1S7KA

Riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
158
Chain Sequence
EIIPVSTTLELRAADESHVPALHQLVLKNTRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyl transferase
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 50
structure length 158
sequence length 177
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7kA00
2CNTA 3I3GA 1YREA 4QC6A 5F48A 2B5GA 3R9FA 2B4BA 3GY9A 3S6KA 2KCWA 5HH1A 5DWNA 4RI1A 4RS2A 2R7HA 3SXOA 3TO6A 3JVNA 4M3SA 2Q0YA 4GS4A 1YK3A 1IYKA 1B87A 3EXNA 2PRBA 1NSLA 4JXRA 4CAXA 4DNCA 4CRYB 2CNSA 4PSWA 2ZW5A 1S60A 3F8KA 2B58A 5J8FA 3JUWA 2HUZA 2ZXVA 3GKRA 2G3TA 3PGPA 4KUAA 4JJXA 4L89A 4FD4A 1Y7RA 4CAVA 1I12A 2J8RA 1GHEA 1YVKA 1XE4A 4LX9A 1WWZA 2GIVA 2Q7BA 4ONUA 1IYLA 3FBUA 4XNHB 2CNMA 2JDDA 2ATRA 4UA3A 2O28A 3DDDA 1QSMA 1QSRA 1VKCA 2WPWA 3R1KA 4PK2A 2G3AA 2A4NA 4M85A 4PV6A 4KVME 4XPLA 4H6ZA 2Q4VA 3BLNA 5F46A 3D8PA 3I9SA 3IGRA 2P6EA 4HNXB 3SHPA 1YLEA 4CS0B 1UFHA 4PK3A 1I21A 4KOUA 2P0WA 4U9YA 1WK4A 4R3LA 1KZFA 2Z11A 3P2FA 3D2PA 2PDOA 4UWJA 2EVNA 3T9YA 3VWDA 3G8WA 3S6FA 3FYNA 1CM0A 3QB8A 5IB0A 4KZTA 3EO4A 2ZPAA 3QAHA 5H84A 4IUSA 4R3KA 4BMHA 4L8AA 4AG7A 2BUEA 4OADA 2PR1A 3EFAA 5J8CA 2VI7A 3C26A 4AVAA 1J4JA 4U9ZA 3DR6A 5IX3A 3PZJA 2FSRA 3F0AA 2HV2A 5EC4A 4MBUA 2NMTA 4FD7A 1SQHA 5FVJA 2OU2A 2VXKA 2OH1A 1XF8A 3LODA 1QSNA 2Q4YA 5C82A 2I79A 4NXYA 4AG9A 3EC4A 3UY5A 3B8GA 1Q2DA 3TTHA 2Q04A 4R57A 4E2AA 1MJBA 4QBJA 4XNHC 4II9A 2PQ8A 3DNSA 4PSXA 1B6BA 1TIQA 4XPDC 3R95A 2OB0A 1IIDA 3KKWA 4KVOE 4MHDA 2VEZA 4X5KA 2JEVA 1VHSA 3W6XA 5KTDA 2ZW6A 4ORFA 4YFJA 2WPXA 1QSOA 3F5BA 1S7NA 3FB3A 5F47A 2QMLA 2OZHA 1NE9A 2P6GA 2FL4A 3IWGA 5HMNA 2GANA 5JPHA 2JLMA 2VQYA 4JXQA 4CAWA 2B5GB 5I0CA 4NCZA 4Y49B 1S3ZA 1CJWA 2P6FA 1M44A 1IICA 4B5PA 4KOVA 3R9GA 1P0HA 2OZGA 4KOXA 4OLLA 1BO4A 4E0AA 1PU9A 1MJ9A 3V8IA 1Q2YA 1OZPA 5KTAA 3K9UA 4R87A 4KUBA 2RC4A 3FXTA 1YX0A 2B4DA 3TT2A 2REEA 2Z10A 3PP9A 3RYOA 2JDCA 1P4NA 4FD6A 2R98A 2FIWA 4KORA 5KTCA 2FIAA 2F5IA 2FXFA 2R8VA 3D3SA 3FIXA 4IF5A 3TO9A 1FY7A 3TO7A 2Y0MA 3DSBA 5CNPA 2Z0ZA 2HQYA 3GYAA 2FCKA 4KOSA 1BOBA 2EUIA 4NF1A 3N7ZA 5C88A 4MY3A 3W6SA 2ARHA 3MGDA 4H6UA 1S7FA 4HNYB 2BL1A 3W91A 3CXPA 2FS5A 3FRMA 4AB7A 3BJ8A 2VBQA 4YRHA 2BEIA 4KOTA 3VWEA 3TCVA 1S7KA 2J8MA 4JD6A 1S7LA 4KOWA 2B3UA 3NE7A 2B4DB 4MY0A 3CXQA 2GE3A 4QB9A 1XMTA 2AE6A 5DWMA 2PR8A 2AJ6A 4UBRA 1IB1E 2K5TA 3S6HA 4NEXA 3SXNA 4XPKA 2G0BA 1Z4RA 3BJ7A 4Y49C 2REFA 2R1IA 4J3GA 4CRZB 4F0YA 2VZYA 2CY2A 4KVXA 3OWCA 1M4GA 3LD2A 1RO5A 4K30A 1N71A 3D2MA 1XEBA 2Q44A 4B5OA 3H4QA 3ZJ0A 1Y9WA 4LUAA 4ZBGA 3TFYA 4R9MA 1R57A 3R9EA 1M4IA 2D4OA 2ZW4A 1RXTA 4NSQA 1M4DA 4MJ8A 4FD5A 3TOBA 4UWIA 5E96A 5ISVA 3E0KA 5H86A 5IV0A 2FT0A 4XPDB 2X7BA 5EBVA 3WR7A 4HKFA 1K4JA 4JWPA 4HNWB 1L0CA 2FE7A 3ZZIA 3EY5A 5JQ4A 2QECA 4KLWA 1YR0A 2PSWA 3FNCA 4EVYA 3TE4A 1V0CA 2BSWA 1Q2CA 2J8NA 3S6GA 5F49A 4YGOA 1XIXA 1I1DA 4AVBA 1U6MA 3CXSA 3DR8A 1LRZA 1KUYA 2C27A 3T90A 4H89A 2PC1A 4F6AA 1MK4A 1MJAA 4I49A 4JLYA 1KUXA 1QSTA 1Z9UA 2D4PA 1ON0A 4B5PB 2VZZA 2OZUA 5GCNA 1KUVA 4AVCA 3TOAA 1YGHA 4E8OA 4MI4A 4KLVA 2I00A 1M1DA 1Y9KA 2B3VA 1Z4EA 1PUAA 2IL4A 4QVTA 3G3SA 4OAEA 2DXQA 1NMTA 1S5KA 2QIRA 3R96A 2H5MA 2ZW7A 4U5YA 4KOYA 3P2HA 1YVOA 4QUSA
chains in the Genus database with same CATH superfamily
4R8FA 4UFVA 2CNTA 3BXMA 3I3GA 1YREA 4QC6A 5F48A 2B5GA 3R9FA 5F09A 3WT4A 4C7IA 4FAIA 2WYRA 2B4BA 2PE3A 2PJ4A 4MHZA 3GY9A 4UEEA 3S6KA 2KCWA 3PFEA 5HH1A 4R76A 5D8NA 1DTDA 5DWNA 4RI1A 3IWEA 1VHEA 4RS2A 2J9AA 3S9MA 3PBEA 4OC0A 2R7HA 3SXOA 3TO6A 3JVNA 4M3SA 2Q0YA 3RZAA 4ZY0A 3ISZA 3IO1A 4OP4A 2ABZA 4P45A 4GS4A 4Z65A 4F8ZA 1YK3A 1IYKA 1B87A 3D68A 3EXNA 5G20A 2PRBA 4NGQA 1NSLA 3KI9A 5LYDA 4DUKA 1CG2A 4JXRA 5D29A 1ZG9A 4CAXA 4DNCA 4CRYB 2CNSA 4B13A 1XOVA 2YNEA 1IOIA 4PSWA 2ZW5A 1S60A 3F8KA 2B58A 2ODFA 2Q4ZA 2DPSA 5J8FA 5LYFA 3JUWA 2HUZA 1Q7LA 2ZXVA 4UIBA 3GKRA 1ARMA 4B11A 3HLPA 4ZI6A 4A38A 2G3TA 4UFXA 4EWTA 3PGPA 3PEIA 4KUAA 2AFSA 3WC5A 4JJXA 4L89A 4FD4A 4LQ6A 1Y7RA 4CAVA 1I12A 4TWEA 1XRYA 4KSAA 2J8RA 4OC5A 4MRIA 1VGYA 4X8IA 1GHEA 2ZEHA 1YVKA 4WJBA 1R3NA 1XE4A 4LX9A 2I3CA 1AMPA 1WWZA 2GIVA 2Q7BA 2OR4A 4ONUA 1IYLA 3FBUA 4IAVA 4P4JA 4XNHB 3B7IA 2CNMA 2PJ9A 2JDDA 4UIAA 2GREA 2AFZA 2ATRA 6CPAA 4MHPA 4NGTA 4UA3A 2O28A 3DDDA 2CXAA 4ZX8A 4FBEA 1QSMA 1QSRA 4H2KA 4CAEA 1VKCA 2ZOFA 2WPWA 3R1KA 4C2XA 5K8PA 4PK2A 4UCMA 2G3AA 2IQ6A 4G1PA 2C1CA 3D66A 2WSAA 4HPSA 2A4NA 4M85A 4PV6A 4MCQA 4KVME 4XPLA 1CPSA 4H6ZA 2ZOGA 4CGOA 1IOFA 3IU2A 3LWUA 4KSFA 4M6IA 2Q4VA 3SI0A 3BLNA 5F46A 1FT7A 3D8PA 3I9SA 3IGRA 2PJCA 3FEDA 5AG5A 4X3RA 4Q38A 2AFXA 2P6EA 2ZEGA 3NH4A 4HNXB 2PVWA 3SHPA 1YLEA 4CS0B 1UFHA 3H8FA 1I21A 2CTCA 4KOUA 4MFQA 4PK3A 4A39A 2P0WA 2GLFA 4KSIA 4U9YA 2PJ6A 1WK4A 2C6GA 4P4DA 4O23A 4IK2A 4R3LA 1KZFA 2RFHA 2Z11A 5JH9A 3P2FA 2PRQA 3D2PA 2O53A 2PDOA 4UWJA 1JWQA 1IY7A 3GLJA 2Z3OA 2EVNA 3T9YA 1KWMA 2EO8A 3VWDA 3D7FA 3CPAA 3G8WA 3KQXA 4M6GA 4ZX9A 4NJRA 3S6FA 3FYNA 1CM0A 1YLOA 1TKHA 3QB8A 4PXEA 5IB0A 3PB6X 1BAVA 1F2OA 3EO4A 4KZTA 2ZPAA 1X10A 2Q7SA 3QAHA 5H84A 4IUSA 4R3KA 2OOTA 1IGBA 2PJ0A 4BMHA 3CDXA 3SJGA 4L8AA 4UF4A 4CGMA 2DEAA 3L2NA 4FWUA 4ZYQA 4MCPA 3WABA 3BI0A 3V38A 2BUEA 4OADA 4AG7A 4CYQA 2PR1A 3KL9A 3EFAA 5J8CA 3FVLA 2VI7A 2Z3LA 3C26A 1J4JA 3B35A 4U9ZA 1ZG8A 4AVAA 4C7HA 3DR6A 2V8GA 5IX3A 4CGLA 3PZJA 2CF4A 2FSRA 3F0AA 3I1UA 2HV2A 5EMIA 5EC4A 2C6PA 4B14A 4NGRA 4MBUA 3FH4A 2PJ1A 3D7DA 3PB9X 2NMTA 4FD7A 4R7MA 4UCNA 2PJ8A 4DYOA 1SQHA 2CTBA 3FMCA 1H8LA 5FVJA 5LRKA 2OU2A 1ZG7A 2VXKA 2OH1A 1QQ9A 2NYQA 2Z3KA 1XF8A 3LODA 4MCSA 1QSNA 2GU2A 3H5ZA 4TNUA 5LRJA 4UEFA 3HUVA 4PXDA 1ZLIA 2Q4YA 5C82A 1JQGA 2GFQA 3JRUA 3GUXA 2I79A 4NXYA 2QYVA 3EC4A 3UY5A 4AG9A 3B8GA 5HVFA 1Q2DA 2G9DA 4X2TA 4RN7A 2PCUA 2XEJA 3TTHA 1PCAA 2HC9A 2Q04A 3SJFA 4P6YA 4R57A 3GB0A 4CAFA 4E2AA 1MJBA 4B6ZA 2V8VA 4QBJA 1ZLHA 2FVGA 4Q36A 4XNHC 4II9A 1YSJA 2PQ8A 3DNSA 4PSXA 1B6BA 1TIQA 4UFWA 3D7HA 4UEZA 1AUGA 3B3CA 4XPDC 3R95A 2OB0A 1IIDA 3NH8A 3KKWA 4R6TA 4BBHA 4KVOE 2AFMA 4MHDA 2VEZA 4X5KA 2JEVA 4NGMA 1VHSA 3W6XA 5KTDA 2ZW6A 4ORFA 4YFJA 4ZGYB 5JGFA 2WPXA 1QSOA 3F5BA 3K2KA 4PPZA 1S7NA 4MFPA 3IEHA 4P4FA 3FB3A 5F47A 2DPTA 2OZHA 2QMLA 4K3NA 1NE9A 1YQEA 2P6GA 2FL4A 3IWGA 4NJQA 4BD9A 5HMNA 5HVHA 2GANA 1CPXA 5JPHA 2ZEFA 4MHNA 1LAMA 3LACA 2JLMA 2VQYA 4JXQA 1YW4A 3DGVA 5AGEA 4CAWA 2GLJA 2YNCA 2B5GB 3V7ZA 5I0CA 4WWVA 3VH9A 4NCZA 3MRUA 2YNCC 5JM6A 4Y49B 1Y0YA 3RO0A 4M6HA 2V8DA 1S3ZA 4AXVA 1CJWA 2P6FA 3H8EA 1M44A 3KHZA 1IICA 4B5PA 4KOVA 3R9GA 2OZGA 1P0HA 3DLJA 4JYWA 4KOXA 1Y0RA 4OLLA 1BO4A 3LMSA 3QAYA 3NE8A 3FX6A 4PQAA 1Z8XA 4OC2A 3S9NA 4YWYA 4A30A 5IB9A 2EBJA 4MMOA 4P10A 4E0AA 2PJBA 4OC4A 5BWAB 4CYPA 1PU9A 3PB8X 5K8NA 5CPAA 1MJ9A 4FUUA 3V8IA 1Q2YA 3KR4A 4A37A 1OZPA 4MFZA 1CX8A 5KTAA 3K9UA 2QVPA 4A95A 2XEGA 4R87A 4KUBA 1GYTA 4NFRA 4Q7AA 2RC4A 4CYOA 2BCOA 1CP7A 3FXTA 1YX0A 2B4DA 3TT2A 4NGNA 3H8GA 4P44A 7CPAA 2REEA 1OBRA 1LANA 3SI2A 1YMEA 2Z10A 2EWBA 3PP9A 1TXRA 3RYOA 1XMBA 2JDCA 1Z5RA 1R43A 1P4NA 2EK8A 4FD6A 2R98A 2FIWA 3B3TA 4MHYA 4KORA 4LQGA 5KTCA 2FIAA 2ZEDA 2ZEOA 4F9VA 2F5IA 2FXFA 2R8VA 2Z3PA 3D3SA 3FIXA 4IF5A 3TO9A 1FY7A 3TO7A 2V77A 2Y0MA 3DSBA 4UCPA 2IMOA 4A31A 3MN8A 5CNPA 2Z0ZA 1HEEA 2HQYA 1BPNA 2ZEPA 4W9YA 3GYAA 2FCKA 3IC1A 3ISXA 5HVGA 4CGNA 3JTKA 4KOSA 1BOBA 1CBXA 2EUIA 4NF1A 3N7ZA 4CGPA 5C88A 2YGWA 4MY3A 2VL1A 3W6SA 2ARHA 3MGDA 1XBUA 1Y7EA 4H6UA 1S7FA 4HNYB 2BL1A 2HB6A 3CPXA 3W91A 3CXPA 1EE3P 3CT9A 1LAPA 2FS5A 4A2ZA 3FRMA 4A33A 1VIXA 4AB7A 3BJ8A 4GM5A 2PVVA 1PYTB 2VBQA 4YRHA 3SJEA 2BEIA 4KOTA 5K8OA 3KGQA 3VWEA 3TCVA 4MXUA 1S7KA 2J8MA 1BLLE 3IWWA 4JD6A 4CYNA 2PJ7A 1S7LA 4KOWA 4MFLA 2C6CA 2B3UA 2QJ8A 2B4DB 3NE7A 4MY0A 1LOKA 4A94A 3CXQA 3KASA 2GE3A 4QB9A 3KHXA 1QMUA 1XMTA 2AE6A 5DWMA 5HXDA 3FJUA 3B2YA 1YW6A 4OC1A 4MCRA 4F0XA 2PR8A 3RNZA 1IU8A 5A27A 2AJ6A 2WZNA 1IB1E 2K5TA 4UBRA 1LCPA 1X12A 2PJ5A 3S6HA 4CPAA 2ZENA 4NEXA 3SXNA 4XPKA 2AFWA 3PFOA 1DE4C 2G0BA 1Z4RA 4GXHA 3WC6A 2ANPA 3IJ3A 3BJ7A 2Z3NA 3SJXA 4Y49C 5G22A 2REFA 3RAMA 2R1IA 4J3GA 2POKA 1TF8A 5DS0A 3T8WA 4CRZB 4F0YA 5LYIA 2VZYA 1BPMA 1F2PA 4A32A 2CY2A 2O4HA 3OWCA 1M4GA 3LD2A 1RO5A 4KVXA 1ZO0A 3KQZA 4K30A 1VHOA 4ONWA 2F8HA 2XEIA 3FECA 1N71A 3D2MA 1HDQA 4P4EA 1XEBA 5AG7A 5A28A 2Q44A 3B3WA 1A2ZA 4IHMA 4B5OA 1Z8TA 3H4QA 1Y9WA 4LUAA 1ARLA 3ZJ0A 4OIDA 4ZBGA 3TFYA 1RTQA 4R9MA 1R57A 3R9EA 3B3VA 1M4IA 3IIBA 2D4OA 2ZW4A 3D4UA 3TC8A 1RXTA 1Z8WA 3N5FA 1NSAA 4NSQA 2BOAA 1M4DA 2EK9A 4JZ0A 4MJ8A 3SI1A 1FNOA 4FD5A 4ZY1A 2Q51A 4RUHA 5LRGA 3TOBA 4UWIA 4NGSA 5E96A 5ISVA 2JEWA 3IFEA 3E0KA 3KR5A 5H86A 5IV0A 1Z8LA 1HDUA 2FT0A 3QNVA 4OC3A 4DJLA 3FF3A 2ZEMA 2X7BA 4XPDB 2XEFA 2F7VA 4NGPA 5EBVA 3WR7A 4HKFA 1CP6A 1K4JA 4JWPA 4HNWB 1L0CA 4YU9A 4OKOA 2FE7A 5LYLA 3ZZIA 3EY5A 5I4MA 5JQ4A 2QECA 4KLWA 2RB7A 1YR0A 2PSWA 3FNCA 4EVYA 2PIZA 1AYEA 3TE4A 1V0CA 1XJOA 1Z2LA 4KS9A 2BSWA 1Q2CA 2BO9A 2J8NA 3A9LA 3PRTA 4B12A 2IJZA 3D7GA 3S6GA 3BHXA 5F49A 3GIUA 3IU1A 2YNDA 2DF5A 4YGOA 1M4LA 1XIXA 5ELYA 3TX8A 1I1DA 1TKFA 3D67A 4ZY2A 2V8HA 3CZXA 3KZWA 4MFKA 1TF9A 4B10A 3S9LA 4AVBA 1U6MA 3CXSA 3DR8A 4P4IA 1LRZA 1KUYA 2C27A 2JBJA 3T90A 3PB4X 4H89A 4F9UA 2PC1A 4F6AA 3NA6A 3BI1A 1MK4A 3PB7X 4C68A 1MJAA 2AFUA 5THWA 4I49A 1ELLP 4JLYA 1KUXA 1QSTA 5AG4A 1Z9UA 2D4PA 4OMEA 8CPAA 2ZELA 3FEEA 2PIYA 1ON0A 2PJ3A 2JBKA 4B5PB 2VZZA 2OZUA 5GCNA 3NFZA 1KUVA 4AVCA 2AFOA 4PXCA 3TOAA 1YGHA 1LFWA 3PBBA 5G21A 5CBMA 4E8OA 2PJAA 1XFOA 5J1QA 4MFJA 4MI4A 3VATA 4KLVA 2I00A 3WC7A 1M1DA 3B3SA 1Y9KA 5G1ZA 4EFDA 3RBUA 2B3VA 1Z4EA 1PUAA 2IL4A 4P4BA 2NSMA 2Q43A 3G3SA 4QVTA 2Z3MA 2ZEEA 4OAEA 2DXQA 4C2ZA 1NMTA 3NH5A 1UWYA 1S5KA 2QIRA 3R96A 4EMEA 5K8MA 2WUUA 3K9TA 4BINA 1ELMP 2H5MA 2CIJA 4C2YA 1F57A 5AG6A 2ZW7A 4PXBA 1TKJA 2PJ2A 4OIWA 4U5YA 4KOYA 3VARA 3P2HA 1YVOA 4QUSA
chains in the Genus database with same CATH topology
4UFVA 2CNTA 3I3GA 1YREA 4QC6A 5F48A 2B5GA 3R9FA 4C7IA 2B4BA 3GY9A 3S6KA 2KCWA 5HH1A 5DWNA 4RI1A 3IWEA 4RS2A 2R7HA 3SXOA 3TO6A 3JVNA 4M3SA 2Q0YA 4GS4A 1YK3A 1IYKA 1B87A 3EXNA 5G20A 2PRBA 1NSLA 4JXRA 4CAXA 4DNCA 4CRYB 2CNSA 4B13A 2YNEA 4PSWA 2ZW5A 1S60A 3F8KA 2B58A 5J8FA 2DPSA 3JUWA 2HUZA 2ZXVA 3GKRA 4B11A 2G3TA 4UFXA 3PGPA 4KUAA 4JJXA 4L89A 4FD4A 1Y7RA 4CAVA 1I12A 4KSAA 2J8RA 1GHEA 1YVKA 1XE4A 4LX9A 1WWZA 2GIVA 2Q7BA 4ONUA 1IYLA 3FBUA 4XNHB 2CNMA 2JDDA 2ATRA 4UA3A 2O28A 3DDDA 2CXAA 1QSMA 1QSRA 4CAEA 1VKCA 2WPWA 3R1KA 4C2XA 4PK2A 4UCMA 2G3AA 2WSAA 2A4NA 4M85A 4PV6A 4KVME 4XPLA 4H6ZA 4CGOA 3IU2A 4KSFA 2Q4VA 3BLNA 5F46A 3D8PA 3I9SA 3IGRA 5AG5A 4Q38A 2P6EA 4HNXB 3SHPA 1YLEA 4CS0B 1UFHA 4MFQA 1I21A 4KOUA 4PK3A 2P0WA 4U9YA 1WK4A 4R3LA 1KZFA 2Z11A 3P2FA 3D2PA 2PDOA 4UWJA 2Z3OA 2EVNA 3T9YA 3VWDA 3G8WA 3S6FA 3FYNA 1CM0A 3QB8A 5IB0A 4KZTA 3EO4A 2ZPAA 3QAHA 5H84A 4IUSA 4R3KA 4BMHA 4CGMA 4L8AA 4AG7A 2BUEA 4OADA 4CYQA 2PR1A 3EFAA 5J8CA 2VI7A 2Z3LA 3C26A 1J4JA 4AVAA 4U9ZA 4C7HA 3DR6A 5IX3A 4CGLA 3PZJA 2FSRA 3F0AA 2HV2A 5EC4A 4B14A 4MBUA 2NMTA 4FD7A 4UCNA 1SQHA 5FVJA 2OU2A 2VXKA 2OH1A 2Z3KA 1XF8A 3LODA 1QSNA 3H5ZA 2Q4YA 5C82A 2I79A 4NXYA 4AG9A 3EC4A 3UY5A 3B8GA 1Q2DA 3TTHA 2Q04A 4R57A 4CAFA 4E2AA 1MJBA 4QBJA 4Q36A 4XNHC 4II9A 2PQ8A 3DNSA 4PSXA 1B6BA 1TIQA 4UFWA 4XPDC 3R95A 2OB0A 1IIDA 3KKWA 4BBHA 4KVOE 4MHDA 2VEZA 4X5KA 2JEVA 1VHSA 3W6XA 5KTDA 2ZW6A 4ORFA 4YFJA 4ZGYB 2WPXA 1QSOA 3F5BA 1S7NA 4MFPA 3FB3A 5F47A 2DPTA 2OZHA 2QMLA 1NE9A 2P6GA 2FL4A 3IWGA 5HMNA 2GANA 5JPHA 2JLMA 2VQYA 4JXQA 5AGEA 4CAWA 2YNCA 2B5GB 5I0CA 4NCZA 2YNCC 4Y49B 1S3ZA 1CJWA 2P6FA 1M44A 1IICA 4B5PA 4KOVA 3R9GA 1P0HA 2OZGA 4KOXA 4OLLA 1BO4A 4A30A 4E0AA 5BWAB 4CYPA 1PU9A 1MJ9A 3V8IA 1Q2YA 1OZPA 4MFZA 5KTAA 3K9UA 4A95A 4R87A 4KUBA 2RC4A 4CYOA 3FXTA 1YX0A 2B4DA 3TT2A 2REEA 2Z10A 3PP9A 3RYOA 2JDCA 1P4NA 4FD6A 2R98A 2FIWA 4KORA 5KTCA 2FIAA 2F5IA 2FXFA 2R8VA 2Z3PA 3D3SA 3FIXA 4IF5A 3TO9A 1FY7A 3TO7A 2Y0MA 3DSBA 4UCPA 4A31A 5CNPA 2Z0ZA 2HQYA 3GYAA 2FCKA 4CGNA 3JTKA 4KOSA 1BOBA 2EUIA 4NF1A 4CGPA 3N7ZA 5C88A 2YGWA 4MY3A 3W6SA 2ARHA 3MGDA 4H6UA 1S7FA 4HNYB 2BL1A 3W91A 3CXPA 2FS5A 4A2ZA 3FRMA 4A33A 4AB7A 3BJ8A 2VBQA 4YRHA 2BEIA 4KOTA 3VWEA 3TCVA 1S7KA 2J8MA 4JD6A 4CYNA 1S7LA 4KOWA 4MFLA 2B3UA 3NE7A 2B4DB 4MY0A 3CXQA 2GE3A 4QB9A 1XMTA 2AE6A 5DWMA 4F0XA 2PR8A 5A27A 2AJ6A 4UBRA 1IB1E 2K5TA 3S6HA 4NEXA 3SXNA 4XPKA 2G0BA 1Z4RA 3BJ7A 2Z3NA 4Y49C 5G22A 2REFA 2R1IA 4J3GA 4CRZB 4F0YA 2VZYA 4A32A 2CY2A 4KVXA 3OWCA 1M4GA 3LD2A 1RO5A 1ZO0A 4K30A 1N71A 3D2MA 1XEBA 5AG7A 5A28A 2Q44A 4B5OA 3H4QA 3ZJ0A 1Y9WA 4LUAA 4ZBGA 3TFYA 4R9MA 1R57A 3R9EA 1M4IA 2D4OA 2ZW4A 1RXTA 4NSQA 1M4DA 4MJ8A 4FD5A 3TOBA 4UWIA 5E96A 5ISVA 3E0KA 5H86A 5IV0A 2FT0A 4XPDB 2X7BA 5EBVA 3WR7A 4HKFA 1K4JA 4JWPA 4HNWB 1L0CA 2FE7A 3ZZIA 3EY5A 5JQ4A 2QECA 4KLWA 1YR0A 2PSWA 3FNCA 4EVYA 3TE4A 1V0CA 4KS9A 2BSWA 1Q2CA 2J8NA 3A9LA 4B12A 3S6GA 5F49A 3IU1A 2YNDA 4YGOA 1XIXA 1I1DA 4MFKA 4B10A 4AVBA 1U6MA 3CXSA 3DR8A 1LRZA 1KUYA 2C27A 3T90A 4H89A 2PC1A 4F6AA 1MK4A 4C68A 1MJAA 4I49A 4JLYA 1KUXA 1QSTA 5AG4A 1Z9UA 2D4PA 1ON0A 4B5PB 2VZZA 2OZUA 5GCNA 1KUVA 4AVCA 3TOAA 1YGHA 5G21A 4E8OA 4MFJA 4MI4A 4KLVA 2I00A 1M1DA 5G1ZA 1Y9KA 2B3VA 1Z4EA 1PUAA 2IL4A 4QVTA 3G3SA 2Z3MA 4OAEA 2DXQA 4C2ZA 1NMTA 1S5KA 2QIRA 3R96A 2WUUA 2H5MA 4C2YA 5AG6A 2ZW7A 4U5YA 4KOYA 3P2HA 1YVOA 4QUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNT A;  3I3G A;  1YRE A;  4QC6 A;  5F48 A;  2B5G A;  3R9F A;  2B4B A;  3GY9 A;  3S6K A;  2KCW A;  5HH1 A;  5DWN A;  4RI1 A;  4RS2 A;  2R7H A;  3SXO A;  3TO6 A;  3JVN A;  4M3S A;  2Q0Y A;  4GS4 A;  1YK3 A;  1IYK A;  1B87 A;  3EXN A;  2PRB A;  1NSL A;  4JXR A;  4CAX A;  4DNC A;  4CRY B;  2CNS A;  4PSW A;  2ZW5 A;  1S60 A;  3F8K A;  2B58 A;  5J8F A;  3JUW A;  2HUZ A;  2ZXV A;  3GKR A;  2G3T A;  3PGP A;  4KUA A;  4JJX A;  4L89 A;  4FD4 A;  1Y7R A;  4CAV A;  1I12 A;  2J8R A;  1GHE A;  1YVK A;  1XE4 A;  4LX9 A;  1WWZ A;  2GIV A;  2Q7B A;  4ONU A;  1IYL A;  3FBU A;  4XNH B;  2CNM A;  2JDD A;  2ATR A;  4UA3 A;  2O28 A;  3DDD A;  1QSM A;  1QSR A;  1VKC A;  2WPW A;  3R1K A;  4PK2 A;  2G3A A;  2A4N A;  4M85 A;  4PV6 A;  4KVM E;  4XPL A;  4H6Z A;  2Q4V A;  3BLN A;  5F46 A;  3D8P A;  3I9S A;  3IGR A;  2P6E A;  4HNX B;  3SHP A;  1YLE A;  4CS0 B;  1UFH A;  4PK3 A;  1I21 A;  4KOU A;  2P0W A;  4U9Y A;  1WK4 A;  4R3L A;  1KZF A;  2Z11 A;  3P2F A;  3D2P A;  2PDO A;  4UWJ A;  2EVN A;  3T9Y A;  3VWD A;  3G8W A;  3S6F A;  3FYN A;  1CM0 A;  3QB8 A;  5IB0 A;  4KZT A;  3EO4 A;  2ZPA A;  3QAH A;  5H84 A;  4IUS A;  4R3K A;  4BMH A;  4L8A A;  4AG7 A;  2BUE A;  4OAD A;  2PR1 A;  3EFA A;  5J8C A;  2VI7 A;  3C26 A;  4AVA A;  1J4J A;  4U9Z A;  3DR6 A;  5IX3 A;  3PZJ A;  2FSR A;  3F0A A;  2HV2 A;  5EC4 A;  4MBU A;  2NMT A;  4FD7 A;  1SQH A;  5FVJ A;  2OU2 A;  2VXK A;  2OH1 A;  1XF8 A;  3LOD A;  1QSN A;  2Q4Y A;  5C82 A;  2I79 A;  4NXY A;  4AG9 A;  3EC4 A;  3UY5 A;  3B8G A;  1Q2D A;  3TTH A;  2Q04 A;  4R57 A;  4E2A A;  1MJB A;  4QBJ A;  4XNH C;  4II9 A;  2PQ8 A;  3DNS A;  4PSX A;  1B6B A;  1TIQ A;  4XPD C;  3R95 A;  2OB0 A;  1IID A;  3KKW A;  4KVO E;  4MHD A;  2VEZ A;  4X5K A;  2JEV A;  1VHS A;  3W6X A;  5KTD A;  2ZW6 A;  4ORF A;  4YFJ A;  2WPX A;  1QSO A;  3F5B A;  1S7N A;  3FB3 A;  5F47 A;  2QML A;  2OZH A;  1NE9 A;  2P6G A;  2FL4 A;  3IWG A;  5HMN A;  2GAN A;  5JPH A;  2JLM A;  2VQY A;  4JXQ A;  4CAW A;  2B5G B;  5I0C A;  4NCZ A;  4Y49 B;  1S3Z A;  1CJW A;  2P6F A;  1M44 A;  1IIC A;  4B5P A;  4KOV A;  3R9G A;  1P0H A;  2OZG A;  4KOX A;  4OLL A;  1BO4 A;  4E0A A;  1PU9 A;  1MJ9 A;  3V8I A;  1Q2Y A;  1OZP A;  5KTA A;  3K9U A;  4R87 A;  4KUB A;  2RC4 A;  3FXT A;  1YX0 A;  2B4D A;  3TT2 A;  2REE A;  2Z10 A;  3PP9 A;  3RYO A;  2JDC A;  1P4N A;  4FD6 A;  2R98 A;  2FIW A;  4KOR A;  5KTC A;  2FIA A;  2F5I A;  2FXF A;  2R8V A;  3D3S A;  3FIX A;  4IF5 A;  3TO9 A;  1FY7 A;  3TO7 A;  2Y0M A;  3DSB A;  5CNP A;  2Z0Z A;  2HQY A;  3GYA A;  2FCK A;  4KOS A;  1BOB A;  2EUI A;  4NF1 A;  3N7Z A;  5C88 A;  4MY3 A;  3W6S A;  2ARH A;  3MGD A;  4H6U A;  1S7F A;  4HNY B;  2BL1 A;  3W91 A;  3CXP A;  2FS5 A;  3FRM A;  4AB7 A;  3BJ8 A;  2VBQ A;  4YRH A;  2BEI A;  4KOT A;  3VWE A;  3TCV A;  1S7K A;  2J8M A;  4JD6 A;  1S7L A;  4KOW A;  2B3U A;  3NE7 A;  2B4D B;  4MY0 A;  3CXQ A;  2GE3 A;  4QB9 A;  1XMT A;  2AE6 A;  5DWM A;  2PR8 A;  2AJ6 A;  4UBR A;  1IB1 E;  2K5T A;  3S6H A;  4NEX A;  3SXN A;  4XPK A;  2G0B A;  1Z4R A;  3BJ7 A;  4Y49 C;  2REF A;  2R1I A;  4J3G A;  4CRZ B;  4F0Y A;  2VZY A;  2CY2 A;  4KVX A;  3OWC A;  1M4G A;  3LD2 A;  1RO5 A;  4K30 A;  1N71 A;  3D2M A;  1XEB A;  2Q44 A;  4B5O A;  3H4Q A;  3ZJ0 A;  1Y9W A;  4LUA A;  4ZBG A;  3TFY A;  4R9M A;  1R57 A;  3R9E A;  1M4I A;  2D4O A;  2ZW4 A;  1RXT A;  4NSQ A;  1M4D A;  4MJ8 A;  4FD5 A;  3TOB A;  4UWI A;  5E96 A;  5ISV A;  3E0K A;  5H86 A;  5IV0 A;  2FT0 A;  4XPD B;  2X7B A;  5EBV A;  3WR7 A;  4HKF A;  1K4J A;  4JWP A;  4HNW B;  1L0C A;  2FE7 A;  3ZZI A;  3EY5 A;  5JQ4 A;  2QEC A;  4KLW A;  1YR0 A;  2PSW A;  3FNC A;  4EVY A;  3TE4 A;  1V0C A;  2BSW A;  1Q2C A;  2J8N A;  3S6G A;  5F49 A;  4YGO A;  1XIX A;  1I1D A;  4AVB A;  1U6M A;  3CXS A;  3DR8 A;  1LRZ A;  1KUY A;  2C27 A;  3T90 A;  4H89 A;  2PC1 A;  4F6A A;  1MK4 A;  1MJA A;  4I49 A;  4JLY A;  1KUX A;  1QST A;  1Z9U A;  2D4P A;  1ON0 A;  4B5P B;  2VZZ A;  2OZU A;  5GCN A;  1KUV A;  4AVC A;  3TOA A;  1YGH A;  4E8O A;  4MI4 A;  4KLV A;  2I00 A;  1M1D A;  1Y9K A;  2B3V A;  1Z4E A;  1PUA A;  2IL4 A;  4QVT A;  3G3S A;  4OAE A;  2DXQ A;  1NMT A;  1S5K A;  2QIR A;  3R96 A;  2H5M A;  2ZW7 A;  4U5Y A;  4KOY A;  3P2H A;  1YVO A;  4QUS A; 
#chains in the Genus database with same CATH topology
 4R8F A;  4UFV A;  2CNT A;  3BXM A;  3I3G A;  1YRE A;  4QC6 A;  5F48 A;  2B5G A;  3R9F A;  5F09 A;  3WT4 A;  4C7I A;  4FAI A;  2WYR A;  2B4B A;  2PE3 A;  2PJ4 A;  4MHZ A;  3GY9 A;  4UEE A;  3S6K A;  2KCW A;  3PFE A;  5HH1 A;  4R76 A;  5D8N A;  1DTD A;  5DWN A;  4RI1 A;  3IWE A;  1VHE A;  4RS2 A;  2J9A A;  3S9M A;  3PBE A;  4OC0 A;  2R7H A;  3SXO A;  3TO6 A;  3JVN A;  4M3S A;  2Q0Y A;  3RZA A;  4ZY0 A;  3ISZ A;  3IO1 A;  4OP4 A;  2ABZ A;  4P45 A;  4GS4 A;  4Z65 A;  4F8Z A;  1YK3 A;  1IYK A;  1B87 A;  3D68 A;  3EXN A;  5G20 A;  2PRB A;  4NGQ A;  1NSL A;  3KI9 A;  5LYD A;  4DUK A;  1CG2 A;  4JXR A;  5D29 A;  1ZG9 A;  4CAX A;  4DNC A;  4CRY B;  2CNS A;  4B13 A;  1XOV A;  2YNE A;  1IOI A;  4PSW A;  2ZW5 A;  1S60 A;  3F8K A;  2B58 A;  2ODF A;  2Q4Z A;  2DPS A;  5J8F A;  5LYF A;  3JUW A;  2HUZ A;  1Q7L A;  2ZXV A;  4UIB A;  3GKR A;  1ARM A;  4B11 A;  3HLP A;  4ZI6 A;  4A38 A;  2G3T A;  4UFX A;  4EWT A;  3PGP A;  3PEI A;  4KUA A;  2AFS A;  3WC5 A;  4JJX A;  4L89 A;  4FD4 A;  4LQ6 A;  1Y7R A;  4CAV A;  1I12 A;  4TWE A;  1XRY A;  4KSA A;  2J8R A;  4OC5 A;  4MRI A;  1VGY A;  4X8I A;  1GHE A;  2ZEH A;  1YVK A;  4WJB A;  1R3N A;  1XE4 A;  4LX9 A;  2I3C A;  1AMP A;  1WWZ A;  2GIV A;  2Q7B A;  2OR4 A;  4ONU A;  1IYL A;  3FBU A;  4IAV A;  4P4J A;  4XNH B;  3B7I A;  2CNM A;  2PJ9 A;  2JDD A;  4UIA A;  2GRE A;  2AFZ A;  2ATR A;  6CPA A;  4MHP A;  4NGT A;  4UA3 A;  2O28 A;  3DDD A;  2CXA A;  4ZX8 A;  4FBE A;  1QSM A;  1QSR A;  4H2K A;  4CAE A;  1VKC A;  2ZOF A;  2WPW A;  3R1K A;  4C2X A;  5K8P A;  4PK2 A;  4UCM A;  2G3A A;  2IQ6 A;  4G1P A;  2C1C A;  3D66 A;  2WSA A;  4HPS A;  2A4N A;  4M85 A;  4PV6 A;  4MCQ A;  4KVM E;  4XPL A;  1CPS A;  4H6Z A;  2ZOG A;  4CGO A;  1IOF A;  3IU2 A;  3LWU A;  4KSF A;  4M6I A;  2Q4V A;  3SI0 A;  3BLN A;  5F46 A;  1FT7 A;  3D8P A;  3I9S A;  3IGR A;  2PJC A;  3FED A;  5AG5 A;  4X3R A;  4Q38 A;  2AFX A;  2P6E A;  2ZEG A;  3NH4 A;  4HNX B;  2PVW A;  3SHP A;  1YLE A;  4CS0 B;  1UFH A;  3H8F A;  1I21 A;  2CTC A;  4KOU A;  4MFQ A;  4PK3 A;  4A39 A;  2P0W A;  2GLF A;  4KSI A;  4U9Y A;  2PJ6 A;  1WK4 A;  2C6G A;  4P4D A;  4O23 A;  4IK2 A;  4R3L A;  1KZF A;  2RFH A;  2Z11 A;  5JH9 A;  3P2F A;  2PRQ A;  3D2P A;  2O53 A;  2PDO A;  4UWJ A;  1JWQ A;  1IY7 A;  3GLJ A;  2Z3O A;  2EVN A;  3T9Y A;  1KWM A;  2EO8 A;  3VWD A;  3D7F A;  3CPA A;  3G8W A;  3KQX A;  4M6G A;  4ZX9 A;  4NJR A;  3S6F A;  3FYN A;  1CM0 A;  1YLO A;  1TKH A;  3QB8 A;  4PXE A;  5IB0 A;  3PB6 X;  1BAV A;  1F2O A;  3EO4 A;  4KZT A;  2ZPA A;  1X10 A;  2Q7S A;  3QAH A;  5H84 A;  4IUS A;  4R3K A;  2OOT A;  1IGB A;  2PJ0 A;  4BMH A;  3CDX A;  3SJG A;  4L8A A;  4UF4 A;  4CGM A;  2DEA A;  3L2N A;  4FWU A;  4ZYQ A;  4MCP A;  3WAB A;  3BI0 A;  3V38 A;  2BUE A;  4OAD A;  4AG7 A;  4CYQ A;  2PR1 A;  3KL9 A;  3EFA A;  5J8C A;  3FVL A;  2VI7 A;  2Z3L A;  3C26 A;  1J4J A;  3B35 A;  4U9Z A;  1ZG8 A;  4AVA A;  4C7H A;  3DR6 A;  2V8G A;  5IX3 A;  4CGL A;  3PZJ A;  2CF4 A;  2FSR A;  3F0A A;  3I1U A;  2HV2 A;  5EMI A;  5EC4 A;  2C6P A;  4B14 A;  4NGR A;  4MBU A;  3FH4 A;  2PJ1 A;  3D7D A;  3PB9 X;  2NMT A;  4FD7 A;  4R7M A;  4UCN A;  2PJ8 A;  4DYO A;  1SQH A;  2CTB A;  3FMC A;  1H8L A;  5FVJ A;  5LRK A;  2OU2 A;  1ZG7 A;  2VXK A;  2OH1 A;  1QQ9 A;  2NYQ A;  2Z3K A;  1XF8 A;  3LOD A;  4MCS A;  1QSN A;  2GU2 A;  3H5Z A;  4TNU A;  5LRJ A;  4UEF A;  3HUV A;  4PXD A;  1ZLI A;  2Q4Y A;  5C82 A;  1JQG A;  2GFQ A;  3JRU A;  3GUX A;  2I79 A;  4NXY A;  2QYV A;  3EC4 A;  3UY5 A;  4AG9 A;  3B8G A;  5HVF A;  1Q2D A;  2G9D A;  4X2T A;  4RN7 A;  2PCU A;  2XEJ A;  3TTH A;  1PCA A;  2HC9 A;  2Q04 A;  3SJF A;  4P6Y A;  4R57 A;  3GB0 A;  4CAF A;  4E2A A;  1MJB A;  4B6Z A;  2V8V A;  4QBJ A;  1ZLH A;  2FVG A;  4Q36 A;  4XNH C;  4II9 A;  1YSJ A;  2PQ8 A;  3DNS A;  4PSX A;  1B6B A;  1TIQ A;  4UFW A;  3D7H A;  4UEZ A;  1AUG A;  3B3C A;  4XPD C;  3R95 A;  2OB0 A;  1IID A;  3NH8 A;  3KKW A;  4R6T A;  4BBH A;  4KVO E;  2AFM A;  4MHD A;  2VEZ A;  4X5K A;  2JEV A;  4NGM A;  1VHS A;  3W6X A;  5KTD A;  2ZW6 A;  4ORF A;  4YFJ A;  4ZGY B;  5JGF A;  2WPX A;  1QSO A;  3F5B A;  3K2K A;  4PPZ A;  1S7N A;  4MFP A;  3IEH A;  4P4F A;  3FB3 A;  5F47 A;  2DPT A;  2OZH A;  2QML A;  4K3N A;  1NE9 A;  1YQE A;  2P6G A;  2FL4 A;  3IWG A;  4NJQ A;  4BD9 A;  5HMN A;  5HVH A;  2GAN A;  1CPX A;  5JPH A;  2ZEF A;  4MHN A;  1LAM A;  3LAC A;  2JLM A;  2VQY A;  4JXQ A;  1YW4 A;  3DGV A;  5AGE A;  4CAW A;  2GLJ A;  2YNC A;  2B5G B;  3V7Z A;  5I0C A;  4WWV A;  3VH9 A;  4NCZ A;  3MRU A;  2YNC C;  5JM6 A;  4Y49 B;  1Y0Y A;  3RO0 A;  4M6H A;  2V8D A;  1S3Z A;  4AXV A;  1CJW A;  2P6F A;  3H8E A;  1M44 A;  3KHZ A;  1IIC A;  4B5P A;  4KOV A;  3R9G A;  2OZG A;  1P0H A;  3DLJ A;  4JYW A;  4KOX A;  1Y0R A;  4OLL A;  1BO4 A;  3LMS A;  3QAY A;  3NE8 A;  3FX6 A;  4PQA A;  1Z8X A;  4OC2 A;  3S9N A;  4YWY A;  4A30 A;  5IB9 A;  2EBJ A;  4MMO A;  4P10 A;  4E0A A;  2PJB A;  4OC4 A;  5BWA B;  4CYP A;  1PU9 A;  3PB8 X;  5K8N A;  5CPA A;  1MJ9 A;  4FUU A;  3V8I A;  1Q2Y A;  3KR4 A;  4A37 A;  1OZP A;  4MFZ A;  1CX8 A;  5KTA A;  3K9U A;  2QVP A;  4A95 A;  2XEG A;  4R87 A;  4KUB A;  1GYT A;  4NFR A;  4Q7A A;  2RC4 A;  4CYO A;  2BCO A;  1CP7 A;  3FXT A;  1YX0 A;  2B4D A;  3TT2 A;  4NGN A;  3H8G A;  4P44 A;  7CPA A;  2REE A;  1OBR A;  1LAN A;  3SI2 A;  1YME A;  2Z10 A;  2EWB A;  3PP9 A;  1TXR A;  3RYO A;  1XMB A;  2JDC A;  1Z5R A;  1R43 A;  1P4N A;  2EK8 A;  4FD6 A;  2R98 A;  2FIW A;  3B3T A;  4MHY A;  4KOR A;  4LQG A;  5KTC A;  2FIA A;  2ZED A;  2ZEO A;  4F9V A;  2F5I A;  2FXF A;  2R8V A;  2Z3P A;  3D3S A;  3FIX A;  4IF5 A;  3TO9 A;  1FY7 A;  3TO7 A;  2V77 A;  2Y0M A;  3DSB A;  4UCP A;  2IMO A;  4A31 A;  3MN8 A;  5CNP A;  2Z0Z A;  1HEE A;  2HQY A;  1BPN A;  2ZEP A;  4W9Y A;  3GYA A;  2FCK A;  3IC1 A;  3ISX A;  5HVG A;  4CGN A;  3JTK A;  4KOS A;  1BOB A;  1CBX A;  2EUI A;  4NF1 A;  3N7Z A;  4CGP A;  5C88 A;  2YGW A;  4MY3 A;  2VL1 A;  3W6S A;  2ARH A;  3MGD A;  1XBU A;  1Y7E A;  4H6U A;  1S7F A;  4HNY B;  2BL1 A;  2HB6 A;  3CPX A;  3W91 A;  3CXP A;  1EE3 P;  3CT9 A;  1LAP A;  2FS5 A;  4A2Z A;  3FRM A;  4A33 A;  1VIX A;  4AB7 A;  3BJ8 A;  4GM5 A;  2PVV A;  1PYT B;  2VBQ A;  4YRH A;  3SJE A;  2BEI A;  4KOT A;  5K8O A;  3KGQ A;  3VWE A;  3TCV A;  4MXU A;  1S7K A;  2J8M A;  1BLL E;  3IWW A;  4JD6 A;  4CYN A;  2PJ7 A;  1S7L A;  4KOW A;  4MFL A;  2C6C A;  2B3U A;  2QJ8 A;  2B4D B;  3NE7 A;  4MY0 A;  1LOK A;  4A94 A;  3CXQ A;  3KAS A;  2GE3 A;  4QB9 A;  3KHX A;  1QMU A;  1XMT A;  2AE6 A;  5DWM A;  5HXD A;  3FJU A;  3B2Y A;  1YW6 A;  4OC1 A;  4MCR A;  4F0X A;  2PR8 A;  3RNZ A;  1IU8 A;  5A27 A;  2AJ6 A;  2WZN A;  1IB1 E;  2K5T A;  4UBR A;  1LCP A;  1X12 A;  2PJ5 A;  3S6H A;  4CPA A;  2ZEN A;  4NEX A;  3SXN A;  4XPK A;  2AFW A;  3PFO A;  1DE4 C;  2G0B A;  1Z4R A;  4GXH A;  3WC6 A;  2ANP A;  3IJ3 A;  3BJ7 A;  2Z3N A;  3SJX A;  4Y49 C;  5G22 A;  2REF A;  3RAM A;  2R1I A;  4J3G A;  2POK A;  1TF8 A;  5DS0 A;  3T8W A;  4CRZ B;  4F0Y A;  5LYI A;  2VZY A;  1BPM A;  1F2P A;  4A32 A;  2CY2 A;  2O4H A;  3OWC A;  1M4G A;  3LD2 A;  1RO5 A;  4KVX A;  1ZO0 A;  3KQZ A;  4K30 A;  1VHO A;  4ONW A;  2F8H A;  2XEI A;  3FEC A;  1N71 A;  3D2M A;  1HDQ A;  4P4E A;  1XEB A;  5AG7 A;  5A28 A;  2Q44 A;  3B3W A;  1A2Z A;  4IHM A;  4B5O A;  1Z8T A;  3H4Q A;  1Y9W A;  4LUA A;  1ARL A;  3ZJ0 A;  4OID A;  4ZBG A;  3TFY A;  1RTQ A;  4R9M A;  1R57 A;  3R9E A;  3B3V A;  1M4I A;  3IIB A;  2D4O A;  2ZW4 A;  3D4U A;  3TC8 A;  1RXT A;  1Z8W A;  3N5F A;  1NSA A;  4NSQ A;  2BOA A;  1M4D A;  2EK9 A;  4JZ0 A;  4MJ8 A;  3SI1 A;  1FNO A;  4FD5 A;  4ZY1 A;  2Q51 A;  4RUH A;  5LRG A;  3TOB A;  4UWI A;  4NGS A;  5E96 A;  5ISV A;  2JEW A;  3IFE A;  3E0K A;  3KR5 A;  5H86 A;  5IV0 A;  1Z8L A;  1HDU A;  2FT0 A;  3QNV A;  4OC3 A;  4DJL A;  3FF3 A;  2ZEM A;  2X7B A;  4XPD B;  2XEF A;  2F7V A;  4NGP A;  5EBV A;  3WR7 A;  4HKF A;  1CP6 A;  1K4J A;  4JWP A;  4HNW B;  1L0C A;  4YU9 A;  4OKO A;  2FE7 A;  5LYL A;  3ZZI A;  3EY5 A;  5I4M A;  5JQ4 A;  2QEC A;  4KLW A;  2RB7 A;  1YR0 A;  2PSW A;  3FNC A;  4EVY A;  2PIZ A;  1AYE A;  3TE4 A;  1V0C A;  1XJO A;  1Z2L A;  4KS9 A;  2BSW A;  1Q2C A;  2BO9 A;  2J8N A;  3A9L A;  3PRT A;  4B12 A;  2IJZ A;  3D7G A;  3S6G A;  3BHX A;  5F49 A;  3GIU A;  3IU1 A;  2YND A;  2DF5 A;  4YGO A;  1M4L A;  1XIX A;  5ELY A;  3TX8 A;  1I1D A;  1TKF A;  3D67 A;  4ZY2 A;  2V8H A;  3CZX A;  3KZW A;  4MFK A;  1TF9 A;  4B10 A;  3S9L A;  4AVB A;  1U6M A;  3CXS A;  3DR8 A;  4P4I A;  1LRZ A;  1KUY A;  2C27 A;  2JBJ A;  3T90 A;  3PB4 X;  4H89 A;  4F9U A;  2PC1 A;  4F6A A;  3NA6 A;  3BI1 A;  1MK4 A;  3PB7 X;  4C68 A;  1MJA A;  2AFU A;  5THW A;  4I49 A;  1ELL P;  4JLY A;  1KUX A;  1QST A;  5AG4 A;  1Z9U A;  2D4P A;  4OME A;  8CPA A;  2ZEL A;  3FEE A;  2PIY A;  1ON0 A;  2PJ3 A;  2JBK A;  4B5P B;  2VZZ A;  2OZU A;  5GCN A;  3NFZ A;  1KUV A;  4AVC A;  2AFO A;  4PXC A;  3TOA A;  1YGH A;  1LFW A;  3PBB A;  5G21 A;  5CBM A;  4E8O A;  2PJA A;  1XFO A;  5J1Q A;  4MFJ A;  4MI4 A;  3VAT A;  4KLV A;  2I00 A;  3WC7 A;  1M1D A;  3B3S A;  1Y9K A;  5G1Z A;  4EFD A;  3RBU A;  2B3V A;  1Z4E A;  1PUA A;  2IL4 A;  4P4B A;  2NSM A;  2Q43 A;  3G3S A;  4QVT A;  2Z3M A;  2ZEE A;  4OAE A;  2DXQ A;  4C2Z A;  1NMT A;  3NH5 A;  1UWY A;  1S5K A;  2QIR A;  3R96 A;  4EME A;  5K8M A;  2WUU A;  3K9T A;  4BIN A;  1ELM P;  2H5M A;  2CIJ A;  4C2Y A;  1F57 A;  5AG6 A;  2ZW7 A;  4PXB A;  1TKJ A;  2PJ2 A;  4OIW A;  4U5Y A;  4KOY A;  3VAR A;  3P2H A;  1YVO A;  4QUS A; 
#chains in the Genus database with same CATH homology
 4UFV A;  2CNT A;  3I3G A;  1YRE A;  4QC6 A;  5F48 A;  2B5G A;  3R9F A;  4C7I A;  2B4B A;  3GY9 A;  3S6K A;  2KCW A;  5HH1 A;  5DWN A;  4RI1 A;  3IWE A;  4RS2 A;  2R7H A;  3SXO A;  3TO6 A;  3JVN A;  4M3S A;  2Q0Y A;  4GS4 A;  1YK3 A;  1IYK A;  1B87 A;  3EXN A;  5G20 A;  2PRB A;  1NSL A;  4JXR A;  4CAX A;  4DNC A;  4CRY B;  2CNS A;  4B13 A;  2YNE A;  4PSW A;  2ZW5 A;  1S60 A;  3F8K A;  2B58 A;  5J8F A;  2DPS A;  3JUW A;  2HUZ A;  2ZXV A;  3GKR A;  4B11 A;  2G3T A;  4UFX A;  3PGP A;  4KUA A;  4JJX A;  4L89 A;  4FD4 A;  1Y7R A;  4CAV A;  1I12 A;  4KSA A;  2J8R A;  1GHE A;  1YVK A;  1XE4 A;  4LX9 A;  1WWZ A;  2GIV A;  2Q7B A;  4ONU A;  1IYL A;  3FBU A;  4XNH B;  2CNM A;  2JDD A;  2ATR A;  4UA3 A;  2O28 A;  3DDD A;  2CXA A;  1QSM A;  1QSR A;  4CAE A;  1VKC A;  2WPW A;  3R1K A;  4C2X A;  4PK2 A;  4UCM A;  2G3A A;  2WSA A;  2A4N A;  4M85 A;  4PV6 A;  4KVM E;  4XPL A;  4H6Z A;  4CGO A;  3IU2 A;  4KSF A;  2Q4V A;  3BLN A;  5F46 A;  3D8P A;  3I9S A;  3IGR A;  5AG5 A;  4Q38 A;  2P6E A;  4HNX B;  3SHP A;  1YLE A;  4CS0 B;  1UFH A;  4MFQ A;  1I21 A;  4KOU A;  4PK3 A;  2P0W A;  4U9Y A;  1WK4 A;  4R3L A;  1KZF A;  2Z11 A;  3P2F A;  3D2P A;  2PDO A;  4UWJ A;  2Z3O A;  2EVN A;  3T9Y A;  3VWD A;  3G8W A;  3S6F A;  3FYN A;  1CM0 A;  3QB8 A;  5IB0 A;  4KZT A;  3EO4 A;  2ZPA A;  3QAH A;  5H84 A;  4IUS A;  4R3K A;  4BMH A;  4CGM A;  4L8A A;  4AG7 A;  2BUE A;  4OAD A;  4CYQ A;  2PR1 A;  3EFA A;  5J8C A;  2VI7 A;  2Z3L A;  3C26 A;  1J4J A;  4AVA A;  4U9Z A;  4C7H A;  3DR6 A;  5IX3 A;  4CGL A;  3PZJ A;  2FSR A;  3F0A A;  2HV2 A;  5EC4 A;  4B14 A;  4MBU A;  2NMT A;  4FD7 A;  4UCN A;  1SQH A;  5FVJ A;  2OU2 A;  2VXK A;  2OH1 A;  2Z3K A;  1XF8 A;  3LOD A;  1QSN A;  3H5Z A;  2Q4Y A;  5C82 A;  2I79 A;  4NXY A;  4AG9 A;  3EC4 A;  3UY5 A;  3B8G A;  1Q2D A;  3TTH A;  2Q04 A;  4R57 A;  4CAF A;  4E2A A;  1MJB A;  4QBJ A;  4Q36 A;  4XNH C;  4II9 A;  2PQ8 A;  3DNS A;  4PSX A;  1B6B A;  1TIQ A;  4UFW A;  4XPD C;  3R95 A;  2OB0 A;  1IID A;  3KKW A;  4BBH A;  4KVO E;  4MHD A;  2VEZ A;  4X5K A;  2JEV A;  1VHS A;  3W6X A;  5KTD A;  2ZW6 A;  4ORF A;  4YFJ A;  4ZGY B;  2WPX A;  1QSO A;  3F5B A;  1S7N A;  4MFP A;  3FB3 A;  5F47 A;  2DPT A;  2OZH A;  2QML A;  1NE9 A;  2P6G A;  2FL4 A;  3IWG A;  5HMN A;  2GAN A;  5JPH A;  2JLM A;  2VQY A;  4JXQ A;  5AGE A;  4CAW A;  2YNC A;  2B5G B;  5I0C A;  4NCZ A;  2YNC C;  4Y49 B;  1S3Z A;  1CJW A;  2P6F A;  1M44 A;  1IIC A;  4B5P A;  4KOV A;  3R9G A;  1P0H A;  2OZG A;  4KOX A;  4OLL A;  1BO4 A;  4A30 A;  4E0A A;  5BWA B;  4CYP A;  1PU9 A;  1MJ9 A;  3V8I A;  1Q2Y A;  1OZP A;  4MFZ A;  5KTA A;  3K9U A;  4A95 A;  4R87 A;  4KUB A;  2RC4 A;  4CYO A;  3FXT A;  1YX0 A;  2B4D A;  3TT2 A;  2REE A;  2Z10 A;  3PP9 A;  3RYO A;  2JDC A;  1P4N A;  4FD6 A;  2R98 A;  2FIW A;  4KOR A;  5KTC A;  2FIA A;  2F5I A;  2FXF A;  2R8V A;  2Z3P A;  3D3S A;  3FIX A;  4IF5 A;  3TO9 A;  1FY7 A;  3TO7 A;  2Y0M A;  3DSB A;  4UCP A;  4A31 A;  5CNP A;  2Z0Z A;  2HQY A;  3GYA A;  2FCK A;  4CGN A;  3JTK A;  4KOS A;  1BOB A;  2EUI A;  4NF1 A;  4CGP A;  3N7Z A;  5C88 A;  2YGW A;  4MY3 A;  3W6S A;  2ARH A;  3MGD A;  4H6U A;  1S7F A;  4HNY B;  2BL1 A;  3W91 A;  3CXP A;  2FS5 A;  4A2Z A;  3FRM A;  4A33 A;  4AB7 A;  3BJ8 A;  2VBQ A;  4YRH A;  2BEI A;  4KOT A;  3VWE A;  3TCV A;  1S7K A;  2J8M A;  4JD6 A;  4CYN A;  1S7L A;  4KOW A;  4MFL A;  2B3U A;  3NE7 A;  2B4D B;  4MY0 A;  3CXQ A;  2GE3 A;  4QB9 A;  1XMT A;  2AE6 A;  5DWM A;  4F0X A;  2PR8 A;  5A27 A;  2AJ6 A;  4UBR A;  1IB1 E;  2K5T A;  3S6H A;  4NEX A;  3SXN A;  4XPK A;  2G0B A;  1Z4R A;  3BJ7 A;  2Z3N A;  4Y49 C;  5G22 A;  2REF A;  2R1I A;  4J3G A;  4CRZ B;  4F0Y A;  2VZY A;  4A32 A;  2CY2 A;  4KVX A;  3OWC A;  1M4G A;  3LD2 A;  1RO5 A;  1ZO0 A;  4K30 A;  1N71 A;  3D2M A;  1XEB A;  5AG7 A;  5A28 A;  2Q44 A;  4B5O A;  3H4Q A;  3ZJ0 A;  1Y9W A;  4LUA A;  4ZBG A;  3TFY A;  4R9M A;  1R57 A;  3R9E A;  1M4I A;  2D4O A;  2ZW4 A;  1RXT A;  4NSQ A;  1M4D A;  4MJ8 A;  4FD5 A;  3TOB A;  4UWI A;  5E96 A;  5ISV A;  3E0K A;  5H86 A;  5IV0 A;  2FT0 A;  4XPD B;  2X7B A;  5EBV A;  3WR7 A;  4HKF A;  1K4J A;  4JWP A;  4HNW B;  1L0C A;  2FE7 A;  3ZZI A;  3EY5 A;  5JQ4 A;  2QEC A;  4KLW A;  1YR0 A;  2PSW A;  3FNC A;  4EVY A;  3TE4 A;  1V0C A;  4KS9 A;  2BSW A;  1Q2C A;  2J8N A;  3A9L A;  4B12 A;  3S6G A;  5F49 A;  3IU1 A;  2YND A;  4YGO A;  1XIX A;  1I1D A;  4MFK A;  4B10 A;  4AVB A;  1U6M A;  3CXS A;  3DR8 A;  1LRZ A;  1KUY A;  2C27 A;  3T90 A;  4H89 A;  2PC1 A;  4F6A A;  1MK4 A;  4C68 A;  1MJA A;  4I49 A;  4JLY A;  1KUX A;  1QST A;  5AG4 A;  1Z9U A;  2D4P A;  1ON0 A;  4B5P B;  2VZZ A;  2OZU A;  5GCN A;  1KUV A;  4AVC A;  3TOA A;  1YGH A;  5G21 A;  4E8O A;  4MFJ A;  4MI4 A;  4KLV A;  2I00 A;  1M1D A;  5G1Z A;  1Y9K A;  2B3V A;  1Z4E A;  1PUA A;  2IL4 A;  4QVT A;  3G3S A;  2Z3M A;  4OAE A;  2DXQ A;  4C2Z A;  1NMT A;  1S5K A;  2QIR A;  3R96 A;  2WUU A;  2H5M A;  4C2Y A;  5AG6 A;  2ZW7 A;  4U5Y A;  4KOY A;  3P2H A;  1YVO A;  4QUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...