4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
1IYLA 2I79A 1N71A 1RXTA 2G3TA 2VQYA 2JLMA 2REEA 3CXQA 2AE6A 4CRYB 2FXFA 1YLEA 5DWNA 4Y49B 3F8KA 1VHSA 3IWGA 4PK3A 3IGRA 1Z9UA 4MJ8A 4XPDC 1SQHA 3NE7A 1PUAA 4KVOE 5C88A 1YVOA 2Q4YA 2ARHA 3K9UA 5HMNA 2OZUA 3I3GA 5F47A 4AB7A 4RI1A 2ZW7A 4H6UA 2ZW5A 3FNCA 3FXTA 4MY0A 2VZYA 1KUXA 1I12A 2Q7BA 4B5OA 4X5KA 4E2AA 4NEXA 1YK3A 1QSTA 1IYKA 5EC4A 4CAXA 4PSWA 4R3KA 5J8FA 2GIVA 1M1DA 2CNTA 2D4PA 5DWMA 1QSOA 3I9SA 2P6GA 5EBVA 3P2FA 2JEVA 3VWEA 3D2MA 4PSXA 2B3VA 2OU2A 4XPLA 3PZJA 3MGDA 4MI4A 1NMTA 2VBQA 3FRMA 1XF8A 4HNXB 2J8MA 3G8WA 5F46A 3ZZIA 4UWJA 4ONUA 2B4DB 2FE7A 3OWCA 4AVAA 2FS5A 5C82A 3SXNA 2Z10A 1M4DA 3KKWA 3S6HA 3BJ8A 2C27A 3R9GA 4KOWA 2CNMA 1IICA 4OLLA 1QSNA 3EXNA 2O28A 2BL1A 2G0BA 3DDDA 2PR8A 4M3SA 3TO6A 3V8IA 4XPDB 4AVCA 4II9A 1CJWA 2ZW4A 2GANA 3JVNA 4U9ZA 4NF1A 2R7HA 3VWDA 1PU9A 5H86A 1B6BA 2B5GA 3FYNA 2REFA 4LUAA 1KZFA 2P6FA 1Z4EA 3TFYA 3PP9A 2Z11A 2PRBA 3FIXA 5FVJA 3DR6A 4KOUA 5HH1A 2R8VA 2FL4A 4ZBGA 2J8NA 4JJXA 2Q44A 3GY9A 4UBRA 4UWIA 3N7ZA 3DR8A 4JD6A 3CXPA 2X7BA 2CY2A 2B3UA 2G3AA 3G3SA 2PQ8A 2Q4VA 1XIXA 2ZPAA 3TO7A 4JLYA 1MK4A 3S6GA 2A4NA 2PSWA 2H5MA 1B87A 2BSWA 3BJ7A 2PC1A 3T9YA 4KOVA 3DNSA 3R95A 2VXKA 4XPKA 4CS0B 5IB0A 5KTCA 2R1IA 4F6AA 2VEZA 3P2HA 4CRZB 5JQ4A 4H6ZA 3E0KA 4KOSA 2HV2A 1I1DA 4LX9A 5F49A 2OZHA 3BLNA 4OADA 2QECA 3DSBA 2D4OA 4PV6A 3TCVA 1P0HA 4KLVA 3R9EA 1Q2CA 4KVME 4YRHA 1S7LA 1M4GA 4CAVA 3RYOA 2K5TA 4NXYA 4U9YA 4YGOA 4R87A 3LODA 4NCZA 4DNCA 4IF5A 4H89A 4L8AA 3D8PA 2FCKA 3W6XA 1U6MA 1MJAA 4FD4A 4HKFA 5I0CA 4B5PA 1BOBA 4KOXA 1YGHA 4PK2A 5E96A 2JDCA 3F0AA 3R1KA 4E8OA 4GS4A 1UFHA 1LRZA 1Y9WA 1Q2YA 4QBJA 1Y9KA 2JDDA 2FIWA 4JXRA 1P4NA 2NMTA 1RO5A 2CNSA 2OZGA 3D2PA 5IX3A 1FY7A 4NSQA 3EY5A 2FIAA 1XMTA 3TOBA 2FT0A 4E0AA 1S7FA 2OH1A 4YFJA 1V0CA 1R57A 5F48A 2B58A 4FD6A 2B5GB 4QVTA 2P6EA 4R9MA 3S6KA 2F5IA 3QAHA 3C26A 1ON0A 4AG7A 1VKCA 4J3GA 2BEIA 1YVKA 4AG9A 4R57A 4QB9A 1L0CA 4MBUA 2Q0YA 1IB1E 3R96A 2VZZA 4IUSA 1YR0A 4EVYA 2P0WA 3TT2A 3ZJ0A 5ISVA 4I49A 4KUAA 3EO4A 2GE3A 1I21A 2Q04A 4M85A 1OZPA 4KOTA 1S7NA 4ORFA 4XNHC 4KUBA 4BMHA 5JPHA 3WR7A 2OB0A 2FSRA 2QMLA 1YREA 1S5KA 5J8CA 1S60A 3GKRA 4FD7A 4KLWA 3TO9A 1TIQA 1GHEA 4FD5A 1WWZA 4QC6A 1S3ZA 3R9FA 3SXOA 1KUYA 3W6SA 2I00A 1MJBA 3LD2A 2ATRA 2RC4A 2PDOA 2EUIA 1Q2DA 1WK4A 1IIDA 2VI7A 3W91A 1M4IA 4RS2A 1CM0A 3CXSA 2IL4A 3EC4A 3EFAA 3F5BA 4Y49C 4JWPA 2J8RA 4OAEA 4UA3A 2KCWA 3TOAA 1BO4A 4HNYB 1MJ9A 4QUSA 4K30A 3D3SA 4HNWB 2QIRA 3SHPA 4JXQA 4KZTA 2EVNA 1QSRA 4MY3A 2B4BA 1Y7RA 2B4DA 5CNPA 4B5PB 3T90A 3TTHA 4KVXA 4CAWA 5GCNA 4F0YA 2DXQA 2WPXA 5H84A 1S7KA 4U5YA 4AVBA 1KUVA 1NSLA 1M44A 1YX0A 1Z4RA 3H4QA 3QB8A 3FB3A 3JUWA 4KORA 3TE4A 4KOYA 3FBUA 5IV0A 1NE9A 1XEBA 2Y0MA 1K4JA 1XE4A 4XNHB 5KTDA 2HQYA 5KTAA 2BUEA 1QSMA 2ZW6A 4L89A 3PGPA 4R3LA 2R98A 2HUZA 3UY5A 4MHDA 3B8GA 3S6FA 2AJ6A 2PR1A 3GYAA 1J4JA 2Z0ZA 2ZXVA 2WPWA
chains in the Genus database with same CATH superfamily
1IYLA 2I79A 1N71A 1RXTA 2G3TA 2VQYA 2JLMA 2REEA 3CXQA 3SI0A 2PJ9A 5JM6A 5EMIA 2AE6A 4CRYB 2FXFA 1YLEA 4OKOA 1IOIA 2EK9A 5DWNA 4OC2A 4Y49B 3F8KA 3S9MA 1VHSA 1LOKA 4F9VA 3B3WA 3IWGA 3BI1A 4PK3A 3SJEA 3IGRA 2AFUA 2ZXVA 3IIBA 1Z9UA 3WC6A 4MJ8A 4X8IA 3RBUA 1QQ9A 4XPDC 4X3RA 2NSMA 4NGNA 1SQHA 1YLOA 3NE7A 4EMEA 1PUAA 4KVOE 5C88A 2EK8A 1XRYA 2PVWA 1HDQA 1YVOA 4ZX9A 2Q4YA 1TKJA 3B2YA 3SI1A 1Y7EA 3CDXA 3V7ZA 2ARHA 3H8EA 3K9UA 3SJFA 5HMNA 4Z65A 1TF9A 2Z3KA 2OZUA 1X12A 3I3GA 5F47A 3LMSA 1Z8TA 3VATA 4AB7A 4RI1A 4R6TA 2V77A 2ZW7A 4H6UA 5K8NA 4A95A 1PYTB 3WC7A 2ZW5A 3FNCA 3FXTA 3B3CA 2VZYA 4MY0A 1KUXA 3PB7X 1I12A 1H8LA 2WUUA 4PQAA 2Q7BA 3PEIA 4X5KA 4B5OA 2C1CA 1ZLIA 4IAVA 1ARLA 4E2AA 3IC1A 4GM5A 4NEXA 3SJXA 1YK3A 1QSTA 1IYKA 5EC4A 4CAXA 4PSWA 4M6HA 2GREA 4R3KA 2GIVA 5J8FA 1M1DA 2CNTA 2D4PA 4NGTA 5DWMA 4FBEA 2HB6A 3TX8A 5HXDA 2ZEPA 2ZEHA 1QSOA 4Q7AA 1A2ZA 4MCRA 3I9SA 2P6GA 2Q4ZA 5EBVA 3KR5A 3P2FA 5LRGA 2JEVA 3VWEA 3D2MA 4PSXA 4H2KA 2B3VA 2OU2A 1R3NA 4XPLA 3PZJA 3MGDA 4MI4A 1NMTA 4UF4A 1ARMA 2VBQA 2Z3MA 3FRMA 1YW6A 1XF8A 2DPTA 4HNXB 4MCSA 2J8MA 3G8WA 5F46A 3FECA 5AG6A 3ZZIA 4C7HA 4UWJA 3GLJA 1IU8A 3VH9A 3DGVA 2B4DB 2FE7A 3IO1A 4MCPA 1R43A 4ONUA 5HVGA 3OWCA 4AVAA 2FS5A 5C82A 3PBEA 3H5ZA 2Z10A 3SXNA 5AG5A 4DYOA 1JWQA 1M4DA 3KKWA 2NYQA 3S6HA 4OC3A 3BJ8A 1LCPA 2C27A 3R9GA 4IK2A 1AUGA 1DE4C 4CGPA 4KOWA 4KSFA 4OMEA 4UFWA 4C2XA 2CNMA 1IICA 6CPAA 4MHZA 2ZENA 3A9LA 2Z3LA 4OLLA 3D7HA 4UEFA 1JQGA 4JYWA 1QSNA 3EXNA 4NFRA 4P4DA 2O28A 4CYNA 2ZEGA 2BL1A 2G0BA 3DDDA 3WC5A 5G1ZA 2PR8A 4G1PA 4YWYA 2PIYA 1XFOA 4M3SA 3NA6A 3TO6A 3V8IA 4NJQA 1BPMA 4XPDB 8CPAA 4R7MA 4AVCA 4II9A 1TKHA 3FH4A 1CJWA 2ZW4A 3IJ3A 5G22A 2GANA 4CAFA 3JVNA 4FUUA 5CPAA 5HVHA 2V8GA 4U9ZA 4NF1A 2R7HA 3VWDA 1PU9A 2AFOA 5H86A 2Q7SA 3PRTA 4CPAA 1B6BA 2B5GA 4P10A 3FYNA 2C6CA 2DPSA 3IEHA 2REFA 3GIUA 4LUAA 3D68A 3CPAA 1KZFA 2P6FA 1Z4EA 2Q43A 4NGRA 3KQXA 3TFYA 1YW4A 4FAIA 3BXMA 3PP9A 1PCAA 4MFKA 7CPAA 2Z11A 2PRBA 3FIXA 5FVJA 3SI2A 3WABA 4CYPA 3DR6A 4KOUA 5HH1A 2R8VA 4UEZA 1EE3P 2FL4A 4GXHA 4ZBGA 1F2OA 2J8NA 4JJXA 2Q44A 3GY9A 4UBRA 4UWIA 5JH9A 3N7ZA 4F8ZA 3DR8A 4JD6A 3CXPA 4P4JA 2X7BA 3FVLA 1YMEA 2CY2A 2B3UA 2PE3A 4UCPA 2G3AA 3G3SA 1Z8LA 4A33A 4BD9A 2PQ8A 1CG2A 4PPZA 4B14A 4ZI6A 2Q4VA 2PJ2A 3PBBA 4B6ZA 1XIXA 2ZPAA 3TO7A 4JLYA 3ISXA 1MK4A 3S6GA 2A4NA 2EO8A 2PSWA 2H5MA 1B87A 2O4HA 3B35A 3KQZA 1IGBA 4B11A 2BSWA 2C6PA 3D4UA 4BBHA 1X10A 1Y0YA 2PC1A 3BJ7A 3T9YA 4KOVA 3DNSA 5LRKA 3R95A 2VXKA 4XPKA 3DLJA 5A27A 4CS0B 1Z2LA 2CTCA 3B3TA 5IB0A 2WSAA 5D8NA 5KTCA 2PJ4A 4CGOA 2R1IA 3B7IA 4KS9A 4F6AA 2F8HA 2VEZA 1QMUA 3N5FA 3BHXA 3RZAA 2O53A 3P2HA 1KWMA 2PJBA 4CRZB 5JQ4A 4H6ZA 3E0KA 4KOSA 2HV2A 3GB0A 2Z3PA 1I1DA 4LX9A 5F49A 4RUHA 2OZHA 3KASA 3D66A 3BLNA 4P6YA 4OADA 2QECA 4ZY0A 3S9LA 3DSBA 3K9TA 1HEEA 2Z3NA 3HUVA 2JEWA 2POKA 2D4OA 1LAPA 5AG4A 5LYIA 4PV6A 5DS0A 3D67A 3TCVA 1P0HA 5THWA 4KSAA 4CAEA 4KLVA 2PRQA 4Q36A 3R9EA 2XEGA 1Q2CA 4F0XA 4KVME 4MCQA 4OC0A 4YRHA 4MXUA 1S7LA 1M4GA 3NH4A 4NGPA 3CT9A 4CAVA 3FEDA 3FJUA 1ZLHA 1NSAA 4C2YA 3RYOA 2K5TA 3PB8X 3H8FA 3KHXA 4HPSA 4NXYA 3PFEA 4P4FA 3HLPA 2PJ1A 4U9YA 1AYEA 2JBKA 4YGOA 4R87A 3LODA 2WYRA 4NCZA 4UIBA 4DNCA 4IF5A 4H89A 4L8AA 3D8PA 4CYQA 5LYFA 3ISZA 2FCKA 3NFZA 2G9DA 2DEAA 4ZY2A 3W6XA 1U6MA 4KSIA 1MJAA 2BCOA 1BAVA 2YNEA 4FD4A 4HKFA 5CBMA 5I0CA 4B5PA 1XBUA 1BOBA 4KOXA 3MN8A 1YGHA 4PK2A 5E96A 2JDCA 2YNDA 4EFDA 3F0AA 2GLJA 3R1KA 4E8OA 2ZOFA 1ZG9A 2GU2A 1UFHA 4GS4A 3KZWA 1LRZA 1Y9WA 2ZEFA 4A94A 1XMBA 4NGSA 1Q2YA 2GFQA 4UFVA 1Z5RA 2PJ6A 2AFXA 4W9YA 4QBJA 2C6GA 1Y9KA 2JDDA 2FIWA 4JXRA 1P4NA 4UCMA 4EWTA 1Z8XA 2NMTA 4TNUA 2ABZA 2ANPA 2V8HA 3V38A 4OC4A 1RO5A 3NE8A 2CNSA 2OZGA 3D2PA 4O23A 5IX3A 4CGNA 2JBJA 2CIJA 3D7DA 4UIAA 1FY7A 1Z8WA 2QJ8A 3EY5A 4NSQA 1F2PA 1LFWA 1XMTA 2FIAA 3TOBA 2FT0A 1ELLP 4E0AA 2CF4A 1S7FA 4A39A 1VHEA 2OH1A 5LYDA 1HDUA 4A2ZA 4YFJA 2J9AA 1V0CA 1R57A 5F48A 2Q51A 2B58A 4FD6A 2B5GB 4QVTA 2P6EA 2YNCA 4R9MA 4C68A 3S6KA 2F5IA 3QAHA 3S9NA 3C26A 1VIXA 4F9UA 2RB7A 3RAMA 3KHZA 4FWUA 1ON0A 4X2TA 4AG7A 3H8GA 3B3SA 2PIZA 3K2KA 4Q38A 1VKCA 3D7FA 3T8WA 4J3GA 4TWEA 4MHNA 4CGMA 2BEIA 4IHMA 1ZO0A 4ZYQA 3JRUA 1YVKA 4AG9A 1FT7A 4R57A 3IWWA 4YU9A 4QB9A 1L0CA 4MBUA 4CGLA 4MRIA 2Q0YA 2AFMA 1IB1E 3R96A 5F09A 4UCNA 2VZZA 3KI9A 4IUSA 1YR0A 3L2NA 4OIDA 4UFXA 4EVYA 3IU2A 5IB9A 5LYLA 4PXEA 4DJLA 1ZG7A 4WWVA 1GYTA 2ZELA 4JZ0A 1F57A 2P0WA 3TT2A 3ZJ0A 1LAMA 2BO9A 5ISVA 4I49A 3PB6X 5J1QA 1IOFA 4KUAA 4PXBA 3EO4A 4P45A 2GLFA 2GE3A 4NGQA 4LQGA 4M6GA 1I21A 2Q04A 1YQEA 2EBJA 4M85A 5K8MA 1TF8A 4B13A 1OZPA 2YGWA 4KOTA 4B10A 1S7NA 2PJCA 3QAYA 4ORFA 3RO0A 2CXAA 2IQ6A 2HC9A 4XNHC 4KUBA 5LRJA 4BMHA 5JPHA 4A31A 4MMOA 3RNZA 3WR7A 1XJOA 2OB0A 2FSRA 1YREA 2QMLA 4PXCA 2YNCC 1TXRA 1S5KA 5J8CA 1S60A 3FMCA 4MFZA 3GKRA 3JTKA 4FD7A 1RTQA 4KLWA 4WJBA 3TO9A 1TIQA 2CTBA 1GHEA 4FD5A 1CP7A 1AMPA 2PCUA 1WWZA 3KR4A 4QC6A 1BPNA 1S3ZA 2V8DA 2BOAA 4A32A 3R9FA 3SXOA 1CP6A 1KUYA 3W6SA 2I00A 1UWYA 1MJBA 4A30A 2IJZA 3LD2A 4BINA 2ATRA 1CPSA 2RC4A 2PDOA 3NH5A 2EUIA 2PJAA 3SJGA 1Q2DA 1WK4A 1IIDA 2PJ5A 4OC5A 2VI7A 3W91A 4CYOA 3IFEA 5AG7A 1M4IA 4RS2A 2ZEDA 1M4LA 2PJ3A 3IU1A 4NJRA 4R76A 5K8PA 3CPXA 3PB4X 1CM0A 3CXSA 2IL4A 1LANA 2AFZA 3EC4A 4ZX8A 5BWAB 3CZXA 3EFAA 3F5BA 4Y49C 2F7VA 2ZOGA 4JWPA 2PJ8A 2J8RA 4OAEA 4MFQA 2OOTA 4UA3A 2XEFA 2KCWA 3TOAA 1BO4A 1Y0RA 3TC8A 4DUKA 4HNYB 1MJ9A 3FX6A 4K30A 4QUSA 2IMOA 2OR4A 2WZNA 3D3SA 4HNWB 4MHPA 3BI0A 2QIRA 2ZEMA 3SHPA 4JXQA 1ELMP 1CX8A 1YSJA 1DTDA 2EVNA 3PFOA 4KZTA 5D29A 2AFWA 1QSRA 4MY3A 2B4BA 1Y7RA 1VHOA 2B4DA 5CNPA 5G21A 4B5PB 2VL1A 5ELYA 3KGQA 3T90A 2PJ0A 1BLLE 3TTHA 1CBXA 4R8FA 3D7GA 4ONWA 4AXVA 2AFSA 4KVXA 4OC1A 4A37A 4CAWA 4ZY1A 5GCNA 4C2ZA 4F0YA 2DXQA 5AGEA 4OP4A 1Q7LA 3LWUA 3QNVA 3KL9A 4RN7A 4M6IA 1TKFA 2WPXA 3GUXA 5H84A 1S7KA 4NGMA 4P44A 1VGYA 3MRUA 4U5YA 4AVBA 5K8OA 1KUVA 1NSLA 4UEEA 4MHYA 2XEJA 3FEEA 2Z3OA 4B12A 1M44A 1FNOA 1YX0A 1Z4RA 2EWBA 3H4QA 3QB8A 2FVGA 2XEIA 3FB3A 3JUWA 4KORA 3TE4A 4KOYA 3FBUA 2PJ7A 2DF5A 5G20A 5IV0A 1NE9A 3I1UA 1XEBA 5JGFA 2V8VA 1K4JA 2Y0MA 4MFJA 1XE4A 2ZEOA 4XNHB 5I4MA 4C7IA 5KTDA 4OIWA 4A38A 3NH8A 4P4EA 4P4BA 3IWEA 4K3NA 3PB9X 2HQYA 2QVPA 5HVFA 3B3VA 2PVVA 5KTAA 1IY7A 2BUEA 2QYVA 1QSMA 2ZW6A 4P4IA 4LQ6A 4ZGYB 4L89A 4PXDA 3PGPA 3FF3A 4R3LA 2R98A 2HUZA 2ZEEA 3UY5A 4MHDA 4MFPA 3B8GA 1CPXA 1ZG8A 3S6FA 2RFHA 3WT4A 1OBRA 2AJ6A 2PR1A 3GYAA 5A28A 1J4JA 2Z0ZA 3LACA 4MFLA 2ODFA 2I3CA 1XOVA 3VARA 2WPWA
chains in the Genus database with same CATH topology
1IYLA 2I79A 1N71A 1RXTA 2G3TA 2VQYA 2JLMA 2REEA 3CXQA 2AE6A 4CRYB 2FXFA 1YLEA 5DWNA 4Y49B 3F8KA 1VHSA 3IWGA 4PK3A 3IGRA 1Z9UA 4MJ8A 4XPDC 1SQHA 3NE7A 1PUAA 4KVOE 5C88A 1YVOA 2Q4YA 2ARHA 3K9UA 5HMNA 2Z3KA 2OZUA 3I3GA 5F47A 4AB7A 4RI1A 2ZW7A 4H6UA 4A95A 2ZW5A 3FNCA 3FXTA 4MY0A 2VZYA 1KUXA 1I12A 2WUUA 2Q7BA 4B5OA 4X5KA 4E2AA 4NEXA 1YK3A 1QSTA 1IYKA 5EC4A 4CAXA 4PSWA 4R3KA 5J8FA 2GIVA 1M1DA 2CNTA 2D4PA 5DWMA 1QSOA 3I9SA 2P6GA 5EBVA 3P2FA 2JEVA 3VWEA 3D2MA 4PSXA 2B3VA 2OU2A 4XPLA 3PZJA 3MGDA 4MI4A 1NMTA 2VBQA 2Z3MA 3FRMA 1XF8A 2DPTA 4HNXB 2J8MA 3G8WA 5F46A 5AG6A 3ZZIA 4C7HA 4UWJA 4ONUA 2B4DB 2FE7A 3OWCA 4AVAA 2FS5A 5C82A 3SXNA 3H5ZA 2Z10A 5AG5A 1M4DA 3KKWA 3S6HA 3BJ8A 2C27A 3R9GA 4CGPA 4KOWA 4KSFA 4UFWA 4C2XA 2CNMA 1IICA 3A9LA 2Z3LA 4OLLA 1QSNA 3EXNA 2O28A 4CYNA 2BL1A 2G0BA 3DDDA 5G1ZA 2PR8A 4M3SA 3TO6A 3V8IA 4XPDB 4AVCA 4II9A 1CJWA 2ZW4A 5G22A 4CAFA 2GANA 3JVNA 4U9ZA 4NF1A 2R7HA 3VWDA 1PU9A 5H86A 1B6BA 2B5GA 3FYNA 2DPSA 2REFA 4LUAA 1KZFA 2P6FA 1Z4EA 3TFYA 3PP9A 4MFKA 2Z11A 2PRBA 3FIXA 5FVJA 4CYPA 3DR6A 4KOUA 5HH1A 2R8VA 2FL4A 4ZBGA 2J8NA 4JJXA 2Q44A 3GY9A 4UBRA 4UWIA 3N7ZA 3DR8A 4JD6A 3CXPA 2X7BA 2CY2A 2B3UA 4UCPA 2G3AA 3G3SA 4A33A 2PQ8A 4B14A 2Q4VA 1XIXA 2ZPAA 3TO7A 4JLYA 1MK4A 3S6GA 2A4NA 2PSWA 2H5MA 1B87A 4B11A 2BSWA 4BBHA 3BJ7A 2PC1A 3T9YA 4KOVA 3DNSA 3R95A 2VXKA 4XPKA 5A27A 4CS0B 5IB0A 2WSAA 5KTCA 4CGOA 2R1IA 4KS9A 4F6AA 2VEZA 3P2HA 4CRZB 5JQ4A 4H6ZA 3E0KA 4KOSA 2HV2A 2Z3PA 1I1DA 4LX9A 5F49A 2OZHA 3BLNA 4OADA 2QECA 3DSBA 2Z3NA 2D4OA 5AG4A 4PV6A 3TCVA 1P0HA 4KSAA 4CAEA 4KLVA 4Q36A 3R9EA 1Q2CA 4F0XA 4KVME 4YRHA 1S7LA 1M4GA 4CAVA 4C2YA 3RYOA 2K5TA 4NXYA 4U9YA 4YGOA 4R87A 3LODA 4NCZA 4DNCA 4IF5A 4H89A 4L8AA 3D8PA 4CYQA 2FCKA 3W6XA 1U6MA 1MJAA 2YNEA 4FD4A 4HKFA 5I0CA 4B5PA 1BOBA 4KOXA 1YGHA 4PK2A 5E96A 2JDCA 2YNDA 3F0AA 3R1KA 4E8OA 4GS4A 1UFHA 1LRZA 1Y9WA 4UFVA 1Q2YA 4QBJA 1Y9KA 2JDDA 2FIWA 4JXRA 1P4NA 4UCMA 2NMTA 1RO5A 2CNSA 2OZGA 3D2PA 5IX3A 4CGNA 1FY7A 4NSQA 3EY5A 2FIAA 1XMTA 3TOBA 2FT0A 4E0AA 1S7FA 2OH1A 4A2ZA 4YFJA 1V0CA 1R57A 5F48A 2B58A 4FD6A 2B5GB 4QVTA 2P6EA 2YNCA 4R9MA 4C68A 3S6KA 2F5IA 3QAHA 3C26A 1ON0A 4AG7A 4Q38A 1VKCA 4J3GA 4CGMA 2BEIA 1ZO0A 1YVKA 4AG9A 4R57A 4CGLA 4QB9A 1L0CA 4MBUA 2Q0YA 1IB1E 3R96A 4UCNA 2VZZA 4IUSA 1YR0A 4UFXA 4EVYA 3IU2A 2P0WA 3TT2A 3ZJ0A 5ISVA 4I49A 4KUAA 3EO4A 2GE3A 1I21A 2Q04A 4M85A 4B13A 1OZPA 2YGWA 4KOTA 4B10A 1S7NA 4ORFA 2CXAA 4XNHC 4KUBA 4BMHA 5JPHA 4A31A 3WR7A 2OB0A 2FSRA 2QMLA 1YREA 2YNCC 1S5KA 5J8CA 1S60A 4MFZA 3GKRA 3JTKA 4FD7A 4KLWA 3TO9A 1TIQA 1GHEA 4FD5A 1WWZA 4QC6A 1S3ZA 4A32A 3R9FA 3SXOA 1KUYA 3W6SA 2I00A 1MJBA 4A30A 3LD2A 2ATRA 2RC4A 2PDOA 2EUIA 1Q2DA 1WK4A 1IIDA 2VI7A 3W91A 4CYOA 5AG7A 1M4IA 4RS2A 3IU1A 1CM0A 3CXSA 2IL4A 3EC4A 5BWAB 3EFAA 3F5BA 4Y49C 4JWPA 2J8RA 4OAEA 4MFQA 4UA3A 2KCWA 3TOAA 1BO4A 4HNYB 1MJ9A 4QUSA 4K30A 3D3SA 4HNWB 2QIRA 3SHPA 4JXQA 4KZTA 2EVNA 1QSRA 4MY3A 2B4BA 1Y7RA 2B4DA 5CNPA 5G21A 4B5PB 3T90A 3TTHA 4KVXA 4CAWA 5GCNA 4C2ZA 4F0YA 2DXQA 5AGEA 2WPXA 5H84A 1S7KA 4U5YA 4AVBA 1KUVA 1NSLA 2Z3OA 4B12A 1M44A 1YX0A 1Z4RA 3H4QA 3QB8A 3FB3A 3JUWA 4KORA 3TE4A 4KOYA 3FBUA 5G20A 5IV0A 1NE9A 1XEBA 2Y0MA 1K4JA 4MFJA 1XE4A 4XNHB 4C7IA 5KTDA 3IWEA 2HQYA 5KTAA 2BUEA 1QSMA 2ZW6A 4ZGYB 4L89A 3PGPA 4R3LA 2R98A 2HUZA 3UY5A 4MHDA 4MFPA 3B8GA 3S6FA 2AJ6A 2PR1A 3GYAA 5A28A 1J4JA 2Z0ZA 4MFLA 2ZXVA 2WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYL A;  2I79 A;  1N71 A;  1RXT A;  2G3T A;  2VQY A;  2JLM A;  2REE A;  3CXQ A;  2AE6 A;  4CRY B;  2FXF A;  1YLE A;  5DWN A;  4Y49 B;  3F8K A;  1VHS A;  3IWG A;  4PK3 A;  3IGR A;  1Z9U A;  4MJ8 A;  4XPD C;  1SQH A;  3NE7 A;  1PUA A;  4KVO E;  5C88 A;  1YVO A;  2Q4Y A;  2ARH A;  3K9U A;  5HMN A;  2OZU A;  3I3G A;  5F47 A;  4AB7 A;  4RI1 A;  2ZW7 A;  4H6U A;  2ZW5 A;  3FNC A;  3FXT A;  4MY0 A;  2VZY A;  1KUX A;  1I12 A;  2Q7B A;  4B5O A;  4X5K A;  4E2A A;  4NEX A;  1YK3 A;  1QST A;  1IYK A;  5EC4 A;  4CAX A;  4PSW A;  4R3K A;  5J8F A;  2GIV A;  1M1D A;  2CNT A;  2D4P A;  5DWM A;  1QSO A;  3I9S A;  2P6G A;  5EBV A;  3P2F A;  2JEV A;  3VWE A;  3D2M A;  4PSX A;  2B3V A;  2OU2 A;  4XPL A;  3PZJ A;  3MGD A;  4MI4 A;  1NMT A;  2VBQ A;  3FRM A;  1XF8 A;  4HNX B;  2J8M A;  3G8W A;  5F46 A;  3ZZI A;  4UWJ A;  4ONU A;  2B4D B;  2FE7 A;  3OWC A;  4AVA A;  2FS5 A;  5C82 A;  3SXN A;  2Z10 A;  1M4D A;  3KKW A;  3S6H A;  3BJ8 A;  2C27 A;  3R9G A;  4KOW A;  2CNM A;  1IIC A;  4OLL A;  1QSN A;  3EXN A;  2O28 A;  2BL1 A;  2G0B A;  3DDD A;  2PR8 A;  4M3S A;  3TO6 A;  3V8I A;  4XPD B;  4AVC A;  4II9 A;  1CJW A;  2ZW4 A;  2GAN A;  3JVN A;  4U9Z A;  4NF1 A;  2R7H A;  3VWD A;  1PU9 A;  5H86 A;  1B6B A;  2B5G A;  3FYN A;  2REF A;  4LUA A;  1KZF A;  2P6F A;  1Z4E A;  3TFY A;  3PP9 A;  2Z11 A;  2PRB A;  3FIX A;  5FVJ A;  3DR6 A;  4KOU A;  5HH1 A;  2R8V A;  2FL4 A;  4ZBG A;  2J8N A;  4JJX A;  2Q44 A;  3GY9 A;  4UBR A;  4UWI A;  3N7Z A;  3DR8 A;  4JD6 A;  3CXP A;  2X7B A;  2CY2 A;  2B3U A;  2G3A A;  3G3S A;  2PQ8 A;  2Q4V A;  1XIX A;  2ZPA A;  3TO7 A;  4JLY A;  1MK4 A;  3S6G A;  2A4N A;  2PSW A;  2H5M A;  1B87 A;  2BSW A;  3BJ7 A;  2PC1 A;  3T9Y A;  4KOV A;  3DNS A;  3R95 A;  2VXK A;  4XPK A;  4CS0 B;  5IB0 A;  5KTC A;  2R1I A;  4F6A A;  2VEZ A;  3P2H A;  4CRZ B;  5JQ4 A;  4H6Z A;  3E0K A;  4KOS A;  2HV2 A;  1I1D A;  4LX9 A;  5F49 A;  2OZH A;  3BLN A;  4OAD A;  2QEC A;  3DSB A;  2D4O A;  4PV6 A;  3TCV A;  1P0H A;  4KLV A;  3R9E A;  1Q2C A;  4KVM E;  4YRH A;  1S7L A;  1M4G A;  4CAV A;  3RYO A;  2K5T A;  4NXY A;  4U9Y A;  4YGO A;  4R87 A;  3LOD A;  4NCZ A;  4DNC A;  4IF5 A;  4H89 A;  4L8A A;  3D8P A;  2FCK A;  3W6X A;  1U6M A;  1MJA A;  4FD4 A;  4HKF A;  5I0C A;  4B5P A;  1BOB A;  4KOX A;  1YGH A;  4PK2 A;  5E96 A;  2JDC A;  3F0A A;  3R1K A;  4E8O A;  4GS4 A;  1UFH A;  1LRZ A;  1Y9W A;  1Q2Y A;  4QBJ A;  1Y9K A;  2JDD A;  2FIW A;  4JXR A;  1P4N A;  2NMT A;  1RO5 A;  2CNS A;  2OZG A;  3D2P A;  5IX3 A;  1FY7 A;  4NSQ A;  3EY5 A;  2FIA A;  1XMT A;  3TOB A;  2FT0 A;  4E0A A;  1S7F A;  2OH1 A;  4YFJ A;  1V0C A;  1R57 A;  5F48 A;  2B58 A;  4FD6 A;  2B5G B;  4QVT A;  2P6E A;  4R9M A;  3S6K A;  2F5I A;  3QAH A;  3C26 A;  1ON0 A;  4AG7 A;  1VKC A;  4J3G A;  2BEI A;  1YVK A;  4AG9 A;  4R57 A;  4QB9 A;  1L0C A;  4MBU A;  2Q0Y A;  1IB1 E;  3R96 A;  2VZZ A;  4IUS A;  1YR0 A;  4EVY A;  2P0W A;  3TT2 A;  3ZJ0 A;  5ISV A;  4I49 A;  4KUA A;  3EO4 A;  2GE3 A;  1I21 A;  2Q04 A;  4M85 A;  1OZP A;  4KOT A;  1S7N A;  4ORF A;  4XNH C;  4KUB A;  4BMH A;  5JPH A;  3WR7 A;  2OB0 A;  2FSR A;  2QML A;  1YRE A;  1S5K A;  5J8C A;  1S60 A;  3GKR A;  4FD7 A;  4KLW A;  3TO9 A;  1TIQ A;  1GHE A;  4FD5 A;  1WWZ A;  4QC6 A;  1S3Z A;  3R9F A;  3SXO A;  1KUY A;  3W6S A;  2I00 A;  1MJB A;  3LD2 A;  2ATR A;  2RC4 A;  2PDO A;  2EUI A;  1Q2D A;  1WK4 A;  1IID A;  2VI7 A;  3W91 A;  1M4I A;  4RS2 A;  1CM0 A;  3CXS A;  2IL4 A;  3EC4 A;  3EFA A;  3F5B A;  4Y49 C;  4JWP A;  2J8R A;  4OAE A;  4UA3 A;  2KCW A;  3TOA A;  1BO4 A;  4HNY B;  1MJ9 A;  4QUS A;  4K30 A;  3D3S A;  4HNW B;  2QIR A;  3SHP A;  4JXQ A;  4KZT A;  2EVN A;  1QSR A;  4MY3 A;  2B4B A;  1Y7R A;  2B4D A;  5CNP A;  4B5P B;  3T90 A;  3TTH A;  4KVX A;  4CAW A;  5GCN A;  4F0Y A;  2DXQ A;  2WPX A;  5H84 A;  1S7K A;  4U5Y A;  4AVB A;  1KUV A;  1NSL A;  1M44 A;  1YX0 A;  1Z4R A;  3H4Q A;  3QB8 A;  3FB3 A;  3JUW A;  4KOR A;  3TE4 A;  4KOY A;  3FBU A;  5IV0 A;  1NE9 A;  1XEB A;  2Y0M A;  1K4J A;  1XE4 A;  4XNH B;  5KTD A;  2HQY A;  5KTA A;  2BUE A;  1QSM A;  2ZW6 A;  4L89 A;  3PGP A;  4R3L A;  2R98 A;  2HUZ A;  3UY5 A;  4MHD A;  3B8G A;  3S6F A;  2AJ6 A;  2PR1 A;  3GYA A;  1J4J A;  2Z0Z A;  2ZXV A;  2WPW A; 
#chains in the Genus database with same CATH topology
 1IYL A;  2I79 A;  1N71 A;  1RXT A;  2G3T A;  2VQY A;  2JLM A;  2REE A;  3CXQ A;  3SI0 A;  2PJ9 A;  5JM6 A;  5EMI A;  2AE6 A;  4CRY B;  2FXF A;  1YLE A;  4OKO A;  1IOI A;  2EK9 A;  5DWN A;  4OC2 A;  4Y49 B;  3F8K A;  3S9M A;  1VHS A;  1LOK A;  4F9V A;  3B3W A;  3IWG A;  3BI1 A;  4PK3 A;  3SJE A;  3IGR A;  2AFU A;  2ZXV A;  3IIB A;  1Z9U A;  3WC6 A;  4MJ8 A;  4X8I A;  3RBU A;  1QQ9 A;  4XPD C;  4X3R A;  2NSM A;  4NGN A;  1SQH A;  1YLO A;  3NE7 A;  4EME A;  1PUA A;  4KVO E;  5C88 A;  2EK8 A;  1XRY A;  2PVW A;  1HDQ A;  1YVO A;  4ZX9 A;  2Q4Y A;  1TKJ A;  3B2Y A;  3SI1 A;  1Y7E A;  3CDX A;  3V7Z A;  2ARH A;  3H8E A;  3K9U A;  3SJF A;  5HMN A;  4Z65 A;  1TF9 A;  2Z3K A;  2OZU A;  1X12 A;  3I3G A;  5F47 A;  3LMS A;  1Z8T A;  3VAT A;  4AB7 A;  4RI1 A;  4R6T A;  2V77 A;  2ZW7 A;  4H6U A;  5K8N A;  4A95 A;  1PYT B;  3WC7 A;  2ZW5 A;  3FNC A;  3FXT A;  3B3C A;  2VZY A;  4MY0 A;  1KUX A;  3PB7 X;  1I12 A;  1H8L A;  2WUU A;  4PQA A;  2Q7B A;  3PEI A;  4X5K A;  4B5O A;  2C1C A;  1ZLI A;  4IAV A;  1ARL A;  4E2A A;  3IC1 A;  4GM5 A;  4NEX A;  3SJX A;  1YK3 A;  1QST A;  1IYK A;  5EC4 A;  4CAX A;  4PSW A;  4M6H A;  2GRE A;  4R3K A;  2GIV A;  5J8F A;  1M1D A;  2CNT A;  2D4P A;  4NGT A;  5DWM A;  4FBE A;  2HB6 A;  3TX8 A;  5HXD A;  2ZEP A;  2ZEH A;  1QSO A;  4Q7A A;  1A2Z A;  4MCR A;  3I9S A;  2P6G A;  2Q4Z A;  5EBV A;  3KR5 A;  3P2F A;  5LRG A;  2JEV A;  3VWE A;  3D2M A;  4PSX A;  4H2K A;  2B3V A;  2OU2 A;  1R3N A;  4XPL A;  3PZJ A;  3MGD A;  4MI4 A;  1NMT A;  4UF4 A;  1ARM A;  2VBQ A;  2Z3M A;  3FRM A;  1YW6 A;  1XF8 A;  2DPT A;  4HNX B;  4MCS A;  2J8M A;  3G8W A;  5F46 A;  3FEC A;  5AG6 A;  3ZZI A;  4C7H A;  4UWJ A;  3GLJ A;  1IU8 A;  3VH9 A;  3DGV A;  2B4D B;  2FE7 A;  3IO1 A;  4MCP A;  1R43 A;  4ONU A;  5HVG A;  3OWC A;  4AVA A;  2FS5 A;  5C82 A;  3PBE A;  3H5Z A;  2Z10 A;  3SXN A;  5AG5 A;  4DYO A;  1JWQ A;  1M4D A;  3KKW A;  2NYQ A;  3S6H A;  4OC3 A;  3BJ8 A;  1LCP A;  2C27 A;  3R9G A;  4IK2 A;  1AUG A;  1DE4 C;  4CGP A;  4KOW A;  4KSF A;  4OME A;  4UFW A;  4C2X A;  2CNM A;  1IIC A;  6CPA A;  4MHZ A;  2ZEN A;  3A9L A;  2Z3L A;  4OLL A;  3D7H A;  4UEF A;  1JQG A;  4JYW A;  1QSN A;  3EXN A;  4NFR A;  4P4D A;  2O28 A;  4CYN A;  2ZEG A;  2BL1 A;  2G0B A;  3DDD A;  3WC5 A;  5G1Z A;  2PR8 A;  4G1P A;  4YWY A;  2PIY A;  1XFO A;  4M3S A;  3NA6 A;  3TO6 A;  3V8I A;  4NJQ A;  1BPM A;  4XPD B;  8CPA A;  4R7M A;  4AVC A;  4II9 A;  1TKH A;  3FH4 A;  1CJW A;  2ZW4 A;  3IJ3 A;  5G22 A;  2GAN A;  4CAF A;  3JVN A;  4FUU A;  5CPA A;  5HVH A;  2V8G A;  4U9Z A;  4NF1 A;  2R7H A;  3VWD A;  1PU9 A;  2AFO A;  5H86 A;  2Q7S A;  3PRT A;  4CPA A;  1B6B A;  2B5G A;  4P10 A;  3FYN A;  2C6C A;  2DPS A;  3IEH A;  2REF A;  3GIU A;  4LUA A;  3D68 A;  3CPA A;  1KZF A;  2P6F A;  1Z4E A;  2Q43 A;  4NGR A;  3KQX A;  3TFY A;  1YW4 A;  4FAI A;  3BXM A;  3PP9 A;  1PCA A;  4MFK A;  7CPA A;  2Z11 A;  2PRB A;  3FIX A;  5FVJ A;  3SI2 A;  3WAB A;  4CYP A;  3DR6 A;  4KOU A;  5HH1 A;  2R8V A;  4UEZ A;  1EE3 P;  2FL4 A;  4GXH A;  4ZBG A;  1F2O A;  2J8N A;  4JJX A;  2Q44 A;  3GY9 A;  4UBR A;  4UWI A;  5JH9 A;  3N7Z A;  4F8Z A;  3DR8 A;  4JD6 A;  3CXP A;  4P4J A;  2X7B A;  3FVL A;  1YME A;  2CY2 A;  2B3U A;  2PE3 A;  4UCP A;  2G3A A;  3G3S A;  1Z8L A;  4A33 A;  4BD9 A;  2PQ8 A;  1CG2 A;  4PPZ A;  4B14 A;  4ZI6 A;  2Q4V A;  2PJ2 A;  3PBB A;  4B6Z A;  1XIX A;  2ZPA A;  3TO7 A;  4JLY A;  3ISX A;  1MK4 A;  3S6G A;  2A4N A;  2EO8 A;  2PSW A;  2H5M A;  1B87 A;  2O4H A;  3B35 A;  3KQZ A;  1IGB A;  4B11 A;  2BSW A;  2C6P A;  3D4U A;  4BBH A;  1X10 A;  1Y0Y A;  2PC1 A;  3BJ7 A;  3T9Y A;  4KOV A;  3DNS A;  5LRK A;  3R95 A;  2VXK A;  4XPK A;  3DLJ A;  5A27 A;  4CS0 B;  1Z2L A;  2CTC A;  3B3T A;  5IB0 A;  2WSA A;  5D8N A;  5KTC A;  2PJ4 A;  4CGO A;  2R1I A;  3B7I A;  4KS9 A;  4F6A A;  2F8H A;  2VEZ A;  1QMU A;  3N5F A;  3BHX A;  3RZA A;  2O53 A;  3P2H A;  1KWM A;  2PJB A;  4CRZ B;  5JQ4 A;  4H6Z A;  3E0K A;  4KOS A;  2HV2 A;  3GB0 A;  2Z3P A;  1I1D A;  4LX9 A;  5F49 A;  4RUH A;  2OZH A;  3KAS A;  3D66 A;  3BLN A;  4P6Y A;  4OAD A;  2QEC A;  4ZY0 A;  3S9L A;  3DSB A;  3K9T A;  1HEE A;  2Z3N A;  3HUV A;  2JEW A;  2POK A;  2D4O A;  1LAP A;  5AG4 A;  5LYI A;  4PV6 A;  5DS0 A;  3D67 A;  3TCV A;  1P0H A;  5THW A;  4KSA A;  4CAE A;  4KLV A;  2PRQ A;  4Q36 A;  3R9E A;  2XEG A;  1Q2C A;  4F0X A;  4KVM E;  4MCQ A;  4OC0 A;  4YRH A;  4MXU A;  1S7L A;  1M4G A;  3NH4 A;  4NGP A;  3CT9 A;  4CAV A;  3FED A;  3FJU A;  1ZLH A;  1NSA A;  4C2Y A;  3RYO A;  2K5T A;  3PB8 X;  3H8F A;  3KHX A;  4HPS A;  4NXY A;  3PFE A;  4P4F A;  3HLP A;  2PJ1 A;  4U9Y A;  1AYE A;  2JBK A;  4YGO A;  4R87 A;  3LOD A;  2WYR A;  4NCZ A;  4UIB A;  4DNC A;  4IF5 A;  4H89 A;  4L8A A;  3D8P A;  4CYQ A;  5LYF A;  3ISZ A;  2FCK A;  3NFZ A;  2G9D A;  2DEA A;  4ZY2 A;  3W6X A;  1U6M A;  4KSI A;  1MJA A;  2BCO A;  1BAV A;  2YNE A;  4FD4 A;  4HKF A;  5CBM A;  5I0C A;  4B5P A;  1XBU A;  1BOB A;  4KOX A;  3MN8 A;  1YGH A;  4PK2 A;  5E96 A;  2JDC A;  2YND A;  4EFD A;  3F0A A;  2GLJ A;  3R1K A;  4E8O A;  2ZOF A;  1ZG9 A;  2GU2 A;  1UFH A;  4GS4 A;  3KZW A;  1LRZ A;  1Y9W A;  2ZEF A;  4A94 A;  1XMB A;  4NGS A;  1Q2Y A;  2GFQ A;  4UFV A;  1Z5R A;  2PJ6 A;  2AFX A;  4W9Y A;  4QBJ A;  2C6G A;  1Y9K A;  2JDD A;  2FIW A;  4JXR A;  1P4N A;  4UCM A;  4EWT A;  1Z8X A;  2NMT A;  4TNU A;  2ABZ A;  2ANP A;  2V8H A;  3V38 A;  4OC4 A;  1RO5 A;  3NE8 A;  2CNS A;  2OZG A;  3D2P A;  4O23 A;  5IX3 A;  4CGN A;  2JBJ A;  2CIJ A;  3D7D A;  4UIA A;  1FY7 A;  1Z8W A;  2QJ8 A;  3EY5 A;  4NSQ A;  1F2P A;  1LFW A;  1XMT A;  2FIA A;  3TOB A;  2FT0 A;  1ELL P;  4E0A A;  2CF4 A;  1S7F A;  4A39 A;  1VHE A;  2OH1 A;  5LYD A;  1HDU A;  4A2Z A;  4YFJ A;  2J9A A;  1V0C A;  1R57 A;  5F48 A;  2Q51 A;  2B58 A;  4FD6 A;  2B5G B;  4QVT A;  2P6E A;  2YNC A;  4R9M A;  4C68 A;  3S6K A;  2F5I A;  3QAH A;  3S9N A;  3C26 A;  1VIX A;  4F9U A;  2RB7 A;  3RAM A;  3KHZ A;  4FWU A;  1ON0 A;  4X2T A;  4AG7 A;  3H8G A;  3B3S A;  2PIZ A;  3K2K A;  4Q38 A;  1VKC A;  3D7F A;  3T8W A;  4J3G A;  4TWE A;  4MHN A;  4CGM A;  2BEI A;  4IHM A;  1ZO0 A;  4ZYQ A;  3JRU A;  1YVK A;  4AG9 A;  1FT7 A;  4R57 A;  3IWW A;  4YU9 A;  4QB9 A;  1L0C A;  4MBU A;  4CGL A;  4MRI A;  2Q0Y A;  2AFM A;  1IB1 E;  3R96 A;  5F09 A;  4UCN A;  2VZZ A;  3KI9 A;  4IUS A;  1YR0 A;  3L2N A;  4OID A;  4UFX A;  4EVY A;  3IU2 A;  5IB9 A;  5LYL A;  4PXE A;  4DJL A;  1ZG7 A;  4WWV A;  1GYT A;  2ZEL A;  4JZ0 A;  1F57 A;  2P0W A;  3TT2 A;  3ZJ0 A;  1LAM A;  2BO9 A;  5ISV A;  4I49 A;  3PB6 X;  5J1Q A;  1IOF A;  4KUA A;  4PXB A;  3EO4 A;  4P45 A;  2GLF A;  2GE3 A;  4NGQ A;  4LQG A;  4M6G A;  1I21 A;  2Q04 A;  1YQE A;  2EBJ A;  4M85 A;  5K8M A;  1TF8 A;  4B13 A;  1OZP A;  2YGW A;  4KOT A;  4B10 A;  1S7N A;  2PJC A;  3QAY A;  4ORF A;  3RO0 A;  2CXA A;  2IQ6 A;  2HC9 A;  4XNH C;  4KUB A;  5LRJ A;  4BMH A;  5JPH A;  4A31 A;  4MMO A;  3RNZ A;  3WR7 A;  1XJO A;  2OB0 A;  2FSR A;  1YRE A;  2QML A;  4PXC A;  2YNC C;  1TXR A;  1S5K A;  5J8C A;  1S60 A;  3FMC A;  4MFZ A;  3GKR A;  3JTK A;  4FD7 A;  1RTQ A;  4KLW A;  4WJB A;  3TO9 A;  1TIQ A;  2CTB A;  1GHE A;  4FD5 A;  1CP7 A;  1AMP A;  2PCU A;  1WWZ A;  3KR4 A;  4QC6 A;  1BPN A;  1S3Z A;  2V8D A;  2BOA A;  4A32 A;  3R9F A;  3SXO A;  1CP6 A;  1KUY A;  3W6S A;  2I00 A;  1UWY A;  1MJB A;  4A30 A;  2IJZ A;  3LD2 A;  4BIN A;  2ATR A;  1CPS A;  2RC4 A;  2PDO A;  3NH5 A;  2EUI A;  2PJA A;  3SJG A;  1Q2D A;  1WK4 A;  1IID A;  2PJ5 A;  4OC5 A;  2VI7 A;  3W91 A;  4CYO A;  3IFE A;  5AG7 A;  1M4I A;  4RS2 A;  2ZED A;  1M4L A;  2PJ3 A;  3IU1 A;  4NJR A;  4R76 A;  5K8P A;  3CPX A;  3PB4 X;  1CM0 A;  3CXS A;  2IL4 A;  1LAN A;  2AFZ A;  3EC4 A;  4ZX8 A;  5BWA B;  3CZX A;  3EFA A;  3F5B A;  4Y49 C;  2F7V A;  2ZOG A;  4JWP A;  2PJ8 A;  2J8R A;  4OAE A;  4MFQ A;  2OOT A;  4UA3 A;  2XEF A;  2KCW A;  3TOA A;  1BO4 A;  1Y0R A;  3TC8 A;  4DUK A;  4HNY B;  1MJ9 A;  3FX6 A;  4K30 A;  4QUS A;  2IMO A;  2OR4 A;  2WZN A;  3D3S A;  4HNW B;  4MHP A;  3BI0 A;  2QIR A;  2ZEM A;  3SHP A;  4JXQ A;  1ELM P;  1CX8 A;  1YSJ A;  1DTD A;  2EVN A;  3PFO A;  4KZT A;  5D29 A;  2AFW A;  1QSR A;  4MY3 A;  2B4B A;  1Y7R A;  1VHO A;  2B4D A;  5CNP A;  5G21 A;  4B5P B;  2VL1 A;  5ELY A;  3KGQ A;  3T90 A;  2PJ0 A;  1BLL E;  3TTH A;  1CBX A;  4R8F A;  3D7G A;  4ONW A;  4AXV A;  2AFS A;  4KVX A;  4OC1 A;  4A37 A;  4CAW A;  4ZY1 A;  5GCN A;  4C2Z A;  4F0Y A;  2DXQ A;  5AGE A;  4OP4 A;  1Q7L A;  3LWU A;  3QNV A;  3KL9 A;  4RN7 A;  4M6I A;  1TKF A;  2WPX A;  3GUX A;  5H84 A;  1S7K A;  4NGM A;  4P44 A;  1VGY A;  3MRU A;  4U5Y A;  4AVB A;  5K8O A;  1KUV A;  1NSL A;  4UEE A;  4MHY A;  2XEJ A;  3FEE A;  2Z3O A;  4B12 A;  1M44 A;  1FNO A;  1YX0 A;  1Z4R A;  2EWB A;  3H4Q A;  3QB8 A;  2FVG A;  2XEI A;  3FB3 A;  3JUW A;  4KOR A;  3TE4 A;  4KOY A;  3FBU A;  2PJ7 A;  2DF5 A;  5G20 A;  5IV0 A;  1NE9 A;  3I1U A;  1XEB A;  5JGF A;  2V8V A;  1K4J A;  2Y0M A;  4MFJ A;  1XE4 A;  2ZEO A;  4XNH B;  5I4M A;  4C7I A;  5KTD A;  4OIW A;  4A38 A;  3NH8 A;  4P4E A;  4P4B A;  3IWE A;  4K3N A;  3PB9 X;  2HQY A;  2QVP A;  5HVF A;  3B3V A;  2PVV A;  5KTA A;  1IY7 A;  2BUE A;  2QYV A;  1QSM A;  2ZW6 A;  4P4I A;  4LQ6 A;  4ZGY B;  4L89 A;  4PXD A;  3PGP A;  3FF3 A;  4R3L A;  2R98 A;  2HUZ A;  2ZEE A;  3UY5 A;  4MHD A;  4MFP A;  3B8G A;  1CPX A;  1ZG8 A;  3S6F A;  2RFH A;  3WT4 A;  1OBR A;  2AJ6 A;  2PR1 A;  3GYA A;  5A28 A;  1J4J A;  2Z0Z A;  3LAC A;  4MFL A;  2ODF A;  2I3C A;  1XOV A;  3VAR A;  2WPW A; 
#chains in the Genus database with same CATH homology
 1IYL A;  2I79 A;  1N71 A;  1RXT A;  2G3T A;  2VQY A;  2JLM A;  2REE A;  3CXQ A;  2AE6 A;  4CRY B;  2FXF A;  1YLE A;  5DWN A;  4Y49 B;  3F8K A;  1VHS A;  3IWG A;  4PK3 A;  3IGR A;  1Z9U A;  4MJ8 A;  4XPD C;  1SQH A;  3NE7 A;  1PUA A;  4KVO E;  5C88 A;  1YVO A;  2Q4Y A;  2ARH A;  3K9U A;  5HMN A;  2Z3K A;  2OZU A;  3I3G A;  5F47 A;  4AB7 A;  4RI1 A;  2ZW7 A;  4H6U A;  4A95 A;  2ZW5 A;  3FNC A;  3FXT A;  4MY0 A;  2VZY A;  1KUX A;  1I12 A;  2WUU A;  2Q7B A;  4B5O A;  4X5K A;  4E2A A;  4NEX A;  1YK3 A;  1QST A;  1IYK A;  5EC4 A;  4CAX A;  4PSW A;  4R3K A;  5J8F A;  2GIV A;  1M1D A;  2CNT A;  2D4P A;  5DWM A;  1QSO A;  3I9S A;  2P6G A;  5EBV A;  3P2F A;  2JEV A;  3VWE A;  3D2M A;  4PSX A;  2B3V A;  2OU2 A;  4XPL A;  3PZJ A;  3MGD A;  4MI4 A;  1NMT A;  2VBQ A;  2Z3M A;  3FRM A;  1XF8 A;  2DPT A;  4HNX B;  2J8M A;  3G8W A;  5F46 A;  5AG6 A;  3ZZI A;  4C7H A;  4UWJ A;  4ONU A;  2B4D B;  2FE7 A;  3OWC A;  4AVA A;  2FS5 A;  5C82 A;  3SXN A;  3H5Z A;  2Z10 A;  5AG5 A;  1M4D A;  3KKW A;  3S6H A;  3BJ8 A;  2C27 A;  3R9G A;  4CGP A;  4KOW A;  4KSF A;  4UFW A;  4C2X A;  2CNM A;  1IIC A;  3A9L A;  2Z3L A;  4OLL A;  1QSN A;  3EXN A;  2O28 A;  4CYN A;  2BL1 A;  2G0B A;  3DDD A;  5G1Z A;  2PR8 A;  4M3S A;  3TO6 A;  3V8I A;  4XPD B;  4AVC A;  4II9 A;  1CJW A;  2ZW4 A;  5G22 A;  4CAF A;  2GAN A;  3JVN A;  4U9Z A;  4NF1 A;  2R7H A;  3VWD A;  1PU9 A;  5H86 A;  1B6B A;  2B5G A;  3FYN A;  2DPS A;  2REF A;  4LUA A;  1KZF A;  2P6F A;  1Z4E A;  3TFY A;  3PP9 A;  4MFK A;  2Z11 A;  2PRB A;  3FIX A;  5FVJ A;  4CYP A;  3DR6 A;  4KOU A;  5HH1 A;  2R8V A;  2FL4 A;  4ZBG A;  2J8N A;  4JJX A;  2Q44 A;  3GY9 A;  4UBR A;  4UWI A;  3N7Z A;  3DR8 A;  4JD6 A;  3CXP A;  2X7B A;  2CY2 A;  2B3U A;  4UCP A;  2G3A A;  3G3S A;  4A33 A;  2PQ8 A;  4B14 A;  2Q4V A;  1XIX A;  2ZPA A;  3TO7 A;  4JLY A;  1MK4 A;  3S6G A;  2A4N A;  2PSW A;  2H5M A;  1B87 A;  4B11 A;  2BSW A;  4BBH A;  3BJ7 A;  2PC1 A;  3T9Y A;  4KOV A;  3DNS A;  3R95 A;  2VXK A;  4XPK A;  5A27 A;  4CS0 B;  5IB0 A;  2WSA A;  5KTC A;  4CGO A;  2R1I A;  4KS9 A;  4F6A A;  2VEZ A;  3P2H A;  4CRZ B;  5JQ4 A;  4H6Z A;  3E0K A;  4KOS A;  2HV2 A;  2Z3P A;  1I1D A;  4LX9 A;  5F49 A;  2OZH A;  3BLN A;  4OAD A;  2QEC A;  3DSB A;  2Z3N A;  2D4O A;  5AG4 A;  4PV6 A;  3TCV A;  1P0H A;  4KSA A;  4CAE A;  4KLV A;  4Q36 A;  3R9E A;  1Q2C A;  4F0X A;  4KVM E;  4YRH A;  1S7L A;  1M4G A;  4CAV A;  4C2Y A;  3RYO A;  2K5T A;  4NXY A;  4U9Y A;  4YGO A;  4R87 A;  3LOD A;  4NCZ A;  4DNC A;  4IF5 A;  4H89 A;  4L8A A;  3D8P A;  4CYQ A;  2FCK A;  3W6X A;  1U6M A;  1MJA A;  2YNE A;  4FD4 A;  4HKF A;  5I0C A;  4B5P A;  1BOB A;  4KOX A;  1YGH A;  4PK2 A;  5E96 A;  2JDC A;  2YND A;  3F0A A;  3R1K A;  4E8O A;  4GS4 A;  1UFH A;  1LRZ A;  1Y9W A;  4UFV A;  1Q2Y A;  4QBJ A;  1Y9K A;  2JDD A;  2FIW A;  4JXR A;  1P4N A;  4UCM A;  2NMT A;  1RO5 A;  2CNS A;  2OZG A;  3D2P A;  5IX3 A;  4CGN A;  1FY7 A;  4NSQ A;  3EY5 A;  2FIA A;  1XMT A;  3TOB A;  2FT0 A;  4E0A A;  1S7F A;  2OH1 A;  4A2Z A;  4YFJ A;  1V0C A;  1R57 A;  5F48 A;  2B58 A;  4FD6 A;  2B5G B;  4QVT A;  2P6E A;  2YNC A;  4R9M A;  4C68 A;  3S6K A;  2F5I A;  3QAH A;  3C26 A;  1ON0 A;  4AG7 A;  4Q38 A;  1VKC A;  4J3G A;  4CGM A;  2BEI A;  1ZO0 A;  1YVK A;  4AG9 A;  4R57 A;  4CGL A;  4QB9 A;  1L0C A;  4MBU A;  2Q0Y A;  1IB1 E;  3R96 A;  4UCN A;  2VZZ A;  4IUS A;  1YR0 A;  4UFX A;  4EVY A;  3IU2 A;  2P0W A;  3TT2 A;  3ZJ0 A;  5ISV A;  4I49 A;  4KUA A;  3EO4 A;  2GE3 A;  1I21 A;  2Q04 A;  4M85 A;  4B13 A;  1OZP A;  2YGW A;  4KOT A;  4B10 A;  1S7N A;  4ORF A;  2CXA A;  4XNH C;  4KUB A;  4BMH A;  5JPH A;  4A31 A;  3WR7 A;  2OB0 A;  2FSR A;  2QML A;  1YRE A;  2YNC C;  1S5K A;  5J8C A;  1S60 A;  4MFZ A;  3GKR A;  3JTK A;  4FD7 A;  4KLW A;  3TO9 A;  1TIQ A;  1GHE A;  4FD5 A;  1WWZ A;  4QC6 A;  1S3Z A;  4A32 A;  3R9F A;  3SXO A;  1KUY A;  3W6S A;  2I00 A;  1MJB A;  4A30 A;  3LD2 A;  2ATR A;  2RC4 A;  2PDO A;  2EUI A;  1Q2D A;  1WK4 A;  1IID A;  2VI7 A;  3W91 A;  4CYO A;  5AG7 A;  1M4I A;  4RS2 A;  3IU1 A;  1CM0 A;  3CXS A;  2IL4 A;  3EC4 A;  5BWA B;  3EFA A;  3F5B A;  4Y49 C;  4JWP A;  2J8R A;  4OAE A;  4MFQ A;  4UA3 A;  2KCW A;  3TOA A;  1BO4 A;  4HNY B;  1MJ9 A;  4QUS A;  4K30 A;  3D3S A;  4HNW B;  2QIR A;  3SHP A;  4JXQ A;  4KZT A;  2EVN A;  1QSR A;  4MY3 A;  2B4B A;  1Y7R A;  2B4D A;  5CNP A;  5G21 A;  4B5P B;  3T90 A;  3TTH A;  4KVX A;  4CAW A;  5GCN A;  4C2Z A;  4F0Y A;  2DXQ A;  5AGE A;  2WPX A;  5H84 A;  1S7K A;  4U5Y A;  4AVB A;  1KUV A;  1NSL A;  2Z3O A;  4B12 A;  1M44 A;  1YX0 A;  1Z4R A;  3H4Q A;  3QB8 A;  3FB3 A;  3JUW A;  4KOR A;  3TE4 A;  4KOY A;  3FBU A;  5G20 A;  5IV0 A;  1NE9 A;  1XEB A;  2Y0M A;  1K4J A;  4MFJ A;  1XE4 A;  4XNH B;  4C7I A;  5KTD A;  3IWE A;  2HQY A;  5KTA A;  2BUE A;  1QSM A;  2ZW6 A;  4ZGY B;  4L89 A;  3PGP A;  4R3L A;  2R98 A;  2HUZ A;  3UY5 A;  4MHD A;  4MFP A;  3B8G A;  3S6F A;  2AJ6 A;  2PR1 A;  3GYA A;  5A28 A;  1J4J A;  2Z0Z A;  4MFL A;  2ZXV A;  2WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...