1Z9UA

Structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDQYTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyl transferase
publication title The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 172
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z9uA00
2KCWA 3EY5A 2BSWA 3BJ7A 3BJ8A 2FXFA 4H89A 4KOYA 5J8CA 3EC4A 4JJXA 2QMLA 3S6KA 3GKRA 2G0BA 4K30A 3UY5A 4CRYB 5E96A 2CNTA 2R1IA 3I3GA 2A4NA 2BL1A 4NF1A 2PQ8A 2EVNA 2REFA 1YVKA 1MJBA 1IB1E 3TE4A 3LODA 4AG9A 1S7FA 3BLNA 3R1KA 1P4NA 3EXNA 1M44A 2P6FA 4Y49B 4LX9A 4FD4A 2OH1A 2PSWA 5DWMA 1QSOA 2JDDA 3V8IA 5F49A 2OZHA 1BOBA 4XPLA 2Y0MA 1PUAA 2H5MA 4QVTA 3D2MA 3R95A 1RO5A 5HMNA 1XIXA 2JEVA 4E8OA 4R57A 4R3KA 4U9ZA 2Z0ZA 4KUBA 4PV6A 1N71A 4CS0B 2ATRA 4JXQA 3GYAA 4PSXA 2CNMA 4E2AA 3FB3A 4MJ8A 3PP9A 3C26A 4KUAA 3TCVA 4HKFA 2R8VA 1QSMA 4QB9A 3QAHA 2NMTA 1S7LA 4OAEA 2Q04A 4XPKA 2B3VA 4AB7A 4NEXA 1ON0A 2B4DA 4OADA 4CRZB 1KUVA 5J8FA 1KUYA 4UWJA 1I21A 2VEZA 1TIQA 2ZPAA 1M4IA 4JWPA 1OZPA 5KTAA 5JQ4A 1Y7RA 3DDDA 4X5KA 2HV2A 4MY3A 4KOUA 5C88A 1VKCA 3DR6A 3P2HA 1WWZA 3FRMA 3D3SA 2Q0YA 2VI7A 2VZYA 2Q4VA 4H6ZA 3RYOA 2FE7A 3G8WA 4HNXB 2BEIA 1IYLA 3MGDA 2WPWA 4AVBA 4KOWA 2BUEA 2Z10A 5F48A 4F6AA 5DWNA 2ZW6A 1Z4RA 3CXPA 4AVAA 3TTHA 4PK3A 3TO9A 5GCNA 4R87A 4RI1A 5KTDA 1R57A 2PR8A 3FBUA 3F8KA 3TT2A 1U6MA 1YLEA 4XNHC 4NCZA 4IF5A 5H84A 2ZW5A 3H4QA 4CAWA 5EBVA 2G3AA 4YRHA 3GY9A 4EVYA 2P6GA 4QC6A 3S6FA 4MY0A 4B5OA 3FXTA 3K9UA 4MHDA 1P0HA 2OZGA 3FIXA 4ZBGA 1M4GA 4UA3A 3D8PA 2ZW7A 3I9SA 4B5PA 2R98A 3ZZIA 3CXQA 1S7NA 1WK4A 4NSQA 3E0KA 2B58A 3PZJA 4QUSA 4R9MA 4UWIA 3R9EA 5HH1A 2PDOA 4F0YA 4J3GA 4L89A 4KOXA 4KVME 4XPDC 2B4BA 4U5YA 4KORA 3ZJ0A 3D2PA 4KZTA 4PK2A 4KOSA 1GHEA 4R3LA 4PSWA 1V0CA 1Y9WA 2Z11A 4U9YA 1PU9A 1QSNA 1KZFA 1IICA 3P2FA 2B5GA 4KVOE 2ARHA 1YVOA 5F47A 3TO6A 3KKWA 3VWDA 1YX0A 1YR0A 2FT0A 3TOBA 2DXQA 3T9YA 5JPHA 2I79A 4FD5A 1FY7A 1MJ9A 1MK4A 2CY2A 3QB8A 3EO4A 4KLVA 2OZUA 4JLYA 5F46A 4XNHB 4NXYA 3SXNA 1IYKA 4GS4A 5IV0A 2FIAA 4FD7A 2AE6A 2ZW4A 4LUAA 2G3TA 1L0CA 4H6UA 5ISVA 3IWGA 4HNWB 4I49A 4KLWA 3W6SA 2EUIA 1I1DA 1YK3A 2P6EA 1IIDA 2ZXVA 4KOVA 4IUSA 3SXOA 1Y9KA 1Q2CA 5IB0A 2P0WA 1LRZA 2R7HA 1S60A 5KTCA 3DNSA 1S7KA 3VWEA 1YREA 4AVCA 2REEA 2AJ6A 1KUXA 4KOTA 2Q4YA 4YFJA 2OB0A 5IX3A 3S6HA 4XPDB 3FNCA 3R9FA 4E0AA 2D4PA 2J8NA 3JVNA 3LD2A 4DNCA 3F0AA 3TO7A 1QSRA 1RXTA 2B5GB 2FIWA 1Z4EA 2HQYA 1Z9UA 3G3SA 3OWCA 2JDCA 2X7BA 1BO4A 2B4DB 1S5KA 1XE4A 1I12A 4MI4A 2VZZA 2IL4A 4CAXA 3N7ZA 2B3UA 2F5IA 2FSRA 3F5BA 1CM0A 3IGRA 3FYNA 3CXSA 2FL4A 2RC4A 2FS5A 4JD6A 1B87A 3R96A 3S6GA 4AG7A 1UFHA 1NSLA 1YGHA 3T90A 4M3SA 1QSTA 2O28A 1M4DA 4BMHA 4II9A 4OLLA 3R9GA 3SHPA 2PR1A 2QECA 3EFAA 4JXRA 4FD6A 5FVJA 2D4OA 2VQYA 3JUWA 3WR7A 1J4JA 2OU2A 5I0CA 5H86A 3DSBA 3W6XA 4MBUA 2I00A 2QIRA 2PRBA 4Y49C 4ORFA 5CNPA 1S3ZA 1NE9A 3NE7A 4L8AA 1K4JA 3TOAA 1B6BA 1XMTA 4CAVA 2FCKA 2JLMA 4UBRA 1MJAA 5EC4A 4RS2A 1XEBA 2K5TA 2GIVA 4HNYB 2C27A 2J8RA 3PGPA 3W91A 2HUZA 2PC1A 3TFYA 1Q2YA 2VBQA 2WPXA 1NMTA 4YGOA 4QBJA 5C82A 1CJWA 1VHSA 2GANA 2GE3A 4M85A 1M1DA 1SQHA 2Q7BA 2CNSA 4B5PB 2VXKA 4ONUA 2J8MA 1XF8A 3B8GA 1Q2DA 4KVXA 3DR8A 2Q44A
chains in the Genus database with same CATH superfamily
4P45A 2KCWA 3EY5A 5HVHA 2BSWA 3BJ7A 4R8FA 5K8OA 3IJ3A 4WJBA 2C6GA 3BJ8A 2AFZA 1TKHA 2FXFA 3D68A 2ABZA 4H2KA 4H89A 4KOYA 6CPAA 5J8CA 4P4IA 2WYRA 3EC4A 5K8NA 4UIBA 3H8GA 4JJXA 3WC6A 2QMLA 2PE3A 3CDXA 3S6KA 3GKRA 1DE4C 1XBUA 4UEFA 2G0BA 4K30A 3ISZA 2AFSA 3UY5A 4BBHA 1IY7A 1YQEA 3FMCA 4CRYB 2YNEA 4EFDA 4IK2A 5E96A 2CNTA 2R1IA 4NGQA 4MFPA 3I3GA 2A4NA 2BL1A 4NF1A 5THWA 2PIYA 2PQ8A 2EWBA 5AG7A 1JWQA 5AG6A 4C7IA 5JGFA 1X10A 2EVNA 4B13A 2REFA 1YVKA 1F2OA 1MJBA 3IEHA 4P4BA 3DGVA 4UEZA 4EMEA 1IB1E 3TE4A 1IU8A 4DUKA 3LODA 3GIUA 4AG9A 1S7FA 3BLNA 1YLOA 3R1KA 1TXRA 1P4NA 3VARA 3EXNA 2Z3MA 3FECA 1M44A 2P6FA 4ZX8A 4Y49B 4RUHA 1KWMA 2PJ4A 4LX9A 2CXAA 3JRUA 1LANA 4OKOA 3LMSA 3PRTA 2AFMA 4FD4A 2OH1A 2PSWA 2XEFA 3B2YA 3KR5A 3PB4X 1QSOA 2JDDA 3PFEA 3V8IA 4PQAA 5F49A 4DYOA 1CPSA 2OZHA 2Z3PA 4CYOA 1BOBA 4XPLA 2Y0MA 3IU2A 1ELLP 3QNVA 5K8PA 2Z3KA 1PUAA 3I1UA 3IO1A 2H5MA 4PXBA 5G20A 4QVTA 4UF4A 3D2MA 3R95A 1RO5A 2XEGA 5HMNA 1XIXA 2JEVA 1A2ZA 4ONWA 4E8OA 2ZEHA 5LYLA 1XRYA 1Z8LA 4R57A 1Z8WA 2OOTA 4MHZA 4R3KA 4IAVA 4U9ZA 2V8GA 2YGWA 2Z0ZA 2PIZA 4NGPA 4KUBA 4PV6A 1N71A 4CS0B 1UWYA 3RZAA 2ATRA 3IFEA 4JXQA 2Z3NA 3GYAA 4PSXA 2CNMA 2GREA 4E2AA 3FB3A 4R7MA 4MJ8A 3PP9A 4FBEA 2V8DA 3C26A 4KUAA 3TCVA 4HKFA 2R8VA 1QSMA 3B35A 4P10A 2CTBA 4CGNA 1VHEA 2EBJA 2YNCA 3KHXA 3QAHA 3D7FA 4QB9A 3MN8A 4UFXA 4UIAA 4C2XA 2AFXA 2NMTA 5A27A 2DEAA 1S7LA 4OAEA 2Q04A 4UEEA 4OC1A 3DR8A 2B3VA 2IQ6A 4JYWA 4NEXA 1ON0A 2B4DA 4XPKA 4AB7A 4OADA 4CRZB 1KUVA 5J8FA 1KUYA 2J9AA 4UWJA 2PJ5A 2XEJA 1I21A 2VEZA 1TIQA 4P44A 4UCPA 2ZPAA 3KHZA 1Z2LA 1M4IA 4TWEA 2ODFA 3PFOA 4JWPA 4MFZA 1OZPA 4JZ0A 5JQ4A 5KTAA 1Y7RA 2EK9A 3IWWA 4CYNA 3DDDA 4X5KA 3SJGA 2HV2A 4ZGYB 4MY3A 5I4MA 4KOUA 4Q36A 5C88A 1VKCA 2ZEMA 4GXHA 5DS0A 3DR6A 3P2HA 1WWZA 2PJCA 3FRMA 3D3SA 2DPSA 2Q0YA 2VI7A 3PB9X 2VZYA 2Q4VA 4H6ZA 3RBUA 3RYOA 2FE7A 4W9YA 2RFHA 3G8WA 5LRJA 1ZG7A 3H8FA 4HNXB 5ELYA 2BEIA 3BXMA 1IYLA 2BOAA 3MGDA 2PVVA 2WPWA 1AMPA 5LRGA 4CGMA 5JH9A 4CYPA 4AVBA 2ZEDA 2PJ8A 3S9LA 3NH4A 4KOWA 1CP7A 2BUEA 3FEEA 1VIXA 2ZEPA 2O53A 2Z10A 1LAPA 4WWVA 5F48A 3NH8A 3HUVA 5DWNA 4A2ZA 4F6AA 2WSAA 2ZW6A 5G22A 4Q7AA 2V8HA 1Z5RA 4P4FA 1Z4RA 2AFOA 3CXPA 2PRQA 1VHOA 4AVAA 1PCAA 3TTHA 4PK3A 2CF4A 3TO9A 2PJAA 2Q51A 1H8LA 2CTCA 2PJ9A 3B3TA 4NJQA 5GCNA 1ZLHA 4R87A 2ZENA 3IWEA 4RI1A 5KTDA 1R57A 4ZX9A 4EWTA 2Z3LA 5A28A 2PR8A 3FBUA 3PB7X 2VL1A 3F8KA 1AYEA 3H5ZA 4MFKA 3S9MA 4DJLA 4YU9A 4OC4A 1X12A 3TT2A 1JQGA 1BAVA 1U6MA 2RB7A 4PXEA 1XJOA 1YLEA 1FNOA 4NFRA 4XNHC 4NCZA 4IF5A 4X2TA 2QJ8A 5H84A 4ZY1A 4F9VA 2ZW5A 3H4QA 4YWYA 4CAWA 7CPAA 3DLJA 4MHPA 5EBVA 1F2PA 2G3AA 1Y0YA 4YRHA 3GY9A 3FH4A 3HLPA 3KL9A 3QAYA 4OIWA 3FX6A 2I3CA 2P6GA 5AG5A 4EVYA 4P6YA 4O23A 4UCMA 4A33A 4QC6A 1IGBA 1RTQA 3BI1A 3S6FA 2NYQA 2POKA 3NE8A 2ZOFA 4MY0A 3BHXA 4KSAA 4B5OA 2F8HA 1Q7LA 3FXTA 3K9UA 4MHDA 1P0HA 5J1QA 3RNZA 2OZGA 3FIXA 3D67A 1ZO0A 1NSAA 2XEIA 3SJXA 4ZBGA 3RO0A 3SJEA 1ELMP 1M4GA 4UA3A 1TF8A 3D8PA 4A94A 2ZW7A 3I9SA 1GYTA 3CZXA 4A37A 4B5PA 2R98A 3ZZIA 1LOKA 3CXQA 4UFVA 1S7NA 1WK4A 4LQGA 4NSQA 1QQ9A 3WABA 3H8EA 1VGYA 3E0KA 3NA6A 2B58A 2HB6A 3PZJA 4FUUA 4QUSA 4R9MA 4UWIA 5CPAA 3IC1A 3R9EA 4MFQA 5HH1A 3VH9A 2PDOA 2Z3OA 4LQ6A 4B11A 5F09A 4F0YA 3KZWA 4J3GA 4MFLA 4L89A 1HEEA 4KOXA 4KVME 4XPDC 4B10A 1AUGA 2B4BA 3N5FA 4MCSA 4U5YA 4KORA 5G21A 1LAMA 3ZJ0A 5LYDA 3D2PA 4KZTA 4PK2A 3B3CA 1XFOA 4KOSA 1GHEA 4R3LA 4C7HA 5LYIA 4C2ZA 4PSWA 2V8VA 4KS9A 1V0CA 1Y9WA 3D7DA 1HDQA 2Z11A 5BWAB 2YNCC 1HDUA 4U9YA 4OMEA 5JM6A 1M4LA 1XOVA 4MHNA 1PU9A 1QSNA 1KZFA 1IICA 3P2FA 4A31A 4KSIA 2B5GA 4Q38A 4NJRA 4KVOE 1FT7A 2ARHA 2NSMA 3D7HA 1YVOA 3FJUA 4OC5A 5F47A 4CAFA 4NGTA 2IMOA 3TO6A 3KKWA 3VWDA 1YX0A 1YR0A 4F0XA 2FT0A 3TOBA 2DXQA 3T9YA 5JPHA 1R43A 1Y7EA 2O4HA 3GUXA 1YSJA 2I79A 4FWUA 4FD5A 1FY7A 1MJ9A 4MCPA 1MK4A 2CY2A 1CX8A 2YNDA 3QB8A 4CPAA 5HXDA 4MHYA 3EO4A 4KLVA 2OZUA 3B3SA 4JLYA 3D7GA 4UFWA 5F46A 3V38A 4A39A 4XNHB 3PBEA 4BD9A 4NXYA 3SXNA 3TX8A 4RN7A 1IYKA 4GS4A 3SI1A 3KGQA 1CG2A 2FIAA 4FD7A 2AE6A 4ZY0A 5IV0A 2ZW4A 3CPXA 2Q7SA 4LUAA 4OC2A 5D29A 2G3TA 2GU2A 1L0CA 2DPTA 3CPAA 4H6UA 5ISVA 3IWGA 3NFZA 4HNWB 4I49A 4KLWA 2JEWA 4OIDA 3W6SA 5AGEA 2EUIA 1I1DA 1YK3A 1IOIA 1YMEA 1IIDA 1YW4A 2P6EA 2ZXVA 3B7IA 4KOVA 2PJ6A 4IUSA 3K9TA 3SXOA 1Y9KA 1Q2CA 1PYTB 5IB0A 2P0WA 1LRZA 2R7HA 3TC8A 1S60A 5KTCA 4HPSA 3B3WA 3DNSA 4C68A 1S7KA 1TF9A 4MMOA 3VWEA 4F8ZA 1YREA 3IIBA 4PPZA 4AVCA 2REEA 1CBXA 2BO9A 5LYFA 3S9NA 2AJ6A 1KUXA 4Z65A 3K2KA 4KOTA 4M6HA 3PB8X 3WC7A 2Q4YA 4YFJA 4ZYQA 4NGRA 3T8WA 2FVGA 1CP6A 2OB0A 2PJ7A 3S6HA 5IX3A 4XPDB 4NGMA 3FNCA 5K8MA 3R9FA 1Z8XA 4E0AA 2D4PA 2J8NA 3SI2A 3JVNA 4MCRA 3B3VA 4A32A 3IU1A 3LD2A 3RAMA 2C6PA 4DNCA 3F0AA 4F9UA 3TO7A 1QSRA 1RXTA 3SI0A 1IOFA 2B5GB 3JTKA 2FIWA 2WUUA 2F7VA 3KQXA 1Z4EA 2HQYA 2PVWA 2C6CA 1Z9UA 3G3SA 3OWCA 4A95A 4PXCA 2JDCA 2X7BA 2PJ2A 1BO4A 2B4DB 1QMUA 2GFQA 4R76A 1S5KA 2WZNA 1XE4A 1I12A 4MI4A 4B14A 3ISXA 3MRUA 4M6GA 2VZZA 2IL4A 4X3RA 3GLJA 4CAXA 3N7ZA 3L2NA 3KR4A 2Q43A 2B3UA 4NGSA 4CGOA 2F5IA 5LRKA 2JBKA 4CAEA 2HC9A 2ZOGA 4OC0A 2FSRA 3F5BA 1CM0A 4IHMA 3FVLA 3IGRA 4B6ZA 4A38A 2GLFA 3FYNA 4AXVA 2QVPA 3CXSA 5HVGA 2FL4A 2RC4A 2FS5A 4JD6A 1TKFA 1B87A 3D66A 4NGNA 1TKJA 3R96A 3S6GA 8CPAA 2PCUA 4AG7A 1UFHA 4ZI6A 2DF5A 4MXUA 1YGHA 1NSLA 2ZEEA 3T90A 4M3SA 3V7ZA 1QSTA 2AFWA 4A30A 2O28A 1EE3P 1M4DA 4MCQA 4CGPA 5IB9A 4BMHA 4II9A 5HVFA 3WT4A 4OLLA 3R9GA 3SHPA 4P4DA 1R3NA 4GM5A 2PR1A 2QECA 3EFAA 4P4EA 3PEIA 1BPNA 4JXRA 2IJZA 4FAIA 4MRIA 4FD6A 4BINA 4X8IA 5FVJA 1LFWA 4OC3A 1DTDA 5DWMA 3D4UA 4KSFA 2QYVA 2VQYA 2ZEFA 3JUWA 2PJ0A 1J4JA 3LACA 3WR7A 1F57A 4ZY2A 4P4JA 4B12A 4C2YA 1BPMA 2OR4A 4CGLA 2OU2A 3PB6X 1ZG8A 2ANPA 4TNUA 5I0CA 5H86A 3DSBA 3W6XA 4MBUA 1YW6A 2I00A 2G9DA 2QIRA 2PRBA 2GLJA 3FF3A 3BI0A 4Y49C 1XMBA 4ORFA 5CNPA 2JBJA 1S3ZA 3LWUA 1ZG9A 1NE9A 3NE7A 4L8AA 5G1ZA 1K4JA 1ARMA 3TOAA 1B6BA 5D8NA 2CIJA 1XMTA 4CAVA 3KI9A 2FCKA 2JLMA 3NH5A 4UBRA 1Y0RA 2PJBA 1MJAA 1CPXA 4M6IA 5EC4A 2BCOA 2ZEGA 4RS2A 4OP4A 1BLLE 1XEBA 2V77A 2K5TA 5CBMA 2Q4ZA 2C1CA 2GIVA 4MFJA 4HNYB 2C27A 2J8RA 4K3NA 2ZEOA 3PGPA 4UCNA 1Z8TA 3GB0A 3W91A 2HUZA 4G1PA 3WC5A 1LCPA 3SJFA 3A9LA 1OBRA 2PC1A 2ZELA 3CT9A 3TFYA 1Q2YA 2VBQA 1ARLA 2WPXA 1NMTA 4YGOA 4QBJA 5C82A 1CJWA 1VHSA 2EK8A 2PJ1A 3KQZA 3VATA 2GANA 1ZLIA 2AFUA 5EMIA 2GE3A 4M85A 1M1DA 1SQHA 2EO8A 2Q7BA 2CNSA 4B5PB 2VXKA 4CYQA 4ONUA 2J8MA 5AG4A 2PJ3A 1XF8A 3B8GA 3PBBA 1Q2DA 4R6TA 3KASA 3FEDA 4KVXA 2D4OA 4PXDA 2Q44A
chains in the Genus database with same CATH topology
2KCWA 3EY5A 2BSWA 3BJ7A 3BJ8A 2FXFA 4H89A 4KOYA 5J8CA 3EC4A 4JJXA 2QMLA 3S6KA 3GKRA 2G0BA 4K30A 3UY5A 4BBHA 4CRYB 2YNEA 5E96A 2CNTA 2R1IA 4MFPA 3I3GA 2A4NA 2BL1A 4NF1A 2PQ8A 5AG7A 5AG6A 2EVNA 4B13A 2REFA 1YVKA 1MJBA 1IB1E 3TE4A 3LODA 4AG9A 1S7FA 3BLNA 3R1KA 1P4NA 3EXNA 2Z3MA 1M44A 2P6FA 4Y49B 4LX9A 2CXAA 4MFQA 4FD4A 2OH1A 2PSWA 5DWMA 4C7IA 1QSOA 2JDDA 3V8IA 5F49A 2OZHA 2Z3PA 4CYOA 1BOBA 4XPLA 2Y0MA 3IU2A 2Z3KA 1PUAA 2H5MA 5G20A 4QVTA 3D2MA 3R95A 1RO5A 5HMNA 1XIXA 2JEVA 4E8OA 4R57A 4R3KA 4U9ZA 2YGWA 2Z0ZA 4KUBA 4PV6A 1N71A 4CS0B 2ATRA 4JXQA 2Z3NA 3GYAA 4PSXA 2CNMA 4E2AA 3FB3A 4MJ8A 3PP9A 3C26A 4KUAA 3TCVA 4HKFA 2R8VA 1QSMA 4CGNA 2YNCA 4QB9A 4UFXA 3QAHA 4C2XA 2NMTA 5A27A 1S7LA 4OAEA 2Q04A 4XPKA 2B3VA 4AB7A 4NEXA 1ON0A 2B4DA 4OADA 4CRZB 1KUVA 5J8FA 1KUYA 4UWJA 1I21A 2VEZA 1TIQA 4UCPA 2ZPAA 1M4IA 4JWPA 4MFZA 1OZPA 5KTAA 5JQ4A 1Y7RA 4CYNA 3DDDA 4X5KA 4ZGYB 2HV2A 4MY3A 4KOUA 4Q36A 5C88A 1VKCA 3DR6A 3P2HA 1WWZA 3FRMA 3D3SA 2DPSA 2Q0YA 2VI7A 2VZYA 2Q4VA 4H6ZA 3RYOA 2FE7A 3G8WA 4HNXB 2BEIA 1IYLA 3MGDA 4CGMA 2WPWA 4CYPA 4AVBA 4KOWA 2BUEA 2Z10A 5F48A 4A2ZA 5DWNA 4F6AA 2WSAA 2ZW6A 5G22A 1Z4RA 3CXPA 4AVAA 3TTHA 4PK3A 3TO9A 5GCNA 4R87A 3IWEA 4RI1A 5KTDA 1R57A 2Z3LA 5A28A 2PR8A 3FBUA 3F8KA 4MFKA 3H5ZA 3TT2A 1U6MA 1YLEA 4XNHC 4NCZA 4IF5A 5H84A 2ZW5A 3H4QA 4CAWA 5EBVA 2G3AA 4YRHA 3GY9A 4EVYA 5AG5A 2P6GA 4UCMA 4A33A 4QC6A 3S6FA 4MY0A 4KSAA 4B5OA 3FXTA 3K9UA 4MHDA 1P0HA 2OZGA 3FIXA 1ZO0A 4ZBGA 1M4GA 4UA3A 3D8PA 2ZW7A 3I9SA 4B5PA 2R98A 3ZZIA 3CXQA 4UFVA 1S7NA 1WK4A 4NSQA 3E0KA 2B58A 3PZJA 4QUSA 4R9MA 4UWIA 3R9EA 5HH1A 2PDOA 2Z3OA 4B11A 4F0YA 4MFLA 4J3GA 4L89A 4KOXA 4KVME 4XPDC 4B10A 2B4BA 4U5YA 4KORA 5G21A 3ZJ0A 3D2PA 4KZTA 4PK2A 4KOSA 1GHEA 4R3LA 4C7HA 4C2ZA 4PSWA 4KS9A 1V0CA 1Y9WA 2Z11A 5BWAB 2YNCC 4U9YA 1PU9A 1QSNA 1KZFA 1IICA 3P2FA 4A31A 2B5GA 4Q38A 4KVOE 2ARHA 1YVOA 5F47A 4CAFA 3TO6A 3KKWA 3VWDA 1YX0A 1YR0A 4F0XA 2FT0A 3TOBA 2DXQA 3T9YA 5JPHA 2I79A 4FD5A 1FY7A 1MJ9A 1MK4A 2CY2A 2YNDA 3QB8A 3EO4A 4KLVA 2OZUA 4JLYA 4UFWA 5F46A 4XNHB 4NXYA 3SXNA 4GS4A 1IYKA 5IV0A 2FIAA 4FD7A 2AE6A 2ZW4A 4LUAA 2G3TA 1L0CA 2DPTA 4H6UA 5ISVA 3IWGA 4HNWB 4I49A 4KLWA 3W6SA 5AGEA 2EUIA 1I1DA 1YK3A 2P6EA 1IIDA 2ZXVA 4KOVA 4IUSA 3SXOA 1Y9KA 1Q2CA 5IB0A 2P0WA 1LRZA 2R7HA 1S60A 5KTCA 3DNSA 4C68A 1S7KA 3VWEA 1YREA 4AVCA 2REEA 2AJ6A 1KUXA 4KOTA 2Q4YA 4YFJA 2OB0A 5IX3A 3S6HA 4XPDB 3FNCA 3R9FA 4E0AA 2D4PA 2J8NA 3JVNA 4A32A 3IU1A 3LD2A 4DNCA 3F0AA 3TO7A 1QSRA 1RXTA 3JTKA 2B5GB 2FIWA 2WUUA 1Z4EA 2HQYA 1Z9UA 3G3SA 3OWCA 4A95A 2JDCA 2X7BA 1BO4A 2B4DB 1S5KA 1XE4A 1I12A 4MI4A 4B14A 2VZZA 2IL4A 4CAXA 3N7ZA 2B3UA 4CGOA 2F5IA 4CAEA 2FSRA 3F5BA 1CM0A 3IGRA 3FYNA 3CXSA 2FL4A 2RC4A 2FS5A 4JD6A 1B87A 3R96A 3S6GA 4AG7A 1UFHA 1NSLA 1YGHA 3T90A 4M3SA 1QSTA 4A30A 2O28A 1M4DA 4CGPA 4BMHA 4II9A 4OLLA 3R9GA 3SHPA 2PR1A 2QECA 3EFAA 4JXRA 4FD6A 5FVJA 4KSFA 2D4OA 2VQYA 3JUWA 3WR7A 1J4JA 4B12A 4C2YA 4CGLA 2OU2A 5I0CA 5H86A 3DSBA 3W6XA 4MBUA 2I00A 2QIRA 2PRBA 4Y49C 4ORFA 5CNPA 1S3ZA 1NE9A 3NE7A 4L8AA 5G1ZA 1K4JA 3TOAA 1B6BA 1XMTA 4CAVA 2FCKA 2JLMA 4UBRA 1MJAA 5EC4A 4RS2A 1XEBA 2K5TA 2GIVA 4MFJA 4HNYB 2C27A 2J8RA 4UCNA 3PGPA 3W91A 2HUZA 3A9LA 2PC1A 3TFYA 1Q2YA 2VBQA 2WPXA 1NMTA 4YGOA 4QBJA 5C82A 1CJWA 1VHSA 2GANA 2GE3A 4M85A 1M1DA 1SQHA 2Q7BA 2CNSA 4B5PB 2VXKA 4CYQA 4ONUA 2J8MA 5AG4A 1XF8A 3B8GA 1Q2DA 4KVXA 3DR8A 2Q44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCW A;  3EY5 A;  2BSW A;  3BJ7 A;  3BJ8 A;  2FXF A;  4H89 A;  4KOY A;  5J8C A;  3EC4 A;  4JJX A;  2QML A;  3S6K A;  3GKR A;  2G0B A;  4K30 A;  3UY5 A;  4CRY B;  5E96 A;  2CNT A;  2R1I A;  3I3G A;  2A4N A;  2BL1 A;  4NF1 A;  2PQ8 A;  2EVN A;  2REF A;  1YVK A;  1MJB A;  1IB1 E;  3TE4 A;  3LOD A;  4AG9 A;  1S7F A;  3BLN A;  3R1K A;  1P4N A;  3EXN A;  1M44 A;  2P6F A;  4Y49 B;  4LX9 A;  4FD4 A;  2OH1 A;  2PSW A;  5DWM A;  1QSO A;  2JDD A;  3V8I A;  5F49 A;  2OZH A;  1BOB A;  4XPL A;  2Y0M A;  1PUA A;  2H5M A;  4QVT A;  3D2M A;  3R95 A;  1RO5 A;  5HMN A;  1XIX A;  2JEV A;  4E8O A;  4R57 A;  4R3K A;  4U9Z A;  2Z0Z A;  4KUB A;  4PV6 A;  1N71 A;  4CS0 B;  2ATR A;  4JXQ A;  3GYA A;  4PSX A;  2CNM A;  4E2A A;  3FB3 A;  4MJ8 A;  3PP9 A;  3C26 A;  4KUA A;  3TCV A;  4HKF A;  2R8V A;  1QSM A;  4QB9 A;  3QAH A;  2NMT A;  1S7L A;  4OAE A;  2Q04 A;  4XPK A;  2B3V A;  4AB7 A;  4NEX A;  1ON0 A;  2B4D A;  4OAD A;  4CRZ B;  1KUV A;  5J8F A;  1KUY A;  4UWJ A;  1I21 A;  2VEZ A;  1TIQ A;  2ZPA A;  1M4I A;  4JWP A;  1OZP A;  5KTA A;  5JQ4 A;  1Y7R A;  3DDD A;  4X5K A;  2HV2 A;  4MY3 A;  4KOU A;  5C88 A;  1VKC A;  3DR6 A;  3P2H A;  1WWZ A;  3FRM A;  3D3S A;  2Q0Y A;  2VI7 A;  2VZY A;  2Q4V A;  4H6Z A;  3RYO A;  2FE7 A;  3G8W A;  4HNX B;  2BEI A;  1IYL A;  3MGD A;  2WPW A;  4AVB A;  4KOW A;  2BUE A;  2Z10 A;  5F48 A;  4F6A A;  5DWN A;  2ZW6 A;  1Z4R A;  3CXP A;  4AVA A;  3TTH A;  4PK3 A;  3TO9 A;  5GCN A;  4R87 A;  4RI1 A;  5KTD A;  1R57 A;  2PR8 A;  3FBU A;  3F8K A;  3TT2 A;  1U6M A;  1YLE A;  4XNH C;  4NCZ A;  4IF5 A;  5H84 A;  2ZW5 A;  3H4Q A;  4CAW A;  5EBV A;  2G3A A;  4YRH A;  3GY9 A;  4EVY A;  2P6G A;  4QC6 A;  3S6F A;  4MY0 A;  4B5O A;  3FXT A;  3K9U A;  4MHD A;  1P0H A;  2OZG A;  3FIX A;  4ZBG A;  1M4G A;  4UA3 A;  3D8P A;  2ZW7 A;  3I9S A;  4B5P A;  2R98 A;  3ZZI A;  3CXQ A;  1S7N A;  1WK4 A;  4NSQ A;  3E0K A;  2B58 A;  3PZJ A;  4QUS A;  4R9M A;  4UWI A;  3R9E A;  5HH1 A;  2PDO A;  4F0Y A;  4J3G A;  4L89 A;  4KOX A;  4KVM E;  4XPD C;  2B4B A;  4U5Y A;  4KOR A;  3ZJ0 A;  3D2P A;  4KZT A;  4PK2 A;  4KOS A;  1GHE A;  4R3L A;  4PSW A;  1V0C A;  1Y9W A;  2Z11 A;  4U9Y A;  1PU9 A;  1QSN A;  1KZF A;  1IIC A;  3P2F A;  2B5G A;  4KVO E;  2ARH A;  1YVO A;  5F47 A;  3TO6 A;  3KKW A;  3VWD A;  1YX0 A;  1YR0 A;  2FT0 A;  3TOB A;  2DXQ A;  3T9Y A;  5JPH A;  2I79 A;  4FD5 A;  1FY7 A;  1MJ9 A;  1MK4 A;  2CY2 A;  3QB8 A;  3EO4 A;  4KLV A;  2OZU A;  4JLY A;  5F46 A;  4XNH B;  4NXY A;  3SXN A;  1IYK A;  4GS4 A;  5IV0 A;  2FIA A;  4FD7 A;  2AE6 A;  2ZW4 A;  4LUA A;  2G3T A;  1L0C A;  4H6U A;  5ISV A;  3IWG A;  4HNW B;  4I49 A;  4KLW A;  3W6S A;  2EUI A;  1I1D A;  1YK3 A;  2P6E A;  1IID A;  2ZXV A;  4KOV A;  4IUS A;  3SXO A;  1Y9K A;  1Q2C A;  5IB0 A;  2P0W A;  1LRZ A;  2R7H A;  1S60 A;  5KTC A;  3DNS A;  1S7K A;  3VWE A;  1YRE A;  4AVC A;  2REE A;  2AJ6 A;  1KUX A;  4KOT A;  2Q4Y A;  4YFJ A;  2OB0 A;  5IX3 A;  3S6H A;  4XPD B;  3FNC A;  3R9F A;  4E0A A;  2D4P A;  2J8N A;  3JVN A;  3LD2 A;  4DNC A;  3F0A A;  3TO7 A;  1QSR A;  1RXT A;  2B5G B;  2FIW A;  1Z4E A;  2HQY A;  1Z9U A;  3G3S A;  3OWC A;  2JDC A;  2X7B A;  1BO4 A;  2B4D B;  1S5K A;  1XE4 A;  1I12 A;  4MI4 A;  2VZZ A;  2IL4 A;  4CAX A;  3N7Z A;  2B3U A;  2F5I A;  2FSR A;  3F5B A;  1CM0 A;  3IGR A;  3FYN A;  3CXS A;  2FL4 A;  2RC4 A;  2FS5 A;  4JD6 A;  1B87 A;  3R96 A;  3S6G A;  4AG7 A;  1UFH A;  1NSL A;  1YGH A;  3T90 A;  4M3S A;  1QST A;  2O28 A;  1M4D A;  4BMH A;  4II9 A;  4OLL A;  3R9G A;  3SHP A;  2PR1 A;  2QEC A;  3EFA A;  4JXR A;  4FD6 A;  5FVJ A;  2D4O A;  2VQY A;  3JUW A;  3WR7 A;  1J4J A;  2OU2 A;  5I0C A;  5H86 A;  3DSB A;  3W6X A;  4MBU A;  2I00 A;  2QIR A;  2PRB A;  4Y49 C;  4ORF A;  5CNP A;  1S3Z A;  1NE9 A;  3NE7 A;  4L8A A;  1K4J A;  3TOA A;  1B6B A;  1XMT A;  4CAV A;  2FCK A;  2JLM A;  4UBR A;  1MJA A;  5EC4 A;  4RS2 A;  1XEB A;  2K5T A;  2GIV A;  4HNY B;  2C27 A;  2J8R A;  3PGP A;  3W91 A;  2HUZ A;  2PC1 A;  3TFY A;  1Q2Y A;  2VBQ A;  2WPX A;  1NMT A;  4YGO A;  4QBJ A;  5C82 A;  1CJW A;  1VHS A;  2GAN A;  2GE3 A;  4M85 A;  1M1D A;  1SQH A;  2Q7B A;  2CNS A;  4B5P B;  2VXK A;  4ONU A;  2J8M A;  1XF8 A;  3B8G A;  1Q2D A;  4KVX A;  3DR8 A;  2Q44 A; 
#chains in the Genus database with same CATH topology
 4P45 A;  2KCW A;  3EY5 A;  5HVH A;  2BSW A;  3BJ7 A;  4R8F A;  5K8O A;  3IJ3 A;  4WJB A;  2C6G A;  3BJ8 A;  2AFZ A;  1TKH A;  2FXF A;  3D68 A;  2ABZ A;  4H2K A;  4H89 A;  4KOY A;  6CPA A;  5J8C A;  4P4I A;  2WYR A;  3EC4 A;  5K8N A;  4UIB A;  3H8G A;  4JJX A;  3WC6 A;  2QML A;  2PE3 A;  3CDX A;  3S6K A;  3GKR A;  1DE4 C;  1XBU A;  4UEF A;  2G0B A;  4K30 A;  3ISZ A;  2AFS A;  3UY5 A;  4BBH A;  1IY7 A;  1YQE A;  3FMC A;  4CRY B;  2YNE A;  4EFD A;  4IK2 A;  5E96 A;  2CNT A;  2R1I A;  4NGQ A;  4MFP A;  3I3G A;  2A4N A;  2BL1 A;  4NF1 A;  5THW A;  2PIY A;  2PQ8 A;  2EWB A;  5AG7 A;  1JWQ A;  5AG6 A;  4C7I A;  5JGF A;  1X10 A;  2EVN A;  4B13 A;  2REF A;  1YVK A;  1F2O A;  1MJB A;  3IEH A;  4P4B A;  3DGV A;  4UEZ A;  4EME A;  1IB1 E;  3TE4 A;  1IU8 A;  4DUK A;  3LOD A;  3GIU A;  4AG9 A;  1S7F A;  3BLN A;  1YLO A;  3R1K A;  1TXR A;  1P4N A;  3VAR A;  3EXN A;  2Z3M A;  3FEC A;  1M44 A;  2P6F A;  4ZX8 A;  4Y49 B;  4RUH A;  1KWM A;  2PJ4 A;  4LX9 A;  2CXA A;  3JRU A;  1LAN A;  4OKO A;  3LMS A;  3PRT A;  2AFM A;  4FD4 A;  2OH1 A;  2PSW A;  2XEF A;  3B2Y A;  3KR5 A;  3PB4 X;  1QSO A;  2JDD A;  3PFE A;  3V8I A;  4PQA A;  5F49 A;  4DYO A;  1CPS A;  2OZH A;  2Z3P A;  4CYO A;  1BOB A;  4XPL A;  2Y0M A;  3IU2 A;  1ELL P;  3QNV A;  5K8P A;  2Z3K A;  1PUA A;  3I1U A;  3IO1 A;  2H5M A;  4PXB A;  5G20 A;  4QVT A;  4UF4 A;  3D2M A;  3R95 A;  1RO5 A;  2XEG A;  5HMN A;  1XIX A;  2JEV A;  1A2Z A;  4ONW A;  4E8O A;  2ZEH A;  5LYL A;  1XRY A;  1Z8L A;  4R57 A;  1Z8W A;  2OOT A;  4MHZ A;  4R3K A;  4IAV A;  4U9Z A;  2V8G A;  2YGW A;  2Z0Z A;  2PIZ A;  4NGP A;  4KUB A;  4PV6 A;  1N71 A;  4CS0 B;  1UWY A;  3RZA A;  2ATR A;  3IFE A;  4JXQ A;  2Z3N A;  3GYA A;  4PSX A;  2CNM A;  2GRE A;  4E2A A;  3FB3 A;  4R7M A;  4MJ8 A;  3PP9 A;  4FBE A;  2V8D A;  3C26 A;  4KUA A;  3TCV A;  4HKF A;  2R8V A;  1QSM A;  3B35 A;  4P10 A;  2CTB A;  4CGN A;  1VHE A;  2EBJ A;  2YNC A;  3KHX A;  3QAH A;  3D7F A;  4QB9 A;  3MN8 A;  4UFX A;  4UIA A;  4C2X A;  2AFX A;  2NMT A;  5A27 A;  2DEA A;  1S7L A;  4OAE A;  2Q04 A;  4UEE A;  4OC1 A;  3DR8 A;  2B3V A;  2IQ6 A;  4JYW A;  4NEX A;  1ON0 A;  2B4D A;  4XPK A;  4AB7 A;  4OAD A;  4CRZ B;  1KUV A;  5J8F A;  1KUY A;  2J9A A;  4UWJ A;  2PJ5 A;  2XEJ A;  1I21 A;  2VEZ A;  1TIQ A;  4P44 A;  4UCP A;  2ZPA A;  3KHZ A;  1Z2L A;  1M4I A;  4TWE A;  2ODF A;  3PFO A;  4JWP A;  4MFZ A;  1OZP A;  4JZ0 A;  5JQ4 A;  5KTA A;  1Y7R A;  2EK9 A;  3IWW A;  4CYN A;  3DDD A;  4X5K A;  3SJG A;  2HV2 A;  4ZGY B;  4MY3 A;  5I4M A;  4KOU A;  4Q36 A;  5C88 A;  1VKC A;  2ZEM A;  4GXH A;  5DS0 A;  3DR6 A;  3P2H A;  1WWZ A;  2PJC A;  3FRM A;  3D3S A;  2DPS A;  2Q0Y A;  2VI7 A;  3PB9 X;  2VZY A;  2Q4V A;  4H6Z A;  3RBU A;  3RYO A;  2FE7 A;  4W9Y A;  2RFH A;  3G8W A;  5LRJ A;  1ZG7 A;  3H8F A;  4HNX B;  5ELY A;  2BEI A;  3BXM A;  1IYL A;  2BOA A;  3MGD A;  2PVV A;  2WPW A;  1AMP A;  5LRG A;  4CGM A;  5JH9 A;  4CYP A;  4AVB A;  2ZED A;  2PJ8 A;  3S9L A;  3NH4 A;  4KOW A;  1CP7 A;  2BUE A;  3FEE A;  1VIX A;  2ZEP A;  2O53 A;  2Z10 A;  1LAP A;  4WWV A;  5F48 A;  3NH8 A;  3HUV A;  5DWN A;  4A2Z A;  4F6A A;  2WSA A;  2ZW6 A;  5G22 A;  4Q7A A;  2V8H A;  1Z5R A;  4P4F A;  1Z4R A;  2AFO A;  3CXP A;  2PRQ A;  1VHO A;  4AVA A;  1PCA A;  3TTH A;  4PK3 A;  2CF4 A;  3TO9 A;  2PJA A;  2Q51 A;  1H8L A;  2CTC A;  2PJ9 A;  3B3T A;  4NJQ A;  5GCN A;  1ZLH A;  4R87 A;  2ZEN A;  3IWE A;  4RI1 A;  5KTD A;  1R57 A;  4ZX9 A;  4EWT A;  2Z3L A;  5A28 A;  2PR8 A;  3FBU A;  3PB7 X;  2VL1 A;  3F8K A;  1AYE A;  3H5Z A;  4MFK A;  3S9M A;  4DJL A;  4YU9 A;  4OC4 A;  1X12 A;  3TT2 A;  1JQG A;  1BAV A;  1U6M A;  2RB7 A;  4PXE A;  1XJO A;  1YLE A;  1FNO A;  4NFR A;  4XNH C;  4NCZ A;  4IF5 A;  4X2T A;  2QJ8 A;  5H84 A;  4ZY1 A;  4F9V A;  2ZW5 A;  3H4Q A;  4YWY A;  4CAW A;  7CPA A;  3DLJ A;  4MHP A;  5EBV A;  1F2P A;  2G3A A;  1Y0Y A;  4YRH A;  3GY9 A;  3FH4 A;  3HLP A;  3KL9 A;  3QAY A;  4OIW A;  3FX6 A;  2I3C A;  2P6G A;  5AG5 A;  4EVY A;  4P6Y A;  4O23 A;  4UCM A;  4A33 A;  4QC6 A;  1IGB A;  1RTQ A;  3BI1 A;  3S6F A;  2NYQ A;  2POK A;  3NE8 A;  2ZOF A;  4MY0 A;  3BHX A;  4KSA A;  4B5O A;  2F8H A;  1Q7L A;  3FXT A;  3K9U A;  4MHD A;  1P0H A;  5J1Q A;  3RNZ A;  2OZG A;  3FIX A;  3D67 A;  1ZO0 A;  1NSA A;  2XEI A;  3SJX A;  4ZBG A;  3RO0 A;  3SJE A;  1ELM P;  1M4G A;  4UA3 A;  1TF8 A;  3D8P A;  4A94 A;  2ZW7 A;  3I9S A;  1GYT A;  3CZX A;  4A37 A;  4B5P A;  2R98 A;  3ZZI A;  1LOK A;  3CXQ A;  4UFV A;  1S7N A;  1WK4 A;  4LQG A;  4NSQ A;  1QQ9 A;  3WAB A;  3H8E A;  1VGY A;  3E0K A;  3NA6 A;  2B58 A;  2HB6 A;  3PZJ A;  4FUU A;  4QUS A;  4R9M A;  4UWI A;  5CPA A;  3IC1 A;  3R9E A;  4MFQ A;  5HH1 A;  3VH9 A;  2PDO A;  2Z3O A;  4LQ6 A;  4B11 A;  5F09 A;  4F0Y A;  3KZW A;  4J3G A;  4MFL A;  4L89 A;  1HEE A;  4KOX A;  4KVM E;  4XPD C;  4B10 A;  1AUG A;  2B4B A;  3N5F A;  4MCS A;  4U5Y A;  4KOR A;  5G21 A;  1LAM A;  3ZJ0 A;  5LYD A;  3D2P A;  4KZT A;  4PK2 A;  3B3C A;  1XFO A;  4KOS A;  1GHE A;  4R3L A;  4C7H A;  5LYI A;  4C2Z A;  4PSW A;  2V8V A;  4KS9 A;  1V0C A;  1Y9W A;  3D7D A;  1HDQ A;  2Z11 A;  5BWA B;  2YNC C;  1HDU A;  4U9Y A;  4OME A;  5JM6 A;  1M4L A;  1XOV A;  4MHN A;  1PU9 A;  1QSN A;  1KZF A;  1IIC A;  3P2F A;  4A31 A;  4KSI A;  2B5G A;  4Q38 A;  4NJR A;  4KVO E;  1FT7 A;  2ARH A;  2NSM A;  3D7H A;  1YVO A;  3FJU A;  4OC5 A;  5F47 A;  4CAF A;  4NGT A;  2IMO A;  3TO6 A;  3KKW A;  3VWD A;  1YX0 A;  1YR0 A;  4F0X A;  2FT0 A;  3TOB A;  2DXQ A;  3T9Y A;  5JPH A;  1R43 A;  1Y7E A;  2O4H A;  3GUX A;  1YSJ A;  2I79 A;  4FWU A;  4FD5 A;  1FY7 A;  1MJ9 A;  4MCP A;  1MK4 A;  2CY2 A;  1CX8 A;  2YND A;  3QB8 A;  4CPA A;  5HXD A;  4MHY A;  3EO4 A;  4KLV A;  2OZU A;  3B3S A;  4JLY A;  3D7G A;  4UFW A;  5F46 A;  3V38 A;  4A39 A;  4XNH B;  3PBE A;  4BD9 A;  4NXY A;  3SXN A;  3TX8 A;  4RN7 A;  1IYK A;  4GS4 A;  3SI1 A;  3KGQ A;  1CG2 A;  2FIA A;  4FD7 A;  2AE6 A;  4ZY0 A;  5IV0 A;  2ZW4 A;  3CPX A;  2Q7S A;  4LUA A;  4OC2 A;  5D29 A;  2G3T A;  2GU2 A;  1L0C A;  2DPT A;  3CPA A;  4H6U A;  5ISV A;  3IWG A;  3NFZ A;  4HNW B;  4I49 A;  4KLW A;  2JEW A;  4OID A;  3W6S A;  5AGE A;  2EUI A;  1I1D A;  1YK3 A;  1IOI A;  1YME A;  1IID A;  1YW4 A;  2P6E A;  2ZXV A;  3B7I A;  4KOV A;  2PJ6 A;  4IUS A;  3K9T A;  3SXO A;  1Y9K A;  1Q2C A;  1PYT B;  5IB0 A;  2P0W A;  1LRZ A;  2R7H A;  3TC8 A;  1S60 A;  5KTC A;  4HPS A;  3B3W A;  3DNS A;  4C68 A;  1S7K A;  1TF9 A;  4MMO A;  3VWE A;  4F8Z A;  1YRE A;  3IIB A;  4PPZ A;  4AVC A;  2REE A;  1CBX A;  2BO9 A;  5LYF A;  3S9N A;  2AJ6 A;  1KUX A;  4Z65 A;  3K2K A;  4KOT A;  4M6H A;  3PB8 X;  3WC7 A;  2Q4Y A;  4YFJ A;  4ZYQ A;  4NGR A;  3T8W A;  2FVG A;  1CP6 A;  2OB0 A;  2PJ7 A;  3S6H A;  5IX3 A;  4XPD B;  4NGM A;  3FNC A;  5K8M A;  3R9F A;  1Z8X A;  4E0A A;  2D4P A;  2J8N A;  3SI2 A;  3JVN A;  4MCR A;  3B3V A;  4A32 A;  3IU1 A;  3LD2 A;  3RAM A;  2C6P A;  4DNC A;  3F0A A;  4F9U A;  3TO7 A;  1QSR A;  1RXT A;  3SI0 A;  1IOF A;  2B5G B;  3JTK A;  2FIW A;  2WUU A;  2F7V A;  3KQX A;  1Z4E A;  2HQY A;  2PVW A;  2C6C A;  1Z9U A;  3G3S A;  3OWC A;  4A95 A;  4PXC A;  2JDC A;  2X7B A;  2PJ2 A;  1BO4 A;  2B4D B;  1QMU A;  2GFQ A;  4R76 A;  1S5K A;  2WZN A;  1XE4 A;  1I12 A;  4MI4 A;  4B14 A;  3ISX A;  3MRU A;  4M6G A;  2VZZ A;  2IL4 A;  4X3R A;  3GLJ A;  4CAX A;  3N7Z A;  3L2N A;  3KR4 A;  2Q43 A;  2B3U A;  4NGS A;  4CGO A;  2F5I A;  5LRK A;  2JBK A;  4CAE A;  2HC9 A;  2ZOG A;  4OC0 A;  2FSR A;  3F5B A;  1CM0 A;  4IHM A;  3FVL A;  3IGR A;  4B6Z A;  4A38 A;  2GLF A;  3FYN A;  4AXV A;  2QVP A;  3CXS A;  5HVG A;  2FL4 A;  2RC4 A;  2FS5 A;  4JD6 A;  1TKF A;  1B87 A;  3D66 A;  4NGN A;  1TKJ A;  3R96 A;  3S6G A;  8CPA A;  2PCU A;  4AG7 A;  1UFH A;  4ZI6 A;  2DF5 A;  4MXU A;  1YGH A;  1NSL A;  2ZEE A;  3T90 A;  4M3S A;  3V7Z A;  1QST A;  2AFW A;  4A30 A;  2O28 A;  1EE3 P;  1M4D A;  4MCQ A;  4CGP A;  5IB9 A;  4BMH A;  4II9 A;  5HVF A;  3WT4 A;  4OLL A;  3R9G A;  3SHP A;  4P4D A;  1R3N A;  4GM5 A;  2PR1 A;  2QEC A;  3EFA A;  4P4E A;  3PEI A;  1BPN A;  4JXR A;  2IJZ A;  4FAI A;  4MRI A;  4FD6 A;  4BIN A;  4X8I A;  5FVJ A;  1LFW A;  4OC3 A;  1DTD A;  5DWM A;  3D4U A;  4KSF A;  2QYV A;  2VQY A;  2ZEF A;  3JUW A;  2PJ0 A;  1J4J A;  3LAC A;  3WR7 A;  1F57 A;  4ZY2 A;  4P4J A;  4B12 A;  4C2Y A;  1BPM A;  2OR4 A;  4CGL A;  2OU2 A;  3PB6 X;  1ZG8 A;  2ANP A;  4TNU A;  5I0C A;  5H86 A;  3DSB A;  3W6X A;  4MBU A;  1YW6 A;  2I00 A;  2G9D A;  2QIR A;  2PRB A;  2GLJ A;  3FF3 A;  3BI0 A;  4Y49 C;  1XMB A;  4ORF A;  5CNP A;  2JBJ A;  1S3Z A;  3LWU A;  1ZG9 A;  1NE9 A;  3NE7 A;  4L8A A;  5G1Z A;  1K4J A;  1ARM A;  3TOA A;  1B6B A;  5D8N A;  2CIJ A;  1XMT A;  4CAV A;  3KI9 A;  2FCK A;  2JLM A;  3NH5 A;  4UBR A;  1Y0R A;  2PJB A;  1MJA A;  1CPX A;  4M6I A;  5EC4 A;  2BCO A;  2ZEG A;  4RS2 A;  4OP4 A;  1BLL E;  1XEB A;  2V77 A;  2K5T A;  5CBM A;  2Q4Z A;  2C1C A;  2GIV A;  4MFJ A;  4HNY B;  2C27 A;  2J8R A;  4K3N A;  2ZEO A;  3PGP A;  4UCN A;  1Z8T A;  3GB0 A;  3W91 A;  2HUZ A;  4G1P A;  3WC5 A;  1LCP A;  3SJF A;  3A9L A;  1OBR A;  2PC1 A;  2ZEL A;  3CT9 A;  3TFY A;  1Q2Y A;  2VBQ A;  1ARL A;  2WPX A;  1NMT A;  4YGO A;  4QBJ A;  5C82 A;  1CJW A;  1VHS A;  2EK8 A;  2PJ1 A;  3KQZ A;  3VAT A;  2GAN A;  1ZLI A;  2AFU A;  5EMI A;  2GE3 A;  4M85 A;  1M1D A;  1SQH A;  2EO8 A;  2Q7B A;  2CNS A;  4B5P B;  2VXK A;  4CYQ A;  4ONU A;  2J8M A;  5AG4 A;  2PJ3 A;  1XF8 A;  3B8G A;  3PBB A;  1Q2D A;  4R6T A;  3KAS A;  3FED A;  4KVX A;  2D4O A;  4PXD A;  2Q44 A; 
#chains in the Genus database with same CATH homology
 2KCW A;  3EY5 A;  2BSW A;  3BJ7 A;  3BJ8 A;  2FXF A;  4H89 A;  4KOY A;  5J8C A;  3EC4 A;  4JJX A;  2QML A;  3S6K A;  3GKR A;  2G0B A;  4K30 A;  3UY5 A;  4BBH A;  4CRY B;  2YNE A;  5E96 A;  2CNT A;  2R1I A;  4MFP A;  3I3G A;  2A4N A;  2BL1 A;  4NF1 A;  2PQ8 A;  5AG7 A;  5AG6 A;  2EVN A;  4B13 A;  2REF A;  1YVK A;  1MJB A;  1IB1 E;  3TE4 A;  3LOD A;  4AG9 A;  1S7F A;  3BLN A;  3R1K A;  1P4N A;  3EXN A;  2Z3M A;  1M44 A;  2P6F A;  4Y49 B;  4LX9 A;  2CXA A;  4MFQ A;  4FD4 A;  2OH1 A;  2PSW A;  5DWM A;  4C7I A;  1QSO A;  2JDD A;  3V8I A;  5F49 A;  2OZH A;  2Z3P A;  4CYO A;  1BOB A;  4XPL A;  2Y0M A;  3IU2 A;  2Z3K A;  1PUA A;  2H5M A;  5G20 A;  4QVT A;  3D2M A;  3R95 A;  1RO5 A;  5HMN A;  1XIX A;  2JEV A;  4E8O A;  4R57 A;  4R3K A;  4U9Z A;  2YGW A;  2Z0Z A;  4KUB A;  4PV6 A;  1N71 A;  4CS0 B;  2ATR A;  4JXQ A;  2Z3N A;  3GYA A;  4PSX A;  2CNM A;  4E2A A;  3FB3 A;  4MJ8 A;  3PP9 A;  3C26 A;  4KUA A;  3TCV A;  4HKF A;  2R8V A;  1QSM A;  4CGN A;  2YNC A;  4QB9 A;  4UFX A;  3QAH A;  4C2X A;  2NMT A;  5A27 A;  1S7L A;  4OAE A;  2Q04 A;  4XPK A;  2B3V A;  4AB7 A;  4NEX A;  1ON0 A;  2B4D A;  4OAD A;  4CRZ B;  1KUV A;  5J8F A;  1KUY A;  4UWJ A;  1I21 A;  2VEZ A;  1TIQ A;  4UCP A;  2ZPA A;  1M4I A;  4JWP A;  4MFZ A;  1OZP A;  5KTA A;  5JQ4 A;  1Y7R A;  4CYN A;  3DDD A;  4X5K A;  4ZGY B;  2HV2 A;  4MY3 A;  4KOU A;  4Q36 A;  5C88 A;  1VKC A;  3DR6 A;  3P2H A;  1WWZ A;  3FRM A;  3D3S A;  2DPS A;  2Q0Y A;  2VI7 A;  2VZY A;  2Q4V A;  4H6Z A;  3RYO A;  2FE7 A;  3G8W A;  4HNX B;  2BEI A;  1IYL A;  3MGD A;  4CGM A;  2WPW A;  4CYP A;  4AVB A;  4KOW A;  2BUE A;  2Z10 A;  5F48 A;  4A2Z A;  5DWN A;  4F6A A;  2WSA A;  2ZW6 A;  5G22 A;  1Z4R A;  3CXP A;  4AVA A;  3TTH A;  4PK3 A;  3TO9 A;  5GCN A;  4R87 A;  3IWE A;  4RI1 A;  5KTD A;  1R57 A;  2Z3L A;  5A28 A;  2PR8 A;  3FBU A;  3F8K A;  4MFK A;  3H5Z A;  3TT2 A;  1U6M A;  1YLE A;  4XNH C;  4NCZ A;  4IF5 A;  5H84 A;  2ZW5 A;  3H4Q A;  4CAW A;  5EBV A;  2G3A A;  4YRH A;  3GY9 A;  4EVY A;  5AG5 A;  2P6G A;  4UCM A;  4A33 A;  4QC6 A;  3S6F A;  4MY0 A;  4KSA A;  4B5O A;  3FXT A;  3K9U A;  4MHD A;  1P0H A;  2OZG A;  3FIX A;  1ZO0 A;  4ZBG A;  1M4G A;  4UA3 A;  3D8P A;  2ZW7 A;  3I9S A;  4B5P A;  2R98 A;  3ZZI A;  3CXQ A;  4UFV A;  1S7N A;  1WK4 A;  4NSQ A;  3E0K A;  2B58 A;  3PZJ A;  4QUS A;  4R9M A;  4UWI A;  3R9E A;  5HH1 A;  2PDO A;  2Z3O A;  4B11 A;  4F0Y A;  4MFL A;  4J3G A;  4L89 A;  4KOX A;  4KVM E;  4XPD C;  4B10 A;  2B4B A;  4U5Y A;  4KOR A;  5G21 A;  3ZJ0 A;  3D2P A;  4KZT A;  4PK2 A;  4KOS A;  1GHE A;  4R3L A;  4C7H A;  4C2Z A;  4PSW A;  4KS9 A;  1V0C A;  1Y9W A;  2Z11 A;  5BWA B;  2YNC C;  4U9Y A;  1PU9 A;  1QSN A;  1KZF A;  1IIC A;  3P2F A;  4A31 A;  2B5G A;  4Q38 A;  4KVO E;  2ARH A;  1YVO A;  5F47 A;  4CAF A;  3TO6 A;  3KKW A;  3VWD A;  1YX0 A;  1YR0 A;  4F0X A;  2FT0 A;  3TOB A;  2DXQ A;  3T9Y A;  5JPH A;  2I79 A;  4FD5 A;  1FY7 A;  1MJ9 A;  1MK4 A;  2CY2 A;  2YND A;  3QB8 A;  3EO4 A;  4KLV A;  2OZU A;  4JLY A;  4UFW A;  5F46 A;  4XNH B;  4NXY A;  3SXN A;  4GS4 A;  1IYK A;  5IV0 A;  2FIA A;  4FD7 A;  2AE6 A;  2ZW4 A;  4LUA A;  2G3T A;  1L0C A;  2DPT A;  4H6U A;  5ISV A;  3IWG A;  4HNW B;  4I49 A;  4KLW A;  3W6S A;  5AGE A;  2EUI A;  1I1D A;  1YK3 A;  2P6E A;  1IID A;  2ZXV A;  4KOV A;  4IUS A;  3SXO A;  1Y9K A;  1Q2C A;  5IB0 A;  2P0W A;  1LRZ A;  2R7H A;  1S60 A;  5KTC A;  3DNS A;  4C68 A;  1S7K A;  3VWE A;  1YRE A;  4AVC A;  2REE A;  2AJ6 A;  1KUX A;  4KOT A;  2Q4Y A;  4YFJ A;  2OB0 A;  5IX3 A;  3S6H A;  4XPD B;  3FNC A;  3R9F A;  4E0A A;  2D4P A;  2J8N A;  3JVN A;  4A32 A;  3IU1 A;  3LD2 A;  4DNC A;  3F0A A;  3TO7 A;  1QSR A;  1RXT A;  3JTK A;  2B5G B;  2FIW A;  2WUU A;  1Z4E A;  2HQY A;  1Z9U A;  3G3S A;  3OWC A;  4A95 A;  2JDC A;  2X7B A;  1BO4 A;  2B4D B;  1S5K A;  1XE4 A;  1I12 A;  4MI4 A;  4B14 A;  2VZZ A;  2IL4 A;  4CAX A;  3N7Z A;  2B3U A;  4CGO A;  2F5I A;  4CAE A;  2FSR A;  3F5B A;  1CM0 A;  3IGR A;  3FYN A;  3CXS A;  2FL4 A;  2RC4 A;  2FS5 A;  4JD6 A;  1B87 A;  3R96 A;  3S6G A;  4AG7 A;  1UFH A;  1NSL A;  1YGH A;  3T90 A;  4M3S A;  1QST A;  4A30 A;  2O28 A;  1M4D A;  4CGP A;  4BMH A;  4II9 A;  4OLL A;  3R9G A;  3SHP A;  2PR1 A;  2QEC A;  3EFA A;  4JXR A;  4FD6 A;  5FVJ A;  4KSF A;  2D4O A;  2VQY A;  3JUW A;  3WR7 A;  1J4J A;  4B12 A;  4C2Y A;  4CGL A;  2OU2 A;  5I0C A;  5H86 A;  3DSB A;  3W6X A;  4MBU A;  2I00 A;  2QIR A;  2PRB A;  4Y49 C;  4ORF A;  5CNP A;  1S3Z A;  1NE9 A;  3NE7 A;  4L8A A;  5G1Z A;  1K4J A;  3TOA A;  1B6B A;  1XMT A;  4CAV A;  2FCK A;  2JLM A;  4UBR A;  1MJA A;  5EC4 A;  4RS2 A;  1XEB A;  2K5T A;  2GIV A;  4MFJ A;  4HNY B;  2C27 A;  2J8R A;  4UCN A;  3PGP A;  3W91 A;  2HUZ A;  3A9L A;  2PC1 A;  3TFY A;  1Q2Y A;  2VBQ A;  2WPX A;  1NMT A;  4YGO A;  4QBJ A;  5C82 A;  1CJW A;  1VHS A;  2GAN A;  2GE3 A;  4M85 A;  1M1D A;  1SQH A;  2Q7B A;  2CNS A;  4B5P B;  2VXK A;  4CYQ A;  4ONU A;  2J8M A;  5AG4 A;  1XF8 A;  3B8G A;  1Q2D A;  4KVX A;  3DR8 A;  2Q44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...