2ANPA

Functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAHEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords leucyl aminopeptidase
publication title Kinetic, Spectroscopic, and X-ray Crystallographic Characterization of the Functional E151H Aminopeptidase from Aeromonas proteolytica.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2anpA00
2PJ0A 5JH9A 4MCPA 4DYOA 3FF3A 3GB0A 3RBUA 4OC0A 3B2YA 3NH4A 3D7FA 4YU9A 4CPAA 1YW4A 4DJLA 2CF4A 3FEDA 2Q43A 3V7ZA 4F9VA 4MCQA 4JZ0A 5LYLA 4A38A 4Q7AA 1M4LA 3I1UA 4YWYA 1ZLIA 2AFXA 3B35A 1ELLP 3B7IA 4MHNA 5LYDA 2ZEMA 1LOKA 1Y0RA 3BXMA 1F2PA 3H8FA 3RAMA 4NJQA 4X8IA 5ELYA 4UEZA 3PB6X 3TX8A 3KHZA 5D29A 2HB6A 2C6CA 1ZG7A 2EK9A 3IC1A 2I3CA 2V8HA 2PJ2A 3IFEA 1VHOA 3PB9X 1H8LA 1TKFA 3B3VA 4F9UA 2ZENA 2XEGA 2IQ6A 2PIZA 4DUKA 3FX6A 2WZNA 2C6GA 3ISZA 3FEEA 3FJUA 3LMSA 4UEFA 1DE4C 1XMBA 2PRQA 4H2KA 3D67A 3H8GA 4NFRA 2NSMA 4G1PA 3WC5A 4NGQA 1ZG8A 4WWVA 5K8MA 5F09A 1BAVA 1EE3P 3KR4A 3FH4A 2O4HA 2C1CA 1GYTA 4OIWA 2ZEGA 2PCUA 4UF4A 4ZY0A 1XJOA 5D8NA 4IAVA 5JGFA 2V8VA 3FMCA 4ZY2A 3B3TA 4NGRA 2IMOA 1QMUA 3IEHA 4FWUA 1IY7A 3K9TA 1Z2LA 1YMEA 7CPAA 4UIAA 4BD9A 3IO1A 2O53A 3PB8X 2AFWA 1ZG9A 3KR5A 2ZEEA 3SJGA 2BOAA 4FUUA 2EK8A 1XRYA 1OBRA 1Y0YA 2AFZA 3N5FA 2ZEFA 3PFEA 4AXVA 3PBBA 3SJXA 2EWBA 4R7MA 4MCSA 3KGQA 4ZYQA 1PCAA 4TWEA 1XFOA 3V38A 4PXCA 2XEJA 4LQGA 4P4FA 5IB9A 3KL9A 3D7GA 4PXDA 4EMEA 4NGSA 2F8HA 5HVFA 4P45A 1LCPA 3WC7A 4X3RA 1IGBA 2F7VA 1CPSA 4R76A 4OC2A 1BPNA 1CG2A 2ABZA 4OC5A 2PJ5A 2CTCA 3MRUA 4ZX9A 2POKA 5HVGA 3IWWA 1YLOA 2JBKA 1KWMA 2PJ8A 1LANA 1TXRA 2C6PA 3KHXA 5K8NA 4UEEA 4NGNA 3PFOA 4MXUA 3PB7X 1ARLA 3D7DA 4OP4A 2QYVA 4NJRA 4MCRA 1JQGA 1TF8A 1ELMP 5HVHA 4NGMA 4OC1A 4EFDA 3BI1A 2RFHA 4IK2A 3IJ3A 1HEEA 2AFSA 6CPAA 2PVVA 3CDXA 4NGPA 3DGVA 4F8ZA 3D4UA 1CX8A 2G9DA 4ZY1A 1FT7A 2FVGA 1PYTB 3FVLA 3L2NA 4OIDA 5HXDA 4MRIA 2ZEHA 2PJ6A 1QQ9A 3PRTA 1Z5RA 1CPXA 3NH8A 1HDUA 1RTQA 2NYQA 4P4BA 2IJZA 2GLJA 1ZLHA 3SJFA 3KQXA 4PXEA 4P4JA 3LWUA 2PJ7A 2PE3A 2PJAA 2QJ8A 4R8FA 3D7HA 3PEIA 4B6ZA 2GU2A 2XEIA 3WC6A 4TNUA 2PVWA 1CBXA 3HLPA 3MN8A 4GM5A 4PQAA 1TKHA 4P4IA 1VGYA 2OR4A 1LFWA 4JYWA 1NSAA 2ZEOA 1BPMA 2QVPA 3SI0A 2GREA 4MMOA 1LAPA 3D68A 5I4MA 3BI0A 4P4DA 4WJBA 2WYRA 1ARMA 2Q51A 4Z65A 4EWTA 3S9NA 3CT9A 5LRJA 2JEWA 2GLFA 3RZAA 2DEAA 3S9MA 4A39A 3FECA 4X2TA 5LYIA 4PXBA 1F57A 3VH9A 5THWA 1AMPA 3HUVA 3WABA 2PJCA 5K8OA 4P6YA 3D66A 4NGTA 4R6TA 3NFZA 4OKOA 1Y7EA 2JBJA 3K2KA 3B3CA 4P10A 5CBMA 3CPAA 3KASA 3GLJA 2Q4ZA 4MHYA 5LRGA 2VL1A 1Z8LA 2PJ9A 5LRKA 3S9LA 2PJBA 2CIJA 3NH5A 2J9AA 3H8EA 4UIBA 3B3WA 3SI2A 5J1QA 4ZI6A 5JM6A 2AFOA 2PJ3A 4PPZA 3KI9A 2V8DA 3WT4A 2BCOA 3PBEA 4KSIA 4O23A 3CPXA 2OOTA 3T8WA 2ANPA 4OC3A 4FBEA 3VARA 2CTBA 3IIBA 4ZX8A 3JRUA 3SJEA 4MHPA 2ZOFA 4A37A 4K3NA 3ISXA 4IHMA 1TKJA 1HDQA 3NA6A 1FNOA 4A94A 3KQZA 1R43A 5LYFA 2PJ1A 2PIYA 1TF9A 8CPAA 1CP6A 1R3NA 2PJ4A 4ONWA 2ZELA 4MHZA 5DS0A 4P4EA 2BO9A 2V77A 2V8GA 4FAIA 1F2OA 4OMEA 3PB4X 2RB7A 3QNVA 5K8PA 4RUHA 1LAMA 1YW6A 1BLLE 1VIXA 2ZEDA 4P44A 4OC4A 3SI1A 2ZEPA 3B3SA 1UWYA 1AYEA 4W9YA 2AFMA 3KZWA 3DLJA 3GUXA 1XBUA 3VATA 1YSJA 2HC9A 2AFUA 5CPAA 1DTDA 1Q7LA 1CP7A 2ZOGA 3BHXA 3TC8A 1VHEA 2XEFA
chains in the Genus database with same CATH superfamily
2OH1A 2PJ0A 3CXQA 2BSWA 1SQHA 5JH9A 4MCPA 4XPDB 4DYOA 1Q2CA 2FSRA 4GS4A 1S7NA 3FF3A 3GB0A 3RBUA 1I12A 4OC0A 3B2YA 3NH4A 3D7FA 4KS9A 3DDDA 2EUIA 4J3GA 4QC6A 4YU9A 5JQ4A 2R8VA 4CPAA 2VZZA 1YW4A 4R3LA 1I21A 4DJLA 5I0CA 2CF4A 1YVKA 3FEDA 1IIDA 2Q43A 4UBRA 1X10A 3V7ZA 4F9VA 1KZFA 4KVOE 3CZXA 4B12A 4MCQA 3LACA 4KOVA 4JZ0A 5LYLA 4A38A 4CYOA 1UFHA 1M4LA 4Q7AA 2CNSA 3I1UA 1Z8XA 3F8KA 1ZLIA 2AFXA 3B35A 4YWYA 1ELLP 1I1DA 1MJAA 3B7IA 3SXNA 4JWPA 4MHNA 2VEZA 4JJXA 5LYDA 2ZEMA 2Z11A 3TTHA 2FL4A 1LOKA 4H6ZA 1Y0RA 3SXOA 3BXMA 1F2PA 3H8FA 3TO6A 2Q7SA 1KUYA 1VKCA 2B5GB 4NJQA 4X8IA 3RAMA 2BL1A 4C2XA 2P0WA 4MY0A 4B5PB 5ELYA 3DR8A 2REEA 4UEZA 2Q44A 3PB6X 3KHZA 3TX8A 5D29A 2HB6A 5JPHA 4UCNA 2C6CA 5DWNA 1ZG7A 3TOAA 4AB7A 4KLVA 1S7KA 2GIVA 2EK9A 3RYOA 4CGPA 3IC1A 2BUEA 2I3CA 2Q04A 4F6AA 4E0AA 2PR8A 2Q0YA 2Z10A 5E96A 2V8HA 2PJ2A 3IFEA 1VHOA 3PB9X 1M1DA 1XEBA 2AJ6A 3PZJA 1H8LA 1TKFA 2CNMA 4PV6A 2DXQA 3B3VA 4KOSA 3PGPA 1Y9WA 4JXRA 4M85A 4YGOA 4F9UA 2ZENA 2XEGA 1P0HA 2B4DB 2ATRA 2IQ6A 1IOFA 2FT0A 4KUBA 4BBHA 2PIZA 5A28A 4DUKA 3FX6A 4M3SA 5C88A 3TE4A 2WZNA 3RO0A 3R9EA 2C6GA 3N7ZA 3TOBA 3ISZA 2GANA 3DSBA 2ZW7A 1X12A 2JEVA 3FJUA 3FEEA 1DE4C 3LMSA 4UEFA 2R7HA 1L0CA 1XMBA 3D8PA 2PRQA 3TO9A 4H2KA 4YFJA 3D67A 3NE7A 3H8GA 3I3GA 4CGMA 4NFRA 1XIXA 1KUXA 2NSMA 4G1PA 3JTKA 4C2YA 3WC5A 4NGQA 2ZW4A 1ZG8A 4WWVA 4JXQA 3CXPA 5G22A 1J4JA 4A31A 5AG6A 1BAVA 5F09A 2IL4A 5K8MA 1EE3P 3GKRA 3FH4A 3KR4A 4PSWA 5BWAB 3TFYA 2OU2A 2O4HA 2C1CA 1GYTA 4OIWA 2Q7BA 4XPKA 2ZEGA 1Y7RA 2PCUA 4Q38A 3EFAA 4UF4A 4ZY0A 2Q4YA 2Z3LA 1XJOA 5D8NA 2ZW5A 4CGNA 4IAVA 3VWDA 4ORFA 5JGFA 4HNXB 2V8VA 1B6BA 4X5KA 2BEIA 3FMCA 4ZY2A 3B3TA 2VZYA 2IMOA 2P6EA 2EVNA 4NGRA 3T90A 1QMUA 3IEHA 4FWUA 2B58A 1IY7A 3K9TA 4K30A 4LUAA 1Z2LA 1Z4EA 1YMEA 4MY3A 5EC4A 7CPAA 5J8CA 2J8NA 3BJ8A 4CRYB 4UIAA 4BD9A 2Z3KA 2JLMA 4RI1A 1Z8WA 3IO1A 5AGEA 4HPSA 2O53A 3PB8X 2AFWA 1ZG9A 3KR5A 1OZPA 2ZEEA 1RXTA 3SJGA 2BOAA 3JVNA 4FUUA 4HKFA 5KTAA 2EK8A 3R9FA 1XRYA 1OBRA 1Y0YA 2AFZA 3N5FA 2ZEFA 3PFEA 4AXVA 3PBBA 3SJXA 1QSTA 4HNYB 4MI4A 1MJ9A 2EWBA 2CXAA 2PR1A 5HH1A 3TT2A 4R7MA 1XE4A 3FB3A 4MCSA 3NE8A 3KGQA 2QIRA 2I79A 3I9SA 4ZYQA 1PCAA 4TWEA 1XFOA 2D4PA 3V38A 4NEXA 4PXCA 3RNZA 2VBQA 4FD6A 4A33A 2B3UA 2XEJA 4LQGA 4P4FA 5GCNA 3TO7A 4EVYA 2G3TA 5IB9A 2Z3PA 4MFPA 3KL9A 3D7GA 3V8IA 4LX9A 4PXDA 4EMEA 1QSNA 4NGSA 3GY9A 3VWEA 2F8HA 5HVFA 4P45A 1LCPA 4U9YA 3WC7A 4X3RA 4YRHA 1V0CA 1Z9UA 1IGBA 2F7VA 4UFWA 1S60A 4CAFA 1CPSA 4IUSA 1R57A 1B87A 4R76A 2QMLA 4FD7A 1XMTA 2WPXA 4OC2A 1AUGA 1BPNA 1CG2A 1YX0A 3DR6A 2AE6A 2ABZA 4OC5A 3W91A 4AVAA 4E2AA 4R9MA 2PJ5A 2CTCA 5F47A 2PC1A 3MRUA 4ZX9A 4Y49C 4B5OA 2POKA 5HVGA 2CNTA 3IWWA 4RS2A 1YLEA 1YLOA 4A32A 1QSMA 1YGHA 4B10A 2JBKA 3EO4A 4NCZA 3IWEA 1KWMA 2PJ8A 3G3SA 1LANA 1TXRA 2Z3OA 4NSQA 5IB0A 4CAVA 2C6PA 3KHXA 5K8NA 2O28A 5F48A 4UEEA 3PFOA 4NGNA 4XNHB 4L89A 4MXUA 3PB7X 3R1KA 4AG7A 1ARLA 4FD4A 1YVOA 1M44A 1Y9KA 3D2PA 3D7DA 4R3KA 3A9LA 4ZBGA 4KOTA 4OP4A 4CS0B 4KOXA 2QYVA 4NJRA 4MCRA 4R87A 1KUVA 1JQGA 1TF8A 1ELMP 2OZHA 5HVHA 4NGMA 1QSOA 3EXNA 4OC1A 4EFDA 1XF8A 3BI1A 2RFHA 4DNCA 4IK2A 3IJ3A 2R1IA 1GHEA 4QB9A 1S5KA 1HEEA 2AFSA 4MFLA 3R9GA 4CRZB 4MFJA 2J8RA 6CPAA 1ZO0A 4KVXA 4XPDC 2PVVA 2X7BA 1PU9A 3CDXA 4NGPA 5G1ZA 1S7FA 4M6IA 2GFQA 3DGVA 2FCKA 4AG9A 4BMHA 4CYNA 4F8ZA 3D4UA 4QVTA 1CX8A 4Q36A 4QBJA 2G9DA 2P6GA 4ZY1A 1M4DA 1FT7A 2FVGA 2RC4A 3KKWA 2F5IA 1PYTB 1XOVA 1ON0A 3FVLA 1A2ZA 3L2NA 4UFXA 4MFZA 4OIDA 5HXDA 4UA3A 3LD2A 4U9ZA 4MRIA 2ZEHA 4M6HA 2HQYA 3BJ7A 4MFQA 2PJ6A 1QQ9A 3PRTA 1Z5RA 4HNWB 2FS5A 4CAWA 1CPXA 3NH8A 3D3SA 1P4NA 3EY5A 3W6SA 4PK2A 1HDUA 1RTQA 2NYQA 4P4BA 4OLLA 5IV0A 2IJZA 3MGDA 2GLJA 1YR0A 2HV2A 3JUWA 1ZLHA 3F5BA 4B14A 3SJFA 3CXSA 3KQXA 4A2ZA 1IU8A 1Q2YA 2WSAA 4JLYA 4P4JA 4PXEA 2PJ7A 2PE3A 2PJAA 2QJ8A 3LWUA 3T9YA 4C7IA 4H6UA 4R8FA 3D7HA 2R98A 1LRZA 3PEIA 4B6ZA 2Z3NA 2GU2A 2XEIA 2D4OA 3WC6A 1YQEA 4TNUA 2PVWA 1CBXA 3HLPA 4M6GA 3MN8A 4GM5A 4PQAA 3QB8A 2OZUA 2ZXVA 2P6FA 1TKHA 4P4IA 1VGYA 2B5GA 4KOWA 4UFVA 1IYKA 4XNHC 2OR4A 1LFWA 5DWMA 5FVJA 4JYWA 2CY2A 4B5PA 4BINA 4CYPA 1NSAA 2ZEOA 3W6XA 2Z0ZA 1BPMA 2QVPA 3P2FA 1Z4RA 2ODFA 4MHDA 2GREA 3SI0A 1RO5A 4MMOA 1WK4A 1IYLA 1LAPA 3D68A 5I4MA 3BI0A 2FIAA 2WUUA 4MJ8A 5AG7A 3E0KA 4LQ6A 3OWCA 4P4DA 4WJBA 4KORA 4L8AA 4RN7A 2JDCA 4FD5A 2WYRA 3FIXA 2A4NA 4AVBA 5KTCA 1ARMA 2Q51A 3S6KA 4Z65A 4EWTA 3S9NA 1BO4A 1JWQA 4KSAA 3CT9A 2WPWA 2B4DA 5LRJA 2JEWA 3F0AA 2GLFA 5EBVA 2KCWA 3B8GA 5F49A 3RZAA 4U5YA 1CM0A 2DEAA 1S7LA 2B4BA 3H4QA 3QAHA 3S9MA 3ZZIA 1VHSA 3IU1A 4A39A 3FECA 4X2TA 5LYIA 4PXBA 1F57A 3VH9A 4CYQA 2ZPAA 5THWA 1AMPA 3H5ZA 1S3ZA 3GYAA 3HUVA 5C82A 4QUSA 2ARHA 3WABA 4OADA 4KLWA 2PJCA 2YGWA 5K8OA 4P6YA 3D66A 4B13A 5F46A 2VXKA 4A95A 3FRMA 1U6MA 4NGTA 4R6TA 3NFZA 4OKOA 1Y7EA 2JBJA 4E8OA 3K2KA 1NE9A 3B3CA 4P10A 5CBMA 3CPAA 1YREA 2PRBA 3KASA 3GLJA 2NMTA 2Q4ZA 4I49A 4MHYA 1Z8TA 1Q2DA 1IICA 3IGRA 5LRGA 2DPTA 2HUZA 5G20A 2VL1A 1Z8LA 3K9UA 2Z3MA 4UWJA 4CGLA 2PJ9A 5LRKA 3S9LA 2EO8A 5J8FA 2PJBA 2OZGA 2CIJA 3S6GA 3R95A 1FY7A 2JDDA 1MK4A 3NH5A 2J9AA 3H8EA 3TCVA 5G21A 2H5MA 4C68A 2PDOA 3B3WA 4UIBA 3SI2A 4ONUA 2EBJA 5J1QA 4GXHA 3EC4A 4ZI6A 2VQYA 1BOBA 2G3AA 2PQ8A 2VI7A 4KUAA 5IX3A 2Q4VA 5JM6A 2GE3A 1WWZA 2I00A 2AFOA 3FYNA 5KTDA 2PJ3A 4KOUA 1QSRA 4PPZA 4CGOA 3KI9A 4KSFA 3UY5A 4F0XA 2V8DA 3WT4A 5HMNA 2BCOA 3PBEA 1NMTA 4KSIA 3CPXA 4O23A 2OOTA 3T8WA 3QAYA 2ANPA 5H86A 4IF5A 4OC3A 4PK3A 4FBEA 3VARA 2CTBA 2QECA 3IIBA 4ZX8A 2YNEA 3JRUA 3SJEA 1NSLA 4MHPA 2ZOFA 3FNCA 1M4IA 3P2HA 4JD6A 4CAXA 1TIQA 2DPSA 4H89A 4A37A 4UWIA 5AG4A 3LODA 5A27A 1YK3A 3GIUA 4K3NA 3ISXA 2J8MA 4IHMA 2YNCC 4C7HA 3PP9A 1TKJA 1N71A 1HDQA 3NA6A 1FNOA 2B3VA 2FXFA 4KVME 4NXYA 3IU2A 4II9A 4A94A 2Y0MA 3KQZA 4R57A 1R43A 5LYFA 2OB0A 2PSWA 3BLNA 4PSXA 3S6FA 2PJ1A 2PIYA 1TF9A 2REFA 8CPAA 1CP6A 1R3NA 1M4GA 2YNCA 4MFKA 4A30A 4MBUA 2ZW6A 5ISVA 1MJBA 2DF5A 2K5TA 2PJ4A 3G8WA 5AG5A 4ONWA 2ZELA 4MHZA 5DS0A 4P4EA 2BO9A 2V77A 2V8GA 4KZTA 1IOIA 4OAEA 4B11A 4FAIA 4C2ZA 5EMIA 5H84A 1K4JA 3ZJ0A 2G0BA 1F2OA 4Y49B 4OMEA 4CAEA 3PB4X 3D2MA 2RB7A 1PUAA 3QNVA 5K8PA 3R96A 3C26A 4UCMA 5CNPA 1LAMA 4RUHA 1YW6A 1BLLE 1CJWA 1VIXA 2ZEDA 4P44A 3IWGA 3WR7A 4AVCA 2YNDA 4OC4A 3SI1A 4NF1A 4F0YA 4UCPA 3FXTA 2ZEPA 3B3SA 4KOYA 4ZGYB 2FE7A 2C27A 3S6HA 3SHPA 3DNSA 1UWYA 1AYEA 4W9YA 2AFMA 3KZWA 3DLJA 3GUXA 4XPLA 1XBUA 3FBUA 2FIWA 3VATA 1YSJA 2HC9A 2AFUA 5CPAA 1DTDA 1Q7LA 1CP7A 1IB1E 2ZOGA 3BHXA 3TC8A 1VHEA 2XEFA
chains in the Genus database with same CATH topology
2PJ0A 5JH9A 4MCPA 4DYOA 3FF3A 3GB0A 3RBUA 4OC0A 3B2YA 3NH4A 3D7FA 4YU9A 4CPAA 1YW4A 4DJLA 2CF4A 3FEDA 2Q43A 3V7ZA 4F9VA 4MCQA 4JZ0A 5LYLA 4A38A 4Q7AA 1M4LA 3I1UA 4YWYA 1ZLIA 2AFXA 3B35A 1ELLP 3B7IA 4MHNA 5LYDA 2ZEMA 1LOKA 1Y0RA 3BXMA 1F2PA 3H8FA 3RAMA 4NJQA 4X8IA 5ELYA 4UEZA 3PB6X 3TX8A 3KHZA 5D29A 2HB6A 2C6CA 1ZG7A 2EK9A 3IC1A 2I3CA 2V8HA 2PJ2A 3IFEA 1VHOA 3PB9X 1H8LA 1TKFA 3B3VA 4F9UA 2ZENA 2XEGA 2IQ6A 2PIZA 4DUKA 3FX6A 2WZNA 2C6GA 3ISZA 3FEEA 3FJUA 3LMSA 4UEFA 1DE4C 1XMBA 2PRQA 4H2KA 3D67A 3H8GA 4NFRA 2NSMA 4G1PA 3WC5A 4NGQA 1ZG8A 4WWVA 5K8MA 5F09A 1BAVA 1EE3P 3KR4A 3FH4A 2O4HA 2C1CA 1GYTA 4OIWA 2ZEGA 2PCUA 4UF4A 4ZY0A 1XJOA 5D8NA 4IAVA 5JGFA 2V8VA 3FMCA 4ZY2A 3B3TA 4NGRA 2IMOA 1QMUA 3IEHA 4FWUA 1IY7A 3K9TA 1Z2LA 1YMEA 7CPAA 4UIAA 4BD9A 3IO1A 2O53A 3PB8X 2AFWA 1ZG9A 3KR5A 2ZEEA 3SJGA 2BOAA 4FUUA 2EK8A 1XRYA 1OBRA 1Y0YA 2AFZA 3N5FA 2ZEFA 3PFEA 4AXVA 3PBBA 3SJXA 2EWBA 4R7MA 4MCSA 3KGQA 4ZYQA 1PCAA 4TWEA 1XFOA 3V38A 4PXCA 2XEJA 4LQGA 4P4FA 5IB9A 3KL9A 3D7GA 4PXDA 4EMEA 4NGSA 2F8HA 5HVFA 4P45A 1LCPA 3WC7A 4X3RA 1IGBA 2F7VA 1CPSA 4R76A 4OC2A 1BPNA 1CG2A 2ABZA 4OC5A 2PJ5A 2CTCA 3MRUA 4ZX9A 2POKA 5HVGA 3IWWA 1YLOA 2JBKA 1KWMA 2PJ8A 1LANA 1TXRA 2C6PA 3KHXA 5K8NA 4UEEA 4NGNA 3PFOA 4MXUA 3PB7X 1ARLA 3D7DA 4OP4A 2QYVA 4NJRA 4MCRA 1JQGA 1TF8A 1ELMP 5HVHA 4NGMA 4OC1A 4EFDA 3BI1A 2RFHA 4IK2A 3IJ3A 1HEEA 2AFSA 6CPAA 2PVVA 3CDXA 4NGPA 3DGVA 4F8ZA 3D4UA 1CX8A 2G9DA 4ZY1A 1FT7A 2FVGA 1PYTB 3FVLA 3L2NA 4OIDA 5HXDA 4MRIA 2ZEHA 2PJ6A 1QQ9A 3PRTA 1Z5RA 1CPXA 3NH8A 1HDUA 1RTQA 2NYQA 4P4BA 2IJZA 2GLJA 1ZLHA 3SJFA 3KQXA 4PXEA 4P4JA 3LWUA 2PJ7A 2PE3A 2PJAA 2QJ8A 4R8FA 3D7HA 3PEIA 4B6ZA 2GU2A 2XEIA 3WC6A 4TNUA 2PVWA 1CBXA 3HLPA 3MN8A 4GM5A 4PQAA 1TKHA 4P4IA 1VGYA 2OR4A 1LFWA 4JYWA 1NSAA 2ZEOA 1BPMA 2QVPA 3SI0A 2GREA 4MMOA 1LAPA 3D68A 5I4MA 3BI0A 4P4DA 4WJBA 2WYRA 1ARMA 2Q51A 4Z65A 4EWTA 3S9NA 3CT9A 5LRJA 2JEWA 2GLFA 3RZAA 2DEAA 3S9MA 4A39A 3FECA 4X2TA 5LYIA 4PXBA 1F57A 3VH9A 5THWA 1AMPA 3HUVA 3WABA 2PJCA 5K8OA 4P6YA 3D66A 4NGTA 4R6TA 3NFZA 4OKOA 1Y7EA 2JBJA 3K2KA 3B3CA 4P10A 5CBMA 3CPAA 3KASA 3GLJA 2Q4ZA 4MHYA 5LRGA 2VL1A 1Z8LA 2PJ9A 5LRKA 3S9LA 2PJBA 2CIJA 3NH5A 2J9AA 3H8EA 4UIBA 3B3WA 3SI2A 5J1QA 4ZI6A 5JM6A 2AFOA 2PJ3A 4PPZA 3KI9A 2V8DA 3WT4A 2BCOA 3PBEA 4KSIA 4O23A 3CPXA 2OOTA 3T8WA 2ANPA 4OC3A 4FBEA 3VARA 2CTBA 3IIBA 4ZX8A 3JRUA 3SJEA 4MHPA 2ZOFA 4A37A 4K3NA 3ISXA 4IHMA 1TKJA 1HDQA 3NA6A 1FNOA 4A94A 3KQZA 1R43A 5LYFA 2PJ1A 2PIYA 1TF9A 8CPAA 1CP6A 1R3NA 2PJ4A 4ONWA 2ZELA 4MHZA 5DS0A 4P4EA 2BO9A 2V77A 2V8GA 4FAIA 1F2OA 4OMEA 3PB4X 2RB7A 3QNVA 5K8PA 4RUHA 1LAMA 1YW6A 1BLLE 1VIXA 2ZEDA 4P44A 4OC4A 3SI1A 2ZEPA 3B3SA 1UWYA 1AYEA 4W9YA 2AFMA 3KZWA 3DLJA 3GUXA 1XBUA 3VATA 1YSJA 2HC9A 2AFUA 5CPAA 1DTDA 1Q7LA 1CP7A 2ZOGA 3BHXA 3TC8A 1VHEA 2XEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ0 A;  5JH9 A;  4MCP A;  4DYO A;  3FF3 A;  3GB0 A;  3RBU A;  4OC0 A;  3B2Y A;  3NH4 A;  3D7F A;  4YU9 A;  4CPA A;  1YW4 A;  4DJL A;  2CF4 A;  3FED A;  2Q43 A;  3V7Z A;  4F9V A;  4MCQ A;  4JZ0 A;  5LYL A;  4A38 A;  4Q7A A;  1M4L A;  3I1U A;  4YWY A;  1ZLI A;  2AFX A;  3B35 A;  1ELL P;  3B7I A;  4MHN A;  5LYD A;  2ZEM A;  1LOK A;  1Y0R A;  3BXM A;  1F2P A;  3H8F A;  3RAM A;  4NJQ A;  4X8I A;  5ELY A;  4UEZ A;  3PB6 X;  3TX8 A;  3KHZ A;  5D29 A;  2HB6 A;  2C6C A;  1ZG7 A;  2EK9 A;  3IC1 A;  2I3C A;  2V8H A;  2PJ2 A;  3IFE A;  1VHO A;  3PB9 X;  1H8L A;  1TKF A;  3B3V A;  4F9U A;  2ZEN A;  2XEG A;  2IQ6 A;  2PIZ A;  4DUK A;  3FX6 A;  2WZN A;  2C6G A;  3ISZ A;  3FEE A;  3FJU A;  3LMS A;  4UEF A;  1DE4 C;  1XMB A;  2PRQ A;  4H2K A;  3D67 A;  3H8G A;  4NFR A;  2NSM A;  4G1P A;  3WC5 A;  4NGQ A;  1ZG8 A;  4WWV A;  5K8M A;  5F09 A;  1BAV A;  1EE3 P;  3KR4 A;  3FH4 A;  2O4H A;  2C1C A;  1GYT A;  4OIW A;  2ZEG A;  2PCU A;  4UF4 A;  4ZY0 A;  1XJO A;  5D8N A;  4IAV A;  5JGF A;  2V8V A;  3FMC A;  4ZY2 A;  3B3T A;  4NGR A;  2IMO A;  1QMU A;  3IEH A;  4FWU A;  1IY7 A;  3K9T A;  1Z2L A;  1YME A;  7CPA A;  4UIA A;  4BD9 A;  3IO1 A;  2O53 A;  3PB8 X;  2AFW A;  1ZG9 A;  3KR5 A;  2ZEE A;  3SJG A;  2BOA A;  4FUU A;  2EK8 A;  1XRY A;  1OBR A;  1Y0Y A;  2AFZ A;  3N5F A;  2ZEF A;  3PFE A;  4AXV A;  3PBB A;  3SJX A;  2EWB A;  4R7M A;  4MCS A;  3KGQ A;  4ZYQ A;  1PCA A;  4TWE A;  1XFO A;  3V38 A;  4PXC A;  2XEJ A;  4LQG A;  4P4F A;  5IB9 A;  3KL9 A;  3D7G A;  4PXD A;  4EME A;  4NGS A;  2F8H A;  5HVF A;  4P45 A;  1LCP A;  3WC7 A;  4X3R A;  1IGB A;  2F7V A;  1CPS A;  4R76 A;  4OC2 A;  1BPN A;  1CG2 A;  2ABZ A;  4OC5 A;  2PJ5 A;  2CTC A;  3MRU A;  4ZX9 A;  2POK A;  5HVG A;  3IWW A;  1YLO A;  2JBK A;  1KWM A;  2PJ8 A;  1LAN A;  1TXR A;  2C6P A;  3KHX A;  5K8N A;  4UEE A;  4NGN A;  3PFO A;  4MXU A;  3PB7 X;  1ARL A;  3D7D A;  4OP4 A;  2QYV A;  4NJR A;  4MCR A;  1JQG A;  1TF8 A;  1ELM P;  5HVH A;  4NGM A;  4OC1 A;  4EFD A;  3BI1 A;  2RFH A;  4IK2 A;  3IJ3 A;  1HEE A;  2AFS A;  6CPA A;  2PVV A;  3CDX A;  4NGP A;  3DGV A;  4F8Z A;  3D4U A;  1CX8 A;  2G9D A;  4ZY1 A;  1FT7 A;  2FVG A;  1PYT B;  3FVL A;  3L2N A;  4OID A;  5HXD A;  4MRI A;  2ZEH A;  2PJ6 A;  1QQ9 A;  3PRT A;  1Z5R A;  1CPX A;  3NH8 A;  1HDU A;  1RTQ A;  2NYQ A;  4P4B A;  2IJZ A;  2GLJ A;  1ZLH A;  3SJF A;  3KQX A;  4PXE A;  4P4J A;  3LWU A;  2PJ7 A;  2PE3 A;  2PJA A;  2QJ8 A;  4R8F A;  3D7H A;  3PEI A;  4B6Z A;  2GU2 A;  2XEI A;  3WC6 A;  4TNU A;  2PVW A;  1CBX A;  3HLP A;  3MN8 A;  4GM5 A;  4PQA A;  1TKH A;  4P4I A;  1VGY A;  2OR4 A;  1LFW A;  4JYW A;  1NSA A;  2ZEO A;  1BPM A;  2QVP A;  3SI0 A;  2GRE A;  4MMO A;  1LAP A;  3D68 A;  5I4M A;  3BI0 A;  4P4D A;  4WJB A;  2WYR A;  1ARM A;  2Q51 A;  4Z65 A;  4EWT A;  3S9N A;  3CT9 A;  5LRJ A;  2JEW A;  2GLF A;  3RZA A;  2DEA A;  3S9M A;  4A39 A;  3FEC A;  4X2T A;  5LYI A;  4PXB A;  1F57 A;  3VH9 A;  5THW A;  1AMP A;  3HUV A;  3WAB A;  2PJC A;  5K8O A;  4P6Y A;  3D66 A;  4NGT A;  4R6T A;  3NFZ A;  4OKO A;  1Y7E A;  2JBJ A;  3K2K A;  3B3C A;  4P10 A;  5CBM A;  3CPA A;  3KAS A;  3GLJ A;  2Q4Z A;  4MHY A;  5LRG A;  2VL1 A;  1Z8L A;  2PJ9 A;  5LRK A;  3S9L A;  2PJB A;  2CIJ A;  3NH5 A;  2J9A A;  3H8E A;  4UIB A;  3B3W A;  3SI2 A;  5J1Q A;  4ZI6 A;  5JM6 A;  2AFO A;  2PJ3 A;  4PPZ A;  3KI9 A;  2V8D A;  3WT4 A;  2BCO A;  3PBE A;  4KSI A;  4O23 A;  3CPX A;  2OOT A;  3T8W A;  2ANP A;  4OC3 A;  4FBE A;  3VAR A;  2CTB A;  3IIB A;  4ZX8 A;  3JRU A;  3SJE A;  4MHP A;  2ZOF A;  4A37 A;  4K3N A;  3ISX A;  4IHM A;  1TKJ A;  1HDQ A;  3NA6 A;  1FNO A;  4A94 A;  3KQZ A;  1R43 A;  5LYF A;  2PJ1 A;  2PIY A;  1TF9 A;  8CPA A;  1CP6 A;  1R3N A;  2PJ4 A;  4ONW A;  2ZEL A;  4MHZ A;  5DS0 A;  4P4E A;  2BO9 A;  2V77 A;  2V8G A;  4FAI A;  1F2O A;  4OME A;  3PB4 X;  2RB7 A;  3QNV A;  5K8P A;  4RUH A;  1LAM A;  1YW6 A;  1BLL E;  1VIX A;  2ZED A;  4P44 A;  4OC4 A;  3SI1 A;  2ZEP A;  3B3S A;  1UWY A;  1AYE A;  4W9Y A;  2AFM A;  3KZW A;  3DLJ A;  3GUX A;  1XBU A;  3VAT A;  1YSJ A;  2HC9 A;  2AFU A;  5CPA A;  1DTD A;  1Q7L A;  1CP7 A;  2ZOG A;  3BHX A;  3TC8 A;  1VHE A;  2XEF A; 
#chains in the Genus database with same CATH topology
 2OH1 A;  2PJ0 A;  3CXQ A;  2BSW A;  1SQH A;  5JH9 A;  4MCP A;  4XPD B;  4DYO A;  1Q2C A;  2FSR A;  4GS4 A;  1S7N A;  3FF3 A;  3GB0 A;  3RBU A;  1I12 A;  4OC0 A;  3B2Y A;  3NH4 A;  3D7F A;  4KS9 A;  3DDD A;  2EUI A;  4J3G A;  4QC6 A;  4YU9 A;  5JQ4 A;  2R8V A;  4CPA A;  2VZZ A;  1YW4 A;  4R3L A;  1I21 A;  4DJL A;  5I0C A;  2CF4 A;  1YVK A;  3FED A;  1IID A;  2Q43 A;  4UBR A;  1X10 A;  3V7Z A;  4F9V A;  1KZF A;  4KVO E;  3CZX A;  4B12 A;  4MCQ A;  3LAC A;  4KOV A;  4JZ0 A;  5LYL A;  4A38 A;  4CYO A;  1UFH A;  1M4L A;  4Q7A A;  2CNS A;  3I1U A;  1Z8X A;  3F8K A;  1ZLI A;  2AFX A;  3B35 A;  4YWY A;  1ELL P;  1I1D A;  1MJA A;  3B7I A;  3SXN A;  4JWP A;  4MHN A;  2VEZ A;  4JJX A;  5LYD A;  2ZEM A;  2Z11 A;  3TTH A;  2FL4 A;  1LOK A;  4H6Z A;  1Y0R A;  3SXO A;  3BXM A;  1F2P A;  3H8F A;  3TO6 A;  2Q7S A;  1KUY A;  1VKC A;  2B5G B;  4NJQ A;  4X8I A;  3RAM A;  2BL1 A;  4C2X A;  2P0W A;  4MY0 A;  4B5P B;  5ELY A;  3DR8 A;  2REE A;  4UEZ A;  2Q44 A;  3PB6 X;  3KHZ A;  3TX8 A;  5D29 A;  2HB6 A;  5JPH A;  4UCN A;  2C6C A;  5DWN A;  1ZG7 A;  3TOA A;  4AB7 A;  4KLV A;  1S7K A;  2GIV A;  2EK9 A;  3RYO A;  4CGP A;  3IC1 A;  2BUE A;  2I3C A;  2Q04 A;  4F6A A;  4E0A A;  2PR8 A;  2Q0Y A;  2Z10 A;  5E96 A;  2V8H A;  2PJ2 A;  3IFE A;  1VHO A;  3PB9 X;  1M1D A;  1XEB A;  2AJ6 A;  3PZJ A;  1H8L A;  1TKF A;  2CNM A;  4PV6 A;  2DXQ A;  3B3V A;  4KOS A;  3PGP A;  1Y9W A;  4JXR A;  4M85 A;  4YGO A;  4F9U A;  2ZEN A;  2XEG A;  1P0H A;  2B4D B;  2ATR A;  2IQ6 A;  1IOF A;  2FT0 A;  4KUB A;  4BBH A;  2PIZ A;  5A28 A;  4DUK A;  3FX6 A;  4M3S A;  5C88 A;  3TE4 A;  2WZN A;  3RO0 A;  3R9E A;  2C6G A;  3N7Z A;  3TOB A;  3ISZ A;  2GAN A;  3DSB A;  2ZW7 A;  1X12 A;  2JEV A;  3FJU A;  3FEE A;  1DE4 C;  3LMS A;  4UEF A;  2R7H A;  1L0C A;  1XMB A;  3D8P A;  2PRQ A;  3TO9 A;  4H2K A;  4YFJ A;  3D67 A;  3NE7 A;  3H8G A;  3I3G A;  4CGM A;  4NFR A;  1XIX A;  1KUX A;  2NSM A;  4G1P A;  3JTK A;  4C2Y A;  3WC5 A;  4NGQ A;  2ZW4 A;  1ZG8 A;  4WWV A;  4JXQ A;  3CXP A;  5G22 A;  1J4J A;  4A31 A;  5AG6 A;  1BAV A;  5F09 A;  2IL4 A;  5K8M A;  1EE3 P;  3GKR A;  3FH4 A;  3KR4 A;  4PSW A;  5BWA B;  3TFY A;  2OU2 A;  2O4H A;  2C1C A;  1GYT A;  4OIW A;  2Q7B A;  4XPK A;  2ZEG A;  1Y7R A;  2PCU A;  4Q38 A;  3EFA A;  4UF4 A;  4ZY0 A;  2Q4Y A;  2Z3L A;  1XJO A;  5D8N A;  2ZW5 A;  4CGN A;  4IAV A;  3VWD A;  4ORF A;  5JGF A;  4HNX B;  2V8V A;  1B6B A;  4X5K A;  2BEI A;  3FMC A;  4ZY2 A;  3B3T A;  2VZY A;  2IMO A;  2P6E A;  2EVN A;  4NGR A;  3T90 A;  1QMU A;  3IEH A;  4FWU A;  2B58 A;  1IY7 A;  3K9T A;  4K30 A;  4LUA A;  1Z2L A;  1Z4E A;  1YME A;  4MY3 A;  5EC4 A;  7CPA A;  5J8C A;  2J8N A;  3BJ8 A;  4CRY B;  4UIA A;  4BD9 A;  2Z3K A;  2JLM A;  4RI1 A;  1Z8W A;  3IO1 A;  5AGE A;  4HPS A;  2O53 A;  3PB8 X;  2AFW A;  1ZG9 A;  3KR5 A;  1OZP A;  2ZEE A;  1RXT A;  3SJG A;  2BOA A;  3JVN A;  4FUU A;  4HKF A;  5KTA A;  2EK8 A;  3R9F A;  1XRY A;  1OBR A;  1Y0Y A;  2AFZ A;  3N5F A;  2ZEF A;  3PFE A;  4AXV A;  3PBB A;  3SJX A;  1QST A;  4HNY B;  4MI4 A;  1MJ9 A;  2EWB A;  2CXA A;  2PR1 A;  5HH1 A;  3TT2 A;  4R7M A;  1XE4 A;  3FB3 A;  4MCS A;  3NE8 A;  3KGQ A;  2QIR A;  2I79 A;  3I9S A;  4ZYQ A;  1PCA A;  4TWE A;  1XFO A;  2D4P A;  3V38 A;  4NEX A;  4PXC A;  3RNZ A;  2VBQ A;  4FD6 A;  4A33 A;  2B3U A;  2XEJ A;  4LQG A;  4P4F A;  5GCN A;  3TO7 A;  4EVY A;  2G3T A;  5IB9 A;  2Z3P A;  4MFP A;  3KL9 A;  3D7G A;  3V8I A;  4LX9 A;  4PXD A;  4EME A;  1QSN A;  4NGS A;  3GY9 A;  3VWE A;  2F8H A;  5HVF A;  4P45 A;  1LCP A;  4U9Y A;  3WC7 A;  4X3R A;  4YRH A;  1V0C A;  1Z9U A;  1IGB A;  2F7V A;  4UFW A;  1S60 A;  4CAF A;  1CPS A;  4IUS A;  1R57 A;  1B87 A;  4R76 A;  2QML A;  4FD7 A;  1XMT A;  2WPX A;  4OC2 A;  1AUG A;  1BPN A;  1CG2 A;  1YX0 A;  3DR6 A;  2AE6 A;  2ABZ A;  4OC5 A;  3W91 A;  4AVA A;  4E2A A;  4R9M A;  2PJ5 A;  2CTC A;  5F47 A;  2PC1 A;  3MRU A;  4ZX9 A;  4Y49 C;  4B5O A;  2POK A;  5HVG A;  2CNT A;  3IWW A;  4RS2 A;  1YLE A;  1YLO A;  4A32 A;  1QSM A;  1YGH A;  4B10 A;  2JBK A;  3EO4 A;  4NCZ A;  3IWE A;  1KWM A;  2PJ8 A;  3G3S A;  1LAN A;  1TXR A;  2Z3O A;  4NSQ A;  5IB0 A;  4CAV A;  2C6P A;  3KHX A;  5K8N A;  2O28 A;  5F48 A;  4UEE A;  3PFO A;  4NGN A;  4XNH B;  4L89 A;  4MXU A;  3PB7 X;  3R1K A;  4AG7 A;  1ARL A;  4FD4 A;  1YVO A;  1M44 A;  1Y9K A;  3D2P A;  3D7D A;  4R3K A;  3A9L A;  4ZBG A;  4KOT A;  4OP4 A;  4CS0 B;  4KOX A;  2QYV A;  4NJR A;  4MCR A;  4R87 A;  1KUV A;  1JQG A;  1TF8 A;  1ELM P;  2OZH A;  5HVH A;  4NGM A;  1QSO A;  3EXN A;  4OC1 A;  4EFD A;  1XF8 A;  3BI1 A;  2RFH A;  4DNC A;  4IK2 A;  3IJ3 A;  2R1I A;  1GHE A;  4QB9 A;  1S5K A;  1HEE A;  2AFS A;  4MFL A;  3R9G A;  4CRZ B;  4MFJ A;  2J8R A;  6CPA A;  1ZO0 A;  4KVX A;  4XPD C;  2PVV A;  2X7B A;  1PU9 A;  3CDX A;  4NGP A;  5G1Z A;  1S7F A;  4M6I A;  2GFQ A;  3DGV A;  2FCK A;  4AG9 A;  4BMH A;  4CYN A;  4F8Z A;  3D4U A;  4QVT A;  1CX8 A;  4Q36 A;  4QBJ A;  2G9D A;  2P6G A;  4ZY1 A;  1M4D A;  1FT7 A;  2FVG A;  2RC4 A;  3KKW A;  2F5I A;  1PYT B;  1XOV A;  1ON0 A;  3FVL A;  1A2Z A;  3L2N A;  4UFX A;  4MFZ A;  4OID A;  5HXD A;  4UA3 A;  3LD2 A;  4U9Z A;  4MRI A;  2ZEH A;  4M6H A;  2HQY A;  3BJ7 A;  4MFQ A;  2PJ6 A;  1QQ9 A;  3PRT A;  1Z5R A;  4HNW B;  2FS5 A;  4CAW A;  1CPX A;  3NH8 A;  3D3S A;  1P4N A;  3EY5 A;  3W6S A;  4PK2 A;  1HDU A;  1RTQ A;  2NYQ A;  4P4B A;  4OLL A;  5IV0 A;  2IJZ A;  3MGD A;  2GLJ A;  1YR0 A;  2HV2 A;  3JUW A;  1ZLH A;  3F5B A;  4B14 A;  3SJF A;  3CXS A;  3KQX A;  4A2Z A;  1IU8 A;  1Q2Y A;  2WSA A;  4JLY A;  4P4J A;  4PXE A;  2PJ7 A;  2PE3 A;  2PJA A;  2QJ8 A;  3LWU A;  3T9Y A;  4C7I A;  4H6U A;  4R8F A;  3D7H A;  2R98 A;  1LRZ A;  3PEI A;  4B6Z A;  2Z3N A;  2GU2 A;  2XEI A;  2D4O A;  3WC6 A;  1YQE A;  4TNU A;  2PVW A;  1CBX A;  3HLP A;  4M6G A;  3MN8 A;  4GM5 A;  4PQA A;  3QB8 A;  2OZU A;  2ZXV A;  2P6F A;  1TKH A;  4P4I A;  1VGY A;  2B5G A;  4KOW A;  4UFV A;  1IYK A;  4XNH C;  2OR4 A;  1LFW A;  5DWM A;  5FVJ A;  4JYW A;  2CY2 A;  4B5P A;  4BIN A;  4CYP A;  1NSA A;  2ZEO A;  3W6X A;  2Z0Z A;  1BPM A;  2QVP A;  3P2F A;  1Z4R A;  2ODF A;  4MHD A;  2GRE A;  3SI0 A;  1RO5 A;  4MMO A;  1WK4 A;  1IYL A;  1LAP A;  3D68 A;  5I4M A;  3BI0 A;  2FIA A;  2WUU A;  4MJ8 A;  5AG7 A;  3E0K A;  4LQ6 A;  3OWC A;  4P4D A;  4WJB A;  4KOR A;  4L8A A;  4RN7 A;  2JDC A;  4FD5 A;  2WYR A;  3FIX A;  2A4N A;  4AVB A;  5KTC A;  1ARM A;  2Q51 A;  3S6K A;  4Z65 A;  4EWT A;  3S9N A;  1BO4 A;  1JWQ A;  4KSA A;  3CT9 A;  2WPW A;  2B4D A;  5LRJ A;  2JEW A;  3F0A A;  2GLF A;  5EBV A;  2KCW A;  3B8G A;  5F49 A;  3RZA A;  4U5Y A;  1CM0 A;  2DEA A;  1S7L A;  2B4B A;  3H4Q A;  3QAH A;  3S9M A;  3ZZI A;  1VHS A;  3IU1 A;  4A39 A;  3FEC A;  4X2T A;  5LYI A;  4PXB A;  1F57 A;  3VH9 A;  4CYQ A;  2ZPA A;  5THW A;  1AMP A;  3H5Z A;  1S3Z A;  3GYA A;  3HUV A;  5C82 A;  4QUS A;  2ARH A;  3WAB A;  4OAD A;  4KLW A;  2PJC A;  2YGW A;  5K8O A;  4P6Y A;  3D66 A;  4B13 A;  5F46 A;  2VXK A;  4A95 A;  3FRM A;  1U6M A;  4NGT A;  4R6T A;  3NFZ A;  4OKO A;  1Y7E A;  2JBJ A;  4E8O A;  3K2K A;  1NE9 A;  3B3C A;  4P10 A;  5CBM A;  3CPA A;  1YRE A;  2PRB A;  3KAS A;  3GLJ A;  2NMT A;  2Q4Z A;  4I49 A;  4MHY A;  1Z8T A;  1Q2D A;  1IIC A;  3IGR A;  5LRG A;  2DPT A;  2HUZ A;  5G20 A;  2VL1 A;  1Z8L A;  3K9U A;  2Z3M A;  4UWJ A;  4CGL A;  2PJ9 A;  5LRK A;  3S9L A;  2EO8 A;  5J8F A;  2PJB A;  2OZG A;  2CIJ A;  3S6G A;  3R95 A;  1FY7 A;  2JDD A;  1MK4 A;  3NH5 A;  2J9A A;  3H8E A;  3TCV A;  5G21 A;  2H5M A;  4C68 A;  2PDO A;  3B3W A;  4UIB A;  3SI2 A;  4ONU A;  2EBJ A;  5J1Q A;  4GXH A;  3EC4 A;  4ZI6 A;  2VQY A;  1BOB A;  2G3A A;  2PQ8 A;  2VI7 A;  4KUA A;  5IX3 A;  2Q4V A;  5JM6 A;  2GE3 A;  1WWZ A;  2I00 A;  2AFO A;  3FYN A;  5KTD A;  2PJ3 A;  4KOU A;  1QSR A;  4PPZ A;  4CGO A;  3KI9 A;  4KSF A;  3UY5 A;  4F0X A;  2V8D A;  3WT4 A;  5HMN A;  2BCO A;  3PBE A;  1NMT A;  4KSI A;  3CPX A;  4O23 A;  2OOT A;  3T8W A;  3QAY A;  2ANP A;  5H86 A;  4IF5 A;  4OC3 A;  4PK3 A;  4FBE A;  3VAR A;  2CTB A;  2QEC A;  3IIB A;  4ZX8 A;  2YNE A;  3JRU A;  3SJE A;  1NSL A;  4MHP A;  2ZOF A;  3FNC A;  1M4I A;  3P2H A;  4JD6 A;  4CAX A;  1TIQ A;  2DPS A;  4H89 A;  4A37 A;  4UWI A;  5AG4 A;  3LOD A;  5A27 A;  1YK3 A;  3GIU A;  4K3N A;  3ISX A;  2J8M A;  4IHM A;  2YNC C;  4C7H A;  3PP9 A;  1TKJ A;  1N71 A;  1HDQ A;  3NA6 A;  1FNO A;  2B3V A;  2FXF A;  4KVM E;  4NXY A;  3IU2 A;  4II9 A;  4A94 A;  2Y0M A;  3KQZ A;  4R57 A;  1R43 A;  5LYF A;  2OB0 A;  2PSW A;  3BLN A;  4PSX A;  3S6F A;  2PJ1 A;  2PIY A;  1TF9 A;  2REF A;  8CPA A;  1CP6 A;  1R3N A;  1M4G A;  2YNC A;  4MFK A;  4A30 A;  4MBU A;  2ZW6 A;  5ISV A;  1MJB A;  2DF5 A;  2K5T A;  2PJ4 A;  3G8W A;  5AG5 A;  4ONW A;  2ZEL A;  4MHZ A;  5DS0 A;  4P4E A;  2BO9 A;  2V77 A;  2V8G A;  4KZT A;  1IOI A;  4OAE A;  4B11 A;  4FAI A;  4C2Z A;  5EMI A;  5H84 A;  1K4J A;  3ZJ0 A;  2G0B A;  1F2O A;  4Y49 B;  4OME A;  4CAE A;  3PB4 X;  3D2M A;  2RB7 A;  1PUA A;  3QNV A;  5K8P A;  3R96 A;  3C26 A;  4UCM A;  5CNP A;  1LAM A;  4RUH A;  1YW6 A;  1BLL E;  1CJW A;  1VIX A;  2ZED A;  4P44 A;  3IWG A;  3WR7 A;  4AVC A;  2YND A;  4OC4 A;  3SI1 A;  4NF1 A;  4F0Y A;  4UCP A;  3FXT A;  2ZEP A;  3B3S A;  4KOY A;  4ZGY B;  2FE7 A;  2C27 A;  3S6H A;  3SHP A;  3DNS A;  1UWY A;  1AYE A;  4W9Y A;  2AFM A;  3KZW A;  3DLJ A;  3GUX A;  4XPL A;  1XBU A;  3FBU A;  2FIW A;  3VAT A;  1YSJ A;  2HC9 A;  2AFU A;  5CPA A;  1DTD A;  1Q7L A;  1CP7 A;  1IB1 E;  2ZOG A;  3BHX A;  3TC8 A;  1VHE A;  2XEF A; 
#chains in the Genus database with same CATH homology
 2PJ0 A;  5JH9 A;  4MCP A;  4DYO A;  3FF3 A;  3GB0 A;  3RBU A;  4OC0 A;  3B2Y A;  3NH4 A;  3D7F A;  4YU9 A;  4CPA A;  1YW4 A;  4DJL A;  2CF4 A;  3FED A;  2Q43 A;  3V7Z A;  4F9V A;  4MCQ A;  4JZ0 A;  5LYL A;  4A38 A;  4Q7A A;  1M4L A;  3I1U A;  4YWY A;  1ZLI A;  2AFX A;  3B35 A;  1ELL P;  3B7I A;  4MHN A;  5LYD A;  2ZEM A;  1LOK A;  1Y0R A;  3BXM A;  1F2P A;  3H8F A;  3RAM A;  4NJQ A;  4X8I A;  5ELY A;  4UEZ A;  3PB6 X;  3TX8 A;  3KHZ A;  5D29 A;  2HB6 A;  2C6C A;  1ZG7 A;  2EK9 A;  3IC1 A;  2I3C A;  2V8H A;  2PJ2 A;  3IFE A;  1VHO A;  3PB9 X;  1H8L A;  1TKF A;  3B3V A;  4F9U A;  2ZEN A;  2XEG A;  2IQ6 A;  2PIZ A;  4DUK A;  3FX6 A;  2WZN A;  2C6G A;  3ISZ A;  3FEE A;  3FJU A;  3LMS A;  4UEF A;  1DE4 C;  1XMB A;  2PRQ A;  4H2K A;  3D67 A;  3H8G A;  4NFR A;  2NSM A;  4G1P A;  3WC5 A;  4NGQ A;  1ZG8 A;  4WWV A;  5K8M A;  5F09 A;  1BAV A;  1EE3 P;  3KR4 A;  3FH4 A;  2O4H A;  2C1C A;  1GYT A;  4OIW A;  2ZEG A;  2PCU A;  4UF4 A;  4ZY0 A;  1XJO A;  5D8N A;  4IAV A;  5JGF A;  2V8V A;  3FMC A;  4ZY2 A;  3B3T A;  4NGR A;  2IMO A;  1QMU A;  3IEH A;  4FWU A;  1IY7 A;  3K9T A;  1Z2L A;  1YME A;  7CPA A;  4UIA A;  4BD9 A;  3IO1 A;  2O53 A;  3PB8 X;  2AFW A;  1ZG9 A;  3KR5 A;  2ZEE A;  3SJG A;  2BOA A;  4FUU A;  2EK8 A;  1XRY A;  1OBR A;  1Y0Y A;  2AFZ A;  3N5F A;  2ZEF A;  3PFE A;  4AXV A;  3PBB A;  3SJX A;  2EWB A;  4R7M A;  4MCS A;  3KGQ A;  4ZYQ A;  1PCA A;  4TWE A;  1XFO A;  3V38 A;  4PXC A;  2XEJ A;  4LQG A;  4P4F A;  5IB9 A;  3KL9 A;  3D7G A;  4PXD A;  4EME A;  4NGS A;  2F8H A;  5HVF A;  4P45 A;  1LCP A;  3WC7 A;  4X3R A;  1IGB A;  2F7V A;  1CPS A;  4R76 A;  4OC2 A;  1BPN A;  1CG2 A;  2ABZ A;  4OC5 A;  2PJ5 A;  2CTC A;  3MRU A;  4ZX9 A;  2POK A;  5HVG A;  3IWW A;  1YLO A;  2JBK A;  1KWM A;  2PJ8 A;  1LAN A;  1TXR A;  2C6P A;  3KHX A;  5K8N A;  4UEE A;  4NGN A;  3PFO A;  4MXU A;  3PB7 X;  1ARL A;  3D7D A;  4OP4 A;  2QYV A;  4NJR A;  4MCR A;  1JQG A;  1TF8 A;  1ELM P;  5HVH A;  4NGM A;  4OC1 A;  4EFD A;  3BI1 A;  2RFH A;  4IK2 A;  3IJ3 A;  1HEE A;  2AFS A;  6CPA A;  2PVV A;  3CDX A;  4NGP A;  3DGV A;  4F8Z A;  3D4U A;  1CX8 A;  2G9D A;  4ZY1 A;  1FT7 A;  2FVG A;  1PYT B;  3FVL A;  3L2N A;  4OID A;  5HXD A;  4MRI A;  2ZEH A;  2PJ6 A;  1QQ9 A;  3PRT A;  1Z5R A;  1CPX A;  3NH8 A;  1HDU A;  1RTQ A;  2NYQ A;  4P4B A;  2IJZ A;  2GLJ A;  1ZLH A;  3SJF A;  3KQX A;  4PXE A;  4P4J A;  3LWU A;  2PJ7 A;  2PE3 A;  2PJA A;  2QJ8 A;  4R8F A;  3D7H A;  3PEI A;  4B6Z A;  2GU2 A;  2XEI A;  3WC6 A;  4TNU A;  2PVW A;  1CBX A;  3HLP A;  3MN8 A;  4GM5 A;  4PQA A;  1TKH A;  4P4I A;  1VGY A;  2OR4 A;  1LFW A;  4JYW A;  1NSA A;  2ZEO A;  1BPM A;  2QVP A;  3SI0 A;  2GRE A;  4MMO A;  1LAP A;  3D68 A;  5I4M A;  3BI0 A;  4P4D A;  4WJB A;  2WYR A;  1ARM A;  2Q51 A;  4Z65 A;  4EWT A;  3S9N A;  3CT9 A;  5LRJ A;  2JEW A;  2GLF A;  3RZA A;  2DEA A;  3S9M A;  4A39 A;  3FEC A;  4X2T A;  5LYI A;  4PXB A;  1F57 A;  3VH9 A;  5THW A;  1AMP A;  3HUV A;  3WAB A;  2PJC A;  5K8O A;  4P6Y A;  3D66 A;  4NGT A;  4R6T A;  3NFZ A;  4OKO A;  1Y7E A;  2JBJ A;  3K2K A;  3B3C A;  4P10 A;  5CBM A;  3CPA A;  3KAS A;  3GLJ A;  2Q4Z A;  4MHY A;  5LRG A;  2VL1 A;  1Z8L A;  2PJ9 A;  5LRK A;  3S9L A;  2PJB A;  2CIJ A;  3NH5 A;  2J9A A;  3H8E A;  4UIB A;  3B3W A;  3SI2 A;  5J1Q A;  4ZI6 A;  5JM6 A;  2AFO A;  2PJ3 A;  4PPZ A;  3KI9 A;  2V8D A;  3WT4 A;  2BCO A;  3PBE A;  4KSI A;  4O23 A;  3CPX A;  2OOT A;  3T8W A;  2ANP A;  4OC3 A;  4FBE A;  3VAR A;  2CTB A;  3IIB A;  4ZX8 A;  3JRU A;  3SJE A;  4MHP A;  2ZOF A;  4A37 A;  4K3N A;  3ISX A;  4IHM A;  1TKJ A;  1HDQ A;  3NA6 A;  1FNO A;  4A94 A;  3KQZ A;  1R43 A;  5LYF A;  2PJ1 A;  2PIY A;  1TF9 A;  8CPA A;  1CP6 A;  1R3N A;  2PJ4 A;  4ONW A;  2ZEL A;  4MHZ A;  5DS0 A;  4P4E A;  2BO9 A;  2V77 A;  2V8G A;  4FAI A;  1F2O A;  4OME A;  3PB4 X;  2RB7 A;  3QNV A;  5K8P A;  4RUH A;  1LAM A;  1YW6 A;  1BLL E;  1VIX A;  2ZED A;  4P44 A;  4OC4 A;  3SI1 A;  2ZEP A;  3B3S A;  1UWY A;  1AYE A;  4W9Y A;  2AFM A;  3KZW A;  3DLJ A;  3GUX A;  1XBU A;  3VAT A;  1YSJ A;  2HC9 A;  2AFU A;  5CPA A;  1DTD A;  1Q7L A;  1CP7 A;  2ZOG A;  3BHX A;  3TC8 A;  1VHE A;  2XEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...