5EMIA

N-acetylmuramoyl-l-alanine amidase amic2 of nostoc punctiforme
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
180
structure length
180
Chain Sequence
GSGKLLVVIDPGHGGKDSGAPGLGGLLEKDVILPIGKRVAAILEQHGVQAVLTRDADFFVELQGRVEIAERVNATAFVSIHANSVDNRPDVNGLEVYYYDSGYALAEVVRNTILQNIDTIKNRGTRKARFYVLRKSSMPSILVETGYMTGREDNPRLASREYQNQMAEAIARGILKYLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enabling cell-cell communication via nanopore formation: structure, function and localization of the unique cell wall amidase AmiC2 of Nostoc punctiforme.
pubmed doi rcsb
source organism Nostoc punctiforme (strain atcc 29133 / pcc 73102)
molecule tags Hydrolase
molecule keywords Cell wall hydrolase/autolysin
total genus 73
structure length 180
sequence length 180
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 5emiA00
4M6IA 4BINA 2ODFA 2Q7SA 1XOVA 3CZXA 4LQ6A 4M6HA 4M6GA 1JWQA 4RN7A 5EMIA 3QAYA 3NE8A
chains in the Genus database with same CATH superfamily
3ISZA 2Q4VA 4RUHA 1OBRA 4KOYA 2REFA 2EUIA 3FH4A 3BI0A 4JXQA 2AFUA 1Y0YA 1V0CA 3PFEA 3TCVA 2K5TA 2AFOA 4QB9A 4B10A 1S5KA 4KVME 4TWEA 5KTAA 1YX0A 2WYRA 3IO1A 4MFQA 2ZW5A 4A31A 1SQHA 4MJ8A 2WUUA 5JH9A 1TKFA 2GLJA 4MFLA 2BOAA 1Z9UA 1P0HA 4KOVA 2YNDA 4FUUA 2WPXA 1IYLA 3BLNA 4UCPA 1FY7A 4QC6A 3G8WA 1QQ9A 4KS9A 2R7HA 4UFWA 4CS0B 1JWQA 1F57A 4KLVA 5FVJA 4C2ZA 4P4IA 3RZAA 2YNEA 2X7BA 4KVXA 4ZY2A 3D7DA 3KR5A 1IGBA 5G22A 4XPLA 2ZEPA 4B5OA 2QECA 2ATRA 1BAVA 4CGNA 3JRUA 3SJXA 4C2YA 2PCUA 3FBUA 1YW4A 4U9YA 3EFAA 4KLWA 4XNHC 1KUXA 2ZEOA 5I4MA 4CGOA 4FAIA 1LCPA 2B3UA 3PP9A 4J3GA 2OB0A 2O4HA 3GYAA 3TOAA 1ZG9A 1XBUA 4MCQA 4KOWA 3C26A 2FE7A 4C7IA 2Q44A 1XEBA 1Z8XA 3TX8A 1YMEA 4CRYB 4A37A 5K8PA 4AG9A 4EMEA 3PB4X 4U5YA 3PB8X 1S7FA 4OC4A 4M85A 4XPDC 1KUYA 4BMHA 4KOUA 2PJ4A 3OWCA 1ARMA 1PYTB 2G3TA 3RO0A 3RYOA 3SHPA 1QSMA 1R3NA 2ZEHA 3GIUA 3EO4A 4A33A 1XMBA 2FS5A 4X8IA 3WC7A 5C88A 1TXRA 2ODFA 4NGTA 4Q7AA 2Q43A 3D3SA 4H6ZA 1B87A 4KVOE 4NXYA 4R6TA 2VBQA 3SXOA 3I3GA 2HB6A 2B58A 2PR1A 2BL1A 7CPAA 1QSTA 1ZLHA 5G1ZA 3S9NA 1Q2YA 4MFKA 1AMPA 3TE4A 2VL1A 3S6GA 2FSRA 3SJGA 3IU2A 1U6MA 1VHEA 4R87A 1QSOA 3PB9X 4FD6A 4KUAA 4P44A 4PPZA 3KHZA 3PB6X 2ARHA 4DNCA 4RI1A 1AUGA 1XJOA 3I9SA 1PU9A 3BJ7A 1YREA 2CTCA 2IJZA 2PE3A 3B3TA 5JPHA 2I79A 4CRZB 3TO7A 3TFYA 4MHDA 4PXCA 3DGVA 3IWEA 3LODA 2JLMA 4OMEA 4KORA 1P4NA 4H2KA 1NSLA 3HUVA 5G21A 2YGWA 4A94A 1YLOA 4E0AA 1XIXA 1Y7EA 4Q36A 4FD5A 1BPMA 1KWMA 2P6FA 3NA6A 1I1DA 1ZG7A 5AG6A 3S6KA 4PK2A 1YLEA 3K9TA 3NFZA 2DF5A 2QVPA 2V8DA 3D7FA 1TKHA 2OH1A 4MY0A 2GREA 2NMTA 3W6SA 2QMLA 4P6YA 3KL9A 5GCNA 4A95A 4Q38A 1LAPA 1IB1E 3ZZIA 1LRZA 4MFJA 1CP7A 2G3AA 2REEA 5F48A 1Q2CA 4F8ZA 1ZLIA 2POKA 2PVVA 5I0CA 5LRKA 5ISVA 1YW6A 2FXFA 1ELLP 3B3VA 2Q7SA 2QYVA 3D2MA 4MBUA 2OZUA 4CYQA 3VATA 4DUKA 5J1QA 3DR6A 1NSAA 2DEAA 1LFWA 4OLLA 4M3SA 5LYFA 3IU1A 2NYQA 1CX8A 2GFQA 4P4BA 2OZGA 5HH1A 5A28A 3V7ZA 1VHOA 5LYIA 5CBMA 3CPAA 2BCOA 1Z2LA 1X12A 3FEEA 1Y9WA 2ZW7A 1PUAA 4IHMA 1Z8LA 4AXVA 1BOBA 2J8NA 3GLJA 2ANPA 1LAMA 3MGDA 4C7HA 2CNTA 2ZEFA 3VARA 3EXNA 2AJ6A 5HXDA 4UFXA 5EBVA 4MI4A 4CYOA 2VZYA 4NF1A 5EC4A 1M44A 2EWBA 2PIZA 3PFOA 3VWDA 2Q04A 4MXUA 4AVCA 4CGPA 4JJXA 4RN7A 2QJ8A 2R1IA 4R3KA 3RAMA 4A2ZA 2JDCA 3DDDA 3GUXA 3JTKA 4WWVA 4B14A 2GLFA 3WC5A 2Z3OA 4GXHA 2FIAA 4MFZA 2WZNA 4B12A 2PJAA 2RB7A 2ZW6A 2G0BA 4UF4A 4JLYA 2BEIA 4UWJA 3B3CA 2CY2A 4OIWA 2PRQA 4PXEA 4OKOA 3S6FA 3V38A 2D4PA 4ZY1A 4PK3A 1KUVA 2O53A 4CPAA 3FMCA 1UFHA 4OIDA 4EWTA 3GY9A 4E2AA 5J8CA 3D7HA 3K2KA 4TNUA 2ZOFA 1VIXA 4MHPA 1RO5A 2VXKA 4ZX8A 1KZFA 5F49A 2PJ5A 4LQ6A 3FX6A 4OC2A 2PJ1A 5LRJA 3KR4A 4MCRA 3SI2A 1R43A 4MRIA 3JUWA 1NMTA 1CM0A 4Y49C 5LRGA 2PJ0A 4ZYQA 5K8MA 1N71A 4R9MA 5F46A 2VEZA 3FIXA 1UWYA 1AYEA 4HNWB 2AFXA 2B5GB 4XNHB 3WT4A 1FT7A 2CNMA 3BXMA 3SJFA 3S9LA 5KTDA 5K8NA 3F8KA 2D4OA 4CAEA 1BO4A 4KOSA 1I12A 3HLPA 1F2OA 5H84A 1R57A 4R76A 1CP6A 1WWZA 4AB7A 5THWA 1H8LA 2AFZA 1Z4RA 2DXQA 3P2HA 5CNPA 1IICA 1M1DA 2I3CA 3IFEA 3NH8A 4R3LA 2OOTA 4B5PB 2Z3KA 3TT2A 2V77A 3QB8A 1J4JA 1ON0A 4WJBA 3IIBA 4DJLA 3FVLA 1ELMP 2PJ3A 2ZEEA 4B13A 4LUAA 2B4DA 2J8RA 1CG2A 4UFVA 2B4BA 2XEJA 4FD4A 4MY3A 4QVTA 4LQGA 3MN8A 4P45A 3BJ8A 1LOKA 5A27A 2CNSA 2NSMA 4O23A 5BWAB 4P4FA 3L2NA 2DPTA 4I49A 4UEFA 5LYLA 2PJBA 1TF8A 3H8GA 2PIYA 2EK8A 3D8PA 4B11A 5EMIA 2R8VA 3H4QA 4UBRA 1S7NA 4MHZA 4EFDA 4IAVA 1ZO0A 2RC4A 4H89A 3WR7A 1S7LA 4XPKA 3LACA 1YVOA 4UEZA 1Y0RA 4JXRA 4NSQA 4RS2A 4YU9A 2PQ8A 2P0WA 5KTCA 1M4LA 1YQEA 5J8FA 2CXAA 3DR8A 3FB3A 2IL4A 2Q4YA 1B6BA 4B6ZA 1HDUA 2VI7A 3TOBA 3H8FA 3I1UA 4UIAA 1BLLE 3W6XA 3WC6A 1VHSA 3FEDA 2JBKA 3KHXA 1MJ9A 3BI1A 2AE6A 5C82A 2O28A 4PSXA 3H5ZA 3KASA 4QBJA 5IV0A 4KUBA 1YR0A 2AFSA 2VQYA 2PSWA 2Y0MA 3FF3A 4EVYA 8CPAA 1DE4C 3D4UA 2PJ2A 3DNSA 4NGRA 4ZX9A 3JVNA 3SJEA 4YWYA 4ZY0A 4KSAA 3GB0A 3PRTA 5ELYA 3V8IA 4NGQA 4R57A 1MK4A 1XOVA 2B4DB 4BBHA 4GM5A 2JBJA 3KGQA 5JQ4A 3K9UA 4JD6A 4NCZA 4CAVA 4R7MA 2XEIA 2PVWA 3EC4A 4MHYA 3TO9A 4AVBA 5IB0A 4JZ0A 4ORFA 4NEXA 4E8OA 1XRYA 1IY7A 4NGSA 4B5PA 4F0XA 3IWWA 3DSBA 4NJRA 4C68A 1VKCA 2V8GA 5AG4A 2BUEA 4CGLA 2ZEDA 4UIBA 4CGMA 3CZXA 4NGPA 2CIJA 5D8NA 2C6PA 1HEEA 4PXBA 1DTDA 1IOIA 3H8EA 1WK4A 1Q2DA 2F5IA 3FNCA 2Q7BA 1Y7RA 3CXSA 4OC0A 2P6GA 1IOFA 1GHEA 3PBEA 2HV2A 4K30A 4FD7A 2B5GA 2P6EA 3D66A 3CXPA 3IJ3A 4W9YA 3R9GA 4AVAA 3PEIA 5F09A 3R9EA 2ZENA 3FRMA 4OC3A 2DPSA 4HNXB 3PGPA 5F47A 4L8AA 2V8VA 2I00A 4A38A 3G3SA 4CYNA 3FJUA 3F0AA 2PJ7A 2Q4ZA 4HPSA 3IEHA 1OZPA 2CF4A 4NGNA 1XF8A 4A30A 4OC5A 5HVFA 2WPWA 2H5MA 2GU2A 1MJAA 4NGMA 2Z3PA 4U9ZA 3KKWA 4CAWA 4PV6A 2F7VA 3D2PA 4F0YA 4CAFA 2J8MA 2ZEMA 1HDQA 5AGEA 5IX3A 1I21A 4KOTA 1TF9A 4PSWA 4P4EA 1X10A 4G1PA 4X5KA 1A2ZA 1CBXA 1CJWA 4IK2A 3RBUA 4X3RA 4BD9A 2PJ8A 1CPSA 2BO9A 2JEWA 2FCKA 3PZJA 2ABZA 1QSNA 4M6GA 4PQAA 2CTBA 1PCAA 2C27A 3B3WA 4DYOA 4OADA 4KSFA 4KZTA 1Z8WA 3SI0A 4OP4A 2GIVA 4FWUA 3PB7X 4P10A 4R8FA 1Z5RA 1RTQA 5HVHA 3IC1A 4HNYB 5K8OA 5DS0A 3R96A 3W91A 2PJ6A 2Z0ZA 5HVGA 3B2YA 3FXTA 3BHXA 5DWMA 3SXNA 1QSRA 3RNZA 2G9DA 3ISXA 2PC1A 4UCNA 3CDXA 4A39A 1LANA 5IB9A 1S7KA 3VWEA 5JGFA 3PBBA 3KQZA 1ARLA 4PXDA 2OU2A 2EO8A 1S60A 2V8HA 2ZOGA 2AFWA 3KI9A 4HKFA 4UWIA 3LWUA 4F6AA 1Z4EA 3QNVA 1GYTA 4MCPA 4IF5A 5G20A 4ZI6A 1QMUA 2OZHA 2YNCC 4X2TA 1TIQA 4LX9A 2IQ6A 4IUSA 3NE8A 3D68A 3CT9A 1EE3P 2EVNA 2PDOA 2Z11A 1IU8A 2F8HA 4BINA 5JM6A 4K3NA 4YGOA 2Q0YA 5HMNA 3B7IA 2PRBA 3WABA 1NE9A 3CXQA 5AG5A 4YRHA 2A4NA 4JYWA 2R98A 4ONUA 2FVGA 3CPXA 2VZZA 5H86A 2PJCA 4UCMA 4M6IA 5E96A 4XPDB 5CPAA 4Z65A 3ZJ0A 3LD2A 1ZG8A 1F2PA 1XFOA 2C6CA 1XE4A 3R9FA 3TO6A 1S3ZA 3B3SA 3QAHA 2Z3LA 1FNOA 4Y49B 4JWPA 3KZWA 2B3VA 3MRUA 4FBEA 1CPXA 4MMOA 4II9A 4MFPA 1M4DA 3S9MA 2ZEGA 4P4DA 2HQYA 4GS4A 2QIRA 1XMTA 1IYKA 3D67A 4F9UA 2OR4A 1MJBA 2JDDA 1YGHA 2ZELA 3IWGA 4YFJA 3IGRA 3QAYA 4NJQA 3N7ZA 2AFMA 2GANA 2BSWA 2WSAA 4MHNA 3F5BA 3SI1A 3UY5A 4F9VA 2Z10A 3FYNA 2PR8A 2GE3A 4L89A 2FT0A 2EK9A 2FL4A 2Q51A 3P2FA 5AG7A 3TC8A 3T90A 2HC9A 5LYDA 2ZW4A 3D7GA 3KQXA 4CYPA 4KOXA 2HUZA 3LMSA 3T9YA 1RXTA 2C6GA 4UA3A 4P4JA 6CPAA 3TTHA 3NH5A 5DWNA 3T8WA 1M4IA 4ZBGA 1Z8TA 2YNCA 3B35A 3R95A 3NE7A 3B8GA 5D29A 4NFRA 4M6HA 1L0CA 3GKRA 2RFHA 4H6UA 4A32A 1YVKA 2Z3MA 4CAXA 3S6HA 4KSIA 4ONWA 4AG7A 1YSJA 1IIDA 2ZXVA 3E0KA 1TKJA 3DLJA 3VH9A 2KCWA 1VGYA 3FECA 2Z3NA 1YK3A 4C2XA 4ZGYB 4OC1A 2FIWA 2JEVA 2PJ9A 3A9LA 3R1KA 1BPNA 1Q7LA 4QUSA 4OAEA 2IMOA 1Y9KA 1JQGA 2J9AA 3EY5A 4MCSA 2ZPAA 2EBJA 3NH4A 2C1CA 2XEGA 3N5FA 1M4GA 2XEFA 1K4JA 4UEEA
chains in the Genus database with same CATH topology
2HB6A 4M6IA 4BINA 2ODFA 2HC9A 1XOVA 2Q7SA 3CZXA 4LQ6A 4M6HA 1JWQA 4M6GA 4RN7A 5EMIA 4EFDA 3QAYA 3NE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6I A;  4BIN A;  2ODF A;  2Q7S A;  1XOV A;  3CZX A;  4LQ6 A;  4M6H A;  4M6G A;  1JWQ A;  4RN7 A;  5EMI A;  3QAY A;  3NE8 A; 
#chains in the Genus database with same CATH topology
 3ISZ A;  2Q4V A;  4RUH A;  1OBR A;  4KOY A;  2REF A;  2EUI A;  3FH4 A;  3BI0 A;  4JXQ A;  2AFU A;  1Y0Y A;  1V0C A;  3PFE A;  3TCV A;  2K5T A;  2AFO A;  4QB9 A;  4B10 A;  1S5K A;  4KVM E;  4TWE A;  5KTA A;  1YX0 A;  2WYR A;  3IO1 A;  4MFQ A;  2ZW5 A;  4A31 A;  1SQH A;  4MJ8 A;  2WUU A;  5JH9 A;  1TKF A;  2GLJ A;  4MFL A;  2BOA A;  1Z9U A;  1P0H A;  4KOV A;  2YND A;  4FUU A;  2WPX A;  1IYL A;  3BLN A;  4UCP A;  1FY7 A;  4QC6 A;  3G8W A;  1QQ9 A;  4KS9 A;  2R7H A;  4UFW A;  4CS0 B;  1JWQ A;  1F57 A;  4KLV A;  5FVJ A;  4C2Z A;  4P4I A;  3RZA A;  2YNE A;  2X7B A;  4KVX A;  4ZY2 A;  3D7D A;  3KR5 A;  1IGB A;  5G22 A;  4XPL A;  2ZEP A;  4B5O A;  2QEC A;  2ATR A;  1BAV A;  4CGN A;  3JRU A;  3SJX A;  4C2Y A;  2PCU A;  3FBU A;  1YW4 A;  4U9Y A;  3EFA A;  4KLW A;  4XNH C;  1KUX A;  2ZEO A;  5I4M A;  4CGO A;  4FAI A;  1LCP A;  2B3U A;  3PP9 A;  4J3G A;  2OB0 A;  2O4H A;  3GYA A;  3TOA A;  1ZG9 A;  1XBU A;  4MCQ A;  4KOW A;  3C26 A;  2FE7 A;  4C7I A;  2Q44 A;  1XEB A;  1Z8X A;  3TX8 A;  1YME A;  4CRY B;  4A37 A;  5K8P A;  4AG9 A;  4EME A;  3PB4 X;  4U5Y A;  3PB8 X;  1S7F A;  4OC4 A;  4M85 A;  4XPD C;  1KUY A;  4BMH A;  4KOU A;  2PJ4 A;  3OWC A;  1ARM A;  1PYT B;  2G3T A;  3RO0 A;  3RYO A;  3SHP A;  1QSM A;  1R3N A;  2ZEH A;  3GIU A;  3EO4 A;  4A33 A;  1XMB A;  2FS5 A;  4X8I A;  3WC7 A;  5C88 A;  1TXR A;  2ODF A;  4NGT A;  4Q7A A;  2Q43 A;  3D3S A;  4H6Z A;  1B87 A;  4KVO E;  4NXY A;  4R6T A;  2VBQ A;  3SXO A;  3I3G A;  2HB6 A;  2B58 A;  2PR1 A;  2BL1 A;  7CPA A;  1QST A;  1ZLH A;  5G1Z A;  3S9N A;  1Q2Y A;  4MFK A;  1AMP A;  3TE4 A;  2VL1 A;  3S6G A;  2FSR A;  3SJG A;  3IU2 A;  1U6M A;  1VHE A;  4R87 A;  1QSO A;  3PB9 X;  4FD6 A;  4KUA A;  4P44 A;  4PPZ A;  3KHZ A;  3PB6 X;  2ARH A;  4DNC A;  4RI1 A;  1AUG A;  1XJO A;  3I9S A;  1PU9 A;  3BJ7 A;  1YRE A;  2CTC A;  2IJZ A;  2PE3 A;  3B3T A;  5JPH A;  2I79 A;  4CRZ B;  3TO7 A;  3TFY A;  4MHD A;  4PXC A;  3DGV A;  3IWE A;  3LOD A;  2JLM A;  4OME A;  4KOR A;  1P4N A;  4H2K A;  1NSL A;  3HUV A;  5G21 A;  2YGW A;  4A94 A;  1YLO A;  4E0A A;  1XIX A;  1Y7E A;  4Q36 A;  4FD5 A;  1BPM A;  1KWM A;  2P6F A;  3NA6 A;  1I1D A;  1ZG7 A;  5AG6 A;  3S6K A;  4PK2 A;  1YLE A;  3K9T A;  3NFZ A;  2DF5 A;  2QVP A;  2V8D A;  3D7F A;  1TKH A;  2OH1 A;  4MY0 A;  2GRE A;  2NMT A;  3W6S A;  2QML A;  4P6Y A;  3KL9 A;  5GCN A;  4A95 A;  4Q38 A;  1LAP A;  1IB1 E;  3ZZI A;  1LRZ A;  4MFJ A;  1CP7 A;  2G3A A;  2REE A;  5F48 A;  1Q2C A;  4F8Z A;  1ZLI A;  2POK A;  2PVV A;  5I0C A;  5LRK A;  5ISV A;  1YW6 A;  2FXF A;  1ELL P;  3B3V A;  2Q7S A;  2QYV A;  3D2M A;  4MBU A;  2OZU A;  4CYQ A;  3VAT A;  4DUK A;  5J1Q A;  3DR6 A;  1NSA A;  2DEA A;  1LFW A;  4OLL A;  4M3S A;  5LYF A;  3IU1 A;  2NYQ A;  1CX8 A;  2GFQ A;  4P4B A;  2OZG A;  5HH1 A;  5A28 A;  3V7Z A;  1VHO A;  5LYI A;  5CBM A;  3CPA A;  2BCO A;  1Z2L A;  1X12 A;  3FEE A;  1Y9W A;  2ZW7 A;  1PUA A;  4IHM A;  1Z8L A;  4AXV A;  1BOB A;  2J8N A;  3GLJ A;  2ANP A;  1LAM A;  3MGD A;  4C7H A;  2CNT A;  2ZEF A;  3VAR A;  3EXN A;  2AJ6 A;  5HXD A;  4UFX A;  5EBV A;  4MI4 A;  4CYO A;  2VZY A;  4NF1 A;  5EC4 A;  1M44 A;  2EWB A;  2PIZ A;  3PFO A;  3VWD A;  2Q04 A;  4MXU A;  4AVC A;  4CGP A;  4JJX A;  4RN7 A;  2QJ8 A;  2R1I A;  4R3K A;  3RAM A;  4A2Z A;  2JDC A;  3DDD A;  3GUX A;  3JTK A;  4WWV A;  4B14 A;  2GLF A;  3WC5 A;  2Z3O A;  4GXH A;  2FIA A;  4MFZ A;  2WZN A;  4B12 A;  2PJA A;  2RB7 A;  2ZW6 A;  2G0B A;  4UF4 A;  4JLY A;  2BEI A;  4UWJ A;  3B3C A;  2CY2 A;  4OIW A;  2PRQ A;  4PXE A;  4OKO A;  3S6F A;  3V38 A;  2D4P A;  4ZY1 A;  4PK3 A;  1KUV A;  2O53 A;  4CPA A;  3FMC A;  1UFH A;  4OID A;  4EWT A;  3GY9 A;  4E2A A;  5J8C A;  3D7H A;  3K2K A;  4TNU A;  2ZOF A;  1VIX A;  4MHP A;  1RO5 A;  2VXK A;  4ZX8 A;  1KZF A;  5F49 A;  2PJ5 A;  4LQ6 A;  3FX6 A;  4OC2 A;  2PJ1 A;  5LRJ A;  3KR4 A;  4MCR A;  3SI2 A;  1R43 A;  4MRI A;  3JUW A;  1NMT A;  1CM0 A;  4Y49 C;  5LRG A;  2PJ0 A;  4ZYQ A;  5K8M A;  1N71 A;  4R9M A;  5F46 A;  2VEZ A;  3FIX A;  1UWY A;  1AYE A;  4HNW B;  2AFX A;  2B5G B;  4XNH B;  3WT4 A;  1FT7 A;  2CNM A;  3BXM A;  3SJF A;  3S9L A;  5KTD A;  5K8N A;  3F8K A;  2D4O A;  4CAE A;  1BO4 A;  4KOS A;  1I12 A;  3HLP A;  1F2O A;  5H84 A;  1R57 A;  4R76 A;  1CP6 A;  1WWZ A;  4AB7 A;  5THW A;  1H8L A;  2AFZ A;  1Z4R A;  2DXQ A;  3P2H A;  5CNP A;  1IIC A;  1M1D A;  2I3C A;  3IFE A;  3NH8 A;  4R3L A;  2OOT A;  4B5P B;  2Z3K A;  3TT2 A;  2V77 A;  3QB8 A;  1J4J A;  1ON0 A;  4WJB A;  3IIB A;  4DJL A;  3FVL A;  1ELM P;  2PJ3 A;  2ZEE A;  4B13 A;  4LUA A;  2B4D A;  2J8R A;  1CG2 A;  4UFV A;  2B4B A;  2XEJ A;  4FD4 A;  4MY3 A;  4QVT A;  4LQG A;  3MN8 A;  4P45 A;  3BJ8 A;  1LOK A;  5A27 A;  2CNS A;  2NSM A;  4O23 A;  5BWA B;  4P4F A;  3L2N A;  2DPT A;  4I49 A;  4UEF A;  5LYL A;  2PJB A;  1TF8 A;  3H8G A;  2PIY A;  2EK8 A;  3D8P A;  4B11 A;  5EMI A;  2R8V A;  3H4Q A;  4UBR A;  1S7N A;  4MHZ A;  4EFD A;  4IAV A;  1ZO0 A;  2RC4 A;  4H89 A;  3WR7 A;  1S7L A;  4XPK A;  3LAC A;  1YVO A;  4UEZ A;  1Y0R A;  4JXR A;  4NSQ A;  4RS2 A;  4YU9 A;  2PQ8 A;  2P0W A;  5KTC A;  1M4L A;  1YQE A;  5J8F A;  2CXA A;  3DR8 A;  3FB3 A;  2IL4 A;  2Q4Y A;  1B6B A;  4B6Z A;  1HDU A;  2VI7 A;  3TOB A;  3H8F A;  3I1U A;  4UIA A;  1BLL E;  3W6X A;  3WC6 A;  1VHS A;  3FED A;  2JBK A;  3KHX A;  1MJ9 A;  3BI1 A;  2AE6 A;  5C82 A;  2O28 A;  4PSX A;  3H5Z A;  3KAS A;  4QBJ A;  5IV0 A;  4KUB A;  1YR0 A;  2AFS A;  2VQY A;  2PSW A;  2Y0M A;  3FF3 A;  4EVY A;  8CPA A;  1DE4 C;  3D4U A;  2PJ2 A;  3DNS A;  4NGR A;  4ZX9 A;  3JVN A;  3SJE A;  4YWY A;  4ZY0 A;  4KSA A;  3GB0 A;  3PRT A;  5ELY A;  3V8I A;  4NGQ A;  4R57 A;  1MK4 A;  1XOV A;  2B4D B;  4BBH A;  4GM5 A;  2JBJ A;  3KGQ A;  5JQ4 A;  3K9U A;  4JD6 A;  4NCZ A;  4CAV A;  4R7M A;  2XEI A;  2PVW A;  3EC4 A;  4MHY A;  3TO9 A;  4AVB A;  5IB0 A;  4JZ0 A;  4ORF A;  4NEX A;  4E8O A;  1XRY A;  1IY7 A;  4NGS A;  4B5P A;  4F0X A;  3IWW A;  3DSB A;  4NJR A;  4C68 A;  1VKC A;  2V8G A;  5AG4 A;  2BUE A;  4CGL A;  2ZED A;  4UIB A;  4CGM A;  3CZX A;  4NGP A;  2CIJ A;  5D8N A;  2C6P A;  1HEE A;  4PXB A;  1DTD A;  1IOI A;  3H8E A;  1WK4 A;  1Q2D A;  2F5I A;  3FNC A;  2Q7B A;  1Y7R A;  3CXS A;  4OC0 A;  2P6G A;  1IOF A;  1GHE A;  3PBE A;  2HV2 A;  4K30 A;  4FD7 A;  2B5G A;  2P6E A;  3D66 A;  3CXP A;  3IJ3 A;  4W9Y A;  3R9G A;  4AVA A;  3PEI A;  5F09 A;  3R9E A;  2ZEN A;  3FRM A;  4OC3 A;  2DPS A;  4HNX B;  3PGP A;  5F47 A;  4L8A A;  2V8V A;  2I00 A;  4A38 A;  3G3S A;  4CYN A;  3FJU A;  3F0A A;  2PJ7 A;  2Q4Z A;  4HPS A;  3IEH A;  1OZP A;  2CF4 A;  4NGN A;  1XF8 A;  4A30 A;  4OC5 A;  5HVF A;  2WPW A;  2H5M A;  2GU2 A;  1MJA A;  4NGM A;  2Z3P A;  4U9Z A;  3KKW A;  4CAW A;  4PV6 A;  2F7V A;  3D2P A;  4F0Y A;  4CAF A;  2J8M A;  2ZEM A;  1HDQ A;  5AGE A;  5IX3 A;  1I21 A;  4KOT A;  1TF9 A;  4PSW A;  4P4E A;  1X10 A;  4G1P A;  4X5K A;  1A2Z A;  1CBX A;  1CJW A;  4IK2 A;  3RBU A;  4X3R A;  4BD9 A;  2PJ8 A;  1CPS A;  2BO9 A;  2JEW A;  2FCK A;  3PZJ A;  2ABZ A;  1QSN A;  4M6G A;  4PQA A;  2CTB A;  1PCA A;  2C27 A;  3B3W A;  4DYO A;  4OAD A;  4KSF A;  4KZT A;  1Z8W A;  3SI0 A;  4OP4 A;  2GIV A;  4FWU A;  3PB7 X;  4P10 A;  4R8F A;  1Z5R A;  1RTQ A;  5HVH A;  3IC1 A;  4HNY B;  5K8O A;  5DS0 A;  3R96 A;  3W91 A;  2PJ6 A;  2Z0Z A;  5HVG A;  3B2Y A;  3FXT A;  3BHX A;  5DWM A;  3SXN A;  1QSR A;  3RNZ A;  2G9D A;  3ISX A;  2PC1 A;  4UCN A;  3CDX A;  4A39 A;  1LAN A;  5IB9 A;  1S7K A;  3VWE A;  5JGF A;  3PBB A;  3KQZ A;  1ARL A;  4PXD A;  2OU2 A;  2EO8 A;  1S60 A;  2V8H A;  2ZOG A;  2AFW A;  3KI9 A;  4HKF A;  4UWI A;  3LWU A;  4F6A A;  1Z4E A;  3QNV A;  1GYT A;  4MCP A;  4IF5 A;  5G20 A;  4ZI6 A;  1QMU A;  2OZH A;  2YNC C;  4X2T A;  1TIQ A;  4LX9 A;  2IQ6 A;  4IUS A;  3NE8 A;  3D68 A;  3CT9 A;  1EE3 P;  2EVN A;  2PDO A;  2Z11 A;  1IU8 A;  2F8H A;  4BIN A;  5JM6 A;  4K3N A;  4YGO A;  2Q0Y A;  5HMN A;  3B7I A;  2PRB A;  3WAB A;  1NE9 A;  3CXQ A;  5AG5 A;  4YRH A;  2A4N A;  4JYW A;  2R98 A;  4ONU A;  2FVG A;  3CPX A;  2VZZ A;  5H86 A;  2PJC A;  4UCM A;  4M6I A;  5E96 A;  4XPD B;  5CPA A;  4Z65 A;  3ZJ0 A;  3LD2 A;  1ZG8 A;  1F2P A;  1XFO A;  2C6C A;  1XE4 A;  3R9F A;  3TO6 A;  1S3Z A;  3B3S A;  3QAH A;  2Z3L A;  1FNO A;  4Y49 B;  4JWP A;  3KZW A;  2B3V A;  3MRU A;  4FBE A;  1CPX A;  4MMO A;  4II9 A;  4MFP A;  1M4D A;  3S9M A;  2ZEG A;  4P4D A;  2HQY A;  4GS4 A;  2QIR A;  1XMT A;  1IYK A;  3D67 A;  4F9U A;  2OR4 A;  1MJB A;  2JDD A;  1YGH A;  2ZEL A;  3IWG A;  4YFJ A;  3IGR A;  3QAY A;  4NJQ A;  3N7Z A;  2AFM A;  2GAN A;  2BSW A;  2WSA A;  4MHN A;  3F5B A;  3SI1 A;  3UY5 A;  4F9V A;  2Z10 A;  3FYN A;  2PR8 A;  2GE3 A;  4L89 A;  2FT0 A;  2EK9 A;  2FL4 A;  2Q51 A;  3P2F A;  5AG7 A;  3TC8 A;  3T90 A;  2HC9 A;  5LYD A;  2ZW4 A;  3D7G A;  3KQX A;  4CYP A;  4KOX A;  2HUZ A;  3LMS A;  3T9Y A;  1RXT A;  2C6G A;  4UA3 A;  4P4J A;  6CPA A;  3TTH A;  3NH5 A;  5DWN A;  3T8W A;  1M4I A;  4ZBG A;  1Z8T A;  2YNC A;  3B35 A;  3R95 A;  3NE7 A;  3B8G A;  5D29 A;  4NFR A;  4M6H A;  1L0C A;  3GKR A;  2RFH A;  4H6U A;  4A32 A;  1YVK A;  2Z3M A;  4CAX A;  3S6H A;  4KSI A;  4ONW A;  4AG7 A;  1YSJ A;  1IID A;  2ZXV A;  3E0K A;  1TKJ A;  3DLJ A;  3VH9 A;  2KCW A;  1VGY A;  3FEC A;  2Z3N A;  1YK3 A;  4C2X A;  4ZGY B;  4OC1 A;  2FIW A;  2JEV A;  2PJ9 A;  3A9L A;  3R1K A;  1BPN A;  1Q7L A;  4QUS A;  4OAE A;  2IMO A;  1Y9K A;  1JQG A;  2J9A A;  3EY5 A;  4MCS A;  2ZPA A;  2EBJ A;  3NH4 A;  2C1C A;  2XEG A;  3N5F A;  1M4G A;  2XEF A;  1K4J A;  4UEE A; 
#chains in the Genus database with same CATH homology
 2HB6 A;  4M6I A;  4BIN A;  2ODF A;  2HC9 A;  1XOV A;  2Q7S A;  3CZX A;  4LQ6 A;  4M6H A;  1JWQ A;  4M6G A;  4RN7 A;  5EMI A;  4EFD A;  3QAY A;  3NE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...