3IC1A

Crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
376
structure length
370
Chain Sequence
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIQYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 120
structure length 370
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ic1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ic1A01
3WT4A 4YWYA 3PB8X 3HUVA 2FVGA 4OMEA 1AYEA 2ZEGA 1YLOA 1GYTA 4GM5A 3IIBA 3CPAA 2PVVA 3KHZA 3MRUA 2ZEDA 5LYFA 3D67A 2JBJA 2IQ6A 2PJBA 4P44A 4IHMA 3FEDA 4FWUA 4K3NA 4JYWA 1Z2LA 4MCQA 2ZOFA 1UWYA 3HLPA 3SI0A 2F8HA 2PE3A 1EE3P 4LQGA 4B6ZA 2PJ7A 4R6TA 4X2TA 1LAPA 3H8EA 2PVWA 4WJBA 1RTQA 3KI9A 3NA6A 4MRIA 3S9LA 2PJ2A 4UIBA 3PRTA 4NJRA 1Z5RA 1XJOA 2XEGA 3L2NA 2PJCA 5HXDA 4DUKA 1ZLIA 2C6CA 4JZ0A 4NGQA 3IFEA 1DTDA 5THWA 3TC8A 2PCUA 3SJXA 2AFWA 3D7GA 2GLFA 3KQZA 4A37A 2CF4A 3RZAA 1VHOA 4NJQA 2PJ9A 3GLJA 5LRJA 4MHNA 4PXCA 4FUUA 2PJ4A 3SI1A 4PPZA 4KSIA 1CBXA 3K2KA 2PIZA 2AFSA 3PFEA 5K8NA 3KR4A 2GREA 1LFWA 2J9AA 1PCAA 5LYDA 4P10A 4A39A 4ZYQA 1R43A 3VARA 4R7MA 3FJUA 3ISXA 1YSJA 2NSMA 5I4MA 4NGSA 2CIJA 1LANA 5LYLA 1ZG8A 4R8FA 3D66A 3CDXA 1TF9A 4RUHA 1F57A 4MCRA 2EK8A 2VL1A 3FX6A 4EWTA 3FECA 3B7IA 2C6PA 3IJ3A 2O53A 4UF4A 4TWEA 2NYQA 4NGMA 3DLJA 1Q7LA 4ZY2A 3MN8A 3DGVA 2GU2A 3WC7A 5HVHA 3TX8A 2QVPA 2ZEOA 2CTBA 1QMUA 4P4DA 2PJAA 2AFOA 3LWUA 4OC2A 1CPSA 1R3NA 3S9NA 3H8GA 3VATA 2BCOA 3RBUA 5K8PA 3D4UA 4NGRA 3D7FA 4F9UA 1PYTB 5JGFA 2PJ8A 1YW4A 1LAMA 3BI0A 3JRUA 4ZX8A 2JEWA 3VH9A 1ZG9A 5LRKA 3FEEA 5F09A 2PJ3A 4OKOA 3PEIA 3QNVA 3I1UA 4NFRA 2ZEPA 1YW6A 4O23A 4P4BA 2ANPA 2AFZA 4MMOA 2AFUA 1CP7A 3N5FA 1BLLE 2AFMA 1VHEA 4G1PA 1F2OA 4OC0A 1HEEA 4DJLA 4P4JA 3GUXA 1ELMP 3KR5A 3B3VA 3K9TA 3FH4A 3SI2A 5LRGA 3KGQA 2Q4ZA 1ELLP 4UIAA 3BHXA 4MHPA 3CPXA 5D29A 2PJ6A 6CPAA 2HC9A 3IEHA 1LOKA 3SJFA 3IO1A 4MXUA 3S9MA 1ZG7A 3WC6A 3V38A 4PXDA 3PB9X 3FF3A 1AMPA 1HDUA 3V7ZA 3D7DA 5D8NA 2OOTA 2OR4A 2ZEHA 1YMEA 1DE4C 4PQAA 4MCSA 1IGBA 3NH8A 4A94A 3D68A 3H8FA 5K8MA 1ARMA 5HVGA 5J1QA 4FBEA 3GB0A 2ZEMA 3ISZA 1CG2A 2ABZA 4NGTA 4OIDA 1XRYA 2IJZA 4H2KA 1CPXA 2RB7A 4P45A 2RFHA 2QYVA 4OC5A 3PB4X 1XFOA 2Q51A 4UEFA 3PBBA 1TKJA 3SJGA 4IK2A 2I3CA 1TF8A 3B3CA 3B3TA 1H8LA 1XBUA 4A38A 2BOAA 5CBMA 2V77A 1F2PA 3WABA 2PJ1A 2ZEEA 5JH9A 8CPAA 2EWBA 4YU9A 1TKFA 4OP4A 3WC5A 4DYOA 3KASA 5IB9A 3NFZA 4NGPA 2ZENA 2V8VA 1ARLA 3B3WA 3KQXA 1VIXA 2V8GA 4PXBA 3T8WA 1FT7A 1OBRA 4UEEA 4WWVA 1M4LA 3PFOA 4BD9A 4EFDA 1CP6A 2IMOA 2JBKA 4FAIA 2ZELA 4Z65A 1Y7EA 3SJEA 1BAVA 3NH4A 3IC1A 4PXEA 3FVLA 4P4EA 4ZX9A 3B3SA 2HB6A 2F7VA 1Y0RA 4OC4A 4CPAA 3BXMA 3CT9A 2PJ5A 4TNUA 2CTCA 4W9YA 4OC1A 2O4HA 4MHZA 4P4IA 5LYIA 4ZI6A 3LMSA 2PJ0A 3PBEA 1TXRA 4Q7AA 3KHXA 4P6YA 2XEFA 5K8OA 1BPNA 3D7HA 4AXVA 1BPMA 4MHYA 2Q43A 1XMBA 1FNOA 1NSAA 2PRQA 2WYRA 4OIWA 1TKHA 3NH5A 3PB6X 2XEJA 4X8IA 5ELYA 1JQGA 2DEAA 5HVFA 2C1CA 1QQ9A 4MCPA 4EMEA 4ZY1A 3KZWA 4F9VA 2POKA 2PIYA 3RAMA 2V8DA 1Z8LA 2ZEFA 2G9DA 2WZNA 2C6GA 5CPAA 4X3RA 4OC3A 3FMCA 2XEIA 1IY7A 5JM6A 2GLJA 4P4FA 3KL9A 1LCPA 3B35A 5DS0A 4UEZA 3B2YA 2BO9A 2V8HA 2QJ8A 1ZLHA 4ONWA 2AFXA 3IWWA 7CPAA 2EK9A 4F8ZA 1Y0YA 3BI1A 1KWMA 3PB7X 1VGYA 4R76A 1HDQA 4ZY0A 4IAVA 4NGNA 2ZOGA 1CX8A
chains in the Genus database with same CATH superfamily
1SJ3P 1QSRA 1P4NA 3TTHA 3C6UB 4X4NA 2VBYA 1AYEA 1J2VA 1S7IA 5H84A 1WG5A 4CLFA 2QA4S 5EC4A 2PVVA 2F3JA 2VA2A 2GVZA 4TY8B 2C1EB 3SSSA 4B3MF 1B7YB 2GC8A 4NLXA 1X0FA 1XJWB 1YGYA 4LRFA 2E5LF 4DQPA 1UWYA 1KUVA 1TKXA 4NMLA 2D41A 4B11A 2HBQB 1ZM9A 3EPGA 1F2HA 1RAFB 3VTIA 4CYUB 2R98A 3NGTA 1BQMA 4DR7F 2A3JA 3M8PB 3RRHA 1IBCB 4USHA 5BXIA 2VPWB 4NXMF 1MJAA 4TLRA 3FBUA 5CCLA 3NA6A 4A8KA 1DQAA 4OJGA 2DR5A 3UN5A 2PJCA 1FERA 4I2PB 4RW9A 4FYVB 2NYIA 1TL7A 3TZXA 2XEXA 1IXKA 4PG8A 3SMZA 2IRUA 4W92B 4XTTA 4I69A 2FVQA 4NLGA 2FL4A 3PFEA 2D3ZA 2M3DA 3TYTA 2VIHA 3RAQA 4WTYA 3QIPA 3JYTB 5KTQA 5A8KA 1K0TA 3GIIA 2EFVA 1YSJA 3R5DA 3L9ZA 2JEVA 3T5KA 4PUOA 5RUBA 2B4DB 3TEHB 1XMQF 2OGUA 2DGSA 5ADZA 5F0WA 4B9UA 4KOTA 2FT0A 2V2ZA 1CJUA 1M44A 2ILZA 3RB3A 1JLQB 2DNNA 4V19J 4EFAC 1A7GE 4D3HA 2PMHA 3PJ9A 3BYRA 1KTVA 4B08A 4OZ0A 4DPWA 3D4UA 3A3PB 2GQQA 4O4GA 5T7LA 2UUBF 4LF4F 3CDEA 4YHHJ 1EX8A 5J2PA 5KFKA 5JGFA 1U1MA 3CCJS 2ADCA 4GO5X 5D15A 4IH5A 4K4WA 3JUWA 4LF5F 4DSIA 4RX6A 5LT5A 1C2PA 3H20A 3FZBA 4ILLA 1URNA 4M3SA 1S9GB 4IYQA 1GH8A 2DHHA 4MY0A 4ZN1A 5DDRC 1SI9A 3QAUA 1R0BG 1KOHA 4DV6F 4R5PB 1X4BA 2Q4VA 2LEPA 1KKHA 3CJ4A 4E0DA 2HC9A 1F3VA 3SJFA 4J3GA 3LP0A 4F4YA 3FCVA 3N6MA 1TKZB 1RBOB 4UY8T 1RDRA 1ACMB 2KFYA 2JDJA 4Y34A 2AMCB 2ZZNA 3TAPA 1N56A 3W2WB 3PXGa 4ILRA 4OI6A 4IQXA 5A27A 2GA7A 3VAJA 1S99A 3VWDA 2E5JA 5K8MA 1ARMA 1ITPA 4ES1A 4ZJLA 3T5JA 5GCNA 4CP5A 2MKJA 1NUEA 2IJZA 3K58A 1DRZA 2PI5A 2V69A 2O28A 2CQBA 3L09A 4EYIB 4DI6A 4LF8F 5E3PA 2BUNA 4UEFA 1U2FA 4XDCA 4B14A 2WVEA 1N32F 2QL7B 1WOSA 3M8QB 4O3SA 4QU7A 1TKFA 2DYAA 1KZFA 2HPUA 4BINA 3I0RB 5IQ6A 1S1UA 5J2QB 2FJXA 4WU3A 3W65A 2ZBQA 1Y9KA 4A48A 3M9OB 1U1PA 2CQ3A 2EFQA 4AXIA 2A2CA 1SKSA 1BAVA 4OYAA 2JX2A 4XNHC 1Y7RA 5IX3A 2UP1A 5ETPA 1XERA 5B0DA 2MY7A 3TO9A 2J9DA 5A8WB 3HZGA 5BYSA 3K57A 3CCTA 2XBPA 5D4PA 3BM7A 1LWCA 2XNRA 3NGKA 3DDNA 4RS2A 2RQCA 3BQ2A 1YX0A 5T14A 2Y1LB 4YS2A 1VI7A 3VALA 3OHAA 2C2EA 2PRQA 2E1AA 4OIWA 1FESA 3H5ZA 3LPEA 4A8FA 2V9KA 1EARA 2BZ2A 5AE2A 2Z58B 2C2NA 1REVB 2CPDA 4IG3B 3CPWR 3UN3A 2BJ3A 1UA0A 1SQGA 2PFDA 5DJBA 4MFPA 2MJNA 1RT1B 2V8DA 4LF7F 5KT4A 3DDKA 4RUCA 4JOUA 4KFBB 4NZ7A 1TV6A 5IV3A 2XG8A 2GQCA 2RU3A 1X5OA 4NLPA 3D3SA 2DR9A 5I0CA 4HPSA 5IM0A 1WJ9A 1BD6A 2Q1LA 4J9RA 4AE5A 1GAOA 1YJVA 2FE7A 1B99A 1JWWA 4B3SF 3LP2B 1Q2CA 1JLFB 5G21A 2HV2A 1PJ5A 1M5PC 4YWYA 4KC5A 2FVGA 3S6FA 1KQFB 1EKRA 3K59A 4TY9A 1ICEB 1IBMF 3CO0P 1HNZF 2L9WA 2V2KA 4P44A 1W2BR 3PYGA 2RILA 3CNQP 4KT0C 4ID5A 2MKKA 4OZNA 5GMEA 2OJ3A 2O3DA 2NXUA 2DH9A 2N82B 3PHEA 2F8HA 2W9BA 5DZ7A 3OXFA 1EETB 4PQUA 2ZJQQ 4WJBA 3IRXB 1U1QA 1WDDA 3FBFA 1LW2B 5J1PA 1UKUA 3TVYA 1RK8A 2BMBA 1D09B 1RAAB 1QE1A 3TAQA 1YKWA 2OSQA 3MCOA 4KE5A 3FKBA 4ZBGA 1R6VA 5A8RB 5D0EA 4RNOA 2VICA 5DO2A 2CKWA 2M8HA 4FNHA 1I5OB 4U9ZA 2W8KA 3MEDB 2UUCF 2AP6A 2AFSA 3HM9A 2Z3OA 5ETNA 2HFNA 3OR2A 3DYAB 2J9AA 4RR5A 2C2ZB 3C3LA 4GVBA 3M2RA 2DVIA 2AW0A 5I4MA 5KOXA 4KGZB 2EWHA 1B7FA 3CDXA 1F57A 1D0EA 2VL1A 2OPSA 3CJ8A 2QG9B 2KO1A 2NXNA 3VZHA 1OMSA 3DRPA 1Q7LA 3DGVA 4ALZA 3HF5A 3WC7A 5D4OA 4ZCKA 5HVHA 3K8VA 3KOAA 1WF0A 2YX4A 3I0SA 3H40A 1UEVA 1WTBA 1PAUB 3BDPA 3RYLA 3OLAA 4DX6A 4P2XA 1FY7A 4ZK7M 4Y2KA 1KR4A 2R42A 2RS2A 2IA6A 2DPJA 2E5IA 2GJFA 2BX6A 5J8FA 2OEJA 1YX2A 3NRBA 1FDAA 2B4OA 5FDLA 5ETKA 2DF5A 2VG7B 4E2AA 3ISND 2ZC4A 2N3OA 1UAWA 5EDWA 4PKDB 1P0HA 4FXDA 4CS0B 5HATA 1RJJA 4RW6A 1W2IA 2Y8WA 1LWEB 5ETRA 5HLFA 3BN7A 2IVYA 1HNIA 5AG7A 5ETOA 3MR3A 1AUDA 3N01A 3HHLD 2EG2A 1ZG7A 4JBCA 1S7FA 4MIAA 4ZVRB 4CLTA 5AG4A 2OOTA 1S1XA 8RUCA 3R2DJ 3ZZOA 4MCSA 1DTQA 1LWFB 3T9ZA 2DJWA 1RT5A 4E2FB 1S7NA 3DI6A 3U1LA 3LWMA 2B7CB 3JAMU 3TA0A 3X1LB 4AL6A 3CDBA 3FB3A 5H9FK 2EG1A 4QVTA 4Y3CA 2W25A 3MMAB 3D28A 1XFOA 2ZZTA 2DIVA 4M1KA 3CC7S 3CF5Q 2KRRA 4QR1A 3OUYB 2R7UA 4A38A 1Y4ZB 2XWYA 2YNHA 2V9WA 4KSFA 2PN6A 4KKOB 4LT6A 2AX1A 2YWGA 4PR6A 3F5BA 5KT2A 3MOZA 4GC7A 2JEGA 1U47A 5HMWA 3OL7A 4JYAJ 3SDEB 3HD1A 1VOMA 1U24A 2C22A 5GAEU 4FXWA 2IMOA 3T6BA 2OZHA 3CUNA 3OWCA 4BS2A 3LAKA 2UXCJ 2MKYA 2XWXA 1YIJS 1IQZA 2HB6A 4Y49B 4DN0A 3PW0A 1JB0C 1R0AB 4EYHB 3W5YA 1NZ8A 2K06A 2AHOB 3KWMA 4KOSA 3I9V9 4F4XA 3W8PA 4Q7AA 2E1CA 5CYQB 3NE7A 2CJ9A 2J8SA 3MHYA 1WEZA 3V6DB 2PDOA 3S01A 2HHHF 3PB6X 1MU2B 5HJYA 4X8IA 5ELYA 2DEAA 2UU9J 2DGQA 1M5HA 4PV6A 1YRUA 3NE8A 4MKYA 1WK4A 3IGRA 3VQSA 1P6TA 4DLEA 2LDIA 5KFXA 4AVCA 2ZKTA 2ADBA 4KHRA 2ERRA 1ZH5A 1FRXA 3HT3A 4PSXA 1UFKA 3GWCA 4WXOA 2LQBA 1I6JA 3PIOQ 3QLHB 4C48A 1TKTB 3BYPA 2A0FB 1H3DA 3ZTQA 1QTMA 2YNGA 4ITSA 4S0MA 3ZZUA 3I4HX 1WEYA 2NREA 3AOBA 2RH3A 3R7SB 3LOUA 2KDOA 2JJ4D 2ATRA 3LGMA 3MFHA 1FWKA 3CD6S 2DGTA 3HPOA 3OL6A 3S6GA 4JV0A 4XO0A 4NLDA 1FDDA 4ZVHA 2ZEJA 4QWAA 4NXNF 3O44A 3FJ2A 4HYKA 3HLPA 1P1TA 4Q43A 3FUYA 3KLHA 2HFVA 1TL3A 4ZP9A 4FKYA 2J6SA 3HVTA 2G9OA 3CCES 4AL7A 4RNHA 5L1KA 4RW4A 3R95A 3SXNA 2HHVA 2VBQA 2RKIA 1C1BA 1XR5A 4ZITA 3BV8A 1U48A 2OLWA 4KOXA 5HJXA 3TUZC 2YKQA 2ZNZA 4M5GA 1MSWD 1S77D 3TO7A 4A4JA 4KO0A 4P2FA 2JOQA 1UFLA 3V6HA 3NNAA 2HHXA 4B9TA 4NJQA 2QX0A 5LRJA 1IR0A 3HVWA 4DCOB 5GADU 1S1TA 4J90A 1XR6A 3ET6B 3DOMB 3TEGA 1U6MA 4DV1J 3H2VE 1CJTB 1PCAA 3QFHA 2FHKA 2R7RA 2BBEA 3WQPA 5LJ5Y 5IXUA 1X5PA 2GNKA 2XYGB 1HHTP 3UDCA 2DO4A 2EK8A 2IM2A 2JLGA 3CZXA 5KFUA 2OPPB 5SZTA 2UUTA 3FBEA 3EJMA 4Q5VA 2HVEA 4ZCIA 4PABA 2QVPA 2XMWA 2CTBA 1SB6A 2PJAA 1FO1A 3KNGA 2KXHA 1QSNA 2E1RA 1M5OC 1U1NA 3KNAA 2GQ2A 5HROA 1YW4A 2MZJA 3VH9A 3QZ7A 4DUYJ 3WHIA 3QNVA 1VQ9S 3PR4A 3IR6B 3OTBA 4P4BA 3OVBA 3RYOA 5FLXY 4OJ3A 3UD3P 3PJWA 4L74A 4CRJA 1CP7A 2YQ0A 2R1IA 2ALZA 3P49B 3K5LA 1VQYA 1ELMP 4ECQA 3V6JA 5K14A 2GVZB 3Q8UA 1MW7A 3NNHA 2GS8A 2KJVA 4E98A 4CYPA 4NEZA 4K5RA 4AL5A 2EFGA 2OZGA 4H54A 4TQRA 2HKEA 2VQEJ 1TKXB 2HNYB 3IO1A 2QYCA 3BQ1A 4ECVA 3W5XA 4I56A 3ZJ0A 3PEHA 1C4AA 3MPVA 2RJZA 4CAWA 1J5EJ 1K44A 1BQMB 1EQMA 1HDUA 3QNWB 4KRWA 3PW4A 5EHHA 5ETMA 2OELA 2IL4A 4LBHA 1DBDA 1S7KA 3LF0A 4KHMA 2NYHA 2O01C 4J9SA 3HSDA 1YJ7A 2J7KA 2K7KA 3FMWA 2ABZA 4RW9B 1NDKA 4ZVEA 2H51B 1M5SA 2IJNA 1Q5VA 4H2KA 1TL7B 2G2OA 2WAQD 3B8HA 4ZVTB 2QLWA 3O1LA 4KLWA 2AV5A 4K4TA 2XY6A 4IRDA 2DPTA 3SBMA 4HHJA 1B0PA 2JL9A 3B3CA 1Q16B 4NX9A 3UCUP 4IQMA 2Z2YB 2VFUA 3QIPB 3MM8A 1SJRA 3R1KA 4A31A 4MY3A 1SPBP 4LFAJ 5A8KB 3A1YG 2W7PA 4WFXA 4NLUA 5F8NA 3IBCB 4KV8A 4PUOB 4A2ZA 1D8ZA 2C2RA 4ZVSB 2YQ3A 3VWEA 4YDDB 4ZVOB 5C24A 3MF5A 1CJUB 4R3KA 3R6GB 4J7CA 3I5CA 3GJSB 3UR3C 4CPAA 3J80Y 5AXNA 4F04B 2CQ2A 1J5OA 4TNUA 2ZBRA 1FKPA 4ZPAA 4DFPA 3PP9A 4QWEA 2PJ0A 3D7SB 4UT4A 1P9YA 4DXLA 1Y10A 5DG7A 4O4GB 5T7LB 3KK1A 5ITHA 5J2PB 3BO3A 3GFYA 5EWFA 2D4OA 1IKWA 4FP9A 2FQQB 1VC0A 2RHSB 2RUSA 3RW6A 4CLWA 3DOLA 3OL9A 4I2QA 3KZWA 2N4CA 1TL5A 4J9LA 3BO2A 1OSCA 1Z8LA 2LP4A 2CPEA 5KFZA 1O6XA 4PAAA 1OQ3A 4C4WA 1YVOA 4P4FA 4XNHB 1KVJA 4B3TJ 4OHWA 2BL1A 1WD6A 4M5NA 5L1JA 1K0VA 2LEBA 4OX7A 1I1DA 4ONWA 4CGOA 3PG9A 3LP0B 2MPUA 2HSEB 7CPAA 4CYNA 4F8ZA 1HQ2A 1X7VA 4ED6A 2ILYA 1S0VA 2M4MA 4NLRA 4ELTA 2AKWB 3TW0A 2ZEGA 1W25A 2BE7D 3PYFA 2ZE2A 3PKYA 1OY6A 2UU9F 2YKPA 4MH8A 3C6TA 3M8WA 4ZLPA 2WVDA 2BJDA 2C3YA 3W64A 4ER8A 1M5VC 5KTAA 3TCVA 2XMMA 3W66A 4UWJA 2RE1A 2EW9A 2PE3A 5HMNA 2B51A 4CAVA 3DFEA 3L7UA 2YNDA 1AUGA 3AT1B 3HVAA 2BEIA 4DR4F 4ECRA 4DX8H 4RZRA 3H59A 3C16A 3U1NA 4JXRA 1S1UB 5J8CA 4WKRA 1WC4A 5GAGU 4JI1J 3KHGA 4X62J 3DU5A 4QIWD 1Q86T 1FD2A 3IWGA 2B56A 2HLUA 3NAHA 1VHSA 4JI6J 4ATNA 1JXVA 3FBCA 1MROA 3QMQA 1AUSL 3W2VA 4HDGA 5MLCV 4FD5A 4F0KA 1U09A 1LWCB 1RHRB 3D2WA 4A39A 2JZ5A 4WKYA 2CIMA 3C8YA 3KYLA 1S10A 4OI3A 2PEHA 4ELUA 1XMTA 2LYVA 3W9HA 3GV5B 4LIWA 1XIXA 2RQKA 1KQKA 5G4DA 2NUUG 4LIRA 3N7ZA 4RNFA 5D0GA 1CPSA 2ALYB 3MUMP 3H8GA 4CRZB 3T6JA 3CMQA 2B3UA 1V3ZA 3LO3A 3KLVA 2ASDA 4FYWB 2HUZA 2R3VA 2CWXA 1TV6B 2AGPA 5B0GA 4F4KA 2XYHB 4DV1F 1DURA 3RUBL 3MM9A 2DXEA 5HMZA 4DR6F 4DV5J 3QATA 1RHMB 4FD6A 3FEEA 5IV0A 3R1HA 5IM0B 2QLJB 4NFRA 3VR1A 3B78A 3KJFB 4F0YA 3Q8YA 1NXIA 4JI8J 2X3DA 3GIJA 1HQUA 4F8RA 3A8JA 4UUWA 2PMWA 2A1BA 2CPHA 4G1PA 4TYAA 3SV3A 2MQMA 5GMDA 3S6EA 2H3EB 2OIHA 2FUG9 1RISA 3UDLA 1ELLP 4W4MA 4RW7A 3RR8A 4UIAA 3DNSA 4ID5B 4NLOA 3D0HE 3EGNA 1RTDA 4R3LA 4ILMA 2WB4A 3TZYA 1KUXA 1X4HA 2W9BB 4RNNA 3HT0A 1E6VA 4HDHA 3G8WA 1VJQA 4PQUB 3FNCA 3V7ZA 1JJ2R 2OR4A 3BS9A 5KFQA 4DUYF 2K1RA 2LXFA 3M4XA 4WYWA 3CJTA 2E1PA 4Y2CA 2NQPA 1QE1B 4IOAQ 3MPWA 3FRYA 3GB0A 4I67A 3RTVA 4O4RA 4QBUA 4P71A 1I1GA 4LR9A 3FSYA 4OYWA 2FS5A 2HZAA 1S60A 2EFOA 1WWZA 3SCLE 2JVRA 4O44A 3L3CA 2HZVA 3NP5A 1GMUA 2VQEF 5I3UA 3I9SA 3OR2B 3WABA 5JUMA 4OYIA 4TYBA 1UZDA 1VRUA 4TQSA 5J1EA 4GVBB 4Y6IA 3M2RB 4FF3A 2H5JB 2ZJPQ 3DR8A 1FT7A 1OBRA 4OYOA 1R8CA 1VC6A 1XNQJ 3ZFVA 4FDFA 5HANA 2OPSB 2FD2A 4CRYB 4GKKJ 2QA4G 3P3DA 1YJTA 2QL9B 5AE1A 3DRPB 1Q7LB 1UPMB 4K4ZA 1CJWA 4CZCA 5HP1A 2J0XA 1VQPS 4DLGA 1H74A 1BQNA 3HFVA 1PYSB 4Q44A 3I0SB 1Z4UA 3T5LA 5EX0A 3MEGA 4G1QA 2Q6CA 4L72B 1RO5A 1XIQA 1EZZB 3ETOA 4OX9J 4N77A 2MQOA 1XMBA 3TOAA 1N88A 2WYRA 4IUFA 4QUSA 2HFZA 3DLLQ 5KG7A 4C3LA 2DEIA 3FGVA 1UA1A 5C7PA 1S0MA 5FDLB 2RRBA 4YEAA 4OZJA 5DQHA 3WX4A 4IDKA 4Z7YA 2XEIA 4HVZA 3Q86A 3T1YF 2PGCA 3IRWP 4UEZA 4IO9Q 3HD2A 2CJYB 4RW6B 2R7SA 2HAFA 2HS4A 1P27B 5HLFB 4DUZF 4RU2A 1R57A 2Z3NA 1ZTWA 1WC3A 5MAOA 1M1DA 3IWWA 3O5TB 1OQ6A 4OYPA 4XPKA 2MJUA 3PB7X 2Z56B 2UV8G 4JI0J 4WCEQ 2ASLA 4L3KA 3R7BB 4QQBA 3H4BA 3QSIA 2MKSA 3CJ3A 3VCDA 1S1XB 2G0IA 3SZ2A 2DRAA 2RF2A 1DTQB 5DQIA 5LYFA 3EVOA 1RT5B 4ED0A 3DI6B 3PJXA 3G71S 4FWUA 4I7FA 4JB8B 5HQ8A 2H4YB 4IRCA 3DOKA 4BLGA 1RU1A 4XIUA 3RR7A 5HO4A 3ITHA 3ENVA 4IFYA 1V3RA 4DV4J 2MSSA 5I3PA 2DISA 3OBIA 4HR2A 2Z2MA 1S97A 2NMTA 1HI1A 3IBFB 1LAPA 5G20A 4KGKA 1K1QA 2YNHB 2HBYB 1KNZA 1AFJA 2WB1D 3PW7A 4IFVA 4RJVA 2X1AA 1VQMS 4UIBA 4NJRA 2QGFB 3DXBA 1XJOA 3M32A 3L2NA 2DGOA 1FWLA 3KK3A 3IFEA 5F47A 5IT9U 1Y3JA 2GLFA 2K7JA 1T05A 4CO3A 2CF4A 3RZAA 3A3OB 3Q8SB 4NRTA 1CJVA 1XEZA 1YVFA 4ZS6A 2MLYA 1RWUA 2B43A 5B7WA 3ENAA 3MECA 4RPFA 4ED3A 1FFGB 2R7HA 4NYPA 1X9WA 1OPIA 4M8LA 1GEHA 2GANA 5LYLA 2ZH6A 4JI5J 3FCHA 2NSCA 1CBKA 1Y7PA 1TR0A 1LQ9A 3IM9A 3FECA 1H73A 4DPTA 2AGQA 5JPHA 4HNXB 2IVMA 3DHWC 3ILIA 5KG4A 3M8RA 2ZC3A 3LWUA 4X62F 4A8SA 2HVDA 3S9NA 4FXVA 4DX7A 4G3IA 1X4CA 2BCOA 1K8AT 4DL7A 4KGVB 4A8WA 5KT6A 1VFJA 2MKIA 3JRUA 3GR0A 2ZFHA 5C42A 4RLEA 2KL8A 2AE6A 1N36J 2BQUA 2YNGB 4TN2A 4WIQA 1YW6A 2MDAA 4I1TA 4C3KA 4B9VA 1T9WA 2PD1A 3D6MB 2DNRA 3BSOA 4CAFA 2XMVA 2ATLA 2H65B 2VC0A 1XN9A 5B0AA 2VV5A 4ED4A 5FVJA 2CZ4A 2Z3LA 1HPZA 1Y9WA 1WC0A 5M2RA 2W24A 2FY8A 1N0VC 1NMEB 2J8MA 2I1RA 3FYNA 4OYBA 3KLHB 4DR3J 1RYSA 1TL3B 3SCJE 2NS1B 1KBRA 1S5KA 3HVTB 1F5AA 1TAQA 1AFIA 3M6XA 2QZ8A 3BGLA 4RW4B 3QRRA 2X7IA 4RN7A 2I79A 2E7WA 2RKIB 1C1BB 1X8DA 2IM3A 3JTPA 3D68A 4OLOA 2FHOB 2XB2D 5J1QA 3PDNA 2ZH8A 5KFPA 1ZS6A 4NGTA 2YNCA 4KO0B 4DWIA 3AY0A 4EGLA 1DQ8A 1VJWA 3JXOA 1U2RA 4Q38A 2AEFA 4OC5A 4DQQA 4HT5A 1SL0A 3ZZIA 1S1TB 5F3TA 3W9JA 1TF8A 2O1PA 1F5BA 4ZCLA 1K73T 3OV7A 1ZETA 1D9FA 2YX7A 3P45B 1CJKA 2PR8A 3QB8A 4I6WA 2DGVA 3RW7A 1QSMA 3UNGC 3QAEA 2DGXA 2EBJA 1TK8A 3R5BA 4C7HA 3MGDA 3JSYA 1IKVA 1YJRA 1Y9OA 3NH4A 3SXLA 2KYXA 1QUPA 2OFGX 1C0TA 2PIIA 4OLPA 4HI1A 2VOPA 1Y0RA 1S4FA 2IDEA 2DH7A 2BJEA 4FZVA 1I21A 4RWXA 2O67A 3GE9A 2GO8A 2VU5A 1T3NA 3MAHA 1QSTA 1G7CB 3D7HA 5HROB 1IR1A 2WPWA 3H2LA 1NH8A 4M5DA 2KVIA 2DO0A 2RVJA 1KEKA 5DZ6A 2IC3A 3CCUS 4M5HA 1IBLF 3JTNA 2CJAA 1ZOTA 1RBAA 3V4IA 2YNCC 1XNQF 3EO4A 4OJHA 3I6PA 2QA2A 2YGWA 2OTJS 5EMIA 2DPIA 3OTCA 5K14B 2G1DA 2DNGA 1CQNA 2XMTA 3PYDA 3THPA 3K89A 4JWPA 2YNIA 3EWGA 4BWJA 1L3SA 3LALA 2AFXA 4IR1A 4Y2MA 2PC6A 3N79A 2AD9A 3R9FA 2BE2A 1KWMA 1NK6A 1CX8A 3TFYA 3H5SA 3BGOP 4EUVA 4EVYA 3EXYA 4NASA 4URQU 1RHQB 3M9MB 4LF1A 2I8EA 3GV7B 2IQ6A 1CPZA 2D69A 2FLOA 3G82A 5ETTA 3VHQA 4ZPCA 1XNRJ 1LW0A 3QPIA 3KMSA 2I5JA 3HHDA 5M2PA 4HTJA 4RW8A 9RUBA 1VHFA 1OYDA 4ECXA 8AT1B 4USTA 4PZVA 4QOTA 4CT8A 2BW2A 1TVRA 2PJ7A 1NM2A 1YRTA 2HAIA 4OADA 4GRSA 3OHBA 1VQLS 2IBKA 2DK2A 1NRKA 4LF2A 3UI3A 2CA9A 3MM8B 4R25A 1KOOA 4KJIA 3MD1A 3H7HB 2JWNA 4P73A 4JI0F 4UQTA 1Y00A 4WPAA 4RI1A 1S1VA 4KV8B 2VFTA 2G2ZA 1T03A 1GQEA 4YRHA 1WHVA 2R2UA 2NLWA 1RGVA 5C24B 5CAAA 1S1WA 1NDCA 1CBXA 3K2KA 1ZA2B 4DV0F 2HURA 1TUGB 4B5PA 4ZJQA 1NH7A 3GPAA 1J5OB 5HH1A 1FKPB 5E3CA 4CTAA 3HSZA 3MM6A 4XDDA 4P10A 3VGUA 4YMEA 4DV4F 4K59A 1V6HA 3KK1B 1NEEA 2ROEA 1OIAA 1IKWB 1FT8A 1X4GA 2C2KB 4MCRA 1SH2A 3DDDA 4NE9C 5E2QA 4I0WA 4KQZA 5CYMA 4L75A 2NPFA 2PDAA 3ENQA 3MN8A 3DOLB 4I2QB 1MJ9A 4EO6A 2I2YA 1IIDA 2BDPA 3AD9C 2AFOA 4OC2A 4AD6A 4OI1A 4G1IA 3CCQS 3ZZ0A 2R8IA 3JS9A 4CH0S 1R89A 2ZBPA 2EC0A 3D7FA 4F9UA 5HMXA 2KT3A 1LAMA 5BYRA 1NK8A 3KHRA 5CD4H 1SJFA 3S8SA 5F09A 3J81Y 3PEIA 2ZW6A 2WVFA 2F8EX 3MMJA 2KH9A 3EFAA 4AG7A 1FRLA 2B8QA 2ZDOA 1TMMA 5F41A 5D78A 3OT9A 2EK6A 4USIA 3DXSX 3DRRA 2P9CA 3KUGA 2VG6A 2ZE2B 1DJ0A 4DL5A 2ZWPA 2OU2A 3IU2A 3C6TB 2CQ1A 3QJLA 3CPXA 3KDNA 1FF2A 2CWKA 1HW8A 2LQ8A 4FD4A 2IRXA 2DNMA 2GJ2A 2CY2A 2XMKA 4LRCA 3TA1A 2KN4A 3QGPA 2UV8A 4C3MA 4C98A 2OI2A 1AMPA 2B6AA 4IH6A 1RTJA 4HACA 1QSYA 5IV4A 3Q89A 3KJVA 1YMEA 3CIMA 1DE4C 2ZH9A 2HQYA 1N36F 2BANA 3C16B 5KFEA 4NSQA 1M5KC 1HIYA 5BWAB 2B5GA 1JNRB 4J9QA 2CNTA 1SQEA 3N9UC 4JXQA 2NXCA 4IKAA 2GX8A 5D0HA 3WZ0A 2N7YA 3IGNA 4EBEA 3DNCA 4CGMA 2C2OB 2F40A 3NLCA 2WSFC 1DFDA 3HKZD 4IK2A 1XOVA 1MROB 4KYZA 2V77A 1CS4A 5KFHA 3W2VB 2OZUA 4OMFG 4FBUA 4AXJA 2RDDA 4NCZA 1NKEA 4HH1A 2YH1A 3NY0A 4Y0FA 1O8BA 4UUXA 1OWXA 3A8IA 4C8KA 4Z65A 1Y7EA 2AYBA 1ZZFA 1K4JA 1N5SA 2Q79A 1A2ZA 1X10A 2GVDA 3J7A1 3B3SA 3UPFA 2CXEA 3TJ8A 1N52B 5GAHI 4W9YA 2LXUA 5B0BA 3D1QA 1Q53A 2B5JA 1RAHB 1Q82T 2QTWA 2WSEC 4KAIA 1GK8A 2L41A 4W90B 5K8OA 4RUBA 2G0BA 3MM9B 1TKDA 2MGZA 4LQ9A 2ZUGA 2Y9HA 4KVOE 4JP8A 2AJ0A 5IT4A 1RBLA 1O51A 2QEXS 1LXJA 3E01A 3BR8A 3CJRA 2KFZA 3ZZYA 4ZVQB 1NJXA 3FQLA 2FC9A 3FEZA 1KVKA 1FJEB 3MEEA 2HWHA 4WFYA 3IR7B 1QUVA 4B9LA 4L3NA 1HQUB 4NPOA 1KVIA 3MCMA 4B02A 1HBOA 1ZAXA 1WHYA 2WZNA 2WHOA 2LECA 3FMCA 3M1VA 3RJMB 4P6QA 1DLOA 2W01A 1VISA 4YB6A 3BJ8A 4RW7B 3K9UA 1I51B 1KFDA 1P1LA 2QJ8A 4JJXA 3M7VA 3R8YA 1VKCA 3AA9A 5IFMA 1TL4A 2UVVA 1Y0YA 5ETQA 1E6VB 4O3OA 2FLPA 2DNYA 5H9EK 3MXHP 2KZMA 3QJPA 4OMEA 4MKBA 4MYTA 4EMDA 4QW8A 2K1RB 2Y3YA 2P6EA 3R7NB 4JI7J 3CXPA 4XK8C 4F25A 3ZXWA 2KT2A 1CLFA 2AZ3A 4AYBD 3DRXA 1I94J 1CEZA 4LSNA 4CH7A 1Z2LA 3KLGA 2FHJD 4C2XA 1UMJA 3GSIA 2DNKA 4QJVA 2J0SD 5A76A 2FIUA 3B4DA 1I12A 4O44B 4Q8FA 4JI3F 1H98A 4RU9A 1R6YA 3R2CJ 3H8EA 5I3UB 1FX4A 4J91A 1VRUB 5J1EB 5DS7A 2CQ4A 3BBBA 1UWAA 1MWYA 1PBUA 3AHPA 4X4TA 1GTHA 1V9OA 3VVUA 4JZ0A 3PO4A 1DTDA 1DHMA 4BCAA 3FEXB 4UOFA 1S12A 1IJFB 1ZO0A 3KQZA 2CQ0A 2XMAA 1WF1A 2YPYA 4MHNA 1HNVA 2HK2A 4FYYB 3B54A 3EMTA 4ICLA 1XNRF 2W4DA 2QMWA 2CQDA 4OI0A 2B4UA 3GONA 3FQKA 2XO6A 5HP1B 1H2UX 3AH6A 1SC6A 3GKRA 1BQNB 2D9PA 1J4JA 5G0RA 1HWJA 3HFZB 2OMOA 4M5LA 4EU0A 1U1LA 4U6PA 3OW2R 3MEGB 3FJUA 4G1QB 3PRBA 1D1UA 3UFCX 4Y2IA 4CO0A 2WONA 3JSRA 3UE2A 1ULRA 4CLPA 1WOOA 2F1FA 5IZHA 1NBEB 3NMAA 4RUHA 1FJ7A 3UNYA 3DRSA 1RAIB 1WORA 4RBTA 2DB1A 4Q0BA 1U2CA 2M70A 3QRQA 3I31A 1VQ4S 2A6MA 4Q2MA 2JRSA 2L9NA 1PSDA 1R7IA 5JQ4A 1R3NA 4IDKB 4ECYA 1HYSA 1SC4B 3J81U 3HKWA 4NGRA 4LJMA 5LL6d 4DFKA 5H9FJ 4CH1A 1GHEA 1VYAA 3PVXA 2UVRA 2AJ1A 5LRKA 3M8YA 5IQQA 3V6KA 1NDPA 2A18A 2F4FA 2BSWA 1VK3A 4TNOA 5CA5A 2FVSA 4YUDA 4FPIA 2GGPA 3UO0A 3OTEA 4LF6F 1EP4A 2F9DA 2B7BB 4OYZA 1U02A 2AFMA 1N5YA 2RF2B 2X1BA 1TU0B 4FYDA 2Q4ZA 1M4GA 3CCLS 4KVXA 3NCPA 4I7FB 1Q8LA 1R27B 2M7SA 4F4WA 3UR0A 3T90A 3DOKB 3I5BA 3RBEA 4MHDA 4O3PA 1S49A 4DL6A 4LFCJ 2F65A 3ITHB 4IFYB 2KZZA 2XULA 2VXKA 1VQOS 2RHQB 1UTAA 4BMHA 1FEEA 4IFVB 3HHKA 3CMES 3TANA 2J9EA 5LMUF 3M32B 4HEA9 3TVZA 1ZPVA 4AQYF 3KK3B 4OIDA 1VC5A 1T05B 4WK1A 1BO4A 2W9CA 5LM7E 1JMTA 1M90T 3CJ0A 1B64A 1UEKA 3ZO7A 1PC5A 1U4BA 4M94A 1SV5A 4KSEB 2ROGA 2I0XA 1F2PA 3GIRA 2ZEEA 8CPAA 4WXWA 3MECB 1G3OA 3WIVA 3NFZA 3EX7B 2W2PP 2KG1A 3KQXA 1Q81T 2VJUA 4UEEA 4WWVA 4HNWB 3AA8A 3NAIA 1WELA 3QFWA 2F63A 2C3UA 2V2QA 3HCXA 1FFWB 5D4LA 1MWQA 1IYKA 2IHR1 5L39A 3W1YC 3KG1A 2CPYA 4ED7A 2WBMA 1B0VA 3MR5A 4F4AA 3H90A 1AW0A 2CUYA 3G6ES 2BW7A 2DNOA 4LBIA 2DR6A 5C42B 1KC8T 1JQGA 5B0FA 2ZH2A 4K4VA 1PYOB 1PG5B 3MM7A 4FS2A 1HNWJ 1M4IA 1BY9A 2LU2A 3KL9A 1LCPA 2BJ7A 4ETXA 2D7SA 1HPZB 4OZ1A 2ROPA 2MHNA 2X1FA 2V8HA 2JEIA 2O5DA 4DF8A 2OD6A 5CH7B 4M6HA 2LA6A 3W60A 4DV7J 3DGPB 2ZH7A 4BC9A 3SSRA 1LRZA 3AJDA 4P2SA 2V0NA 2C2DA 4HKFA 2A10A 4UCNA 2W8LA 4OHZA 4K4SA 4KH1B 4UBRA 4BWMA 2MQLA 2LMIA 4ZVUB 1UJ4A 2HFOA 3MOJB 4RO0A 4MCQA 3BB5A 3F8KA 1GT8A 2OEMA 3HHLA 1OJ4A 1HLWA 2BUEA 2N3LA 4WFAQ 1K47A 5C88A 2B4VA 1IKYA 4I49A 1FXLA 4UFVA 2ZZMA 1CJKB 1AA1B 4DV2J 4DBQA 5LMNJ 4YFJA 4C6AA 3QIDA 1L3TA 5LOQA 1L3UA 2IPOB 1ZLIA 3GJQB 3UD5A 2LQJA 4PSWA 4JI7F 1IKVB 3GLJA 2FGOA 2CADA 2CXAA 2GO9A 2OB0A 5KFRA 1VQ8S 1C0TB 2RQMA 1LWXA 3BH6B 3NL0A 4NI2A 1WSRA 3DM2A 2RSQA 3C14A 3I3GA 1TUVA 3DCAA 3IR5B 4QIFA 4CT9A 3KG0A 3RBZA 5D8HB 3FSIA 3DN9A 4UFWA 2GHPA 4J9KA 1L3VA 5L1IA 5DETA 5KFGA 3ISNC 1ZG8A 1T94A 3CJSA 4M5DB 4IH7A 3UN2A 1RP5A 1AB8A 1NLKL 4F0XA 4B3OA 3TOQA 1S59A 1SXLA 4Y28C 2IC3B 5M2UA 4HHUA 3ZZTA 2K3KA 2GU2A 1HBUA 3JAMY 3TX8A 3V4IB 4Q8EA 3H25A 3HHLC 3FEYB 4L73A 1HWKA 4GKJF 1IQTA 2VZYA 4GS4A 2BQRA 1N71A 3MFIA 1S6QA 2YNIB 3G2XA 2PJ3A 1P8GA 2Q7SA 4CWBA 3H98A 2WZ1A 2VZ9A 4LREA 2BE2B 4AB7A 2DY9A 5F8MA 1NSLA 4J9OA 3G8QA 3CJQA 5L1LA 4URGA 3PRDA 2YWKA 2CDRB 1RT6A 3MZIA 4LRDA 3T1AA 3G82B 3MAAA 3G96A 5JVGQ 1LW0B 2I5JB 4LSZB 4RW8B 2PJ6A 1N6QA 5G1ZA 3IEHA 4Z37A 1N33J 1EIYB 3TO6A 4PWUA 2ACYA 1D9AA 1TVRB 3NOGA 3BBCA 2UXDJ 4DFJA 3RRKA 1HD0A 1T11A 2C28A 3BGUA 4NA2A 2GAGC 2PI4A 4QU6A 2ZD1A 2J7WA 1AT1B 4N47A 5AG6A 2CZVC 2BEFA 1FKAF 2DY1A 5K5MA 1S1VB 5A28A 4QYZK 1CPXA 3U02A 1T03B 7FD1A 2RFHA 1FTCA 2VUGA 1PJ7A 3F56A 4O3QA 3BDEA 4HL9A 1NK0A 3HLUA 3Q83A 1YLEA 4DL4A 2JHEA 2YNEA 2QIFA 1S1WB 2I3CA 3MTKA 3D8PA 4B5PB 4EEYA 3TJ9A 1JLEA 2HGMA 3IS9A 4CTAB 2LCWA 3MM6B 1U8SA 3KASA 4NGPA 1A9NB 3SFUA 1IU8A 1M0SA 3PFOA 3MDFA 1NZAA 1JXLA 1GMWD 3GR1A 2YH0A 2JC1A 2IJFA 3QBCA 1PUAA 2DBBA 5DG8A 1XC9A 5CYMB 1XK8A 2CZ9A 2YVSA 2F7VA 4AUKA 4DG1A 4OZ5A 3MCSA 3PTWA 2HHPA 3BJYA 1FNMA 3LMSA 2OHDA 4C0BA 3CCRS 5JMNA 3CULA 2YPZA 1LV5A 2XEFA 4B10A 4H4MA 1BPNA 4XAKA 1BC6A 4K30A 3OJSA 3VAFA 1BUXA 1VR6A 2XSJA 3DRYA 1UZHA 5E3AA 3TO8A 1EJ7L 4CGPA 4OAEA 2WSCC 1YREA 4EMEA 5KT3A 5HN0A 5KFYA 1RWPB 4A8XA 3W62A 4RWWA 1FJCA 2POKA 5A0YA 5CXTA 1FE0A 2CJXB 1NSQA 1YG0A 3PZJA 4M5JA 2NR0A 3DRRB 1HMVA 1W7WA 2VG6B 2MB0B 4TU7A 1YBUA 1SQFA 4OJ1A 1Q8IA 2OAUA 4JI2J 2VH7A 3IWXA 5GAEI 1M4DA 2WPXA 1WKKA 2CQHA 4PG4A 2BJ1A 3GYGA 3BI1A 4L6V3 2HIYA 3ULHA 5FJ4A 3HI9A 4ZY0A 4LUBA 3BZQA 2WVBA 2DNPA 2B6AB 1RTJB 4HACB 2ZVSA 1U45A 1SJ1A 4PK3A 3KJVB 1OPZA 1HNXJ 2VKRA 3LWLA 2BANB 2QLFB 2RS8A 2B5GB 5CNPA 2QRRA 2F8MA 1Q8BA 3GP9A 2BXJA 4JYWA 4DSLA 2LVWA 1HNWF 1ZAWA 4PK2A 5I3QA 4UZCA 5F8HA 1U6ZA 1C0UA 1QAJA 4QWCA 3SI0A 2HK3A 3NCRA 3QO9A 1RA6A 3AAWB 3FCWA 3NXZA 1NSPA 1Y5NB 3B4MA 2YNFA 1ZAVA 4CCHA 2HNZA 4N8NA 1MMNA 2CDQA 1CS4B 4ECTA 1WC6A 5KFVA 2J6UA 3POTA 2JVOA 2VDHA 4DV7F 2V63A 3GJTB 3EZOA 2H9ZA 4E0AA 1SIZA 1OZPA 4N41A 2Z10A 2RIJA 3TC8A 4K4UA 2PCUA 2Z4PA 3D7GA 5AXLA 3D6FB 3NGRA 3OFGA 2B3VA 4I68A 2GVDB 1MWZA 2HBRB 4F0MA 4YHHF 2R9LA 5E5NA 4AG9A 2I38A 3BKFA 3I32A 1SUQA 3ENWA 3IGVA 5LYDA 1YK3A 4JV2A 2B5JB 5U47A 3D2MA 1N34J 3Q24A 3I5AA 5LJ3Y 4DR7J 2Z11A 2JLEA 3Q8RB 2DKOB 2MGZB 4F2RA 1X9SA 2BE9B 4GVLA 4C97A 2HHWA 2RC4A 1AZSA 4K7QA 3E01B 2XCPA 3FFIB 2DRDA 3IJ3A 1FK9A 4NGMA 2D3OR 2GW8A 5F8GA 3MEEB 2G13A 5LSRA 2FZCB 1QMUA 4LMZA 1HBOB 3N6LA 2EO8A 4CIOA 4KTQA 3Q23A 4IUSA 3G87A 3M1VB 1S9EB 1DLOB 3Q2SC 3RBUA 1U26A 1IJEB 2ODFA 2VA3A 3SXOA 1X0PA 3QJJA 1JK9B 4YDXA 4P2MA 2JEWA 4DSJA 4MKVA 4ZP7A 2HQ3A 5GADI 3K5PA 2D3UA 3GCXP 3UY5A 4O23A 1YITS 3CCMS 3CXCR 1F0XA 4P74A 1WHXA 5D4NA 5C25A 2MTLA 4CLLA 3CCZA 2W1BA 2Y8YA 4OC0A 3HSGA 1HEEA 3MAQA 3A4TA 1KTQA 3CMAS 2YKOA 1R8AA 3BEGB 4FBTA 3G6XA 3R6LB 3KLGB 3F73A 3FZ2A 6CPAA 4ED5A 4KGMA 2GFFA 1NPRA 5HBMA 1L5UA 4N5SA 2CVEA 5CZXA 2XZTB 3V38A 4U67Q 3HZEA 2MY8A 5DRKA 5KFMA 1HBNA 4ORFA 1MN7A 4PQAA 4LF5J 1ROFA 2FGCA 1ZYQA 2ZW7A 1WF2A 2YKAA 2XTJP 2LQ9A 3D5MA 4OX8A 1Y5IB 5DLFA 4P45A 4R9MA 1IKXA 2C3MA 2OD4A 2AJ4A 2OEKA 2CVIA 5D3GA 1TELA 1IOIA 2Q51A 1NDLA 3R27A 1HNVB 3SIPB 5CQGA 4ICLB 2R7TA 3B3TA 2NXEA 5GMKa 1KHVA 1RWWB 4DU8A 3KMQA 4DJBA 3QT5A 5G0RB 1NO8A 4MJKA 1TFWA 4K8RA 4RBVA 4DYOA 4WP9A 1T8EA 2UXDF 1VIXA 2EKYA 3GSDA 3KUEA 4ZPTR 2Y1IA 1HR0J 1XE4A 4EFDA 5KFOA 4ZIVA 2JBKA 3DRSB 2ZW5A 3A13A 2HW3A 1B87A 3IC1A 4MFBA 1PAEX 3BF4A 4HHHA 4Q0BB 3K0JA 4P52A 4LX9A 4R0JA 2QLBB 2W2NP 4ZCMA 2CTCA 3LP1A 4RL1A 3KDOA 4Y65A 1XQIA 1P9QC 3BGRB 1N32J 2XLIA 3CC2S 5DDQC 3BSAA 3D3BJ 4CM2A 4ZLLA 2MZTA 2ZPAA 1KQGB 1IWAA 5KG5A 2QN6B 1FNXH 3IG1A 2J7UA 1NKBA 2GGPB 1EP4B 2B4BA 5E3QA 1N5YB 4X3RA 2VBWA 4M5IA 1FRIA 1GX5A 4A8YA 3VQTA 3BKUA 2PFFB 4ES2A 3B2YA 4CLSA 1UW9A 2ATCB 3UVJA 1IVZA 3LTOA 3W7BA 5DWNA 3HHEA 4IOBA 1VRQC 3TVKA 1N0UA 3BPSP 3U27A 1WG1A 1VGYA 4ZLNA 3S6KA 2G1HA 4NWBA 4NGNA 3SEOA 4CM0A 5KFFA 1Q0NA 1N4LA 2FJBB 3P96A 1JLGA 5CCMA 3CPAA 1SBRA 5FIIA 3DLGA 2PJBA 4XPDC 1Z1ZA 1H2VZ 4KIAA 4I64A 4LF7J 1FXDA 3UCGA 4DX5A 1UVKA 2W9CB 1UVNA 4N76A 4UOHA 4JI2F 4I4BA 4YR3A 2NZ4A 4FN5A 2Z8QA 1DTTA 1UFWA 4HLBA 1SV5B 4WU2A 3EZUA 3R97A 3BJ7A 4X2TA 3SQGA 4FF1A 4ID8A 2HBZB 2VBXA 3LQVA 3LANA 1JKHA 4WF9Q 2ACMA 3ZNJ1 1Z5RA 3MURP 1U6BA 4ZKAA 5B09A 1FRJA 1UJ6A 3EGVA 1EB0A 3RBXA 4TU8A 5A2QY 1IBMJ 1F1BB 3TUJC 1HNZJ 1T7PA 3VVTA 5F0UA 3SI1A 3JQMA 4PRFA 2OPQA 2CAJA 5IWAJ 2KCWA 4WP3A 2ZH3A 3PM9A 3C46A 4MYUA 1L3KA 1RT2A 4NLTA 3QSYB 4PYDA 4PG5A 2MSTA 3F0AA 4NLYA 3CE8A 1T3OA 2J6TA 3V2UC 1SH3A 5AXKA 1QVFR 1HD1A 3GILA 5F8IA 4USKA 3SQOP 4UY85 2Q66A 1HQEA 4NLQA 1Q1KA 4UF4A 4IOCQ 4QIVA 4TWEA 2HWIA 3KHHA 2XI2A 3MM7B 2OKQA 5C2CA 2P6GA 1A6LA 2LKZA 5DDOC 1UVMA 3KLIA 2JFDA 3EDRB 3P6YC 4R57A 2UUCJ 3WC2A 5GAGI 1FKOA 3CB4A 3BI0A 2HNYA 5LXYA 4KZTA 4L89A 3G86A 3NNCA 4OKOA 2C2MB 5J2MA 1N34F 1QDUB 2VC1A 4AVBA 2Z0ZA 4MFKA 2HZCA 5DM7Q 1NK4A 4YB7A 4MMOA 2AFUA 4ZN3A 2ARHA 2VF3A 5DG9A 1NJYA 2BR0A 3N5FA 1BLLE 4MJ8A 2FVPA 4P4JA 3HDSA 1U0HA 1JIHA 3BH7B 2FZGB 1MNEA 2Q04A 2IRYA 3KLFA 1K9MT 4KORA 1YJWS 3KJQB 2ZVIA 3HHLB 4WFNQ 3TUPA 1VRTA 3CWJA 3Q22A 2CNSA 2KM8B 5IOLA 2PR1A 3FF3A 5DWMA 4DF4A 1ZZNA 1FVSA 2LU1A 2BA9A 1IKYB 2PA8D 2DGWA 3GG0A 4JYAF 2XQCA 3OTDA 1NB2A 4LF9J 3BN4A 1PC4A 2IJRA 2UXCF 4Z2XA 5DGBA 1QAIA 1WACA 2VPYB 1IBKJ 3FRMA 3ZZRA 3W3SA 1OYEA 3UDVA 5F46A 1WUUA 5HQMA 1F3FA 1R0CB 4P75A 3CJ5A 1EAYC 3CC4S 4NI2B 1AROP 2I00A 3DM2B 4OV1A 3C14B 5JH9A 4JLYA 3MCNA 5HAOA 3CIZA 2AYEA 5DQGA 1UP1A 4B5OA 4J5OA 1MK4A 2F9JA 1Q78A 3B3WA 2E5GA 3T8WA 4FF2A 1RUSA 1UL3A 5IC4B 3WR7A 5L46A 4B3OB 4YP3A 4X4UA 2DHXA 3KJNB 1RT7A 4B17A 3ICLA 3Q8PB 3M30A 4ZX9A 1HBUB 2ZHOA 2VEZA 1IB1E 2QT7A 4OC1A 1RKJA 2ZXVA 1JXEA 1G2EA 2XLKA 2VODA 2EI5A 2DNLA 3PBEA 3EYZA 2QFJA 1DARA 4F67A 3LAMA 4A95A 2M52A 1V3SA 1RYRA 4DS5A 1S6QB 2AJ2A 3JTKA 2R2RA 2DCLA 4OZ3A 3ZZPA 4H89A 3CSKA 5HVFA 4CQ1A 3PY8A 4DPOA 4G6VB 3B82A 3GFZA 4NYOA 2PQ8A 1HR0F 5IT9Y 2CFXA 3RAMA 1JJ4A 1NPKA 2ZEFA 2DTJA 2QE5A 1RT6B 1Z8XA 3VAIA 1PU9A 4E8OA 2V94A 2HQIA 2EBGA 3C19A 1YJ9S 3M05A 2CG8A 1BOBA 4YOEA 3MAAB 2RRAA 1YJNS 4NL5A 4CGLA 5KG6A 1N6QB 2L3MA 3BO4A 3H0PA 2JC0A 1F5CA 2R8KA 4R76A 4PG7A 1TUWA 3RB6A 4WFBQ 4IO1A 4ZVGA 2HHHJ 3UCZP 2M2BA 2LDYA 2C27A 1YLOA 1I3OB 2R4FA 3GIMA 2WBRA 3E51A 2ZD1B 1KLNA 4IHMA 2XY5A 1TIQA 4K3NA 1RXTA 4PPDA 2GIRA 3G6YA 1KUYA 4NCAA 3AXKA 2IYGA 1NHVA 8ATCB 1JX4A 2CJBA 4CLYA 2HNDA 1M1GA 1RT4A 3KKFA 3EVMA 2MQNA 4DHVA 4R6TA 1GFWB 5ETVA 3GYXB 4ZGYB 3FC9A 1YHQS 5LXRA 4NOHA 1JLEB 4MFZA 3IS9B 2PJ2A 1WC1A 3ETMA 1JJHA 3PRTA 5A2QU 3SCIE 4DN9A 3H8YA 1D9DA 5EUHA 3IU1A 3WX8A 4QBJA 2LEAA 4ANCA 4KS9A 2X1GA 4C2MA 2AT1B 1FE4A 4ECSA 2BQ3A 2YKNA 1JLCA 1RT3A 3BR9A 5EWGA 3W8GA 4J9MA 4AFFA 4C2YA 4KSIA 1KD1T 4NXNJ 3SI8A 2VPZB 3K8WA 4DG1B 3JTOA 1X4EA 4GC6A 5K8NA 3V5RA 5E96A 3CDUA 2AJQA 2DH8A 4WBFA 4BHQA 1HA1A 1PILA 2HYIB 2LA4A 2MMYA 3KKWA 2CIJA 2RAQA 5EWEA 4H4MB 3HX9A 1YI2S 4C8LA 1S57A 4KBIA 4UW2A 4F2SA 2FSRA 4GMKA 2A2DA 2XSJB 3FX6A 2FJAB 4QR0A 4E8UA 2GIQA 4UFXA 4C9DA 2PT0A 4ZY2A 4Y00A 1NKCA 5E0OA 1F9HA 3MMBA 3QYYA 5A0YB 3VAGA 1J27A 1T9XA 2XI3A 1HMVB 4CO1A 2KXFA 5K8PA 2UZAA 5IWAF 4ECWA 5AXMA 2JEJA 2X3GA 4DZ6A 4QPTA 1J5EF 1N5QA 3BREA 2Q3PA 4C8OA 4DR1J 2DNZA 1VDHA 4ECUA 2BRLA 1U7LA 1JLAA 5L9NA 4X4OA 2AJ6A 4PYAA 3D3CJ 3CCSS 2VFSA 3D2PA 1REGX 2WK4A 3Q8QB 1XR7A 1MMLA 1VHEA 2HVZA 2AYMA 4USUA 4DJLA 2RU9A 3GUXA 2FZKB 1U1OA 1APSA 1T0TV 1BHNA 2OH2A 3FDSA 2ZH1A 1YVKA 4MHPA 3VGSA 2XGQA 2E5HA 5IC6B 3ADAC 3K5MA 1MG7A 2WOMA 4WIIA 4MAKA 1C0UB 4NA3A 3JSMA 1RCOB 2BJ8A 2QYGA 2HHTA 4LFAF 3QO9B 2PC1A 4OQJA 4V19X 2YNFB 2R7QA 2KYZA 1H72C 2HNZB 3B8GA 3RBDA 2ZEHA 1CULA 2M0GB 4F3QA 3POTB 4C7IA 3WDOA 2QIRA 1LXNA 1XF8A 3A8KA 2F4VJ 3QT6A 4FD7A 4QIGA 2CRLA 1RWMB 2KHDA 3THTA 4MFQA 1F60B 3L95X 3NBPA 2RB7A 3M8ZA 3GQCA 2P0WA 5HMYA 5JJBA 1HNIB 3TOBA 1S6OA 2E1MC 4R8UA 2HRUA 3TQEA 1H8LA 2BOAA 1TAUA 3WIUA 4C7QA 3CVKA 2CNLB 3F0NA 1HW9A 3VAKA 1SUQB 3S6HA 4OHXA 4EZ6A 2H5EA 4U5YA 4ZVPB 5DLGA 2HQGA 1RAOA 4ZPBA 2ZJRQ 1FHTA 2K2PA 4WYLA 3PYEA 5KT7A 2XHCA 2V8GA 2IA0A 5F49A 4TVAB 4BD9A 5KTCA 3TE4A 1AZSB 2W9AA 2YBVA 4OYMA 3I4PA 1KS2A 2MLXA 4LF9F 2JEFA 3PX6A 1QTNB 1VQ7S 1E6YA 1FK9B 1SCJB 3RB4A 1BMQB 2GIFA 5H86A 5H9EJ 4UA3A 1NPPA 4JI4J 3CT9A 2KKHA 4B3TF 4MIWA 1IBKF 2REEA 2CNKB 3OQ2A 2REFA 3TX0A 3EE3A 1YTYA 1Q2YA 3IXQA 3RO0A 5KAKA 3R5GA 5IT0A 1FVQA 2W2MP 1GXUA 2Z3MA 1UW4A 4X84A 4AXVA 3NWRA 3QGIA 4DQIA 2BABA 1B3TA 2HRYA 2V4JA 3BGFA 4ZIWA 2WRMA 2UXBJ 4ZPWR 3CD5A 3PX4A 2FVCA 1QQ9A 5KFCA 2LLZA 1O5JA 4J37A 3TUIC 2D74B 2EPIA 5C25B 4WZMA 2B0GA 5B08A 4A30A 3NS6A 2C6GA 4DR2J 2XY7A 3MEKA 1UFHA 4URSA 2GLJA 3ZNUA 1PYTA 2HRTA 1GNKA 1TL1A 2BV3A 3EXNA 3MMCA 5HBMB 2P6FA 4LRBA 2V6AA 5F9NA 3TAMA 3LODA 3X3UA 2RT3A 2R2TA 3PB8X 1PJ6A 2UVUA 1HBNB 2FTRA 3CEDA 2V67A 3P5BP 4JI1F 4CLKA 4YFUA 4LFBJ 1HBMA 1QSLA 2HMIA 3FEDA 3G8TA 4X66J 4JI6F 4II9A 1WKJA 4YB1P 1YZ6A 2AGOA 1NHKL 3T9NA 1IKXB 3P8BB 4RBUA 3OTOJ 2WTFA 1Z4RA 4KR0B 5D3GB 4ENOA 1X12A 5KG2A 3QAYA 2Z0GA 4FNIA 4LQGA 3ELHA 2MZSA 3FNNA 2PVWA 2DGUA 3R3TA 1RE1B 1RSCA 3GYNA 1NJWA 3E3XA 2W7OA 3M2VA 3K5OA 1CC7A 2IMWP 2XEGA 2GHVC 3RRGA 4O3RA 3CDAA 4F3MA 5KFBA 5J2NA 4DCJB 4GO7X 5THWA 3SJXA 2L48A 3IAS9 3JSBA 4XPLA 3QRPA 2XHWA 1NE9A 4UCMA 4PXCA 4FUUA 4MFBB 3MGJA 4ZPVR 4XPDB 5BR8J 2WCXA 1FXRA 1JJCB 3W6SA 2ZW4A 3I9ZA 4DV5F 3HHNB 2OO4A 3PR5B 3LP1B 3H5UA 3HSJA 4DDFA 3W5ZA 2YTCA 4X4PA 2NSMA 1FWPA 3A9LA 1LANA 4DR4J 2JDCA 4JI8F 2MZRA 1X5SA 2V50A 2QC3A 2O53A 2B58A 1VHIA 4P9SA 5KFIA 3IG1B 2DR7A 1QY7A 1FRKA 4TU9A 2MHEA 2BOPA 2OP5A 4NZ0A 4FYXB 2E7XA 2V5HG 4RKUC 3K17A 1G1XA 1WHWA 2HEKA 4KOUA 5F3ZA 1QJHA 2WW4A 2VFRA 1Z8TA 2Z2ZA 3A3NB 3UVJB 2G4BA 1RKIA 4KHPJ 4USWA 4Q36A 4K50A 2CQPA 2ZEPA 3IMQJ 3GIKA 2VHGA 1W26A 1FRHA 1FFSB 2FIWA 7AT1B 1KRPA 5A6PA 4JV5J 1GXTA 2E66A 4DZDA 4A32A 2APOA 3PKMA 3V8IA 1JLGB 1VBKA 1F2OA 2HFSA 2OTLS 2IIHA 2C3PA 3DLGB 3UD4P 3MWBA 2QLXA 1JWQA 2R8HA 2LXIA 1CQMA 3N28A 3R9LA 1N48A 1VQ6S 1JLBA 1KFSA 3AQOA 4NEXA 3WC6A 4F6AA 4PXDA 4HH0A 3O6QA 1DTTB 4DR6J 1F2GA 6FD1A 1XMOJ 4O0IA 2DPSA 3GIUA 3SQGB 1R8PA 4NZ6A 1WI8A 2CQIA 4G65A 1B0TA 4K4YA 2VG5A 4DR1F 4NCGA 3H8FA 1JKHB 3HJVA 1S72S 4GKKF 1V0CA 1UPPA 1TMJA 4CLUA 2FHJA 3ISZA 2QFIA 2MZQA 2RRNA 4DPYA 1SKUB 2YKMA 3EPIA 1V5IB 2QYVA 4NA1A 4ZVFA 1Z4EA 2HHUA 4MIBA 5CHCB 2XM3A 4DL2A 4QW9A 2OPQB 2C3OA 2D3O1 1IWGA 3SJGA 3K7RA 4M6GA 4OX9F 1RHKB 5A6WA 4OP4A 1RT2B 4DFMA 3HK2A 4BBYA 1RTIA 2DITA 3KLEA 1EKSA 4B9SA 1ARLA 5G22A 2PO4A 4OV6A 3D9BA 3MM5A 2QMLA 2BRKA 1M4LA 3SHPA 2NSBA 3T41A 3M6WA 2A4NA 2R2SA 2ZELA 4DV3J 1HQEB 2F4VF 1M1KT 3KHLA 1K1SA 2VDIA 5B0CA 4OC4A 1MJBA 4J9UE 1Q7YT 4WFZA 2FJEB 2VBZA 3KLIB 4MHZA 2HQDA 4OZ2A 3TRGA 4F4ZA 2V8PA 3FRZA 4IF5A 1SL2A 1FKOB 2P6SA 4MHYA 3OVSA 3CCVS 1NK9A 4B12A 4Z7CA 1DZ5A 2ZNYA 3DHXA 2P9GA 3JB9k 6AT1B 2JDDA 1IUJA 5J2MB 5F9LA 2P6TA 1FA0A 4TKTA 3HVRA 4CYQA 4ZY1A 5AT1B 3TA2A 4ZLJA 2Y1RI 3FXTA 4OLLA 3TNVA 1WG4A 2VPXB 5CPAA 3ZTRA 2DHAA 1WNEA 1U0HB 2CNMA 3B35A 3UDEA 5D0RA 1PBAA 3KLFB 4JI4F 3OD2A 2CPZA 1RAGB 1WTFA 2E9RX 4LBPA 3W63A 1PGZA 2OMLA 2GAHC 1FD8A 1VRTB 2L9DA 1SKWA 1F9EB 2EK9A 3GJRB 3BLNA 3EGWB 3G4SS 4IAVA 2ZOGA 1X9MA 4X4SA 4OFZA 3WT4A 2AIRB 1YQHA 5SUHA 4GM5A 1KHWA 3KHZA 2BKPA 2UXBF 2GFQA 1LOUA 2AQ4A 2FPHX 1KQSR 4C8ZA 1X5TA 2JFKA 2ZOFA 1NSKL 4DR2F 1UJ5A 3T1YJ 9ATCB 1XTZA 1OSDA 1EE3P 2R8JA 3VWSA 2HIQA 2HHQA 1DQ9A 3EC4A 4DUZJ 2UUWA 3AD7C 4JI5F 3KTQA 1WSVA 4NRUA 3QT7A 2DT9A 4NF1A 2Q0YA 4DL0C 3S7RA 5KG3A 4DUKA 3I56S 4CDIA 1VK8A 4NGQA 3DR6A 5DM6Q 3QWPA 1NAQA 4LFBF 3MPYA 3OR1A 3W9IA 1RT7B 1YK9A 3M30B 4K0KJ 1YQEA 3AOCA 3LGNA 3HJFA 2GCFA 4X66F 2HHSA 2HS3A 2E9TA 4DR5J 4UTGA 3OTOF 3CJ2A 4O3NA 3BKTA 5AG5A 1RWOB 3VARA 4QZVB 4QIEA 4LVOP 1D8YA 5E41A 2VQFJ 4ZMMA 1N54B 1R8BA 3CO9A 1VBZA 1TF9A 1QAXA 2HGLA 1N5TA 2V4QA 1URRA 2C6PA 2RUGA 1H2TZ 2NYQA 2HQCA 4B13A 2VASA 7FDRA 1YZ7A 5KFAA 1VQ5S 1Q5YA 4ZHRA 2JLFA 3MI7X 2NUHA 1RAEB 1Y3KA 1T9TA 3H5XA 2VONA 4EBCA 3GFXA 2GIVA 3PZPA 2Y0BB 1HHQA 2ZH4A 5HK4A 2RDIA 1VQNS 5BR8F 2JSXA 4USMA 4DR3F 3J7YI 4QYZJ 5EX3A 4ZX8A 4XPCA 1RTHA 3R9GA 3V81A 2FVRA 1RU2A 3PHTA 3KK2A 2AFZA 1RWNB 2BVZA 4ANEA 1NHUA 1X4FA 3FMBA 3N0VA 2ZWOA 2AEMA 3D6HB 5K9FA 3AXMA 3PEJA 3B3VA 3FH4A 3KGQA 1BWEA 3CXQA 1FRMA 1WOPA 2J76E 2JNJA 1KLMA 2N7CA 4ZA1A 4OL8A 5L8RC 2BM0A 3R1LA 1LOKA 1IOFA 3GZ7A 2IBOA 2GMHA 2P2CB 4MXUA 5F8JA 3S9MA 3N4WA 2HNDB 1RT4B 4UOCA 1B4SA 2JH3A 3PIPQ 5D8NA 4KHPF 3DLKA 1OS5A 4W98A 2B3TB 4U8VA 1YWXA 1YJUA 2DEJA 2C42A 4OI4A 2DNQA 2ZEMA 4MFLA 4JV5F 2G3TA 2VB6A 2Q7BA 4QC6A 1RZMA 3MPDA 2FB0A 3PB4X 2VOOA 2OSRA 2DXDA 2YKNB 1JLCB 1RT3B 2J0QD 2WUUA 3SFGA 3HO1A 2IY5B 4YQWA 1S6PA 3SSQA 2R7VA 1RTDB 3TJAA 1TK0A 2GV1A 1QSSA 3OFEA 4MFJA 2PJ1A 3R5AA 5DDPC 4YU9A 4N8OA 1YBAA 2IM0A 4M5KA 4U7CA 3G3SA 2KFNA 3GY9A 2W2QP 5FLXU 3RB0A 1XMOF 3CW2C 1N8RT 3ZTPA 1UWBA 1HI8A 4P7VA 4C11A 2X51A 1VBYA 2K8GA 3OSPA 4J9PA 3PO5A 2CPXA 2DRBA 1NJZA 3OXGA 3BXMA 3MMBB 3M2UA 2PJ5A 3PW5A 2CG4A 4OHYA 2O4HA 4A8MP 3JQJA 2Y1JA 4P4IA 2FHMA 4ZI6A 4PWDA 4P6YA 1Q8KA 3EGZA 1H0HB 3MR6A 1T9UA 3NGUA 2P8IA 4DSKA 3ILOA 1FNOA 4CYOA 4NYZA 4H4OA 2CYYA 1C1CA 1TKHA 1BXNA 4IR9A 2NZCA 2XZWA 3J7YU 4H6UA 2C1CA 1MLAA 4I6YA 3DLEA 1Y0HA 2IVFB 1JLAB 3E0KA 3US5A 1PKUA 3OFHA 1Y11A 2PIYA 2DHGA 1H6KX 4IG0A 4DOZA 4IRKA 4DV3F 3VZIA 1IY7A 2KT5A 1R8HA 2R7OA 4ED8A 3Q0AA 2F5IA 3FK4A 3GG1A 4DPXA 5DS0A 4LRAA 3W6XA 3NGDA 3IBWA 1GX6A 4U96A 2BO9A 3N6NA 4U9RA 2IAJA 2DNHA 3C15A 2WOMB 2G0CA 3JSMB 1U25A 2R7WA 2D9OA 4MT1A 3GYAA 2PA3A 2VZZA 3CGIA 4MTPA 3UWTA 3G6VA 1VQKS 4C8NA 1SH0A 3HUVA 4QWDA 5KG0A 1WWHA 1CULB 1GYTA 3IIBA 3VGTA 3MRUA 4OIXA 2ZEDA 1IBLJ 5KTDA 2PSZA 2JBJA 1IN0A 3PNIA 5EN1A 1UVLA 5KFTA 4UZBA 3R5JB 2FIAA 3J80U 4BDPA 1H38A 3NBPB 4EI2A 3LW5C 1MMDA 4HKQA 4CAEA 1SJ4P 2PSWA 4LSLA 2SXLA 4R8UB 1F6TA 1NK5A 1HL6A 1LK7A 1WEXA 4NLVA 1RHUB 2DCUB 1ZM4A 3NEKA 4M85A 3U7JA 3ONQA 4MRIA 5K20B 1VLOA 2Z2LA 3P2FA 5HXDA 3V4MA 4ANDA 2C6CA 3I96A 3NOCA 4HNYB 3D4JA 2YY3A 4CGNA 1S79A 1S7LA 3M9NB 2HWTA 1B6BA 5I42A 3S1TA 1OO0B 4EZ9A 1E6YB 3OL8A 3MTJA 3BSCA 1FCAA 2AYGA 3TR5A 3KR4A 2GREA 2WW8A 2J8RA 4F02A 2G2YA 2HS0A 3H4QA 1QM9A 4K2XA 2Z3KA 3EZ5A 1R43A 2IDLA 4UCPA 4NGSA 2KRBA 2KI2A 4ERDA 1SQHA 4MK9A 2D4PA 4WE1A 1YGHA 4R8FA 2ZM6J 1NB7A 1GMWA 4A46A 4EWTA 3DMJA 2V4JB 4ZJOA 2UUAJ 3DLJA 3SCKE 3VF0B 1M1HA 2XS2A 3ZZZA 1CJVB 2XYPB 2KVQE 2FY1A 2W2OP 4ED2A 4P4DA 4DS4A 5F48A 3FIXA 3RG6A 2OUGA 1EHWA 1YRXA 4J9NA 2OFHX 4PWWA 3VATA 3IN5A 4HTIA 4K0KF 5KFSA 2CJQA 3G8SA 2U1AA 2ZKUA 4DV0J 3C2PA 3Q8VA 1PYTB 4DR5F 1BGXT 1F9FA 1BWVA 2IM1A 2OPRA 1TL1B 3J7AN 4KPCA 4U8YA 3H42A 3MMCB 4DPUA 3KFWX 3MR7A 2HVIA 3I1UA 4I6AA 3QGGA 2QMUB 3JVNA 3TAMB 3BPDA 2ANPA 2QECA 2VQFF 1UVJA 3N5BA 3H4DA 1HWIA 4K5SA 1HBMB 3NKYA 1KDNA 2CQCA 4ES3A 1TP7A 2MQ8A 2HMIB 3DSBA 3FSXA 2HG4A 4N7TA 2RD5C 3H2UB 1NCLA 1HWUA 2P9EA 3AODA 1SL1A 2VI7A 4QR2A 3CJKA 1RABB 3PB9X 2R8GA 4D3GA 2EUIA 2YQ1A 4PG6A 2NPIA 5C2GA 2Z57B 3C6UA 2BACA 3D1OA 4DEZA 1S4EA 3NH8A 1RACB 1X31C 4DSEA 3M2VB 4TY8A 2B9XA 3DLBA 5J2NB 1XRYA 5ISVA 2KHCA 1S0OA 4FVCA 1JNZB 1O0PA 4O0NA 1QD1A 4B3RJ 4RNMA 4JD6A 4NLSA 3BBFA 1C4CA 4CYUA 2BYCA 3TP2A 3OPKA 2YWFA 3TI0A 3M8PA 1KSPA 4NMXA 3CTRA 2MQQA 1HI0P 4ECZA 1NU4A 5BYQA 3HULA 3WC5A 3D1HA 4H6ZA 2PEBA 2A6OA 2DD8S 3JQKA 3EM1A 4I2PA 1IM4A 4LVNP 3ZTSA 4R87A 3OSNA 2E29A 2ZBIA 2Q44A 3R9EA 1CP6A 3SJEA 3WC0A 4N56A 3CDWA 3G9CA 3SYZA 3AQPA 3TZZA 1Q79A 4WTOB 3GMGA 4X64J 4XPEA 3K5NA 2FJWA 3JYTA 1EQ0A 3R96A 2IYIA 1TXRA 3KHXA 4C8YA 3GV8B 3DKDA 4LQ6A 2EFPA 2DIUA 1NSAA 2B4DA 1RADB 4NCBA 4MI4A 4C8MA 4EK2A 1SJQA 3DGPA 2XEJA 3AJ1A 2EBEA 2M88A 2R7XA 1NMTA 3E2EA 1G4CA 2EC2A 4PEOA 4BBHA 1JLQA 2GE3A 2W4CA 5JXSA 4F9VA 2R8VA 3AFGA 1I94F 1XEBA 1HARA 1CVJA 2MQPA 4X5KA 2G9DA 1HHSA 4K2JA 4DUTA 1SC1B 3PACA 5E3RA 5H1SV 2J8NA 1G6BA 1LK5A 4X65J 2YX1A 2BM1A 2DXQA 4NEYA 1S48A 5E33A 2ZDPA 5HQLA 2EXUA 4M5MA 2DR8A 2M9KA 1GMVA 1S7HA 1JLBB 1CC8A 2LQ5A 4FPRA 1HDQA 3DC2A 1Q95G 2BJ9A 1S9GA 2PE8A 4ED1A 2MEWA 3OVAA 3C26A 1S0NA 4BC7A 3TT2A 2H1YA 2KU7A 3NGSA 2VG5B 1FEHA 4NCGB 3D67A 2EK1A 4R5PA 5KFNA 3J7Z5 2V34A 5KOWA 2W4PA 4YB5A 3IWNC 2YKMB 5HSPA 2KM8C 2VFVA 1X60A 5CZVA 4YN3B 2EFNA 2KXNB 2MYFA 4HT7A 4OZLA 1OY9A 2CPIA 1TKZA 3EDQB 1Q2DA 3TWZA 2X7BA 2MXYA 2DXFA 2EKNA 4B6ZA 2WVCA 4CI0B 4DQRA 3W2WA 1CM0A 4A8OA 3QAHA 1ELOA 3S9LA 1UETA 4MBUA 2COLA 1RTIB 3LPYA 3KLEB 4F36A 2PRBA 1RWVB 3MM5B 2AFWA 2GHWA 2OH1A 4F7VA 4A37A 5T41A 2MZ1A 4V1Ak 2PJ9A 2O66A 1HWLA 1YDLA 4OI2A 2PJ4A 1RHJB 2VD3A 2GMLA 2B4PA 2PIZA 1H7WA 2AWZA 3THVA 3M8QA 3T19A 1LFWA 3L4BC 1FI4A 2YWEA 3I0RA 5J2QA 2XS7A 4R7MA 1WC5A 3ISXA 1SKRA 4U95A 4JI3J 1S6UA 4A47A 3D66A 2ASJA 3P2HA 2HLTA 5F8LA 4QYRA 3B7IA 1FJGJ 5FD1A 4JV1A 4AT1B 3A12A 5L38A 1T9VA 5A8WA 3PV8A 1CSJA 4KH0B 2ZEOA 3GCWP 2XLJA 4OHVA 4ETZA 3QQCD 3FBBA 4LFCF 5KFLA 3I82A 4KSAA 1TTHB 5AE3A 1MN9A 2RMLA 1DAXA 5EBVA 1VCTA 3IAM9 4QCLA 2H4WB 4MK7A 4ZP8A 2XZDB 4CAXA 1REVA 4IG3A 4WWSA 1Z2ZA 4LR7A 4YY3J 1QLNA 1DY3A 2ZM6F 1RT1A 1KN6A 2RQ4A 4X4RA 1RAJA 2ZOMA 3KR5A 4FS1A 2UUAF 3CXSA 1WDTA 4X4QA 3K9TA 4KFBA 5LRGA 1LEOA 3CD7A 2XS5A 1RA7A 3DLHA 2CNOB 1ZM2A 1V5VA 4CO4A 5KFJA 2XSFA 2RNEA 2NXJA 3T1HJ 1VIOA 3PRVA 1S3ZA 3LP2A 4U9YA 1JLFA 2P5VA 3ZC4A 2K5TA 4M95A 1RWXB 1AXQA 3EICA 1T02A 1IGBA 3M6VA 2B9YA 5BJRA 5HVGA 3J7ZT 2ZUAA 4DU7A 1IM6A 4KB7A 2FDNA 3LACA 4LF6J 4NXYA 4ZDNA 5HL7Q 2B9WA 5HI7A 3NCQA 3OR1B 1H7XA 2RDJA 2ZBCA 4CNZA 3PBBA 1Z8WA 2HQFA 2QO3A 3OLBA 4HI2A 1TKJA 1HKAA 1EETA 2EVNA 2YWWA 3HFKA 5AJ3J 1GXLA 4Y2AA 4YR0A 2XO7A 3IRXA 1LW2A 5KFWA 2FC8A 2EWBA 3MPUB 4L8AA 5IB9A 2ASYA 1S9FA 1VS3A 4YR2A 2ZENA 2V8VA 1RB0A 2H54B 3IA0A 1IICA 2QL5B 3D0GE 1U1RA 5A8RA 2WSAA 1BQXA 2QV6A 4FAIA 3LUYA 5LMUJ 4DMZA 2B8PA 5D6GA 3MEDA 4F26A 4AQYJ 4Q2LA 2BKNA 4ZHRB 2QSWA 5CYJA 3A8EA 3DYAA 3EY5A 2M8DB 1YR0A 1U6FA 3M6UA 4ONUA 4B3RF 1B70B 2CNNB 1R31A 1NNDA 2B9EA 3T9YA 4ELVA 2E7VA 1X4DA 4GXHA 1BPMA 2Q43A 3O3LA 3NS5A 1SIWB 4NLWA 2GZOA 3NH5A 1UEUA 1RTHB 2W7AA 4ZPDA 3V81B 4MCPA 5EGYA 2XCAA 3EVWA 1SC3B 3KK2B 2XC9A 2FJDB 4B3MJ 3AD8C 2VJVA 3AB4B 5ETSA 1X4AA 3E8OA 4ZOSA 3GU0A 3GTYX 3QWUA 2Z3PA 4C0HA 2E5LJ 2J8AA 3KXDA 4KLVA 4WK3A 4X2BA 5JM6A 3B6BA 4A33A 4C2ZA 4Q45A 2FLNA 4AVAA 3C66A 1KLMB 4H4KA 4X64F 2J5AA 1ZLHA 2KTQA 2I6WA 2YWHA 4NXMJ 4DV2F 5C5JA 3P5TL 5LMNF 3BSNA 2V2VA 5IS2A 2VG7A 4P72A 2UVWA 4PCQA 3DLKB 5CD4A 2YXLA 2Q6BA 4LR8A 3I55S 1WKLA 4L76A 2H5MA 3PW2A 4WZQA 5DGAA 3DDIA 4WP8A 5CABA 5AGEA 4K4XA 1FX2A 3R5CA 1LWEA 3EUNA 3LH2S 3D54A 2GJIA 4F50A 2G0JA 2E9ZA 3SV4A 2DHSA 4KUBA 4X65F 1PIEA 5JVHQ 4B9NA 4MKAA 1RLDA 2M5YA 1S6PB 2XGPA 4P7TA 2AJFE 4UQGA 1YLXA 4KPYA 1RTQA 3CD0A 2BKOA 4U7UD 1LWFA 3KI9A 1XMQJ 4QB9A 1QAYA 4U7UK 1RLCL 3J81j 4KOWA 3VGVA 1UWBB 1TFYA 3NWGA 2XMJA 2CPJA 3FFIA 1SVDA 4C11B 4FKXA 4LSNB 2AZ1A 3GFHA 1VHOA 3MMAA 2H5IB 3QZ8A 3OJUA 2J0WA 4KVME 5KG1A 2ZITA 3UQSA 4PPZA 4UOGA 3U1MA 3VAHA 4EBDA 3OUYA 4TXSA 1UCNA 2UUBJ 4LF4J 3NG8A 4H4KC 3M2UB 1UVIA 1S9EA 2VQYA 1ZM3A 2J9CA 3QT8A 4KKOA 3DU6A 4X4VA 1XWLA 3L7OA 4ZYQA 4PWDB 4KGXB 5J1NA 3HXMA 4DSFA 3P4UB 3OFFA 4F0HA 1NJIT 3SDEA 6FDRA 4H4OB 1C1CB 1FDNA 2XNQA 4JUZA 3QGHA 3RU0A 1GTEA 3MUVP 2ZHAA 3DLEB 5D77A 4DV6J 3OXLA 3TARA 1QVGR 3T3FA 1R0AA 3IWEA 1N5VA 2D1CA 3HMJG 4IG0B 1D3WA 4FF4A 4R0EA 1N33F 2FYXA 5B0EA 3D0IE 2JLMA 2EVZA 2QA1A 5CYQA 2K3IA 1VLYA 1ZBTA 2KG0A 4QWBA 5KFDA 2PJ8A 3H5YA 4FVMA 2IAJB 3C15B 3V6DA 1ZG9A 2WONB 1YBTA 1MU2A 2AF6A 3L7PA 2ZHBA 2CPFA 3NMRA 5C82A 1VQSA 3W91A 4DCPB 5ETLA 3HP6A 2F5GA 5E7OB 1S76D 1S5ZA 4J9VA 3PGPA 2PMZD 2VKZG 2V68A 3LD2A 2ZH5A 1FJGF 1Z9UA 2FLLA 1U49A 3SI2A 5IB0A 1HYSB 4LF8J 3IP0A 4UWIA 3PX0A 1ZPWX 3BHXA 2HFUA 2Q4YA 2Z30B 5D29A 3MD3A 2MKCA 3QLHA 1IR2A 1TKTA 4CLZA 1VBXA 2E44A 4GKJJ 3PCOB 1BE4A 2MLZA 2U2FA 1PO6A 4LSLB 3VAMA 2AX0A 5L9XA 2QSFA 1U0SA 4DL3A 1TQLA 1NK7A 4USVA 1LFPA 3D7DA 3AB2B 4M6IA 1T95A 1TZ0A 5LSLA 1ON0A 1ZA1B 1IYLA 5GAHU 4A94A 2NCKL 4F3OA 2V4RA 3KG4A 2QJ3A 3RAXA 4YY3F 4FBEA 1U8WA 2LFVA 4KOVA 4Y49C 1CG2A 3TQ1A 2CQGA 1LNQA 1QSOA 3UW1A 3IWLA 1U1KA 5I42B 2Y0SD 2J9DE 3TZWA 1XBUA 3D6TB 3ILJA 4LUAA 4RUAA 5CBMA 2FCKA 4ZP6A 3BGRA 4QPXA 4USJC 3T1HF 1VMBA 3RNZA 3MR2A 2FXFA 1RWKB 1RCXB 4CO2A 3LGHA 4DQSA 2HGNA 1RTZA 4PXBA 3IM8A 4WE1B 1RQ0A 3K2YA 3I87A 4OX6A 3WBZA 3MUTP 1KONA 3CCWA 3DMJB 4MK8A 2XMUA 4PXEA 4CO5A 3Q2TC 3FVLA 4P4EA 3ET6A 3DOMA 5GVQA 4CNYA 1FDBA 1CJTA 3AJ2A 1KP6A 1WI6A 5KT5A 5LYIA 1Y5LB 3ZTOA 2AU0A 2ABYA 4B3SJ 4M63A 5AJ3F 2KJWA 4KUAA 2OPRB 2CJKA 2G3AA 2IFXA 3RGIA 4LQ3A 3BQ0A 1HNXF 1T9YA 3W61A 2OPPA 2KB2A 1BLUA 1ZTTA 4B9MA 4C0OC 1HFEL 1XBWA 2N4DA 1FTRA 2L08A 3M8SA 4TLQA 5LSOA 1OY8A 2AEJA 2QMXA 3KUHA 4OYXA 3VV2B 2MKHA 4KOYA 4DNCA 2Y0MA 4OC3A 3O2IA 4C68A 1RI7A 3EXCX 3LA0A 2EEYA 2GMJA 1L0CA 4YGOA