1Z9UA

Structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDQYTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyl transferase
publication title The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 172
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z9uA00
3EXNA 2FE7A 4JD6A 4NEXA 2Q7BA 3DNSA 2ATRA 4PSWA 4HNXB 1S5KA 1CJWA 3TO6A 4AVCA 1VKCA 2G3TA 1QSMA 3PGPA 1PUAA 4H6ZA 4HNWB 2ZW4A 2ZW5A 3DR6A 2BEIA 3I9SA 3R9EA 5C82A 4ORFA 4XPLA 4AVBA 4MBUA 3BLNA 3SXNA 5IB0A 1MK4A 2K5TA 2R8VA 4IF5A 4RS2A 2J8RA 2B4DA 2DXQA 1Q2DA 1IYKA 1QSOA 5GCNA 2WPXA 2J8MA 3TCVA 4EVYA 4M85A 3PP9A 3BJ7A 4BMHA 4R9MA 2FT0A 3CXPA 4KUBA 4H89A 3S6FA 3BJ8A 3MGDA 4GS4A 1Q2CA 4F6AA 3R9FA 4M3SA 4FD5A 2KCWA 3FB3A 3P2FA 2B3VA 4KVME 4KUAA 4CRZB 4FD4A 4Y49C 4R3LA 2R7HA 4UBRA 1V0CA 5EC4A 4R3KA 4QUSA 3R96A 1M4DA 5CNPA 1S7NA 4YFJA 1YX0A 3S6HA 4H6UA 1I1DA 1IB1E 3N7ZA 1XEBA 1NSLA 3SXOA 1J4JA 2PDOA 3TO7A 1XF8A 4KOVA 3D8PA 3FNCA 4E2AA 5DWNA 3CXQA 2P0WA 4E0AA 1S3ZA 1S7FA 1KUXA 2NMTA 2Q04A 4YRHA 3TE4A 3F8KA 2IL4A 3EY5A 3C26A 1ON0A 4J3GA 1M1DA 1MJAA 4DNCA 3NE7A 1MJBA 2HV2A 2ZPAA 4II9A 2P6GA 4R87A 3G8WA 1TIQA 1RXTA 2FCKA 5IX3A 3W6SA 1M4GA 1M4IA 4B5PB 4KOYA 3G3SA 1S7LA 4Y49B 2WPWA 2B5GB 2CNMA 2G0BA 5IV0A 2Q44A 2JEVA 1Z9UA 2VZYA 1WWZA 4L89A 3JUWA 4JXRA 2OZUA 4ONUA 4IUSA 2Z10A 3CXSA 3R9GA 1YGHA 3W6XA 4MY3A 1LRZA 4KVOE 4PK2A 2Q4VA 4JWPA 5EBVA 5HH1A 4JJXA 2BSWA 4UWIA 1Y9KA 4NSQA 1WK4A 5KTCA 1KUYA 1CM0A 3EO4A 1YK3A 1KZFA 2VEZA 5KTAA 4QBJA 2P6FA 3P2HA 2QMLA 4HNYB 2FXFA 1YVOA 4KZTA 2PQ8A 1RO5A 5JQ4A 4XPKA 4HKFA 4OADA 3V8IA 2REEA 2PR8A 2RC4A 3FBUA 4XPDC 1M44A 3DDDA 2JDCA 4CAWA 1FY7A 4NF1A 1L0CA 2O28A 1SQHA 1VHSA 2FL4A 4KOUA 4I49A 2FSRA 1NMTA 4PV6A 3S6KA 2BUEA 3VWDA 3ZJ0A 3K9UA 1I21A 1B6BA 4RI1A 4AVAA 3QB8A 2ZXVA 4KOSA 2AJ6A 3VWEA 3SHPA 4UA3A 2QECA 5JPHA 3GY9A 1PU9A 4CAVA 3FRMA 4U9YA 4LUAA 2JLMA 2HQYA 3D2MA 2GIVA 4K30A 2VQYA 3ZZIA 4X5KA 5F48A 1P0HA 2F5IA 5KTDA 4ZBGA 4AG9A 4E8OA 2R1IA 4B5OA 4KORA 3B8GA 3R95A 2GANA 5F49A 2B4DB 4FD6A 4KOXA 4R57A 3EFAA 2I79A 2JDDA 4XPDB 1N71A 2R98A 1YREA 2G3AA 3RYOA 2FS5A 1I12A 5J8CA 4AB7A 4U5YA 4U9ZA 2REFA 3TOBA 4MHDA 1IYLA 1UFHA 2EVNA 1Y7RA 2B4BA 4PSXA 2CY2A 3F0AA 2OB0A 3DSBA 3W91A 1K4JA 3D2PA 2PRBA 2Q0YA 4CAXA 2X7BA 4MJ8A 2P6EA 1QSRA 2PC1A 5DWMA 5E96A 2H5MA 5H84A 1IIDA 2HUZA 5HMNA 4QVTA 2OU2A 4KLVA 1YLEA 3R1KA 2OZGA 1GHEA 1Y9WA 2AE6A 2PSWA 2ZW6A 2GE3A 2EUIA 3JVNA 3EC4A 1S60A 2Z0ZA 2Y0MA 1Z4EA 3FYNA 3PZJA 4QB9A 3TTHA 2CNSA 3F5BA 2ARHA 4MY0A 4OLLA 2FIAA 1S7KA 2OH1A 3T90A 5I0CA 3LD2A 3TOAA 3IGRA 2ZW7A 1U6MA 2VZZA 4XNHB 4FD7A 1YR0A 1P4NA 4UWJA 2D4OA 1R57A 2B58A 3KKWA 3T9YA 3I3GA 4B5PA 2B3UA 1OZPA 4NCZA 2B5GA 4OAEA 4MI4A 1KUVA 1YVKA 4L8AA 5FVJA 3GYAA 4CRYB 2BL1A 2Q4YA 4KOTA 3OWCA 4JXQA 1QSNA 2FIWA 3H4QA 5H86A 3FIXA 1BO4A 5ISVA 1MJ9A 3S6GA 1Q2YA 4PK3A 4KVXA 1B87A 5J8FA 2VXKA 3D3SA 2I00A 1Z4RA 3TFYA 3LODA 1XMTA 5C88A 4JLYA 3IWGA 1NE9A 1XE4A 1QSTA 2QIRA 2CNTA 5F47A 2D4PA 3QAHA 2OZHA 1IICA 5F46A 4QC6A 4XNHC 2Z11A 3TO9A 4YGOA 4KLWA 3GKRA 3WR7A 2PR1A 4NXYA 3DR8A 4AG7A 2VI7A 3E0KA 2VBQA 2J8NA 4LX9A 3TT2A 1BOBA 1XIXA 2A4NA 4KOWA 3FXTA 4CS0B 2C27A 4F0YA 3UY5A
chains in the Genus database with same CATH superfamily
3EXNA 1CP7A 4MCRA 2FE7A 2FVGA 3WT4A 3D7FA 4JD6A 1UWYA 1YW6A 4NEXA 2Q7BA 3DNSA 2ATRA 4DYOA 4PSWA 4KSIA 4HNXB 2Z3NA 1Z5RA 1S5KA 3NH8A 3SJXA 4F9UA 1CJWA 3PRTA 3TO6A 2PJ5A 5LYLA 4AVCA 1VKCA 2G3TA 1QSMA 3PGPA 5THWA 1XJOA 1PCAA 4MHNA 1PUAA 5AG6A 4H6ZA 2WSAA 4HNWB 4BINA 1TF9A 2ZW4A 4UCMA 2ZW5A 5LYIA 3DR6A 2BEIA 4MFZA 3BXMA 1LANA 3I9SA 3R9EA 4OMEA 4B13A 3CT9A 5C82A 3PB6X 2Z3KA 3NE8A 4ORFA 4MXUA 3PFEA 2GLFA 4XPLA 3FJUA 4AVBA 4MBUA 3BLNA 4NGQA 2WUUA 3SXNA 1XBUA 5IB0A 2PRQA 1MK4A 2ODFA 3CPAA 2K5TA 4CGPA 2R8VA 3IEHA 3MRUA 2RB7A 3NH5A 4IF5A 4RS2A 3CDXA 1XRYA 2J8RA 2B4DA 3D7DA 3FX6A 3B2YA 2DXQA 1Q2DA 1HDUA 2XEJA 3VARA 4CYQA 1IYKA 1QSOA 3IFEA 5ELYA 5GCNA 3IWWA 4OC1A 2WPXA 2J8MA 3TCVA 4EVYA 1R3NA 3B35A 4M85A 3PP9A 3BJ7A 3D7HA 4BMHA 2CF4A 4R9MA 4CAEA 2FT0A 4MHZA 2C6GA 3CXPA 1VGYA 2AFMA 4BBHA 4KUBA 3GIUA 1IGBA 4H89A 3S6FA 4UFVA 3RAMA 3BJ8A 3MGDA 4GS4A 1Q2CA 4EMEA 4F6AA 5A28A 3R9FA 4KSFA 4M3SA 4FD5A 4B10A 5I4MA 2KCWA 4FUUA 4ZYQA 4H2KA 3FB3A 3P2FA 4IK2A 2B3VA 3V38A 1JQGA 4FBEA 4KVME 5AG4A 4KUAA 4CRZB 3FH4A 3VATA 5DS0A 4FD4A 2NYQA 4Y49C 4R3LA 4A94A 4FAIA 2R7HA 3KR5A 4UBRA 5LYDA 1V0CA 3DGVA 3PB4X 4MFPA 1FNOA 5EC4A 4R3KA 3SI0A 2QJ8A 2YNEA 5JM6A 3D67A 4RN7A 1CBXA 4QUSA 2Q43A 3R96A 1M4DA 2BCOA 5CNPA 4MRIA 1S7NA 3K2KA 4YFJA 1YX0A 2YNCC 3FMCA 3S6HA 3LWUA 4F8ZA 4A2ZA 1YLOA 4PXEA 4H6UA 3KZWA 1I1DA 4LQGA 3T8WA 4OC0A 2XEFA 1IB1E 2PJCA 3N7ZA 1YSJA 2HC9A 1XEBA 1NSLA 3SXOA 4C2ZA 3KASA 1J4JA 2GREA 2PDOA 2PCUA 3KHZA 4R7MA 1XF8A 3TO7A 4C7IA 4KOVA 3D8PA 3FNCA 1LCPA 4X2TA 5G22A 4B6ZA 3CZXA 1KWMA 4A38A 4CYNA 5DWNA 3CXQA 2P0WA 3RBUA 1S3ZA 1S7FA 2DPTA 4CGMA 4E0AA 1KUXA 2NMTA 2Q04A 4TWEA 4Q7AA 1Z8WA 3KR4A 3D68A 1F57A 3PBBA 1CPXA 4YRHA 3TE4A 2XEGA 3F8KA 4CGNA 2C6CA 2IL4A 2AFWA 3B3TA 3EY5A 3C26A 1Z8TA 1ON0A 4J3GA 2BO9A 1M1DA 1MJAA 4DNCA 3NE7A 4ONWA 1MJBA 2HV2A 4OKOA 2Z3PA 1BAVA 4ZY2A 2ZPAA 4PQAA 2P6GA 3B3SA 4FWUA 3G8WA 1TIQA 4R87A 4II9A 1RXTA 1TXRA 2FCKA 4UIBA 4B14A 5IX3A 3JRUA 1R43A 3PB7X 3W6SA 1M4GA 1M4IA 4UF4A 2ZOFA 4B5PB 4KOYA 1ARLA 1TKHA 2ZENA 1ELMP 3FECA 3G3SA 4LQ6A 3SI2A 4NJQA 1S7LA 2JEWA 4Y49B 2WPWA 2B5GB 2CNMA 3A9LA 2ZOGA 2G0BA 2OOTA 2Q44A 3FF3A 5IV0A 5JGFA 2PJ2A 2JEVA 1Z9UA 2VZYA 4P4EA 2AFZA 2V8VA 2NSMA 1WWZA 4L89A 3JUWA 4JXRA 4MFJA 2OZUA 4OC4A 3L2NA 1IY7A 2ZELA 4OIWA 3QAYA 4IUSA 2Z10A 1ZLHA 4ONUA 3CXSA 4C2XA 2V8GA 3R9GA 1YGHA 3W6XA 4ZGYB 1Z2LA 4MY3A 4UIAA 2YNDA 1LRZA 4KVOE 4F9VA 4NJRA 3PB8X 2YGWA 3KQXA 1H8LA 4PK2A 2Q4VA 4JWPA 2ZEGA 4YWYA 1YQEA 1DTDA 5EBVA 4CAFA 3KGQA 2Q4ZA 4JJXA 1Z8LA 5HH1A 2AFXA 2BSWA 2ZEEA 3D7GA 4UWIA 2PVVA 5D29A 1Y9KA 5G20A 4NSQA 1WK4A 5KTCA 1KUYA 3BI0A 2WYRA 1CM0A 4R8FA 3EO4A 1YK3A 1KZFA 2VEZA 1QQ9A 4MFQA 3KL9A 5AG7A 5KTAA 4QBJA 2P6FA 4EWTA 1LAPA 3P2HA 4ZY0A 4X8IA 1IU8A 2QMLA 3KHXA 4PPZA 4PXBA 2ANPA 4HNYB 2FXFA 5K8OA 1YVOA 4OC5A 3BI1A 4KZTA 2PQ8A 1AUGA 1RO5A 4PXDA 5JQ4A 2I3CA 5LRGA 1M4LA 2ZEMA 4HKFA 4XPKA 4RUHA 5AGEA 4OADA 3S9NA 1DE4C 3V8IA 3B3VA 2REEA 2PR8A 2RC4A 3FBUA 4XPDC 1CP6A 1M44A 3DDDA 2JDCA 4CAWA 1FY7A 4NF1A 1XOVA 3FVLA 1L0CA 3CPXA 2O28A 4P4JA 5LYFA 1SQHA 1VHSA 2EK8A 2FL4A 4KOUA 2FSRA 1NMTA 4I49A 4PV6A 4A95A 4OC2A 4W9YA 3H5ZA 3S6KA 2BUEA 4P6YA 5A27A 1ELLP 3VWDA 3ZJ0A 2PJAA 4ZX8A 2WZNA 1I21A 1B6BA 3K9UA 3K9TA 4RI1A 3TX8A 4R6TA 3QB8A 4AVAA 2ZXVA 4KOSA 2AJ6A 2CIJA 1TKFA 2GU2A 2QVPA 4UCNA 3B3CA 5CBMA 3S9LA 2ABZA 2YNCA 3VWEA 5K8PA 3SHPA 2AFSA 2QYVA 2IMOA 4NGSA 4CYPA 2PIZA 4MHYA 4UA3A 2ZEOA 3RNZA 4Q38A 2QECA 1ZO0A 1CPSA 2IJZA 1NSAA 4OP4A 1XMBA 1ZG9A 5JPHA 5HVGA 4YU9A 3GY9A 2RFHA 3I1UA 1PU9A 1ZG8A 4M6IA 4CAVA 4OC3A 3FRMA 4U9YA 5J1QA 4P4FA 2C6PA 2CXAA 2VL1A 3FEEA 4LUAA 2JLMA 4MFLA 1Z8XA 1IOIA 2C1CA 4Z65A 2HQYA 2JBKA 3D2MA 2JBJA 4OIDA 3RO0A 8CPAA 2Z3LA 2GIVA 1RTQA 4K30A 3PB9X 1A2ZA 4A30A 2VQYA 3ZZIA 4JYWA 4X5KA 5EMIA 4M6HA 5F48A 2POKA 4UFXA 3V7ZA 2ZEHA 1P0HA 2F5IA 4X3RA 3GB0A 5KTDA 4AXVA 4ZBGA 4AG9A 3H8FA 4NGRA 4E8OA 2R1IA 4Q36A 1X10A 4B5OA 4KORA 3B8GA 4MMOA 3R95A 2GANA 5F49A 2B4DB 4FD6A 2IQ6A 1X12A 4KOXA 3EFAA 2I79A 4R57A 4C7HA 2JDDA 4XPDB 2Q7SA 4ZI6A 1XFOA 1N71A 2R98A 3BHXA 1YREA 2G3AA 3RYOA 2FS5A 2PJ4A 4UCPA 5G21A 3PBEA 1I12A 5J8CA 2DF5A 3D66A 4AB7A 4KSAA 4U5YA 4U9ZA 4NFRA 2REFA 3TOBA 4MHDA 3TC8A 2PJ6A 1IYLA 1UFHA 2EVNA 5F09A 1Y7RA 2G9DA 2ZEPA 2ZEDA 2B4BA 4PSXA 1ZLIA 4DUKA 2CY2A 3IJ3A 2EBJA 3F0AA 3QNVA 1ARMA 5G1ZA 2OB0A 3DSBA 1Y0YA 3W91A 2V8HA 2DEAA 1K4JA 2V8DA 5D8NA 3D2PA 2PRBA 4ZX9A 2Q0YA 4CAXA 2X7BA 2XEIA 4MJ8A 2P6EA 4CPAA 3NFZA 3IWEA 4F0XA 1QSRA 2PC1A 3DLJA 3B3WA 5CPAA 5DWMA 3SJGA 2EO8A 2PJ7A 5E96A 2H5MA 5JH9A 2F8HA 1IIDA 2HUZA 5H84A 4A33A 5HMNA 3H8EA 3WABA 2PJ9A 1GYTA 2EK9A 1LAMA 2OU2A 4QVTA 4C68A 4CGOA 1F2PA 4G1PA 4KLVA 1YLEA 2PJ1A 3R1KA 4P45A 5LRJA 2OZGA 1GHEA 3SJFA 1Y9WA 2AE6A 4NGPA 2PSWA 5HVFA 1YMEA 3IU2A 4P4DA 3S9MA 2ZW6A 2GE3A 2AFOA 2PVWA 2EUIA 5HXDA 1F2OA 3JVNA 4GXHA 3EC4A 4NGNA 1S60A 2Z0ZA 2Y0MA 1Z4EA 2PJ3A 4A37A 5AG5A 3FYNA 1TF8A 3PZJA 4M6GA 4QB9A 1LFWA 3GUXA 3TTHA 4EFDA 2CNSA 2PJ0A 3F5BA 2ARHA 2PJBA 4MY0A 4OLLA 2DPSA 2FIAA 1S7KA 2OH1A 3T90A 4PXCA 3HLPA 5I0CA 3LD2A 4O23A 3IC1A 3TOAA 3IGRA 1PYTB 4IHMA 4P44A 2ZW7A 1U6MA 2VZZA 4XNHB 1HDQA 3KI9A 4FD7A 1YR0A 4P10A 1BPMA 1Q7LA 1P4NA 4UWJA 2D4OA 3H8GA 2GLJA 3LMSA 3SI1A 1R57A 3VH9A 4IAVA 2B58A 3KKWA 3T9YA 3I3GA 5HVHA 4WWVA 4B5PA 1Y7EA 5BWAB 2O4HA 1AMPA 3HUVA 1HEEA 2B3UA 1OZPA 4NCZA 4MHPA 2Z3MA 2PJ8A 6CPAA 1FT7A 3D4UA 2B5GA 4OAEA 4R76A 2PE3A 4MI4A 4CYOA 3GLJA 5LRKA 1OBRA 3JTKA 1KUVA 3RZAA 1YVKA 4L8AA 5FVJA 3GYAA 4CRYB 2BL1A 4UEFA 2Q4YA 4KOTA 3OWCA 4JXQA 1QSNA 4A32A 3ISXA 4C2YA 2FIWA 4MCSA 3IIBA 3NA6A 3H4QA 2F7VA 1JWQA 3N5FA 5H86A 3FIXA 1BO4A 4A31A 5ISVA 1MJ9A 1BLLE 3S6GA 1Q2YA 2PIYA 1VIXA 3KQZA 4PK3A 4KVXA 2HB6A 1B87A 1ZG7A 4E2AA 1Y0RA 2BOAA 4MCPA 4DJLA 5J8FA 5K8NA 3B7IA 2J9AA 2VXKA 1EE3P 3D3SA 4B12A 4CGLA 3MN8A 2OR4A 1QMUA 1Z4RA 2I00A 4UEZA 4P4IA 3TFYA 3LODA 1XMTA 2GFQA 5C88A 2Q51A 2EWBA 3IWGA 4HPSA 4JLYA 4KS9A 2ZEFA 3WC7A 4UFWA 1CX8A 4B11A 1NE9A 1XE4A 5K8MA 1QSTA 1CG2A 2QIRA 1VHOA 4JZ0A 3WC5A 1VHEA 2AFUA 2V77A 2CNTA 5F47A 4MCQA 2D4PA 3QAHA 1LOKA 2OZHA 1IICA 5F46A 4QC6A 4XNHC 4NGMA 2CTCA 2Z11A 3TO9A 4A39A 1YW4A 2O53A 4K3NA 4BD9A 3WC6A 2CTBA 4YGOA 1TKJA 3GKRA 4KLWA 3WR7A 2PR1A 1BPNA 1AYEA 4NXYA 4TNUA 5IB9A 3DR8A 3NH4A 4MFKA 4NGTA 4AG7A 2VI7A 3FEDA 3ISZA 3E0KA 2VBQA 4WJBA 2Z3OA 3IO1A 3LACA 3PEIA 7CPAA 4ZY1A 4GM5A 2J8NA 1IOFA 4P4BA 4LX9A 3TT2A 4UEEA 1BOBA 1XIXA 2A4NA 4KOWA 3FXTA 3PFOA 2C27A 3SJEA 4CS0B 3IU1A 4F0YA 3UY5A
chains in the Genus database with same CATH topology
3EXNA 2FE7A 4JD6A 4NEXA 2Q7BA 3DNSA 2ATRA 4PSWA 4HNXB 2Z3NA 1S5KA 1CJWA 3TO6A 4AVCA 1VKCA 2G3TA 1QSMA 3PGPA 1PUAA 5AG6A 4H6ZA 2WSAA 4HNWB 2ZW4A 4UCMA 2ZW5A 3DR6A 2BEIA 4MFZA 3I9SA 4B13A 3R9EA 5C82A 2Z3KA 4ORFA 4XPLA 4AVBA 4MBUA 3BLNA 2WUUA 3SXNA 5IB0A 1MK4A 2K5TA 4CGPA 2R8VA 4IF5A 4RS2A 2J8RA 2B4DA 2DXQA 1Q2DA 4CYQA 1IYKA 1QSOA 5GCNA 2WPXA 2J8MA 3TCVA 4EVYA 4M85A 3PP9A 3BJ7A 4BMHA 4R9MA 4CAEA 2FT0A 3CXPA 4BBHA 4KUBA 4H89A 3S6FA 4UFVA 3BJ8A 3MGDA 4GS4A 1Q2CA 4F6AA 5A28A 3R9FA 4KSFA 4M3SA 4FD5A 4B10A 2KCWA 3FB3A 3P2FA 2B3VA 4KVME 5AG4A 4KUAA 4CRZB 4FD4A 4Y49C 4R3LA 2R7HA 4UBRA 1V0CA 4MFPA 5EC4A 4R3KA 2YNEA 4QUSA 3R96A 1M4DA 5CNPA 1S7NA 4YFJA 1YX0A 2YNCC 3S6HA 4A2ZA 4H6UA 1I1DA 1IB1E 3N7ZA 1XEBA 1NSLA 3SXOA 4C2ZA 1J4JA 2PDOA 3TO7A 4C7IA 1XF8A 4KOVA 3D8PA 3FNCA 5G22A 4E2AA 4CYNA 5DWNA 3CXQA 2P0WA 4CGMA 1S3ZA 1S7FA 2DPTA 4E0AA 1KUXA 2NMTA 2Q04A 4YRHA 3TE4A 3F8KA 4CGNA 2IL4A 3EY5A 3C26A 1ON0A 4J3GA 1M1DA 1MJAA 4DNCA 3NE7A 1MJBA 2HV2A 2Z3PA 2ZPAA 4II9A 2P6GA 4R87A 3G8WA 1TIQA 1RXTA 2FCKA 4B14A 5IX3A 3W6SA 1M4GA 1M4IA 4B5PB 4KOYA 3G3SA 1S7LA 4Y49B 2WPWA 2B5GB 2CNMA 3A9LA 2G0BA 5IV0A 2Q44A 2JEVA 1Z9UA 2VZYA 1WWZA 4L89A 3JUWA 4JXRA 4MFJA 2OZUA 4ONUA 4IUSA 2Z10A 4C2XA 3CXSA 3R9GA 1YGHA 3W6XA 4ZGYB 4MY3A 2YNDA 1LRZA 4KVOE 2YGWA 4CAFA 4PK2A 2Q4VA 4JWPA 5EBVA 5HH1A 4JJXA 2BSWA 5G20A 4UWIA 1Y9KA 4NSQA 1WK4A 5KTCA 1KUYA 1CM0A 3EO4A 1YK3A 1KZFA 2VEZA 4MFQA 5AG7A 5KTAA 4QBJA 2P6FA 3P2HA 2QMLA 4HNYB 2FXFA 1YVOA 4KZTA 2PQ8A 1RO5A 5JQ4A 4XPKA 4HKFA 5AGEA 4OADA 3V8IA 2REEA 2PR8A 2RC4A 3FBUA 4XPDC 1M44A 3DDDA 2JDCA 4CAWA 1FY7A 4NF1A 1L0CA 2O28A 1SQHA 1VHSA 2FL4A 4KOUA 4I49A 2FSRA 1NMTA 4PV6A 4A95A 3H5ZA 3S6KA 2BUEA 5A27A 3VWDA 3ZJ0A 3K9UA 1I21A 1B6BA 4RI1A 4AVAA 3QB8A 2ZXVA 4KOSA 2AJ6A 4UCNA 2YNCA 3VWEA 3SHPA 4CYPA 4UA3A 4Q38A 2QECA 1ZO0A 5JPHA 3GY9A 1PU9A 4CAVA 3FRMA 4U9YA 4MFLA 2CXAA 4LUAA 2JLMA 2HQYA 3D2MA 2Z3LA 2GIVA 4K30A 4A30A 2VQYA 3ZZIA 4X5KA 5F48A 4UFXA 1P0HA 2F5IA 5KTDA 4ZBGA 4AG9A 4E8OA 2R1IA 4Q36A 4B5OA 4KORA 3B8GA 3R95A 2GANA 5F49A 2B4DB 4FD6A 4KOXA 4R57A 3EFAA 2I79A 4C7HA 2JDDA 4XPDB 1N71A 2R98A 1YREA 2G3AA 3RYOA 2FS5A 4UCPA 5G21A 1I12A 5J8CA 4AB7A 4KSAA 4U5YA 4U9ZA 2REFA 3TOBA 4MHDA 1IYLA 1UFHA 2EVNA 1Y7RA 2B4BA 4PSXA 2CY2A 3F0AA 5G1ZA 2OB0A 3DSBA 3W91A 1K4JA 3D2PA 2PRBA 2Q0YA 4CAXA 2X7BA 4MJ8A 2P6EA 3IWEA 4F0XA 1QSRA 2PC1A 5DWMA 5E96A 2H5MA 5H84A 1IIDA 2HUZA 4A33A 5HMNA 4QVTA 4C68A 2OU2A 4CGOA 4KLVA 1YLEA 3R1KA 2OZGA 1GHEA 1Y9WA 2AE6A 2PSWA 3IU2A 2ZW6A 2GE3A 2EUIA 3JVNA 3EC4A 1S60A 2Z0ZA 2Y0MA 1Z4EA 5AG5A 3FYNA 3PZJA 4QB9A 3TTHA 2CNSA 3F5BA 2ARHA 4MY0A 4OLLA 2DPSA 2FIAA 1S7KA 2OH1A 3T90A 5I0CA 3LD2A 3TOAA 3IGRA 2ZW7A 1U6MA 2VZZA 4XNHB 4FD7A 1YR0A 1P4NA 4UWJA 2D4OA 1R57A 2B58A 3KKWA 3T9YA 3I3GA 4B5PA 5BWAB 2B3UA 1OZPA 4NCZA 2Z3MA 2B5GA 4OAEA 4MI4A 4CYOA 3JTKA 1KUVA 1YVKA 4L8AA 5FVJA 3GYAA 4CRYB 2BL1A 2Q4YA 4KOTA 3OWCA 4JXQA 1QSNA 4A32A 4C2YA 2FIWA 3H4QA 5H86A 3FIXA 1BO4A 4A31A 5ISVA 1MJ9A 3S6GA 1Q2YA 4PK3A 4KVXA 1B87A 5J8FA 2VXKA 3D3SA 4B12A 4CGLA 2I00A 1Z4RA 3TFYA 3LODA 1XMTA 5C88A 4JLYA 3IWGA 4KS9A 4UFWA 4B11A 1NE9A 1XE4A 1QSTA 2QIRA 2CNTA 5F47A 2D4PA 3QAHA 2OZHA 1IICA 5F46A 4QC6A 4XNHC 2Z11A 3TO9A 4YGOA 4KLWA 3GKRA 3WR7A 2PR1A 4NXYA 3DR8A 4AG7A 4MFKA 2VI7A 3E0KA 2VBQA 2Z3OA 2J8NA 4LX9A 3TT2A 1BOBA 1XIXA 2A4NA 4KOWA 3FXTA 4CS0B 2C27A 3IU1A 4F0YA 3UY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EXN A;  2FE7 A;  4JD6 A;  4NEX A;  2Q7B A;  3DNS A;  2ATR A;  4PSW A;  4HNX B;  1S5K A;  1CJW A;  3TO6 A;  4AVC A;  1VKC A;  2G3T A;  1QSM A;  3PGP A;  1PUA A;  4H6Z A;  4HNW B;  2ZW4 A;  2ZW5 A;  3DR6 A;  2BEI A;  3I9S A;  3R9E A;  5C82 A;  4ORF A;  4XPL A;  4AVB A;  4MBU A;  3BLN A;  3SXN A;  5IB0 A;  1MK4 A;  2K5T A;  2R8V A;  4IF5 A;  4RS2 A;  2J8R A;  2B4D A;  2DXQ A;  1Q2D A;  1IYK A;  1QSO A;  5GCN A;  2WPX A;  2J8M A;  3TCV A;  4EVY A;  4M85 A;  3PP9 A;  3BJ7 A;  4BMH A;  4R9M A;  2FT0 A;  3CXP A;  4KUB A;  4H89 A;  3S6F A;  3BJ8 A;  3MGD A;  4GS4 A;  1Q2C A;  4F6A A;  3R9F A;  4M3S A;  4FD5 A;  2KCW A;  3FB3 A;  3P2F A;  2B3V A;  4KVM E;  4KUA A;  4CRZ B;  4FD4 A;  4Y49 C;  4R3L A;  2R7H A;  4UBR A;  1V0C A;  5EC4 A;  4R3K A;  4QUS A;  3R96 A;  1M4D A;  5CNP A;  1S7N A;  4YFJ A;  1YX0 A;  3S6H A;  4H6U A;  1I1D A;  1IB1 E;  3N7Z A;  1XEB A;  1NSL A;  3SXO A;  1J4J A;  2PDO A;  3TO7 A;  1XF8 A;  4KOV A;  3D8P A;  3FNC A;  4E2A A;  5DWN A;  3CXQ A;  2P0W A;  4E0A A;  1S3Z A;  1S7F A;  1KUX A;  2NMT A;  2Q04 A;  4YRH A;  3TE4 A;  3F8K A;  2IL4 A;  3EY5 A;  3C26 A;  1ON0 A;  4J3G A;  1M1D A;  1MJA A;  4DNC A;  3NE7 A;  1MJB A;  2HV2 A;  2ZPA A;  4II9 A;  2P6G A;  4R87 A;  3G8W A;  1TIQ A;  1RXT A;  2FCK A;  5IX3 A;  3W6S A;  1M4G A;  1M4I A;  4B5P B;  4KOY A;  3G3S A;  1S7L A;  4Y49 B;  2WPW A;  2B5G B;  2CNM A;  2G0B A;  5IV0 A;  2Q44 A;  2JEV A;  1Z9U A;  2VZY A;  1WWZ A;  4L89 A;  3JUW A;  4JXR A;  2OZU A;  4ONU A;  4IUS A;  2Z10 A;  3CXS A;  3R9G A;  1YGH A;  3W6X A;  4MY3 A;  1LRZ A;  4KVO E;  4PK2 A;  2Q4V A;  4JWP A;  5EBV A;  5HH1 A;  4JJX A;  2BSW A;  4UWI A;  1Y9K A;  4NSQ A;  1WK4 A;  5KTC A;  1KUY A;  1CM0 A;  3EO4 A;  1YK3 A;  1KZF A;  2VEZ A;  5KTA A;  4QBJ A;  2P6F A;  3P2H A;  2QML A;  4HNY B;  2FXF A;  1YVO A;  4KZT A;  2PQ8 A;  1RO5 A;  5JQ4 A;  4XPK A;  4HKF A;  4OAD A;  3V8I A;  2REE A;  2PR8 A;  2RC4 A;  3FBU A;  4XPD C;  1M44 A;  3DDD A;  2JDC A;  4CAW A;  1FY7 A;  4NF1 A;  1L0C A;  2O28 A;  1SQH A;  1VHS A;  2FL4 A;  4KOU A;  4I49 A;  2FSR A;  1NMT A;  4PV6 A;  3S6K A;  2BUE A;  3VWD A;  3ZJ0 A;  3K9U A;  1I21 A;  1B6B A;  4RI1 A;  4AVA A;  3QB8 A;  2ZXV A;  4KOS A;  2AJ6 A;  3VWE A;  3SHP A;  4UA3 A;  2QEC A;  5JPH A;  3GY9 A;  1PU9 A;  4CAV A;  3FRM A;  4U9Y A;  4LUA A;  2JLM A;  2HQY A;  3D2M A;  2GIV A;  4K30 A;  2VQY A;  3ZZI A;  4X5K A;  5F48 A;  1P0H A;  2F5I A;  5KTD A;  4ZBG A;  4AG9 A;  4E8O A;  2R1I A;  4B5O A;  4KOR A;  3B8G A;  3R95 A;  2GAN A;  5F49 A;  2B4D B;  4FD6 A;  4KOX A;  4R57 A;  3EFA A;  2I79 A;  2JDD A;  4XPD B;  1N71 A;  2R98 A;  1YRE A;  2G3A A;  3RYO A;  2FS5 A;  1I12 A;  5J8C A;  4AB7 A;  4U5Y A;  4U9Z A;  2REF A;  3TOB A;  4MHD A;  1IYL A;  1UFH A;  2EVN A;  1Y7R A;  2B4B A;  4PSX A;  2CY2 A;  3F0A A;  2OB0 A;  3DSB A;  3W91 A;  1K4J A;  3D2P A;  2PRB A;  2Q0Y A;  4CAX A;  2X7B A;  4MJ8 A;  2P6E A;  1QSR A;  2PC1 A;  5DWM A;  5E96 A;  2H5M A;  5H84 A;  1IID A;  2HUZ A;  5HMN A;  4QVT A;  2OU2 A;  4KLV A;  1YLE A;  3R1K A;  2OZG A;  1GHE A;  1Y9W A;  2AE6 A;  2PSW A;  2ZW6 A;  2GE3 A;  2EUI A;  3JVN A;  3EC4 A;  1S60 A;  2Z0Z A;  2Y0M A;  1Z4E A;  3FYN A;  3PZJ A;  4QB9 A;  3TTH A;  2CNS A;  3F5B A;  2ARH A;  4MY0 A;  4OLL A;  2FIA A;  1S7K A;  2OH1 A;  3T90 A;  5I0C A;  3LD2 A;  3TOA A;  3IGR A;  2ZW7 A;  1U6M A;  2VZZ A;  4XNH B;  4FD7 A;  1YR0 A;  1P4N A;  4UWJ A;  2D4O A;  1R57 A;  2B58 A;  3KKW A;  3T9Y A;  3I3G A;  4B5P A;  2B3U A;  1OZP A;  4NCZ A;  2B5G A;  4OAE A;  4MI4 A;  1KUV A;  1YVK A;  4L8A A;  5FVJ A;  3GYA A;  4CRY B;  2BL1 A;  2Q4Y A;  4KOT A;  3OWC A;  4JXQ A;  1QSN A;  2FIW A;  3H4Q A;  5H86 A;  3FIX A;  1BO4 A;  5ISV A;  1MJ9 A;  3S6G A;  1Q2Y A;  4PK3 A;  4KVX A;  1B87 A;  5J8F A;  2VXK A;  3D3S A;  2I00 A;  1Z4R A;  3TFY A;  3LOD A;  1XMT A;  5C88 A;  4JLY A;  3IWG A;  1NE9 A;  1XE4 A;  1QST A;  2QIR A;  2CNT A;  5F47 A;  2D4P A;  3QAH A;  2OZH A;  1IIC A;  5F46 A;  4QC6 A;  4XNH C;  2Z11 A;  3TO9 A;  4YGO A;  4KLW A;  3GKR A;  3WR7 A;  2PR1 A;  4NXY A;  3DR8 A;  4AG7 A;  2VI7 A;  3E0K A;  2VBQ A;  2J8N A;  4LX9 A;  3TT2 A;  1BOB A;  1XIX A;  2A4N A;  4KOW A;  3FXT A;  4CS0 B;  2C27 A;  4F0Y A;  3UY5 A; 
#chains in the Genus database with same CATH topology
 3EXN A;  1CP7 A;  4MCR A;  2FE7 A;  2FVG A;  3WT4 A;  3D7F A;  4JD6 A;  1UWY A;  1YW6 A;  4NEX A;  2Q7B A;  3DNS A;  2ATR A;  4DYO A;  4PSW A;  4KSI A;  4HNX B;  2Z3N A;  1Z5R A;  1S5K A;  3NH8 A;  3SJX A;  4F9U A;  1CJW A;  3PRT A;  3TO6 A;  2PJ5 A;  5LYL A;  4AVC A;  1VKC A;  2G3T A;  1QSM A;  3PGP A;  5THW A;  1XJO A;  1PCA A;  4MHN A;  1PUA A;  5AG6 A;  4H6Z A;  2WSA A;  4HNW B;  4BIN A;  1TF9 A;  2ZW4 A;  4UCM A;  2ZW5 A;  5LYI A;  3DR6 A;  2BEI A;  4MFZ A;  3BXM A;  1LAN A;  3I9S A;  3R9E A;  4OME A;  4B13 A;  3CT9 A;  5C82 A;  3PB6 X;  2Z3K A;  3NE8 A;  4ORF A;  4MXU A;  3PFE A;  2GLF A;  4XPL A;  3FJU A;  4AVB A;  4MBU A;  3BLN A;  4NGQ A;  2WUU A;  3SXN A;  1XBU A;  5IB0 A;  2PRQ A;  1MK4 A;  2ODF A;  3CPA A;  2K5T A;  4CGP A;  2R8V A;  3IEH A;  3MRU A;  2RB7 A;  3NH5 A;  4IF5 A;  4RS2 A;  3CDX A;  1XRY A;  2J8R A;  2B4D A;  3D7D A;  3FX6 A;  3B2Y A;  2DXQ A;  1Q2D A;  1HDU A;  2XEJ A;  3VAR A;  4CYQ A;  1IYK A;  1QSO A;  3IFE A;  5ELY A;  5GCN A;  3IWW A;  4OC1 A;  2WPX A;  2J8M A;  3TCV A;  4EVY A;  1R3N A;  3B35 A;  4M85 A;  3PP9 A;  3BJ7 A;  3D7H A;  4BMH A;  2CF4 A;  4R9M A;  4CAE A;  2FT0 A;  4MHZ A;  2C6G A;  3CXP A;  1VGY A;  2AFM A;  4BBH A;  4KUB A;  3GIU A;  1IGB A;  4H89 A;  3S6F A;  4UFV A;  3RAM A;  3BJ8 A;  3MGD A;  4GS4 A;  1Q2C A;  4EME A;  4F6A A;  5A28 A;  3R9F A;  4KSF A;  4M3S A;  4FD5 A;  4B10 A;  5I4M A;  2KCW A;  4FUU A;  4ZYQ A;  4H2K A;  3FB3 A;  3P2F A;  4IK2 A;  2B3V A;  3V38 A;  1JQG A;  4FBE A;  4KVM E;  5AG4 A;  4KUA A;  4CRZ B;  3FH4 A;  3VAT A;  5DS0 A;  4FD4 A;  2NYQ A;  4Y49 C;  4R3L A;  4A94 A;  4FAI A;  2R7H A;  3KR5 A;  4UBR A;  5LYD A;  1V0C A;  3DGV A;  3PB4 X;  4MFP A;  1FNO A;  5EC4 A;  4R3K A;  3SI0 A;  2QJ8 A;  2YNE A;  5JM6 A;  3D67 A;  4RN7 A;  1CBX A;  4QUS A;  2Q43 A;  3R96 A;  1M4D A;  2BCO A;  5CNP A;  4MRI A;  1S7N A;  3K2K A;  4YFJ A;  1YX0 A;  2YNC C;  3FMC A;  3S6H A;  3LWU A;  4F8Z A;  4A2Z A;  1YLO A;  4PXE A;  4H6U A;  3KZW A;  1I1D A;  4LQG A;  3T8W A;  4OC0 A;  2XEF A;  1IB1 E;  2PJC A;  3N7Z A;  1YSJ A;  2HC9 A;  1XEB A;  1NSL A;  3SXO A;  4C2Z A;  3KAS A;  1J4J A;  2GRE A;  2PDO A;  2PCU A;  3KHZ A;  4R7M A;  1XF8 A;  3TO7 A;  4C7I A;  4KOV A;  3D8P A;  3FNC A;  1LCP A;  4X2T A;  5G22 A;  4B6Z A;  3CZX A;  1KWM A;  4A38 A;  4CYN A;  5DWN A;  3CXQ A;  2P0W A;  3RBU A;  1S3Z A;  1S7F A;  2DPT A;  4CGM A;  4E0A A;  1KUX A;  2NMT A;  2Q04 A;  4TWE A;  4Q7A A;  1Z8W A;  3KR4 A;  3D68 A;  1F57 A;  3PBB A;  1CPX A;  4YRH A;  3TE4 A;  2XEG A;  3F8K A;  4CGN A;  2C6C A;  2IL4 A;  2AFW A;  3B3T A;  3EY5 A;  3C26 A;  1Z8T A;  1ON0 A;  4J3G A;  2BO9 A;  1M1D A;  1MJA A;  4DNC A;  3NE7 A;  4ONW A;  1MJB A;  2HV2 A;  4OKO A;  2Z3P A;  1BAV A;  4ZY2 A;  2ZPA A;  4PQA A;  2P6G A;  3B3S A;  4FWU A;  3G8W A;  1TIQ A;  4R87 A;  4II9 A;  1RXT A;  1TXR A;  2FCK A;  4UIB A;  4B14 A;  5IX3 A;  3JRU A;  1R43 A;  3PB7 X;  3W6S A;  1M4G A;  1M4I A;  4UF4 A;  2ZOF A;  4B5P B;  4KOY A;  1ARL A;  1TKH A;  2ZEN A;  1ELM P;  3FEC A;  3G3S A;  4LQ6 A;  3SI2 A;  4NJQ A;  1S7L A;  2JEW A;  4Y49 B;  2WPW A;  2B5G B;  2CNM A;  3A9L A;  2ZOG A;  2G0B A;  2OOT A;  2Q44 A;  3FF3 A;  5IV0 A;  5JGF A;  2PJ2 A;  2JEV A;  1Z9U A;  2VZY A;  4P4E A;  2AFZ A;  2V8V A;  2NSM A;  1WWZ A;  4L89 A;  3JUW A;  4JXR A;  4MFJ A;  2OZU A;  4OC4 A;  3L2N A;  1IY7 A;  2ZEL A;  4OIW A;  3QAY A;  4IUS A;  2Z10 A;  1ZLH A;  4ONU A;  3CXS A;  4C2X A;  2V8G A;  3R9G A;  1YGH A;  3W6X A;  4ZGY B;  1Z2L A;  4MY3 A;  4UIA A;  2YND A;  1LRZ A;  4KVO E;  4F9V A;  4NJR A;  3PB8 X;  2YGW A;  3KQX A;  1H8L A;  4PK2 A;  2Q4V A;  4JWP A;  2ZEG A;  4YWY A;  1YQE A;  1DTD A;  5EBV A;  4CAF A;  3KGQ A;  2Q4Z A;  4JJX A;  1Z8L A;  5HH1 A;  2AFX A;  2BSW A;  2ZEE A;  3D7G A;  4UWI A;  2PVV A;  5D29 A;  1Y9K A;  5G20 A;  4NSQ A;  1WK4 A;  5KTC A;  1KUY A;  3BI0 A;  2WYR A;  1CM0 A;  4R8F A;  3EO4 A;  1YK3 A;  1KZF A;  2VEZ A;  1QQ9 A;  4MFQ A;  3KL9 A;  5AG7 A;  5KTA A;  4QBJ A;  2P6F A;  4EWT A;  1LAP A;  3P2H A;  4ZY0 A;  4X8I A;  1IU8 A;  2QML A;  3KHX A;  4PPZ A;  4PXB A;  2ANP A;  4HNY B;  2FXF A;  5K8O A;  1YVO A;  4OC5 A;  3BI1 A;  4KZT A;  2PQ8 A;  1AUG A;  1RO5 A;  4PXD A;  5JQ4 A;  2I3C A;  5LRG A;  1M4L A;  2ZEM A;  4HKF A;  4XPK A;  4RUH A;  5AGE A;  4OAD A;  3S9N A;  1DE4 C;  3V8I A;  3B3V A;  2REE A;  2PR8 A;  2RC4 A;  3FBU A;  4XPD C;  1CP6 A;  1M44 A;  3DDD A;  2JDC A;  4CAW A;  1FY7 A;  4NF1 A;  1XOV A;  3FVL A;  1L0C A;  3CPX A;  2O28 A;  4P4J A;  5LYF A;  1SQH A;  1VHS A;  2EK8 A;  2FL4 A;  4KOU A;  2FSR A;  1NMT A;  4I49 A;  4PV6 A;  4A95 A;  4OC2 A;  4W9Y A;  3H5Z A;  3S6K A;  2BUE A;  4P6Y A;  5A27 A;  1ELL P;  3VWD A;  3ZJ0 A;  2PJA A;  4ZX8 A;  2WZN A;  1I21 A;  1B6B A;  3K9U A;  3K9T A;  4RI1 A;  3TX8 A;  4R6T A;  3QB8 A;  4AVA A;  2ZXV A;  4KOS A;  2AJ6 A;  2CIJ A;  1TKF A;  2GU2 A;  2QVP A;  4UCN A;  3B3C A;  5CBM A;  3S9L A;  2ABZ A;  2YNC A;  3VWE A;  5K8P A;  3SHP A;  2AFS A;  2QYV A;  2IMO A;  4NGS A;  4CYP A;  2PIZ A;  4MHY A;  4UA3 A;  2ZEO A;  3RNZ A;  4Q38 A;  2QEC A;  1ZO0 A;  1CPS A;  2IJZ A;  1NSA A;  4OP4 A;  1XMB A;  1ZG9 A;  5JPH A;  5HVG A;  4YU9 A;  3GY9 A;  2RFH A;  3I1U A;  1PU9 A;  1ZG8 A;  4M6I A;  4CAV A;  4OC3 A;  3FRM A;  4U9Y A;  5J1Q A;  4P4F A;  2C6P A;  2CXA A;  2VL1 A;  3FEE A;  4LUA A;  2JLM A;  4MFL A;  1Z8X A;  1IOI A;  2C1C A;  4Z65 A;  2HQY A;  2JBK A;  3D2M A;  2JBJ A;  4OID A;  3RO0 A;  8CPA A;  2Z3L A;  2GIV A;  1RTQ A;  4K30 A;  3PB9 X;  1A2Z A;  4A30 A;  2VQY A;  3ZZI A;  4JYW A;  4X5K A;  5EMI A;  4M6H A;  5F48 A;  2POK A;  4UFX A;  3V7Z A;  2ZEH A;  1P0H A;  2F5I A;  4X3R A;  3GB0 A;  5KTD A;  4AXV A;  4ZBG A;  4AG9 A;  3H8F A;  4NGR A;  4E8O A;  2R1I A;  4Q36 A;  1X10 A;  4B5O A;  4KOR A;  3B8G A;  4MMO A;  3R95 A;  2GAN A;  5F49 A;  2B4D B;  4FD6 A;  2IQ6 A;  1X12 A;  4KOX A;  3EFA A;  2I79 A;  4R57 A;  4C7H A;  2JDD A;  4XPD B;  2Q7S A;  4ZI6 A;  1XFO A;  1N71 A;  2R98 A;  3BHX A;  1YRE A;  2G3A A;  3RYO A;  2FS5 A;  2PJ4 A;  4UCP A;  5G21 A;  3PBE A;  1I12 A;  5J8C A;  2DF5 A;  3D66 A;  4AB7 A;  4KSA A;  4U5Y A;  4U9Z A;  4NFR A;  2REF A;  3TOB A;  4MHD A;  3TC8 A;  2PJ6 A;  1IYL A;  1UFH A;  2EVN A;  5F09 A;  1Y7R A;  2G9D A;  2ZEP A;  2ZED A;  2B4B A;  4PSX A;  1ZLI A;  4DUK A;  2CY2 A;  3IJ3 A;  2EBJ A;  3F0A A;  3QNV A;  1ARM A;  5G1Z A;  2OB0 A;  3DSB A;  1Y0Y A;  3W91 A;  2V8H A;  2DEA A;  1K4J A;  2V8D A;  5D8N A;  3D2P A;  2PRB A;  4ZX9 A;  2Q0Y A;  4CAX A;  2X7B A;  2XEI A;  4MJ8 A;  2P6E A;  4CPA A;  3NFZ A;  3IWE A;  4F0X A;  1QSR A;  2PC1 A;  3DLJ A;  3B3W A;  5CPA A;  5DWM A;  3SJG A;  2EO8 A;  2PJ7 A;  5E96 A;  2H5M A;  5JH9 A;  2F8H A;  1IID A;  2HUZ A;  5H84 A;  4A33 A;  5HMN A;  3H8E A;  3WAB A;  2PJ9 A;  1GYT A;  2EK9 A;  1LAM A;  2OU2 A;  4QVT A;  4C68 A;  4CGO A;  1F2P A;  4G1P A;  4KLV A;  1YLE A;  2PJ1 A;  3R1K A;  4P45 A;  5LRJ A;  2OZG A;  1GHE A;  3SJF A;  1Y9W A;  2AE6 A;  4NGP A;  2PSW A;  5HVF A;  1YME A;  3IU2 A;  4P4D A;  3S9M A;  2ZW6 A;  2GE3 A;  2AFO A;  2PVW A;  2EUI A;  5HXD A;  1F2O A;  3JVN A;  4GXH A;  3EC4 A;  4NGN A;  1S60 A;  2Z0Z A;  2Y0M A;  1Z4E A;  2PJ3 A;  4A37 A;  5AG5 A;  3FYN A;  1TF8 A;  3PZJ A;  4M6G A;  4QB9 A;  1LFW A;  3GUX A;  3TTH A;  4EFD A;  2CNS A;  2PJ0 A;  3F5B A;  2ARH A;  2PJB A;  4MY0 A;  4OLL A;  2DPS A;  2FIA A;  1S7K A;  2OH1 A;  3T90 A;  4PXC A;  3HLP A;  5I0C A;  3LD2 A;  4O23 A;  3IC1 A;  3TOA A;  3IGR A;  1PYT B;  4IHM A;  4P44 A;  2ZW7 A;  1U6M A;  2VZZ A;  4XNH B;  1HDQ A;  3KI9 A;  4FD7 A;  1YR0 A;  4P10 A;  1BPM A;  1Q7L A;  1P4N A;  4UWJ A;  2D4O A;  3H8G A;  2GLJ A;  3LMS A;  3SI1 A;  1R57 A;  3VH9 A;  4IAV A;  2B58 A;  3KKW A;  3T9Y A;  3I3G A;  5HVH A;  4WWV A;  4B5P A;  1Y7E A;  5BWA B;  2O4H A;  1AMP A;  3HUV A;  1HEE A;  2B3U A;  1OZP A;  4NCZ A;  4MHP A;  2Z3M A;  2PJ8 A;  6CPA A;  1FT7 A;  3D4U A;  2B5G A;  4OAE A;  4R76 A;  2PE3 A;  4MI4 A;  4CYO A;  3GLJ A;  5LRK A;  1OBR A;  3JTK A;  1KUV A;  3RZA A;  1YVK A;  4L8A A;  5FVJ A;  3GYA A;  4CRY B;  2BL1 A;  4UEF A;  2Q4Y A;  4KOT A;  3OWC A;  4JXQ A;  1QSN A;  4A32 A;  3ISX A;  4C2Y A;  2FIW A;  4MCS A;  3IIB A;  3NA6 A;  3H4Q A;  2F7V A;  1JWQ A;  3N5F A;  5H86 A;  3FIX A;  1BO4 A;  4A31 A;  5ISV A;  1MJ9 A;  1BLL E;  3S6G A;  1Q2Y A;  2PIY A;  1VIX A;  3KQZ A;  4PK3 A;  4KVX A;  2HB6 A;  1B87 A;  1ZG7 A;  4E2A A;  1Y0R A;  2BOA A;  4MCP A;  4DJL A;  5J8F A;  5K8N A;  3B7I A;  2J9A A;  2VXK A;  1EE3 P;  3D3S A;  4B12 A;  4CGL A;  3MN8 A;  2OR4 A;  1QMU A;  1Z4R A;  2I00 A;  4UEZ A;  4P4I A;  3TFY A;  3LOD A;  1XMT A;  2GFQ A;  5C88 A;  2Q51 A;  2EWB A;  3IWG A;  4HPS A;  4JLY A;  4KS9 A;  2ZEF A;  3WC7 A;  4UFW A;  1CX8 A;  4B11 A;  1NE9 A;  1XE4 A;  5K8M A;  1QST A;  1CG2 A;  2QIR A;  1VHO A;  4JZ0 A;  3WC5 A;  1VHE A;  2AFU A;  2V77 A;  2CNT A;  5F47 A;  4MCQ A;  2D4P A;  3QAH A;  1LOK A;  2OZH A;  1IIC A;  5F46 A;  4QC6 A;  4XNH C;  4NGM A;  2CTC A;  2Z11 A;  3TO9 A;  4A39 A;  1YW4 A;  2O53 A;  4K3N A;  4BD9 A;  3WC6 A;  2CTB A;  4YGO A;  1TKJ A;  3GKR A;  4KLW A;  3WR7 A;  2PR1 A;  1BPN A;  1AYE A;  4NXY A;  4TNU A;  5IB9 A;  3DR8 A;  3NH4 A;  4MFK A;  4NGT A;  4AG7 A;  2VI7 A;  3FED A;  3ISZ A;  3E0K A;  2VBQ A;  4WJB A;  2Z3O A;  3IO1 A;  3LAC A;  3PEI A;  7CPA A;  4ZY1 A;  4GM5 A;  2J8N A;  1IOF A;  4P4B A;  4LX9 A;  3TT2 A;  4UEE A;  1BOB A;  1XIX A;  2A4N A;  4KOW A;  3FXT A;  3PFO A;  2C27 A;  3SJE A;  4CS0 B;  3IU1 A;  4F0Y A;  3UY5 A; 
#chains in the Genus database with same CATH homology
 3EXN A;  2FE7 A;  4JD6 A;  4NEX A;  2Q7B A;  3DNS A;  2ATR A;  4PSW A;  4HNX B;  2Z3N A;  1S5K A;  1CJW A;  3TO6 A;  4AVC A;  1VKC A;  2G3T A;  1QSM A;  3PGP A;  1PUA A;  5AG6 A;  4H6Z A;  2WSA A;  4HNW B;  2ZW4 A;  4UCM A;  2ZW5 A;  3DR6 A;  2BEI A;  4MFZ A;  3I9S A;  4B13 A;  3R9E A;  5C82 A;  2Z3K A;  4ORF A;  4XPL A;  4AVB A;  4MBU A;  3BLN A;  2WUU A;  3SXN A;  5IB0 A;  1MK4 A;  2K5T A;  4CGP A;  2R8V A;  4IF5 A;  4RS2 A;  2J8R A;  2B4D A;  2DXQ A;  1Q2D A;  4CYQ A;  1IYK A;  1QSO A;  5GCN A;  2WPX A;  2J8M A;  3TCV A;  4EVY A;  4M85 A;  3PP9 A;  3BJ7 A;  4BMH A;  4R9M A;  4CAE A;  2FT0 A;  3CXP A;  4BBH A;  4KUB A;  4H89 A;  3S6F A;  4UFV A;  3BJ8 A;  3MGD A;  4GS4 A;  1Q2C A;  4F6A A;  5A28 A;  3R9F A;  4KSF A;  4M3S A;  4FD5 A;  4B10 A;  2KCW A;  3FB3 A;  3P2F A;  2B3V A;  4KVM E;  5AG4 A;  4KUA A;  4CRZ B;  4FD4 A;  4Y49 C;  4R3L A;  2R7H A;  4UBR A;  1V0C A;  4MFP A;  5EC4 A;  4R3K A;  2YNE A;  4QUS A;  3R96 A;  1M4D A;  5CNP A;  1S7N A;  4YFJ A;  1YX0 A;  2YNC C;  3S6H A;  4A2Z A;  4H6U A;  1I1D A;  1IB1 E;  3N7Z A;  1XEB A;  1NSL A;  3SXO A;  4C2Z A;  1J4J A;  2PDO A;  3TO7 A;  4C7I A;  1XF8 A;  4KOV A;  3D8P A;  3FNC A;  5G22 A;  4E2A A;  4CYN A;  5DWN A;  3CXQ A;  2P0W A;  4CGM A;  1S3Z A;  1S7F A;  2DPT A;  4E0A A;  1KUX A;  2NMT A;  2Q04 A;  4YRH A;  3TE4 A;  3F8K A;  4CGN A;  2IL4 A;  3EY5 A;  3C26 A;  1ON0 A;  4J3G A;  1M1D A;  1MJA A;  4DNC A;  3NE7 A;  1MJB A;  2HV2 A;  2Z3P A;  2ZPA A;  4II9 A;  2P6G A;  4R87 A;  3G8W A;  1TIQ A;  1RXT A;  2FCK A;  4B14 A;  5IX3 A;  3W6S A;  1M4G A;  1M4I A;  4B5P B;  4KOY A;  3G3S A;  1S7L A;  4Y49 B;  2WPW A;  2B5G B;  2CNM A;  3A9L A;  2G0B A;  5IV0 A;  2Q44 A;  2JEV A;  1Z9U A;  2VZY A;  1WWZ A;  4L89 A;  3JUW A;  4JXR A;  4MFJ A;  2OZU A;  4ONU A;  4IUS A;  2Z10 A;  4C2X A;  3CXS A;  3R9G A;  1YGH A;  3W6X A;  4ZGY B;  4MY3 A;  2YND A;  1LRZ A;  4KVO E;  2YGW A;  4CAF A;  4PK2 A;  2Q4V A;  4JWP A;  5EBV A;  5HH1 A;  4JJX A;  2BSW A;  5G20 A;  4UWI A;  1Y9K A;  4NSQ A;  1WK4 A;  5KTC A;  1KUY A;  1CM0 A;  3EO4 A;  1YK3 A;  1KZF A;  2VEZ A;  4MFQ A;  5AG7 A;  5KTA A;  4QBJ A;  2P6F A;  3P2H A;  2QML A;  4HNY B;  2FXF A;  1YVO A;  4KZT A;  2PQ8 A;  1RO5 A;  5JQ4 A;  4XPK A;  4HKF A;  5AGE A;  4OAD A;  3V8I A;  2REE A;  2PR8 A;  2RC4 A;  3FBU A;  4XPD C;  1M44 A;  3DDD A;  2JDC A;  4CAW A;  1FY7 A;  4NF1 A;  1L0C A;  2O28 A;  1SQH A;  1VHS A;  2FL4 A;  4KOU A;  4I49 A;  2FSR A;  1NMT A;  4PV6 A;  4A95 A;  3H5Z A;  3S6K A;  2BUE A;  5A27 A;  3VWD A;  3ZJ0 A;  3K9U A;  1I21 A;  1B6B A;  4RI1 A;  4AVA A;  3QB8 A;  2ZXV A;  4KOS A;  2AJ6 A;  4UCN A;  2YNC A;  3VWE A;  3SHP A;  4CYP A;  4UA3 A;  4Q38 A;  2QEC A;  1ZO0 A;  5JPH A;  3GY9 A;  1PU9 A;  4CAV A;  3FRM A;  4U9Y A;  4MFL A;  2CXA A;  4LUA A;  2JLM A;  2HQY A;  3D2M A;  2Z3L A;  2GIV A;  4K30 A;  4A30 A;  2VQY A;  3ZZI A;  4X5K A;  5F48 A;  4UFX A;  1P0H A;  2F5I A;  5KTD A;  4ZBG A;  4AG9 A;  4E8O A;  2R1I A;  4Q36 A;  4B5O A;  4KOR A;  3B8G A;  3R95 A;  2GAN A;  5F49 A;  2B4D B;  4FD6 A;  4KOX A;  4R57 A;  3EFA A;  2I79 A;  4C7H A;  2JDD A;  4XPD B;  1N71 A;  2R98 A;  1YRE A;  2G3A A;  3RYO A;  2FS5 A;  4UCP A;  5G21 A;  1I12 A;  5J8C A;  4AB7 A;  4KSA A;  4U5Y A;  4U9Z A;  2REF A;  3TOB A;  4MHD A;  1IYL A;  1UFH A;  2EVN A;  1Y7R A;  2B4B A;  4PSX A;  2CY2 A;  3F0A A;  5G1Z A;  2OB0 A;  3DSB A;  3W91 A;  1K4J A;  3D2P A;  2PRB A;  2Q0Y A;  4CAX A;  2X7B A;  4MJ8 A;  2P6E A;  3IWE A;  4F0X A;  1QSR A;  2PC1 A;  5DWM A;  5E96 A;  2H5M A;  5H84 A;  1IID A;  2HUZ A;  4A33 A;  5HMN A;  4QVT A;  4C68 A;  2OU2 A;  4CGO A;  4KLV A;  1YLE A;  3R1K A;  2OZG A;  1GHE A;  1Y9W A;  2AE6 A;  2PSW A;  3IU2 A;  2ZW6 A;  2GE3 A;  2EUI A;  3JVN A;  3EC4 A;  1S60 A;  2Z0Z A;  2Y0M A;  1Z4E A;  5AG5 A;  3FYN A;  3PZJ A;  4QB9 A;  3TTH A;  2CNS A;  3F5B A;  2ARH A;  4MY0 A;  4OLL A;  2DPS A;  2FIA A;  1S7K A;  2OH1 A;  3T90 A;  5I0C A;  3LD2 A;  3TOA A;  3IGR A;  2ZW7 A;  1U6M A;  2VZZ A;  4XNH B;  4FD7 A;  1YR0 A;  1P4N A;  4UWJ A;  2D4O A;  1R57 A;  2B58 A;  3KKW A;  3T9Y A;  3I3G A;  4B5P A;  5BWA B;  2B3U A;  1OZP A;  4NCZ A;  2Z3M A;  2B5G A;  4OAE A;  4MI4 A;  4CYO A;  3JTK A;  1KUV A;  1YVK A;  4L8A A;  5FVJ A;  3GYA A;  4CRY B;  2BL1 A;  2Q4Y A;  4KOT A;  3OWC A;  4JXQ A;  1QSN A;  4A32 A;  4C2Y A;  2FIW A;  3H4Q A;  5H86 A;  3FIX A;  1BO4 A;  4A31 A;  5ISV A;  1MJ9 A;  3S6G A;  1Q2Y A;  4PK3 A;  4KVX A;  1B87 A;  5J8F A;  2VXK A;  3D3S A;  4B12 A;  4CGL A;  2I00 A;  1Z4R A;  3TFY A;  3LOD A;  1XMT A;  5C88 A;  4JLY A;  3IWG A;  4KS9 A;  4UFW A;  4B11 A;  1NE9 A;  1XE4 A;  1QST A;  2QIR A;  2CNT A;  5F47 A;  2D4P A;  3QAH A;  2OZH A;  1IIC A;  5F46 A;  4QC6 A;  4XNH C;  2Z11 A;  3TO9 A;  4YGO A;  4KLW A;  3GKR A;  3WR7 A;  2PR1 A;  4NXY A;  3DR8 A;  4AG7 A;  4MFK A;  2VI7 A;  3E0K A;  2VBQ A;  2Z3O A;  2J8N A;  4LX9 A;  3TT2 A;  1BOB A;  1XIX A;  2A4N A;  4KOW A;  3FXT A;  4CS0 B;  2C27 A;  3IU1 A;  4F0Y A;  3UY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...