2ANPA

Functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAHEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords leucyl aminopeptidase
publication title Kinetic, Spectroscopic, and X-ray Crystallographic Characterization of the Functional E151H Aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2anpA00
3IIBA 4H2KA 3FEEA 1AYEA 2DEAA 2JBKA 4MHNA 2PE3A 1XBUA 3D66A 2WZNA 3BHXA 3KZWA 5K8MA 2PJ8A 2AFZA 1CX8A 5THWA 1R3NA 1ELMP 4P4FA 1TKFA 5JM6A 4B6ZA 5CPAA 3NH4A 1NSAA 3GLJA 4BD9A 1PCAA 2C6PA 2RFHA 3FEDA 2ZEOA 4UEEA 1AMPA 2C6CA 3RBUA 2PVWA 4ONWA 4KSIA 4OC0A 1Y0YA 3KGQA 1F2OA 3PB6X 2BCOA 4FUUA 4OC4A 1PYTB 3JRUA 2JBJA 1RTQA 5I4MA 2ANPA 1TF8A 2ZENA 3H8EA 4R76A 3WT4A 2PJCA 3K9TA 1TKHA 2G9DA 2ZOFA 8CPAA 5LRJA 4PXDA 4MCQA 4WWVA 2EK9A 2ZEPA 4X8IA 4MRIA 4LQGA 3I1UA 3PRTA 3TC8A 1IY7A 2V77A 3N5FA 5HVFA 2O4HA 4NGRA 3CPXA 4A94A 1LOKA 1ELLP 3SI2A 1H8LA 2EK8A 1F2PA 2ZEHA 4P10A 2Q43A 3MRUA 1ZG8A 2ZEEA 3WABA 1LCPA 5ELYA 4W9YA 3PB8X 1LFWA 4NGTA 3MN8A 2PCUA 2Q51A 1OBRA 4IK2A 1ARLA 2I3CA 3LMSA 5LYIA 3D67A 4FWUA 1LAPA 2ZOGA 4F8ZA 2HC9A 2NYQA 3PFEA 1M4LA 1FT7A 2BO9A 3BI1A 5LYLA 2PJ7A 2AFMA 1YMEA 4ZYQA 4MCSA 4UIAA 3B3TA 3CDXA 3B7IA 3FJUA 2PRQA 3NA6A 1TXRA 3KL9A 4PQAA 5K8NA 4O23A 2OR4A 3RAMA 3FH4A 3KHZA 5F09A 2C6GA 1BAVA 4ZY2A 2F8HA 2V8GA 4R8FA 4Z65A 7CPAA 4RUHA 1YW6A 4ZY0A 2VL1A 4OIWA 3BXMA 1R43A 3IWWA 4PXCA 4PXEA 4K3NA 3VARA 3FF3A 4IAVA 2XEIA 3LWUA 4MCPA 5LYFA 4Q7AA 1QQ9A 5D8NA 1ZG9A 1ZLHA 3S9NA 2PIYA 4MCRA 1XMBA 3PB9X 1VIXA 2IJZA 3FECA 1CP7A 3IO1A 1LAMA 4MMOA 3KR5A 3BI0A 3KQZA 3D7DA 4DJLA 3TX8A 1VHEA 3GB0A 2O53A 2V8DA 3D7FA 3D4UA 5LYDA 2QVPA 1EE3P 3QNVA 3HUVA 2IQ6A 3SI1A 1VGYA 3T8WA 3FX6A 3IEHA 4OC2A 4NGQA 3WC6A 4CPAA 4DYOA 4OP4A 4TWEA 1YSJA 2JEWA 3D7GA 4UEZA 2CTBA 2QYVA 1DE4C 1FNOA 2GU2A 2NSMA 3V7ZA 4UEFA 1ZLIA 4FBEA 4ZX8A 1CPSA 1DTDA 4TNUA 5JH9A 1TKJA 4UIBA 4UF4A 4P45A 4MHYA 4EFDA 4G1PA 2PVVA 2ZELA 3HLPA 4MHZA 2GLJA 3PB7X 2PJ3A 4OC5A 3B3WA 3KI9A 2AFXA 4F9VA 3WC7A 2PJAA 3KASA 5J1QA 2PIZA 5HVGA 3PBBA 2V8VA 5LRGA 2CF4A 3NFZA 4JYWA 1LANA 3B2YA 2AFUA 4ZY1A 2AFWA 4A38A 2PJ2A 3VATA 4A37A 3CPAA 2PJ0A 5CBMA 4P4EA 4PPZA 1BLLE 5IB9A 4OC1A 4PXBA 3SJEA 4IHMA 3D7HA 4ZX9A 3KR4A 1YW4A 3WC5A 2ZEGA 2OOTA 4P44A 1CPXA 4NGNA 1CG2A 4R6TA 3SJXA 3ISZA 1HDUA 1BPMA 4NGPA 2CTCA 3PFOA 4GM5A 4P4DA 2XEFA 2ABZA 3CT9A 3FMCA 4F9UA 4NFRA 2F7VA 4OKOA 3D68A 1UWYA 5JGFA 1CBXA 3B3SA 4EWTA 2J9AA 3RZAA 2C1CA 4JZ0A 4YWYA 2PJ1A 2Q4ZA 3H8GA 1JQGA 3B3VA 4P6YA 1VHOA 2FVGA 2AFOA 4R7MA 3IJ3A 4AXVA 4MHPA 4P4BA 4X2TA 5LRKA 1ARMA 1GYTA 2AFSA 4A39A 3VH9A 2GLFA 2PJ6A 2PJ4A 3DGVA 4EMEA 1TF9A 3ISXA 4WJBA 2PJ9A 3DLJA 2ZEMA 1HEEA 1XFOA 4MXUA 3SI0A 4FAIA 3L2NA 3KQXA 2WYRA 4NGMA 4NJRA 2ZEDA 1QMUA 3PB4X 3H8FA 2PJBA 2GREA 3PEIA 4OC3A 1HDQA 2IMOA 3SJGA 2POKA 2V8HA 3S9MA 3FVLA 4P4IA 2XEGA 5DS0A 5D29A 4X3RA 1XRYA 2HB6A 3S9LA 2BOAA 3IC1A 4YU9A 4ZI6A 1Z5RA 1Z8LA 3NH8A 1F57A 1KWMA 5K8PA 4NJQA 2CIJA 3IFEA 4OIDA 3V38A 1ZG7A 4P4JA 3K2KA 5K8OA 4DUKA 1IGBA 1CP6A 3B35A 6CPAA 5HXDA 1Q7LA 1XJOA 5HVHA 1Y7EA 1Y0RA 4OMEA 2ZEFA 1Z2LA 3NH5A 3SJFA 3GUXA 3PBEA 2EWBA 3KHXA 3B3CA 1YLOA 4NGSA 2XEJA 2RB7A 2PJ5A 1BPNA 2QJ8A
chains in the Genus database with same CATH superfamily
3IIBA 2X7BA 2OZUA 3TFYA 5I0CA 4CAEA 3ZJ0A 4KSAA 4H2KA 3FEEA 1AYEA 2DEAA 3EXNA 1J4JA 2JBKA 2HUZA 2Q4VA 1PU9A 4AG9A 4MHNA 4CAVA 4MY3A 1NSLA 2Z3MA 2PE3A 1XBUA 3D66A 2WZNA 4NXYA 2FL4A 3GY9A 3RYOA 4C7IA 3BHXA 4B12A 3KZWA 3GIUA 4JWPA 2PJ8A 2DXQA 5K8MA 2AFZA 1CX8A 4E0AA 3T9YA 5THWA 1R3NA 4R57A 3P2HA 1ELMP 4KOXA 4QB9A 3IGRA 2BUEA 4P4FA 1Z8XA 4ZGYB 1TKFA 5JM6A 4B6ZA 2ATRA 5AG7A 5CPAA 3NH4A 1NSAA 3GLJA 1BOBA 1VKCA 2ODFA 4JXRA 4BD9A 1IOIA 1PCAA 2C6PA 3W6XA 2RFHA 2PQ8A 1CM0A 2ZEOA 1AMPA 3FEDA 4UEEA 2C6CA 3RBUA 4KLWA 2PVWA 4ONWA 4KSIA 4OC0A 1Y0YA 2P0WA 3KGQA 3UY5A 1F2OA 3WR7A 5J8CA 1GHEA 3RO0A 2Q44A 4LX9A 3SHPA 4CAWA 3PB6X 2BCOA 2PR8A 2WPWA 4FUUA 1PUAA 3DR8A 2OU2A 2VBQA 4OC4A 4PV6A 1PYTB 3JRUA 4UCPA 2JBJA 4HPSA 4UCNA 2EVNA 5HMNA 1QSTA 1RTQA 2JDDA 1YQEA 3PZJA 5I4MA 2VEZA 2FSRA 2ANPA 1TF8A 2ZENA 3H8EA 4B14A 5GCNA 4R76A 3WT4A 2HV2A 4FD6A 2R1IA 4ZBGA 3S6GA 2PJCA 3K9TA 1TKHA 2G9DA 2ZOFA 8CPAA 4OLLA 5LRJA 3VWEA 4PXDA 4MCQA 2D4OA 5KTAA 4B11A 4WWVA 2EK9A 2Q7SA 3SXNA 4C2ZA 1I21A 1IICA 4X5KA 2O28A 2ZEPA 4X8IA 4MRIA 2A4NA 4F6AA 4LQGA 2CNTA 2GE3A 2J8RA 2NMTA 4MFLA 3I1UA 1VHSA 2VZZA 3PRTA 1IY7A 1M4DA 3TC8A 2V77A 3N5FA 4KOTA 4HNWB 2JLMA 4KSFA 3GYAA 4UFVA 3NE8A 4A31A 5HVFA 2O4HA 5H86A 2CY2A 4NGRA 3CPXA 3S6FA 4A94A 1Q2YA 1YLEA 4ONUA 1LOKA 1TIQA 1ELLP 3SI2A 1KUVA 5A28A 1H8LA 4I49A 2EK8A 3EC4A 1F2PA 2ZEHA 4P10A 4CGLA 2Z11A 2Q43A 3MRUA 1I1DA 3GKRA 1Z4EA 1JWQA 1ZG8A 2ZEEA 2VI7A 3WABA 1LCPA 5ELYA 4U9YA 2KCWA 4YFJA 4II9A 4W9YA 3PB8X 1X10A 4U5YA 2J8NA 5J8FA 1LFWA 4LQ6A 4NGTA 5H84A 1M4GA 2EUIA 3W6SA 2QIRA 3MN8A 1QSMA 2PCUA 2Q51A 3CXPA 1S7NA 3JVNA 4MFJA 1OBRA 1IU8A 4IK2A 3R9EA 1ARLA 2I3CA 3LMSA 5LYIA 4F0YA 1IOFA 3D67A 1Z8TA 4FWUA 2B58A 3V8IA 5KTCA 1LAPA 2ZXVA 3R1KA 4M6HA 4MFPA 1Y9WA 1ON0A 2R98A 2ZOGA 2J8MA 4F8ZA 2HC9A 2NYQA 1XMTA 3PFEA 4JLYA 3E0KA 1M4LA 3T90A 1FT7A 3CXSA 2BO9A 3BI1A 5F48A 4AB7A 2PJ7A 2AFMA 5LYLA 4GS4A 1YMEA 4ZYQA 4MCSA 4UIAA 3B3TA 4E2AA 4Y49C 3CDXA 3B7IA 3TO6A 4KS9A 2DPSA 1M1DA 3FJUA 1S7FA 2PRQA 5FVJA 4YRHA 3NA6A 1M4IA 2P6EA 3DSBA 3IWGA 1TXRA 3KL9A 3PGPA 4PQAA 3LACA 4K30A 2PC1A 4IF5A 5K8NA 4O23A 2OR4A 1YR0A 5EC4A 4MFQA 3FH4A 3RAMA 4CGNA 1S3ZA 3KHZA 2C6GA 1BAVA 5F09A 4ZY2A 2F8HA 2V8GA 4R8FA 5C88A 4Z65A 7CPAA 3DDDA 4RUHA 1YW6A 4ZY0A 2GANA 2VL1A 4OIWA 2FIWA 1K4JA 3BXMA 5ISVA 1R43A 4OADA 2OZGA 1RXTA 1MK4A 2H5MA 2G3AA 3IWWA 4PXCA 4PXEA 4BINA 1YX0A 4K3NA 2Y0MA 5DWMA 2Q7BA 3VARA 3FF3A 2QECA 4IAVA 1XOVA 2XEIA 3LWUA 3VWDA 2VXKA 2PDOA 2YNDA 2PRBA 4MCPA 4NF1A 1XE4A 2JEVA 5LYFA 4QUSA 4Q7AA 2ZW5A 2OH1A 5IV0A 1QQ9A 2CNSA 1IIDA 4UEZA 4B13A 4C2YA 5D8NA 4CAFA 1NMTA 4BBHA 1L0CA 1ZG9A 1P4NA 1ZLHA 4OAEA 3R95A 3SXOA 2PSWA 3TO9A 5HH1A 3S9NA 2PIYA 2G0BA 2Z10A 2EO8A 4NSQA 4MCRA 3S6HA 1XMBA 2FIAA 1VIXA 3PB9X 4Y49B 5EMIA 2IJZA 4QBJA 3FECA 1CP7A 2D4PA 3IO1A 4B5PA 1OZPA 2PR1A 3R9FA 1LAMA 4MY0A 4MMOA 3KR5A 3BI0A 3LODA 2CNMA 3FB3A 3KQZA 3BJ7A 3D7DA 4DJLA 4DNCA 4CYNA 5BWAB 3TX8A 1YGHA 4HNXB 4U9ZA 1VHEA 4R3LA 3GB0A 4NCZA 4BMHA 2O53A 2B3VA 2V8DA 2B4DA 1YVOA 4A2ZA 3IU1A 3D7FA 3D4UA 3DNSA 4FD7A 2REEA 5G1ZA 1I12A 5LYDA 4CAXA 2AE6A 2QVPA 1EE3P 3QNVA 3HUVA 3FNCA 2IQ6A 2AJ6A 3CXQA 3D2PA 3ZZIA 2R8VA 1VGYA 3SI1A 1IYKA 1XEBA 3T8WA 3FX6A 2Z3PA 3IEHA 4NGQA 4OC2A 3WC6A 4CPAA 4CYPA 2DF5A 4DYOA 4OP4A 4TWEA 3EY5A 1YSJA 4AG7A 2JEWA 3D7GA 4Q38A 2CTBA 2QYVA 1DE4C 1V0CA 1FNOA 4RI1A 2GU2A 2DPTA 4AVAA 3LD2A 2NSMA 2B3UA 3FYNA 5C82A 3V7ZA 4UEFA 1ZLIA 4FBEA 4ZX8A 1CPSA 4KUBA 1DTDA 2R7HA 1B87A 2ARHA 1Z9UA 3FRMA 4TNUA 5JH9A 4B5PB 5G22A 3JUWA 1TKJA 3I3GA 4UIBA 1Y9KA 4UF4A 4P45A 2Z3NA 2FT0A 4MHYA 5EBVA 4G1PA 2B4BA 4EFDA 2PVVA 3FBUA 2EBJA 2BSWA 4A32A 2OZHA 2ZELA 3HLPA 4HKFA 4KORA 4B5OA 4MHZA 5G21A 3G3SA 4EVYA 3TT2A 2GLJA 3PB7X 2PJ3A 4OC5A 1Q2CA 1YK3A 2RC4A 2WUUA 2AFXA 3B3WA 3C26A 3KI9A 4PK3A 4XNHC 3WC7A 5AG6A 2PJAA 3KASA 4AVCA 4F9VA 5J1QA 2PIZA 5HVGA 4JJXA 1MJBA 4KVME 3PBBA 1X12A 4A30A 4B10A 4XPKA 2V8VA 1IYLA 4J3GA 4UWIA 5LRGA 2CF4A 3NFZA 4JYWA 4MFZA 3TO7A 4CGOA 4R3KA 1WWZA 2Q0YA 1LANA 3B2YA 1R57A 3F0AA 3QB8A 2AFUA 4ZY1A 4MI4A 2AFWA 1M44A 5JQ4A 4A38A 2PJ2A 3TOAA 3TOBA 1A2ZA 3VATA 3KKWA 1P0HA 2FE7A 4GXHA 5CNPA 4A37A 3CPAA 2Z3KA 4CRYB 1ZO0A 2PJ0A 1QSNA 3D2MA 4PSWA 5CBMA 3BJ8A 4PPZA 4P4EA 3H4QA 1BLLE 1Z4RA 3MGDA 4IUSA 3NE7A 5IB9A 4ORFA 4OC1A 4PXBA 2OB0A 4MBUA 3SJEA 4KLVA 4IHMA 3D7HA 4ZX9A 1KZFA 5F49A 3KR4A 5KTDA 2FS5A 4R87A 1LRZA 1S60A 1YW4A 3R96A 3WC5A 2ZEGA 1KUYA 2OOTA 4P44A 1CPXA 4M3SA 2GIVA 1XIXA 4NGNA 5AG5A 1CG2A 4KOVA 2K5TA 3F8KA 4R6TA 3SJXA 3ISZA 4UCMA 1HDUA 1BPMA 4NGPA 2JDCA 2CTCA 5IB0A 3PFOA 3D3SA 4GM5A 3D8PA 4C2XA 2Q04A 2BEIA 4P4DA 4KOSA 2I79A 4PK2A 4XNHB 2XEFA 5AGEA 1RO5A 4QVTA 1MJ9A 2ABZA 3CT9A 1FY7A 3FMCA 3S6KA 4F9UA 4NFRA 2F7VA 4A33A 3IWEA 4OKOA 1KUXA 4UBRA 3D68A 1UWYA 5JGFA 4PSXA 4A95A 2FCKA 4AVBA 2ZW4A 4UFWA 1CBXA 3B3SA 4EWTA 4KOYA 2J9AA 3RZAA 2C1CA 2I00A 4JZ0A 4R9MA 2FXFA 2PJ1A 2Q4ZA 4KOUA 4YWYA 2WSAA 3H8GA 1JQGA 3TTHA 2HQYA 4E8OA 2QMLA 2YNEA 1BO4A 3B3VA 3QAHA 4UA3A 4P6YA 5DWNA 1VHOA 1S7KA 2FVGA 2ZW6A 2AFOA 3OWCA 4QC6A 4YGOA 2F5IA 4M6GA 2YGWA 4R7MA 1YVKA 3IJ3A 4AXVA 4MHPA 4HNYB 4P4BA 1Q2DA 3A9LA 4X2TA 5LRKA 1ARMA 1GYTA 1AUGA 4CGMA 4NEXA 2AFSA 4A39A 4JXQA 3VH9A 2GLFA 2PJ6A 2PJ4A 4C7HA 3DGVA 3TCVA 2G3TA 4CGPA 2Q4YA 2YNCC 4EMEA 1S7LA 1NE9A 1TF9A 3ISXA 4WJBA 2YNCA 1SQHA 2PJ9A 3K9UA 3DLJA 4CS0B 2ZEMA 2WPXA 1HEEA 1XFOA 5F47A 4KOWA 3SJFA 4MXUA 3SI0A 4FAIA 4Q36A 4CRZB 3F5BA 3L2NA 3PP9A 3KQXA 1IB1E 2CXAA 2VQYA 2WYRA 4MJ8A 3H5ZA 1MJAA 1UFHA 4RN7A 1WK4A 3JTKA 4XPDC 4UWJA 1B6BA 2Z3LA 2VZYA 4NGMA 3P2FA 4L89A 1QSRA 2C27A 4LUAA 4NJRA 1Z8WA 2ZEDA 3B8GA 1QMUA 1Y7RA 4MFKA 2B5GA 2Z3OA 3PB4X 3DR6A 3H8FA 2PJBA 1YREA 2GREA 2P6FA 3PEIA 5E96A 1CJWA 4OC3A 1HDQA 2IMOA 2ZW7A 5AG4A 1XF8A 3IU2A 3SJGA 3FXTA 2POKA 2V8HA 3S9MA 3FVLA 4P4IA 4MHDA 4FD5A 2XEGA 3QAYA 5DS0A 5F46A 2B4DB 5D29A 3I9SA 1XRYA 2HB6A 4X3RA 3R9GA 3S9LA 2BOAA 3IC1A 2GFQA 3BLNA 4YU9A 4ZI6A 5IX3A 1Z5RA 1Z8LA 2Z0ZA 1F57A 3NH8A 4KZTA 1KWMA 3W91A 4L8AA 5K8PA 4NJQA 2P6GA 3TE4A 2CIJA 3IFEA 4OIDA 3EO4A 4XPLA 4KVOE 3V38A 5JPHA 2REFA 1ZG7A 4M6IA 3K2KA 4P4JA 4CYQA 4F0XA 5K8OA 4DUKA 4KVXA 1N71A 3G8WA 1IGBA 1CP6A 3B35A 4M85A 3RNZA 6CPAA 5HXDA 1Q7LA 1XJOA 5HVHA 1U6MA 1Y7EA 1Y0RA 4JD6A 4OMEA 5A27A 2ZEFA 1Z2LA 2ZPAA 3NH5A 3GUXA 1QSOA 3PBEA 4FD4A 4H6UA 4UFXA 4XPDB 2EWBA 3FIXA 3KHXA 3EFAA 3B3CA 4H89A 1YLOA 4NGSA 5G20A 2BL1A 4H6ZA 4KUAA 2XEJA 3N7ZA 4C68A 2RB7A 2PJ5A 4RS2A 1S5KA 4CYOA 1BPNA 2QJ8A 2B5GB 2IL4A 3CZXA
chains in the Genus database with same CATH topology
3IIBA 4H2KA 3FEEA 1AYEA 2DEAA 2JBKA 4MHNA 2PE3A 1XBUA 3D66A 2WZNA 3BHXA 3KZWA 5K8MA 2PJ8A 2AFZA 1CX8A 5THWA 1R3NA 1ELMP 4P4FA 1TKFA 5JM6A 4B6ZA 5CPAA 3NH4A 1NSAA 3GLJA 4BD9A 1PCAA 2C6PA 2RFHA 3FEDA 2ZEOA 4UEEA 1AMPA 2C6CA 3RBUA 2PVWA 4ONWA 4KSIA 4OC0A 1Y0YA 3KGQA 1F2OA 3PB6X 2BCOA 4FUUA 4OC4A 1PYTB 3JRUA 2JBJA 1RTQA 5I4MA 2ANPA 1TF8A 2ZENA 3H8EA 4R76A 3WT4A 2PJCA 3K9TA 1TKHA 2G9DA 2ZOFA 8CPAA 5LRJA 4PXDA 4MCQA 4WWVA 2EK9A 2ZEPA 4X8IA 4MRIA 4LQGA 3I1UA 3PRTA 3TC8A 1IY7A 2V77A 3N5FA 5HVFA 2O4HA 4NGRA 3CPXA 4A94A 1LOKA 1ELLP 3SI2A 1H8LA 2EK8A 1F2PA 2ZEHA 4P10A 2Q43A 3MRUA 1ZG8A 2ZEEA 3WABA 1LCPA 5ELYA 4W9YA 3PB8X 1LFWA 4NGTA 3MN8A 2PCUA 2Q51A 1OBRA 4IK2A 1ARLA 2I3CA 3LMSA 5LYIA 3D67A 4FWUA 1LAPA 2ZOGA 4F8ZA 2HC9A 2NYQA 3PFEA 1M4LA 1FT7A 2BO9A 3BI1A 5LYLA 2PJ7A 2AFMA 1YMEA 4ZYQA 4MCSA 4UIAA 3B3TA 3CDXA 3B7IA 3FJUA 2PRQA 3NA6A 1TXRA 3KL9A 4PQAA 5K8NA 4O23A 2OR4A 3RAMA 3FH4A 3KHZA 5F09A 2C6GA 1BAVA 4ZY2A 2F8HA 2V8GA 4R8FA 4Z65A 7CPAA 4RUHA 1YW6A 4ZY0A 2VL1A 4OIWA 3BXMA 1R43A 3IWWA 4PXCA 4PXEA 4K3NA 3VARA 3FF3A 4IAVA 2XEIA 3LWUA 4MCPA 5LYFA 4Q7AA 1QQ9A 5D8NA 1ZG9A 1ZLHA 3S9NA 2PIYA 4MCRA 1XMBA 3PB9X 1VIXA 2IJZA 3FECA 1CP7A 3IO1A 1LAMA 4MMOA 3KR5A 3BI0A 3KQZA 3D7DA 4DJLA 3TX8A 1VHEA 3GB0A 2O53A 2V8DA 3D7FA 3D4UA 5LYDA 2QVPA 1EE3P 3QNVA 3HUVA 2IQ6A 3SI1A 1VGYA 3T8WA 3FX6A 3IEHA 4OC2A 4NGQA 3WC6A 4CPAA 4DYOA 4OP4A 4TWEA 1YSJA 2JEWA 3D7GA 4UEZA 2CTBA 2QYVA 1DE4C 1FNOA 2GU2A 2NSMA 3V7ZA 4UEFA 1ZLIA 4FBEA 4ZX8A 1CPSA 1DTDA 4TNUA 5JH9A 1TKJA 4UIBA 4UF4A 4P45A 4MHYA 4EFDA 4G1PA 2PVVA 2ZELA 3HLPA 4MHZA 2GLJA 3PB7X 2PJ3A 4OC5A 3B3WA 3KI9A 2AFXA 4F9VA 3WC7A 2PJAA 3KASA 5J1QA 2PIZA 5HVGA 3PBBA 2V8VA 5LRGA 2CF4A 3NFZA 4JYWA 1LANA 3B2YA 2AFUA 4ZY1A 2AFWA 4A38A 2PJ2A 3VATA 4A37A 3CPAA 2PJ0A 5CBMA 4P4EA 4PPZA 1BLLE 5IB9A 4OC1A 4PXBA 3SJEA 4IHMA 3D7HA 4ZX9A 3KR4A 1YW4A 3WC5A 2ZEGA 2OOTA 4P44A 1CPXA 4NGNA 1CG2A 4R6TA 3SJXA 3ISZA 1HDUA 1BPMA 4NGPA 2CTCA 3PFOA 4GM5A 4P4DA 2XEFA 2ABZA 3CT9A 3FMCA 4F9UA 4NFRA 2F7VA 4OKOA 3D68A 1UWYA 5JGFA 1CBXA 3B3SA 4EWTA 2J9AA 3RZAA 2C1CA 4JZ0A 4YWYA 2PJ1A 2Q4ZA 3H8GA 1JQGA 3B3VA 4P6YA 1VHOA 2FVGA 2AFOA 4R7MA 3IJ3A 4AXVA 4MHPA 4P4BA 4X2TA 5LRKA 1ARMA 1GYTA 2AFSA 4A39A 3VH9A 2GLFA 2PJ6A 2PJ4A 3DGVA 4EMEA 1TF9A 3ISXA 4WJBA 2PJ9A 3DLJA 2ZEMA 1HEEA 1XFOA 4MXUA 3SI0A 4FAIA 3L2NA 3KQXA 2WYRA 4NGMA 4NJRA 2ZEDA 1QMUA 3PB4X 3H8FA 2PJBA 2GREA 3PEIA 4OC3A 1HDQA 2IMOA 3SJGA 2POKA 2V8HA 3S9MA 3FVLA 4P4IA 2XEGA 5DS0A 5D29A 4X3RA 1XRYA 2HB6A 3S9LA 2BOAA 3IC1A 4YU9A 4ZI6A 1Z5RA 1Z8LA 3NH8A 1F57A 1KWMA 5K8PA 4NJQA 2CIJA 3IFEA 4OIDA 3V38A 1ZG7A 4P4JA 3K2KA 5K8OA 4DUKA 1IGBA 1CP6A 3B35A 6CPAA 5HXDA 1Q7LA 1XJOA 5HVHA 1Y7EA 1Y0RA 4OMEA 2ZEFA 1Z2LA 3NH5A 3SJFA 3GUXA 3PBEA 2EWBA 3KHXA 3B3CA 1YLOA 4NGSA 2XEJA 2RB7A 2PJ5A 1BPNA 2QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIB A;  4H2K A;  3FEE A;  1AYE A;  2DEA A;  2JBK A;  4MHN A;  2PE3 A;  1XBU A;  3D66 A;  2WZN A;  3BHX A;  3KZW A;  5K8M A;  2PJ8 A;  2AFZ A;  1CX8 A;  5THW A;  1R3N A;  1ELM P;  4P4F A;  1TKF A;  5JM6 A;  4B6Z A;  5CPA A;  3NH4 A;  1NSA A;  3GLJ A;  4BD9 A;  1PCA A;  2C6P A;  2RFH A;  3FED A;  2ZEO A;  4UEE A;  1AMP A;  2C6C A;  3RBU A;  2PVW A;  4ONW A;  4KSI A;  4OC0 A;  1Y0Y A;  3KGQ A;  1F2O A;  3PB6 X;  2BCO A;  4FUU A;  4OC4 A;  1PYT B;  3JRU A;  2JBJ A;  1RTQ A;  5I4M A;  2ANP A;  1TF8 A;  2ZEN A;  3H8E A;  4R76 A;  3WT4 A;  2PJC A;  3K9T A;  1TKH A;  2G9D A;  2ZOF A;  8CPA A;  5LRJ A;  4PXD A;  4MCQ A;  4WWV A;  2EK9 A;  2ZEP A;  4X8I A;  4MRI A;  4LQG A;  3I1U A;  3PRT A;  3TC8 A;  1IY7 A;  2V77 A;  3N5F A;  5HVF A;  2O4H A;  4NGR A;  3CPX A;  4A94 A;  1LOK A;  1ELL P;  3SI2 A;  1H8L A;  2EK8 A;  1F2P A;  2ZEH A;  4P10 A;  2Q43 A;  3MRU A;  1ZG8 A;  2ZEE A;  3WAB A;  1LCP A;  5ELY A;  4W9Y A;  3PB8 X;  1LFW A;  4NGT A;  3MN8 A;  2PCU A;  2Q51 A;  1OBR A;  4IK2 A;  1ARL A;  2I3C A;  3LMS A;  5LYI A;  3D67 A;  4FWU A;  1LAP A;  2ZOG A;  4F8Z A;  2HC9 A;  2NYQ A;  3PFE A;  1M4L A;  1FT7 A;  2BO9 A;  3BI1 A;  5LYL A;  2PJ7 A;  2AFM A;  1YME A;  4ZYQ A;  4MCS A;  4UIA A;  3B3T A;  3CDX A;  3B7I A;  3FJU A;  2PRQ A;  3NA6 A;  1TXR A;  3KL9 A;  4PQA A;  5K8N A;  4O23 A;  2OR4 A;  3RAM A;  3FH4 A;  3KHZ A;  5F09 A;  2C6G A;  1BAV A;  4ZY2 A;  2F8H A;  2V8G A;  4R8F A;  4Z65 A;  7CPA A;  4RUH A;  1YW6 A;  4ZY0 A;  2VL1 A;  4OIW A;  3BXM A;  1R43 A;  3IWW A;  4PXC A;  4PXE A;  4K3N A;  3VAR A;  3FF3 A;  4IAV A;  2XEI A;  3LWU A;  4MCP A;  5LYF A;  4Q7A A;  1QQ9 A;  5D8N A;  1ZG9 A;  1ZLH A;  3S9N A;  2PIY A;  4MCR A;  1XMB A;  3PB9 X;  1VIX A;  2IJZ A;  3FEC A;  1CP7 A;  3IO1 A;  1LAM A;  4MMO A;  3KR5 A;  3BI0 A;  3KQZ A;  3D7D A;  4DJL A;  3TX8 A;  1VHE A;  3GB0 A;  2O53 A;  2V8D A;  3D7F A;  3D4U A;  5LYD A;  2QVP A;  1EE3 P;  3QNV A;  3HUV A;  2IQ6 A;  3SI1 A;  1VGY A;  3T8W A;  3FX6 A;  3IEH A;  4OC2 A;  4NGQ A;  3WC6 A;  4CPA A;  4DYO A;  4OP4 A;  4TWE A;  1YSJ A;  2JEW A;  3D7G A;  4UEZ A;  2CTB A;  2QYV A;  1DE4 C;  1FNO A;  2GU2 A;  2NSM A;  3V7Z A;  4UEF A;  1ZLI A;  4FBE A;  4ZX8 A;  1CPS A;  1DTD A;  4TNU A;  5JH9 A;  1TKJ A;  4UIB A;  4UF4 A;  4P45 A;  4MHY A;  4EFD A;  4G1P A;  2PVV A;  2ZEL A;  3HLP A;  4MHZ A;  2GLJ A;  3PB7 X;  2PJ3 A;  4OC5 A;  3B3W A;  3KI9 A;  2AFX A;  4F9V A;  3WC7 A;  2PJA A;  3KAS A;  5J1Q A;  2PIZ A;  5HVG A;  3PBB A;  2V8V A;  5LRG A;  2CF4 A;  3NFZ A;  4JYW A;  1LAN A;  3B2Y A;  2AFU A;  4ZY1 A;  2AFW A;  4A38 A;  2PJ2 A;  3VAT A;  4A37 A;  3CPA A;  2PJ0 A;  5CBM A;  4P4E A;  4PPZ A;  1BLL E;  5IB9 A;  4OC1 A;  4PXB A;  3SJE A;  4IHM A;  3D7H A;  4ZX9 A;  3KR4 A;  1YW4 A;  3WC5 A;  2ZEG A;  2OOT A;  4P44 A;  1CPX A;  4NGN A;  1CG2 A;  4R6T A;  3SJX A;  3ISZ A;  1HDU A;  1BPM A;  4NGP A;  2CTC A;  3PFO A;  4GM5 A;  4P4D A;  2XEF A;  2ABZ A;  3CT9 A;  3FMC A;  4F9U A;  4NFR A;  2F7V A;  4OKO A;  3D68 A;  1UWY A;  5JGF A;  1CBX A;  3B3S A;  4EWT A;  2J9A A;  3RZA A;  2C1C A;  4JZ0 A;  4YWY A;  2PJ1 A;  2Q4Z A;  3H8G A;  1JQG A;  3B3V A;  4P6Y A;  1VHO A;  2FVG A;  2AFO A;  4R7M A;  3IJ3 A;  4AXV A;  4MHP A;  4P4B A;  4X2T A;  5LRK A;  1ARM A;  1GYT A;  2AFS A;  4A39 A;  3VH9 A;  2GLF A;  2PJ6 A;  2PJ4 A;  3DGV A;  4EME A;  1TF9 A;  3ISX A;  4WJB A;  2PJ9 A;  3DLJ A;  2ZEM A;  1HEE A;  1XFO A;  4MXU A;  3SI0 A;  4FAI A;  3L2N A;  3KQX A;  2WYR A;  4NGM A;  4NJR A;  2ZED A;  1QMU A;  3PB4 X;  3H8F A;  2PJB A;  2GRE A;  3PEI A;  4OC3 A;  1HDQ A;  2IMO A;  3SJG A;  2POK A;  2V8H A;  3S9M A;  3FVL A;  4P4I A;  2XEG A;  5DS0 A;  5D29 A;  4X3R A;  1XRY A;  2HB6 A;  3S9L A;  2BOA A;  3IC1 A;  4YU9 A;  4ZI6 A;  1Z5R A;  1Z8L A;  3NH8 A;  1F57 A;  1KWM A;  5K8P A;  4NJQ A;  2CIJ A;  3IFE A;  4OID A;  3V38 A;  1ZG7 A;  4P4J A;  3K2K A;  5K8O A;  4DUK A;  1IGB A;  1CP6 A;  3B35 A;  6CPA A;  5HXD A;  1Q7L A;  1XJO A;  5HVH A;  1Y7E A;  1Y0R A;  4OME A;  2ZEF A;  1Z2L A;  3NH5 A;  3SJF A;  3GUX A;  3PBE A;  2EWB A;  3KHX A;  3B3C A;  1YLO A;  4NGS A;  2XEJ A;  2RB7 A;  2PJ5 A;  1BPN A;  2QJ8 A; 
#chains in the Genus database with same CATH topology
 3IIB A;  2X7B A;  2OZU A;  3TFY A;  5I0C A;  4CAE A;  3ZJ0 A;  4KSA A;  4H2K A;  3FEE A;  1AYE A;  2DEA A;  3EXN A;  1J4J A;  2JBK A;  2HUZ A;  2Q4V A;  1PU9 A;  4AG9 A;  4MHN A;  4CAV A;  4MY3 A;  1NSL A;  2Z3M A;  2PE3 A;  1XBU A;  3D66 A;  2WZN A;  4NXY A;  2FL4 A;  3GY9 A;  3RYO A;  4C7I A;  3BHX A;  4B12 A;  3KZW A;  3GIU A;  4JWP A;  2PJ8 A;  2DXQ A;  5K8M A;  2AFZ A;  1CX8 A;  4E0A A;  3T9Y A;  5THW A;  1R3N A;  4R57 A;  3P2H A;  1ELM P;  4KOX A;  4QB9 A;  3IGR A;  2BUE A;  4P4F A;  1Z8X A;  4ZGY B;  1TKF A;  5JM6 A;  4B6Z A;  2ATR A;  5AG7 A;  5CPA A;  3NH4 A;  1NSA A;  3GLJ A;  1BOB A;  1VKC A;  2ODF A;  4JXR A;  4BD9 A;  1IOI A;  1PCA A;  2C6P A;  3W6X A;  2RFH A;  2PQ8 A;  1CM0 A;  2ZEO A;  1AMP A;  3FED A;  4UEE A;  2C6C A;  3RBU A;  4KLW A;  2PVW A;  4ONW A;  4KSI A;  4OC0 A;  1Y0Y A;  2P0W A;  3KGQ A;  3UY5 A;  1F2O A;  3WR7 A;  5J8C A;  1GHE A;  3RO0 A;  2Q44 A;  4LX9 A;  3SHP A;  4CAW A;  3PB6 X;  2BCO A;  2PR8 A;  2WPW A;  4FUU A;  1PUA A;  3DR8 A;  2OU2 A;  2VBQ A;  4OC4 A;  4PV6 A;  1PYT B;  3JRU A;  4UCP A;  2JBJ A;  4HPS A;  4UCN A;  2EVN A;  5HMN A;  1QST A;  1RTQ A;  2JDD A;  1YQE A;  3PZJ A;  5I4M A;  2VEZ A;  2FSR A;  2ANP A;  1TF8 A;  2ZEN A;  3H8E A;  4B14 A;  5GCN A;  4R76 A;  3WT4 A;  2HV2 A;  4FD6 A;  2R1I A;  4ZBG A;  3S6G A;  2PJC A;  3K9T A;  1TKH A;  2G9D A;  2ZOF A;  8CPA A;  4OLL A;  5LRJ A;  3VWE A;  4PXD A;  4MCQ A;  2D4O A;  5KTA A;  4B11 A;  4WWV A;  2EK9 A;  2Q7S A;  3SXN A;  4C2Z A;  1I21 A;  1IIC A;  4X5K A;  2O28 A;  2ZEP A;  4X8I A;  4MRI A;  2A4N A;  4F6A A;  4LQG A;  2CNT A;  2GE3 A;  2J8R A;  2NMT A;  4MFL A;  3I1U A;  1VHS A;  2VZZ A;  3PRT A;  1IY7 A;  1M4D A;  3TC8 A;  2V77 A;  3N5F A;  4KOT A;  4HNW B;  2JLM A;  4KSF A;  3GYA A;  4UFV A;  3NE8 A;  4A31 A;  5HVF A;  2O4H A;  5H86 A;  2CY2 A;  4NGR A;  3CPX A;  3S6F A;  4A94 A;  1Q2Y A;  1YLE A;  4ONU A;  1LOK A;  1TIQ A;  1ELL P;  3SI2 A;  1KUV A;  5A28 A;  1H8L A;  4I49 A;  2EK8 A;  3EC4 A;  1F2P A;  2ZEH A;  4P10 A;  4CGL A;  2Z11 A;  2Q43 A;  3MRU A;  1I1D A;  3GKR A;  1Z4E A;  1JWQ A;  1ZG8 A;  2ZEE A;  2VI7 A;  3WAB A;  1LCP A;  5ELY A;  4U9Y A;  2KCW A;  4YFJ A;  4II9 A;  4W9Y A;  3PB8 X;  1X10 A;  4U5Y A;  2J8N A;  5J8F A;  1LFW A;  4LQ6 A;  4NGT A;  5H84 A;  1M4G A;  2EUI A;  3W6S A;  2QIR A;  3MN8 A;  1QSM A;  2PCU A;  2Q51 A;  3CXP A;  1S7N A;  3JVN A;  4MFJ A;  1OBR A;  1IU8 A;  4IK2 A;  3R9E A;  1ARL A;  2I3C A;  3LMS A;  5LYI A;  4F0Y A;  1IOF A;  3D67 A;  1Z8T A;  4FWU A;  2B58 A;  3V8I A;  5KTC A;  1LAP A;  2ZXV A;  3R1K A;  4M6H A;  4MFP A;  1Y9W A;  1ON0 A;  2R98 A;  2ZOG A;  2J8M A;  4F8Z A;  2HC9 A;  2NYQ A;  1XMT A;  3PFE A;  4JLY A;  3E0K A;  1M4L A;  3T90 A;  1FT7 A;  3CXS A;  2BO9 A;  3BI1 A;  5F48 A;  4AB7 A;  2PJ7 A;  2AFM A;  5LYL A;  4GS4 A;  1YME A;  4ZYQ A;  4MCS A;  4UIA A;  3B3T A;  4E2A A;  4Y49 C;  3CDX A;  3B7I A;  3TO6 A;  4KS9 A;  2DPS A;  1M1D A;  3FJU A;  1S7F A;  2PRQ A;  5FVJ A;  4YRH A;  3NA6 A;  1M4I A;  2P6E A;  3DSB A;  3IWG A;  1TXR A;  3KL9 A;  3PGP A;  4PQA A;  3LAC A;  4K30 A;  2PC1 A;  4IF5 A;  5K8N A;  4O23 A;  2OR4 A;  1YR0 A;  5EC4 A;  4MFQ A;  3FH4 A;  3RAM A;  4CGN A;  1S3Z A;  3KHZ A;  2C6G A;  1BAV A;  5F09 A;  4ZY2 A;  2F8H A;  2V8G A;  4R8F A;  5C88 A;  4Z65 A;  7CPA A;  3DDD A;  4RUH A;  1YW6 A;  4ZY0 A;  2GAN A;  2VL1 A;  4OIW A;  2FIW A;  1K4J A;  3BXM A;  5ISV A;  1R43 A;  4OAD A;  2OZG A;  1RXT A;  1MK4 A;  2H5M A;  2G3A A;  3IWW A;  4PXC A;  4PXE A;  4BIN A;  1YX0 A;  4K3N A;  2Y0M A;  5DWM A;  2Q7B A;  3VAR A;  3FF3 A;  2QEC A;  4IAV A;  1XOV A;  2XEI A;  3LWU A;  3VWD A;  2VXK A;  2PDO A;  2YND A;  2PRB A;  4MCP A;  4NF1 A;  1XE4 A;  2JEV A;  5LYF A;  4QUS A;  4Q7A A;  2ZW5 A;  2OH1 A;  5IV0 A;  1QQ9 A;  2CNS A;  1IID A;  4UEZ A;  4B13 A;  4C2Y A;  5D8N A;  4CAF A;  1NMT A;  4BBH A;  1L0C A;  1ZG9 A;  1P4N A;  1ZLH A;  4OAE A;  3R95 A;  3SXO A;  2PSW A;  3TO9 A;  5HH1 A;  3S9N A;  2PIY A;  2G0B A;  2Z10 A;  2EO8 A;  4NSQ A;  4MCR A;  3S6H A;  1XMB A;  2FIA A;  1VIX A;  3PB9 X;  4Y49 B;  5EMI A;  2IJZ A;  4QBJ A;  3FEC A;  1CP7 A;  2D4P A;  3IO1 A;  4B5P A;  1OZP A;  2PR1 A;  3R9F A;  1LAM A;  4MY0 A;  4MMO A;  3KR5 A;  3BI0 A;  3LOD A;  2CNM A;  3FB3 A;  3KQZ A;  3BJ7 A;  3D7D A;  4DJL A;  4DNC A;  4CYN A;  5BWA B;  3TX8 A;  1YGH A;  4HNX B;  4U9Z A;  1VHE A;  4R3L A;  3GB0 A;  4NCZ A;  4BMH A;  2O53 A;  2B3V A;  2V8D A;  2B4D A;  1YVO A;  4A2Z A;  3IU1 A;  3D7F A;  3D4U A;  3DNS A;  4FD7 A;  2REE A;  5G1Z A;  1I12 A;  5LYD A;  4CAX A;  2AE6 A;  2QVP A;  1EE3 P;  3QNV A;  3HUV A;  3FNC A;  2IQ6 A;  2AJ6 A;  3CXQ A;  3D2P A;  3ZZI A;  2R8V A;  1VGY A;  3SI1 A;  1IYK A;  1XEB A;  3T8W A;  3FX6 A;  2Z3P A;  3IEH A;  4NGQ A;  4OC2 A;  3WC6 A;  4CPA A;  4CYP A;  2DF5 A;  4DYO A;  4OP4 A;  4TWE A;  3EY5 A;  1YSJ A;  4AG7 A;  2JEW A;  3D7G A;  4Q38 A;  2CTB A;  2QYV A;  1DE4 C;  1V0C A;  1FNO A;  4RI1 A;  2GU2 A;  2DPT A;  4AVA A;  3LD2 A;  2NSM A;  2B3U A;  3FYN A;  5C82 A;  3V7Z A;  4UEF A;  1ZLI A;  4FBE A;  4ZX8 A;  1CPS A;  4KUB A;  1DTD A;  2R7H A;  1B87 A;  2ARH A;  1Z9U A;  3FRM A;  4TNU A;  5JH9 A;  4B5P B;  5G22 A;  3JUW A;  1TKJ A;  3I3G A;  4UIB A;  1Y9K A;  4UF4 A;  4P45 A;  2Z3N A;  2FT0 A;  4MHY A;  5EBV A;  4G1P A;  2B4B A;  4EFD A;  2PVV A;  3FBU A;  2EBJ A;  2BSW A;  4A32 A;  2OZH A;  2ZEL A;  3HLP A;  4HKF A;  4KOR A;  4B5O A;  4MHZ A;  5G21 A;  3G3S A;  4EVY A;  3TT2 A;  2GLJ A;  3PB7 X;  2PJ3 A;  4OC5 A;  1Q2C A;  1YK3 A;  2RC4 A;  2WUU A;  2AFX A;  3B3W A;  3C26 A;  3KI9 A;  4PK3 A;  4XNH C;  3WC7 A;  5AG6 A;  2PJA A;  3KAS A;  4AVC A;  4F9V A;  5J1Q A;  2PIZ A;  5HVG A;  4JJX A;  1MJB A;  4KVM E;  3PBB A;  1X12 A;  4A30 A;  4B10 A;  4XPK A;  2V8V A;  1IYL A;  4J3G A;  4UWI A;  5LRG A;  2CF4 A;  3NFZ A;  4JYW A;  4MFZ A;  3TO7 A;  4CGO A;  4R3K A;  1WWZ A;  2Q0Y A;  1LAN A;  3B2Y A;  1R57 A;  3F0A A;  3QB8 A;  2AFU A;  4ZY1 A;  4MI4 A;  2AFW A;  1M44 A;  5JQ4 A;  4A38 A;  2PJ2 A;  3TOA A;  3TOB A;  1A2Z A;  3VAT A;  3KKW A;  1P0H A;  2FE7 A;  4GXH A;  5CNP A;  4A37 A;  3CPA A;  2Z3K A;  4CRY B;  1ZO0 A;  2PJ0 A;  1QSN A;  3D2M A;  4PSW A;  5CBM A;  3BJ8 A;  4PPZ A;  4P4E A;  3H4Q A;  1BLL E;  1Z4R A;  3MGD A;  4IUS A;  3NE7 A;  5IB9 A;  4ORF A;  4OC1 A;  4PXB A;  2OB0 A;  4MBU A;  3SJE A;  4KLV A;  4IHM A;  3D7H A;  4ZX9 A;  1KZF A;  5F49 A;  3KR4 A;  5KTD A;  2FS5 A;  4R87 A;  1LRZ A;  1S60 A;  1YW4 A;  3R96 A;  3WC5 A;  2ZEG A;  1KUY A;  2OOT A;  4P44 A;  1CPX A;  4M3S A;  2GIV A;  1XIX A;  4NGN A;  5AG5 A;  1CG2 A;  4KOV A;  2K5T A;  3F8K A;  4R6T A;  3SJX A;  3ISZ A;  4UCM A;  1HDU A;  1BPM A;  4NGP A;  2JDC A;  2CTC A;  5IB0 A;  3PFO A;  3D3S A;  4GM5 A;  3D8P A;  4C2X A;  2Q04 A;  2BEI A;  4P4D A;  4KOS A;  2I79 A;  4PK2 A;  4XNH B;  2XEF A;  5AGE A;  1RO5 A;  4QVT A;  1MJ9 A;  2ABZ A;  3CT9 A;  1FY7 A;  3FMC A;  3S6K A;  4F9U A;  4NFR A;  2F7V A;  4A33 A;  3IWE A;  4OKO A;  1KUX A;  4UBR A;  3D68 A;  1UWY A;  5JGF A;  4PSX A;  4A95 A;  2FCK A;  4AVB A;  2ZW4 A;  4UFW A;  1CBX A;  3B3S A;  4EWT A;  4KOY A;  2J9A A;  3RZA A;  2C1C A;  2I00 A;  4JZ0 A;  4R9M A;  2FXF A;  2PJ1 A;  2Q4Z A;  4KOU A;  4YWY A;  2WSA A;  3H8G A;  1JQG A;  3TTH A;  2HQY A;  4E8O A;  2QML A;  2YNE A;  1BO4 A;  3B3V A;  3QAH A;  4UA3 A;  4P6Y A;  5DWN A;  1VHO A;  1S7K A;  2FVG A;  2ZW6 A;  2AFO A;  3OWC A;  4QC6 A;  4YGO A;  2F5I A;  4M6G A;  2YGW A;  4R7M A;  1YVK A;  3IJ3 A;  4AXV A;  4MHP A;  4HNY B;  4P4B A;  1Q2D A;  3A9L A;  4X2T A;  5LRK A;  1ARM A;  1GYT A;  1AUG A;  4CGM A;  4NEX A;  2AFS A;  4A39 A;  4JXQ A;  3VH9 A;  2GLF A;  2PJ6 A;  2PJ4 A;  4C7H A;  3DGV A;  3TCV A;  2G3T A;  4CGP A;  2Q4Y A;  2YNC C;  4EME A;  1S7L A;  1NE9 A;  1TF9 A;  3ISX A;  4WJB A;  2YNC A;  1SQH A;  2PJ9 A;  3K9U A;  3DLJ A;  4CS0 B;  2ZEM A;  2WPX A;  1HEE A;  1XFO A;  5F47 A;  4KOW A;  3SJF A;  4MXU A;  3SI0 A;  4FAI A;  4Q36 A;  4CRZ B;  3F5B A;  3L2N A;  3PP9 A;  3KQX A;  1IB1 E;  2CXA A;  2VQY A;  2WYR A;  4MJ8 A;  3H5Z A;  1MJA A;  1UFH A;  4RN7 A;  1WK4 A;  3JTK A;  4XPD C;  4UWJ A;  1B6B A;  2Z3L A;  2VZY A;  4NGM A;  3P2F A;  4L89 A;  1QSR A;  2C27 A;  4LUA A;  4NJR A;  1Z8W A;  2ZED A;  3B8G A;  1QMU A;  1Y7R A;  4MFK A;  2B5G A;  2Z3O A;  3PB4 X;  3DR6 A;  3H8F A;  2PJB A;  1YRE A;  2GRE A;  2P6F A;  3PEI A;  5E96 A;  1CJW A;  4OC3 A;  1HDQ A;  2IMO A;  2ZW7 A;  5AG4 A;  1XF8 A;  3IU2 A;  3SJG A;  3FXT A;  2POK A;  2V8H A;  3S9M A;  3FVL A;  4P4I A;  4MHD A;  4FD5 A;  2XEG A;  3QAY A;  5DS0 A;  5F46 A;  2B4D B;  5D29 A;  3I9S A;  1XRY A;  2HB6 A;  4X3R A;  3R9G A;  3S9L A;  2BOA A;  3IC1 A;  2GFQ A;  3BLN A;  4YU9 A;  4ZI6 A;  5IX3 A;  1Z5R A;  1Z8L A;  2Z0Z A;  1F57 A;  3NH8 A;  4KZT A;  1KWM A;  3W91 A;  4L8A A;  5K8P A;  4NJQ A;  2P6G A;  3TE4 A;  2CIJ A;  3IFE A;  4OID A;  3EO4 A;  4XPL A;  4KVO E;  3V38 A;  5JPH A;  2REF A;  1ZG7 A;  4M6I A;  3K2K A;  4P4J A;  4CYQ A;  4F0X A;  5K8O A;  4DUK A;  4KVX A;  1N71 A;  3G8W A;  1IGB A;  1CP6 A;  3B35 A;  4M85 A;  3RNZ A;  6CPA A;  5HXD A;  1Q7L A;  1XJO A;  5HVH A;  1U6M A;  1Y7E A;  1Y0R A;  4JD6 A;  4OME A;  5A27 A;  2ZEF A;  1Z2L A;  2ZPA A;  3NH5 A;  3GUX A;  1QSO A;  3PBE A;  4FD4 A;  4H6U A;  4UFX A;  4XPD B;  2EWB A;  3FIX A;  3KHX A;  3EFA A;  3B3C A;  4H89 A;  1YLO A;  4NGS A;  5G20 A;  2BL1 A;  4H6Z A;  4KUA A;  2XEJ A;  3N7Z A;  4C68 A;  2RB7 A;  2PJ5 A;  4RS2 A;  1S5K A;  4CYO A;  1BPN A;  2QJ8 A;  2B5G B;  2IL4 A;  3CZX A; 
#chains in the Genus database with same CATH homology
 3IIB A;  4H2K A;  3FEE A;  1AYE A;  2DEA A;  2JBK A;  4MHN A;  2PE3 A;  1XBU A;  3D66 A;  2WZN A;  3BHX A;  3KZW A;  5K8M A;  2PJ8 A;  2AFZ A;  1CX8 A;  5THW A;  1R3N A;  1ELM P;  4P4F A;  1TKF A;  5JM6 A;  4B6Z A;  5CPA A;  3NH4 A;  1NSA A;  3GLJ A;  4BD9 A;  1PCA A;  2C6P A;  2RFH A;  3FED A;  2ZEO A;  4UEE A;  1AMP A;  2C6C A;  3RBU A;  2PVW A;  4ONW A;  4KSI A;  4OC0 A;  1Y0Y A;  3KGQ A;  1F2O A;  3PB6 X;  2BCO A;  4FUU A;  4OC4 A;  1PYT B;  3JRU A;  2JBJ A;  1RTQ A;  5I4M A;  2ANP A;  1TF8 A;  2ZEN A;  3H8E A;  4R76 A;  3WT4 A;  2PJC A;  3K9T A;  1TKH A;  2G9D A;  2ZOF A;  8CPA A;  5LRJ A;  4PXD A;  4MCQ A;  4WWV A;  2EK9 A;  2ZEP A;  4X8I A;  4MRI A;  4LQG A;  3I1U A;  3PRT A;  3TC8 A;  1IY7 A;  2V77 A;  3N5F A;  5HVF A;  2O4H A;  4NGR A;  3CPX A;  4A94 A;  1LOK A;  1ELL P;  3SI2 A;  1H8L A;  2EK8 A;  1F2P A;  2ZEH A;  4P10 A;  2Q43 A;  3MRU A;  1ZG8 A;  2ZEE A;  3WAB A;  1LCP A;  5ELY A;  4W9Y A;  3PB8 X;  1LFW A;  4NGT A;  3MN8 A;  2PCU A;  2Q51 A;  1OBR A;  4IK2 A;  1ARL A;  2I3C A;  3LMS A;  5LYI A;  3D67 A;  4FWU A;  1LAP A;  2ZOG A;  4F8Z A;  2HC9 A;  2NYQ A;  3PFE A;  1M4L A;  1FT7 A;  2BO9 A;  3BI1 A;  5LYL A;  2PJ7 A;  2AFM A;  1YME A;  4ZYQ A;  4MCS A;  4UIA A;  3B3T A;  3CDX A;  3B7I A;  3FJU A;  2PRQ A;  3NA6 A;  1TXR A;  3KL9 A;  4PQA A;  5K8N A;  4O23 A;  2OR4 A;  3RAM A;  3FH4 A;  3KHZ A;  5F09 A;  2C6G A;  1BAV A;  4ZY2 A;  2F8H A;  2V8G A;  4R8F A;  4Z65 A;  7CPA A;  4RUH A;  1YW6 A;  4ZY0 A;  2VL1 A;  4OIW A;  3BXM A;  1R43 A;  3IWW A;  4PXC A;  4PXE A;  4K3N A;  3VAR A;  3FF3 A;  4IAV A;  2XEI A;  3LWU A;  4MCP A;  5LYF A;  4Q7A A;  1QQ9 A;  5D8N A;  1ZG9 A;  1ZLH A;  3S9N A;  2PIY A;  4MCR A;  1XMB A;  3PB9 X;  1VIX A;  2IJZ A;  3FEC A;  1CP7 A;  3IO1 A;  1LAM A;  4MMO A;  3KR5 A;  3BI0 A;  3KQZ A;  3D7D A;  4DJL A;  3TX8 A;  1VHE A;  3GB0 A;  2O53 A;  2V8D A;  3D7F A;  3D4U A;  5LYD A;  2QVP A;  1EE3 P;  3QNV A;  3HUV A;  2IQ6 A;  3SI1 A;  1VGY A;  3T8W A;  3FX6 A;  3IEH A;  4OC2 A;  4NGQ A;  3WC6 A;  4CPA A;  4DYO A;  4OP4 A;  4TWE A;  1YSJ A;  2JEW A;  3D7G A;  4UEZ A;  2CTB A;  2QYV A;  1DE4 C;  1FNO A;  2GU2 A;  2NSM A;  3V7Z A;  4UEF A;  1ZLI A;  4FBE A;  4ZX8 A;  1CPS A;  1DTD A;  4TNU A;  5JH9 A;  1TKJ A;  4UIB A;  4UF4 A;  4P45 A;  4MHY A;  4EFD A;  4G1P A;  2PVV A;  2ZEL A;  3HLP A;  4MHZ A;  2GLJ A;  3PB7 X;  2PJ3 A;  4OC5 A;  3B3W A;  3KI9 A;  2AFX A;  4F9V A;  3WC7 A;  2PJA A;  3KAS A;  5J1Q A;  2PIZ A;  5HVG A;  3PBB A;  2V8V A;  5LRG A;  2CF4 A;  3NFZ A;  4JYW A;  1LAN A;  3B2Y A;  2AFU A;  4ZY1 A;  2AFW A;  4A38 A;  2PJ2 A;  3VAT A;  4A37 A;  3CPA A;  2PJ0 A;  5CBM A;  4P4E A;  4PPZ A;  1BLL E;  5IB9 A;  4OC1 A;  4PXB A;  3SJE A;  4IHM A;  3D7H A;  4ZX9 A;  3KR4 A;  1YW4 A;  3WC5 A;  2ZEG A;  2OOT A;  4P44 A;  1CPX A;  4NGN A;  1CG2 A;  4R6T A;  3SJX A;  3ISZ A;  1HDU A;  1BPM A;  4NGP A;  2CTC A;  3PFO A;  4GM5 A;  4P4D A;  2XEF A;  2ABZ A;  3CT9 A;  3FMC A;  4F9U A;  4NFR A;  2F7V A;  4OKO A;  3D68 A;  1UWY A;  5JGF A;  1CBX A;  3B3S A;  4EWT A;  2J9A A;  3RZA A;  2C1C A;  4JZ0 A;  4YWY A;  2PJ1 A;  2Q4Z A;  3H8G A;  1JQG A;  3B3V A;  4P6Y A;  1VHO A;  2FVG A;  2AFO A;  4R7M A;  3IJ3 A;  4AXV A;  4MHP A;  4P4B A;  4X2T A;  5LRK A;  1ARM A;  1GYT A;  2AFS A;  4A39 A;  3VH9 A;  2GLF A;  2PJ6 A;  2PJ4 A;  3DGV A;  4EME A;  1TF9 A;  3ISX A;  4WJB A;  2PJ9 A;  3DLJ A;  2ZEM A;  1HEE A;  1XFO A;  4MXU A;  3SI0 A;  4FAI A;  3L2N A;  3KQX A;  2WYR A;  4NGM A;  4NJR A;  2ZED A;  1QMU A;  3PB4 X;  3H8F A;  2PJB A;  2GRE A;  3PEI A;  4OC3 A;  1HDQ A;  2IMO A;  3SJG A;  2POK A;  2V8H A;  3S9M A;  3FVL A;  4P4I A;  2XEG A;  5DS0 A;  5D29 A;  4X3R A;  1XRY A;  2HB6 A;  3S9L A;  2BOA A;  3IC1 A;  4YU9 A;  4ZI6 A;  1Z5R A;  1Z8L A;  3NH8 A;  1F57 A;  1KWM A;  5K8P A;  4NJQ A;  2CIJ A;  3IFE A;  4OID A;  3V38 A;  1ZG7 A;  4P4J A;  3K2K A;  5K8O A;  4DUK A;  1IGB A;  1CP6 A;  3B35 A;  6CPA A;  5HXD A;  1Q7L A;  1XJO A;  5HVH A;  1Y7E A;  1Y0R A;  4OME A;  2ZEF A;  1Z2L A;  3NH5 A;  3SJF A;  3GUX A;  3PBE A;  2EWB A;  3KHX A;  3B3C A;  1YLO A;  4NGS A;  2XEJ A;  2RB7 A;  2PJ5 A;  1BPN A;  2QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...