2ANPA

Functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAHEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords leucyl aminopeptidase
publication title Kinetic, Spectroscopic, and X-ray Crystallographic Characterization of the Functional E151H Aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2anpA00
3B2YA 1CG2A 2PJBA 2RB7A 3NH4A 1Y0RA 3V7ZA 1TKJA 5HVGA 4PXCA 1VGYA 4P6YA 4MCQA 1LAMA 1FT7A 4WJBA 4PXBA 4Q7AA 3B3VA 4OIWA 5CBMA 2OOTA 4MHZA 2PJ5A 4PQAA 2XEJA 5JGFA 3KHZA 3PBBA 4YU9A 2BO9A 2JBJA 4TNUA 2PJ2A 1ZLHA 4O23A 4JZ0A 2V8GA 3JRUA 3NH5A 2ZEOA 3TC8A 4ZI6A 1IY7A 4RUHA 2I3CA 3IWWA 3VATA 4PXDA 3SJEA 4W9YA 1Y0YA 2C1CA 2IMOA 1XBUA 4H2KA 4TWEA 3FEDA 1CPXA 3VARA 5IB9A 1XRYA 4X3RA 1OBRA 2F7VA 2AFUA 3IIBA 2PJ1A 4OMEA 1QMUA 3GUXA 4X2TA 1R43A 2PVWA 5LRJA 4NGSA 1H8LA 4R7MA 5HVHA 3NA6A 2PVVA 2QVPA 2XEFA 4A37A 3FF3A 2CF4A 4NGTA 2CTBA 3PB4X 4R6TA 2ZEEA 3FH4A 1YW6A 4OP4A 3SJGA 1XJOA 1Z2LA 3IFEA 4FBEA 3KGQA 4OC3A 1IGBA 4NGMA 2POKA 4WWVA 4OC0A 3DLJA 2ZENA 3H8EA 2ZOFA 4OKOA 3B3SA 4FWUA 3PB7X 3K2KA 3NH8A 3S9NA 5JH9A 3FMCA 2ZEDA 1TKHA 2ZEGA 3LMSA 2JBKA 1ARMA 2V8HA 4MCPA 3N5FA 3L2NA 4EFDA 4NFRA 3BI1A 2G9DA 1YMEA 4YWYA 3SI2A 3BXMA 2QJ8A 3D66A 4R76A 1CP6A 3WT4A 4ZYQA 1ELMP 2NSMA 1Z8LA 2PIZA 5LRGA 3WC6A 1AMPA 1LANA 1LFWA 1JQGA 3KHXA 1XMBA 3D7DA 2ZEPA 2PIYA 4F9UA 1GYTA 1HDUA 1HEEA 3PFEA 4DJLA 4MMOA 1EE3P 2HC9A 3D4UA 2EK8A 3DGVA 2PJ6A 2AFSA 4UEEA 1VHOA 2BOAA 4MXUA 4MHYA 2PJ9A 3QNVA 3B7IA 2V8VA 5LRKA 3FVLA 4P4JA 4UEFA 4P10A 3IC1A 4IHMA 3SI1A 3KL9A 3ISZA 5ELYA 4ZY2A 3HUVA 2WYRA 2OR4A 5LYIA 4GM5A 3PEIA 4EWTA 4LQGA 5LYFA 4JYWA 4PPZA 3GLJA 3PBEA 2PCUA 2C6CA 5K8OA 7CPAA 3RBUA 1F2OA 3PB9X 3B3WA 2V8DA 3VH9A 8CPAA 4P4FA 4PXEA 2PJAA 3S9LA 5LYLA 2GU2A 1ZG7A 4IAVA 1M4LA 3KR5A 3T8WA 4EMEA 3V38A 3BI0A 5D29A 3KR4A 1RTQA 3H8FA 5JM6A 2PJ7A 2GLFA 3HLPA 4A39A 1LOKA 2EK9A 1ZLIA 3K9TA 4KSIA 4P44A 1KWMA 3I1UA 2BCOA 2F8HA 2AFOA 4OC2A 1BAVA 5K8MA 5I4MA 1UWYA 2RFHA 1CP7A 4OIDA 1YSJA 5DS0A 2IQ6A 4NGNA 5F09A 1F2PA 5K8PA 5HXDA 3SJXA 3IEHA 1CX8A 1Q7LA 1Y7EA 2C6PA 4FAIA 4P4EA 3B3TA 4F9VA 1CBXA 2V77A 3KI9A 4NJRA 3D68A 2C6GA 3B35A 3NFZA 2ZELA 3D7FA 1TXRA 4DUKA 2PJ8A 4UEZA 3IJ3A 1TF8A 3D67A 1VHEA 4UF4A 2ZEHA 2J9AA 3FEEA 2ZEMA 3CT9A 2Q4ZA 2HB6A 3B3CA 2Q51A 3RAMA 2O4HA 2GLJA 4P4DA 4IK2A 6CPAA 3SI0A 4P45A 1QQ9A 4AXVA 4ZY0A 1Z5RA 1F57A 3CPAA 3RZAA 1LCPA 1R3NA 2NYQA 1PYTB 5J1QA 3KASA 2ZEFA 4NGQA 3PB8X 2PJ3A 1AYEA 4ZX8A 2AFWA 2VL1A 2ZOGA 2CIJA 2Q43A 3WABA 3KZWA 5HVFA 2ABZA 2XEIA 2PJ4A 1TKFA 4NGRA 4P4IA 4BD9A 3LWUA 1PCAA 1BPMA 4MHNA 3MN8A 1VIXA 3MRUA 3CPXA 3H8GA 4UIBA 4A38A 2AFMA 3GB0A 3BHXA 3PFOA 2AFZA 2WZNA 4MCSA 1ARLA 2ANPA 1FNOA 4UIAA 3PB6X 2O53A 4ONWA 3TX8A 4K3NA 4B6ZA 1LAPA 3FX6A 3ISXA 3PRTA 4F8ZA 2JEWA 1DTDA 3SJFA 5CPAA 5K8NA 3S9MA 1BPNA 4CPAA 4NJQA 2XEGA 5THWA 1ZG9A 4G1PA 1BLLE 3FJUA 4ZX9A 4MRIA 2FVGA 2CTCA 2GREA 4MHPA 2PJCA 3KQZA 2PE3A 3WC5A 3WC7A 1ZG8A 5LYDA 2DEAA 3CDXA 4OC1A 1XFOA 4Z65A 2QYVA 1YLOA 3D7HA 4ZY1A 2PRQA 2EWBA 4P4BA 4MCRA 4X8IA 1HDQA 4R8FA 4OC5A 1CPSA 4A94A 1NSAA 4OC4A 1ELLP 4DYOA 1TF9A 2AFXA 3IO1A 3FECA 5D8NA 3KQXA 2PJ0A 3D7GA 1YW4A 2IJZA 1DE4C 4NGPA 4FUUA
chains in the Genus database with same CATH superfamily
3B2YA 2REEA 4B11A 2VQYA 2CNMA 3FYNA 3LD2A 1CG2A 4F0XA 3FNCA 5IV0A 4UFVA 2I00A 3PZJA 2PJBA 2RB7A 5EC4A 4A2ZA 3NH4A 1Y0RA 4QBJA 3V7ZA 1TKJA 2CXAA 4AG7A 4MY0A 2DXQA 1A2ZA 5DWMA 5HVGA 4PXCA 4NEXA 3UY5A 4B5OA 1VGYA 4KS9A 3R9GA 4P6YA 1MJ9A 4MCQA 1LAMA 1FT7A 4WJBA 4MY3A 4PXBA 3G3SA 4Q7AA 4TWEA 2GIVA 3B3VA 3GYAA 4JLYA 2B4BA 4JXQA 4OIWA 5CBMA 1X10A 1R57A 4MHZA 2OOTA 2PJ5A 4JXRA 1NMTA 4PQAA 4OADA 2XEJA 5EMIA 5JGFA 4U9YA 1QSRA 2BSWA 3KHZA 5G22A 5H84A 4A31A 4BMHA 3PBBA 4YU9A 2BO9A 2I79A 4B10A 2JBJA 4TNUA 2PJ2A 3FBUA 1ZLHA 4O23A 4R3LA 3IWGA 4JZ0A 4YRHA 2V8GA 3JRUA 2R98A 2ZEOA 3NH5A 4KUAA 3TC8A 5AG5A 4ZI6A 4F6AA 1IY7A 4RUHA 2I3CA 2Q0YA 1XMTA 3IWWA 2HQYA 2PRBA 4PXDA 3VATA 1FY7A 4W9YA 1Y0YA 3SJEA 2C1CA 2IMOA 1XBUA 2CY2A 4H2KA 4KOTA 4MFKA 4LUAA 4NCZA 1PU9A 3FEDA 1CPXA 4KOYA 4X5KA 3VARA 5IB9A 1XRYA 4I49A 4X3RA 1OBRA 2F7VA 4PSXA 2AFUA 2Z3LA 3IIBA 3H5ZA 2PJ1A 4MHDA 4OMEA 1QMUA 4XNHB 3GUXA 5AG7A 2Z3NA 3TE4A 1RXTA 1S5KA 4X2TA 1R43A 1KUVA 2PVWA 5LRJA 4NGSA 1H8LA 3G8WA 4R7MA 5HVHA 1L0CA 3NA6A 2PVVA 3W6SA 2QVPA 2XEFA 1S7KA 2B5GB 3FF3A 2CF4A 3H4QA 4NGTA 4QUSA 2CTBA 2WPWA 3PB4X 4R6TA 2ZEEA 3FH4A 1LRZA 3KKWA 1YW6A 1S7LA 4CS0B 2D4OA 3BJ7A 4OP4A 4II9A 3SJGA 4AVBA 1XJOA 1Z2LA 1IIDA 4B12A 2FS5A 4M6HA 4UCMA 3IFEA 4KOSA 4FBEA 4PV6A 3SXNA 3KGQA 3JUWA 4C2ZA 4B5PA 4OC3A 4BINA 4UA3A 3IU2A 1IGBA 1IICA 2FCKA 2O28A 2Z0ZA 1B87A 4NGMA 2POKA 3BLNA 4GS4A 4WWVA 3S6GA 4OC0A 3DLJA 5F46A 4CAWA 4CGLA 2R1IA 2BL1A 1N71A 2JDCA 2ZENA 5G21A 2Z3OA 2J8RA 1XE4A 2B58A 3EXNA 3H8EA 2ZOFA 4OKOA 3B3SA 3RYOA 4FWUA 3PB7X 1PUAA 3K2KA 3NH8A 3S9NA 5JH9A 2FT0A 3FMCA 5GCNA 4L89A 2PDOA 2ZEDA 4C7IA 1TKHA 1Z4EA 5JQ4A 2ZEGA 3B8GA 3LMSA 3DR6A 5HMNA 2JBKA 1ARMA 5IB0A 2V8HA 2K5TA 3EY5A 4MCPA 3N5FA 4PK3A 2F5IA 4M6GA 3D2MA 2GFQA 4KVME 4KOUA 4PSWA 3R9FA 4KVOE 4CYOA 5J8FA 3L2NA 2FSRA 3GIUA 3CXQA 3QAHA 2OH1A 5F47A 4MI4A 4EFDA 3LACA 2YNDA 4NFRA 3BI1A 2G9DA 1YMEA 1WK4A 3CZXA 3GY9A 4HNXB 1SQHA 4YWYA 3SI2A 1CM0A 4AB7A 2VXKA 2ZW4A 3BXMA 2QJ8A 3D66A 4Y49B 1Z8TA 3ZZIA 2J8MA 1Q2CA 4R76A 1CP6A 3D3SA 2R7HA 2ZW5A 4JWPA 1IOIA 3WT4A 4ZYQA 1ELMP 2NSMA 1Z8LA 2PIZA 2FL4A 4FD6A 5LRGA 2Y0MA 4R9MA 4LQ6A 3WC6A 1AMPA 2FXFA 1UFHA 3TFYA 1LANA 1LFWA 4IUSA 1JQGA 3KHXA 4KSAA 1X12A 1XMBA 3D7DA 4C68A 2ZEPA 1J4JA 1S3ZA 3ZJ0A 2PIYA 4F9UA 1GYTA 1VKCA 1HDUA 3JTKA 4XPDB 3TTHA 1HEEA 1QSNA 3PFEA 4DJLA 4MMOA 1EE3P 4H6UA 2HC9A 1P0HA 2OZHA 3D4UA 4RS2A 2EK8A 4CYPA 4PK2A 3W6XA 5BWAB 3DGVA 2PJ6A 2AFSA 4J3GA 1VHOA 4UEEA 4A33A 2Q4YA 4AG9A 3TO9A 3WR7A 1M44A 5FVJA 2BOAA 1IB1E 4B5PB 4MXUA 4CGMA 2JDDA 4MHYA 2YGWA 2VZZA 4K30A 4OLLA 3IGRA 1ON0A 2PJ9A 1YR0A 3QNVA 3B7IA 2Q7SA 2V8VA 5EBVA 3FVLA 5LRKA 4KUBA 4P4JA 2QMLA 1Q2YA 4UEFA 1IYKA 1K4JA 3CXPA 1OZPA 4P10A 3PGPA 3IC1A 4HPSA 3FIXA 4IHMA 4RN7A 3DR8A 3SI1A 1QSTA 3KL9A 3ISZA 4R3KA 2CNSA 2G3TA 5ELYA 1IOFA 4ZY2A 1ZO0A 4GXHA 1M4DA 3HUVA 2WYRA 2OR4A 3PP9A 4CRYB 4B13A 1NSLA 5LYIA 4GM5A 1YLEA 2X7BA 2PR1A 3PEIA 4LQGA 4FD7A 4EWTA 5LYFA 1IYLA 4JYWA 4FD5A 4PPZA 5AG6A 3GLJA 3PBEA 2PCUA 1Y9WA 2Q44A 2VBQA 2C6CA 2HV2A 5J8CA 4CYQA 5K8OA 4C7HA 3N7ZA 1QSMA 4CAEA 7CPAA 2PSWA 1KUXA 3E0KA 4UFWA 3RBUA 1F2OA 3PB9X 2PR8A 2V8DA 3B3WA 3VH9A 8CPAA 4CAVA 1RO5A 1M4IA 4P4FA 4PXEA 2PJAA 4ONUA 3S9LA 4KZTA 5I0CA 2PQ8A 4C2YA 2Q4VA 5LYLA 1M4GA 2GU2A 1ZG7A 3F8KA 1M4LA 3KR5A 4IAVA 3T8WA 1IU8A 4FD4A 3V38A 4EMEA 5CNPA 3BI0A 5D29A 3KR4A 2HUZA 1RTQA 3H8FA 3VWEA 1YX0A 3TO6A 1U6MA 3QB8A 2REFA 5A27A 5JM6A 2PJ7A 2GLFA 1Y7RA 3I3GA 4MFZA 3HLPA 5F49A 4A30A 4A39A 3FXTA 3EO4A 1LOKA 1YVOA 2EK9A 5C82A 2FE7A 1ZLIA 3OWCA 5DWNA 3EC4A 2ARHA 3K9TA 4KSIA 4P44A 2GE3A 1KWMA 3D8PA 3I1UA 2EBJA 3R96A 2BCOA 1I12A 3SHPA 3F0AA 1YVKA 4QVTA 2F8HA 3T90A 3D2PA 4R57A 5F48A 3EFAA 2AFOA 4CAFA 3DNSA 2AJ6A 2AE6A 4JJXA 4OC2A 1BAVA 2EVNA 5K8MA 4MJ8A 5I4MA 1UWYA 2RFHA 1CP7A 1YSJA 4OIDA 5DS0A 2Z3KA 2IQ6A 4NGNA 3S6HA 3VWDA 4CGPA 5A28A 5F09A 1F2PA 2DPSA 5HXDA 3SJXA 4CYNA 2NMTA 5K8PA 4XNHC 3IEHA 4ORFA 1CX8A 1Q7LA 1Y7EA 2OB0A 5G20A 2C6PA 4H89A 2P6GA 4FAIA 4P4EA 1S7NA 3B3TA 3S6KA 2B5GA 4Q38A 1GHEA 4F9VA 1CBXA 1Q2DA 2V77A 2ZW7A 3KI9A 4ZBGA 2VEZA 4NJRA 3D68A 2C6GA 2J8NA 3B35A 3SXOA 3I9SA 2OZUA 2ZELA 3NFZA 3D7FA 3NE8A 4ZGYB 2R8VA 1TXRA 4RI1A 4DUKA 2PJ8A 4A32A 5IX3A 3DSBA 4UEZA 1YK3A 3IJ3A 5C88A 2ZW6A 4L8AA 1TF8A 1JWQA 2D4PA 3TCVA 3D67A 5E96A 2ZPAA 4E8OA 1VHEA 2QIRA 3NE7A 4UF4A 2ZEHA 2J9AA 3FEEA 1I1DA 2ZEMA 4XPLA 3CT9A 2Q4ZA 2HB6A 3B3CA 2Q51A 3RAMA 2O4HA 2GLJA 1YGHA 5AGEA 4P4DA 4IK2A 6CPAA 5KTDA 1WWZA 2G3AA 3LODA 4LX9A 4Q36A 1XF8A 1AUGA 4M6IA 4BBHA 4E0AA 3SI0A 2GANA 2QECA 1XOVA 4P45A 1QQ9A 4AXVA 2B4DA 4ZY0A 1TIQA 1Z5RA 1F57A 3CPAA 3RZAA 1LCPA 3R1KA 1R3NA 4M85A 2NYQA 4UFXA 1PYTB 1M1DA 4KSFA 4UWJA 4HNYB 3TO7A 5J1QA 3KASA 2ZEFA 4NGQA 3PB8X 2PJ3A 3BJ8A 4UWIA 1Z9UA 3JVNA 5AG4A 4KOXA 1AYEA 2G0BA 5G1ZA 1Z8WA 4ZX8A 2AFWA 2VL1A 4OAEA 5HH1A 3TOAA 2ZOGA 1P4NA 2DPTA 2DF5A 3IU1A 4E2AA 2CIJA 2Q43A 5H86A 3KZWA 4UCNA 5HVFA 3WABA 1CJWA 2ABZA 2IL4A 2PJ4A 2XEIA 1TKFA 2KCWA 3RO0A 1Z8XA 4F0YA 4NGRA 4QC6A 2EO8A 4P4IA 1S7FA 1MJBA 4BD9A 4CAXA 3P2HA 3FB3A 4AVAA 3LWUA 1PCAA 2P6FA 4U9ZA 1BPMA 4MHNA 1S60A 3MN8A 1VIXA 3MRUA 3CPXA 3H8GA 2Z3PA 4UIBA 4Y49C 3MGDA 4A38A 3A9LA 2AFMA 4KOWA 3GB0A 2Z3MA 3BHXA 4MBUA 4B14A 4KVXA 4UCPA 4HKFA 3W91A 3PFOA 2OZGA 2AFZA 1MJAA 1B6BA 2BEIA 1KUYA 1Y9KA 4YGOA 2WZNA 4CGNA 2BUEA 3TT2A 4NSQA 1XEBA 1ARLA 2ANPA 1FNOA 4MCSA 3DDDA 3PB6X 4UIAA 2O53A 4ONWA 4EVYA 1YREA 2YNEA 3TX8A 4K3NA 4B6ZA 2FIWA 1LAPA 3S6FA 3FX6A 3ISXA 3PRTA 2VI7A 4HNWB 4KLVA 4MFQA 4F8ZA 4XPDC 2JEWA 3P2FA 1DTDA 3R95A 1V0CA 3SJFA 4CRZB 5CPAA 4MFJA 5K8NA 4XPKA 3S9MA 1BPNA 2ODFA 4CPAA 4YFJA 1Z4RA 4QB9A 3F5BA 4KORA 4NJQA 2Z10A 4NXYA 2XEGA 5THWA 1ZG9A 4NF1A 4G1PA 2WPXA 2JEVA 4IF5A 1BLLE 3FJUA 1BOBA 3IWEA 4C2XA 1QSOA 4ZX9A 2A4NA 4MRIA 2FVGA 1MK4A 2CTCA 2GREA 4MHPA 2PJCA 2ATRA 2FIAA 3KQZA 2PE3A 3WC5A 3WC7A 3QAYA 5KTCA 1ZG8A 2Q04A 5LYDA 1I21A 1NE9A 2DEAA 3CDXA 4KOVA 4OC1A 2Q7BA 3V8IA 1XFOA 3FRMA 2H5MA 3C26A 2B4DB 2VZYA 4Z65A 2WUUA 3RNZA 2QYVA 1YLOA 2C27A 4DNCA 1YQEA 3D7HA 4ZY1A 3CXSA 4H6ZA 5KTAA 2PRQA 4JD6A 3R9EA 2EWBA 4R87A 4P4BA 4MCRA 2Z11A 3K9UA 4X8IA 4KLWA 4A37A 5ISVA 1HDQA 1KZFA 4R8FA 5JPHA 4OC5A 1CPSA 2EUIA 4U5YA 4A94A 2JLMA 4UBRA 4CGOA 1NSAA 4OC4A 4AVCA 1ELLP 4DYOA 1TF9A 2PC1A 1VHSA 2AFXA 2B3UA 2YNCA 3IO1A 2P0WA 2RC4A 1BO4A 3FECA 5D8NA 3TOBA 3KQXA 2OU2A 2PJ0A 4A95A 2P6EA 2YNCC 3D7GA 3GKRA 3T9YA 2ZXVA 1YW4A 4M3SA 2CNTA 2IJZA 4MFPA 1DE4C 4NGPA 4FUUA 2B3VA 1XIXA 4MFLA 2WSAA
chains in the Genus database with same CATH topology
3B2YA 1CG2A 2PJBA 2RB7A 3NH4A 1Y0RA 3V7ZA 1TKJA 5HVGA 4PXCA 1VGYA 4P6YA 4MCQA 1LAMA 1FT7A 4WJBA 4PXBA 4Q7AA 3B3VA 4OIWA 5CBMA 2OOTA 4MHZA 2PJ5A 4PQAA 2XEJA 5JGFA 3KHZA 3PBBA 4YU9A 2BO9A 2JBJA 4TNUA 2PJ2A 1ZLHA 4O23A 4JZ0A 2V8GA 3JRUA 3NH5A 2ZEOA 3TC8A 4ZI6A 1IY7A 4RUHA 2I3CA 3IWWA 3VATA 4PXDA 3SJEA 4W9YA 1Y0YA 2C1CA 2IMOA 1XBUA 4H2KA 4TWEA 3FEDA 1CPXA 3VARA 5IB9A 1XRYA 4X3RA 1OBRA 2F7VA 2AFUA 3IIBA 2PJ1A 4OMEA 1QMUA 3GUXA 4X2TA 1R43A 2PVWA 5LRJA 4NGSA 1H8LA 4R7MA 5HVHA 3NA6A 2PVVA 2QVPA 2XEFA 4A37A 3FF3A 2CF4A 4NGTA 2CTBA 3PB4X 4R6TA 2ZEEA 3FH4A 1YW6A 4OP4A 3SJGA 1XJOA 1Z2LA 3IFEA 4FBEA 3KGQA 4OC3A 1IGBA 4NGMA 2POKA 4WWVA 4OC0A 3DLJA 2ZENA 3H8EA 2ZOFA 4OKOA 3B3SA 4FWUA 3PB7X 3K2KA 3NH8A 3S9NA 5JH9A 3FMCA 2ZEDA 1TKHA 2ZEGA 3LMSA 2JBKA 1ARMA 2V8HA 4MCPA 3N5FA 3L2NA 4EFDA 4NFRA 3BI1A 2G9DA 1YMEA 4YWYA 3SI2A 3BXMA 2QJ8A 3D66A 4R76A 1CP6A 3WT4A 4ZYQA 1ELMP 2NSMA 1Z8LA 2PIZA 5LRGA 3WC6A 1AMPA 1LANA 1LFWA 1JQGA 3KHXA 1XMBA 3D7DA 2ZEPA 2PIYA 4F9UA 1GYTA 1HDUA 1HEEA 3PFEA 4DJLA 4MMOA 1EE3P 2HC9A 3D4UA 2EK8A 3DGVA 2PJ6A 2AFSA 4UEEA 1VHOA 2BOAA 4MXUA 4MHYA 2PJ9A 3QNVA 3B7IA 2V8VA 5LRKA 3FVLA 4P4JA 4UEFA 4P10A 3IC1A 4IHMA 3SI1A 3KL9A 3ISZA 5ELYA 4ZY2A 3HUVA 2WYRA 2OR4A 5LYIA 4GM5A 3PEIA 4EWTA 4LQGA 5LYFA 4JYWA 4PPZA 3GLJA 3PBEA 2PCUA 2C6CA 5K8OA 7CPAA 3RBUA 1F2OA 3PB9X 3B3WA 2V8DA 3VH9A 8CPAA 4P4FA 4PXEA 2PJAA 3S9LA 5LYLA 2GU2A 1ZG7A 4IAVA 1M4LA 3KR5A 3T8WA 4EMEA 3V38A 3BI0A 5D29A 3KR4A 1RTQA 3H8FA 5JM6A 2PJ7A 2GLFA 3HLPA 4A39A 1LOKA 2EK9A 1ZLIA 3K9TA 4KSIA 4P44A 1KWMA 3I1UA 2BCOA 2F8HA 2AFOA 4OC2A 1BAVA 5K8MA 5I4MA 1UWYA 2RFHA 1CP7A 4OIDA 1YSJA 5DS0A 2IQ6A 4NGNA 5F09A 1F2PA 5K8PA 5HXDA 3SJXA 3IEHA 1CX8A 1Q7LA 1Y7EA 2C6PA 4FAIA 4P4EA 3B3TA 4F9VA 1CBXA 2V77A 3KI9A 4NJRA 3D68A 2C6GA 3B35A 3NFZA 2ZELA 3D7FA 1TXRA 4DUKA 2PJ8A 4UEZA 3IJ3A 1TF8A 3D67A 1VHEA 4UF4A 2ZEHA 2J9AA 3FEEA 2ZEMA 3CT9A 2Q4ZA 2HB6A 3B3CA 2Q51A 3RAMA 2O4HA 2GLJA 4P4DA 4IK2A 6CPAA 3SI0A 4P45A 1QQ9A 4AXVA 4ZY0A 1Z5RA 1F57A 3CPAA 3RZAA 1LCPA 1R3NA 2NYQA 1PYTB 5J1QA 3KASA 2ZEFA 4NGQA 3PB8X 2PJ3A 1AYEA 4ZX8A 2AFWA 2VL1A 2ZOGA 2CIJA 2Q43A 3WABA 3KZWA 5HVFA 2ABZA 2XEIA 2PJ4A 1TKFA 4NGRA 4P4IA 4BD9A 3LWUA 1PCAA 1BPMA 4MHNA 3MN8A 1VIXA 3MRUA 3CPXA 3H8GA 4UIBA 4A38A 2AFMA 3GB0A 3BHXA 3PFOA 2AFZA 2WZNA 4MCSA 1ARLA 2ANPA 1FNOA 4UIAA 3PB6X 2O53A 4ONWA 3TX8A 4K3NA 4B6ZA 1LAPA 3FX6A 3ISXA 3PRTA 4F8ZA 2JEWA 1DTDA 3SJFA 5CPAA 5K8NA 3S9MA 1BPNA 4CPAA 4NJQA 2XEGA 5THWA 1ZG9A 4G1PA 1BLLE 3FJUA 4ZX9A 4MRIA 2FVGA 2CTCA 2GREA 4MHPA 2PJCA 3KQZA 2PE3A 3WC5A 3WC7A 1ZG8A 5LYDA 2DEAA 3CDXA 4OC1A 1XFOA 4Z65A 2QYVA 1YLOA 3D7HA 4ZY1A 2PRQA 2EWBA 4P4BA 4MCRA 4X8IA 1HDQA 4R8FA 4OC5A 1CPSA 4A94A 1NSAA 4OC4A 1ELLP 4DYOA 1TF9A 2AFXA 3IO1A 3FECA 5D8NA 3KQXA 2PJ0A 3D7GA 1YW4A 2IJZA 1DE4C 4NGPA 4FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2Y A;  1CG2 A;  2PJB A;  2RB7 A;  3NH4 A;  1Y0R A;  3V7Z A;  1TKJ A;  5HVG A;  4PXC A;  1VGY A;  4P6Y A;  4MCQ A;  1LAM A;  1FT7 A;  4WJB A;  4PXB A;  4Q7A A;  3B3V A;  4OIW A;  5CBM A;  2OOT A;  4MHZ A;  2PJ5 A;  4PQA A;  2XEJ A;  5JGF A;  3KHZ A;  3PBB A;  4YU9 A;  2BO9 A;  2JBJ A;  4TNU A;  2PJ2 A;  1ZLH A;  4O23 A;  4JZ0 A;  2V8G A;  3JRU A;  3NH5 A;  2ZEO A;  3TC8 A;  4ZI6 A;  1IY7 A;  4RUH A;  2I3C A;  3IWW A;  3VAT A;  4PXD A;  3SJE A;  4W9Y A;  1Y0Y A;  2C1C A;  2IMO A;  1XBU A;  4H2K A;  4TWE A;  3FED A;  1CPX A;  3VAR A;  5IB9 A;  1XRY A;  4X3R A;  1OBR A;  2F7V A;  2AFU A;  3IIB A;  2PJ1 A;  4OME A;  1QMU A;  3GUX A;  4X2T A;  1R43 A;  2PVW A;  5LRJ A;  4NGS A;  1H8L A;  4R7M A;  5HVH A;  3NA6 A;  2PVV A;  2QVP A;  2XEF A;  4A37 A;  3FF3 A;  2CF4 A;  4NGT A;  2CTB A;  3PB4 X;  4R6T A;  2ZEE A;  3FH4 A;  1YW6 A;  4OP4 A;  3SJG A;  1XJO A;  1Z2L A;  3IFE A;  4FBE A;  3KGQ A;  4OC3 A;  1IGB A;  4NGM A;  2POK A;  4WWV A;  4OC0 A;  3DLJ A;  2ZEN A;  3H8E A;  2ZOF A;  4OKO A;  3B3S A;  4FWU A;  3PB7 X;  3K2K A;  3NH8 A;  3S9N A;  5JH9 A;  3FMC A;  2ZED A;  1TKH A;  2ZEG A;  3LMS A;  2JBK A;  1ARM A;  2V8H A;  4MCP A;  3N5F A;  3L2N A;  4EFD A;  4NFR A;  3BI1 A;  2G9D A;  1YME A;  4YWY A;  3SI2 A;  3BXM A;  2QJ8 A;  3D66 A;  4R76 A;  1CP6 A;  3WT4 A;  4ZYQ A;  1ELM P;  2NSM A;  1Z8L A;  2PIZ A;  5LRG A;  3WC6 A;  1AMP A;  1LAN A;  1LFW A;  1JQG A;  3KHX A;  1XMB A;  3D7D A;  2ZEP A;  2PIY A;  4F9U A;  1GYT A;  1HDU A;  1HEE A;  3PFE A;  4DJL A;  4MMO A;  1EE3 P;  2HC9 A;  3D4U A;  2EK8 A;  3DGV A;  2PJ6 A;  2AFS A;  4UEE A;  1VHO A;  2BOA A;  4MXU A;  4MHY A;  2PJ9 A;  3QNV A;  3B7I A;  2V8V A;  5LRK A;  3FVL A;  4P4J A;  4UEF A;  4P10 A;  3IC1 A;  4IHM A;  3SI1 A;  3KL9 A;  3ISZ A;  5ELY A;  4ZY2 A;  3HUV A;  2WYR A;  2OR4 A;  5LYI A;  4GM5 A;  3PEI A;  4EWT A;  4LQG A;  5LYF A;  4JYW A;  4PPZ A;  3GLJ A;  3PBE A;  2PCU A;  2C6C A;  5K8O A;  7CPA A;  3RBU A;  1F2O A;  3PB9 X;  3B3W A;  2V8D A;  3VH9 A;  8CPA A;  4P4F A;  4PXE A;  2PJA A;  3S9L A;  5LYL A;  2GU2 A;  1ZG7 A;  4IAV A;  1M4L A;  3KR5 A;  3T8W A;  4EME A;  3V38 A;  3BI0 A;  5D29 A;  3KR4 A;  1RTQ A;  3H8F A;  5JM6 A;  2PJ7 A;  2GLF A;  3HLP A;  4A39 A;  1LOK A;  2EK9 A;  1ZLI A;  3K9T A;  4KSI A;  4P44 A;  1KWM A;  3I1U A;  2BCO A;  2F8H A;  2AFO A;  4OC2 A;  1BAV A;  5K8M A;  5I4M A;  1UWY A;  2RFH A;  1CP7 A;  4OID A;  1YSJ A;  5DS0 A;  2IQ6 A;  4NGN A;  5F09 A;  1F2P A;  5K8P A;  5HXD A;  3SJX A;  3IEH A;  1CX8 A;  1Q7L A;  1Y7E A;  2C6P A;  4FAI A;  4P4E A;  3B3T A;  4F9V A;  1CBX A;  2V77 A;  3KI9 A;  4NJR A;  3D68 A;  2C6G A;  3B35 A;  3NFZ A;  2ZEL A;  3D7F A;  1TXR A;  4DUK A;  2PJ8 A;  4UEZ A;  3IJ3 A;  1TF8 A;  3D67 A;  1VHE A;  4UF4 A;  2ZEH A;  2J9A A;  3FEE A;  2ZEM A;  3CT9 A;  2Q4Z A;  2HB6 A;  3B3C A;  2Q51 A;  3RAM A;  2O4H A;  2GLJ A;  4P4D A;  4IK2 A;  6CPA A;  3SI0 A;  4P45 A;  1QQ9 A;  4AXV A;  4ZY0 A;  1Z5R A;  1F57 A;  3CPA A;  3RZA A;  1LCP A;  1R3N A;  2NYQ A;  1PYT B;  5J1Q A;  3KAS A;  2ZEF A;  4NGQ A;  3PB8 X;  2PJ3 A;  1AYE A;  4ZX8 A;  2AFW A;  2VL1 A;  2ZOG A;  2CIJ A;  2Q43 A;  3WAB A;  3KZW A;  5HVF A;  2ABZ A;  2XEI A;  2PJ4 A;  1TKF A;  4NGR A;  4P4I A;  4BD9 A;  3LWU A;  1PCA A;  1BPM A;  4MHN A;  3MN8 A;  1VIX A;  3MRU A;  3CPX A;  3H8G A;  4UIB A;  4A38 A;  2AFM A;  3GB0 A;  3BHX A;  3PFO A;  2AFZ A;  2WZN A;  4MCS A;  1ARL A;  2ANP A;  1FNO A;  4UIA A;  3PB6 X;  2O53 A;  4ONW A;  3TX8 A;  4K3N A;  4B6Z A;  1LAP A;  3FX6 A;  3ISX A;  3PRT A;  4F8Z A;  2JEW A;  1DTD A;  3SJF A;  5CPA A;  5K8N A;  3S9M A;  1BPN A;  4CPA A;  4NJQ A;  2XEG A;  5THW A;  1ZG9 A;  4G1P A;  1BLL E;  3FJU A;  4ZX9 A;  4MRI A;  2FVG A;  2CTC A;  2GRE A;  4MHP A;  2PJC A;  3KQZ A;  2PE3 A;  3WC5 A;  3WC7 A;  1ZG8 A;  5LYD A;  2DEA A;  3CDX A;  4OC1 A;  1XFO A;  4Z65 A;  2QYV A;  1YLO A;  3D7H A;  4ZY1 A;  2PRQ A;  2EWB A;  4P4B A;  4MCR A;  4X8I A;  1HDQ A;  4R8F A;  4OC5 A;  1CPS A;  4A94 A;  1NSA A;  4OC4 A;  1ELL P;  4DYO A;  1TF9 A;  2AFX A;  3IO1 A;  3FEC A;  5D8N A;  3KQX A;  2PJ0 A;  3D7G A;  1YW4 A;  2IJZ A;  1DE4 C;  4NGP A;  4FUU A; 
#chains in the Genus database with same CATH topology
 3B2Y A;  2REE A;  4B11 A;  2VQY A;  2CNM A;  3FYN A;  3LD2 A;  1CG2 A;  4F0X A;  3FNC A;  5IV0 A;  4UFV A;  2I00 A;  3PZJ A;  2PJB A;  2RB7 A;  5EC4 A;  4A2Z A;  3NH4 A;  1Y0R A;  4QBJ A;  3V7Z A;  1TKJ A;  2CXA A;  4AG7 A;  4MY0 A;  2DXQ A;  1A2Z A;  5DWM A;  5HVG A;  4PXC A;  4NEX A;  3UY5 A;  4B5O A;  1VGY A;  4KS9 A;  3R9G A;  4P6Y A;  1MJ9 A;  4MCQ A;  1LAM A;  1FT7 A;  4WJB A;  4MY3 A;  4PXB A;  3G3S A;  4Q7A A;  4TWE A;  2GIV A;  3B3V A;  3GYA A;  4JLY A;  2B4B A;  4JXQ A;  4OIW A;  5CBM A;  1X10 A;  1R57 A;  4MHZ A;  2OOT A;  2PJ5 A;  4JXR A;  1NMT A;  4PQA A;  4OAD A;  2XEJ A;  5EMI A;  5JGF A;  4U9Y A;  1QSR A;  2BSW A;  3KHZ A;  5G22 A;  5H84 A;  4A31 A;  4BMH A;  3PBB A;  4YU9 A;  2BO9 A;  2I79 A;  4B10 A;  2JBJ A;  4TNU A;  2PJ2 A;  3FBU A;  1ZLH A;  4O23 A;  4R3L A;  3IWG A;  4JZ0 A;  4YRH A;  2V8G A;  3JRU A;  2R98 A;  2ZEO A;  3NH5 A;  4KUA A;  3TC8 A;  5AG5 A;  4ZI6 A;  4F6A A;  1IY7 A;  4RUH A;  2I3C A;  2Q0Y A;  1XMT A;  3IWW A;  2HQY A;  2PRB A;  4PXD A;  3VAT A;  1FY7 A;  4W9Y A;  1Y0Y A;  3SJE A;  2C1C A;  2IMO A;  1XBU A;  2CY2 A;  4H2K A;  4KOT A;  4MFK A;  4LUA A;  4NCZ A;  1PU9 A;  3FED A;  1CPX A;  4KOY A;  4X5K A;  3VAR A;  5IB9 A;  1XRY A;  4I49 A;  4X3R A;  1OBR A;  2F7V A;  4PSX A;  2AFU A;  2Z3L A;  3IIB A;  3H5Z A;  2PJ1 A;  4MHD A;  4OME A;  1QMU A;  4XNH B;  3GUX A;  5AG7 A;  2Z3N A;  3TE4 A;  1RXT A;  1S5K A;  4X2T A;  1R43 A;  1KUV A;  2PVW A;  5LRJ A;  4NGS A;  1H8L A;  3G8W A;  4R7M A;  5HVH A;  1L0C A;  3NA6 A;  2PVV A;  3W6S A;  2QVP A;  2XEF A;  1S7K A;  2B5G B;  3FF3 A;  2CF4 A;  3H4Q A;  4NGT A;  4QUS A;  2CTB A;  2WPW A;  3PB4 X;  4R6T A;  2ZEE A;  3FH4 A;  1LRZ A;  3KKW A;  1YW6 A;  1S7L A;  4CS0 B;  2D4O A;  3BJ7 A;  4OP4 A;  4II9 A;  3SJG A;  4AVB A;  1XJO A;  1Z2L A;  1IID A;  4B12 A;  2FS5 A;  4M6H A;  4UCM A;  3IFE A;  4KOS A;  4FBE A;  4PV6 A;  3SXN A;  3KGQ A;  3JUW A;  4C2Z A;  4B5P A;  4OC3 A;  4BIN A;  4UA3 A;  3IU2 A;  1IGB A;  1IIC A;  2FCK A;  2O28 A;  2Z0Z A;  1B87 A;  4NGM A;  2POK A;  3BLN A;  4GS4 A;  4WWV A;  3S6G A;  4OC0 A;  3DLJ A;  5F46 A;  4CAW A;  4CGL A;  2R1I A;  2BL1 A;  1N71 A;  2JDC A;  2ZEN A;  5G21 A;  2Z3O A;  2J8R A;  1XE4 A;  2B58 A;  3EXN A;  3H8E A;  2ZOF A;  4OKO A;  3B3S A;  3RYO A;  4FWU A;  3PB7 X;  1PUA A;  3K2K A;  3NH8 A;  3S9N A;  5JH9 A;  2FT0 A;  3FMC A;  5GCN A;  4L89 A;  2PDO A;  2ZED A;  4C7I A;  1TKH A;  1Z4E A;  5JQ4 A;  2ZEG A;  3B8G A;  3LMS A;  3DR6 A;  5HMN A;  2JBK A;  1ARM A;  5IB0 A;  2V8H A;  2K5T A;  3EY5 A;  4MCP A;  3N5F A;  4PK3 A;  2F5I A;  4M6G A;  3D2M A;  2GFQ A;  4KVM E;  4KOU A;  4PSW A;  3R9F A;  4KVO E;  4CYO A;  5J8F A;  3L2N A;  2FSR A;  3GIU A;  3CXQ A;  3QAH A;  2OH1 A;  5F47 A;  4MI4 A;  4EFD A;  3LAC A;  2YND A;  4NFR A;  3BI1 A;  2G9D A;  1YME A;  1WK4 A;  3CZX A;  3GY9 A;  4HNX B;  1SQH A;  4YWY A;  3SI2 A;  1CM0 A;  4AB7 A;  2VXK A;  2ZW4 A;  3BXM A;  2QJ8 A;  3D66 A;  4Y49 B;  1Z8T A;  3ZZI A;  2J8M A;  1Q2C A;  4R76 A;  1CP6 A;  3D3S A;  2R7H A;  2ZW5 A;  4JWP A;  1IOI A;  3WT4 A;  4ZYQ A;  1ELM P;  2NSM A;  1Z8L A;  2PIZ A;  2FL4 A;  4FD6 A;  5LRG A;  2Y0M A;  4R9M A;  4LQ6 A;  3WC6 A;  1AMP A;  2FXF A;  1UFH A;  3TFY A;  1LAN A;  1LFW A;  4IUS A;  1JQG A;  3KHX A;  4KSA A;  1X12 A;  1XMB A;  3D7D A;  4C68 A;  2ZEP A;  1J4J A;  1S3Z A;  3ZJ0 A;  2PIY A;  4F9U A;  1GYT A;  1VKC A;  1HDU A;  3JTK A;  4XPD B;  3TTH A;  1HEE A;  1QSN A;  3PFE A;  4DJL A;  4MMO A;  1EE3 P;  4H6U A;  2HC9 A;  1P0H A;  2OZH A;  3D4U A;  4RS2 A;  2EK8 A;  4CYP A;  4PK2 A;  3W6X A;  5BWA B;  3DGV A;  2PJ6 A;  2AFS A;  4J3G A;  1VHO A;  4UEE A;  4A33 A;  2Q4Y A;  4AG9 A;  3TO9 A;  3WR7 A;  1M44 A;  5FVJ A;  2BOA A;  1IB1 E;  4B5P B;  4MXU A;  4CGM A;  2JDD A;  4MHY A;  2YGW A;  2VZZ A;  4K30 A;  4OLL A;  3IGR A;  1ON0 A;  2PJ9 A;  1YR0 A;  3QNV A;  3B7I A;  2Q7S A;  2V8V A;  5EBV A;  3FVL A;  5LRK A;  4KUB A;  4P4J A;  2QML A;  1Q2Y A;  4UEF A;  1IYK A;  1K4J A;  3CXP A;  1OZP A;  4P10 A;  3PGP A;  3IC1 A;  4HPS A;  3FIX A;  4IHM A;  4RN7 A;  3DR8 A;  3SI1 A;  1QST A;  3KL9 A;  3ISZ A;  4R3K A;  2CNS A;  2G3T A;  5ELY A;  1IOF A;  4ZY2 A;  1ZO0 A;  4GXH A;  1M4D A;  3HUV A;  2WYR A;  2OR4 A;  3PP9 A;  4CRY B;  4B13 A;  1NSL A;  5LYI A;  4GM5 A;  1YLE A;  2X7B A;  2PR1 A;  3PEI A;  4LQG A;  4FD7 A;  4EWT A;  5LYF A;  1IYL A;  4JYW A;  4FD5 A;  4PPZ A;  5AG6 A;  3GLJ A;  3PBE A;  2PCU A;  1Y9W A;  2Q44 A;  2VBQ A;  2C6C A;  2HV2 A;  5J8C A;  4CYQ A;  5K8O A;  4C7H A;  3N7Z A;  1QSM A;  4CAE A;  7CPA A;  2PSW A;  1KUX A;  3E0K A;  4UFW A;  3RBU A;  1F2O A;  3PB9 X;  2PR8 A;  2V8D A;  3B3W A;  3VH9 A;  8CPA A;  4CAV A;  1RO5 A;  1M4I A;  4P4F A;  4PXE A;  2PJA A;  4ONU A;  3S9L A;  4KZT A;  5I0C A;  2PQ8 A;  4C2Y A;  2Q4V A;  5LYL A;  1M4G A;  2GU2 A;  1ZG7 A;  3F8K A;  1M4L A;  3KR5 A;  4IAV A;  3T8W A;  1IU8 A;  4FD4 A;  3V38 A;  4EME A;  5CNP A;  3BI0 A;  5D29 A;  3KR4 A;  2HUZ A;  1RTQ A;  3H8F A;  3VWE A;  1YX0 A;  3TO6 A;  1U6M A;  3QB8 A;  2REF A;  5A27 A;  5JM6 A;  2PJ7 A;  2GLF A;  1Y7R A;  3I3G A;  4MFZ A;  3HLP A;  5F49 A;  4A30 A;  4A39 A;  3FXT A;  3EO4 A;  1LOK A;  1YVO A;  2EK9 A;  5C82 A;  2FE7 A;  1ZLI A;  3OWC A;  5DWN A;  3EC4 A;  2ARH A;  3K9T A;  4KSI A;  4P44 A;  2GE3 A;  1KWM A;  3D8P A;  3I1U A;  2EBJ A;  3R96 A;  2BCO A;  1I12 A;  3SHP A;  3F0A A;  1YVK A;  4QVT A;  2F8H A;  3T90 A;  3D2P A;  4R57 A;  5F48 A;  3EFA A;  2AFO A;  4CAF A;  3DNS A;  2AJ6 A;  2AE6 A;  4JJX A;  4OC2 A;  1BAV A;  2EVN A;  5K8M A;  4MJ8 A;  5I4M A;  1UWY A;  2RFH A;  1CP7 A;  1YSJ A;  4OID A;  5DS0 A;  2Z3K A;  2IQ6 A;  4NGN A;  3S6H A;  3VWD A;  4CGP A;  5A28 A;  5F09 A;  1F2P A;  2DPS A;  5HXD A;  3SJX A;  4CYN A;  2NMT A;  5K8P A;  4XNH C;  3IEH A;  4ORF A;  1CX8 A;  1Q7L A;  1Y7E A;  2OB0 A;  5G20 A;  2C6P A;  4H89 A;  2P6G A;  4FAI A;  4P4E A;  1S7N A;  3B3T A;  3S6K A;  2B5G A;  4Q38 A;  1GHE A;  4F9V A;  1CBX A;  1Q2D A;  2V77 A;  2ZW7 A;  3KI9 A;  4ZBG A;  2VEZ A;  4NJR A;  3D68 A;  2C6G A;  2J8N A;  3B35 A;  3SXO A;  3I9S A;  2OZU A;  2ZEL A;  3NFZ A;  3D7F A;  3NE8 A;  4ZGY B;  2R8V A;  1TXR A;  4RI1 A;  4DUK A;  2PJ8 A;  4A32 A;  5IX3 A;  3DSB A;  4UEZ A;  1YK3 A;  3IJ3 A;  5C88 A;  2ZW6 A;  4L8A A;  1TF8 A;  1JWQ A;  2D4P A;  3TCV A;  3D67 A;  5E96 A;  2ZPA A;  4E8O A;  1VHE A;  2QIR A;  3NE7 A;  4UF4 A;  2ZEH A;  2J9A A;  3FEE A;  1I1D A;  2ZEM A;  4XPL A;  3CT9 A;  2Q4Z A;  2HB6 A;  3B3C A;  2Q51 A;  3RAM A;  2O4H A;  2GLJ A;  1YGH A;  5AGE A;  4P4D A;  4IK2 A;  6CPA A;  5KTD A;  1WWZ A;  2G3A A;  3LOD A;  4LX9 A;  4Q36 A;  1XF8 A;  1AUG A;  4M6I A;  4BBH A;  4E0A A;  3SI0 A;  2GAN A;  2QEC A;  1XOV A;  4P45 A;  1QQ9 A;  4AXV A;  2B4D A;  4ZY0 A;  1TIQ A;  1Z5R A;  1F57 A;  3CPA A;  3RZA A;  1LCP A;  3R1K A;  1R3N A;  4M85 A;  2NYQ A;  4UFX A;  1PYT B;  1M1D A;  4KSF A;  4UWJ A;  4HNY B;  3TO7 A;  5J1Q A;  3KAS A;  2ZEF A;  4NGQ A;  3PB8 X;  2PJ3 A;  3BJ8 A;  4UWI A;  1Z9U A;  3JVN A;  5AG4 A;  4KOX A;  1AYE A;  2G0B A;  5G1Z A;  1Z8W A;  4ZX8 A;  2AFW A;  2VL1 A;  4OAE A;  5HH1 A;  3TOA A;  2ZOG A;  1P4N A;  2DPT A;  2DF5 A;  3IU1 A;  4E2A A;  2CIJ A;  2Q43 A;  5H86 A;  3KZW A;  4UCN A;  5HVF A;  3WAB A;  1CJW A;  2ABZ A;  2IL4 A;  2PJ4 A;  2XEI A;  1TKF A;  2KCW A;  3RO0 A;  1Z8X A;  4F0Y A;  4NGR A;  4QC6 A;  2EO8 A;  4P4I A;  1S7F A;  1MJB A;  4BD9 A;  4CAX A;  3P2H A;  3FB3 A;  4AVA A;  3LWU A;  1PCA A;  2P6F A;  4U9Z A;  1BPM A;  4MHN A;  1S60 A;  3MN8 A;  1VIX A;  3MRU A;  3CPX A;  3H8G A;  2Z3P A;  4UIB A;  4Y49 C;  3MGD A;  4A38 A;  3A9L A;  2AFM A;  4KOW A;  3GB0 A;  2Z3M A;  3BHX A;  4MBU A;  4B14 A;  4KVX A;  4UCP A;  4HKF A;  3W91 A;  3PFO A;  2OZG A;  2AFZ A;  1MJA A;  1B6B A;  2BEI A;  1KUY A;  1Y9K A;  4YGO A;  2WZN A;  4CGN A;  2BUE A;  3TT2 A;  4NSQ A;  1XEB A;  1ARL A;  2ANP A;  1FNO A;  4MCS A;  3DDD A;  3PB6 X;  4UIA A;  2O53 A;  4ONW A;  4EVY A;  1YRE A;  2YNE A;  3TX8 A;  4K3N A;  4B6Z A;  2FIW A;  1LAP A;  3S6F A;  3FX6 A;  3ISX A;  3PRT A;  2VI7 A;  4HNW B;  4KLV A;  4MFQ A;  4F8Z A;  4XPD C;  2JEW A;  3P2F A;  1DTD A;  3R95 A;  1V0C A;  3SJF A;  4CRZ B;  5CPA A;  4MFJ A;  5K8N A;  4XPK A;  3S9M A;  1BPN A;  2ODF A;  4CPA A;  4YFJ A;  1Z4R A;  4QB9 A;  3F5B A;  4KOR A;  4NJQ A;  2Z10 A;  4NXY A;  2XEG A;  5THW A;  1ZG9 A;  4NF1 A;  4G1P A;  2WPX A;  2JEV A;  4IF5 A;  1BLL E;  3FJU A;  1BOB A;  3IWE A;  4C2X A;  1QSO A;  4ZX9 A;  2A4N A;  4MRI A;  2FVG A;  1MK4 A;  2CTC A;  2GRE A;  4MHP A;  2PJC A;  2ATR A;  2FIA A;  3KQZ A;  2PE3 A;  3WC5 A;  3WC7 A;  3QAY A;  5KTC A;  1ZG8 A;  2Q04 A;  5LYD A;  1I21 A;  1NE9 A;  2DEA A;  3CDX A;  4KOV A;  4OC1 A;  2Q7B A;  3V8I A;  1XFO A;  3FRM A;  2H5M A;  3C26 A;  2B4D B;  2VZY A;  4Z65 A;  2WUU A;  3RNZ A;  2QYV A;  1YLO A;  2C27 A;  4DNC A;  1YQE A;  3D7H A;  4ZY1 A;  3CXS A;  4H6Z A;  5KTA A;  2PRQ A;  4JD6 A;  3R9E A;  2EWB A;  4R87 A;  4P4B A;  4MCR A;  2Z11 A;  3K9U A;  4X8I A;  4KLW A;  4A37 A;  5ISV A;  1HDQ A;  1KZF A;  4R8F A;  5JPH A;  4OC5 A;  1CPS A;  2EUI A;  4U5Y A;  4A94 A;  2JLM A;  4UBR A;  4CGO A;  1NSA A;  4OC4 A;  4AVC A;  1ELL P;  4DYO A;  1TF9 A;  2PC1 A;  1VHS A;  2AFX A;  2B3U A;  2YNC A;  3IO1 A;  2P0W A;  2RC4 A;  1BO4 A;  3FEC A;  5D8N A;  3TOB A;  3KQX A;  2OU2 A;  2PJ0 A;  4A95 A;  2P6E A;  2YNC C;  3D7G A;  3GKR A;  3T9Y A;  2ZXV A;  1YW4 A;  4M3S A;  2CNT A;  2IJZ A;  4MFP A;  1DE4 C;  4NGP A;  4FUU A;  2B3V A;  1XIX A;  4MFL A;  2WSA A; 
#chains in the Genus database with same CATH homology
 3B2Y A;  1CG2 A;  2PJB A;  2RB7 A;  3NH4 A;  1Y0R A;  3V7Z A;  1TKJ A;  5HVG A;  4PXC A;  1VGY A;  4P6Y A;  4MCQ A;  1LAM A;  1FT7 A;  4WJB A;  4PXB A;  4Q7A A;  3B3V A;  4OIW A;  5CBM A;  2OOT A;  4MHZ A;  2PJ5 A;  4PQA A;  2XEJ A;  5JGF A;  3KHZ A;  3PBB A;  4YU9 A;  2BO9 A;  2JBJ A;  4TNU A;  2PJ2 A;  1ZLH A;  4O23 A;  4JZ0 A;  2V8G A;  3JRU A;  3NH5 A;  2ZEO A;  3TC8 A;  4ZI6 A;  1IY7 A;  4RUH A;  2I3C A;  3IWW A;  3VAT A;  4PXD A;  3SJE A;  4W9Y A;  1Y0Y A;  2C1C A;  2IMO A;  1XBU A;  4H2K A;  4TWE A;  3FED A;  1CPX A;  3VAR A;  5IB9 A;  1XRY A;  4X3R A;  1OBR A;  2F7V A;  2AFU A;  3IIB A;  2PJ1 A;  4OME A;  1QMU A;  3GUX A;  4X2T A;  1R43 A;  2PVW A;  5LRJ A;  4NGS A;  1H8L A;  4R7M A;  5HVH A;  3NA6 A;  2PVV A;  2QVP A;  2XEF A;  4A37 A;  3FF3 A;  2CF4 A;  4NGT A;  2CTB A;  3PB4 X;  4R6T A;  2ZEE A;  3FH4 A;  1YW6 A;  4OP4 A;  3SJG A;  1XJO A;  1Z2L A;  3IFE A;  4FBE A;  3KGQ A;  4OC3 A;  1IGB A;  4NGM A;  2POK A;  4WWV A;  4OC0 A;  3DLJ A;  2ZEN A;  3H8E A;  2ZOF A;  4OKO A;  3B3S A;  4FWU A;  3PB7 X;  3K2K A;  3NH8 A;  3S9N A;  5JH9 A;  3FMC A;  2ZED A;  1TKH A;  2ZEG A;  3LMS A;  2JBK A;  1ARM A;  2V8H A;  4MCP A;  3N5F A;  3L2N A;  4EFD A;  4NFR A;  3BI1 A;  2G9D A;  1YME A;  4YWY A;  3SI2 A;  3BXM A;  2QJ8 A;  3D66 A;  4R76 A;  1CP6 A;  3WT4 A;  4ZYQ A;  1ELM P;  2NSM A;  1Z8L A;  2PIZ A;  5LRG A;  3WC6 A;  1AMP A;  1LAN A;  1LFW A;  1JQG A;  3KHX A;  1XMB A;  3D7D A;  2ZEP A;  2PIY A;  4F9U A;  1GYT A;  1HDU A;  1HEE A;  3PFE A;  4DJL A;  4MMO A;  1EE3 P;  2HC9 A;  3D4U A;  2EK8 A;  3DGV A;  2PJ6 A;  2AFS A;  4UEE A;  1VHO A;  2BOA A;  4MXU A;  4MHY A;  2PJ9 A;  3QNV A;  3B7I A;  2V8V A;  5LRK A;  3FVL A;  4P4J A;  4UEF A;  4P10 A;  3IC1 A;  4IHM A;  3SI1 A;  3KL9 A;  3ISZ A;  5ELY A;  4ZY2 A;  3HUV A;  2WYR A;  2OR4 A;  5LYI A;  4GM5 A;  3PEI A;  4EWT A;  4LQG A;  5LYF A;  4JYW A;  4PPZ A;  3GLJ A;  3PBE A;  2PCU A;  2C6C A;  5K8O A;  7CPA A;  3RBU A;  1F2O A;  3PB9 X;  3B3W A;  2V8D A;  3VH9 A;  8CPA A;  4P4F A;  4PXE A;  2PJA A;  3S9L A;  5LYL A;  2GU2 A;  1ZG7 A;  4IAV A;  1M4L A;  3KR5 A;  3T8W A;  4EME A;  3V38 A;  3BI0 A;  5D29 A;  3KR4 A;  1RTQ A;  3H8F A;  5JM6 A;  2PJ7 A;  2GLF A;  3HLP A;  4A39 A;  1LOK A;  2EK9 A;  1ZLI A;  3K9T A;  4KSI A;  4P44 A;  1KWM A;  3I1U A;  2BCO A;  2F8H A;  2AFO A;  4OC2 A;  1BAV A;  5K8M A;  5I4M A;  1UWY A;  2RFH A;  1CP7 A;  4OID A;  1YSJ A;  5DS0 A;  2IQ6 A;  4NGN A;  5F09 A;  1F2P A;  5K8P A;  5HXD A;  3SJX A;  3IEH A;  1CX8 A;  1Q7L A;  1Y7E A;  2C6P A;  4FAI A;  4P4E A;  3B3T A;  4F9V A;  1CBX A;  2V77 A;  3KI9 A;  4NJR A;  3D68 A;  2C6G A;  3B35 A;  3NFZ A;  2ZEL A;  3D7F A;  1TXR A;  4DUK A;  2PJ8 A;  4UEZ A;  3IJ3 A;  1TF8 A;  3D67 A;  1VHE A;  4UF4 A;  2ZEH A;  2J9A A;  3FEE A;  2ZEM A;  3CT9 A;  2Q4Z A;  2HB6 A;  3B3C A;  2Q51 A;  3RAM A;  2O4H A;  2GLJ A;  4P4D A;  4IK2 A;  6CPA A;  3SI0 A;  4P45 A;  1QQ9 A;  4AXV A;  4ZY0 A;  1Z5R A;  1F57 A;  3CPA A;  3RZA A;  1LCP A;  1R3N A;  2NYQ A;  1PYT B;  5J1Q A;  3KAS A;  2ZEF A;  4NGQ A;  3PB8 X;  2PJ3 A;  1AYE A;  4ZX8 A;  2AFW A;  2VL1 A;  2ZOG A;  2CIJ A;  2Q43 A;  3WAB A;  3KZW A;  5HVF A;  2ABZ A;  2XEI A;  2PJ4 A;  1TKF A;  4NGR A;  4P4I A;  4BD9 A;  3LWU A;  1PCA A;  1BPM A;  4MHN A;  3MN8 A;  1VIX A;  3MRU A;  3CPX A;  3H8G A;  4UIB A;  4A38 A;  2AFM A;  3GB0 A;  3BHX A;  3PFO A;  2AFZ A;  2WZN A;  4MCS A;  1ARL A;  2ANP A;  1FNO A;  4UIA A;  3PB6 X;  2O53 A;  4ONW A;  3TX8 A;  4K3N A;  4B6Z A;  1LAP A;  3FX6 A;  3ISX A;  3PRT A;  4F8Z A;  2JEW A;  1DTD A;  3SJF A;  5CPA A;  5K8N A;  3S9M A;  1BPN A;  4CPA A;  4NJQ A;  2XEG A;  5THW A;  1ZG9 A;  4G1P A;  1BLL E;  3FJU A;  4ZX9 A;  4MRI A;  2FVG A;  2CTC A;  2GRE A;  4MHP A;  2PJC A;  3KQZ A;  2PE3 A;  3WC5 A;  3WC7 A;  1ZG8 A;  5LYD A;  2DEA A;  3CDX A;  4OC1 A;  1XFO A;  4Z65 A;  2QYV A;  1YLO A;  3D7H A;  4ZY1 A;  2PRQ A;  2EWB A;  4P4B A;  4MCR A;  4X8I A;  1HDQ A;  4R8F A;  4OC5 A;  1CPS A;  4A94 A;  1NSA A;  4OC4 A;  1ELL P;  4DYO A;  1TF9 A;  2AFX A;  3IO1 A;  3FEC A;  5D8N A;  3KQX A;  2PJ0 A;  3D7G A;  1YW4 A;  2IJZ A;  1DE4 C;  4NGP A;  4FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...