1Z9UA

Structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
EIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDQYTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyl transferase
publication title The crystal structure of the acetyl transferase, modifies N-terminal serine of 50S ribosomal subunit protein L7/L12 from Salmonella typhimurium
rcsb
source organism Salmonella typhimurium
total genus 51
structure length 172
sequence length 175
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1z9uA00
2G0BA 1CM0A 1CJWA 1M1DA 2ZXVA 2JLMA 4PSXA 3FRMA 3MGDA 3R9EA 1PU9A 1N71A 1WK4A 3EO4A 2I00A 5F46A 1KZFA 4XPKA 3OWCA 2QIRA 2OH1A 4E2AA 4QB9A 2D4PA 2Q4YA 4YGOA 4QUSA 3TO7A 2AJ6A 2FXFA 3PGPA 2FS5A 1Z4RA 1MJBA 2P6GA 3TOAA 2BEIA 3W6SA 4KOSA 1YX0A 4ONUA 3W91A 4AVCA 5J8CA 4CAVA 3W6XA 3ZJ0A 1I1DA 5HH1A 3DDDA 5J8FA 2B4DA 3TO6A 3F8KA 1V0CA 3D2PA 4HKFA 2DXQA 2EVNA 1BO4A 4R3KA 3FXTA 1S7KA 1Y9KA 1YREA 2FSRA 2F5IA 5IB0A 3N7ZA 2H5MA 2OU2A 4H6ZA 4M3SA 1L0CA 4KUBA 1NSLA 2PR1A 1B87A 2PSWA 3TT2A 2RC4A 3GY9A 3CXQA 4IF5A 1Q2YA 3EY5A 4JXQA 2B3UA 2GIVA 3EFAA 2J8NA 4J3GA 2I79A 1XE4A 1QSMA 2OZUA 3VWEA 3IWGA 4KVME 4Y49C 4NCZA 4AVBA 3JVNA 1PUAA 2VZZA 1J4JA 4F0YA 4Y49B 4OLLA 2VQYA 4U9YA 3I9SA 1M4DA 4KOTA 4HNWB 4X5KA 4YFJA 4B5PA 4UBRA 1U6MA 2EUIA 2VBQA 1ON0A 2BL1A 3DR6A 4NXYA 2KCWA 3TO9A 3TTHA 3TE4A 4EVYA 2B4BA 4R3LA 3VWDA 4R87A 2ZW6A 1YLEA 2FT0A 4LUAA 5HMNA 1NMTA 2R98A 2Z0ZA 1KUXA 5IV0A 3IGRA 3FIXA 2REEA 1VHSA 4MBUA 1Q2CA 2VI7A 1XMTA 2B5GA 3KKWA 2B3VA 4KOUA 4KLVA 4PSWA 2BUEA 3R9GA 4KOVA 1I21A 2D4OA 1M4IA 2ZW7A 2JDCA 2PDOA 5E96A 1YK3A 2JEVA 3C26A 3LODA 4R9MA 2FIWA 3F5BA 2HV2A 3EXNA 4RI1A 2OZHA 2REFA 1QSRA 4LX9A 1KUVA 2HQYA 1S5KA 1S7NA 2Q04A 2R1IA 5JQ4A 2Q0YA 3S6FA 4B5PB 2ZW4A 2G3AA 4M85A 3P2FA 5KTCA 2P0WA 4FD4A 2Q44A 1P0HA 4RS2A 1YVOA 1Q2DA 4QVTA 3D8PA 2OZGA 3FBUA 4HNXB 3PZJA 4XPDC 5JPHA 2G3TA 4XPDB 4MHDA 1QSTA 5IX3A 3I3GA 3B8GA 2B5GB 1QSOA 4KOXA 1KUYA 3D2MA 5FVJA 2FE7A 1IIDA 4BMHA 4KOWA 3TFYA 4JJXA 3E0KA 5EC4A 3TCVA 5H84A 4MY3A 2VXKA 4L8AA 4KUAA 3R9FA 2O28A 4I49A 1YVKA 2IL4A 2GANA 3FB3A 1GHEA 4AG9A 5F48A 4GS4A 1IICA 4UWIA 5KTAA 2B4DB 3H4QA 1UFHA 2GE3A 4KOYA 4DNCA 2K5TA 4AG7A 3SHPA 2CY2A 3S6GA 3F0AA 3G8WA 3T90A 1B6BA 5H86A 2R7HA 4FD7A 1OZPA 1YR0A 4FD6A 2WPWA 2ZW5A 3T9YA 1XIXA 4CAWA 5I0CA 4K30A 2FCKA 4JD6A 4JWPA 4CAXA 3JUWA 4U9ZA 5DWMA 2CNMA 2B58A 3FYNA 1VKCA 5KTDA 1XEBA 3QAHA 1IB1E 4E8OA 2A4NA 2Z10A 4YRHA 3SXNA 4B5OA 2AE6A 2VZYA 1K4JA 1S7LA 2FIAA 4AVAA 2J8MA 4MI4A 4KVXA 1QSNA 2FL4A 1LRZA 1S3ZA 3ZZIA 4FD5A 3BLNA 1M44A 3RYOA 3CXPA 3R95A 1Z4EA 2Z11A 4QC6A 4UA3A 3LD2A 4H6UA 4NSQA 2NMTA 2C27A 3DR8A 1S60A 4MJ8A 2ATRA 2Q4VA 3SXOA 3V8IA 1YGHA 1IYLA 2PRBA 3DSBA 5F49A 3S6HA 4L89A 1Z9UA 4UWJA 1SQHA 5C82A 2JDDA 4CS0B 4PV6A 4PK3A 2CNSA 3QB8A 2CNTA 2Q7BA 4U5YA 2P6FA 2PR8A 3BJ8A 4HNYB 4AB7A 5GCNA 4JXRA 4II9A 4IUSA 2PQ8A 4NEXA 5F47A 4NF1A 2J8RA 1RXTA 2BSWA 5CNPA 2HUZA 1WWZA 4CRZB 3TOBA 2P6EA 4ZBGA 4E0AA 4ORFA 3FNCA 4MY0A 1FY7A 1MK4A 1MJAA 3D3SA 3GYAA 3NE7A 4OADA 3K9UA 5DWNA 4H89A 1Y7RA 3R96A 1M4GA 1XF8A 4PK2A 1BOBA 4QBJA 4XPLA 5EBVA 2QECA 3CXSA 4OAEA 1S7FA 4KVOE 2OB0A 3P2HA 3PP9A 1NE9A 5ISVA 1I12A 4XNHC 2ARHA 1MJ9A 3UY5A 4CRYB 3WR7A 4KLWA 3BJ7A 2X7BA 4XNHB 3G3SA 1Y9WA 2VEZA 3GKRA 2ZPAA 5C88A 2WPXA 4F6AA 3DNSA 1RO5A 1TIQA 3R1KA 4R57A 4KZTA 2R8VA 2Y0MA 1IYKA 3EC4A 1R57A 2PC1A 4KORA 3S6KA 4JLYA 1P4NA 2QMLA
chains in the Genus database with same CATH superfamily
2NYQA 2G0BA 1ZG9A 2Z3KA 1GYTA 1Z8XA 1OBRA 2PVWA 3B3SA 4KS9A 4ZGYB 1ARMA 1CM0A 1CJWA 1M1DA 3JTKA 2ZXVA 2JLMA 4PSXA 3FRMA 3MGDA 4UEZA 3R9EA 4GXHA 4MFKA 1PU9A 1M4LA 3IEHA 1N71A 1WK4A 3EO4A 2I00A 4R6TA 5F46A 1KZFA 2PJBA 1CG2A 4XPKA 4B13A 4FAIA 3OWCA 4NGMA 3NA6A 2QIRA 3IJ3A 3PB9X 2PIYA 4PXEA 2OH1A 2O4HA 1QQ9A 4FWUA 4E2AA 2PJCA 4QB9A 1HDQA 1QMUA 4PXBA 2D4PA 3D7DA 2V8DA 3A9LA 4MCSA 2Q4YA 4YGOA 4QUSA 3TO7A 3S9NA 2AJ6A 3KHZA 2O53A 2F7VA 1ZG7A 5G20A 4CYNA 3NH5A 4M6IA 1ZG8A 2FXFA 2FS5A 1Z4RA 3PGPA 1MJBA 2P6GA 4K3NA 2C1CA 1ELLP 4OIWA 3TOAA 3SI2A 2BEIA 2ZOFA 4KOSA 3W6SA 4UIBA 1YX0A 1Y7EA 4ONUA 4MFJA 1ARLA 3W91A 4AVCA 3IFEA 5J8CA 4CAVA 1XFOA 3W6XA 3ZJ0A 3DGVA 3HUVA 1I1DA 1BPNA 3LACA 5HH1A 2G9DA 3S9MA 3DDDA 4A33A 4KSAA 5J8FA 2YNEA 2B4DA 4R7MA 4MFLA 4UFXA 5EMIA 3B7IA 3TO6A 3D7FA 1V0CA 3F8KA 3VH9A 1FT7A 3N5FA 4CYQA 3D2PA 4W9YA 4OC5A 4CGMA 4HKFA 2DXQA 2EVNA 1BO4A 4R3KA 1AUGA 2PJ8A 1IU8A 3FXTA 1S7KA 5LRKA 2BCOA 1Y9KA 1X10A 1YREA 2QYVA 2FSRA 2Z3MA 2F5IA 3WABA 4ZY2A 1TF9A 2ZEEA 3IU2A 5IB0A 5LYLA 5D29A 3N7ZA 5BWAB 2H5MA 2OU2A 2JEWA 4H6ZA 1CPSA 4M3SA 1L0CA 2Q4ZA 4BBHA 4KUBA 1NSLA 2PR1A 1B87A 3PEIA 4NJRA 1Z8TA 2C6GA 2Z3OA 1Y0YA 2PSWA 2ABZA 2OOTA 3NE8A 3WC5A 1FNOA 3TT2A 2RC4A 4P6YA 2GLFA 2ZEMA 3GY9A 3IIBA 4UIAA 3CXQA 3PFEA 4IF5A 1TXRA 4P45A 1Q2YA 2Q51A 3EY5A 5IB9A 4JXQA 4B10A 2B3UA 2GIVA 2QMLA 3BHXA 3EFAA 2J8NA 4R76A 8CPAA 4B12A 4J3GA 2I79A 1XE4A 4ZX9A 3GLJA 2IQ6A 3IC1A 3IU1A 2OR4A 3VARA 1QSMA 2OZUA 3VWEA 6CPAA 4R8FA 3GB0A 1XMBA 3KQZA 4CRYB 3IWGA 1ZO0A 4KVME 4Y49C 4NCZA 3PRTA 4AVBA 1PUAA 2VZZA 3JVNA 4FBEA 5HXDA 1J4JA 4CGPA 4F0YA 4Y49B 3B2YA 1XJOA 4OLLA 2VQYA 4PXDA 4U9YA 4OC3A 4A2ZA 2F8HA 3I9SA 1A2ZA 1M4DA 2PJ2A 5AG5A 4KOTA 4M6GA 1VGYA 4HNWB 3ISZA 4X5KA 2DF5A 4YFJA 1IY7A 2AFUA 4P4IA 4ONWA 4UBRA 1U6MA 2EUIA 2VBQA 3PB8X 4B5PA 4BD9A 2HB6A 1ON0A 2BL1A 2XEGA 3CZXA 3DR6A 3D4UA 4NXYA 3FECA 2KCWA 3TO9A 3TTHA 4A94A 2JBKA 1R3NA 3TE4A 1ZLIA 4JLYA 2RFHA 4EVYA 2B4BA 2DPTA 4R3LA 5A27A 3VWDA 4R87A 1VHEA 2HC9A 4CYOA 2ZW6A 5J1QA 1YLEA 1EE3P 2ZEOA 1TKHA 2FT0A 4LUAA 3T8WA 1PYTB 4WWVA 5HMNA 1NMTA 1LFWA 3FMCA 2R98A 2YNDA 1KUXA 2Z0ZA 3H8EA 3IGRA 4B6ZA 5IV0A 4BINA 4OP4A 4PPZA 2Q7SA 5D8NA 3MN8A 2WZNA 3FIXA 1JWQA 2REEA 1VHSA 4MBUA 3SI0A 4O23A 1Q2CA 2VI7A 2QVPA 7CPAA 5CBMA 1XMTA 2B5GA 3KHXA 3KKWA 2XEFA 3VATA 2B3VA 3B3CA 4MHNA 3L2NA 4KOUA 4KLVA 4FUUA 2BUEA 4PSWA 3R9GA 4B14A 3PB4X 5THWA 4KOVA 2POKA 1I21A 2D4OA 3CPAA 3KR4A 5AGEA 1M4IA 1BPMA 2AFSA 2C6PA 1JQGA 1AMPA 3ISXA 2ZW7A 2JDCA 5CPAA 3BI1A 2PDOA 4OC1A 5E96A 1YK3A 1BLLE 2JEVA 3C26A 4ZI6A 3IO1A 3LODA 4R9MA 2FIWA 3F5BA 2HV2A 1LOKA 3EXNA 4F9UA 3D68A 4RI1A 2OZHA 4GM5A 2ZEGA 2REFA 4LQGA 1QSRA 4OIDA 4LX9A 1KUVA 2HQYA 1S5KA 1S7NA 3PB7X 2Z3LA 4C2XA 2Q04A 2R1IA 5JQ4A 2Q0YA 3S6FA 4B5PB 2RB7A 2ZW4A 4IK2A 2G3AA 4M85A 3P2FA 2PJ9A 5KTCA 2P0WA 4FD4A 2ZEHA 2Q44A 5LRGA 4NFRA 3TC8A 2Q43A 1P0HA 4CGNA 4RS2A 4UEEA 1Q2DA 2PJ1A 4QVTA 4IHMA 5AG7A 3D8PA 1F2OA 3KGQA 2IMOA 2OZGA 2PJ5A 1LAPA 3D67A 1UWYA 3FBUA 3FEDA 3PZJA 4HNXB 4X3RA 4XPDC 4RUHA 2PE3A 2ANPA 2EWBA 2WYRA 2NSMA 3GUXA 4A32A 5JPHA 2G3TA 4XPDB 2ZEFA 2AFWA 3KQXA 3RAMA 4MHDA 1QSTA 5G21A 1TKFA 3D7GA 2CXAA 4KSIA 2Z3NA 3I3GA 3WT4A 3B8GA 2B5GB 5A28A 5IX3A 5AG4A 1QSOA 3D66A 4KSFA 4G1PA 4KOXA 4MMOA 1KUYA 5HVGA 1Q7LA 3CPXA 3BXMA 4EWTA 3D2MA 3QAYA 4P4JA 5FVJA 2FE7A 4A31A 5JGFA 4DJLA 1IIDA 1ELMP 3SJFA 3PFOA 4BMHA 4KOWA 1NSAA 5LYDA 4YWYA 4JJXA 4MCPA 4ZX8A 3TFYA 3E0KA 5HVHA 2DEAA 1Y0RA 5LYFA 2WSAA 4JYWA 4HPSA 5EC4A 3TCVA 4CGLA 5H84A 4TNUA 4MY3A 4C2ZA 2VXKA 4L8AA 4KUAA 5DS0A 3RNZA 3R9FA 4X8IA 2O28A 1IOFA 4I49A 4OC4A 3WC7A 1YVKA 2ZEPA 3KL9A 2ZELA 2IL4A 2GANA 3FB3A 4MCRA 1AYEA 4A38A 1GHEA 1YMEA 1CP7A 4AG9A 5HVFA 5F48A 4GS4A 4MFQA 1IICA 4UWIA 5KTAA 2J9AA 2B4DB 4C2YA 1XOVA 3H4QA 4PQAA 4C7IA 1DTDA 2GU2A 1VHOA 1UFHA 2YNCA 3B35A 2GE3A 4OMEA 3B3WA 4KOYA 3MRUA 2JBJA 5AG6A 4DNCA 2BO9A 2K5TA 3B3TA 4AG7A 3SHPA 2WUUA 2DPSA 4A30A 3S9LA 2CY2A 3S6GA 3F0AA 2EK9A 2ODFA 3G8WA 3T90A 4F9VA 1IGBA 3NH8A 1B6BA 1ZLHA 2R7HA 4FD7A 4P10A 5H86A 5LYIA 4ZY1A 1OZPA 4Q7AA 1YR0A 4MXUA 4RN7A 5K8OA 4A95A 4LQ6A 3JRUA 4FD6A 1F2PA 2WPWA 1LAMA 3KZWA 2ZW5A 3T9YA 1XIXA 4CAWA 4MFPA 2CF4A 1YQEA 2XEIA 4Q38A 1RTQA 5I0CA 4K30A 2FCKA 4NGTA 1R43A 3SJGA 4JD6A 4JWPA 4MHPA 4AXVA 2PJ4A 4IAVA 4Q36A 3BI0A 3JUWA 5G1ZA 4CAXA 1HDUA 2CTBA 4EMEA 4U9ZA 5DWMA 4CPAA 2CNMA 2B58A 3FYNA 1BAVA 3RZAA 3KASA 1VKCA 2V8GA 5KTDA 1XEBA 3QAHA 4OC0A 1IB1E 4E8OA 4OKOA 1KWMA 2A4NA 3CDXA 3NH4A 4MHYA 2PJ6A 2V8HA 2Z10A 1YW6A 3FEEA 4YRHA 3SJEA 4NGRA 3SXNA 4B5OA 2AE6A 4MFZA 3FVLA 2VZYA 4MHZA 1TF8A 1K4JA 1S7LA 2PJ7A 2FIAA 1X12A 3CT9A 5K8PA 2EBJA 2ZOGA 4AVAA 2J8MA 4TWEA 4NJQA 4JZ0A 4MI4A 3NFZA 3D7HA 4KVXA 1YW4A 4NGSA 1QSNA 4NGNA 2FL4A 2YGWA 1LANA 1LRZA 2YNCC 1S3ZA 4YU9A 2PJ3A 3ZZIA 4FD5A 4UFWA 2PCUA 3BLNA 1M44A 2PJ0A 4UEFA 1TKJA 3RYOA 3FX6A 4UCNA 3CXPA 3PBEA 4C68A 4MRIA 3R95A 3WC6A 1Z4EA 3K2KA 2Z11A 3I1UA 4QC6A 2Z3PA 4UA3A 3LD2A 4UF4A 4UCMA 4A37A 4H6UA 1H8LA 4NSQA 2NMTA 2C27A 2PJAA 3DR8A 1S60A 3V7ZA 2PRQA 3RBUA 4MJ8A 4ZY0A 2ATRA 2Q4VA 4Z65A 3SXOA 3V38A 1YGHA 3V8IA 1YLOA 2C6CA 3QNVA 1IYLA 2PRBA 3DSBA 5JM6A 5F49A 3S6HA 4F0XA 4L89A 1Z9UA 1CP6A 4UWJA 2AFZA 1SQHA 2EO8A 2JDDA 4UCPA 5G22A 5C82A 1LCPA 4CS0B 4PV6A 4PK3A 2CNSA 3QB8A 4A39A 3SJXA 2CNTA 2Q7BA 4U5YA 2P6FA 2PR8A 3BJ8A 4HNYB 4AB7A 5GCNA 4JXRA 3RO0A 2PVVA 4II9A 3FF3A 4IUSA 3LMSA 2PQ8A 4NEXA 4WJBA 4P44A 3FH4A 5F47A 2AFMA 2XEJA 4NF1A 1DE4C 2J8RA 1RXTA 2BSWA 5ELYA 1PCAA 5CNPA 2HUZA 1WWZA 4CRZB 3TOBA 4C7HA 4OC2A 4P4FA 5LRJA 4ZBGA 2QJ8A 2VL1A 1F57A 2PIZA 4E0AA 4ORFA 1CX8A 3FNCA 2IJZA 4P4BA 4MY0A 1FY7A 1MK4A 1MJAA 2BOAA 3D3SA 3FJUA 3IWEA 3GYAA 3NE7A 3KI9A 3K9UA 4OADA 5DWNA 4H89A 3DLJA 4M6HA 1Y7RA 2ZEDA 3R96A 1M4GA 2V77A 1XF8A 5JH9A 4PK2A 4P4DA 3PBBA 1BOBA 4X2TA 4QBJA 4XPLA 2AFXA 1Z8WA 5EBVA 2QECA 3CXSA 3H5ZA 4OAEA 4CAFA 4F8ZA 3IWWA 3GIUA 4ZYQA 4EFDA 2V8VA 5F09A 1VIXA 2GFQA 4DYOA 1S7FA 4KVOE 2OB0A 2GLJA 3P2HA 3PP9A 4UFVA 1NE9A 5ISVA 3H8FA 2GREA 1I12A 4CYPA 3PB6X 4XNHC 2ARHA 3KR5A 1MJ9A 1CBXA 4P4EA 3UY5A 1HEEA 3WR7A 1Z2LA 3LWUA 4KLWA 3BJ7A 4B11A 1XRYA 1YSJA 2X7BA 2I3CA 4XNHB 3H8GA 2CIJA 1XBUA 1IOIA 3G3SA 1Y9WA 3K9TA 4NGQA 4PXCA 2VEZA 3GKRA 5K8NA 5I4MA 2ZPAA 4CGOA 5C88A 2WPXA 4DUKA 1Z8LA 3HLPA 4F6AA 5K8MA 2ZENA 3TX8A 4CAEA 3DNSA 4NGPA 2FVGA 4H2KA 2CTCA 3SI1A 3B3VA 1RO5A 1TIQA 3R1KA 4R57A 4KZTA 2R8VA 2Y0MA 1IYKA 3EC4A 1R57A 2PC1A 4KORA 3S6KA 2AFOA 1Z5RA 1CPXA 2EK8A 1YVOA 1P4NA 4MCQA 2P6EA
chains in the Genus database with same CATH topology
2G0BA 2Z3KA 4KS9A 4ZGYB 1CM0A 1CJWA 1M1DA 3JTKA 2ZXVA 2JLMA 4PSXA 3FRMA 3MGDA 3R9EA 4MFKA 1PU9A 1N71A 1WK4A 3EO4A 2I00A 5F46A 1KZFA 4XPKA 4B13A 3OWCA 2QIRA 2OH1A 4E2AA 4QB9A 2D4PA 3A9LA 2Q4YA 4YGOA 4QUSA 3TO7A 2AJ6A 5G20A 4CYNA 2FXFA 3PGPA 2FS5A 1Z4RA 1MJBA 2P6GA 3TOAA 2BEIA 3W6SA 4KOSA 1YX0A 4ONUA 4MFJA 3W91A 4AVCA 5J8CA 4CAVA 3W6XA 3ZJ0A 1I1DA 5HH1A 4A33A 3DDDA 4KSAA 5J8FA 2YNEA 2B4DA 4UFXA 4MFLA 3TO6A 3F8KA 1V0CA 4CYQA 3D2PA 4CGMA 4HKFA 2DXQA 2EVNA 1BO4A 4R3KA 3FXTA 1S7KA 1Y9KA 2Z3MA 1YREA 2FSRA 2F5IA 5IB0A 3IU2A 3N7ZA 5BWAB 2H5MA 2OU2A 4H6ZA 4M3SA 1L0CA 4BBHA 4KUBA 1NSLA 2PR1A 1B87A 2Z3OA 2PSWA 3TT2A 2RC4A 3GY9A 3CXQA 4IF5A 1Q2YA 3EY5A 4JXQA 4B10A 2B3UA 2GIVA 3EFAA 2J8NA 4B12A 4J3GA 2I79A 1XE4A 3IU1A 1QSMA 2OZUA 3VWEA 3IWGA 1ZO0A 4KVME 4Y49C 4NCZA 4AVBA 3JVNA 1PUAA 2VZZA 1J4JA 4CGPA 4F0YA 4Y49B 4OLLA 2VQYA 4U9YA 4A2ZA 3I9SA 1M4DA 5AG5A 4KOTA 4HNWB 4X5KA 4YFJA 4B5PA 4UBRA 1U6MA 2EUIA 2VBQA 1ON0A 2BL1A 3DR6A 4NXYA 2KCWA 3TO9A 3TTHA 3TE4A 4EVYA 2B4BA 2DPTA 4R3LA 5A27A 3VWDA 4R87A 4CYOA 2ZW6A 1YLEA 2FT0A 4LUAA 5HMNA 1NMTA 2R98A 2YNDA 1KUXA 2Z0ZA 5IV0A 3IGRA 3FIXA 2REEA 1VHSA 4MBUA 1Q2CA 2VI7A 1XMTA 2B5GA 3KKWA 2B3VA 4KOUA 4KLVA 4PSWA 2BUEA 3R9GA 4B14A 4KOVA 1I21A 2D4OA 5AGEA 1M4IA 2ZW7A 2JDCA 2PDOA 5E96A 1YK3A 2JEVA 3C26A 3LODA 4R9MA 2FIWA 3F5BA 2HV2A 3EXNA 4RI1A 2OZHA 2REFA 1QSRA 4LX9A 1KUVA 2HQYA 1S5KA 1S7NA 4C2XA 2Z3LA 2Q04A 2R1IA 5JQ4A 2Q0YA 3S6FA 4B5PB 2ZW4A 2G3AA 4M85A 3P2FA 5KTCA 2P0WA 4FD4A 2Q44A 1P0HA 4CGNA 4RS2A 1YVOA 1Q2DA 4QVTA 5AG7A 3D8PA 2OZGA 3FBUA 4HNXB 3PZJA 4XPDC 4A32A 5JPHA 2G3TA 4XPDB 4MHDA 1QSTA 5G21A 2CXAA 2Z3NA 3I3GA 5IX3A 3B8GA 2B5GB 5A28A 5AG4A 1QSOA 4KSFA 4KOXA 1KUYA 3D2MA 5FVJA 2FE7A 4A31A 1IIDA 4BMHA 4KOWA 3TFYA 4JJXA 3E0KA 2WSAA 5EC4A 3TCVA 4CGLA 5H84A 4C2ZA 4MY3A 2VXKA 4L8AA 4KUAA 3R9FA 2O28A 4I49A 1YVKA 2IL4A 2GANA 3FB3A 1GHEA 4AG9A 5F48A 4GS4A 4MFQA 1IICA 4UWIA 5KTAA 2B4DB 4C2YA 3H4QA 4C7IA 1UFHA 2YNCA 2GE3A 4KOYA 5AG6A 4DNCA 2K5TA 4AG7A 3SHPA 2WUUA 2DPSA 4A30A 2CY2A 3S6GA 3F0AA 3G8WA 3T90A 1B6BA 5H86A 2R7HA 4FD7A 1OZPA 1YR0A 4A95A 4FD6A 2WPWA 2ZW5A 3T9YA 1XIXA 4CAWA 4MFPA 4Q38A 5I0CA 4K30A 2FCKA 4JD6A 4JWPA 4Q36A 5G1ZA 4CAXA 3JUWA 4U9ZA 5DWMA 2CNMA 2B58A 3FYNA 1VKCA 5KTDA 1XEBA 3QAHA 1IB1E 4E8OA 2A4NA 2Z10A 4YRHA 3SXNA 4B5OA 2AE6A 4MFZA 2VZYA 1K4JA 1S7LA 2FIAA 4AVAA 2J8MA 4MI4A 4KVXA 1QSNA 2FL4A 2YGWA 1LRZA 2YNCC 1S3ZA 3ZZIA 4FD5A 4UFWA 3BLNA 1M44A 3RYOA 4UCNA 3CXPA 4C68A 3R95A 1Z4EA 2Z11A 4QC6A 2Z3PA 4UA3A 3LD2A 4UCMA 4H6UA 4NSQA 2NMTA 2C27A 3DR8A 1S60A 4MJ8A 2ATRA 2Q4VA 3SXOA 3V8IA 1YGHA 1IYLA 2PRBA 3DSBA 5F49A 3S6HA 4F0XA 4L89A 1Z9UA 4UWJA 4UCPA 1SQHA 5G22A 2JDDA 5C82A 4CS0B 4PV6A 4PK3A 2CNSA 3QB8A 2CNTA 2Q7BA 4U5YA 2P6FA 2PR8A 3BJ8A 4HNYB 4AB7A 5GCNA 4JXRA 4II9A 4IUSA 2PQ8A 4NEXA 5F47A 4NF1A 2J8RA 1RXTA 2BSWA 5CNPA 2HUZA 1WWZA 4CRZB 3TOBA 2P6EA 4C7HA 4ZBGA 4E0AA 4ORFA 3FNCA 4MY0A 1FY7A 1MK4A 1MJAA 3D3SA 3IWEA 3GYAA 3NE7A 4OADA 3K9UA 5DWNA 4H89A 1Y7RA 3R96A 1M4GA 1XF8A 4PK2A 1BOBA 4QBJA 4XPLA 5EBVA 2QECA 3CXSA 3H5ZA 4OAEA 4CAFA 1S7FA 4KVOE 2OB0A 3P2HA 3PP9A 4UFVA 1NE9A 5ISVA 1I12A 4CYPA 4XNHC 2ARHA 1MJ9A 3UY5A 4CRYB 3WR7A 4B11A 4KLWA 3BJ7A 2X7BA 4XNHB 3G3SA 1Y9WA 2VEZA 3GKRA 2ZPAA 4CGOA 5C88A 2WPXA 4F6AA 4CAEA 3DNSA 1RO5A 1TIQA 3R1KA 4R57A 4KZTA 2R8VA 2Y0MA 1IYKA 3EC4A 1R57A 2PC1A 4KORA 3S6KA 4JLYA 1P4NA 2QMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0B A;  1CM0 A;  1CJW A;  1M1D A;  2ZXV A;  2JLM A;  4PSX A;  3FRM A;  3MGD A;  3R9E A;  1PU9 A;  1N71 A;  1WK4 A;  3EO4 A;  2I00 A;  5F46 A;  1KZF A;  4XPK A;  3OWC A;  2QIR A;  2OH1 A;  4E2A A;  4QB9 A;  2D4P A;  2Q4Y A;  4YGO A;  4QUS A;  3TO7 A;  2AJ6 A;  2FXF A;  3PGP A;  2FS5 A;  1Z4R A;  1MJB A;  2P6G A;  3TOA A;  2BEI A;  3W6S A;  4KOS A;  1YX0 A;  4ONU A;  3W91 A;  4AVC A;  5J8C A;  4CAV A;  3W6X A;  3ZJ0 A;  1I1D A;  5HH1 A;  3DDD A;  5J8F A;  2B4D A;  3TO6 A;  3F8K A;  1V0C A;  3D2P A;  4HKF A;  2DXQ A;  2EVN A;  1BO4 A;  4R3K A;  3FXT A;  1S7K A;  1Y9K A;  1YRE A;  2FSR A;  2F5I A;  5IB0 A;  3N7Z A;  2H5M A;  2OU2 A;  4H6Z A;  4M3S A;  1L0C A;  4KUB A;  1NSL A;  2PR1 A;  1B87 A;  2PSW A;  3TT2 A;  2RC4 A;  3GY9 A;  3CXQ A;  4IF5 A;  1Q2Y A;  3EY5 A;  4JXQ A;  2B3U A;  2GIV A;  3EFA A;  2J8N A;  4J3G A;  2I79 A;  1XE4 A;  1QSM A;  2OZU A;  3VWE A;  3IWG A;  4KVM E;  4Y49 C;  4NCZ A;  4AVB A;  3JVN A;  1PUA A;  2VZZ A;  1J4J A;  4F0Y A;  4Y49 B;  4OLL A;  2VQY A;  4U9Y A;  3I9S A;  1M4D A;  4KOT A;  4HNW B;  4X5K A;  4YFJ A;  4B5P A;  4UBR A;  1U6M A;  2EUI A;  2VBQ A;  1ON0 A;  2BL1 A;  3DR6 A;  4NXY A;  2KCW A;  3TO9 A;  3TTH A;  3TE4 A;  4EVY A;  2B4B A;  4R3L A;  3VWD A;  4R87 A;  2ZW6 A;  1YLE A;  2FT0 A;  4LUA A;  5HMN A;  1NMT A;  2R98 A;  2Z0Z A;  1KUX A;  5IV0 A;  3IGR A;  3FIX A;  2REE A;  1VHS A;  4MBU A;  1Q2C A;  2VI7 A;  1XMT A;  2B5G A;  3KKW A;  2B3V A;  4KOU A;  4KLV A;  4PSW A;  2BUE A;  3R9G A;  4KOV A;  1I21 A;  2D4O A;  1M4I A;  2ZW7 A;  2JDC A;  2PDO A;  5E96 A;  1YK3 A;  2JEV A;  3C26 A;  3LOD A;  4R9M A;  2FIW A;  3F5B A;  2HV2 A;  3EXN A;  4RI1 A;  2OZH A;  2REF A;  1QSR A;  4LX9 A;  1KUV A;  2HQY A;  1S5K A;  1S7N A;  2Q04 A;  2R1I A;  5JQ4 A;  2Q0Y A;  3S6F A;  4B5P B;  2ZW4 A;  2G3A A;  4M85 A;  3P2F A;  5KTC A;  2P0W A;  4FD4 A;  2Q44 A;  1P0H A;  4RS2 A;  1YVO A;  1Q2D A;  4QVT A;  3D8P A;  2OZG A;  3FBU A;  4HNX B;  3PZJ A;  4XPD C;  5JPH A;  2G3T A;  4XPD B;  4MHD A;  1QST A;  5IX3 A;  3I3G A;  3B8G A;  2B5G B;  1QSO A;  4KOX A;  1KUY A;  3D2M A;  5FVJ A;  2FE7 A;  1IID A;  4BMH A;  4KOW A;  3TFY A;  4JJX A;  3E0K A;  5EC4 A;  3TCV A;  5H84 A;  4MY3 A;  2VXK A;  4L8A A;  4KUA A;  3R9F A;  2O28 A;  4I49 A;  1YVK A;  2IL4 A;  2GAN A;  3FB3 A;  1GHE A;  4AG9 A;  5F48 A;  4GS4 A;  1IIC A;  4UWI A;  5KTA A;  2B4D B;  3H4Q A;  1UFH A;  2GE3 A;  4KOY A;  4DNC A;  2K5T A;  4AG7 A;  3SHP A;  2CY2 A;  3S6G A;  3F0A A;  3G8W A;  3T90 A;  1B6B A;  5H86 A;  2R7H A;  4FD7 A;  1OZP A;  1YR0 A;  4FD6 A;  2WPW A;  2ZW5 A;  3T9Y A;  1XIX A;  4CAW A;  5I0C A;  4K30 A;  2FCK A;  4JD6 A;  4JWP A;  4CAX A;  3JUW A;  4U9Z A;  5DWM A;  2CNM A;  2B58 A;  3FYN A;  1VKC A;  5KTD A;  1XEB A;  3QAH A;  1IB1 E;  4E8O A;  2A4N A;  2Z10 A;  4YRH A;  3SXN A;  4B5O A;  2AE6 A;  2VZY A;  1K4J A;  1S7L A;  2FIA A;  4AVA A;  2J8M A;  4MI4 A;  4KVX A;  1QSN A;  2FL4 A;  1LRZ A;  1S3Z A;  3ZZI A;  4FD5 A;  3BLN A;  1M44 A;  3RYO A;  3CXP A;  3R95 A;  1Z4E A;  2Z11 A;  4QC6 A;  4UA3 A;  3LD2 A;  4H6U A;  4NSQ A;  2NMT A;  2C27 A;  3DR8 A;  1S60 A;  4MJ8 A;  2ATR A;  2Q4V A;  3SXO A;  3V8I A;  1YGH A;  1IYL A;  2PRB A;  3DSB A;  5F49 A;  3S6H A;  4L89 A;  1Z9U A;  4UWJ A;  1SQH A;  5C82 A;  2JDD A;  4CS0 B;  4PV6 A;  4PK3 A;  2CNS A;  3QB8 A;  2CNT A;  2Q7B A;  4U5Y A;  2P6F A;  2PR8 A;  3BJ8 A;  4HNY B;  4AB7 A;  5GCN A;  4JXR A;  4II9 A;  4IUS A;  2PQ8 A;  4NEX A;  5F47 A;  4NF1 A;  2J8R A;  1RXT A;  2BSW A;  5CNP A;  2HUZ A;  1WWZ A;  4CRZ B;  3TOB A;  2P6E A;  4ZBG A;  4E0A A;  4ORF A;  3FNC A;  4MY0 A;  1FY7 A;  1MK4 A;  1MJA A;  3D3S A;  3GYA A;  3NE7 A;  4OAD A;  3K9U A;  5DWN A;  4H89 A;  1Y7R A;  3R96 A;  1M4G A;  1XF8 A;  4PK2 A;  1BOB A;  4QBJ A;  4XPL A;  5EBV A;  2QEC A;  3CXS A;  4OAE A;  1S7F A;  4KVO E;  2OB0 A;  3P2H A;  3PP9 A;  1NE9 A;  5ISV A;  1I12 A;  4XNH C;  2ARH A;  1MJ9 A;  3UY5 A;  4CRY B;  3WR7 A;  4KLW A;  3BJ7 A;  2X7B A;  4XNH B;  3G3S A;  1Y9W A;  2VEZ A;  3GKR A;  2ZPA A;  5C88 A;  2WPX A;  4F6A A;  3DNS A;  1RO5 A;  1TIQ A;  3R1K A;  4R57 A;  4KZT A;  2R8V A;  2Y0M A;  1IYK A;  3EC4 A;  1R57 A;  2PC1 A;  4KOR A;  3S6K A;  4JLY A;  1P4N A;  2QML A; 
#chains in the Genus database with same CATH topology
 2NYQ A;  2G0B A;  1ZG9 A;  2Z3K A;  1GYT A;  1Z8X A;  1OBR A;  2PVW A;  3B3S A;  4KS9 A;  4ZGY B;  1ARM A;  1CM0 A;  1CJW A;  1M1D A;  3JTK A;  2ZXV A;  2JLM A;  4PSX A;  3FRM A;  3MGD A;  4UEZ A;  3R9E A;  4GXH A;  4MFK A;  1PU9 A;  1M4L A;  3IEH A;  1N71 A;  1WK4 A;  3EO4 A;  2I00 A;  4R6T A;  5F46 A;  1KZF A;  2PJB A;  1CG2 A;  4XPK A;  4B13 A;  4FAI A;  3OWC A;  4NGM A;  3NA6 A;  2QIR A;  3IJ3 A;  3PB9 X;  2PIY A;  4PXE A;  2OH1 A;  2O4H A;  1QQ9 A;  4FWU A;  4E2A A;  2PJC A;  4QB9 A;  1HDQ A;  1QMU A;  4PXB A;  2D4P A;  3D7D A;  2V8D A;  3A9L A;  4MCS A;  2Q4Y A;  4YGO A;  4QUS A;  3TO7 A;  3S9N A;  2AJ6 A;  3KHZ A;  2O53 A;  2F7V A;  1ZG7 A;  5G20 A;  4CYN A;  3NH5 A;  4M6I A;  1ZG8 A;  2FXF A;  2FS5 A;  1Z4R A;  3PGP A;  1MJB A;  2P6G A;  4K3N A;  2C1C A;  1ELL P;  4OIW A;  3TOA A;  3SI2 A;  2BEI A;  2ZOF A;  4KOS A;  3W6S A;  4UIB A;  1YX0 A;  1Y7E A;  4ONU A;  4MFJ A;  1ARL A;  3W91 A;  4AVC A;  3IFE A;  5J8C A;  4CAV A;  1XFO A;  3W6X A;  3ZJ0 A;  3DGV A;  3HUV A;  1I1D A;  1BPN A;  3LAC A;  5HH1 A;  2G9D A;  3S9M A;  3DDD A;  4A33 A;  4KSA A;  5J8F A;  2YNE A;  2B4D A;  4R7M A;  4MFL A;  4UFX A;  5EMI A;  3B7I A;  3TO6 A;  3D7F A;  1V0C A;  3F8K A;  3VH9 A;  1FT7 A;  3N5F A;  4CYQ A;  3D2P A;  4W9Y A;  4OC5 A;  4CGM A;  4HKF A;  2DXQ A;  2EVN A;  1BO4 A;  4R3K A;  1AUG A;  2PJ8 A;  1IU8 A;  3FXT A;  1S7K A;  5LRK A;  2BCO A;  1Y9K A;  1X10 A;  1YRE A;  2QYV A;  2FSR A;  2Z3M A;  2F5I A;  3WAB A;  4ZY2 A;  1TF9 A;  2ZEE A;  3IU2 A;  5IB0 A;  5LYL A;  5D29 A;  3N7Z A;  5BWA B;  2H5M A;  2OU2 A;  2JEW A;  4H6Z A;  1CPS A;  4M3S A;  1L0C A;  2Q4Z A;  4BBH A;  4KUB A;  1NSL A;  2PR1 A;  1B87 A;  3PEI A;  4NJR A;  1Z8T A;  2C6G A;  2Z3O A;  1Y0Y A;  2PSW A;  2ABZ A;  2OOT A;  3NE8 A;  3WC5 A;  1FNO A;  3TT2 A;  2RC4 A;  4P6Y A;  2GLF A;  2ZEM A;  3GY9 A;  3IIB A;  4UIA A;  3CXQ A;  3PFE A;  4IF5 A;  1TXR A;  4P45 A;  1Q2Y A;  2Q51 A;  3EY5 A;  5IB9 A;  4JXQ A;  4B10 A;  2B3U A;  2GIV A;  2QML A;  3BHX A;  3EFA A;  2J8N A;  4R76 A;  8CPA A;  4B12 A;  4J3G A;  2I79 A;  1XE4 A;  4ZX9 A;  3GLJ A;  2IQ6 A;  3IC1 A;  3IU1 A;  2OR4 A;  3VAR A;  1QSM A;  2OZU A;  3VWE A;  6CPA A;  4R8F A;  3GB0 A;  1XMB A;  3KQZ A;  4CRY B;  3IWG A;  1ZO0 A;  4KVM E;  4Y49 C;  4NCZ A;  3PRT A;  4AVB A;  1PUA A;  2VZZ A;  3JVN A;  4FBE A;  5HXD A;  1J4J A;  4CGP A;  4F0Y A;  4Y49 B;  3B2Y A;  1XJO A;  4OLL A;  2VQY A;  4PXD A;  4U9Y A;  4OC3 A;  4A2Z A;  2F8H A;  3I9S A;  1A2Z A;  1M4D A;  2PJ2 A;  5AG5 A;  4KOT A;  4M6G A;  1VGY A;  4HNW B;  3ISZ A;  4X5K A;  2DF5 A;  4YFJ A;  1IY7 A;  2AFU A;  4P4I A;  4ONW A;  4UBR A;  1U6M A;  2EUI A;  2VBQ A;  3PB8 X;  4B5P A;  4BD9 A;  2HB6 A;  1ON0 A;  2BL1 A;  2XEG A;  3CZX A;  3DR6 A;  3D4U A;  4NXY A;  3FEC A;  2KCW A;  3TO9 A;  3TTH A;  4A94 A;  2JBK A;  1R3N A;  3TE4 A;  1ZLI A;  4JLY A;  2RFH A;  4EVY A;  2B4B A;  2DPT A;  4R3L A;  5A27 A;  3VWD A;  4R87 A;  1VHE A;  2HC9 A;  4CYO A;  2ZW6 A;  5J1Q A;  1YLE A;  1EE3 P;  2ZEO A;  1TKH A;  2FT0 A;  4LUA A;  3T8W A;  1PYT B;  4WWV A;  5HMN A;  1NMT A;  1LFW A;  3FMC A;  2R98 A;  2YND A;  1KUX A;  2Z0Z A;  3H8E A;  3IGR A;  4B6Z A;  5IV0 A;  4BIN A;  4OP4 A;  4PPZ A;  2Q7S A;  5D8N A;  3MN8 A;  2WZN A;  3FIX A;  1JWQ A;  2REE A;  1VHS A;  4MBU A;  3SI0 A;  4O23 A;  1Q2C A;  2VI7 A;  2QVP A;  7CPA A;  5CBM A;  1XMT A;  2B5G A;  3KHX A;  3KKW A;  2XEF A;  3VAT A;  2B3V A;  3B3C A;  4MHN A;  3L2N A;  4KOU A;  4KLV A;  4FUU A;  2BUE A;  4PSW A;  3R9G A;  4B14 A;  3PB4 X;  5THW A;  4KOV A;  2POK A;  1I21 A;  2D4O A;  3CPA A;  3KR4 A;  5AGE A;  1M4I A;  1BPM A;  2AFS A;  2C6P A;  1JQG A;  1AMP A;  3ISX A;  2ZW7 A;  2JDC A;  5CPA A;  3BI1 A;  2PDO A;  4OC1 A;  5E96 A;  1YK3 A;  1BLL E;  2JEV A;  3C26 A;  4ZI6 A;  3IO1 A;  3LOD A;  4R9M A;  2FIW A;  3F5B A;  2HV2 A;  1LOK A;  3EXN A;  4F9U A;  3D68 A;  4RI1 A;  2OZH A;  4GM5 A;  2ZEG A;  2REF A;  4LQG A;  1QSR A;  4OID A;  4LX9 A;  1KUV A;  2HQY A;  1S5K A;  1S7N A;  3PB7 X;  2Z3L A;  4C2X A;  2Q04 A;  2R1I A;  5JQ4 A;  2Q0Y A;  3S6F A;  4B5P B;  2RB7 A;  2ZW4 A;  4IK2 A;  2G3A A;  4M85 A;  3P2F A;  2PJ9 A;  5KTC A;  2P0W A;  4FD4 A;  2ZEH A;  2Q44 A;  5LRG A;  4NFR A;  3TC8 A;  2Q43 A;  1P0H A;  4CGN A;  4RS2 A;  4UEE A;  1Q2D A;  2PJ1 A;  4QVT A;  4IHM A;  5AG7 A;  3D8P A;  1F2O A;  3KGQ A;  2IMO A;  2OZG A;  2PJ5 A;  1LAP A;  3D67 A;  1UWY A;  3FBU A;  3FED A;  3PZJ A;  4HNX B;  4X3R A;  4XPD C;  4RUH A;  2PE3 A;  2ANP A;  2EWB A;  2WYR A;  2NSM A;  3GUX A;  4A32 A;  5JPH A;  2G3T A;  4XPD B;  2ZEF A;  2AFW A;  3KQX A;  3RAM A;  4MHD A;  1QST A;  5G21 A;  1TKF A;  3D7G A;  2CXA A;  4KSI A;  2Z3N A;  3I3G A;  3WT4 A;  3B8G A;  2B5G B;  5A28 A;  5IX3 A;  5AG4 A;  1QSO A;  3D66 A;  4KSF A;  4G1P A;  4KOX A;  4MMO A;  1KUY A;  5HVG A;  1Q7L A;  3CPX A;  3BXM A;  4EWT A;  3D2M A;  3QAY A;  4P4J A;  5FVJ A;  2FE7 A;  4A31 A;  5JGF A;  4DJL A;  1IID A;  1ELM P;  3SJF A;  3PFO A;  4BMH A;  4KOW A;  1NSA A;  5LYD A;  4YWY A;  4JJX A;  4MCP A;  4ZX8 A;  3TFY A;  3E0K A;  5HVH A;  2DEA A;  1Y0R A;  5LYF A;  2WSA A;  4JYW A;  4HPS A;  5EC4 A;  3TCV A;  4CGL A;  5H84 A;  4TNU A;  4MY3 A;  4C2Z A;  2VXK A;  4L8A A;  4KUA A;  5DS0 A;  3RNZ A;  3R9F A;  4X8I A;  2O28 A;  1IOF A;  4I49 A;  4OC4 A;  3WC7 A;  1YVK A;  2ZEP A;  3KL9 A;  2ZEL A;  2IL4 A;  2GAN A;  3FB3 A;  4MCR A;  1AYE A;  4A38 A;  1GHE A;  1YME A;  1CP7 A;  4AG9 A;  5HVF A;  5F48 A;  4GS4 A;  4MFQ A;  1IIC A;  4UWI A;  5KTA A;  2J9A A;  2B4D B;  4C2Y A;  1XOV A;  3H4Q A;  4PQA A;  4C7I A;  1DTD A;  2GU2 A;  1VHO A;  1UFH A;  2YNC A;  3B35 A;  2GE3 A;  4OME A;  3B3W A;  4KOY A;  3MRU A;  2JBJ A;  5AG6 A;  4DNC A;  2BO9 A;  2K5T A;  3B3T A;  4AG7 A;  3SHP A;  2WUU A;  2DPS A;  4A30 A;  3S9L A;  2CY2 A;  3S6G A;  3F0A A;  2EK9 A;  2ODF A;  3G8W A;  3T90 A;  4F9V A;  1IGB A;  3NH8 A;  1B6B A;  1ZLH A;  2R7H A;  4FD7 A;  4P10 A;  5H86 A;  5LYI A;  4ZY1 A;  1OZP A;  4Q7A A;  1YR0 A;  4MXU A;  4RN7 A;  5K8O A;  4A95 A;  4LQ6 A;  3JRU A;  4FD6 A;  1F2P A;  2WPW A;  1LAM A;  3KZW A;  2ZW5 A;  3T9Y A;  1XIX A;  4CAW A;  4MFP A;  2CF4 A;  1YQE A;  2XEI A;  4Q38 A;  1RTQ A;  5I0C A;  4K30 A;  2FCK A;  4NGT A;  1R43 A;  3SJG A;  4JD6 A;  4JWP A;  4MHP A;  4AXV A;  2PJ4 A;  4IAV A;  4Q36 A;  3BI0 A;  3JUW A;  5G1Z A;  4CAX A;  1HDU A;  2CTB A;  4EME A;  4U9Z A;  5DWM A;  4CPA A;  2CNM A;  2B58 A;  3FYN A;  1BAV A;  3RZA A;  3KAS A;  1VKC A;  2V8G A;  5KTD A;  1XEB A;  3QAH A;  4OC0 A;  1IB1 E;  4E8O A;  4OKO A;  1KWM A;  2A4N A;  3CDX A;  3NH4 A;  4MHY A;  2PJ6 A;  2V8H A;  2Z10 A;  1YW6 A;  3FEE A;  4YRH A;  3SJE A;  4NGR A;  3SXN A;  4B5O A;  2AE6 A;  4MFZ A;  3FVL A;  2VZY A;  4MHZ A;  1TF8 A;  1K4J A;  1S7L A;  2PJ7 A;  2FIA A;  1X12 A;  3CT9 A;  5K8P A;  2EBJ A;  2ZOG A;  4AVA A;  2J8M A;  4TWE A;  4NJQ A;  4JZ0 A;  4MI4 A;  3NFZ A;  3D7H A;  4KVX A;  1YW4 A;  4NGS A;  1QSN A;  4NGN A;  2FL4 A;  2YGW A;  1LAN A;  1LRZ A;  2YNC C;  1S3Z A;  4YU9 A;  2PJ3 A;  3ZZI A;  4FD5 A;  4UFW A;  2PCU A;  3BLN A;  1M44 A;  2PJ0 A;  4UEF A;  1TKJ A;  3RYO A;  3FX6 A;  4UCN A;  3CXP A;  3PBE A;  4C68 A;  4MRI A;  3R95 A;  3WC6 A;  1Z4E A;  3K2K A;  2Z11 A;  3I1U A;  4QC6 A;  2Z3P A;  4UA3 A;  3LD2 A;  4UF4 A;  4UCM A;  4A37 A;  4H6U A;  1H8L A;  4NSQ A;  2NMT A;  2C27 A;  2PJA A;  3DR8 A;  1S60 A;  3V7Z A;  2PRQ A;  3RBU A;  4MJ8 A;  4ZY0 A;  2ATR A;  2Q4V A;  4Z65 A;  3SXO A;  3V38 A;  1YGH A;  3V8I A;  1YLO A;  2C6C A;  3QNV A;  1IYL A;  2PRB A;  3DSB A;  5JM6 A;  5F49 A;  3S6H A;  4F0X A;  4L89 A;  1Z9U A;  1CP6 A;  4UWJ A;  2AFZ A;  1SQH A;  2EO8 A;  2JDD A;  4UCP A;  5G22 A;  5C82 A;  1LCP A;  4CS0 B;  4PV6 A;  4PK3 A;  2CNS A;  3QB8 A;  4A39 A;  3SJX A;  2CNT A;  2Q7B A;  4U5Y A;  2P6F A;  2PR8 A;  3BJ8 A;  4HNY B;  4AB7 A;  5GCN A;  4JXR A;  3RO0 A;  2PVV A;  4II9 A;  3FF3 A;  4IUS A;  3LMS A;  2PQ8 A;  4NEX A;  4WJB A;  4P44 A;  3FH4 A;  5F47 A;  2AFM A;  2XEJ A;  4NF1 A;  1DE4 C;  2J8R A;  1RXT A;  2BSW A;  5ELY A;  1PCA A;  5CNP A;  2HUZ A;  1WWZ A;  4CRZ B;  3TOB A;  4C7H A;  4OC2 A;  4P4F A;  5LRJ A;  4ZBG A;  2QJ8 A;  2VL1 A;  1F57 A;  2PIZ A;  4E0A A;  4ORF A;  1CX8 A;  3FNC A;  2IJZ A;  4P4B A;  4MY0 A;  1FY7 A;  1MK4 A;  1MJA A;  2BOA A;  3D3S A;  3FJU A;  3IWE A;  3GYA A;  3NE7 A;  3KI9 A;  3K9U A;  4OAD A;  5DWN A;  4H89 A;  3DLJ A;  4M6H A;  1Y7R A;  2ZED A;  3R96 A;  1M4G A;  2V77 A;  1XF8 A;  5JH9 A;  4PK2 A;  4P4D A;  3PBB A;  1BOB A;  4X2T A;  4QBJ A;  4XPL A;  2AFX A;  1Z8W A;  5EBV A;  2QEC A;  3CXS A;  3H5Z A;  4OAE A;  4CAF A;  4F8Z A;  3IWW A;  3GIU A;  4ZYQ A;  4EFD A;  2V8V A;  5F09 A;  1VIX A;  2GFQ A;  4DYO A;  1S7F A;  4KVO E;  2OB0 A;  2GLJ A;  3P2H A;  3PP9 A;  4UFV A;  1NE9 A;  5ISV A;  3H8F A;  2GRE A;  1I12 A;  4CYP A;  3PB6 X;  4XNH C;  2ARH A;  3KR5 A;  1MJ9 A;  1CBX A;  4P4E A;  3UY5 A;  1HEE A;  3WR7 A;  1Z2L A;  3LWU A;  4KLW A;  3BJ7 A;  4B11 A;  1XRY A;  1YSJ A;  2X7B A;  2I3C A;  4XNH B;  3H8G A;  2CIJ A;  1XBU A;  1IOI A;  3G3S A;  1Y9W A;  3K9T A;  4NGQ A;  4PXC A;  2VEZ A;  3GKR A;  5K8N A;  5I4M A;  2ZPA A;  4CGO A;  5C88 A;  2WPX A;  4DUK A;  1Z8L A;  3HLP A;  4F6A A;  5K8M A;  2ZEN A;  3TX8 A;  4CAE A;  3DNS A;  4NGP A;  2FVG A;  4H2K A;  2CTC A;  3SI1 A;  3B3V A;  1RO5 A;  1TIQ A;  3R1K A;  4R57 A;  4KZT A;  2R8V A;  2Y0M A;  1IYK A;  3EC4 A;  1R57 A;  2PC1 A;  4KOR A;  3S6K A;  2AFO A;  1Z5R A;  1CPX A;  2EK8 A;  1YVO A;  1P4N A;  4MCQ A;  2P6E A; 
#chains in the Genus database with same CATH homology
 2G0B A;  2Z3K A;  4KS9 A;  4ZGY B;  1CM0 A;  1CJW A;  1M1D A;  3JTK A;  2ZXV A;  2JLM A;  4PSX A;  3FRM A;  3MGD A;  3R9E A;  4MFK A;  1PU9 A;  1N71 A;  1WK4 A;  3EO4 A;  2I00 A;  5F46 A;  1KZF A;  4XPK A;  4B13 A;  3OWC A;  2QIR A;  2OH1 A;  4E2A A;  4QB9 A;  2D4P A;  3A9L A;  2Q4Y A;  4YGO A;  4QUS A;  3TO7 A;  2AJ6 A;  5G20 A;  4CYN A;  2FXF A;  3PGP A;  2FS5 A;  1Z4R A;  1MJB A;  2P6G A;  3TOA A;  2BEI A;  3W6S A;  4KOS A;  1YX0 A;  4ONU A;  4MFJ A;  3W91 A;  4AVC A;  5J8C A;  4CAV A;  3W6X A;  3ZJ0 A;  1I1D A;  5HH1 A;  4A33 A;  3DDD A;  4KSA A;  5J8F A;  2YNE A;  2B4D A;  4UFX A;  4MFL A;  3TO6 A;  3F8K A;  1V0C A;  4CYQ A;  3D2P A;  4CGM A;  4HKF A;  2DXQ A;  2EVN A;  1BO4 A;  4R3K A;  3FXT A;  1S7K A;  1Y9K A;  2Z3M A;  1YRE A;  2FSR A;  2F5I A;  5IB0 A;  3IU2 A;  3N7Z A;  5BWA B;  2H5M A;  2OU2 A;  4H6Z A;  4M3S A;  1L0C A;  4BBH A;  4KUB A;  1NSL A;  2PR1 A;  1B87 A;  2Z3O A;  2PSW A;  3TT2 A;  2RC4 A;  3GY9 A;  3CXQ A;  4IF5 A;  1Q2Y A;  3EY5 A;  4JXQ A;  4B10 A;  2B3U A;  2GIV A;  3EFA A;  2J8N A;  4B12 A;  4J3G A;  2I79 A;  1XE4 A;  3IU1 A;  1QSM A;  2OZU A;  3VWE A;  3IWG A;  1ZO0 A;  4KVM E;  4Y49 C;  4NCZ A;  4AVB A;  3JVN A;  1PUA A;  2VZZ A;  1J4J A;  4CGP A;  4F0Y A;  4Y49 B;  4OLL A;  2VQY A;  4U9Y A;  4A2Z A;  3I9S A;  1M4D A;  5AG5 A;  4KOT A;  4HNW B;  4X5K A;  4YFJ A;  4B5P A;  4UBR A;  1U6M A;  2EUI A;  2VBQ A;  1ON0 A;  2BL1 A;  3DR6 A;  4NXY A;  2KCW A;  3TO9 A;  3TTH A;  3TE4 A;  4EVY A;  2B4B A;  2DPT A;  4R3L A;  5A27 A;  3VWD A;  4R87 A;  4CYO A;  2ZW6 A;  1YLE A;  2FT0 A;  4LUA A;  5HMN A;  1NMT A;  2R98 A;  2YND A;  1KUX A;  2Z0Z A;  5IV0 A;  3IGR A;  3FIX A;  2REE A;  1VHS A;  4MBU A;  1Q2C A;  2VI7 A;  1XMT A;  2B5G A;  3KKW A;  2B3V A;  4KOU A;  4KLV A;  4PSW A;  2BUE A;  3R9G A;  4B14 A;  4KOV A;  1I21 A;  2D4O A;  5AGE A;  1M4I A;  2ZW7 A;  2JDC A;  2PDO A;  5E96 A;  1YK3 A;  2JEV A;  3C26 A;  3LOD A;  4R9M A;  2FIW A;  3F5B A;  2HV2 A;  3EXN A;  4RI1 A;  2OZH A;  2REF A;  1QSR A;  4LX9 A;  1KUV A;  2HQY A;  1S5K A;  1S7N A;  4C2X A;  2Z3L A;  2Q04 A;  2R1I A;  5JQ4 A;  2Q0Y A;  3S6F A;  4B5P B;  2ZW4 A;  2G3A A;  4M85 A;  3P2F A;  5KTC A;  2P0W A;  4FD4 A;  2Q44 A;  1P0H A;  4CGN A;  4RS2 A;  1YVO A;  1Q2D A;  4QVT A;  5AG7 A;  3D8P A;  2OZG A;  3FBU A;  4HNX B;  3PZJ A;  4XPD C;  4A32 A;  5JPH A;  2G3T A;  4XPD B;  4MHD A;  1QST A;  5G21 A;  2CXA A;  2Z3N A;  3I3G A;  5IX3 A;  3B8G A;  2B5G B;  5A28 A;  5AG4 A;  1QSO A;  4KSF A;  4KOX A;  1KUY A;  3D2M A;  5FVJ A;  2FE7 A;  4A31 A;  1IID A;  4BMH A;  4KOW A;  3TFY A;  4JJX A;  3E0K A;  2WSA A;  5EC4 A;  3TCV A;  4CGL A;  5H84 A;  4C2Z A;  4MY3 A;  2VXK A;  4L8A A;  4KUA A;  3R9F A;  2O28 A;  4I49 A;  1YVK A;  2IL4 A;  2GAN A;  3FB3 A;  1GHE A;  4AG9 A;  5F48 A;  4GS4 A;  4MFQ A;  1IIC A;  4UWI A;  5KTA A;  2B4D B;  4C2Y A;  3H4Q A;  4C7I A;  1UFH A;  2YNC A;  2GE3 A;  4KOY A;  5AG6 A;  4DNC A;  2K5T A;  4AG7 A;  3SHP A;  2WUU A;  2DPS A;  4A30 A;  2CY2 A;  3S6G A;  3F0A A;  3G8W A;  3T90 A;  1B6B A;  5H86 A;  2R7H A;  4FD7 A;  1OZP A;  1YR0 A;  4A95 A;  4FD6 A;  2WPW A;  2ZW5 A;  3T9Y A;  1XIX A;  4CAW A;  4MFP A;  4Q38 A;  5I0C A;  4K30 A;  2FCK A;  4JD6 A;  4JWP A;  4Q36 A;  5G1Z A;  4CAX A;  3JUW A;  4U9Z A;  5DWM A;  2CNM A;  2B58 A;  3FYN A;  1VKC A;  5KTD A;  1XEB A;  3QAH A;  1IB1 E;  4E8O A;  2A4N A;  2Z10 A;  4YRH A;  3SXN A;  4B5O A;  2AE6 A;  4MFZ A;  2VZY A;  1K4J A;  1S7L A;  2FIA A;  4AVA A;  2J8M A;  4MI4 A;  4KVX A;  1QSN A;  2FL4 A;  2YGW A;  1LRZ A;  2YNC C;  1S3Z A;  3ZZI A;  4FD5 A;  4UFW A;  3BLN A;  1M44 A;  3RYO A;  4UCN A;  3CXP A;  4C68 A;  3R95 A;  1Z4E A;  2Z11 A;  4QC6 A;  2Z3P A;  4UA3 A;  3LD2 A;  4UCM A;  4H6U A;  4NSQ A;  2NMT A;  2C27 A;  3DR8 A;  1S60 A;  4MJ8 A;  2ATR A;  2Q4V A;  3SXO A;  3V8I A;  1YGH A;  1IYL A;  2PRB A;  3DSB A;  5F49 A;  3S6H A;  4F0X A;  4L89 A;  1Z9U A;  4UWJ A;  4UCP A;  1SQH A;  5G22 A;  2JDD A;  5C82 A;  4CS0 B;  4PV6 A;  4PK3 A;  2CNS A;  3QB8 A;  2CNT A;  2Q7B A;  4U5Y A;  2P6F A;  2PR8 A;  3BJ8 A;  4HNY B;  4AB7 A;  5GCN A;  4JXR A;  4II9 A;  4IUS A;  2PQ8 A;  4NEX A;  5F47 A;  4NF1 A;  2J8R A;  1RXT A;  2BSW A;  5CNP A;  2HUZ A;  1WWZ A;  4CRZ B;  3TOB A;  2P6E A;  4C7H A;  4ZBG A;  4E0A A;  4ORF A;  3FNC A;  4MY0 A;  1FY7 A;  1MK4 A;  1MJA A;  3D3S A;  3IWE A;  3GYA A;  3NE7 A;  4OAD A;  3K9U A;  5DWN A;  4H89 A;  1Y7R A;  3R96 A;  1M4G A;  1XF8 A;  4PK2 A;  1BOB A;  4QBJ A;  4XPL A;  5EBV A;  2QEC A;  3CXS A;  3H5Z A;  4OAE A;  4CAF A;  1S7F A;  4KVO E;  2OB0 A;  3P2H A;  3PP9 A;  4UFV A;  1NE9 A;  5ISV A;  1I12 A;  4CYP A;  4XNH C;  2ARH A;  1MJ9 A;  3UY5 A;  4CRY B;  3WR7 A;  4B11 A;  4KLW A;  3BJ7 A;  2X7B A;  4XNH B;  3G3S A;  1Y9W A;  2VEZ A;  3GKR A;  2ZPA A;  4CGO A;  5C88 A;  2WPX A;  4F6A A;  4CAE A;  3DNS A;  1RO5 A;  1TIQ A;  3R1K A;  4R57 A;  4KZT A;  2R8V A;  2Y0M A;  1IYK A;  3EC4 A;  1R57 A;  2PC1 A;  4KOR A;  3S6K A;  4JLY A;  1P4N A;  2QML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...