1S7KA

Riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form 2 (apo)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
177
structure length
158
Chain Sequence
EIIPVSTTLELRAADESHVPALHQLVLKNTRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyl transferase
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 50
structure length 158
sequence length 177
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7kA00
4LUAA 5I0CA 1LRZA 3JVNA 4B5PA 1IB1E 3FBUA 1PU9A 1Y7RA 4ONUA 3K9UA 1S7LA 4RS2A 1KZFA 1QSOA 3BLNA 4Y49B 3P2HA 1IYKA 4PSXA 2C27A 4HNYB 1YX0A 4QUSA 2R98A 3B8GA 1NE9A 3EXNA 2B4DA 2Q4YA 4JWPA 2OH1A 4FD5A 4RI1A 1K4JA 1QSNA 2K5TA 2FE7A 2DXQA 1I1DA 2HUZA 2P6GA 3FB3A 3S6FA 4ORFA 2FXFA 1V0CA 2D4OA 2P6FA 2B3UA 3TTHA 4NF1A 3JUWA 2G3TA 1QSTA 4XNHC 3ZZIA 2PR8A 1KUXA 3TT2A 5F48A 2Z10A 4XPDC 4UBRA 3EO4A 2FS5A 4U9YA 4MJ8A 3TO9A 3NE7A 4DNCA 3PP9A 1YREA 3CXSA 1KUVA 3E0KA 4UWIA 5EBVA 2PSWA 3DDDA 5IX3A 4M3SA 3BJ8A 3T90A 3V8IA 1XIXA 1N71A 3W6SA 5HMNA 2VZYA 1UFHA 1P4NA 1YR0A 5J8CA 2QIRA 4B5PB 2CY2A 1YLEA 2VQYA 2OZHA 3KKWA 4MBUA 2B5GA 3S6KA 4AG7A 1BOBA 2G3AA 4ZBGA 4J3GA 3F8KA 4AG9A 1S3ZA 4E8OA 3S6GA 2PDOA 2R1IA 2OZGA 4HNWB 2NMTA 3S6HA 1QSMA 2B4DB 2Q04A 4KUBA 2X7BA 1P0HA 1FY7A 1S5KA 2AE6A 2Z0ZA 3EFAA 1XF8A 2Q44A 5J8FA 1S7KA 1RO5A 1QSRA 2G0BA 2REFA 4IUSA 5F49A 3F0AA 3GKRA 3TCVA 3SXNA 2I00A 2WPXA 5DWNA 2PRBA 2VI7A 3QAHA 2I79A 2VBQA 2Q4VA 4L8AA 1CM0A 2ZW5A 1L0CA 2P6EA 5GCNA 2EUIA 4JLYA 4M85A 1Q2YA 5ISVA 4H6UA 4FD6A 2ZW7A 2ATRA 4KVOE 4YFJA 3SXOA 3G3SA 4AB7A 4R3LA 3LD2A 3EY5A 3GY9A 1Z4EA 1YGHA 4HKFA 3N7ZA 2BEIA 4KVXA 5H86A 2P0WA 1KUYA 3TO7A 2J8RA 2VZZA 4PSWA 3W6XA 4K30A 5IV0A 2R8VA 3R1KA 3P2FA 4F6AA 4YRHA 4YGOA 4MI4A 2B58A 3R9EA 1I21A 2FSRA 3CXPA 4PV6A 4JJXA 5EC4A 1B6BA 1YVKA 2QECA 4I49A 4CAWA 2FIWA 2AJ6A 3LODA 4B5OA 2ZW6A 1IICA 1VKCA 1Y9WA 2J8NA 4XPKA 3I9SA 2FCKA 4NXYA 4PK3A 4PK2A 2IL4A 4KOYA 4KOUA 2KCWA 2O28A 2JEVA 3TE4A 4QB9A 3FYNA 2PR1A 3F5BA 2QMLA 3D8PA 2GE3A 1J4JA 3UY5A 3BJ7A 1BO4A 2D4PA 4R87A 2CNSA 3I3GA 2Q0YA 4AVBA 3ZJ0A 1YK3A 4XNHB 1Y9KA 2F5IA 5C82A 1I12A 1M1DA 4CAXA 2ZW4A 1CJWA 5KTCA 5H84A 2OU2A 2VXKA 2BSWA 4JXQA 2H5MA 1M4DA 1PUAA 3IGRA 3TFYA 1IIDA 3OWCA 1XE4A 3VWEA 1TIQA 1S60A 2OZUA 5DWMA 1SQHA 2B3VA 2Y0MA 4BMHA 4CRZB 4OLLA 4NSQA 4H89A 1ON0A 4LX9A 4MY0A 1RXTA 1S7FA 3D2MA 3DR6A 4Y49C 5HH1A 4UWJA 2ZXVA 2JDCA 3R96A 5JQ4A 4X5KA 1MJBA 4U9ZA 3FXTA 3H4QA 3DNSA 2PC1A 2JLMA 4OAEA 4EVYA 1Z4RA 4KLVA 3T9YA 1YVOA 2B4BA 2RC4A 5E96A 3DSBA 4L89A 3MGDA 1Q2CA 4NCZA 3PZJA 1U6MA 4KOWA 3FRMA 4KOVA 4MHDA 1Z9UA 2B5GB 1B87A 4CS0B 1MJ9A 2CNMA 4MY3A 2WPWA 5F46A 3RYOA 1XMTA 4KVME 2BL1A 2GIVA 4R9MA 3R9GA 2A4NA 3EC4A 1M4GA 3VWDA 2CNTA 2VEZA 3PGPA 5IB0A 4E2AA 1IYLA 3DR8A 3FNCA 4AVAA 4E0AA 5JPHA 2OB0A 1M4IA 4IF5A 4KORA 4R3KA 3FIXA 2JDDA 1M44A 4HNXB 4KZTA 3D3SA 4KOXA 2Z11A 4GS4A 2Q7BA 2ARHA 1WWZA 5C88A 4QBJA 3G8WA 5KTDA 5FVJA 4JXRA 4R57A 3CXQA 4FD7A 2REEA 4KOTA 4NEXA 2HV2A 4JD6A 1OZPA 4FD4A 1R57A 4F0YA 2EVNA 1MJAA 3WR7A 2FL4A 3R9FA 4CAVA 1VHSA 2BUEA 4XPDB 4KOSA 1NSLA 3QB8A 1XEBA 3TO6A 3D2PA 4QVTA 2GANA 4UA3A 2R7HA 2FIAA 3R95A 4XPLA 2HQYA 2PQ8A 4AVCA 4H6ZA 3W91A 1S7NA 5CNPA 3GYAA 2ZPAA 1MK4A 4QC6A 1WK4A 4CRYB 3TOBA 1Q2DA 3TOAA 4II9A 1NMTA 2FT0A 4OADA 3SHPA 4KLWA 1GHEA 2J8MA 4U5YA 3IWGA 5F47A 4KUAA 5KTAA 3C26A
chains in the Genus database with same CATH superfamily
4BINA 1Y7EA 4LUAA 4A39A 1TXRA 5I0CA 2PJBA 2BCOA 3B3SA 4FUUA 1LRZA 3JVNA 4B5PA 4IK2A 3KR4A 1IB1E 3FBUA 3SI2A 1PU9A 1Y7RA 2XEGA 4ONUA 2NYQA 3IWWA 4CGMA 2F8HA 3K9UA 1S7LA 4RS2A 1KZFA 3D7HA 4P4BA 1QSOA 4EWTA 2ZEDA 3BLNA 4Y49B 3P2HA 4UIAA 1IYKA 1EE3P 1YSJA 4PSXA 4PXBA 1VHOA 4C7HA 2C27A 3H8FA 3WT4A 4ZY1A 4HNYB 4A31A 4G1PA 4OC0A 3IU2A 4X8IA 4CYPA 1YX0A 4QUSA 2OOTA 4GXHA 2PCUA 4R76A 2R98A 3B8GA 2Q43A 1NE9A 2GLJA 3EXNA 1VGYA 2B4DA 2Q4YA 4MXUA 2VL1A 3K2KA 4JWPA 1JWQA 3B3WA 4B14A 2OH1A 4FD5A 4NGTA 4RI1A 3BI1A 1K4JA 1QSNA 3FECA 4CGOA 2K5TA 3FF3A 2FE7A 2YNDA 1PYTB 5K8NA 4R6TA 2DXQA 3KGQA 3JTKA 1I1DA 2HUZA 3FEDA 7CPAA 2P6GA 1LAMA 3FB3A 1BPNA 4ORFA 3S6FA 4CYQA 2FXFA 1V0CA 4MCRA 2ZEMA 4CAFA 4RUHA 2D4OA 2P6FA 2B3UA 4CGNA 3TTHA 4NF1A 4OIDA 2YNCA 1KWMA 4WJBA 4A95A 3JUWA 4EMEA 3DGVA 4ZYQA 3ISZA 5ELYA 4ZI6A 4TNUA 2G3TA 2RFHA 3CZXA 1QSTA 4XNHC 3ZZIA 2PR8A 2Q51A 4CGPA 4FAIA 1KUXA 3MRUA 3TT2A 4NGQA 1Z2LA 2DPSA 3PFEA 2Z10A 5F48A 5AG5A 2PIZA 3PEIA 4XPDC 4UBRA 3EO4A 2FS5A 3A9LA 4MJ8A 2O53A 4OC4A 3BI0A 4U9YA 2O4HA 3NE7A 5LRJA 3TO9A 3V38A 4CYNA 4MFLA 4IAVA 4DNCA 3PP9A 1YREA 1CP7A 1KUVA 3CXSA 3E0KA 3GIUA 4JYWA 4UWIA 5EBVA 4A37A 5HVGA 2PSWA 3DDDA 5IX3A 4M3SA 3BJ8A 3PBBA 3T90A 4F0XA 3B7IA 4MFJA 4P44A 5THWA 1CG2A 3RAMA 3FEEA 3V8IA 4R7MA 4NGNA 1XIXA 1N71A 3W6SA 5HMNA 2VZYA 1UFHA 1P4NA 1YR0A 3D7DA 5J8CA 2QIRA 4B5PB 2CY2A 1YLEA 3SJEA 2VQYA 4KSIA 4Q7AA 3WC5A 1CBXA 2OZHA 3KKWA 3B3VA 4MBUA 5D8NA 1YW6A 2B5GA 3S6KA 3SI1A 4AG7A 1BOBA 3H5ZA 3VH9A 2G3AA 2V77A 4ZBGA 4J3GA 3F8KA 1DTDA 4AG9A 1TF8A 1S3ZA 5AGEA 4E8OA 3S6GA 3KL9A 2C6CA 3IFEA 3KHXA 5HXDA 3LACA 2PDOA 2R1IA 4MMOA 2PJ3A 2OZGA 3N5FA 4FWUA 3CDXA 4CPAA 4HNWB 2NMTA 4P4JA 6CPAA 3S6HA 1ELLP 1QSMA 1Z5RA 2B4DB 3KQXA 4RN7A 2Q04A 4KUBA 2X7BA 1P0HA 1FY7A 5LYIA 1F2OA 4R8FA 1S5KA 3HUVA 2AE6A 1CPSA 2Z0ZA 3QAYA 2HC9A 1ELMP 5F09A 3EFAA 1XF8A 2Q44A 3HLPA 1QQ9A 5J8FA 1DE4C 2IJZA 2IMOA 2WUUA 1S7KA 4UCNA 1RO5A 1QSRA 2G0BA 2AFOA 4A30A 2REFA 4IUSA 3NH5A 5F49A 2ZEFA 3F0AA 3PB7X 3GKRA 4P4EA 1PCAA 2CTCA 4YU9A 3TCVA 3SXNA 2DPTA 2J9AA 2I00A 2WPXA 5DWNA 2PRBA 2PJ9A 2VI7A 4UEFA 3QAHA 4F9VA 1FNOA 2FVGA 4X2TA 2I79A 1Q7LA 2VBQA 3WABA 2Q4VA 4L8AA 2XEJA 1CM0A 1ZG9A 3KASA 2ZW5A 1L0CA 2P6EA 3FVLA 5GCNA 2EUIA 3CT9A 4JLYA 3WC6A 4M85A 1Z8LA 3BHXA 2XEFA 4C68A 1Q2YA 2DEAA 3IO1A 4OC1A 5ISVA 2PVWA 4M6GA 1YLOA 4FD6A 4H6UA 2ZW7A 2ATRA 2ZEEA 2PVVA 4KVOE 4PXEA 1ZG8A 4YFJA 1CP6A 5CPAA 3S9LA 3SXOA 3G3SA 4AB7A 3KI9A 2JEWA 4OC5A 3S9NA 4W9YA 4R3LA 3LD2A 3EY5A 2I3CA 3GY9A 5JH9A 1Z4EA 1YGHA 4HKFA 3N7ZA 2BEIA 4KVXA 5H86A 1AYEA 4C2ZA 1YQEA 1CPXA 2P0WA 2GREA 5EMIA 1IGBA 5JM6A 1KUYA 4P4IA 4P4DA 2Z3LA 4ZY0A 1ARMA 3TO7A 2J8RA 4DUKA 2VZZA 4PSWA 3W6XA 3PFOA 4K30A 5HVFA 5IV0A 4IHMA 2R8VA 2Z3PA 1LFWA 3P2FA 3R1KA 3D66A 4F6AA 1XOVA 5BWAB 4YRHA 4PQAA 4YGOA 5LRGA 4MI4A 3JRUA 3D7FA 2B58A 2CF4A 4H2KA 4NJRA 3R9EA 1I21A 1IOFA 4ZX9A 2FSRA 2PRQA 3CXPA 4PV6A 4JJXA 5EC4A 1B6BA 1YVKA 2QECA 4I49A 4CAWA 2FIWA 5K8PA 4EFDA 1R3NA 2AFMA 2C1CA 3B3CA 2AJ6A 3LODA 1IY7A 1X10A 4B5OA 2NSMA 4UEEA 2ZW6A 4Q36A 1IICA 1VKCA 2BOAA 1Y9WA 2J8NA 5LRKA 1XBUA 2ZEOA 5AG7A 4XPKA 3I9SA 4F9UA 2FCKA 3LMSA 4NXYA 4PK3A 4PK2A 3B2YA 2IL4A 2V8DA 4KOYA 4KOUA 1GYTA 4NFRA 2Q7SA 2KCWA 2O28A 3NFZA 2JEVA 4NGSA 3TE4A 4QB9A 3NH4A 3PB9X 5CBMA 1VHEA 1JQGA 2PR1A 3F5BA 3FYNA 5I4MA 2QMLA 1XFOA 1Y0YA 2ZOFA 1ZO0A 3VATA 2IQ6A 4NJQA 4PPZA 3D8PA 4NGRA 2GE3A 1J4JA 4YWYA 2CIJA 1BPMA 3BXMA 3BJ7A 1BO4A 3UY5A 5HVHA 2D4PA 4R87A 1ZG7A 2CNSA 3B35A 3T8WA 3I3GA 2Q0YA 4AVBA 3ZJ0A 1YK3A 2C6GA 3KZWA 4XNHB 1Y9KA 2F5IA 3GUXA 4A38A 5C82A 3V7ZA 2ABZA 2WSAA 4MFPA 3QNVA 2BO9A 3RO0A 1I12A 1M1DA 2F7VA 4LQGA 4CAXA 3PB8X 2ZW4A 1CJWA 1YW4A 5KTCA 1Z8TA 3SJGA 5H84A 2OU2A 2PJ1A 1RTQA 3S9MA 2VXKA 4UFXA 2BSWA 4CAVA 4JXQA 3SI0A 2H5MA 5K8MA 2YGWA 1M4DA 1PUAA 3IGRA 4AXVA 1IIDA 3KQZA 1XE4A 3OWCA 3TFYA 2EK9A 3VWEA 4M6IA 2YNEA 1TIQA 1S60A 2OZUA 5DWMA 4A33A 4FBEA 1SQHA 4M6HA 2B3VA 3IJ3A 4TWEA 3CPAA 5LYLA 1Z8XA 2Y0MA 4KS9A 4BMHA 4OLLA 4NSQA 4CRZB 2JBKA 4H89A 4F8ZA 1ON0A 4LX9A 4MY0A 2XEIA 4C7IA 4B10A 4CGLA 1RXTA 3SJXA 1S7FA 4OP4A 1XMBA 4CYOA 3D2MA 4OMEA 1YMEA 1F57A 3SJFA 3IWEA 3DR6A 4WWVA 4Y49C 5HH1A 3ISXA 4MFZA 4UWJA 1LCPA 3GB0A 2ZXVA 2JDCA 1FT7A 2POKA 5G21A 5G22A 4MHPA 3R96A 3RBUA 5JQ4A 4X5KA 1LOKA 1MJBA 1BLLE 3NE8A 4U9ZA 3FXTA 4MCQA 3H4QA 1XRYA 5D29A 3DNSA 4P45A 4B12A 2PC1A 2JLMA 2CTBA 4OAEA 5AG6A 4EVYA 1Z4RA 3B3TA 4B6ZA 1TKJA 2Z3KA 2PJ5A 1VIXA 4OC2A 4KLVA 4C2YA 2PJCA 1YVOA 3T9YA 2B4BA 2RC4A 4O23A 5E96A 4A2ZA 3DSBA 4K3NA 4L89A 3IIBA 3MGDA 4PXDA 1Q2CA 4UFWA 4NCZA 2EO8A 4UEZA 3PB6X 3PZJA 3H8EA 4B11A 1AUGA 1U6MA 5LYDA 3GLJA 1OBRA 1R43A 1TF9A 2ZENA 4KOWA 1LAPA 3K9TA 2WZNA 3FRMA 5DS0A 4KOVA 2ODFA 3LWUA 4MHDA 4ZX8A 1H8LA 3TC8A 1Z9UA 1M4LA 2B5GB 2AFXA 1B87A 2HB6A 4CS0B 1MJ9A 2CNMA 2G9DA 3MN8A 2PJ2A 4MY3A 4UF4A 5K8OA 1Y0RA 4A94A 2AFZA 4JZ0A 2WPWA 3I1UA 3PBEA 5F46A 1IU8A 3RYOA 2EBJA 5G20A 2QVPA 1XMTA 1CX8A 4KVME 2BL1A 4B13A 2GIVA 4R9MA 4ZY2A 3R9GA 2A4NA 4GM5A 3EC4A 4Z65A 4OIWA 4UFVA 2ZELA 4OKOA 2Z3MA 3PB4X 1HEEA 1ZLHA 1M4GA 3VWDA 2CNTA 2VEZA 3PGPA 3D7GA 1IOIA 4CAEA 2ZEHA 3IU1A 5IB0A 2PIYA 2PJ4A 4MHYA 4E2AA 1IYLA 3DLJA 3RNZA 8CPAA 3DR8A 3FNCA 4MCSA 4AVAA 4E0AA 5JPHA 2OB0A 1M4IA 4IF5A 1HDUA 4KORA 2ANPA 3WC7A 2GFQA 4R3KA 3CPXA 2GLFA 3FIXA 2EWBA 1M44A 2JDDA 4HNXB 4PXCA 3IC1A 2EK8A 3D67A 4KZTA 2CXAA 3D3SA 2Z11A 4KOXA 2Z3OA 4GS4A 4P6YA 5J1QA 2Q7BA 2WYRA 4MFKA 1BAVA 1ARLA 2ARHA 1AMPA 2QYVA 4UCMA 1WWZA 5C88A 4QBJA 1LANA 3NA6A 3G8WA 5LYFA 5KTDA 5FVJA 1A2ZA 4JXRA 2V8HA 4ZGYB 1F2PA 4OC3A 4A32A 4R57A 3RZAA 3CXQA 2AFWA 4Q38A 1NSAA 3L2NA 2Z3NA 1TKHA 3FMCA 2JBJA 4BBHA 4LQ6A 4FD7A 2REEA 4KOTA 4NEXA 3D68A 2HV2A 4JD6A 4BD9A 1OZPA 2AFUA 4FD4A 1QMUA 2PJ6A 1R57A 4NGMA 3NH8A 4F0YA 2EVNA 1HDQA 1MJAA 2FL4A 3PRTA 4NGPA 3R9FA 3TX8A 2C6PA 4ONWA 3WR7A 1VHSA 2BUEA 3IEHA 4XPDB 4X3RA 4DYOA 4KOSA 2PJ8A 2ZEGA 3KR5A 3QB8A 3H8GA 1NSLA 4C2XA 2QJ8A 5IB9A 2PJAA 1X12A 1XEBA 2PE3A 3TO6A 3D2PA 3VARA 4QVTA 2PJ0A 1XJOA 2GANA 2OR4A 2V8GA 4UA3A 2YNCC 2R7HA 2FIAA 2ZEPA 3R95A 4XPLA 5JGFA 2HQYA 2PQ8A 2Q4ZA 4AVCA 4KSAA 4H6ZA 3W91A 5G1ZA 1S7NA 4HPSA 1ZLIA 4MCPA 4UCPA 4UIBA 5CNPA 3GYAA 2GU2A 2ZOGA 2ZPAA 4MHZA 1MK4A 3FX6A 4QC6A 1UWYA 1WK4A 4CRYB 3TOBA 1Q2DA 4MHNA 5A27A 3TOAA 4II9A 1NMTA 2FT0A 4OADA 4DJLA 3SHPA 5A28A 4KLWA 1GHEA 2J8MA 4U5YA 3KHZA 3FH4A 4MRIA 4P4FA 5AG4A 2PJ7A 3IWGA 2V8VA 2DF5A 3D4UA 1Z8WA 5F47A 2AFSA 3FJUA 4KUAA 5KTAA 4KSFA 1TKFA 3C26A 4P10A 4MFQA 2RB7A
chains in the Genus database with same CATH topology
4LUAA 5I0CA 1LRZA 3JVNA 4B5PA 1IB1E 3FBUA 1PU9A 1Y7RA 4ONUA 4CGMA 3K9UA 1S7LA 4RS2A 1KZFA 1QSOA 3BLNA 4Y49B 3P2HA 1IYKA 4PSXA 4C7HA 2C27A 4HNYB 4A31A 3IU2A 4CYPA 1YX0A 4QUSA 2R98A 3B8GA 1NE9A 3EXNA 2B4DA 2Q4YA 4JWPA 4B14A 2OH1A 4FD5A 4RI1A 1K4JA 1QSNA 4CGOA 2K5TA 2FE7A 2YNDA 2DXQA 3JTKA 1I1DA 2HUZA 2P6GA 3FB3A 3S6FA 4ORFA 4CYQA 2FXFA 1V0CA 4CAFA 2D4OA 2P6FA 2B3UA 4CGNA 3TTHA 4NF1A 2YNCA 4A95A 3JUWA 2G3TA 1QSTA 4XNHC 3ZZIA 2PR8A 4CGPA 1KUXA 3TT2A 5F48A 2DPSA 2Z10A 5AG5A 4XPDC 4UBRA 3EO4A 2FS5A 3A9LA 4MJ8A 4U9YA 3TO9A 3NE7A 4CYNA 4DNCA 4MFLA 3PP9A 1YREA 3CXSA 1KUVA 3E0KA 4UWIA 5EBVA 2PSWA 3DDDA 5IX3A 4M3SA 3BJ8A 3T90A 4F0XA 4MFJA 3V8IA 1XIXA 1N71A 3W6SA 5HMNA 2VZYA 1UFHA 1P4NA 1YR0A 5J8CA 2QIRA 4B5PB 2CY2A 1YLEA 2VQYA 2OZHA 3KKWA 4MBUA 2B5GA 3S6KA 4AG7A 1BOBA 3H5ZA 2G3AA 4ZBGA 4J3GA 3F8KA 4AG9A 1S3ZA 5AGEA 4E8OA 3S6GA 2PDOA 2R1IA 2OZGA 4HNWB 2NMTA 3S6HA 1QSMA 2B4DB 2Q04A 4KUBA 2X7BA 1P0HA 1FY7A 1S5KA 2AE6A 2Z0ZA 3EFAA 1XF8A 2Q44A 5J8FA 2WUUA 1S7KA 4UCNA 1RO5A 1QSRA 2G0BA 4A30A 2REFA 4IUSA 5F49A 3F0AA 3GKRA 3TCVA 3SXNA 2DPTA 2I00A 2WPXA 5DWNA 2PRBA 2VI7A 3QAHA 2I79A 2VBQA 2Q4VA 4L8AA 1CM0A 2ZW5A 1L0CA 2P6EA 5GCNA 2EUIA 4JLYA 4M85A 4C68A 1Q2YA 5ISVA 4H6UA 4FD6A 2ZW7A 2ATRA 4KVOE 4YFJA 3SXOA 3G3SA 4AB7A 4R3LA 3LD2A 3EY5A 3GY9A 1Z4EA 1YGHA 4HKFA 3N7ZA 2BEIA 4KVXA 5H86A 4C2ZA 2P0WA 1KUYA 2Z3LA 3TO7A 2J8RA 2VZZA 4PSWA 3W6XA 4K30A 5IV0A 2R8VA 2Z3PA 3R1KA 3P2FA 4F6AA 5BWAB 4YRHA 4YGOA 4MI4A 2B58A 3R9EA 1I21A 2FSRA 3CXPA 4PV6A 4JJXA 5EC4A 1B6BA 1YVKA 2QECA 4I49A 4CAWA 2FIWA 2AJ6A 3LODA 4B5OA 2ZW6A 4Q36A 1IICA 1VKCA 1Y9WA 2J8NA 5AG7A 4XPKA 3I9SA 2FCKA 4NXYA 4PK3A 4PK2A 2IL4A 4KOYA 4KOUA 2KCWA 2O28A 2JEVA 3TE4A 4QB9A 3FYNA 2PR1A 3F5BA 2QMLA 1ZO0A 3D8PA 2GE3A 1J4JA 3UY5A 3BJ7A 1BO4A 2D4PA 4R87A 2CNSA 3I3GA 2Q0YA 4AVBA 3ZJ0A 1YK3A 4XNHB 1Y9KA 2F5IA 5C82A 2WSAA 4MFPA 1I12A 1M1DA 4CAXA 2ZW4A 1CJWA 5KTCA 5H84A 2OU2A 2VXKA 4UFXA 2BSWA 4JXQA 2H5MA 2YGWA 1M4DA 1PUAA 3IGRA 3TFYA 1IIDA 3OWCA 1XE4A 3VWEA 2YNEA 1TIQA 1S60A 2OZUA 5DWMA 4A33A 1SQHA 2B3VA 2Y0MA 4BMHA 4KS9A 4CRZB 4OLLA 4NSQA 4H89A 1ON0A 4LX9A 4MY0A 4C7IA 4CGLA 1RXTA 1S7FA 4CYOA 3D2MA 3IWEA 3DR6A 4Y49C 5HH1A 4MFZA 4UWJA 2ZXVA 2JDCA 5G21A 5G22A 3R96A 5JQ4A 4X5KA 1MJBA 4U9ZA 3FXTA 3H4QA 3DNSA 4B12A 2PC1A 2JLMA 4OAEA 5AG6A 4EVYA 1Z4RA 2Z3KA 4KLVA 4C2YA 3T9YA 1YVOA 4A2ZA 2B4BA 2RC4A 5E96A 3DSBA 4L89A 3MGDA 1Q2CA 4UFWA 4NCZA 3PZJA 4B11A 1U6MA 4KOWA 3FRMA 4KOVA 4MHDA 1Z9UA 2B5GB 1B87A 4CS0B 1MJ9A 2CNMA 4MY3A 2WPWA 5F46A 3RYOA 5G20A 1XMTA 4KVME 2BL1A 4B13A 2GIVA 4R9MA 3R9GA 2A4NA 3EC4A 4UFVA 2Z3MA 1M4GA 3VWDA 2CNTA 2VEZA 3PGPA 4CAEA 3IU1A 5IB0A 4E2AA 1IYLA 3DR8A 3FNCA 4AVAA 4E0AA 5JPHA 2OB0A 1M4IA 4IF5A 4KORA 4R3KA 3FIXA 2JDDA 1M44A 4HNXB 4B10A 4KZTA 2CXAA 3D3SA 2Z11A 4KOXA 2Z3OA 4GS4A 2Q7BA 4MFKA 2ARHA 4UCMA 1WWZA 5C88A 4QBJA 3G8WA 5KTDA 5FVJA 4JXRA 4ZGYB 4A32A 4R57A 3CXQA 4Q38A 2Z3NA 4BBHA 4FD7A 2REEA 4KOTA 4NEXA 2HV2A 4JD6A 1OZPA 4FD4A 1R57A 4F0YA 2EVNA 1MJAA 3WR7A 2FL4A 3R9FA 4CAVA 1VHSA 2BUEA 4XPDB 4KOSA 4C2XA 1NSLA 3QB8A 1XEBA 3TO6A 3D2PA 4QVTA 2GANA 4UA3A 2YNCC 2R7HA 2FIAA 3R95A 4XPLA 2HQYA 2PQ8A 4AVCA 4KSAA 4H6ZA 3W91A 5G1ZA 1S7NA 4UCPA 5CNPA 3GYAA 2ZPAA 1MK4A 4QC6A 1WK4A 4CRYB 3TOBA 1Q2DA 5A27A 3TOAA 4II9A 1NMTA 2FT0A 4OADA 3SHPA 5A28A 4KLWA 1GHEA 2J8MA 4U5YA 5AG4A 3IWGA 5F47A 4KUAA 5KTAA 4KSFA 3C26A 4MFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUA A;  5I0C A;  1LRZ A;  3JVN A;  4B5P A;  1IB1 E;  3FBU A;  1PU9 A;  1Y7R A;  4ONU A;  3K9U A;  1S7L A;  4RS2 A;  1KZF A;  1QSO A;  3BLN A;  4Y49 B;  3P2H A;  1IYK A;  4PSX A;  2C27 A;  4HNY B;  1YX0 A;  4QUS A;  2R98 A;  3B8G A;  1NE9 A;  3EXN A;  2B4D A;  2Q4Y A;  4JWP A;  2OH1 A;  4FD5 A;  4RI1 A;  1K4J A;  1QSN A;  2K5T A;  2FE7 A;  2DXQ A;  1I1D A;  2HUZ A;  2P6G A;  3FB3 A;  3S6F A;  4ORF A;  2FXF A;  1V0C A;  2D4O A;  2P6F A;  2B3U A;  3TTH A;  4NF1 A;  3JUW A;  2G3T A;  1QST A;  4XNH C;  3ZZI A;  2PR8 A;  1KUX A;  3TT2 A;  5F48 A;  2Z10 A;  4XPD C;  4UBR A;  3EO4 A;  2FS5 A;  4U9Y A;  4MJ8 A;  3TO9 A;  3NE7 A;  4DNC A;  3PP9 A;  1YRE A;  3CXS A;  1KUV A;  3E0K A;  4UWI A;  5EBV A;  2PSW A;  3DDD A;  5IX3 A;  4M3S A;  3BJ8 A;  3T90 A;  3V8I A;  1XIX A;  1N71 A;  3W6S A;  5HMN A;  2VZY A;  1UFH A;  1P4N A;  1YR0 A;  5J8C A;  2QIR A;  4B5P B;  2CY2 A;  1YLE A;  2VQY A;  2OZH A;  3KKW A;  4MBU A;  2B5G A;  3S6K A;  4AG7 A;  1BOB A;  2G3A A;  4ZBG A;  4J3G A;  3F8K A;  4AG9 A;  1S3Z A;  4E8O A;  3S6G A;  2PDO A;  2R1I A;  2OZG A;  4HNW B;  2NMT A;  3S6H A;  1QSM A;  2B4D B;  2Q04 A;  4KUB A;  2X7B A;  1P0H A;  1FY7 A;  1S5K A;  2AE6 A;  2Z0Z A;  3EFA A;  1XF8 A;  2Q44 A;  5J8F A;  1S7K A;  1RO5 A;  1QSR A;  2G0B A;  2REF A;  4IUS A;  5F49 A;  3F0A A;  3GKR A;  3TCV A;  3SXN A;  2I00 A;  2WPX A;  5DWN A;  2PRB A;  2VI7 A;  3QAH A;  2I79 A;  2VBQ A;  2Q4V A;  4L8A A;  1CM0 A;  2ZW5 A;  1L0C A;  2P6E A;  5GCN A;  2EUI A;  4JLY A;  4M85 A;  1Q2Y A;  5ISV A;  4H6U A;  4FD6 A;  2ZW7 A;  2ATR A;  4KVO E;  4YFJ A;  3SXO A;  3G3S A;  4AB7 A;  4R3L A;  3LD2 A;  3EY5 A;  3GY9 A;  1Z4E A;  1YGH A;  4HKF A;  3N7Z A;  2BEI A;  4KVX A;  5H86 A;  2P0W A;  1KUY A;  3TO7 A;  2J8R A;  2VZZ A;  4PSW A;  3W6X A;  4K30 A;  5IV0 A;  2R8V A;  3R1K A;  3P2F A;  4F6A A;  4YRH A;  4YGO A;  4MI4 A;  2B58 A;  3R9E A;  1I21 A;  2FSR A;  3CXP A;  4PV6 A;  4JJX A;  5EC4 A;  1B6B A;  1YVK A;  2QEC A;  4I49 A;  4CAW A;  2FIW A;  2AJ6 A;  3LOD A;  4B5O A;  2ZW6 A;  1IIC A;  1VKC A;  1Y9W A;  2J8N A;  4XPK A;  3I9S A;  2FCK A;  4NXY A;  4PK3 A;  4PK2 A;  2IL4 A;  4KOY A;  4KOU A;  2KCW A;  2O28 A;  2JEV A;  3TE4 A;  4QB9 A;  3FYN A;  2PR1 A;  3F5B A;  2QML A;  3D8P A;  2GE3 A;  1J4J A;  3UY5 A;  3BJ7 A;  1BO4 A;  2D4P A;  4R87 A;  2CNS A;  3I3G A;  2Q0Y A;  4AVB A;  3ZJ0 A;  1YK3 A;  4XNH B;  1Y9K A;  2F5I A;  5C82 A;  1I12 A;  1M1D A;  4CAX A;  2ZW4 A;  1CJW A;  5KTC A;  5H84 A;  2OU2 A;  2VXK A;  2BSW A;  4JXQ A;  2H5M A;  1M4D A;  1PUA A;  3IGR A;  3TFY A;  1IID A;  3OWC A;  1XE4 A;  3VWE A;  1TIQ A;  1S60 A;  2OZU A;  5DWM A;  1SQH A;  2B3V A;  2Y0M A;  4BMH A;  4CRZ B;  4OLL A;  4NSQ A;  4H89 A;  1ON0 A;  4LX9 A;  4MY0 A;  1RXT A;  1S7F A;  3D2M A;  3DR6 A;  4Y49 C;  5HH1 A;  4UWJ A;  2ZXV A;  2JDC A;  3R96 A;  5JQ4 A;  4X5K A;  1MJB A;  4U9Z A;  3FXT A;  3H4Q A;  3DNS A;  2PC1 A;  2JLM A;  4OAE A;  4EVY A;  1Z4R A;  4KLV A;  3T9Y A;  1YVO A;  2B4B A;  2RC4 A;  5E96 A;  3DSB A;  4L89 A;  3MGD A;  1Q2C A;  4NCZ A;  3PZJ A;  1U6M A;  4KOW A;  3FRM A;  4KOV A;  4MHD A;  1Z9U A;  2B5G B;  1B87 A;  4CS0 B;  1MJ9 A;  2CNM A;  4MY3 A;  2WPW A;  5F46 A;  3RYO A;  1XMT A;  4KVM E;  2BL1 A;  2GIV A;  4R9M A;  3R9G A;  2A4N A;  3EC4 A;  1M4G A;  3VWD A;  2CNT A;  2VEZ A;  3PGP A;  5IB0 A;  4E2A A;  1IYL A;  3DR8 A;  3FNC A;  4AVA A;  4E0A A;  5JPH A;  2OB0 A;  1M4I A;  4IF5 A;  4KOR A;  4R3K A;  3FIX A;  2JDD A;  1M44 A;  4HNX B;  4KZT A;  3D3S A;  4KOX A;  2Z11 A;  4GS4 A;  2Q7B A;  2ARH A;  1WWZ A;  5C88 A;  4QBJ A;  3G8W A;  5KTD A;  5FVJ A;  4JXR A;  4R57 A;  3CXQ A;  4FD7 A;  2REE A;  4KOT A;  4NEX A;  2HV2 A;  4JD6 A;  1OZP A;  4FD4 A;  1R57 A;  4F0Y A;  2EVN A;  1MJA A;  3WR7 A;  2FL4 A;  3R9F A;  4CAV A;  1VHS A;  2BUE A;  4XPD B;  4KOS A;  1NSL A;  3QB8 A;  1XEB A;  3TO6 A;  3D2P A;  4QVT A;  2GAN A;  4UA3 A;  2R7H A;  2FIA A;  3R95 A;  4XPL A;  2HQY A;  2PQ8 A;  4AVC A;  4H6Z A;  3W91 A;  1S7N A;  5CNP A;  3GYA A;  2ZPA A;  1MK4 A;  4QC6 A;  1WK4 A;  4CRY B;  3TOB A;  1Q2D A;  3TOA A;  4II9 A;  1NMT A;  2FT0 A;  4OAD A;  3SHP A;  4KLW A;  1GHE A;  2J8M A;  4U5Y A;  3IWG A;  5F47 A;  4KUA A;  5KTA A;  3C26 A; 
#chains in the Genus database with same CATH topology
 4BIN A;  1Y7E A;  4LUA A;  4A39 A;  1TXR A;  5I0C A;  2PJB A;  2BCO A;  3B3S A;  4FUU A;  1LRZ A;  3JVN A;  4B5P A;  4IK2 A;  3KR4 A;  1IB1 E;  3FBU A;  3SI2 A;  1PU9 A;  1Y7R A;  2XEG A;  4ONU A;  2NYQ A;  3IWW A;  4CGM A;  2F8H A;  3K9U A;  1S7L A;  4RS2 A;  1KZF A;  3D7H A;  4P4B A;  1QSO A;  4EWT A;  2ZED A;  3BLN A;  4Y49 B;  3P2H A;  4UIA A;  1IYK A;  1EE3 P;  1YSJ A;  4PSX A;  4PXB A;  1VHO A;  4C7H A;  2C27 A;  3H8F A;  3WT4 A;  4ZY1 A;  4HNY B;  4A31 A;  4G1P A;  4OC0 A;  3IU2 A;  4X8I A;  4CYP A;  1YX0 A;  4QUS A;  2OOT A;  4GXH A;  2PCU A;  4R76 A;  2R98 A;  3B8G A;  2Q43 A;  1NE9 A;  2GLJ A;  3EXN A;  1VGY A;  2B4D A;  2Q4Y A;  4MXU A;  2VL1 A;  3K2K A;  4JWP A;  1JWQ A;  3B3W A;  4B14 A;  2OH1 A;  4FD5 A;  4NGT A;  4RI1 A;  3BI1 A;  1K4J A;  1QSN A;  3FEC A;  4CGO A;  2K5T A;  3FF3 A;  2FE7 A;  2YND A;  1PYT B;  5K8N A;  4R6T A;  2DXQ A;  3KGQ A;  3JTK A;  1I1D A;  2HUZ A;  3FED A;  7CPA A;  2P6G A;  1LAM A;  3FB3 A;  1BPN A;  4ORF A;  3S6F A;  4CYQ A;  2FXF A;  1V0C A;  4MCR A;  2ZEM A;  4CAF A;  4RUH A;  2D4O A;  2P6F A;  2B3U A;  4CGN A;  3TTH A;  4NF1 A;  4OID A;  2YNC A;  1KWM A;  4WJB A;  4A95 A;  3JUW A;  4EME A;  3DGV A;  4ZYQ A;  3ISZ A;  5ELY A;  4ZI6 A;  4TNU A;  2G3T A;  2RFH A;  3CZX A;  1QST A;  4XNH C;  3ZZI A;  2PR8 A;  2Q51 A;  4CGP A;  4FAI A;  1KUX A;  3MRU A;  3TT2 A;  4NGQ A;  1Z2L A;  2DPS A;  3PFE A;  2Z10 A;  5F48 A;  5AG5 A;  2PIZ A;  3PEI A;  4XPD C;  4UBR A;  3EO4 A;  2FS5 A;  3A9L A;  4MJ8 A;  2O53 A;  4OC4 A;  3BI0 A;  4U9Y A;  2O4H A;  3NE7 A;  5LRJ A;  3TO9 A;  3V38 A;  4CYN A;  4MFL A;  4IAV A;  4DNC A;  3PP9 A;  1YRE A;  1CP7 A;  1KUV A;  3CXS A;  3E0K A;  3GIU A;  4JYW A;  4UWI A;  5EBV A;  4A37 A;  5HVG A;  2PSW A;  3DDD A;  5IX3 A;  4M3S A;  3BJ8 A;  3PBB A;  3T90 A;  4F0X A;  3B7I A;  4MFJ A;  4P44 A;  5THW A;  1CG2 A;  3RAM A;  3FEE A;  3V8I A;  4R7M A;  4NGN A;  1XIX A;  1N71 A;  3W6S A;  5HMN A;  2VZY A;  1UFH A;  1P4N A;  1YR0 A;  3D7D A;  5J8C A;  2QIR A;  4B5P B;  2CY2 A;  1YLE A;  3SJE A;  2VQY A;  4KSI A;  4Q7A A;  3WC5 A;  1CBX A;  2OZH A;  3KKW A;  3B3V A;  4MBU A;  5D8N A;  1YW6 A;  2B5G A;  3S6K A;  3SI1 A;  4AG7 A;  1BOB A;  3H5Z A;  3VH9 A;  2G3A A;  2V77 A;  4ZBG A;  4J3G A;  3F8K A;  1DTD A;  4AG9 A;  1TF8 A;  1S3Z A;  5AGE A;  4E8O A;  3S6G A;  3KL9 A;  2C6C A;  3IFE A;  3KHX A;  5HXD A;  3LAC A;  2PDO A;  2R1I A;  4MMO A;  2PJ3 A;  2OZG A;  3N5F A;  4FWU A;  3CDX A;  4CPA A;  4HNW B;  2NMT A;  4P4J A;  6CPA A;  3S6H A;  1ELL P;  1QSM A;  1Z5R A;  2B4D B;  3KQX A;  4RN7 A;  2Q04 A;  4KUB A;  2X7B A;  1P0H A;  1FY7 A;  5LYI A;  1F2O A;  4R8F A;  1S5K A;  3HUV A;  2AE6 A;  1CPS A;  2Z0Z A;  3QAY A;  2HC9 A;  1ELM P;  5F09 A;  3EFA A;  1XF8 A;  2Q44 A;  3HLP A;  1QQ9 A;  5J8F A;  1DE4 C;  2IJZ A;  2IMO A;  2WUU A;  1S7K A;  4UCN A;  1RO5 A;  1QSR A;  2G0B A;  2AFO A;  4A30 A;  2REF A;  4IUS A;  3NH5 A;  5F49 A;  2ZEF A;  3F0A A;  3PB7 X;  3GKR A;  4P4E A;  1PCA A;  2CTC A;  4YU9 A;  3TCV A;  3SXN A;  2DPT A;  2J9A A;  2I00 A;  2WPX A;  5DWN A;  2PRB A;  2PJ9 A;  2VI7 A;  4UEF A;  3QAH A;  4F9V A;  1FNO A;  2FVG A;  4X2T A;  2I79 A;  1Q7L A;  2VBQ A;  3WAB A;  2Q4V A;  4L8A A;  2XEJ A;  1CM0 A;  1ZG9 A;  3KAS A;  2ZW5 A;  1L0C A;  2P6E A;  3FVL A;  5GCN A;  2EUI A;  3CT9 A;  4JLY A;  3WC6 A;  4M85 A;  1Z8L A;  3BHX A;  2XEF A;  4C68 A;  1Q2Y A;  2DEA A;  3IO1 A;  4OC1 A;  5ISV A;  2PVW A;  4M6G A;  1YLO A;  4FD6 A;  4H6U A;  2ZW7 A;  2ATR A;  2ZEE A;  2PVV A;  4KVO E;  4PXE A;  1ZG8 A;  4YFJ A;  1CP6 A;  5CPA A;  3S9L A;  3SXO A;  3G3S A;  4AB7 A;  3KI9 A;  2JEW A;  4OC5 A;  3S9N A;  4W9Y A;  4R3L A;  3LD2 A;  3EY5 A;  2I3C A;  3GY9 A;  5JH9 A;  1Z4E A;  1YGH A;  4HKF A;  3N7Z A;  2BEI A;  4KVX A;  5H86 A;  1AYE A;  4C2Z A;  1YQE A;  1CPX A;  2P0W A;  2GRE A;  5EMI A;  1IGB A;  5JM6 A;  1KUY A;  4P4I A;  4P4D A;  2Z3L A;  4ZY0 A;  1ARM A;  3TO7 A;  2J8R A;  4DUK A;  2VZZ A;  4PSW A;  3W6X A;  3PFO A;  4K30 A;  5HVF A;  5IV0 A;  4IHM A;  2R8V A;  2Z3P A;  1LFW A;  3P2F A;  3R1K A;  3D66 A;  4F6A A;  1XOV A;  5BWA B;  4YRH A;  4PQA A;  4YGO A;  5LRG A;  4MI4 A;  3JRU A;  3D7F A;  2B58 A;  2CF4 A;  4H2K A;  4NJR A;  3R9E A;  1I21 A;  1IOF A;  4ZX9 A;  2FSR A;  2PRQ A;  3CXP A;  4PV6 A;  4JJX A;  5EC4 A;  1B6B A;  1YVK A;  2QEC A;  4I49 A;  4CAW A;  2FIW A;  5K8P A;  4EFD A;  1R3N A;  2AFM A;  2C1C A;  3B3C A;  2AJ6 A;  3LOD A;  1IY7 A;  1X10 A;  4B5O A;  2NSM A;  4UEE A;  2ZW6 A;  4Q36 A;  1IIC A;  1VKC A;  2BOA A;  1Y9W A;  2J8N A;  5LRK A;  1XBU A;  2ZEO A;  5AG7 A;  4XPK A;  3I9S A;  4F9U A;  2FCK A;  3LMS A;  4NXY A;  4PK3 A;  4PK2 A;  3B2Y A;  2IL4 A;  2V8D A;  4KOY A;  4KOU A;  1GYT A;  4NFR A;  2Q7S A;  2KCW A;  2O28 A;  3NFZ A;  2JEV A;  4NGS A;  3TE4 A;  4QB9 A;  3NH4 A;  3PB9 X;  5CBM A;  1VHE A;  1JQG A;  2PR1 A;  3F5B A;  3FYN A;  5I4M A;  2QML A;  1XFO A;  1Y0Y A;  2ZOF A;  1ZO0 A;  3VAT A;  2IQ6 A;  4NJQ A;  4PPZ A;  3D8P A;  4NGR A;  2GE3 A;  1J4J A;  4YWY A;  2CIJ A;  1BPM A;  3BXM A;  3BJ7 A;  1BO4 A;  3UY5 A;  5HVH A;  2D4P A;  4R87 A;  1ZG7 A;  2CNS A;  3B35 A;  3T8W A;  3I3G A;  2Q0Y A;  4AVB A;  3ZJ0 A;  1YK3 A;  2C6G A;  3KZW A;  4XNH B;  1Y9K A;  2F5I A;  3GUX A;  4A38 A;  5C82 A;  3V7Z A;  2ABZ A;  2WSA A;  4MFP A;  3QNV A;  2BO9 A;  3RO0 A;  1I12 A;  1M1D A;  2F7V A;  4LQG A;  4CAX A;  3PB8 X;  2ZW4 A;  1CJW A;  1YW4 A;  5KTC A;  1Z8T A;  3SJG A;  5H84 A;  2OU2 A;  2PJ1 A;  1RTQ A;  3S9M A;  2VXK A;  4UFX A;  2BSW A;  4CAV A;  4JXQ A;  3SI0 A;  2H5M A;  5K8M A;  2YGW A;  1M4D A;  1PUA A;  3IGR A;  4AXV A;  1IID A;  3KQZ A;  1XE4 A;  3OWC A;  3TFY A;  2EK9 A;  3VWE A;  4M6I A;  2YNE A;  1TIQ A;  1S60 A;  2OZU A;  5DWM A;  4A33 A;  4FBE A;  1SQH A;  4M6H A;  2B3V A;  3IJ3 A;  4TWE A;  3CPA A;  5LYL A;  1Z8X A;  2Y0M A;  4KS9 A;  4BMH A;  4OLL A;  4NSQ A;  4CRZ B;  2JBK A;  4H89 A;  4F8Z A;  1ON0 A;  4LX9 A;  4MY0 A;  2XEI A;  4C7I A;  4B10 A;  4CGL A;  1RXT A;  3SJX A;  1S7F A;  4OP4 A;  1XMB A;  4CYO A;  3D2M A;  4OME A;  1YME A;  1F57 A;  3SJF A;  3IWE A;  3DR6 A;  4WWV A;  4Y49 C;  5HH1 A;  3ISX A;  4MFZ A;  4UWJ A;  1LCP A;  3GB0 A;  2ZXV A;  2JDC A;  1FT7 A;  2POK A;  5G21 A;  5G22 A;  4MHP A;  3R96 A;  3RBU A;  5JQ4 A;  4X5K A;  1LOK A;  1MJB A;  1BLL E;  3NE8 A;  4U9Z A;  3FXT A;  4MCQ A;  3H4Q A;  1XRY A;  5D29 A;  3DNS A;  4P45 A;  4B12 A;  2PC1 A;  2JLM A;  2CTB A;  4OAE A;  5AG6 A;  4EVY A;  1Z4R A;  3B3T A;  4B6Z A;  1TKJ A;  2Z3K A;  2PJ5 A;  1VIX A;  4OC2 A;  4KLV A;  4C2Y A;  2PJC A;  1YVO A;  3T9Y A;  2B4B A;  2RC4 A;  4O23 A;  5E96 A;  4A2Z A;  3DSB A;  4K3N A;  4L89 A;  3IIB A;  3MGD A;  4PXD A;  1Q2C A;  4UFW A;  4NCZ A;  2EO8 A;  4UEZ A;  3PB6 X;  3PZJ A;  3H8E A;  4B11 A;  1AUG A;  1U6M A;  5LYD A;  3GLJ A;  1OBR A;  1R43 A;  1TF9 A;  2ZEN A;  4KOW A;  1LAP A;  3K9T A;  2WZN A;  3FRM A;  5DS0 A;  4KOV A;  2ODF A;  3LWU A;  4MHD A;  4ZX8 A;  1H8L A;  3TC8 A;  1Z9U A;  1M4L A;  2B5G B;  2AFX A;  1B87 A;  2HB6 A;  4CS0 B;  1MJ9 A;  2CNM A;  2G9D A;  3MN8 A;  2PJ2 A;  4MY3 A;  4UF4 A;  5K8O A;  1Y0R A;  4A94 A;  2AFZ A;  4JZ0 A;  2WPW A;  3I1U A;  3PBE A;  5F46 A;  1IU8 A;  3RYO A;  2EBJ A;  5G20 A;  2QVP A;  1XMT A;  1CX8 A;  4KVM E;  2BL1 A;  4B13 A;  2GIV A;  4R9M A;  4ZY2 A;  3R9G A;  2A4N A;  4GM5 A;  3EC4 A;  4Z65 A;  4OIW A;  4UFV A;  2ZEL A;  4OKO A;  2Z3M A;  3PB4 X;  1HEE A;  1ZLH A;  1M4G A;  3VWD A;  2CNT A;  2VEZ A;  3PGP A;  3D7G A;  1IOI A;  4CAE A;  2ZEH A;  3IU1 A;  5IB0 A;  2PIY A;  2PJ4 A;  4MHY A;  4E2A A;  1IYL A;  3DLJ A;  3RNZ A;  8CPA A;  3DR8 A;  3FNC A;  4MCS A;  4AVA A;  4E0A A;  5JPH A;  2OB0 A;  1M4I A;  4IF5 A;  1HDU A;  4KOR A;  2ANP A;  3WC7 A;  2GFQ A;  4R3K A;  3CPX A;  2GLF A;  3FIX A;  2EWB A;  1M44 A;  2JDD A;  4HNX B;  4PXC A;  3IC1 A;  2EK8 A;  3D67 A;  4KZT A;  2CXA A;  3D3S A;  2Z11 A;  4KOX A;  2Z3O A;  4GS4 A;  4P6Y A;  5J1Q A;  2Q7B A;  2WYR A;  4MFK A;  1BAV A;  1ARL A;  2ARH A;  1AMP A;  2QYV A;  4UCM A;  1WWZ A;  5C88 A;  4QBJ A;  1LAN A;  3NA6 A;  3G8W A;  5LYF A;  5KTD A;  5FVJ A;  1A2Z A;  4JXR A;  2V8H A;  4ZGY B;  1F2P A;  4OC3 A;  4A32 A;  4R57 A;  3RZA A;  3CXQ A;  2AFW A;  4Q38 A;  1NSA A;  3L2N A;  2Z3N A;  1TKH A;  3FMC A;  2JBJ A;  4BBH A;  4LQ6 A;  4FD7 A;  2REE A;  4KOT A;  4NEX A;  3D68 A;  2HV2 A;  4JD6 A;  4BD9 A;  1OZP A;  2AFU A;  4FD4 A;  1QMU A;  2PJ6 A;  1R57 A;  4NGM A;  3NH8 A;  4F0Y A;  2EVN A;  1HDQ A;  1MJA A;  2FL4 A;  3PRT A;  4NGP A;  3R9F A;  3TX8 A;  2C6P A;  4ONW A;  3WR7 A;  1VHS A;  2BUE A;  3IEH A;  4XPD B;  4X3R A;  4DYO A;  4KOS A;  2PJ8 A;  2ZEG A;  3KR5 A;  3QB8 A;  3H8G A;  1NSL A;  4C2X A;  2QJ8 A;  5IB9 A;  2PJA A;  1X12 A;  1XEB A;  2PE3 A;  3TO6 A;  3D2P A;  3VAR A;  4QVT A;  2PJ0 A;  1XJO A;  2GAN A;  2OR4 A;  2V8G A;  4UA3 A;  2YNC C;  2R7H A;  2FIA A;  2ZEP A;  3R95 A;  4XPL A;  5JGF A;  2HQY A;  2PQ8 A;  2Q4Z A;  4AVC A;  4KSA A;  4H6Z A;  3W91 A;  5G1Z A;  1S7N A;  4HPS A;  1ZLI A;  4MCP A;  4UCP A;  4UIB A;  5CNP A;  3GYA A;  2GU2 A;  2ZOG A;  2ZPA A;  4MHZ A;  1MK4 A;  3FX6 A;  4QC6 A;  1UWY A;  1WK4 A;  4CRY B;  3TOB A;  1Q2D A;  4MHN A;  5A27 A;  3TOA A;  4II9 A;  1NMT A;  2FT0 A;  4OAD A;  4DJL A;  3SHP A;  5A28 A;  4KLW A;  1GHE A;  2J8M A;  4U5Y A;  3KHZ A;  3FH4 A;  4MRI A;  4P4F A;  5AG4 A;  2PJ7 A;  3IWG A;  2V8V A;  2DF5 A;  3D4U A;  1Z8W A;  5F47 A;  2AFS A;  3FJU A;  4KUA A;  5KTA A;  4KSF A;  1TKF A;  3C26 A;  4P10 A;  4MFQ A;  2RB7 A; 
#chains in the Genus database with same CATH homology
 4LUA A;  5I0C A;  1LRZ A;  3JVN A;  4B5P A;  1IB1 E;  3FBU A;  1PU9 A;  1Y7R A;  4ONU A;  4CGM A;  3K9U A;  1S7L A;  4RS2 A;  1KZF A;  1QSO A;  3BLN A;  4Y49 B;  3P2H A;  1IYK A;  4PSX A;  4C7H A;  2C27 A;  4HNY B;  4A31 A;  3IU2 A;  4CYP A;  1YX0 A;  4QUS A;  2R98 A;  3B8G A;  1NE9 A;  3EXN A;  2B4D A;  2Q4Y A;  4JWP A;  4B14 A;  2OH1 A;  4FD5 A;  4RI1 A;  1K4J A;  1QSN A;  4CGO A;  2K5T A;  2FE7 A;  2YND A;  2DXQ A;  3JTK A;  1I1D A;  2HUZ A;  2P6G A;  3FB3 A;  3S6F A;  4ORF A;  4CYQ A;  2FXF A;  1V0C A;  4CAF A;  2D4O A;  2P6F A;  2B3U A;  4CGN A;  3TTH A;  4NF1 A;  2YNC A;  4A95 A;  3JUW A;  2G3T A;  1QST A;  4XNH C;  3ZZI A;  2PR8 A;  4CGP A;  1KUX A;  3TT2 A;  5F48 A;  2DPS A;  2Z10 A;  5AG5 A;  4XPD C;  4UBR A;  3EO4 A;  2FS5 A;  3A9L A;  4MJ8 A;  4U9Y A;  3TO9 A;  3NE7 A;  4CYN A;  4DNC A;  4MFL A;  3PP9 A;  1YRE A;  3CXS A;  1KUV A;  3E0K A;  4UWI A;  5EBV A;  2PSW A;  3DDD A;  5IX3 A;  4M3S A;  3BJ8 A;  3T90 A;  4F0X A;  4MFJ A;  3V8I A;  1XIX A;  1N71 A;  3W6S A;  5HMN A;  2VZY A;  1UFH A;  1P4N A;  1YR0 A;  5J8C A;  2QIR A;  4B5P B;  2CY2 A;  1YLE A;  2VQY A;  2OZH A;  3KKW A;  4MBU A;  2B5G A;  3S6K A;  4AG7 A;  1BOB A;  3H5Z A;  2G3A A;  4ZBG A;  4J3G A;  3F8K A;  4AG9 A;  1S3Z A;  5AGE A;  4E8O A;  3S6G A;  2PDO A;  2R1I A;  2OZG A;  4HNW B;  2NMT A;  3S6H A;  1QSM A;  2B4D B;  2Q04 A;  4KUB A;  2X7B A;  1P0H A;  1FY7 A;  1S5K A;  2AE6 A;  2Z0Z A;  3EFA A;  1XF8 A;  2Q44 A;  5J8F A;  2WUU A;  1S7K A;  4UCN A;  1RO5 A;  1QSR A;  2G0B A;  4A30 A;  2REF A;  4IUS A;  5F49 A;  3F0A A;  3GKR A;  3TCV A;  3SXN A;  2DPT A;  2I00 A;  2WPX A;  5DWN A;  2PRB A;  2VI7 A;  3QAH A;  2I79 A;  2VBQ A;  2Q4V A;  4L8A A;  1CM0 A;  2ZW5 A;  1L0C A;  2P6E A;  5GCN A;  2EUI A;  4JLY A;  4M85 A;  4C68 A;  1Q2Y A;  5ISV A;  4H6U A;  4FD6 A;  2ZW7 A;  2ATR A;  4KVO E;  4YFJ A;  3SXO A;  3G3S A;  4AB7 A;  4R3L A;  3LD2 A;  3EY5 A;  3GY9 A;  1Z4E A;  1YGH A;  4HKF A;  3N7Z A;  2BEI A;  4KVX A;  5H86 A;  4C2Z A;  2P0W A;  1KUY A;  2Z3L A;  3TO7 A;  2J8R A;  2VZZ A;  4PSW A;  3W6X A;  4K30 A;  5IV0 A;  2R8V A;  2Z3P A;  3R1K A;  3P2F A;  4F6A A;  5BWA B;  4YRH A;  4YGO A;  4MI4 A;  2B58 A;  3R9E A;  1I21 A;  2FSR A;  3CXP A;  4PV6 A;  4JJX A;  5EC4 A;  1B6B A;  1YVK A;  2QEC A;  4I49 A;  4CAW A;  2FIW A;  2AJ6 A;  3LOD A;  4B5O A;  2ZW6 A;  4Q36 A;  1IIC A;  1VKC A;  1Y9W A;  2J8N A;  5AG7 A;  4XPK A;  3I9S A;  2FCK A;  4NXY A;  4PK3 A;  4PK2 A;  2IL4 A;  4KOY A;  4KOU A;  2KCW A;  2O28 A;  2JEV A;  3TE4 A;  4QB9 A;  3FYN A;  2PR1 A;  3F5B A;  2QML A;  1ZO0 A;  3D8P A;  2GE3 A;  1J4J A;  3UY5 A;  3BJ7 A;  1BO4 A;  2D4P A;  4R87 A;  2CNS A;  3I3G A;  2Q0Y A;  4AVB A;  3ZJ0 A;  1YK3 A;  4XNH B;  1Y9K A;  2F5I A;  5C82 A;  2WSA A;  4MFP A;  1I12 A;  1M1D A;  4CAX A;  2ZW4 A;  1CJW A;  5KTC A;  5H84 A;  2OU2 A;  2VXK A;  4UFX A;  2BSW A;  4JXQ A;  2H5M A;  2YGW A;  1M4D A;  1PUA A;  3IGR A;  3TFY A;  1IID A;  3OWC A;  1XE4 A;  3VWE A;  2YNE A;  1TIQ A;  1S60 A;  2OZU A;  5DWM A;  4A33 A;  1SQH A;  2B3V A;  2Y0M A;  4BMH A;  4KS9 A;  4CRZ B;  4OLL A;  4NSQ A;  4H89 A;  1ON0 A;  4LX9 A;  4MY0 A;  4C7I A;  4CGL A;  1RXT A;  1S7F A;  4CYO A;  3D2M A;  3IWE A;  3DR6 A;  4Y49 C;  5HH1 A;  4MFZ A;  4UWJ A;  2ZXV A;  2JDC A;  5G21 A;  5G22 A;  3R96 A;  5JQ4 A;  4X5K A;  1MJB A;  4U9Z A;  3FXT A;  3H4Q A;  3DNS A;  4B12 A;  2PC1 A;  2JLM A;  4OAE A;  5AG6 A;  4EVY A;  1Z4R A;  2Z3K A;  4KLV A;  4C2Y A;  3T9Y A;  1YVO A;  4A2Z A;  2B4B A;  2RC4 A;  5E96 A;  3DSB A;  4L89 A;  3MGD A;  1Q2C A;  4UFW A;  4NCZ A;  3PZJ A;  4B11 A;  1U6M A;  4KOW A;  3FRM A;  4KOV A;  4MHD A;  1Z9U A;  2B5G B;  1B87 A;  4CS0 B;  1MJ9 A;  2CNM A;  4MY3 A;  2WPW A;  5F46 A;  3RYO A;  5G20 A;  1XMT A;  4KVM E;  2BL1 A;  4B13 A;  2GIV A;  4R9M A;  3R9G A;  2A4N A;  3EC4 A;  4UFV A;  2Z3M A;  1M4G A;  3VWD A;  2CNT A;  2VEZ A;  3PGP A;  4CAE A;  3IU1 A;  5IB0 A;  4E2A A;  1IYL A;  3DR8 A;  3FNC A;  4AVA A;  4E0A A;  5JPH A;  2OB0 A;  1M4I A;  4IF5 A;  4KOR A;  4R3K A;  3FIX A;  2JDD A;  1M44 A;  4HNX B;  4B10 A;  4KZT A;  2CXA A;  3D3S A;  2Z11 A;  4KOX A;  2Z3O A;  4GS4 A;  2Q7B A;  4MFK A;  2ARH A;  4UCM A;  1WWZ A;  5C88 A;  4QBJ A;  3G8W A;  5KTD A;  5FVJ A;  4JXR A;  4ZGY B;  4A32 A;  4R57 A;  3CXQ A;  4Q38 A;  2Z3N A;  4BBH A;  4FD7 A;  2REE A;  4KOT A;  4NEX A;  2HV2 A;  4JD6 A;  1OZP A;  4FD4 A;  1R57 A;  4F0Y A;  2EVN A;  1MJA A;  3WR7 A;  2FL4 A;  3R9F A;  4CAV A;  1VHS A;  2BUE A;  4XPD B;  4KOS A;  4C2X A;  1NSL A;  3QB8 A;  1XEB A;  3TO6 A;  3D2P A;  4QVT A;  2GAN A;  4UA3 A;  2YNC C;  2R7H A;  2FIA A;  3R95 A;  4XPL A;  2HQY A;  2PQ8 A;  4AVC A;  4KSA A;  4H6Z A;  3W91 A;  5G1Z A;  1S7N A;  4UCP A;  5CNP A;  3GYA A;  2ZPA A;  1MK4 A;  4QC6 A;  1WK4 A;  4CRY B;  3TOB A;  1Q2D A;  5A27 A;  3TOA A;  4II9 A;  1NMT A;  2FT0 A;  4OAD A;  3SHP A;  5A28 A;  4KLW A;  1GHE A;  2J8M A;  4U5Y A;  5AG4 A;  3IWG A;  5F47 A;  4KUA A;  5KTA A;  4KSF A;  3C26 A;  4MFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...