3IC1A

Crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from haemophilus influenzae
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
376
structure length
370
Chain Sequence
b'MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNLYIQGIQYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinyl-diaminopimelate desuccinylase
molecule tags Hydrolase
source organism Haemophilus influenzae
publication title Structural basis for catalysis by the mono- and dimetalated forms of the dapE-encoded N-succinyl-L,L-diaminopimelic acid desuccinylase.
pubmed doi rcsb
total genus 120
structure length 370
sequence length 376
chains with identical sequence B
ec nomenclature ec 3.5.1.18: Succinyl-diaminopimelate desuccinylase.
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ic1A02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3ic1A01
3FEEA 4X2TA 3WT4A 2ZEPA 4B6ZA 2O53A 2GU2A 1KWMA 1ELLP 3H8GA 1ZLIA 2PJ4A 4PXBA 3NH8A 4F9UA 2PVWA 3SI1A 3T8WA 3NH5A 2CTCA 1Z5RA 2ABZA 2AFSA 1LAPA 3GUXA 2RB7A 3NA6A 2JBJA 1R43A 3KGQA 2PJ1A 1CP6A 3B3WA 2ZEFA 3DLJA 2G9DA 3SJXA 1Y7EA 2AFXA 1FT7A 2WYRA 3FH4A 3FF3A 2C6PA 3PRTA 3KR4A 3B3TA 4JZ0A 4H2KA 2HC9A 3IFEA 2ZENA 4ONWA 3HLPA 4ZX9A 2ZELA 3BXMA 2HB6A 1ZG8A 3RAMA 3BHXA 4NGSA 2PIZA 5D8NA 2GLJA 4P45A 4F8ZA 4FAIA 1BLLE 1TKFA 2GLFA 2I3CA 5THWA 4R7MA 3IIBA 4PXEA 3D7FA 4OC4A 1FNOA 2PJAA 1YW4A 4MHYA 4UF4A 2ZEDA 3D66A 2PRQA 1YLOA 3K9TA 4P4DA 5LRGA 2NYQA 4PPZA 1ARLA 2XEJA 3MRUA 4NGPA 2DEAA 4ZX8A 2F8HA 4A39A 1OBRA 3VATA 3KHZA 2EK9A 3B35A 1BPMA 4TWEA 3PB9X 3I1UA 1Z8LA 3DGVA 4P4IA 4PXCA 4MHZA 4R76A 1H8LA 4DYOA 3CPXA 3IWWA 2IMOA 3N5FA 2XEIA 2C6GA 2NSMA 3VH9A 3PBEA 3TX8A 3QNVA 5I4MA 1ZG7A 5JH9A 1VHEA 3PB8X 1CPXA 3KZWA 4R6TA 2BO9A 4OMEA 1TKHA 1XFOA 3D67A 1GYTA 2QJ8A 3NFZA 4P4BA 3SJFA 1F57A 2PJ5A 5DS0A 1R3NA 2OR4A 4P4EA 1DE4C 2AFZA 3KHXA 3WC5A 2Q43A 1Y0RA 1LOKA 3PB6X 3B2YA 4MCSA 3NH4A 2PJ7A 3H8FA 3CDXA 5JGFA 4WWVA 3H8EA 1AMPA 1TKJA 4PXDA 4FBEA 1XRYA 1HDQA 2ZEHA 1HDUA 1F2PA 3PBBA 3VARA 3SI2A 3V7ZA 4NFRA 4F9VA 5D29A 5HVGA 3PB4X 4ZY2A 5LYLA 4NJQA 1YMEA 2AFMA 2V77A 4OC0A 1CBXA 2POKA 4P4JA 2OOTA 2AFOA 3S9LA 3KI9A 5ELYA 3D4UA 4OIDA 3ISXA 4RUHA 3V38A 3FVLA 1IY7A 2PJ2A 2C6CA 4OC2A 3KL9A 2J9AA 3JRUA 3B3CA 4NGNA 1Z2LA 1VHOA 5HXDA 3FECA 4OP4A 4Q7AA 2BOAA 3GLJA 3RBUA 2QVPA 4TNUA 3ISZA 2PJ3A 4X3RA 1M4LA 3IJ3A 1QQ9A 4OIWA 4K3NA 3LWUA 3D7GA 2F7VA 3FJUA 3IEHA 2Q4ZA 2ZEOA 3TC8A 1LCPA 3FX6A 5CBMA 3IC1A 1NSAA 4MCRA 1DTDA 3IO1A 2PIYA 2JEWA 4UEZA 2PCUA 4UEEA 4G1PA 6CPAA 5J1QA 1BAVA 3PEIA 4JYWA 3D68A 3B3SA 2IQ6A 4MMOA 4EFDA 2WZNA 3KQXA 3S9NA 4GM5A 5HVFA 1CX8A 3HUVA 2RFHA 4WJBA 2V8HA 5K8PA 1XJOA 1Y0YA 1BPNA 4UEFA 2PJBA 1TF8A 2V8GA 2BCOA 5LYDA 4Z65A 3KQZA 4IK2A 5K8NA 5HVHA 4IAVA 1IGBA 5LRJA 2ZOFA 5LYFA 4FUUA 3WC7A 4NGRA 2AFWA 8CPAA 4ZI6A 1CG2A 2ZOGA 3B7IA 2PJCA 3SJEA 2CIJA 1YSJA 1HEEA 2C1CA 2CTBA 4YWYA 3CPAA 3L2NA 5CPAA 2ANPA 1CPSA 4X8IA 2XEFA 4ZYQA 3PFOA 1LANA 5IB9A 4R8FA 2ZEEA 2V8VA 1AYEA 4P4FA 2ZEGA 1ZLHA 4A94A 3KASA 4EWTA 4NGQA 3SI0A 4YU9A 1YW6A 4P6YA 4MXUA 4UIAA 4OKOA 2PJ8A 4W9YA 4KSIA 4DJLA 5JM6A 4P44A 5F09A 3B3VA 3KR5A 4LQGA 4MRIA 4P10A 1CP7A 3CT9A 1F2OA 3RZAA 5LYIA 4A38A 3WC6A 4PQAA 3WABA 4OC1A 1EE3P 2CF4A 4A37A 4NGTA 2PJ0A 5K8OA 1QMUA 3FMCA 3MN8A 3FEDA 3PB7X 3S9MA 3LMSA 2O4HA 4MHNA 2XEGA 4NGMA 2JBKA 3PFEA 4ZY1A 2PE3A 2AFUA 3BI1A 4DUKA 1VIXA 4OC3A 3D7HA 1ELMP 2GREA 1TXRA 4OC5A 4BD9A 4MCQA 2PJ9A 2PJ6A 4ZY0A 3K2KA 3BI0A 1RTQA 1XBUA 3GB0A 4AXVA 1LAMA 1PCAA 1Q7LA 4MCPA 1ARMA 4IHMA 4EMEA 2ZEMA 1UWYA 1VGYA 2V8DA 2VL1A 4UIBA 4CPAA 2Q51A 2EWBA 4MHPA 3SJGA 1PYTB 3D7DA 4FWUA 4O23A 4NJRA 2EK8A 2QYVA 1JQGA 2PVVA 7CPAA 5K8MA 2FVGA 5LRKA 1TF9A 2IJZA 1LFWA 1XMBA 1ZG9A
chains in the Genus database with same CATH superfamily
2ZEPA 1UVKA 5IM0A 1ZTTA 2DPTA 2PJ4A 2BV3A 2JZ5A 3NH8A 1JB0C 4TY8A 1M1HA 3M8PA 2ZOMA 4ANEA 1NB7A 1IBLJ 1HI1A 2W8LA 4CI0B 1NU4A 3MMBB 4P52A 2E44A 4C8KA 5AG4A 2VKRA 2RHSB 3SCJE 1VK8A 1VK3A 4ZGYB 2JNJA 4FYWB 3FK4A 1N32F 4LQ6A 3HKZD 3KR4A 4JZ0A 1NK0A 3J7ZT 3DRYA 2KZMA 3G86A 2ZC3A 5DGAA 4YB5A 2OPPA 4QPTA 3KLEB 4PAAA 4N41A 4P2XA 5HP1A 2FZKB 4IG0A 4H6UA 3H2LA 3TAPA 3D1HA 1DZ5A 1M5VC 4P9SA 3P96A 1IKYA 3TA2A 2PDOA 2MGZA 3E01A 5KFPA 2HVDA 1FRLA 4NGPA 3FCWA 1U24A 1TKTA 4KR0B 2RQKA 1BMQB 5DM6Q 4U7UD 1XOVA 4DFMA 3FQLA 3CJ8A 1SCJB 3JAMY 3E0KA 3N9UC 4TWEA 2XTJP 4QWBA 4PWWA 4AL7A 4CYQA 1PU9A 4U7CA 2IMOA 1DQ9A 3RBEA 2MQ8A 4FS1A 2KU7A 5JH9A 1VQLS 2MKCA 3P45B 4YFUA 1JJCB 2FS5A 5AG5A 4JI2F 4X4TA 2R42A 4Q45A 5L1JA 2I1RA 1QD1A 2BKOA 3FIXA 1C1CB 1Y0RA 4A32A 4RWWA 4IRCA 4JI3F 5LJ3Y 4HI1A 4TY8B 3EZOA 3LP2A 1T95A 1BD6A 1HDUA 2CPXA 3UE2A 1SJQA 3V7ZA 1FRMA 4P72A 1S9GA 4OI1A 2MQOA 4USVA 1B6BA 2I5JA 5LMNJ 2RIJA 1NKBA 4USJC 3Q8UA 4ATNA 2EI5A 5CA5A 1K4JA 1YLXA 1GTEA 4ED5A 3OPKA 1S59A 4D3HA 3OFGA 3KMSA 4NZ7A 1QTNB 1RT4A 4Q2LA 5KOXA 3JRUA 1A7GE 3H5ZA 1LV5A 4B9NA 3ZTPA 4LR7A 3V6HA 2D9OA 4UFXA 4UWJA 3NWRA 3HDSA 2CPFA 2WTFA 1TKZB 2E7WA 4CDIA 3EGZA 2VG6B 2VG5A 3ISZA 2OSQA 3IJ3A 2KJVA 1LFPA 5CCLA 3N6NA 1MROB 4ZIVA 1KNZA 1WELA 2AEFA 1NSAA 2J0XA 2WCXA 5HSPA 2HBRB 4R25A 1WDTA 4KKOB 4ZP9A 2MDAA 1R57A 1S12A 3IM8A 5E3CA 3VAHA 4XTTA 4CRJA 3I55S 1CX8A 1QSTA 4J9KA 2NPIA 4J9LA 1F6TA 4U9ZA 3T41A 4I2PB 1E6YA 4UZCA 4DQQA 3JSRA 4ZPAA 5HVHA 1BQXA 2DCUB 4ENOA 3JYTB 4LREA 5LRJA 2GFQA 1REGX 3KFWX 1X0FA 3OFEA 4PABA 1FD8A 4H89A 4ZI6A 2E7XA 2DT9A 2VZYA 1Y3JA 4ZCLA 5DG7A 3VALA 4TVAB 3L2NA 5J1PA 3QT7A 3OFHA 2GQCA 4X8IA 3A8JA 1RAOA 2V4JA 2VHGA 2Z56B 4JYAJ 3EDQB 1EZZB 5C24A 1M90T 2RF2A 1ZAVA 4TQRA 3I3GA 1VBYA 3M4XA 2R8IA 3L7UA 3ZO7A 1UCNA 2MQMA 1VDHA 1Z2ZA 1U2FA 2VQEJ 4OHYA 3GJTB 5EC4A 2VD3A 3UPFA 1P27B 3HVWA 3DGPA 1YZ6A 1RLDA 3AFGA 1L3UA 4B08A 4B13A 5L1KA 2M8DB 2R9LA 3EPIA 3WIVA 2BYCA 4PUOB 3S6KA 4IFVA 1VQ7S 1HNZJ 3M8ZA 4QBUA 5D0EA 2V0NA 4ECSA 2ASYA 2PJ0A 2K3KA 1TFYA 4M6IA 2ODFA 5KFCA 4R87A 3F41A 3PB7X 3MMJA 2RD5C 4JXQA 3LMSA 2LLZA 2EVNA 5A6PA 5LMUF 2V8PA 2GREA 1TXRA 2LEPA 4DXLA 1M1KT 3EFAA 1RAAB 2NZ4A 4I56A 1Q7LA 1FRIA 5B0FA 2XMWA 2EK6A 1XNRJ 4ZVUB 4AD6A 4ECYA 2KFYA 3DGPB 1PYTB 1Q5VA 1KFSA 2LCWA 3U7JA 2P9EA 3GFYA 4CLYA 5IM0B 3OJUA 2UUCF 3PZJA 4L75A 1BWVA 1U8WA 2P5VA 1XQIA 1FT8A 4PRFA 4CYUB 5DRKA 2LMIA 1X10A 3QJPA 4F25A 4AYBD 4QC6A 1GXUA 4HDGA 4X2TA 2AE6A 1PKUA 3RB0A 1K0VA 2XS5A 2P6TA 1UW4A 3TOAA 2FXFA 3GFZA 2HRTA 2J6UA 3TX0A 2CNKB 1SC4B 2LA4A 1Y0HA 2EBJA 4JI6F 3SI1A 2G3AA 4CT9A 1XIQA 3U1NA 2H54B 4RL1A 1U6ZA 1NHKL 4WXWA 3E8OA 1IVZA 4X4VA 1OQ6A 3OD2A 2X1FA 3CNQP 2WYRA 1NSLA 3FH4A 1TK5A 2GNKA 1HR0J 2C6PA 1UVNA 2KRRA 3P5BP 4HL9A 1MK4A 1CBKA 4J9NA 1GH8A 1T8EA 1M4IA 2BKNA 2HB6A 4M5IA 3BHXA 4P6QA 3I0SA 2J0QD 3I87A 2GX8A 3V81B 3LUYA 1OS5A 5F49A 2I3CA 1SJFA 3R27A 3LALA 1DQ8A 1PC4A 1DFDA 2L9WA 2B5JB 3IU2A 2GHPA 1IBKJ 3KKFA 1U48A 1YLOA 4A8KA 1YJNS 1KSPA 2LXIA 2VUGA 4OX9F 4UQGA 3TYTA 4Q0BA 5LRGA 1Q7YT 2GJIA 1R6VA 4M63A 3PCOB 2EK9A 1KUXA 3ZZIA 5GAGI 1TK8A 4DU7A 1Y00A 3PYDA 3H8YA 1MROA 3ENVA 1P9YA 4ZN3A 1RT2B 4G1QB 2DJWA 4I68A 5A0YB 2KZZA 4F04B 3F0NA 2ATRA 4CNYA 4DF8A 3RBXA 1N33J 1MN7A 1T9YA 3CIMA 1FDAA 1DE4C 2FT0A 1EP4B 5AJ3F 4A4JA 1XF8A 3LH2S 2R7UA 2L08A 5IZHA 3PB6X 2PRBA 3KG1A 5GADI 2ADBA 3H98A 1RHQB 3TW0A 2M0GB 3QATA 1TKJA 2GFFA 3GCXP 3QJLA 3DYAB 2EXUA 2YNFA 2NSCA 1U1QA 3NE8A 2P0WA 2E9RX 2ILYA 4XPLA 2XSJB 3HK2A 3AB2B 4MYTA 2CNSA 3OWCA 3IGRA 1SUQA 3PNIA 3FRYA 1S9GB 3MF5A 1WOOA 3FVLA 3BN7A 1ROFA 3RTVA 3DFEA 4ES3A 2VI7A 2LFVA 2E1PA 2KYXA 2AJ4A 4X66J 3HHDA 4ILLA 5D6GA 2E66A 1REVA 4ZPWR 4FYYB 4LQ9A 4OYWA 1JKHA 5B7WA 5EX3A 3J7AN 4KGKA 4EU0A 2HHUA 3RO0A 1IKYB 1DTTA 1IUJA 5L46A 3O1LA 2Z0GA 2LEBA 2IPOB 1S5KA 1JLAB 4YDXA 1FK9B 2R7SA 2RKIB 4DR6F 4PG5A 4YB1P 4DSEA 3ZZPA 5I3QA 3RB3A 4JI8J 1M4DA 3I0RA 3DHXA 4FVMA 2Y9HA 1MLAA 4NI2B 4CO1A 1SKSA 2WPXA 2RVJA 3GU0A 3MPWA 1RWUA 5K8PA 3SZ2A 2MEWA 1V5VA 2AJ2A 4USHA 2YNGB 4PQUA 2R4FA 3DLLQ 2JLFA 5IQQA 3BGLA 2HWTA 1WC5A 2Z30B 5B0GA 3VHQA 4OJ3A 3WC7A 2QT7A 3N4WA 4UFVA 1U2CA 2P6SA 1PSDA 3NRBA 1NE9A 3C6UA 2ZOGA 3KLEA 4DQSA 1HEEA 4A33A 1VOMA 2HQCA 4DSFA 2IC3B 1MWQA 2O67A 3IAM9 3HHKA 4ICLA 1IBKF 2ZEEA 2MKKA 1WHYA 1RA6A 4NA2A 4PWDB 1AFJA 5F8IA 4EWTA 1SVDA 3KK1A 2GHVC 2VIHA 1Q2DA 1Q8LA 5J2MA 2V50A 4I7FA 4I49A 3R5JB 1TP7A 3W5ZA 3DOLB 1UFKA 1GMUA 4QW9A 2I2YA 1YVKA 2EFVA 1V9OA 5L9XA 4CT8A 3W2WB 1QMUA 3MN8A 4DPWA 3V4MA 3NBPA 3NGRA 2HURA 3PRVA 5EWEA 2WVBA 3TTHA 2FY1A 4DLGA 4EFAC 3AQOA 2AX1A 1CC8A 1RAHB 2UVVA 3CJ5A 1EB0A 2HSEB 2B43A 4ECVA 3N5BA 2BACA 2BMBA 1S79A 4PWUA 4GC7A 4MAKA 5T41A 3CF5Q 3H2VE 4K0KF 4ZJQA 2M3DA 1ARMA 4FZVA 4J9SA 1UWYA 3F0AA 3W8GA 5G0RA 4YHHJ 3HULA 2J76E 1XN9A 3JAMU 2FVGA 5IX3A 5KFDA 4Q8FA 2R7VA 1ZO0A 3T9NA 1KUYA 4B6ZA 3WHIA 2ACYA 4MIAA 4JI2J 4ZP7A 2FJAB 2NR0A 1HD1A 2OELA 1VYAA 3UDLA 3AQPA 5CYJA 3W91A 1RB0A 5F9LA 2PJ1A 4CLPA 2K7KA 4IFYB 3BEGB 1HNVA 3SQOP 1X5SA 1HNXJ 1VCTA 4EEYA 2ZJQQ 2HMIB 4I67A 2UUBF 3HLPA 2YXLA 3DDIA 2IVFB 1NSQA 2OEMA 4KOTA 3HMJG 1U6FA 3GCWP 5DETA 4FAIA 3VR1A 2A6MA 3I5AA 5H1SV 3Q2SC 4MK8A 1B0VA 2B6AA 4NLDA 4C0BA 2ZH6A 3MR2A 1S0MA 1Q8IA 2ZM6J 2R1IA 4H4KA 1RCXB 4F4XA 2JEIA 1YW4A 2QV6A 4NL5A 2VPZB 1L5UA 2XSFA 2QLFB 1OYDA 1KRPA 1DRZA 4WFXA 1M0SA 3FFIB 3ZZTA 1CJKA 3N28A 4DL2A 3PJ9A 1N48A 4OYZA 3B35A 2IM2A 5JPHA 1X12A 1NM2A 1SB6A 4Q2MA 4PXCA 4ILRA 2XEIA 2U2FA 2BKPA 4YGOA 4R0EA 3QNVA 2HZCA 1NK5A 3W66A 4U9RA 4MFLA 2XMMA 2BJ3A 2W9CA 4NCGB 4RWXA 1JXVA 4G1QA 1F57A 3EXCX 3SIPB 2FC9A 4PYDA 4C2ZA 4G1IA 2I38A 1RA7A 1Y11A 4FPIA 3H8FA 4NRUA 1N0VC 3CDXA 3VCDA 2IA6A 2WZ1A 5DM7Q 4NEYA 1FJCA 4F0KA 3NOCA 2XYHB 4U96A 2D3UA 1PG5B 3I6PA 4HHJA 4WBFA 3L95X 1YBUA 1EQMA 3SXNA 5AT1B 4V19J 4YP3A 2D1CA 1RT5A 1RWPB 2VASA 4RZRA 4B3OA 1H2VZ 2HAIA 3JQJA 1YR0A 4NEXA 3P2HA 2XQCA 3K9UA 4A48A 2DF5A 2ERRA 4C7QA 3A13A 2E5HA 1KQGB 3K59A 2HVZA 2HS0A 3MMCB 3ILOA 2BL1A 4CYNA 4R3KA 2BOAA 4C8NA 5AXKA 4CS0B 1KC8T 2DXDA 2F65A 1P0HA 2IFXA 3Q89A 3HFKA 4HH1A 1QM9A 1DTDA 2Q04A 1KUVA 3JVNA 4C3MA 1R7IA 3T1HJ 3GE9A 1QSSA 3PR5B 1Q53A 3D68A 3UCUP 4Y2IA 4LT6A 3WR7A 5I3PA 2MKJA 1RTIB 3HZEA 2HMIA 4WP8A 5KFKA 1YX0A 3OTOJ 2V2ZA 2M5YA 2YWHA 3EYZA 4MJ8A 2YNGA 4PQUB 3W63A 2KB2A 3CCZA 1GXTA 1AT1B 2C1CA 2YNIA 2K2PA 3MR7A 4MIBA 3MGDA 4QIVA 3NLCA 3N0VA 1SH3A 4FYVB 1WUUA 2I9SA 2DISA 3OR2B 4O3QA 2JC1A 2AGOA 2EFGA 3QWUA 4F4WA 1ZLHA 5BWAB 4F50A 4YU9A 5BJRA 3LGNA 4CGOA 4LFCF 1WD6A 2KCWA 1TVRB 1S0OA 3Q8VA 6FDRA 4RJVA 4MRIA 2GCFA 2D7SA 1JIHA 4HT5A 4F4YA 1RU1A 2Z57B 2X7IA 2D3OR 2X1AA 4O4GB 4KYZA 1FKPB 3H5XA 3PRDA 2GIFA 1X9SA 1TV6B 2F4VF 1LQ9A 4ZJLA 2WBMA 3AY0A 2HQ3A 1SH2A 1FO1A 1RBAA 3MPYA 4KGXB 3SXLA 1FWLA 1UVIA 3TT2A 4MFQA 1G6BA 4ZY1A 2OO4A 2R3VA 3CO9A 1KP6A 4GS4A 4RBUA 2BDPA 3IWXA 4DX5A 1F1BB 3DLKA 2VODA 2Z2MA 2W4CA 4I69A 4GKJJ 3BKUA 3VAIA 5C2GA 3RW7A 3H25A 5F48A 1N5QA 2R8KA 2LYVA 3CB4A 1NMEB 4MHPA 4A47A 1IOIA 4U6PA 3LTOA 1SC6A 2MKSA 1O51A 1UVJA 1SPBP 2BUNA 5EGYA 3C14B 4HH0A 1OMSA 4F7VA 4UOGA 1ZS6A 5K8MA 3HO1A 2GVDA 4RUBA 2F4VJ 1RAIB 1AUDA 3D6FB 1ZG9A 4KIAA 3WX4A 5IT9U 1HQEB 1ZM4A 2AEJA 9RUBA 1ZLIA 1ZM3A 2KDOA 2G0JA 3GIMA 3VTIA 3GIIA 4M5GA 4Y00A 3IR7B 3CCRS 5J2NA 4RW6B 2FE7A 5B0AA 1CJTB 2LEAA 4YUDA 3JUWA 2D4OA 1I51B 1HQ2A 2FGCA 3VF0B 4E0DA 1EHWA 4CH0S 2DEJA 4NZ0A 5DQHA 1GHEA 1H7WA 3W62A 2DITA 2BVZA 1NH8A 1W2IA 2IRYA 1YQHA 2XYGB 4IRDA 4QVTA 2L41A 2XZTB 1VBZA 4NZ6A 2HNDB 3IA0A 1VISA 4AE5A 4J9OA 3CJKB 3IP0A 4FN5A 4NA3A 2HGNA 1Z4RA 1L3KA 3CPWR 2HV2A 2OJ3A 3U27A 3ILLA 4R7MA 2XZWA 2VB6A 3R95A 1QY7A 4A8XA 2OHDA 4H4OB 2RJZA 3JQKA 5BYSA 2J7KA 4JI5J 3QMQA 3R1HA 2F8MA 4JV2A 3CCLS 3PY8A 1VQYA 1HBMB 5HK4A 4B5PA 4CM2A 1RT6B 3BB5A 1OY9A 3OLBA 2ASLA 2VA2A 3FRZA 4LRFA 5KTDA 4R76A 3D3BJ 5LXYA 2CVEA 2AEMA 2CJAA 4EYHB 3D0HE 1RTDA 4J9QA 2CQ3A 5HMYA 3HHLA 4TNOA 4DZDA 3I9ZA 4OMEA 3OTOF 3AJ2A 3TEHB 7FDRA 1VQPS 1BE4A 4N77A 4FP9A 4IH5A 2YQ3A 2OPSA 2H51B 3LANA 3ITHB 1HQUA 4LF8F 3TO8A 3H8EA 4DG1B 5A27A 5A8RA 4DQIA 2ZEHA 2FHMA 1GMVA 1B0TA 3ITHA 4Z7CA 3PBBA 4E2FB 1YZ7A 4O4RA 2DD8S 1F5AA 1T05A 2VFVA 2HZAA 3RRKA 3PHTA 2DBBA 3H4QA 4MFZA 4AXIA 2V77A 3TUZC 4KJIA 2OOTA 3C26A 3HHLB 2GIVA 3G4SS 2HQYA 2DTJA 4B5PB 1IY7A 2BX6A 1YBAA 3T5HA 1J5EF 1VRQC 3F8KA 3MM9B 3EGVA 4QIWD 1VHOA 3FECA 2AJ0A 5EHHA 5T14A 3OTBA 2KH9A 2XCPA 3GLJA 2YWKA 3TI0A 1B4SA 4DX6A 1FKOB 4D3GA 2XS7A 2DY1A 3B4MA 5T7LA 1S77D 3IEHA 3K8VA 3T6BA 1VHFA 3W60A 4DV5J 5FJ4A 4YY3J 3CJKA 4PWDA 1Q86T 1AZSA 3GSDA 3V81A 3F5BA 2W2NP 4LF7F 2MYFA 3M6VA 2WAQD 2HHTA 4UEEA 1WG1A 3DLEA 3PG9A 3KHRA 3ISND 2CNTA 5DG9A 2ZH8A 4ECQA 2DNGA 1Q95G 1TU0B 2KKHA 2ZW6A 5M2UA 1RCOB 2C2NA 3BGUA 4JI0F 5ADZA 2AHOB 2HFZA 1W2BR 3BBFA 1XE4A 3HVAA 5KTAA 3MAAA 3FEYB 4BWMA 3TEGA 3PYEA 4JWPA 1NK8A 2BM1A 2LU2A 3LA0A 5J2NB 1HQEA 3G6YA 2RHQB 3CEDA 1IJFB 2VFSA 4HR2A 4JI0J 3PW2A 1NJWA 2VBZA 5CPAA 2YKOA 3NBPB 4KPCA 4NLXA 1S9FA 2QFJA 4XNHB 2XEFA 1UPPA 3CJ0A 4QR0A 5A76A 2HG4A 2DGVA 3QGIA 1G7CB 1KQKA 3MD3A 2OSRA 1MU2A 2UVRA 3DR6A 2DR5A 3KMQA 3DOLA 1JLBA 2OZHA 5I3UB 4WE1A 2ZE2B 2EG1A 5I42A 1K0TA 1TV6A 2ABYA 3EMTA 5CYQA 3PYFA 2H1YA 1TVRA 1CP7A 3PDNA 3CT9A 3KJVA 4A38A 4NMLA 4DR4F 3MUVP 2PA3A 1QUPA 1EE3P 5F3TA 4A37A 3UCZP 1V0CA 1T7PA 1CM0A 5K8OA 2W9CB 4DQRA 1TR0A 4CO4A 1S48A 2QA4S 2G1DA 4MHNA 3FZ2A 4CAEA 2CPHA 2HVEA 2PJ9A 3W6SA 1WWHA 4KH0B 4UOHA 5M2PA 1B64A 5CYMA 4JBCA 4H54A 4X62J 5F8GA 4KB7A 2CVIA 2HHPA 4A8OA 5CZVA 4DV2F 3WZ0A 3DDDA 1EP4A 1YLEA 2B5GB 2BEFA 4C8LA 5J8FA 1KEKA 4B3MJ 1K73T 2DXQA 2ZFHA 1B70B 3BO3A 4LVOP 3MM8B 1Y4ZB 2ZW7A 1C1BB 4ERDA 1HKAA 4P2FA 2OPRA 3Q0AA 4PXBA 4XO0A 2RUSA 3MMAA 4R5PB 1OY6A 4XPKA 3CMAS 3I32A 5ETPA 1PJ5A 3KGQA 2Q7SA 1EKRA 3PGPA 5KTCA 2G9DA 5BXIA 5HJYA 1U2RA 5A8KA 4EVYA 4B9LA 2U1AA 4LF8J 3MMCA 3R5DA 2BM0A 1ZH5A 3PRTA 1NLKL 1RK8A 3MCNA 4RBVA 5CABA 3GWCA 1CJTA 4NCAA 4IG0B 4B3TJ 2DRAA 4X4PA 3T6JA 3TWZA 5KG1A 3TO6A 4AXJA 1TZ0A 3I0SB 1VKCA 1IBMF 1NDKA 5AG7A 4FPRA 2J8NA 4NLTA 4PXEA 3DRSB 3RBDA 1QVFR 2QTWA 4FD6A 3M2VA 2ZEDA 4ETXA 1Q1KA 4GXHA 1NPKA 3M6XA 1I94J 4H4MA 2XB2D 2QMXA 4B3OB 5I3UA 3PB9X 3MOZA 3CD6S 1Z8LA 1YG0A 1PYOB 4O0IA 1WC0A 3HI9A 2ZW5A 4NLWA 1Q82T 2C2ZB 5EX0A 2WUUA 4B10A 2O3DA 4ZMMA 2RQMA 3UW1A 3ISNC 5KFAA 1TAQA 3QO9B 1EKSA 1RAGB 1SL2A 1F9HA 1UAWA 3Q83A 4MCSA 2J9EA 2HFSA 2PI5A 5CNPA 1YJWS 4Y2KA 1YWXA 2KFZA 2I6WA 4QWEA 4WU2A 3T9YA 2WONA 1WG5A 2J7WA 4AT1B 4QR1A 3TOBA 4P71A 1N8RT 4CO3A 4X4SA 4OC0A 2ZITA 1NJIT 4B14A 4YHHF 1BGXT 2AYGA 4OHXA 4QYZK 1QSOA 1YTYA 4X4OA 2PJ2A 4MY0A 3KWMA 4KVME 3KLFB 3J7YU 5FLXU 3OTEA 3TVKA 3BQ1A 4DV3J 5CQGA 2VC1A 2GHWA 5GMEA 3CJ3A 1FKOA 4NXYA 3LPYA 5B0DA 1QSRA 2CFXA 3PW7A 2CQ0A 1QTMA 4OIWA 3LWUA 4MKBA 2M52A 2HEKA 2ACMA 5L39A 4DSIA 4JUZA 1U02A 1YJUA 4JI4J 3FX6A 3IC1A 4DS4A 1HNVB 4OI6A 1ZA1B 3BLNA 4MT1A 3IO1A 4J90A 1FVSA 2W9BB 4DR7F 4UEZA 2E5GA 1BAVA 2ZBPA 3EC4A 1SH0A 1O8BA 2D3ZA 2ZH7A 2HLUA 2RFHA 2RU9A 3QBCA 2UP1A 2WB1D 2V8HA 2HNDA 3AT1B 1IKXB 2ARHA 3RUBL 1FJ7A 2H5IB 2L48A 5LYDA 1GMWA 3C6TB 2C2RA 3HSJA 1IGBA 4GVBB 2O01C 3D6MB 1Q8KA 3DOKB 3SXOA 5H86A 2E5JA 1UPMB 2BANA 1CG2A 1S6OA 2IA0A 2BQUA 2K5TA 3C2PA 4C8MA 4DSJA 2B3TB 1ON0A 2G13A 3BQ0A 2V9KA 1M4GA 3NCRA 1S4FA 3P4UB 4A94A 3VWEA 3QGPA 2VBYA 3KASA 1WNEA 2DNLA 3ZXWA 3PIPQ 3UNYA 3IXQA 3T5JA 4W9YA 3POTA 5JM6A 3QYYA 4USMA 4JI1J 3G6ES 2DR8A 4AQYJ 2C3YA 2PIIA 1S1XB 1HIYA 2DH9A 2N7YA 3UNGC 2ZW4A 1HNWF 1FI4A 3EWGA 4NGTA 2CPIA 4C3LA 3KLVA 4M85A 1UETA 2NXJA 3IRXB 2CQPA 4UA3A 1WI8A 5IC4B 5J8CA 1HPZA 1LW0B 4KOYA 1VIXA 2XNQA 3I5CA 4K2JA 4MCQA 3GSIA 4IDKA 1ZAWA 2PJ6A 1I1GA 4O3OA 4W4MA 3IGNA 4DUYJ 1RTQA 1FFWB 1X8DA 3AA8A 3M2UA 2LXUA 1FXLA 4K0KJ 5KFXA 1S0NA 1A2ZA 2K8GA 3TUJC 4I2QA 2VPWB 1HWKA 1WI6A 2CJYB 2ZNYA 3FEZA 1TAUA 2EPIA 1T9UA 3GR1A 1NJYA 4KKOA 1S7HA 4U5YA 1R8HA 2IJZA 1GX6A 5KFOA 2R2RA 3R9GA 4ZIWA 4DPUA 4NSQA 1YJ7A 1U49A 4IUSA 3MM8A 4MFKA 1RAFB 1C0TA 3Q24A 2MLYA 2CTCA 2HUZA 1C4CA 1JK9B 3NA6A 3K17A 4CGPA 2OD4A 4X62F 1WEYA 3DLJA 2PT0A 2BEIA 3QAYA 4C8OA 3BGRA 2F1FA 3UI3A 4OFZA 3MEEB 4J5OA 3FF3A 4BBHA 1C4AA 5DJBA 2DGOA 2ZENA 4UZBA 1AA1B 5KFHA 5D8NA 2FPHX 4WFNQ 2XY5A 1N5YB 3R7SB 3C8YA 4Q38A 5FVJA 5AE2A 5F9NA 3K5MA 3IIBA 5HLFB 4HYKA 1UVMA 5E33A 3MCMA 1HW8A 1RT3B 4MKVA 5IS2A 3OUYA 2IDEA 4BC7A 1DTQB 3SHPA 3L9ZA 3DRXA 4NCZA 4AVCA 2NREA 5A8RB 3Q8RB 4KOUA 2XI3A 4OZ0A 2P6EA 2ILZA 3KOAA 4J37A 3R9LA 3CPXA 3M32A 1G2EA 1N34J 3N5FA 4DV7F 4LBPA 5DGBA 4X4NA 1SUQB 2UU9J 3KZWA 1NKEA 1KZFA 3BJ8A 1TKHA 3DR8A 1WF1A 1MU2B 4C9DA 2ZNZA 2RH3A 4P4EA 2OR4A 1U6BA 1RT1A 1X0PA 4C11A 2V6AA 2Z3OA 3A9LA 3HM9A 1VBKA 4UFWA 3A8KA 3CTRA 3MR6A 2CG8A 4U8VA 5MLCV 1HWIA 4ZITA 4CZCA 5HATA 1RSCA 5ETRA 4ZVSB 2HQFA 3BSAA 5LYLA 4DV5F 2C2MB 5H9EJ 4IR9A 4KE5A 1LWEB 4NCBA 2HK2A 3DN9A 2OPPB 2Z2YB 4B9UA 3KUEA 1HA1A 1BXNA 2X1BA 3CGIA 4ED2A 2ZH1A 2FVRA 3KL9A 2YKMA 1U7LA 5CH7B 3KHGA 3W7BA 3KJFB 3UVJB 3RGIA 2VPXB 3WBZA 4Q7AA 2FSRA 1VFJA 1F5BA 3MAAB 1CLFA 2QVPA 5E3RA 4IRKA 4DI6A 3OV7A 3M2RA 3DOMB 1YX2A 4QIEA 4WKYA 3PIOQ 5CBMA 2ZJRQ 5H9FK 3LACA 2HIYA 2REFA 2D74B 2JFKA 3D3CJ 3M9NB 1HL6A 1IM6A 2UXBF 5BYRA 1QLNA 3KQXA 2E1CA 4CAFA 1J27A 4TLRA 2G0BA 4YB7A 1FA0A 1HNWJ 1BPNA 4RNOA 1U1PA 4K4SA 4CAWA 2C42A 2QLWA 2ZUAA 5HH1A 2RSQA 2ZOFA 4Y65A 2XMJA 1X9MA 1XMQF 4RNHA 2R8GA 1WK4A 3TA1A 2JEVA 8CPAA 3K2YA 1XEBA 2CIJA 1Y9OA 2CTBA 3FMWA 5JVHQ 1PO6A 3FDSA 3NY0A 2CKWA 2B4VA 3CCMS 4F26A 4RUCA 3CWJA 5ETOA 3MM5B 3MPVA 1SJRA 1N32J 4JI5F 3M32B 4HTIA 4ZVEA 2MZJA 5GAEU 4Q36A 2UUTA 3HFZB 4M5DA 3C15B 3H59A 1URNA 4YQWA 3WDOA 3B3VA 4XNHC 3BGFA 2GMJA 1ZPWX 1IN0A 2W7OA 3CXCR 4DR7J 4JI8F 3LOUA 3H5YA 1BY9A 2ASDA 2QL7B 3CW2C 2KM8C 1CJVA 3BSOA 3H4BA 1N0UA 3ILIA 3R2DJ 4C0HA 2IY5B 5JQ4A 1AROP 1FFSB 4OYPA 5KG0A 1QJHA 2CPZA 1QSNA 3T90A 1YJTA 2ALZA 3CDEA 3B78A 4CGMA 4YB6A 2D41A 2GJ2A 4NGMA 1FERA 3PZPA 2B8QA 1V3ZA 1FTCA 4TU8A 3QAUA 1JWQA 4DPXA 2V4JB 3CE8A 1LWCA 1T9TA 4ED4A 4MCPA 1WJ9A 4W98A 2X51A 3CXPA 4ED8A 2LP4A 3QFHA 1XEZA 1H2UX 4UWIA 2YX4A 4HDHA 5CYQB 4PV6A 2CPEA 4OV6A 3SJGA 4FWUA 1LWXA 4O23A 1S1UA 2LQ5A 1ITPA 2WPWA 1YRTA 5DZ6A 3QJJA 4RW4A 1GNKA 4DCOB 5K9FA 3KLFA 2XG8A 3WT4A 3DOMA 1S7KA 3RYOA 5LJ5Y 5HQ8A 5G1ZA 1PAEX 3PVXA 2HS4A 2IC3A 4HLBA 2FDNA 5KTQA 2AP6A 3BREA 2BJ1A 1YVOA 2FLPA 1VQNS 2ZEFA 2EEYA 1SJ3P 1WORA 2X1GA 4N8NA 1X4DA 4ZP6A 3SCIE 2MPUA 5HL7Q 2V4QA 1BUXA 4K30A 3CCSS 3TFYA 2GIQA 3VVUA 4ECXA 4B9VA 3CCQS 3PR4A 4N5SA 4F4ZA 3FSIA 2ZEJA 5ITHA 2V2QA 3UDEA 3HSDA 3ILJA 5GAHI 5A28A 1F3FA 2VC0A 1TL4A 4K4XA 3GZ7A 5H9FJ 3BM7A 4FBUA 2CQCA 3ENWA 3ZTQA 1YBTA 3M8QB 1YITS 3K9TA 4FDFA 3VWSA 4RU2A 3KK2A 4UOCA 2KRBA 4KSEB 3P8BB 3TARA 2K3IA 2BJ7A 1VC6A 1RP5A 2SXLA 2AW0A 2VKZG 2BRLA 4RW7B 5F8JA 2E5LJ 3GIKA 2BW7A 2WSCC 4AL5A 1GMWD 1XMQJ 3DXSX 3R6LB 4OQJA 4Y49B 3DNCA 4ZP8A 4NCGA 3PKYA 3KLHB 4QR2A 3VAMA 5I4MA 1VHEA 3K5PA 1SJ4P 1XERA 1CPXA 4FYDA 2VG7B 2BO9A 4PG4A 2DR9A 5KFTA 1TELA 3A4TA 3VAKA 3WC5A 1FEHA 1BQNB 2YQ0A 1SXLA 3AXMA 1LOKA 2G2OA 4E2AA 4C8ZA 4ED1A 3PO4A 3IG1B 3R9EA 5HLFA 1FX2A 4B3TF 2AYMA 2MQNA 2GVZB 3P6YC 3SI2A 2P6FA 1Z8TA 4M5HA 4KC5A 5E3QA 2MTLA 1WF2A 3RAXA 3RRHA 1WTFA 4DL3A 4DR1J 3W6XA 3OR1A 1YGYA 2AFMA 2JH3A 4KOVA 3Q23A 4A8YA 3RG6A 3MURP 2KT5A 5KFEA 4OIDA 3KJNB 1UL3A 2BJDA 1HBOB 4IO9Q 3B3CA 2GANA 3TCVA 1VC0A 3DI6B 4WF9Q 2A4NA 2R7TA 4OZNA 4OP4A 4B3MF 2W25A 1XJWB 1VHIA 3FNCA 2KTQA 1IM4A 4N7TA 2G0IA 1M4LA 1RADB 2W2PP 3FJUA 2F7VA 2C3OA 2Q4ZA 4RW8A 1RISA 2FJVA 4NASA 1LCPA 5FDLA 5HP1B 2FLLA 3GMGA 1Y3KA 4CP5A 2PMWA 3GIJA 5J1QA 4M5KA 3H0PA 1T94A 1BO4A 1YGHA 2YKPA 5DG8A 3HHLD 1BC6A 2HVIA 4X2BA 2OPQB 4C7IA 1SL1A 4KFBA 1TF8A 2VQFJ 2FD2A 2BCOA 2H65B 5LM7E 3BDPA 2HAFA 3TVZA 4JOUA 1B87A 2DGQA 4DL0C 4JI1F 1WDDA 4W90B 4UY8T 3G82A 2XGPA 2FL4A 4OMFG 4NRTA 4MY3A 5E7OB 1RTJB 1Q78A 1HD0A 2FIWA 3I56S 2FIAA 1TL7B 1DQAA 2M88A 1UZHA 2O66A 3ULHA 2C27A 4JJXA 2VJUA 2CUYA 2C3MA 1J4JA 1Z9UA 2IMWP 4C2XA 1FRXA 3R5AA 1P9QC 5F09A 4ZHRB 4LQGA 2B4UA 2R8HA 2IJRA 3GONA 2HHHF 1HHQA 1OJ4A 2CQBA 2YPZA 3RJMB 2AMCB 4I7FB 3H40A 3TO7A 2E1AA 5J2QB 1CEZA 1S7NA 4KOSA 4LSZB 1UJ6A 2LDYA 3M8YA 2DGTA 4OZ3A 4X66F 2YNEA 4ANCA 3SSQA 1V5IB 2QC3A 5IWAJ 3ZZZA 2JLGA 4NE9C 2OEKA 3D28A 5ETKA 2OAUA 1LAMA 5C25B 2XMVA 5CCMA 3TNVA 2BA9A 2FTRA 4CWBA 4TLQA 2Y1IA 2DHHA 4RW8B 4JV0A 4DX7A 4NXNJ 4TQSA 1TL1B 4WU3A 3D7DA 2Z10A 4NI2A 3MWBA 1FE4A 4ES1A 3M9OB 2N3LA 1HNIB 2BR0A 3R5BA 4OLPA 1S0VA 2HQGA 3DI6A 2FQQB 5D0HA 3GP9A 3TAMB 1NSKL 2MSSA 4X64F 1RWKB 4HEA9 1ELLP 2YNCA 1ZZNA 3LAMA 1H2TZ 4ONUA 2V68A 1IKVA 3QLHA 1IICA 2CADA 3GUXA 3HHEA 4Z2XA 4ELUA 4YOEA 2DHSA 2CJXB 3BS9A 3DSBA 2I00A 3B3WA 4RNNA 5HBMB 2HYIB 3DDNA 2OTLS 2EBEA 4RN7A 4HACA 2A0FB 1Y5LB 2OKQA 2DH7A 2ADCA 4ZBGA 4QBJA 4DOZA 2W4PA 4ZVFA 4FVCA 4ONWA 1H74A 1IKWB 1YJVA 3FEXB 2PIZA 1GFWB 1M5PC 4FXVA 4I4BA 2YNHB 4ZVPB 1L3TA 2MMYA 2QFIA 4YFJA 3CJRA 4RLEA 2RUGA 2QE5A 5A2QU 4UF4A 4QWDA 4ZCMA 4P4DA 4CH1A 4C4WA 4WCEQ 1RAEB 3HSGA 1VQKS 1TL7A 4USUA 2J0WA 2J8RA 3K89A 3NWGA 3EGNA 2F5IA 3H42A 4Z7YA 4ZHRA 2Z3LA 4B3RF 4DYOA 5ETSA 2X7BA 4QU6A 3TAQA 1RWVB 2W01A 2DIUA 4DV4F 3MAQA 2M2BA 1FJEB 4ICLB 3I4PA 4F2RA 4LX9A 1QDUB 4WKRA 2Q66A 2L9DA 2A1BA 4EK2A 1T03B 1KN6A 3MPDA 5KFGA 2V9WA 4NF1A 1T3NA 1GTHA 4TKTA 2QLBB 3NH4A 3NAHA 3W3SA 3RNZA 2AZ1A 4WWVA 5KFYA 1AMPA 3THVA 2YNHA 1T0TV 5J2PB 3G8TA 2VBQA 4B5OA 4II9A 2XMAA 4HKFA 5HMZA 4M94A 3A3NB 3JTOA 2LQJA 2CPDA 2RDJA 4LUBA 4L8AA 1KHVA 4XDCA 2CXAA 1RXTA 2AFOA 1NB2A 5JVGQ 3D4UA 1XWLA 2Q6CA 2W2QP 3DRPB 3SCLE 2B6AB 2GIRA 3MHYA 4OC2A 1M5SA 3KG0A 5EBVA 5CHCB 5HXDA 4MFPA 1X9WA 2QEXS 3D8PA 1MNEA 4DV3F 1S6PA 3BYRA 5SUHA 3CJTA 2B5GA 3I82A 1X4AA 3FFIA 2PI4A 1YJ9S 2PJ3A 1HBOA 1P1LA 2QL9B 4J3GA 3J81j 1VIOA 1F60B 1JLFA 4DR5F 2GGPB 1ZTWA 3BZQA 3TC8A 3CDWA 4NLVA 1N5TA 1QAXA 1QSLA 3MMAB 2P8IA 5GVQA 4QB9A 1UTAA 4KV8B 2DHXA 3PEIA 5E3PA 2FCKA 4EFDA 2M7SA 4ECUA 2IDLA 2APOA 2DB1A 4RW9A 2DK2A 4GM5A 3SCKE 2LXFA 2XGQA 5K20B 4IUFA 3THPA 4O4GA 4OLLA 6FD1A 4IK2A 4LF6J 1CSJA 1FXRA 2FZGB 4IFYA 2WSAA 1KONA 5F8HA 2AFWA 1WHXA 3M8WA 2WONB 3HHNB 3B7IA 1WC1A 4K4TA 4GC6A 2PJCA 2IVYA 1RWNB 4YWYA 4FNHA 1U8SA 3L7OA 2JDJA 4J9VA 3KJQB 1FD2A 3PFOA 3ET6A 1Q2CA 4DEZA 3SFUA 4B3SF 4R8FA 4I6AA 2WHOA 5D15A 4HHHA 4P4FA 1OIAA 2BJ8A 1YRUA 3O44A 3O2IA 5KOWA 4OKOA 4ZLPA 3CC7S 3EJMA 2DNQA 4V1Ak 5CAAA 2ZC4A 3R7BB 3MCSA 1BLUA 4KV8A 3QT6A 4TYBA 1EIYB 3AOCA 2KM8B 3S1TA 1RTHB 2CNNB 1D1UA 4K59A 1FWKA 2RC4A 1NCLA 2HNZB 2Z11A 2DRDA 3J81U 3MTJA 3X3UA 1H0HB 3AD8C 4O3SA 2G3TA 4RBTA 2R7QA 4GO5X 2PMHA 5F0UA 2JBKA 2XEXA 1WEZA 5KFWA 4M3SA 1B7YB 4ZY0A 1WHWA 2JDDA 4YY3F 4FXDA 3JS9A 2AYBA 4NYOA 4AXVA 2XZDB 2HRUA 4AG7A 4ORFA 3UD4P 4ED3A 4DUYF 1S9EA 1VGYA 1R8CA 3LODA 1RWOB 4J9UE 1W25A 5DLFA 4F3QA 2W8KA 1U1NA 3FVYA 4OYOA 4GMKA 2PN6A 3RB4A 2PEHA 4LIRA 2OD6A 1T02A 2M9KA 3IBCB 3S01A 1KWMA 1SI9A 3CCTA 1YVFA 4EI2A 1I1DA 1WF0A 4JXRA 2H9ZA 2HNYB 4ED0A 4YN3B 1LAPA 4PYAA 1RAJA 4KHRA 3M1VA 1XK8A 3CULA 2HHHJ 3A1YG 2IL4A 4OI0A 2MKYA 4ED7A 2WOMB 2CQ4A 4C97A 2DHAA 2R7HA 3BH6B 4NLYA 1UEUA 4CH7A 1FKPA 3Q8SB 1HW9A 2ZELA 4EZ6A 1VS3A 2FUG9 4RO0A 1F9FA 2JEFA 2PR8A 5ETNA 2J9DA 2MXYA 3QT5A 3LAKA 2YQ1A 3NXZA 1KS2A 3OL7A 3HFVA 3BV8A 3Q2TC 2DCLA 5BYQA 2A6OA 2XLKA 2QA1A 4WYWA 3FBFA 3WX8A 4OC4A 1RDRA 2AV5A 1GX5A 2WVFA 1YREA 3KNAA 2OH2A 3W9IA 2E29A 2F9JA 2B9XA 5IT0A 4DJBA 3D66A 2UXCF 5K5MA 4EGLA 2C3UA 3UN3A 3O5TB 4ZLNA 4PPZA 3V8IA 4M5DB 4OZLA 4CLKA 3KHZA 4C2YA 1CJUB 2W9BA 3QZ7A 3NEKA 2CZ9A 1NEEA 5KT2A 2DPJA 3I1UA 1OYEA 4DFJA 1N4LA 3SI8A 1D09B 3OUYB 2RS2A 1NPRA 4O3PA 3FUYA 3H7HB 4DR2F 3PX0A 5LXRA 5DWNA 4RW7A 3NOGA 4F0HA 3PBEA 4OZ2A 3IAS9 4CCHA 1HNIA 3G71S 3MR3A 3N6MA 4A8SA 4WZQA 2XMKA 1YI2S 2CQDA 4DL6A 1UVLA 2B51A 4ID8A 1O5JA 3HJVA 3HZGA 1PIEA 3KHXA 3M8QA 5IT4A 2Q1LA 2UUAF 1NDPA 4LVNP 4M5MA 5DO2A 4EUVA 2DO4A 4HNXB 1LW2B 1U6MA 5GCNA 2B7CB 9ATCB 5JXSA 5F46A 3QIPA 2W7AA 3M7VA 1WACA 4OX8A 4K5RA 4RS2A 1N6QA 2DRBA 3CIZA 1RTIA 2JWNA 3GJQB 3RAQA 1TK0A 3FBCA 4NJQA 4LMZA 3R7NB 4DSKA 3S9LA 2H4YB 2MHEA 3RBZA 1V6HA 1HWJA 1R8BA 4Q5VA 3LF0A 1D8YA 3M2RB 2BW2A 4K4VA 3ZZRA 4M6HA 5FIIA 5EMIA 4DQPA 5LL6d 2OGUA 3GYGA 1KTQA 3QIDA 1IJEB 2C2EA 3RU0A 2KN4A 3D7GA 2BJ9A 2XI2A 1HPZB 2W7PA 2IRUA 3CUNA 4CGNA 1KVJA 4J91A 1RWMB 1FJGF 1U4BA 1F2GA 2F3JA 1UEKA 4K4WA 2XY6A 4EYIB 3CMES 4WP3A 4PK3A 2A3JA 2H5EA 3M2UB 5HAOA 4DV4J 2YVSA 2CJKA 5KFFA 1Q8BA 3CJ2A 2AJQA 1U0SA 3NMAA 1I94F 2V94A 1VQMS 2FJDB 4L3NA 2E1MC 1FFGB 4G6VB 3IS9B 2ZJPQ 2ZH5A 1GXLA 5K8NA 5KT4A 2PR1A 1LEOA 2ROEA 2IYIA 3JXOA 5LYFA 1JMTA 8AT1B 4ZVRB 4ETZA 2DGUA 2AGQA 4H4MB 4TYAA 3KK1B 4URGA 2ANPA 3BJYA 3KUGA 5K14A 4J7CA 3UR3C 1FDNA 3V2UC 3P3DA 2MQQA 4QWAA 4OX9J 1I5OB 3GJSB 2CPYA 1EAYC 2V8VA 2HIQA 3R5CA 2VZ9A 4BDPA 2JEGA 2F63A 3US5A 4F67A 4DCJB 1KDNA 2RT3A 3TANA 3NE7A 4JI7F 3RZAA 5BR8F 4PSWA 5E3AA 1PUAA 2PSWA 3WABA 3TO9A 2WSEC 4V19X 2EG2A 3UD3P 1U1MA 1S1WA 4R9MA 2EK1A 1Z8XA 4ZJOA 1JLQB 1IYKA 3MAHA 4K5SA 4KZTA 1M44A 2HWHA 1JLQA 3PFEA 2AFUA 1U47A 1K44A 5KT7A 2XULA 4FD5A 2IBKA 1ICEB 4MIWA 1FKAF 2GS8A 2E1RA 4RU9A 4I64A 1VQ6S 4ZPTR 1ZBTA 4PKDB 5KFUA 4F3OA 2WBRA 4KTQA 2QYVA 1SV5A 7CPAA 5J2QA 4I2PA 1YHQS 1N36J 1XMBA 3TA0A 3OW2R 1YK9A 2ZKTA 5ETVA 3H8GA 5G22A 2LDIA 3E2EA 1FX4A 3GYNA 5IV0A 5DDRC 2PVWA 1RHKB 1LRZA 4KHMA 4LR8A 4B02A 4MK7A 3IU1A 4KOXA 3DRPA 2DEIA 4TY9A 1ZETA 4ZPVR 2CY2A 1R43A 1U1OA 3R6GB 1CULB 3ZTRA 5B09A 4GKJF 4O3RA 1N52B 4P73A 4C6AA 1M1GA 3IWGA 2NMTA 1NBEB 3ZZ0A 5LSRA 2NYIA 2E9ZA 4ZX9A 4ILMA 2GAHC 5IOLA 1MMNA 5I42B 2KFNA 3QRRA 4Q43A 2QMUB 1RT5B 3H5UA 4G65A 2L9NA 4ECWA 3C46A 1N34F 5D8HB 1T9XA 2YH0A 3HXMA 1FCAA 2XS2A 2PJAA 1PC5A 2YKNA 5LSOA 4NXMF 1LK5A 5F8LA 1IXKA 2PRQA 2V4RA 1VRUA 2NYQA 1IBMJ 1NK6A 1RZMA 2VG5B 2ASJA 3ONQA 3GV5B 5HMWA 4DR3F 2Y3YA 1TUWA 1VHSA 4K8RA 3UO0A 4DNCA 1FE0A 3JSYA 1RWWB 4O3NA 2D4PA 4PZVA 5A8WB 3TX8A 3A3OB 2C28A 1NHUA 2Y0SD 3R96A 2OPQA 3G6XA 2J5AA 4LBHA 2FGOA 4P4BA 3T1YF 2QG9B 5ETLA 2CQGA 1GT8A 3PW0A 5DWMA 1X4CA 3F44A 1JLCA 1RT7A 4CO0A 2Z2ZA 1H7XA 4KGVB 4ED6A 2CAJA 4Y6IA 2V69A 4GKKF 2HGLA 4F3MA 3U1MA 4EZ9A 4LFAF 2AIRB 3DOKA 2HFNA 4QCLA 3AB4B 1RACB 3F73A 1DHMA 5AXLA 2NS1B 3GG0A 1CQMA 3D4JA 5D4LA 2H5JB 3QT8A 3TAMA 4B9TA 1S6QA 3OJSA 4Y49C 1ZM9A 2RILA 2IJFA 5ETQA 5KFZA 1UA1A 2YH1A 3RYLA 1NZAA 4K50A 2E9TA 3KI9A 4PG6A 2MLXA 3ISXA 1KVKA 4ID5A 4JI6J 2C6CA 4WFZA 1K8AT 1REVB 5GAHU 3QRQA 4DHVA 3I0RB 5D0GA 3V6DB 2CWXA 1LOUA 2XLIA 4PEOA 1IWGA 2F8EX 5KFIA 1X4HA 3Q8YA 3D0IE 2CJ9A 1MWYA 4BLGA 4DX8H 4H6ZA 1TKTB 4TNUA 3ZNUA 1MW7A 4K3NA 3QZ8A 1CQNA 3FXTA 5I0CA 3R5GA 2Z8QA 2VONA 3NL0A 1QVGR 3B82A 2W4DA 3OLAA 1OY8A 2UUWA 3C15A 3DDKA 2FVPA 2PIYA 4R0JA 2QRRA 1RO5A 4OX7A 2JDCA 2DPSA 3TJ9A 1YDLA 3HP6A 4E8UA 4MMOA 2IM3A 2PFDA 3K58A 4F0YA 3QSIA 4DCPB 5HVFA 5LMUJ 4JP8A 4NYZA 3IS9A 1JLBB 1J5OB 2CZ4A 4Z65A 2ZBCA 4BHQA 3TUPA 4DDFA 4IAVA 2N82B 3WIUA 1UZDA 3BSNA 4UW2A 3FGVA 2VQYA 3KDOA 3NG8A 4QIGA 2BXJA 2B7BB 4DU8A 2GGPA 2YWGA 2OZGA 1D0EA 2CRLA 4GVLA 1LANA 4LF4F 3UDCA 1VJWA 2ZEGA 3BYPA 2ZVIA 4ZCIA 4CLWA 4MHDA 2DR6A 3D6TB 1KLNA 1VQ9S 3C16A 3FNNA 3C19A 2QIRA 2DGWA 2MY7A 3QNWB 2KI2A 3KUHA 4X4UA 1TL5A 1Z4UA 3K0JA 2ROGA 5KFQA 4LR9A 5CXTA 3NCPA 5E2QA 2FJEB 3FBBA 4I6YA 1NHVA 3HLUA 3CXQA 3FQKA 3BF4A 4RW4B 1ELMP 2AF6A 2RQCA 3BN4A 3CCWA 2YNCC 1S9EB 5DZ7A 2CJBA 2KXHA 4CLLA 2OPRB 4ZVTB 3I31A 3U02A 3MM9A 2NXNA 2Q51A 4R5PA 2BE7D 2Z58B 2V5HG 1YQEA 3SMZA 2MZ1A 3KK3B 5KT5A 3QRPA 1RI7A 3MR5A 1AZSB 3BBBA 1VQ8S 4ECRA 2EK8A 3BH7B 4ELVA 2ZVSA 3C3LA 1WG4A 1HARA 1FK9A 1B0PA 5C5JA 4C8YA 1Y7PA 2ZH9A 1LWFB 4MFJA 5C88A 4C0OC 5IV4A 4KPYA 3J81Y 1SJ1A 5BR8J 1CJUA 1CJVB 4AL6A 4JD6A 4FKYA 3FSXA 3DU5A 3AAWB 1VLYA 4LSNA 1JLGB 2B8PA 4DR2J 4KRWA 1X60A 5CD4H 4AG9A 1FESA 2IHR1 2MQPA 4XIUA 2E7VA 3OR1B 1SKUB 2MB0B 3V6KA 2VG7A 2B9WA 4LF2A 4KLWA 1R0BG 2AZ3A 1RTDB 2ZPAA 1S1VB 4F2SA 3NS7B 1C1CA 3RAMA 1FVQA 1S1TB 1BQMB 2G2YA 3BKTA 2Z3PA 4JI3J 5G0RB 2CZVC 2VPYB 3AOBA 1BLLE 4KUBA 1XR6A 2OPSB 3D7FA 2Y8YA 2Y0MA 3ETOA 4L74A 4CRYB 3OXLA 2LU1A 7FD1A 4DV1F 3ENQA 1U0HB 1UP1A 3WC2A 1HR0F 3A12A 2V67A 3W2WA 1OPIA 2MLZA 2BQRA 4ZKAA 1H8LA 4P7TA 2C6GA 4R8UB 2C2KB 1RTJA 3TR5A 1XBWA 3DCAA 3X1LB 4ZVQB 4E98A 1GYTA 2NCKL 1NPPA 3W9JA 2PJ5A 4DL4A 5JUMA 4K4ZA 1R0AA 3HCXA 4DV6F 3B2YA 5DLGA 4K2XA 2CJQA 4P7VA 2H48B 4A8MP 2NYHA 4DPTA 2PJ7A 1JLCB 4ES2A 1DLOA 4O44B 3ZZUA 3HKWA 2AJ1A 3LGMA 4DN9A 1N36F 5D29A 1D3WA 3VZIA 3A8IA 4I1TA 4L6V3 2ALYB 2GAGC 2DY9A 2ZHOA 3GKRA 2MSTA 1I12A 1LWEA 3UVJA 1HI8A 5ELYA 3NS6A 1Y9KA 5GMDA 2PMZD 4MKYA 3M6WA 1VRTB 4OYBA 1RBOB 5HQMA 2OUGA 3FSYA 1VQ4S 4WZMA 3VWDA 1FF2A 3C14A 3N6LA 3DLKB 1U1LA 1XR5A 1QUVA 3MDFA 2VDHA 2ZHBA 4KORA 4ZPDA 4O0NA 1FRJA 3GTYX 4UTGA 5IC6B 2LQ8A 1HHSA 4ECTA 4OHZA 2HNZA 3DRRB 4M8LA 2JFDA 2OP5A 3GQCA 4MCRA 2CQ1A 1Y9WA 3VAFA 3MUTP 3NGSA 3OFFA 3H20A 1N33F 5KFBA 1VQOS 3W9HA 3T3FA 1JWWA 3N01A 2HPUA 3BGOP 4G1PA 4JYWA 3M2VB 1RT4B 1AB8A 2RDIA 2WZNA 1CC7A 4WJBA 1XJOA 1R8PA 1TL3B 5HROA 3JTKA 1Q5YA 3T1AA 1N56A 4ZVGA 3T9ZA 4DSLA 2QLXA 4M5NA 1IKWA 3OTCA 4RW9B 3M30B 3TZZA 1N5YA 1NH7A 2EUIA 3QPIA 2JC0A 2BE9B 1SC1B 5JJBA 1FHTA 2OTJS 1CJKB 1U1RA 2QA4G 4JV5J 2UXDJ 4U67Q 1LWFA 3CJQA 4LFCJ 5D4OA 4B9MA 2BSWA 3RW6A 2C22A 4HHUA 1M5OC 3CDAA 2CG4A 4YR2A 1AYEA 1OWXA 3BKFA 3CVKA 4CTAB 4USTA 2MJUA 2ZUGA 4XAKA 4NGQA 1S10A 2DKOB 1S6QB 3OVSA 3FCVA 4UIAA 4FYXB 2J0SD 1XTZA 3OBIA 4IFVB 1RHRB 4NX9A 4ZLLA 1F2OA 3G8QA 3MEDB 4R3LA 2XLJA 3NKYA 4PQAA 1SKRA 5F8NA 1X4BA 1RT7B 1X5OA 3QAHA 1WKLA 4DWIA 3FMCA 1M1DA 3E01B 3ZZOA 4BCAA 4MJKA 1S6PB 2XEGA 5KFJA 2NZCA 5EDWA 3PX6A 2VXKA 2VZZA 3UN5A 1PGZA 4IG3B 3D0GE 1VI7A 5EN1A 5KFSA 2X3DA 1Q2YA 2QLJB 3QAEA 1R0CB 1GQEA 3GILA 1SL0A 4ZVOB 3VAJA 3MFHA 4IDKB 4EMEA 4FS2A 1JXEA 1WKJA 2KG0A 2KJWA 2XO7A 1XNQJ 2YNFB 1PJ7A 4IOAQ 1F5CA 3G6VA 3QO9A 2J6SA 2GE3A 2FY8A 3Q8QB 2B4DA 2QSWA 1EETA 1URRA 4NWBA 3SQGB 1LW0A 3D1OA 2DYAA 5LRKA 3PP9A 4DV6J 3KLGB 2GO9A 3EO4A 2KHDA 2KT2A 2AWZA 3GV7B 1U1KA 2GU2A 1SIWB 4KGZB 1VJQA 3DRRA 3D5MA 5KFVA 1NJXA 1OSCA 4F9UA 2KHCA 1Z5RA 5HANA 2R7WA 1XNQF 3MM7B 2JBJA 3IRXA 1EETB 1BWEA 1P4NA 5G20A 1KLMA 4Z37A 2GJFA 4RX6A 2HC9A 2EKYA 4N76A 1ZG8A 4NGSA 3OQ2A 2GLJA 3P2FA 3OHBA 2JVOA 3GYXB 1DY3A 3G82B 2J8MA 4F02A 5KFMA 4XK8C 4KHPF 4NMXA 5THWA 2A10A 4HVZA 3SQGA 2FJBB 1FNOA 3AJ1A 2V2KA 2XM3A 2B9EA 4P2MA 2E5IA 4PK2A 5IT9Y 2WVEA 2XEJA 2QGFB 4AVBA 1R6YA 2IVMA 2DEAA 1QE1A 4LF6F 2FIUA 5E5NA 3VATA 2IAJB 1GAOA 4DUZJ 2COLA 2OLWA 2Q7BA 1BPMA 3OR2A 2Q3PA 2PEBA 4CO5A 4NLGA 2FJXA 3GY9A 4I6WA 2DNZA 2HQDA 3M9MB 4Y2CA 2OB0A 1S1UB 3HVTB 5EUHA 5H84A 3DLGA 4UCMA 3G8SA 1ZG7A 1APSA 1M5KC 2EWHA 2W2MP 3MEEA 3E3XA 4BS2A 4X64J 1H6KX 5H9EK 3SJFA 1RHMB 1IU8A 4QU7A 3GR0A 2PA8D 4LUAA 3EXYA 4PG7A 2ZHAA 1H38A 2IM1A 2WVCA 3WC0A 4K4YA 1FY7A 3K5OA 5C25A 1SQFA 1QE1B 5LSLA 3IG1A 1ZAXA 4FBEA 2UUBJ 3MTKA 2UVUA 4F9VA 1JLEA 4FNIA 5KG4A 5HVGA 3V5RA 1UJ4A 2IAJA 2DNMA 3PACA 4IQXA 5LT5A 3FZBA 1YMEA 3T5LA 2POKA 2YBVA 1CPZA 3R2CJ 1GK8A 1WC4A 4RNFA 3D6HB 4I2QB 4KVXA 3W1YC 1HBUA 4NGNA 5LMNF 4B11A 1A6LA 5F47A 1NO8A 1Q16B 1RWXB 4UUXA 4KO0B 3RBUA 3T19A 1HBNB 2FHJD 2G1HA 2Q44A 4X3RA 3OXGA 2CPJA 3KDNA 1J5EJ 2MY8A 1DBDA 3KG4A 4EO8A 4X84A 4EBDA 2B3UA 3G87A 2NLWA 1T3OA 3CDUA 2CNLB 2HBZB 3T1YJ 2XWYA 4UY85 2ZBRA 4IR1A 2VG6A 3MM7A 4URSA 1F9EB 1HI0P 3CJ4A 2NUHA 3OL6A 4X4RA 4OYXA 2YTCA 4J9RA 3DM2A 5IV3A 1T9VA 1J2VA 1CS4A 2J9CA 4F6AA 5EWFA 4CM0A 2WOMA 3AJDA 1S7FA 2QZ8A 3KLIB 4LRCA 1C0UB 1QSYA 2R2SA 2XHWA 4OYAA 4QQBA 3J80Y 1N5SA 2V8GA 2FHJA 1KKHA 2YKNB 3R3TA 4M1KA 3DC2A 1OPZA 4CAXA 5IXUA 4U95A 3TRGA 3VAGA 2RNEA 1XIXA 2BOPA 3EZ5A 2WVDA 3LPEA 3H4DA 1G3OA 4WTOB 4DV0J 3SJEA 3UY5A 4QUSA 1R0AB 4IG3A 3TQ1A 4F0XA 3C6UB 3BR9A 2Y1JA 1X4EA 3IWEA 1WKKA 3EVMA 4DR3J 3OL9A 3ICLA 4KBIA 3D1QA 4WFBQ 2KL8A 1CULA 5KG5A 2EFPA 2FJWA 5HJXA 4HKQA 1YW6A 4KLVA 3S7RA 4RR5A 4Y34A 2YX7A 3Q8PB 3FMBA 4I0WA 2UXDF 1SV5B 4OI3A 4ZS6A 2B58A 2LVWA 3FCHA 5J1NA 2GVDB 1NK9A 3HSZA 2XO6A 3K7RA 1IBLF 3TZYA 4CLSA 1WTBA 2LA6A 3J80U 4DR5J 4GVBA 4NLPA 4K4UA 1MSWD 4ID5B 3IGVA 3LD2A 2AD9A 3DKDA 3PHEA 5B0CA 1E6VB 2YGWA 3CZXA 1BOBA 2XC9A 3G96A 1LW2A 1VQ5S 4BD9A 4P74A 2REEA 2ZD1A 2BRKA 3DHWC 3VGSA 2ZDPA 3PM9A 3GB0A 4IHMA 1S1VA 4JLYA 1UA0A 2XNRA 5C7PA 2HVHA 2VL1A 5CYMB 1D9DA 4M5JA 3MI7X 1O6XA 2GO8A 2WRMA 1Z8WA 3LP2B 1PYTA 2FB0A 2I79A 2K1RA 1QAIA 1TUVA 2VBXA 1VQSA 4KY3A 1B7FA 4DG1A 3KJVB 4AB7A 4Q44A 2DVIA 2HLTA 2ATLA 4CIOA 1QSMA 3T8WA 2UUAJ 3MGJA 6AT1B 3HJFA 2GQ2A 2IJNA 4WWSA 2AGPA 3MEGA 1HYSB 2RU3A 4CLTA 1IR0A 1G4CA 3LWMA 2GQQA 4WTYA 4LSLB 1FRKA 1S76D 1EARA 4BINA 3B3TA 4H2KA 3IFEA 5A0YA 1TL3A 3ZJ0A 4DPOA 3UN2A 1S97A 5ISVA 1VC5A 4YS2A 3BPDA 3UCGA 2QSFA 5D4NA 5GADU 3EVWA 4DPYA 1SQEA 1RJJA 4YEAA 4JB8B 8ATCB 1OSDA 1IQTA 4MHYA 2JOQA 2HK3A 2DNRA 2IBOA 4XPDC 1DAXA 1ARLA 5J2MB 2DNYA 1R31A 3S6GA 1JNRB 2F8HA 2P9GA 2BUEA 1S60A 2J6TA 2WSFC 2XMTA 4C2MA 3DGVA 4PCQA 4OZ5A 3JYTA 1NJZA 4O44A 3DLEB 2FVSA 3VH9A 4X65F 3DMJA 2GV1A 4R8UA 5E96A 3D67A 3MOJB 4NOHA 2MZRA 2QJ8A 1F0XA 1NUEA 1MJBA 2LQBA 1TUGB 1S5ZA 2AFZA 4ZLJA 2Q43A 3EGWB 3GG1A 2OMOA 2KVIA 3MEDA 4NLOA 1MWZA 2HFVA 1S99A 4DN0A 1HDQA 5EWGA 3VARA 3DNSA 3ZZYA 2OI2A 2DXEA 3EY5A 5DQGA 4ZY2A 3MECA 3PEJA 3WQPA 2UXBJ 1S49A 3F56A 1CS4B 3JB9k 3RR7A 1CBXA 1N6QB 5KFNA 4FD4A 4P4JA 4P75A 3K8WA 2FHOB 3FKBA 2H5MA 2XWXA 3AD7C 1XNRF 4LRDA 2MHNA 4EBCA 1NNDA 4LFAJ 1HLWA 4QW8A 2J9AA 3A3PB 5KG2A 4YDDB 1Z2LA 4QOTA 2UUCJ 3TOQA 5D77A 4LF1A 2HHSA 1JKHB 2KG1A 3FBEA 3PJXA 3NGKA 4KT0C 3H5SA 1N71A 2QIFA 2FLOA 4KO0A 2DPIA 3BPSP 1QQ9A 1DARA 2ZWPA 2EO8A 3HT3A 3GIRA 1DTTB 2CDRB 2Q0YA 4J9PA 1B3TA 2OU2A 3PRBA 3W5YA 2MKIA 3SSRA 3KTQA 2ZZNA 2J8SA 2P9CA 4LFBJ 5B0EA 1Q4RA 5F8MA 1X5TA 5K14B 3OSPA 2PFFB 6CPAA 4USIA 1SC3B 3L09A 1M5HA 4BC9A 2N4CA 3MD1A 3D2MA 4CAVA 2GC8A 2A18A 4JV5F 2PJBA 2EFQA 1SKWA 3BGRB 4IOBA 2RRNA 4L73A 2K7JA 3OT9A 3GYAA 1KVIA 2C2DA 3NGTA 1X5PA 4PUOA 5DDOC 2J8AA 1UFLA 3D7SB 2R2TA 5AE3A 2YNIB 5KG3A 3NCQA 2IM0A 4ZPBA 1FNXH 3IWNC 1L3SA 4CLZA 2EFOA 3ZC4A 3SDEB 4OLOA 1N88A 3CPAA 3B54A 4C3KA 4X65J 2JLMA 2HHXA 3S6FA 2HNYA 4ZYQA 3JSMA 4OZJA 3MZIA 4Q0BB 4H4OA 3TQEA 1NDCA 3MECB 2VQFF 5C2CA 5E41A 4TU7A 3CC4S 2KVQE 3E51A 5FLXY 4Y2MA 4LF4J 4MXUA 2BABA 2PJ8A 1S6UA 4P44A 1FJGJ 2HGMA 1TKDA 1RT2A 1ZYQA 5L1LA 3I5BA 2PC1A 4LF7J 2ZM6F 5C82A 2EVZA 4HT7A 4NLUA 1F3VA 5CZXA 2CF4A 3HD1A 3NNHA 1R8AA 3PV8A 4ZK7M 2WW8A 3IMQJ 5HN0A 4F0MA 1E6YB 3UR0A 1YK3A 4N56A 5HMXA 4OC3A 2QYGA 3O3LA 2EBGA 4ZDNA 1N5VA 1W26A 2QYCA 2RQ4A 3UD5A 3PYGA 3S6EA 2YKAA 4KH1B 2ZEMA 4AVAA 4KVOE 3KLIA 3POTB 3AODA 2WK4A 4ZA1A 3LQVA 2DNKA 2Q79A 2QA2A 4KFBB 3EDRB 3CD7A 1Q81T 3LP0B 2HZVA 2PVVA 4F36A 3BR8A 2EFNA 5A2QY 4C98A 4DFKA 3EE3A 4P2SA 1S57A 3MFIA 2CXEA 1LFWA 3FEEA 2HRYA 1P6TA 2QO3A 4CRZB 2JHEA 3QFWA 3B6BA 4WIQA 1NK4A 3G8WA 4L89A 4JI7J 3FBUA 1HWUA 3NH5A 3LGHA 1NRKA 2AFSA 2HBQB 3SYZA 1AUGA 4KSFA 2MZSA 2B0GA 1VR6A 4RNMA 4DR1F 4DMZA 3MEGB 3OXFA 3UQSA 2HS3A 2F5GA 1NSPA 2EC0A 4Y28C 1Y7RA 1DURA 4DUTA 3JTPA 2I5JB 3R1LA 1WSRA 4PR6A 1JLGA 4WK1A 5IB0A 4A8QA 3ETMA 3BXMA 4OJGA 1TFWA 5D4PA 1D9FA 5E0OA 1RT6A 3ZTSA 2M4MA 3AHPA 2R7RA 4A8FA 2GLFA 2B3VA 2B4BA 1RT3A 1X4GA 1JLEB 2CNOB 3VZHA 2ZD1B 4JV1A 5DDPC 1T11A 3DXBA 4M6GA 2LECA 4ELTA 2KXNB 1I6JA 4F8RA 4ZX8A 2OFGX 1OBRA 3PX4A 3PTWA 4TN2A 1KQSR 4IH7A 2RRBA 3EPGA 3M1VB 2H3EB 3NGUA 3UFCX 3B8HA 4P4IA 2MGZB 4CTAA 4MHZA 5F3ZA 2NXCA 4UOFA 3W2VA 3IWWA 1NZ8A 3PJWA 3RRGA 1VRTA 4XPDB 4NXMJ 3PB8X 2P6GA 1Y5IB 2YWWA 1FRHA 1IR2A 2B56A 1S1WB 1XFOA 1NDLA 5DS0A 1LXJA 4DR6J 4FKXA 3W8PA 4A30A 1UKUA 1AW0A 4K7QA 4OZ1A 4C68A 3M30A 4CYOA 2ZWOA 1ACMB 3QSYB 1PBUA 2XBPA 4CO2A 5AGEA 5JGFA 4WK3A 4PXDA 3H90A 4LFBF 1F2PA 2NSBA 4Y0FA 4MFBB 2J7UA 5D3GA 4ZVHA 1KFDA 2V34A 1NXIA 3BJ7A 1VRUB 2MZTA 3EZUA 3MMBA 2EKNA 4KUAA 2Y0BB 5L38A 5J1EB 2R2UA 3V38A 5M2RA 3TZWA 5A8WA 4Y3CA 2QJ3A 3TJAA 4DL7A 3DLBA 1RYRA 4BWJA 3CD5A 1NAQA 1PBAA 1KQFB 1S1XA 5G21A 2F9DA 3GFHA 4YMEA 2CNMA 4FF2A 1C2PA 3KNGA 3NP5A 5IWAF 4DL5A 1RKIA 2R8JA 5FD1A 3NMRA 4KGMA 3TZXA 2JEJA 3FJ2A 1C0UA 4XDDA 3BBCA 2AT1B 4RPFA 2Z3MA 2CWKA 1TKZA 2HFOA 2VU5A 4M5LA 3C66A 3CJSA 2JEWA 3AA9A 2PCUA 4B12A 2DNHA 2VDIA 3B3SA 1O0PA 2B5JA 2IQ6A 2OH1A 2YY3A 1H98A 4OI4A 4ITSA 3S9NA 2Z4PA 1BQMA 1Y0YA 1FTRA 1MG7A 2VV5A 4DLEA 1WEXA 4LSLA 2K1RB 3KQZA 1YKWA 2FYXA 4X5KA 4WYLA 1TIQA 2YX1A 3VGTA 4DZ6A 1HYSA 3IBFB 1I21A 4NGRA 4WFYA 4BMHA 1HBUB 1IKVB 3QLHB 3SBMA 3MCOA 1UWBB 5L9NA 3LO3A 5B0BA 1YSJA 2G4BA 4H4KC 3QQCD 3U1LA 4JYAF 4OHVA 1HHTP 2X3GA 4FF1A 4ZOSA 2R7XA 2BZ2A 1EX8A 3ZFVA 3AOAA 2Y8WA 2UXCJ 2QN6B 3CD0A 2RRAA 3P49B 3O6QA 2FZCB 8RUCA 3SI0A 5CD4A 1RU2A 5SZTA 4QJVA 3SEOA 4KSIA 4USWA 4DV1J 1Z4EA 1OZPA 2C2OB 2RF2B 3OVBA 3DLHA 1HFEL 4P10A 4URQU 2W9AA 5U47A 4WPAA 4CGLA 1UEVA 3KK3A 2AX0A 1TQLA 4AUKA 5F0WA 1IR1A 3R1KA 4LRBA 3FEDA 2G9OA 3S9MA 5HMNA 1N54B 3LP1A 4QIFA 2DO0A 2PE3A 3BI1A 2ZH4A 3CXSA 1LXNA 2R98A 1CJWA 2XYPB 2HFUA 3K2KA 3M8PB 2GVZA 2J9DE 1W7WA 2QMLA 5A6WA 4U8YA 2XSJA 5AXMA 5KG6A 2V8DA 2YPYA 4ALZA 4UIBA 2F4FA 4WE1B 1IOFA 4HNWB 3TP2A 5C42A 1T9WA 5JMNA 4NJRA 1Y10A 1JQGA 3IBWA 3O8WA 1JX4A 1TF9A 2DNOA 1ZM2A 3THTA 5HO4A 2JLEA 3N79A 2D3O1 3B8GA 1WOPA 3IM9A 4QYRA 2IYGA 3KLGA 2RB7A 3MM6B 1AUSL 4KS9A 2VFTA 2AKWB 4B3RJ 3I9SA 3R8YA 2Z2LA 1KLMB 1RXOB 1K9MT 4ZN1A 2UVWA 3PO5A 1H73A 5F41A 1Y7EA 1FT7A 4ECZA 2ATCB 1S7IA 3M8SA 2NUUG 1JJ2R 2GW8A 4CLUA 4LF9F 4RKUC 3P5TL 4GKKJ 1JNZB 5B08A 4OJ1A 3M05A 1EQ0A 1JJ4A 4DV0F 1R89A 4F8ZA 4LF5F 2ZBQA 4A46A 4MYUA 1PYSB 1RUSA 3ENAA 1VLOA 1TKFA 2N7CA 2HW3A 1RE1B 2CIMA 2ZXVA 1A0OB 2MQLA 4QZVB 5HI7A 2E5LF 2V2VA 4L72B 1L0CA 4A8WA 5J2PA 1RQ0A 4LBIA 1FEEA 3C6TA 3EICA 4MFBA 3MRUA 2HHWA 3J7Z5 4PPDA 5ETMA 1PILA 3J7A1 4MBUA 2ZH2A 5DDQC 2VEZA 2FVCA 2F40A 4N8OA 4DUZF 2RKIA 1ZPVA 3N7ZA 3RR8A 4C48A 1KHWA 1RLCL 4CLFA 4GRSA 4WP9A 4A95A 2R8VA 5A8KB 4U7UK 1RTZA 3W64A 4IQMA 3NFZA 4AFFA 1R3NA 2C1EB 2RAQA 4KHPJ 3AXKA 4DFPA 3HVTA 2WB4A 1U09A 3B4DA 4QPXA 3QIPB 2CA9A 2AU0A 3DU6A 4DV2J 1HWLA 4NLQA 1WHVA 1D9AA 3G2XA 4NFRA 5C42B 2GMHA 3LW5C 2PC6A 3UDVA 5HQLA 1HNXF 2K06A 2NXEA 2GMLA 4FXWA 4M95A 2W24A 1Z1ZA 2HQIA 2I8EA 1K1QA 3KLHA 3GV8B 1V3SA 4L3KA 3D2PA 2M8HA 2A2DA 3SV4A 4N47A 1LNQA 2N4DA 4LIWA 4TXSA 1Q7LB 2I0XA 1WSVA 4OAEA 2ZE2A 3LP1B 3LWLA 1S3ZA 2W2OP 2HKEA 3TUIC 2DGXA 3VGVA 1S4EA 4BBYA 4LJMA 3LP0A 5HROB 2UU9F 2OFHX 5ETTA 2PE8A 4A2ZA 4QYZJ 2JRSA 3I4HX 1UWAA 3KK2B 4DV7J 2JX2A 1C0TB 2MJNA 3JQMA 3L4BC 4CNZA 2XY7A 3PXGa 5GAGU 3GJRB 5IQ6A 3HD2A 3MUMP 3JTNA 4MI4A 3VQTA 2VJVA 1RHJB 1QAYA 2EW9A 3IR6B 3M8RA 3QWPA 4UEFA 3K57A 1B99A 1Q0NA 2B4PA 2WW4A 4B9SA 5C24B 3NNCA 3FC9A 3QB8A 2IIHA 1ZA2B 4OYIA 4HNYB 1RGVA 1LK7A 1VBXA 4FUUA 3IN5A 2XMUA 3FYNA 3W65A 4WXOA 3CDBA 4AQYF 2LQ9A 4OADA 2AJFE 1IWAA 1CPSA 1CVJA 2N3OA 1Q79A 2Z0ZA 3TJ8A 3HF5A 1X4FA 2QECA 5IB9A 2PSZA 1WWZA 4FF3A 3G3SA 1IB1E 2D69A 3HPOA 1EJ7L 2A2CA 3S8SA 2ZH3A 1P1TA 1FDDA 2FVQA 3L3CA 3A8EA 2O1PA 5D0RA 2BJEA 4P6YA 2OIHA 3KXDA 4DJLA 2ZBIA 1Y5NB 4TU9A 1D8ZA 3KHHA 2IRXA 3V4IB 4USKA 3KR5A 2JJ4D 2CQIA 5KFLA 2Q4VA 1RTHA 5LYIA 3HHLC 4YRHA 2RMLA 2AJ6A 1KTVA 2ZZTA 4JI4F 3QGGA 3SDEA 1C1BA 4LF9J 2G0CA 2PDAA 3IR5B 5T7LB 2JSXA 1MJAA 3FB3A 1HMVA 4OL8A 2O4HA 2RS8A 3MM6A 3TE4A 7AT1B 4NEZA 4G3IA 4DUKA 3DM2B 3D7HA 5IFMA 2FLNA 2DNNA 4OC5A 2DNPA 3M6UA 3RB6A 2OEJA 2BANB 4YR3A 3ET6B 3BI0A 4MH8A 4NPOA 1XBUA 1HQUB 3SFGA 3OHAA 1T05B 2DIVA 1LWCB 3I9V9 4OJHA 1WC6A 4NXNF 3AH6A 4CPAA 4OYMA 3W5XA 2VOOA 2EWBA 3D3SA 2OMLA 2H4WB 2VOPA 3VQSA 4CYUA 4KOWA 1FXDA 4ZCKA 1U45A 1BHNA 1YRXA 2ZDOA 4UT4A 2VBWA 2JVRA 3ZNJ1 1S7LA 2DR7A 2NQPA 2V63A 3VGUA 2Q6BA 3PKMA 3V6DA 2O53A 3CSKA 2M70A 1ZZFA 4DR4J 3BO4A 4FF4A 5GMKa 4ANDA 1I3OB 3V6JA 4EO6A 2ABZA 1X31C 2RE1A 2AYEA 2HBYB 5AJ3J 5D78A 1H3DA 1VMBA 4DS5A 4OHWA 4XPCA 3W2VB 1CP6A 4R57A 2UV8G 1K1SA 3SJXA 2AFXA 1SBRA 3TVYA 3CO0P 1YJRA 3EVOA 1IQZA 3D2WA 3MPUB 4UUWA 5KT3A 1HNZF 2Y1LB 2VH7A 4WIIA 3PEHA 4MK9A 3SSSA 1HBMA 4P45A 2YKQA 4WFAQ 4PSXA 2BBEA 1XC9A 5RUBA 2B9YA 2LKZA 2VF3A 2NPFA 2L3MA 2RDDA 3ZTOA 4OX6A 3FRMA 2KT3A 3MXHP 4CYPA 2ROPA 4KAIA 3NAIA 4ER8A 1UW9A 4OV1A 1JLFB 2EC2A 5AG6A 1RYSA 4F4KA 3OVAA 4FBTA 4DBQA 4A39A 5L1IA 5KFRA 4LF5J 4IO1A 3DMJB 1R27B 2GZOA 1LKZA 3JSBA 3BSCA 3W61A 5DQIA 4KQZA 3AD9C 4NLSA 4RW6A 2YWEA 3MEKA 4YR0A 3V4IA 2Y1RI 1QAJA 2VICA 4OI2A 2NSMA 1DJ0A 1TMJA 4MTPA 3EUNA 2KO1A 4IF5A 1UMJA 4LQ3A 1OO0B 4OIXA 3L7PA 4R6TA 1MJ9A 1ZOTA 1XMTA 3NGDA 2XCAA 2HHQA 3PW5A 2VA3A 1TMMA 1P8GA 2XHCA 1MN9A 2B4OA 1ELOA 2PD1A 2QX0A 1IIDA 5KG7A 4UBRA 1TKXB 3HVRA 2DHGA 1NK7A 2OZUA 3JSMB 3GFXA 2CQ2A 3OL8A 4Q8EA 2YKMB 4NYPA 1PAUB 1RABB 3C16B 1DLOB 1XRYA 1H72C 4NLRA 3EX7B 2JL9A 1KOHA 4A31A 3IRWP 3PB4X 3T1HF 4J9MA 3QGHA 5DS7A 4F4AA 5D3GB 4EMDA 1RT1B 2KXFA 2CYYA 1V3RA 1J5OA 3K5NA 1JLAA 3CCVS 3I96A 4RUHA 3CCES 3KYLA 5AE1A 2MKHA 5AXNA 4C7HA 2CDQA 2ZZMA 4IYQA 1S1TA 4NA1A 1RKJA 4UCPA 4C11B 2BE2A 1KBRA 3K5LA 3D54A 1U0HA 4X4QA 4E0AA 4IH6A 3R97A 2DH8A 4FD7A 3CMQA 2ZEOA 3CCJS 3OTDA 4QWCA 5HBMA 3Q22A 2DGSA 1XR7A 2FC8A 1L3VA 1SQGA 4LSNB 3NNAA 3MM5A 4HTJA 4ZPCA 4KSAA 3D9BA 1FWPA 1ULRA 4GO7X 1WC3A 5FDLB 1KOOA 4HACB 1KD1T 2NXUA 4RUAA 2DXFA 1IKXA 1DTQA 3HUVA 3T5KA 2KYZA 2VFUA 2VQEF 1IBCB 3IWLA 4S0MA 2PGCA 1X7VA 3CCUS 2D9PA 1TL1A 2C3PA 1WOSA 1UFWA 2Q4YA 4MKAA 2YWFA 1YIJS 4PG8A 1A9NB 4UCNA 2VFRA 1RHUB 3KHLA 1UJ5A 1UFHA 2FHKA 4Y2AA 3GIUA 1HMVB 3ADAC 2ZKUA 4DF4A 3HX9A 2O5DA 4HI2A 2R7OA 5G4DA 1FDBA 1JXLA 3VVTA 3HT0A 1BQNA 4EBEA 4HPSA 1TTHB 1UWBA 4B3SJ 1AXQA 5L8RC 3Q86A 1NMTA 1E6VA 3G9CA 1PJ6A 2G2ZA 3VV2B 3DLGB 2QMWA 2BQ3A 1K47A 4RI1A 4E8OA 2GA7A 1SQHA 4U9YA 4IOCQ 2AQ4A 3EXNA 4W92B 3WC6A 4IKAA 2Z3KA 4OC1A 1IYLA 3NS5A 1AFIA 2BE2B 4B17A 1SIZA 3J7YI 4UQTA 2HWIA 2PQ8A 1FNMA 3UWTA 3DYAA 3EM1A 3R9FA 2W1BA 1NKCA 5GAEI 3ELHA 4XPEA 2UV8A 1XMOF 1F2HA 2PO4A 3BDEA 1KR4A 1U26A 3GPAA 1MMDA 3S6HA 3BO2A 2UZAA 4CQ1A 3KKWA 1PCAA 4L76A 2YNDA 4LRAA 2CQHA 1U25A 3BQ2A 1MMLA 2QL5B 1JJHA 5MAOA 2Z3NA 3OSNA 2HHVA 1XMOJ