5EMIA

N-acetylmuramoyl-l-alanine amidase amic2 of nostoc punctiforme
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
180
structure length
180
Chain Sequence
GSGKLLVVIDPGHGGKDSGAPGLGGLLEKDVILPIGKRVAAILEQHGVQAVLTRDADFFVELQGRVEIAERVNATAFVSIHANSVDNRPDVNGLEVYYYDSGYALAEVVRNTILQNIDTIKNRGTRKARFYVLRKSSMPSILVETGYMTGREDNPRLASREYQNQMAEAIARGILKYLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cell wall hydrolase/autolysin
publication title Enabling cell-cell communication via nanopore formation: structure, function and localization of the unique cell wall amidase AmiC2 of Nostoc punctiforme.
pubmed doi rcsb
source organism Nostoc punctiforme (strain atcc 29133 / pcc 73102)
total genus 73
structure length 180
sequence length 180
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 5emiA00
3QAYA 2Q7SA 4LQ6A 3CZXA 4M6IA 4M6HA 2ODFA 5EMIA 4RN7A 3NE8A 1XOVA 4M6GA 4BINA 1JWQA
chains in the Genus database with same CATH superfamily
4HNWB 2C6CA 1J4JA 1FNOA 1BLLE 4ONUA 1M4GA 1HDUA 1BAVA 2DPTA 5CNPA 4NSQA 1KWMA 3LMSA 2P0WA 5HVFA 1XIXA 4XNHC 4KVXA 2NYQA 3R9GA 1I21A 1MJBA 5KTCA 3DDDA 2PJCA 5LYFA 3WT4A 1IIDA 3IWEA 3IU2A 2EO8A 4PK3A 2PCUA 2PJBA 3BJ8A 4PSXA 3EFAA 4PK2A 5HVHA 4CGMA 4OLLA 2HC9A 2Q44A 4UA3A 3DSBA 1NMTA 3LODA 3V8IA 3SJXA 4OC4A 1IU8A 4KLWA 3D7FA 2BOAA 2FXFA 3D67A 3K9UA 4KOSA 4MFLA 3FEEA 1LRZA 3TO6A 2FVGA 3TCVA 4F8ZA 3GKRA 4WJBA 4DJLA 5LRGA 3RAMA 4XNHB 5DWNA 2PJ5A 3JRUA 3KASA 3NA6A 2ZELA 4ZY0A 4AVBA 4H89A 1XOVA 4OADA 1KUVA 3WC5A 3PB4X 1Z4EA 3FB3A 1Z9UA 3E0KA 4A32A 4B14A 4CAXA 1OZPA 4MHNA 1QSMA 4QBJA 2V8VA 1ZG8A 3FBUA 4B12A 2PRQA 5EMIA 4ZBGA 3UY5A 4QVTA 2Q43A 3R9EA 4CYQA 5JQ4A 5FVJA 3V7ZA 5LRKA 2OOTA 2ZW5A 2ATRA 3IC1A 4F9UA 4C2YA 3SI0A 4E8OA 2BSWA 3FNCA 2C27A 5F49A 3LD2A 4KVME 4A33A 4LQ6A 4UWIA 4ZY2A 4M6HA 3D4UA 4K30A 3N7ZA 5J8FA 3KI9A 1LAMA 4M6GA 1LCPA 2B4DB 2JDCA 4AVCA 1Z8XA 5C88A 4CGNA 1XE4A 1ZLHA 2HB6A 2I00A 1YREA 2PJ0A 2VBQA 2ZPAA 2Q4ZA 2JEVA 4OC5A 3RYOA 1R43A 2ZEOA 5CPAA 4ZYQA 1HEEA 5IV0A 3S9NA 3GUXA 2PIYA 1CJWA 2AFMA 3D7GA 4KOUA 3FVLA 4HNXB 3TT2A 1NSLA 3KQZA 5EC4A 5KTDA 1S7LA 5LYDA 5K8PA 3CZXA 4FWUA 2G3TA 1S3ZA 1PUAA 4ZX8A 2X7BA 5F46A 2B4BA 4ONWA 4A38A 2GU2A 2DF5A 4ORFA 2B3UA 2PR8A 4F0YA 3WABA 3RNZA 4B5PB 4H6UA 4II9A 1RO5A 2Z11A 1F2OA 1JQGA 4CS0B 2B3VA 2POKA 2EVNA 3CT9A 2PDOA 1BPMA 3ZJ0A 4UCMA 4OMEA 2ZW7A 3D2MA 2JBKA 2PJ3A 4FD6A 4MJ8A 4X8IA 3GB0A 5AG6A 2J8NA 1M1DA 4P6YA 2JBJA 4ZI6A 1YW4A 1EE3P 3RBUA 1MJ9A 4M6IA 4P4EA 1IYLA 3F0AA 1KUYA 5IX3A 4OC0A 4R76A 1JWQA 4R9MA 2DXQA 4JXQA 4YWYA 4BD9A 1LANA 7CPAA 1L0CA 2OZUA 5A27A 5I4MA 2K5TA 2QMLA 1K4JA 1VHEA 3KQXA 3PB8X 4R87A 4YGOA 5H84A 1CP7A 3W91A 1M4LA 4AG9A 2J9AA 1ELLP 4NFRA 3LWUA 2CIJA 4C2ZA 2C6GA 3A9LA 4KSIA 2FIWA 2WUUA 2YNCA 3PP9A 5LYIA 3TX8A 3S9MA 4DUKA 2O4HA 5J8CA 1XRYA 3CPAA 4KOVA 1TKHA 1Q2CA 4G1PA 3FRMA 3PBEA 2ZEMA 4OIWA 4R3LA 1S7FA 5G20A 2O53A 3S6KA 1XJOA 3PBBA 1LOKA 1GHEA 2ARHA 4KUBA 1M4IA 4PQAA 1HDQA 4MHDA 4AG7A 1S60A 2CNMA 3B3TA 2Y0MA 1DE4C 1AYEA 1Y0YA 1ZG9A 3BJ7A 1P0HA 3F5BA 2AFWA 4AVAA 4CYOA 2ZW6A 3CPXA 3P2HA 1H8LA 4HNYB 2R8VA 3PB6X 2XEGA 2Z3KA 4H2KA 3BLNA 1IYKA 2Z0ZA 2AFSA 1XF8A 2B5GA 4FAIA 4O23A 3PZJA 2AFXA 4MFKA 4A94A 1CBXA 3R1KA 1QSTA 4WWVA 5JM6A 4BINA 3B8GA 3SJEA 5HVGA 1F2PA 4B10A 3CXQA 4B11A 3DR6A 4MFQA 4Y49C 1CP6A 2HUZA 1YVOA 3JTKA 2YNEA 4KOWA 1U6MA 1V0CA 2FSRA 4UWJA 2Q0YA 4NGQA 4P4FA 4KLVA 4MFPA 2ZEHA 3TTHA 3D7HA 3S6GA 4MHYA 2WYRA 1BOBA 2QVPA 3T90A 1RTQA 3L2NA 2GIVA 3NH8A 3CXSA 1Y9KA 4TNUA 1Z5RA 4XPDC 2IMOA 2IL4A 2ZENA 5GCNA 1A2ZA 3SJGA 2WZNA 3R96A 1Q2YA 3TOAA 4PXDA 4NGMA 5D29A 2ZEPA 3MN8A 5K8OA 5HMNA 1YLEA 2NMTA 2XEIA 4KVOE 4Y49B 2FT0A 1YLOA 1Z2LA 4PPZA 4DNCA 3B3CA 2J8RA 2PVVA 4P4JA 4CAEA 4M3SA 1QQ9A 3KHXA 1Y7EA 5ELYA 1M4DA 4UBRA 2PJ6A 1VHSA 3SI1A 2V8GA 3KZWA 4CGLA 4NGPA 5IB0A 4KSAA 4XPDB 3WC7A 4OKOA 4NF1A 2PE3A 4P4DA 3V38A 2NSMA 4JYWA 1YW6A 5I0CA 1TXRA 2VL1A 4NJRA 4PV6A 3FEDA 4W9YA 3H5ZA 4U9ZA 3FMCA 4X3RA 1S7NA 4UEZA 4UFWA 2YNDA 5BWAB 3QNVA 2F8HA 4PXBA 2PJ2A 2I79A 3DLJA 3MGDA 4YRHA 2ODFA 2ZOGA 2REEA 3TFYA 4C2XA 4ZY1A 3FF3A 2Z10A 2OU2A 2ZEFA 1Z4RA 1P4NA 2EK8A 2WSAA 3PB9X 3FYNA 2EBJA 2BL1A 4OC3A 4RN7A 4A30A 1CPSA 3OWCA 3EO4A 2A4NA 1Z8LA 5JGFA 5K8MA 4J3GA 4NGTA 1Q7LA 2V8HA 2EK9A 2VXKA 1FY7A 2CXAA 2D4OA 2GFQA 4CYNA 2P6FA 2Q04A 2OZHA 2PJ9A 3IU1A 5A28A 1NSAA 3IIBA 2O28A 2ZOFA 2VZZA 2OR4A 2EWBA 2QYVA 5C82A 3GYAA 3P2FA 1SQHA 2Z3MA 4NJQA 3KKWA 4CRYB 1M44A 4A31A 1TF8A 2ZXVA 4MBUA 2R98A 2AFZA 1LAPA 2QJ8A 4B6ZA 3D3SA 1DTDA 1IOFA 4M85A 4OC1A 4E2AA 3ISZA 3I3GA 4C68A 4MHPA 4JLYA 1XEBA 4YFJA 1ZG7A 2QECA 3BHXA 3CDXA 3QAYA 5IB9A 2ANPA 4EWTA 1IOIA 4HPSA 1PCAA 1XMTA 6CPAA 3TE4A 4Z65A 2OB0A 5F47A 2VZYA 2G9DA 4IK2A 1Y9WA 2C6PA 2F5IA 2Q51A 4UEFA 3SXNA 4BBHA 4CGPA 2R1IA 3B3SA 4NCZA 5DS0A 5CBMA 1N71A 2R7HA 2FCKA 2V77A 3QB8A 3GY9A 2PJAA 2FS5A 4E0AA 4B13A 4FBEA 4TWEA 1IY7A 5G1ZA 4Q7AA 5LRJA 2F7VA 3C26A 5JH9A 1YX0A 4FUUA 1WWZA 1YVKA 4LX9A 4MXUA 4OC2A 4AXVA 5THWA 3D66A 4A37A 1QSOA 3VWEA 4CAFA 4CPAA 1GYTA 2PJ4A 1UFHA 2Q4YA 2CY2A 3IEHA 4PXEA 4IAVA 4MCQA 1TIQA 4JXRA 2ZEDA 2AFOA 3S6FA 1ON0A 4KOXA 4F6AA 4KSFA 2P6EA 1Q2DA 4R3KA 4MY0A 4P4IA 2PSWA 2PRBA 2YNCC 2ZW4A 3IO1A 3DGVA 2RB7A 4NXYA 4JD6A 2Q7SA 2JEWA 2G3AA 4NEXA 2GLJA 4B5OA 2B4DA 4RI1A 2Z3PA 5AG4A 1CG2A 2REFA 1VIXA 2RFHA 4KZTA 3PFEA 4P10A 4R7MA 4GXHA 4JWPA 1PYTB 3EC4A 3R9FA 2Z3NA 4PXCA 4KUAA 1UWYA 1VGYA 3K9TA 4OAEA 2GE3A 2XEFA 3GLJA 4LQGA 4Q38A 2B58A 3FECA 3KR4A 3B2YA 4CGOA 2BCOA 4UIBA 3BI0A 3SI2A 2I3CA 3D68A 2QIRA 4U9YA 2Q7BA 2FE7A 1TF9A 3FXTA 4MRIA 4A95A 4CAVA 2PJ1A 1QSRA 4L89A 1YK3A 1MK4A 2HQYA 3KHZA 4MFZA 3S9LA 3B35A 3KGQA 1XBUA 4QB9A 4XPLA 4UIAA 3TO7A 2JLMA 3B3VA 1XFOA 3WR7A 5F09A 3NFZA 3TC8A 4Q36A 5KTAA 4B5PA 1B6BA 2XEJA 4PSWA 1B87A 3BI1A 8CPAA 4X5KA 2BUEA 4CRZB 3NE8A 4EFDA 2HV2A 2CNSA 1R3NA 2PC1A 3DNSA 4MI4A 3T9YA 4LUAA 1KUXA 4H6ZA 5DWMA 3MRUA 1ZLIA 4UFXA 2WPXA 2VQYA 2AFUA 1BO4A 4L8AA 5G21A 3W6SA 2PIZA 2BO9A 5F48A 1YMEA 1ELMP 2B5GB 5D8NA 3H8FA 1IICA 3FX6A 3PGPA 1I1DA 4A2ZA 3HUVA 2C1CA 1X12A 2BEIA 2ZEEA 3IGRA 3RZAA 4EMEA 1Z8WA 2YGWA 3IFEA 4K3NA 5AGEA 3EXNA 3TO9A 4ZGYB 3NH5A 4A39A 3SHPA 3B3WA 4BMHA 3H8GA 4XPKA 3W6XA 1TKFA 3IJ3A 2Z3OA 3N5FA 4KOYA 4KOTA 1S7KA 2PR1A 4MY3A 3H4QA 4OP4A 3PFOA 4CYPA 5LYLA 3PEIA 4FD4A 4MHZA 3VWDA 5JPHA 2CNTA 1ZO0A 3JUWA 1R57A 3HLPA 4I49A 2AE6A 2IJZA 3FH4A 4JZ0A 1FT7A 3I9SA 2G0BA 2DEAA 2GREA 3CXPA 4HKFA 1KZFA 4IF5A 1I12A 4RS2A 3TOBA 4NGSA 4MCPA 1IB1E 2H5MA 2P6GA 4EVYA 1AMPA 2D4PA 2WPWA 3KL9A 1QMUA 3R95A 1Y0RA 1VKCA 1YGHA 3VATA 4JJXA 3T8WA 3VH9A 3SJFA 5HH1A 3BXMA 1RXTA 4U5YA 4P45A 2OZGA 2PVWA 4GS4A 1CM0A 3D7DA 4RUHA 2PJ7A 3ISXA 3IWWA 3NH4A 4QC6A 2ZEGA 5EBVA 4OIDA 2GLFA 2KCWA 4X2TA 5J1QA 1YR0A 4P44A 4R57A 1Y7RA 3NE7A 4UF4A 3QAHA 4DYOA 5HXDA 4MCSA 2ABZA 2RC4A 4IHMA 1X10A 3H8EA 3D8PA 2FL4A 1ARMA 2IQ6A 3B7IA 3F8KA 1PU9A 3GIUA 1Z8TA 2CF4A 4CAWA 4NGRA 2AJ6A 3FJUA 4FD5A 4MCRA 2EUIA 5H86A 4FD7A 3ZZIA 1S5KA 4ZX9A 1CX8A 1IGBA 4R6TA 4P4BA 3G3SA 3IWGA 3SXOA 3K2KA 2JDDA 2VEZA 2Z3LA 1LFWA 1QSNA 1NE9A 3LACA 4F0XA 3G8WA 2CTCA 4F9VA 1XMBA 1YSJA 2CTBA 1ARLA 1AUGA 2DPSA 4NGNA 1WK4A 3PB7X 4UEEA 2FIAA 4GM5A 1OBRA 5E96A 4C7IA 1TKJA 2J8MA 1BPNA 1YQEA 2VI7A 4KS9A 2V8DA 3KR5A 3RO0A 3S6HA 2PQ8A 3I1UA 4QUSA 4AB7A 4C7HA 5G22A 4MMOA 1CPXA 2PJ8A 4UCPA 3VARA 3WC6A 4YU9A 5AG7A 3D2PA 5ISVA 1F57A 3PRTA 4MFJA 1VHOA 2OH1A 4UFVA 1MJAA 5K8NA 3EY5A 2Q4VA 4R8FA 3FIXA 3JVNA 4IUSA 5AG5A 3DR8A 4KORA 4UCNA 2GANA
chains in the Genus database with same CATH topology
2HB6A 3QAYA 2Q7SA 4LQ6A 3CZXA 4M6IA 4M6HA 2ODFA 5EMIA 4RN7A 3NE8A 4EFDA 1XOVA 4M6GA 4BINA 1JWQA 2HC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAY A;  2Q7S A;  4LQ6 A;  3CZX A;  4M6I A;  4M6H A;  2ODF A;  5EMI A;  4RN7 A;  3NE8 A;  1XOV A;  4M6G A;  4BIN A;  1JWQ A; 
#chains in the Genus database with same CATH topology
 4HNW B;  2C6C A;  1J4J A;  1FNO A;  1BLL E;  4ONU A;  1M4G A;  1HDU A;  1BAV A;  2DPT A;  5CNP A;  4NSQ A;  1KWM A;  3LMS A;  2P0W A;  5HVF A;  1XIX A;  4XNH C;  4KVX A;  2NYQ A;  3R9G A;  1I21 A;  1MJB A;  5KTC A;  3DDD A;  2PJC A;  5LYF A;  3WT4 A;  1IID A;  3IWE A;  3IU2 A;  2EO8 A;  4PK3 A;  2PCU A;  2PJB A;  3BJ8 A;  4PSX A;  3EFA A;  4PK2 A;  5HVH A;  4CGM A;  4OLL A;  2HC9 A;  2Q44 A;  4UA3 A;  3DSB A;  1NMT A;  3LOD A;  3V8I A;  3SJX A;  4OC4 A;  1IU8 A;  4KLW A;  3D7F A;  2BOA A;  2FXF A;  3D67 A;  3K9U A;  4KOS A;  4MFL A;  3FEE A;  1LRZ A;  3TO6 A;  2FVG A;  3TCV A;  4F8Z A;  3GKR A;  4WJB A;  4DJL A;  5LRG A;  3RAM A;  4XNH B;  5DWN A;  2PJ5 A;  3JRU A;  3KAS A;  3NA6 A;  2ZEL A;  4ZY0 A;  4AVB A;  4H89 A;  1XOV A;  4OAD A;  1KUV A;  3WC5 A;  3PB4 X;  1Z4E A;  3FB3 A;  1Z9U A;  3E0K A;  4A32 A;  4B14 A;  4CAX A;  1OZP A;  4MHN A;  1QSM A;  4QBJ A;  2V8V A;  1ZG8 A;  3FBU A;  4B12 A;  2PRQ A;  5EMI A;  4ZBG A;  3UY5 A;  4QVT A;  2Q43 A;  3R9E A;  4CYQ A;  5JQ4 A;  5FVJ A;  3V7Z A;  5LRK A;  2OOT A;  2ZW5 A;  2ATR A;  3IC1 A;  4F9U A;  4C2Y A;  3SI0 A;  4E8O A;  2BSW A;  3FNC A;  2C27 A;  5F49 A;  3LD2 A;  4KVM E;  4A33 A;  4LQ6 A;  4UWI A;  4ZY2 A;  4M6H A;  3D4U A;  4K30 A;  3N7Z A;  5J8F A;  3KI9 A;  1LAM A;  4M6G A;  1LCP A;  2B4D B;  2JDC A;  4AVC A;  1Z8X A;  5C88 A;  4CGN A;  1XE4 A;  1ZLH A;  2HB6 A;  2I00 A;  1YRE A;  2PJ0 A;  2VBQ A;  2ZPA A;  2Q4Z A;  2JEV A;  4OC5 A;  3RYO A;  1R43 A;  2ZEO A;  5CPA A;  4ZYQ A;  1HEE A;  5IV0 A;  3S9N A;  3GUX A;  2PIY A;  1CJW A;  2AFM A;  3D7G A;  4KOU A;  3FVL A;  4HNX B;  3TT2 A;  1NSL A;  3KQZ A;  5EC4 A;  5KTD A;  1S7L A;  5LYD A;  5K8P A;  3CZX A;  4FWU A;  2G3T A;  1S3Z A;  1PUA A;  4ZX8 A;  2X7B A;  5F46 A;  2B4B A;  4ONW A;  4A38 A;  2GU2 A;  2DF5 A;  4ORF A;  2B3U A;  2PR8 A;  4F0Y A;  3WAB A;  3RNZ A;  4B5P B;  4H6U A;  4II9 A;  1RO5 A;  2Z11 A;  1F2O A;  1JQG A;  4CS0 B;  2B3V A;  2POK A;  2EVN A;  3CT9 A;  2PDO A;  1BPM A;  3ZJ0 A;  4UCM A;  4OME A;  2ZW7 A;  3D2M A;  2JBK A;  2PJ3 A;  4FD6 A;  4MJ8 A;  4X8I A;  3GB0 A;  5AG6 A;  2J8N A;  1M1D A;  4P6Y A;  2JBJ A;  4ZI6 A;  1YW4 A;  1EE3 P;  3RBU A;  1MJ9 A;  4M6I A;  4P4E A;  1IYL A;  3F0A A;  1KUY A;  5IX3 A;  4OC0 A;  4R76 A;  1JWQ A;  4R9M A;  2DXQ A;  4JXQ A;  4YWY A;  4BD9 A;  1LAN A;  7CPA A;  1L0C A;  2OZU A;  5A27 A;  5I4M A;  2K5T A;  2QML A;  1K4J A;  1VHE A;  3KQX A;  3PB8 X;  4R87 A;  4YGO A;  5H84 A;  1CP7 A;  3W91 A;  1M4L A;  4AG9 A;  2J9A A;  1ELL P;  4NFR A;  3LWU A;  2CIJ A;  4C2Z A;  2C6G A;  3A9L A;  4KSI A;  2FIW A;  2WUU A;  2YNC A;  3PP9 A;  5LYI A;  3TX8 A;  3S9M A;  4DUK A;  2O4H A;  5J8C A;  1XRY A;  3CPA A;  4KOV A;  1TKH A;  1Q2C A;  4G1P A;  3FRM A;  3PBE A;  2ZEM A;  4OIW A;  4R3L A;  1S7F A;  5G20 A;  2O53 A;  3S6K A;  1XJO A;  3PBB A;  1LOK A;  1GHE A;  2ARH A;  4KUB A;  1M4I A;  4PQA A;  1HDQ A;  4MHD A;  4AG7 A;  1S60 A;  2CNM A;  3B3T A;  2Y0M A;  1DE4 C;  1AYE A;  1Y0Y A;  1ZG9 A;  3BJ7 A;  1P0H A;  3F5B A;  2AFW A;  4AVA A;  4CYO A;  2ZW6 A;  3CPX A;  3P2H A;  1H8L A;  4HNY B;  2R8V A;  3PB6 X;  2XEG A;  2Z3K A;  4H2K A;  3BLN A;  1IYK A;  2Z0Z A;  2AFS A;  1XF8 A;  2B5G A;  4FAI A;  4O23 A;  3PZJ A;  2AFX A;  4MFK A;  4A94 A;  1CBX A;  3R1K A;  1QST A;  4WWV A;  5JM6 A;  4BIN A;  3B8G A;  3SJE A;  5HVG A;  1F2P A;  4B10 A;  3CXQ A;  4B11 A;  3DR6 A;  4MFQ A;  4Y49 C;  1CP6 A;  2HUZ A;  1YVO A;  3JTK A;  2YNE A;  4KOW A;  1U6M A;  1V0C A;  2FSR A;  4UWJ A;  2Q0Y A;  4NGQ A;  4P4F A;  4KLV A;  4MFP A;  2ZEH A;  3TTH A;  3D7H A;  3S6G A;  4MHY A;  2WYR A;  1BOB A;  2QVP A;  3T90 A;  1RTQ A;  3L2N A;  2GIV A;  3NH8 A;  3CXS A;  1Y9K A;  4TNU A;  1Z5R A;  4XPD C;  2IMO A;  2IL4 A;  2ZEN A;  5GCN A;  1A2Z A;  3SJG A;  2WZN A;  3R96 A;  1Q2Y A;  3TOA A;  4PXD A;  4NGM A;  5D29 A;  2ZEP A;  3MN8 A;  5K8O A;  5HMN A;  1YLE A;  2NMT A;  2XEI A;  4KVO E;  4Y49 B;  2FT0 A;  1YLO A;  1Z2L A;  4PPZ A;  4DNC A;  3B3C A;  2J8R A;  2PVV A;  4P4J A;  4CAE A;  4M3S A;  1QQ9 A;  3KHX A;  1Y7E A;  5ELY A;  1M4D A;  4UBR A;  2PJ6 A;  1VHS A;  3SI1 A;  2V8G A;  3KZW A;  4CGL A;  4NGP A;  5IB0 A;  4KSA A;  4XPD B;  3WC7 A;  4OKO A;  4NF1 A;  2PE3 A;  4P4D A;  3V38 A;  2NSM A;  4JYW A;  1YW6 A;  5I0C A;  1TXR A;  2VL1 A;  4NJR A;  4PV6 A;  3FED A;  4W9Y A;  3H5Z A;  4U9Z A;  3FMC A;  4X3R A;  1S7N A;  4UEZ A;  4UFW A;  2YND A;  5BWA B;  3QNV A;  2F8H A;  4PXB A;  2PJ2 A;  2I79 A;  3DLJ A;  3MGD A;  4YRH A;  2ODF A;  2ZOG A;  2REE A;  3TFY A;  4C2X A;  4ZY1 A;  3FF3 A;  2Z10 A;  2OU2 A;  2ZEF A;  1Z4R A;  1P4N A;  2EK8 A;  2WSA A;  3PB9 X;  3FYN A;  2EBJ A;  2BL1 A;  4OC3 A;  4RN7 A;  4A30 A;  1CPS A;  3OWC A;  3EO4 A;  2A4N A;  1Z8L A;  5JGF A;  5K8M A;  4J3G A;  4NGT A;  1Q7L A;  2V8H A;  2EK9 A;  2VXK A;  1FY7 A;  2CXA A;  2D4O A;  2GFQ A;  4CYN A;  2P6F A;  2Q04 A;  2OZH A;  2PJ9 A;  3IU1 A;  5A28 A;  1NSA A;  3IIB A;  2O28 A;  2ZOF A;  2VZZ A;  2OR4 A;  2EWB A;  2QYV A;  5C82 A;  3GYA A;  3P2F A;  1SQH A;  2Z3M A;  4NJQ A;  3KKW A;  4CRY B;  1M44 A;  4A31 A;  1TF8 A;  2ZXV A;  4MBU A;  2R98 A;  2AFZ A;  1LAP A;  2QJ8 A;  4B6Z A;  3D3S A;  1DTD A;  1IOF A;  4M85 A;  4OC1 A;  4E2A A;  3ISZ A;  3I3G A;  4C68 A;  4MHP A;  4JLY A;  1XEB A;  4YFJ A;  1ZG7 A;  2QEC A;  3BHX A;  3CDX A;  3QAY A;  5IB9 A;  2ANP A;  4EWT A;  1IOI A;  4HPS A;  1PCA A;  1XMT A;  6CPA A;  3TE4 A;  4Z65 A;  2OB0 A;  5F47 A;  2VZY A;  2G9D A;  4IK2 A;  1Y9W A;  2C6P A;  2F5I A;  2Q51 A;  4UEF A;  3SXN A;  4BBH A;  4CGP A;  2R1I A;  3B3S A;  4NCZ A;  5DS0 A;  5CBM A;  1N71 A;  2R7H A;  2FCK A;  2V77 A;  3QB8 A;  3GY9 A;  2PJA A;  2FS5 A;  4E0A A;  4B13 A;  4FBE A;  4TWE A;  1IY7 A;  5G1Z A;  4Q7A A;  5LRJ A;  2F7V A;  3C26 A;  5JH9 A;  1YX0 A;  4FUU A;  1WWZ A;  1YVK A;  4LX9 A;  4MXU A;  4OC2 A;  4AXV A;  5THW A;  3D66 A;  4A37 A;  1QSO A;  3VWE A;  4CAF A;  4CPA A;  1GYT A;  2PJ4 A;  1UFH A;  2Q4Y A;  2CY2 A;  3IEH A;  4PXE A;  4IAV A;  4MCQ A;  1TIQ A;  4JXR A;  2ZED A;  2AFO A;  3S6F A;  1ON0 A;  4KOX A;  4F6A A;  4KSF A;  2P6E A;  1Q2D A;  4R3K A;  4MY0 A;  4P4I A;  2PSW A;  2PRB A;  2YNC C;  2ZW4 A;  3IO1 A;  3DGV A;  2RB7 A;  4NXY A;  4JD6 A;  2Q7S A;  2JEW A;  2G3A A;  4NEX A;  2GLJ A;  4B5O A;  2B4D A;  4RI1 A;  2Z3P A;  5AG4 A;  1CG2 A;  2REF A;  1VIX A;  2RFH A;  4KZT A;  3PFE A;  4P10 A;  4R7M A;  4GXH A;  4JWP A;  1PYT B;  3EC4 A;  3R9F A;  2Z3N A;  4PXC A;  4KUA A;  1UWY A;  1VGY A;  3K9T A;  4OAE A;  2GE3 A;  2XEF A;  3GLJ A;  4LQG A;  4Q38 A;  2B58 A;  3FEC A;  3KR4 A;  3B2Y A;  4CGO A;  2BCO A;  4UIB A;  3BI0 A;  3SI2 A;  2I3C A;  3D68 A;  2QIR A;  4U9Y A;  2Q7B A;  2FE7 A;  1TF9 A;  3FXT A;  4MRI A;  4A95 A;  4CAV A;  2PJ1 A;  1QSR A;  4L89 A;  1YK3 A;  1MK4 A;  2HQY A;  3KHZ A;  4MFZ A;  3S9L A;  3B35 A;  3KGQ A;  1XBU A;  4QB9 A;  4XPL A;  4UIA A;  3TO7 A;  2JLM A;  3B3V A;  1XFO A;  3WR7 A;  5F09 A;  3NFZ A;  3TC8 A;  4Q36 A;  5KTA A;  4B5P A;  1B6B A;  2XEJ A;  4PSW A;  1B87 A;  3BI1 A;  8CPA A;  4X5K A;  2BUE A;  4CRZ B;  3NE8 A;  4EFD A;  2HV2 A;  2CNS A;  1R3N A;  2PC1 A;  3DNS A;  4MI4 A;  3T9Y A;  4LUA A;  1KUX A;  4H6Z A;  5DWM A;  3MRU A;  1ZLI A;  4UFX A;  2WPX A;  2VQY A;  2AFU A;  1BO4 A;  4L8A A;  5G21 A;  3W6S A;  2PIZ A;  2BO9 A;  5F48 A;  1YME A;  1ELM P;  2B5G B;  5D8N A;  3H8F A;  1IIC A;  3FX6 A;  3PGP A;  1I1D A;  4A2Z A;  3HUV A;  2C1C A;  1X12 A;  2BEI A;  2ZEE A;  3IGR A;  3RZA A;  4EME A;  1Z8W A;  2YGW A;  3IFE A;  4K3N A;  5AGE A;  3EXN A;  3TO9 A;  4ZGY B;  3NH5 A;  4A39 A;  3SHP A;  3B3W A;  4BMH A;  3H8G A;  4XPK A;  3W6X A;  1TKF A;  3IJ3 A;  2Z3O A;  3N5F A;  4KOY A;  4KOT A;  1S7K A;  2PR1 A;  4MY3 A;  3H4Q A;  4OP4 A;  3PFO A;  4CYP A;  5LYL A;  3PEI A;  4FD4 A;  4MHZ A;  3VWD A;  5JPH A;  2CNT A;  1ZO0 A;  3JUW A;  1R57 A;  3HLP A;  4I49 A;  2AE6 A;  2IJZ A;  3FH4 A;  4JZ0 A;  1FT7 A;  3I9S A;  2G0B A;  2DEA A;  2GRE A;  3CXP A;  4HKF A;  1KZF A;  4IF5 A;  1I12 A;  4RS2 A;  3TOB A;  4NGS A;  4MCP A;  1IB1 E;  2H5M A;  2P6G A;  4EVY A;  1AMP A;  2D4P A;  2WPW A;  3KL9 A;  1QMU A;  3R95 A;  1Y0R A;  1VKC A;  1YGH A;  3VAT A;  4JJX A;  3T8W A;  3VH9 A;  3SJF A;  5HH1 A;  3BXM A;  1RXT A;  4U5Y A;  4P45 A;  2OZG A;  2PVW A;  4GS4 A;  1CM0 A;  3D7D A;  4RUH A;  2PJ7 A;  3ISX A;  3IWW A;  3NH4 A;  4QC6 A;  2ZEG A;  5EBV A;  4OID A;  2GLF A;  2KCW A;  4X2T A;  5J1Q A;  1YR0 A;  4P44 A;  4R57 A;  1Y7R A;  3NE7 A;  4UF4 A;  3QAH A;  4DYO A;  5HXD A;  4MCS A;  2ABZ A;  2RC4 A;  4IHM A;  1X10 A;  3H8E A;  3D8P A;  2FL4 A;  1ARM A;  2IQ6 A;  3B7I A;  3F8K A;  1PU9 A;  3GIU A;  1Z8T A;  2CF4 A;  4CAW A;  4NGR A;  2AJ6 A;  3FJU A;  4FD5 A;  4MCR A;  2EUI A;  5H86 A;  4FD7 A;  3ZZI A;  1S5K A;  4ZX9 A;  1CX8 A;  1IGB A;  4R6T A;  4P4B A;  3G3S A;  3IWG A;  3SXO A;  3K2K A;  2JDD A;  2VEZ A;  2Z3L A;  1LFW A;  1QSN A;  1NE9 A;  3LAC A;  4F0X A;  3G8W A;  2CTC A;  4F9V A;  1XMB A;  1YSJ A;  2CTB A;  1ARL A;  1AUG A;  2DPS A;  4NGN A;  1WK4 A;  3PB7 X;  4UEE A;  2FIA A;  4GM5 A;  1OBR A;  5E96 A;  4C7I A;  1TKJ A;  2J8M A;  1BPN A;  1YQE A;  2VI7 A;  4KS9 A;  2V8D A;  3KR5 A;  3RO0 A;  3S6H A;  2PQ8 A;  3I1U A;  4QUS A;  4AB7 A;  4C7H A;  5G22 A;  4MMO A;  1CPX A;  2PJ8 A;  4UCP A;  3VAR A;  3WC6 A;  4YU9 A;  5AG7 A;  3D2P A;  5ISV A;  1F57 A;  3PRT A;  4MFJ A;  1VHO A;  2OH1 A;  4UFV A;  1MJA A;  5K8N A;  3EY5 A;  2Q4V A;  4R8F A;  3FIX A;  3JVN A;  4IUS A;  5AG5 A;  3DR8 A;  4KOR A;  4UCN A;  2GAN A; 
#chains in the Genus database with same CATH homology
 2HB6 A;  3QAY A;  2Q7S A;  4LQ6 A;  3CZX A;  4M6I A;  4M6H A;  2ODF A;  5EMI A;  4RN7 A;  3NE8 A;  4EFD A;  1XOV A;  4M6G A;  4BIN A;  1JWQ A;  2HC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...