AUSL 3KLHA 1KUVA 2K1RA 1XMTA 3RBUA 5HVGA 4PQAA 1YMEA 5J8CA 2V50A 2XZWA 4ZP9A 3UW1A 2MY7A 4OLLA 2GANA 2VUGA 5KFCA 1IOIA 2PJ6A 2Y0SD 5LOQA 4AG9A 2DNLA 2YKNA 2YY3A 2PO4A 2ZZTA 4NCBA 1TELA 3BV8A 2XO7A 4J9NA 3B8HA 2DNPA 4L76A 1S79A 4DV2F 3MMBB 3RU0A 4DHVA 3DDNA 3AQPA 3M2RA 4URQU 2GIQA 2ANPA 1Y9WA 1GXTA 4HHHA 2A18A 2PJCA 3GIKA 4ZVTB 3HMJG 2PMHA 4IHMA 2V4RA 5KFIA 4P4DA 3JQMA 1UVKA 4JBCA 4H6UA 1FRJA 2EFPA 2BOAA 1BLUA 4NLUA 3DRRB 1EQMA 3WZ0A 4FPRA 4HNWB 1RSCA 3PEJA 3WT4A 2QIFA 5AG7A 3R96A 2KTQA 1RT6A 5F0WA 5B7WA 1IKYB 3KK1A 4J37A 5HAOA 2E7VA 1NM2A 4P74A 1TIQA 2FS5A 5H84A 1R3NA 2ERRA 4TLQA 3TAPA 4C0BA 1HI0P 3RW7A 4CDIA 1EKRA 1WHWA 2R42A 4YMEA 2Z11A 1NJWA 4IOBA 3CULA 1A6LA 1BHNA 1C1BB 1KRPA 4P4BA 5C5JA 1C4AA 2HHVA 4CAXA 2HNYA 5H86A 3AD7C 2Z0ZA 2XSJA 1REGX 3QAEA 3NS5A 2DPTA 3I0SB 3R5JB 2BM1A 2K2PA 1DARA 2VF3A 4U9RA 2YVSA 1HWIA 3NWRA 3NCPA 2WHOA 4U96A 1YJWS 5ADZA 2F8MA 4R8FA 3KFWX 3JQKA 3DC2A 2AFZA 4DU7A 2J8RA 4W98A 1FERA 2B4DB 4OJHA 2RVJA 4EI2A 6FD1A 3SCLE 4C98A 3E8OA 3BXMA 3TA1A 3OWCA 5T7LB 4C3KA 5IQQA 2HB6A 3TUPA 3BREA 3PIOQ 3T5KA 1Y0RA 3BSCA 2ZEHA 5LT5A 4L73A 1FNXH 1WHXA 3PX0A 2CG8A 4IUFA 1LANA 1HW9A 4IH7A 1RWMB 4I2PB 1Z5RA 3TAMA 4E98A 2GMLA 3T9YA 5E3CA 3WIUA 2R7QA 4EGLA 4N5SA 3MFIA 5A0YA 5L9NA 2AFMA 1AXQA 5D4NA 3EDQB 5A76A 2YQ0A 2BE7D 2R7HA 1JJCB 4DPWA 5HROA 4YR0A 1BAVA 5F41A 2WOMB 1LV5A 1UETA 2OEJA 1WC4A 2XM3A 2OZUA 3KHRA 2LCWA 2MB0B 5D77A 1Q2YA 4C8KA 1IICA 1RTIB 2W9BA 2XMKA 1YVOA 1WACA 4J9LA 1YBAA 1DBDA 2OSRA 1ZBTA 5DQIA 3G4SS 4CAVA 2OH2A 1RXTA 4KRWA 4OX8A 3GPAA 2N82B 1VS3A 1S9GB 2BE2B 2DNYA 1JJHA 2IBOA 1Y9KA 4N77A 3I1UA 3NGDA 1K44A 4MY0A 2WYRA 2RMLA 2B8QA 3D1QA 4OZ5A 3AT1B 3ONQA 3BKUA 4M63A 1AUDA 3C46A 4I6AA 3Q8SB 1CG2A 3BSOA 4WZMA 2MZTA 3C6UB 4BLGA 1X4HA 3IRXA 3R5BA 2UUBJ 2M8DB 5G4DA 1G1XA 2QC3A 1LW0A 4BC7A 2IDEA 3W63A 4K2JA 1RLCL 1IBCB 1Y0HA 2JDCA 1I12A 1RT7B 3B3WA 5HQMA 2IA0A 3NGRA 2IJRA 3FF3A 3TR5A 1X5OA 3W2WB 4TNUA 1F57A 3MEEA 2XYPB 1RGVA 1OJ4A 4DLGA 5DLFA 4A37A 1MN7A 2XG8A 3WC5A 5EGYA 3QBCA 1CBKA 2HNDA 2V5HG 5F8HA 3N7ZA 2VPZB 5E5NA 2XWYA 4ID5A 3BR9A 2LVWA 3TNVA 3IU1A 5FIIA 4K4XA 3NXZA 5F9NA 2MLZA 1RYRA 4ALZA 3M8RA 2E66A 1ZG8A 1HARA 2UU9F 3DNSA 1IYKA 2HNZA 5H9FK 1PJ7A 3C6TA 1T05B 2IVYA 4CM2A 1FRLA 1GX6A 1RTDB 3DLHA 5IV4A 4R9MA 2QSWA 3A8JA 2ZXVA 3VF0B 1M1HA 4Y28C 2XEFA 5D4LA 3LPEA 2YX7A 2IM3A 2E9TA 4MIWA 1OYDA 5JPHA 1PC5A 3W6XA 4YOEA 3UNYA 2GFQA 2E5LJ 2IC3A 4DFMA 5J2MA 4C2MA 1JXLA 1ZAVA 1C2PA 1RBLA 2Q44A 3U1MA 3FBBA 1OY6A 5DWNA 1GTHA 1VCTA 4DUTA 2RUGA 2CYYA 1VLOA 1JLEA 2XO6A 3S01A 3SV4A 1YLXA 1TV6B 1NDKA 1M4GA 4DQPA 3ZZZA 2AJ2A 2W9AA 1RACB 2VG6B 5JJBA 3GG1A 2A1BA 2BV3A 3PYEA 1ZM9A 2AJ6A 2EPIA 4NA3A 2HFOA 2J6TA 3HJFA 4ANEA 2VBZA 1N52B 4C68A 1CLFA 4HTJA 1PCAA 1UL3A 2RHSB 1U49A 3U02A 5C24A 4NSQA 5K14B 3GG0A 3T1AA 3DYAA 2L9DA 4DCJB 2VASA 4K4YA 2NZCA 2VIHA 3O2IA 1MK4A 4USTA 4ED0A 2XS7A 2YNDA 1WKKA 2VG5B 3A3OB 1UFHA 2XYGB 1V3ZA 2FL4A 2I5JA 2O66A 5L9XA 3SI0A 4YB7A 1B7YB 4B3MF 3UD5A 4KC5A 1RHJB 3M32A 3OTDA 4CT8A 2B4VA 2Y8WA 1KZFA 2HRTA 1DTQA 3QRPA 1S6PA 5C42A 1VRUB 2P6FA 1T8EA 3TX0A 4F6AA 4Y0FA 3FMCA 1KONA 4ECTA 1FI4A 5J1EA 1Q95G 1EARA 3EPGA 1CJKB 2ROGA 2V6AA 2XS5A 3MCSA 2AWZA 2Z10A 2MHNA 4PUOB 3S6FA 3DOKB 4BBYA 1VFJA 2UP1A 4HT7A 5C2GA 2CZ9A 3UD4P 3R27A 1RWUA 3BN4A 2H48B 3HD2A 1S97A 1TUVA 3RR8A 3EM1A 2J8NA 1FXRA 4DL6A 5J8FA 3MECA 3CSKA 1S1WA 1WEXA 5IC6B 1RZMA 1ZAWA 1HKAA 4F0HA 4BCAA 4HEA9 4J5OA 1OPIA 2FVQA 2OD4A 4UIBA 2JLGA 2Y1LB 1RWVB 3SBMA 4N8NA 4P72A 1SJ1A 4QCLA 2CPFA 3NGSA 4RBTA 1U09A 4O3NA 4DN0A 5LXRA 3US5A 4DPYA 1G2EA 1BO4A 1JLQB 4Y65A 5ETNA 1WJ9A 1HNZF 4DV3J 1G4CA 1GNKA 1NDPA 3H5ZA 2ZBRA 3CDBA 4U95A 4F02A 5F8JA 4QIGA 3LP0A 3W3SA 3GLJA 1T9WA 1BWEA 3ZZUA 4RBUA 4LF7J 2RNEA 3PRDA 2NS1B 1HBMA 1TP7A 3VAHA 3LGHA 2G3AA 1IKWA 2R8HA 4MFJA 1NKEA 5MAOA 3TI0A 1KHVA 2JFKA 3GV5B 4DR7J 2ZEJA 3IWXA 2UV8A 4J9MA 2DHSA 2OI2A 1SI9A 4DBQA 1WKJA 4WE1A 3QNVA 4OC3A 4URSA 2MGZB 5IT9U 1MLAA 4ZP6A 2GVZA 3Q22A 4Y49B 2CPYA 2GJIA 1VJWA 3G6YA 2WONA 3B2YA 4CLUA 4RW8B 1WG5A 2MJUA 2BDPA 2L3MA 1RB0A 4I68A 2R8JA 1U47A 1CJVB 4FYDA 4NMLA 3H8FA 4FVCA 4NLSA 4ED2A 2QECA 4C9DA 4GXHA 4IQMA 1Z4UA 4UEZA 3V81A 3PKMA 4TU9A 1ON0A 3UO0A 4FF4A 4FF1A 2HHUA 4ZP7A 3CJRA 4GS4A 2GLFA 2DHGA 2EWHA 3T5LA 4OZ0A 2B5JA 2PA8D 1XIXA 3HF5A 2OEKA 3UR0A 1WDDA 4C3LA 4CI0B 3IA0A 3KMSA 3OT9A 1AYEA 2V69A 1M4IA 2BKOA 5IV0A 1TUGB 1EETB 3PBEA 2KVQE 4Q2LA 1U6ZA 1CP7A 1D8YA 3DRPA 4F2SA 2UXDJ 3EZ5A 3HVTB 4Y2MA 4UIAA 1TL1B 3PB9X 3JAMU 4ZA1A 4CWBA 3I0RB 1NSAA 1X5PA 3CCUS 4DCPB 5A27A 2PVVA 2IYIA 1M0SA 2PJ3A 3K59A 3FSYA 1S77D 4DX8H 4EMDA