4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
4KOXA 2NMTA 1Z4EA 4ONUA 4H6UA 1Y9KA 4XPDB 1P4NA 1VKCA 1XE4A 1UFHA 4JJXA 4UWJA 1I12A 2FIWA 3SHPA 4IF5A 1GHEA 3KKWA 4KOSA 2P0WA 2BL1A 2PRBA 2I00A 4DNCA 1I1DA 4K30A 3DR8A 3JVNA 2J8MA 4QB9A 2F5IA 3B8GA 4R3LA 5E96A 4GS4A 1S7LA 2HQYA 2DXQA 2PDOA 3W91A 1NMTA 4NF1A 3C26A 2HUZA 4MI4A 4JXQA 3VWEA 4JWPA 3G3SA 1Z9UA 2FL4A 2ZXVA 5H84A 5GCNA 3FB3A 1U6MA 2FS5A 5C88A 2OZHA 4YGOA 1S7NA 4EVYA 1S3ZA 3EXNA 1WK4A 5J8CA 3IWGA 3TTHA 2JDCA 3TFYA 1S60A 1L0CA 2OZGA 2D4PA 4KUBA 4Y49C 4CAVA 4XNHB 2J8RA 2ZW4A 4B5OA 2OH1A 2OB0A 3MGDA 4CRZB 4F6AA 5EBVA 4BMHA 2GE3A 2Q0YA 4R9MA 5F49A 1Y9WA 3CXSA 3TE4A 4F0YA 1MJ9A 2PC1A 2Z10A 2Q44A 2A4NA 3TO6A 2C27A 1M1DA 3T90A 1YGHA 2OU2A 1YX0A 2ZW5A 5JQ4A 1NE9A 4PSXA 2AE6A 4KVME 2O28A 3OWCA 3GKRA 1M4IA 3BJ7A 2Z0ZA 4PK3A 2QMLA 2Q4VA 4B5PA 5I0CA 1QSMA 2R8VA 3EY5A 4NCZA 4KOWA 1CJWA 4CAWA 3FNCA 5IB0A 2G0BA 1Q2CA 5F47A 2JEVA 1FY7A 4LUAA 3DR6A 2PSWA 1Q2YA 3S6HA 1Y7RA 4Y49B 3WR7A 3QAHA 4II9A 2B3UA 2OZUA 4H89A 3DDDA 4KOUA 3R95A 1YVOA 3D2MA 3TO7A 2VZZA 4NEXA 3PP9A 4MJ8A 3I9SA 4JLYA 2Q04A 2PR8A 4HNWB 2ATRA 2Y0MA 1OZPA 4KOTA 4RI1A 4PK2A 3JUWA 2P6FA 3EO4A 1YLEA 3QB8A 1PU9A 1LRZA 4L8AA 4KOVA 4FD7A 4CAXA 1IYLA 2R98A 4M3SA 3EFAA 3F8KA 1PUAA 2I79A 4XPDC 4YRHA 3BLNA 1MK4A 4KLWA 4AVAA 1QSNA 4RS2A 4AG7A 2FE7A 5IV0A 5HH1A 2EVNA 3FYNA 3W6SA 1YK3A 2WPXA 4MY3A 4MBUA 2PR1A 3VWDA 2JDDA 4NXYA 2CNTA 5H86A 4ZBGA 1KUVA 4JXRA 1N71A 2ZPAA 1NSLA 2P6EA 3D3SA 4OADA 3FBUA 2D4OA 2J8NA 3F5BA 1WWZA 3W6XA 3TT2A 4PV6A 2B4DA 4UA3A 1XF8A 3R9EA 1BO4A 3RYOA 4MHDA 4AB7A 5KTCA 3GY9A 3PGPA 1YVKA 1KUYA 1QSOA 3LODA 5F46A 2ZW7A 5DWNA 4NSQA 4OAEA 3DSBA 5IX3A 1M4DA 4AG9A 5DWMA 2BSWA 4ORFA 1CM0A 4X5KA 5C82A 5F48A 4QVTA 4MY0A 4AVBA 2B4DB 2H5MA 3V8IA 3DNSA 2BEIA 4E2AA 5ISVA 2B4BA 5HMNA 4U5YA 1IIDA 3I3GA 3P2HA 4KLVA 4IUSA 2G3TA 2EUIA 4FD5A 2IL4A 4UBRA 4PSWA 2VI7A 4QUSA 3E0KA 2WPWA 1IB1E 3ZJ0A 1BOBA 5KTDA 2R1IA 3H4QA 1IYKA 2CNMA 4XPLA 1B6BA 1P0HA 1XMTA 1TIQA 4OLLA 3S6GA 4U9YA 5CNPA 3NE7A 4KORA 4QC6A 1M4GA 2CNSA 3S6KA 4FD4A 2FIAA 1IICA 2X7BA 1S7KA 2ZW6A 3UY5A 3P2FA 4AVCA 3CXQA 1I21A 2VZYA 2VBQA 1QSTA 1XIXA 4KUAA 2FSRA 1R57A 4H6ZA 2ARHA 3G8WA 3T9YA 4KOYA 3TOBA 2GANA 1XEBA 3FIXA 1YREA 3F0AA 2GIVA 2CY2A 3TCVA 5J8FA 4E0AA 3R1KA 2B5GB 4R3KA 1V0CA 5FVJA 4B5PB 2FCKA 3R96A 2KCWA 1QSRA 2JLMA 3SXNA 3D8PA 3PZJA 2R7HA 1B87A 4FD6A 2VQYA 5KTAA 1Z4RA 4XPKA 3GYAA 1YR0A 3BJ8A 2VXKA 4HNXB 2REFA 2AJ6A 3SXOA 5JPHA 1RO5A 2QIRA 1MJBA 3R9GA 3K9UA 3N7ZA 2QECA 2PQ8A 2G3AA 4HKFA 4R87A 4KVOE 1Q2DA 2Z11A 1ON0A 3TOAA 1M44A 1SQHA 4M85A 4L89A 4CS0B 2B5GA 4HNYB 2FXFA 4R57A 4YFJA 2P6GA 3ZZIA 1KZFA 4XNHC 1K4JA 2VEZA 3IGRA 3R9FA 2B58A 3EC4A 4U9ZA 3TO9A 1VHSA 2REEA 2K5TA 2FT0A 2RC4A 3S6FA 1RXTA 3CXPA 2HV2A 1S7FA 3D2PA 2Q7BA 4LX9A 1KUXA 5EC4A 4I49A 4JD6A 4J3GA 4CRYB 1S5KA 4UWIA 2B3VA 2Q4YA 4KZTA 3FXTA 1MJAA 1J4JA 3LD2A 2BUEA 3FRMA 4QBJA 4KVXA 4E8OA
chains in the Genus database with same CATH superfamily
5D29A 4KOXA 3K9TA 1IGBA 1AYEA 2NMTA 1Z4EA 4ONUA 4F0XA 4F8ZA 4H6UA 4OIDA 1LAPA 1Y9KA 1YW6A 4XPDB 4EFDA 1P4NA 3KR5A 1VKCA 3B3SA 5AG5A 1F2OA 3SJEA 5LYFA 1XE4A 2YNCC 4P6YA 2PJ9A 1UFHA 4JJXA 3FEEA 4UWJA 3NH4A 1I12A 1ZG7A 4IK2A 2FIWA 3SHPA 4IF5A 4MFZA 3GUXA 4B11A 3CZXA 1GHEA 1Z8WA 3KKWA 3WC5A 4KOSA 3FH4A 2P0WA 5HVFA 2BL1A 2PJ2A 2PRBA 1LOKA 2I00A 4DNCA 1LAMA 1I1DA 4CYPA 4PXDA 1YQEA 4NGPA 2PJ3A 4K30A 3DR8A 3JVNA 3B3TA 4NGNA 2J8MA 4QB9A 2F5IA 3B8GA 2CF4A 2PJ7A 4R3LA 5E96A 4GS4A 4UIBA 4UCNA 1TKJA 4CGNA 4CYOA 3PB8X 3WC6A 4CYQA 1S7LA 4C2XA 1R43A 5F09A 2HQYA 2DXQA 1JQGA 2PDOA 4MFLA 3W91A 1NMTA 4NF1A 3C26A 2HUZA 4FWUA 4PPZA 5HVGA 3GLJA 4MI4A 3CPAA 4JXQA 3D7GA 4X2TA 2ZEGA 1Y0RA 4B10A 3FVLA 1Y0YA 4F9UA 1AMPA 4NGTA 3VWEA 4A30A 3KQZA 4JWPA 3G3SA 3H8GA 4EWTA 1Z9UA 2FL4A 5JH9A 2ZXVA 2PJ4A 5H84A 2V8HA 3H8FA 5GCNA 3FB3A 1U6MA 2FS5A 5C88A 2OZHA 3PB7X 2POKA 3B3CA 4YGOA 1S7NA 3KHZA 4MCRA 4EVYA 4MXUA 1S3ZA 5D8NA 3EXNA 1WK4A 5J8CA 5LYIA 1M4LA 3D66A 3IWGA 3TTHA 3V38A 4C2YA 2JDCA 4UEFA 3TFYA 1S60A 1L0CA 1LANA 2OZGA 4WJBA 3TX8A 4MCQA 5JGFA 2D4PA 4KUBA 2EWBA 4Y49C 4CAVA 4NGSA 2PJ6A 4XNHB 2J8RA 3PB6X 1DTDA 3FMCA 2ZW4A 4R7MA 4B5OA 4CYNA 2OH1A 4P4DA 2OB0A 3MGDA 4CRZB 4OP4A 3I1UA 3ISXA 4F6AA 5K8MA 5AGEA 3IU2A 1PYTB 5EBVA 3MN8A 4BMHA 2DF5A 2Q0YA 2GE3A 4R9MA 5F49A 1Y9WA 1YLOA 3CXSA 2XEGA 4A2ZA 4F0YA 3TE4A 2IMOA 1MJ9A 2PC1A 4OC4A 4MHNA 5CBMA 2Z3LA 2Z10A 4ZI6A 2Q44A 1QMUA 2A4NA 2Z3OA 5DS0A 3TO6A 2C27A 1M1DA 3T90A 1YGHA 3FECA 2OU2A 1YX0A 2ZW5A 5JQ4A 1NE9A 4PSXA 4OC1A 3T8WA 4B6ZA 2AE6A 4KVME 2O28A 3JRUA 1A2ZA 2I3CA 1HEEA 4ONWA 3RNZA 3RAMA 3OWCA 3S9NA 2GU2A 3GKRA 1M4IA 3BJ7A 1CG2A 2Z0ZA 4PK3A 2ZEOA 1RTQA 2BO9A 2PJCA 2QMLA 4NGQA 2Q4VA 4W9YA 3SI0A 4B5PA 4BBHA 5I0CA 2WZNA 3NA6A 4MHZA 1QSMA 1VGYA 2R8VA 1ZLHA 4LQGA 2AFUA 2XEJA 3FX6A 4MFQA 4UIAA 5A28A 3EY5A 4NCZA 3HLPA 4KOWA 1CJWA 4MHYA 2GREA 3FNCA 4JYWA 4O23A 4CAWA 4DYOA 5THWA 1IOFA 3BHXA 2J9AA 3DGVA 5IB0A 4ZX8A 1VIXA 7CPAA 1UWYA 1ZG8A 5G20A 3FF3A 2G0BA 1Q2CA 3B3WA 3FEDA 5F47A 4P4EA 4P10A 4X8IA 2JEVA 1FY7A 4LUAA 3DR6A 4Q38A 4YU9A 2WUUA 1ELLP 3PB4X 2PSWA 5K8NA 2AFOA 3PFEA 3KQXA 1PCAA 1Q2YA 4P4IA 3S6HA 4CPAA 4ZY1A 1Y7RA 4Y49B 3T9YA 4KSIA 3WR7A 3QAHA 4II9A 3D7FA 2B3UA 3TC8A 2OZUA 3H5ZA 4H89A 2ZEDA 3DDDA 3WT4A 4KOUA 2YNCA 4UFWA 4P44A 3R95A 1YVOA 4H6ZA 5HXDA 3BI1A 3D2MA 5LYDA 1BAVA 4CAEA 3TO7A 2HC9A 2WSAA 3BI0A 1XJOA 2ZEFA 3WABA 4A31A 2VZZA 4MHPA 4NEXA 4PXEA 3PP9A 4MJ8A 3I9SA 4JLYA 2PIYA 2RFHA 1XFOA 1LCPA 2Q04A 2PR8A 4JZ0A 4HNWB 2ATRA 2Y0MA 5LRJA 3KASA 1OZPA 4KOTA 2VL1A 4RI1A 4PK2A 3JUWA 2ZEPA 2V8DA 2P6FA 1Z2LA 1YLEA 3EO4A 3QB8A 3QNVA 4B14A 4F9VA 2Q4ZA 5K8OA 1PU9A 1X12A 1LRZA 4L8AA 4KOVA 4FD7A 1ARLA 4CAXA 3D68A 4TNUA 1IYLA 4MCPA 8CPAA 2R98A 2C6GA 3DLJA 3PB9X 4NFRA 1Z8TA 3EFAA 3F8KA 4M3SA 1PUAA 4GM5A 4OC0A 2I79A 2PVWA 4XPDC 4YRHA 3BLNA 2JBJA 1MK4A 4KLWA 2GFQA 4HPSA 4AVAA 1QSNA 4RS2A 4AG7A 2FE7A 5IV0A 3KGQA 5J1QA 2G9DA 3HUVA 2V8GA 5HH1A 1NSAA 1HDUA 3D67A 4OC5A 2EVNA 4P4BA 3FYNA 3W6SA 1YK3A 2PJ0A 3IIBA 1FT7A 2WPXA 4M6IA 3SJGA 4DUKA 4ZX9A 4MY3A 4MBUA 3BXMA 2C1CA 2EK9A 4YWYA 2IJZA 2PR1A 3NH8A 4OC2A 3VWDA 2JDDA 4NXYA 2CNTA 2PCUA 5H86A 2PJ1A 4ZBGA 1KUVA 4EMEA 2NSMA 3MRUA 4JXRA 2C6PA 1CP7A 2PJ8A 3N5FA 5LRGA 4C7HA 4ZYQA 1N71A 2O53A 2EO8A 2ZPAA 4Q7AA 1NSLA 2P6EA 3D3SA 3KI9A 2ZEEA 1GYTA 4OADA 2Q7SA 3FBUA 4A37A 5EMIA 2D4OA 1IY7A 2PIZA 2J8NA 3F5BA 1WWZA 4CGOA 2V8VA 3IJ3A 4TWEA 4CAFA 5G22A 3W6XA 3PBBA 3D7DA 2BCOA 3VH9A 3TT2A 4PV6A 4R8FA 2B4DA 4UA3A 1XF8A 3R9EA 4OKOA 1BO4A 3RYOA 4MHDA 1Z5RA 4AB7A 4AXVA 2ABZA 5KTCA 4NJQA 3GY9A 3PGPA 1YVKA 1KUYA 1QSOA 3A9LA 4UF4A 3FJUA 3LODA 5F46A 2ZW7A 5DWNA 4NSQA 3B7IA 4OAEA 3DSBA 5IX3A 2Z3KA 3JTKA 1M4DA 4UFXA 1F57A 4AG9A 5DWMA 2BSWA 1HDQA 2GLJA 4ORFA 2CXAA 4LQ6A 1CM0A 5G1ZA 4X5KA 5C82A 3NE8A 2QYVA 3H8EA 4QVTA 5F48A 3K2KA 4MY0A 4AVBA 2B4DB 2H5MA 3V8IA 3B3VA 3DNSA 2BEIA 4E2AA 5ISVA 2B4BA 3RBUA 5HMNA 4U5YA 1IIDA 3I3GA 3P2HA 4KLVA 4IUSA 3V7ZA 3IFEA 2G3TA 2ZENA 2EUIA 4UEEA 1Z8XA 4FD5A 2IL4A 3CT9A 4UBRA 6CPAA 4PSWA 2EK8A 2VI7A 4H2KA 4DJLA 1Q7LA 2DPTA 4QUSA 3E0KA 4BD9A 2NYQA 2WPWA 1IB1E 2QJ8A 2ANPA 1CP6A 4MFKA 5I4MA 3ZJ0A 3S9MA 4G1PA 1BOBA 2RB7A 3CDXA 4P45A 1ZO0A 4C68A 2R1IA 3SJFA 3PRTA 5KTDA 1KWMA 2CTCA 4B12A 3H4QA 3SI1A 1IYKA 2ZOGA 4P4JA 4CGMA 1ZG9A 4RN7A 2YNEA 2CNMA 4IAVA 4XPLA 4ZY0A 5AG7A 1B6BA 1P0HA 1QQ9A 1XMTA 1TIQA 3IEHA 1TF8A 1BPMA 4PQAA 1Z8LA 4NJRA 4OLLA 2OR4A 1F2PA 2AFMA 3S6GA 3VATA 2Z3MA 4U9YA 3IWWA 4ZY2A 3D4UA 3GIUA 3PEIA 4GXHA 5CNPA 3NE7A 1CPSA 1ZLIA 4KORA 1M4GA 4QC6A 4IHMA 1VHEA 1AUGA 2CNSA 3S6KA 3LMSA 4FD4A 2PRQA 5LRKA 1IU8A 2QVPA 3RZAA 2FVGA 2HB6A 4A32A 2FIAA 1IICA 2X7BA 4B13A 1S7KA 2ZW6A 3UY5A 3NH5A 3P2FA 4AVCA 3CXQA 4PXBA 1XMBA 1XBUA 1I21A 3IWEA 2VZYA 2VBQA 2JEWA 1QSTA 4RUHA 4KVXA 1XIXA 4KUAA 3IO1A 3QAYA 1ELMP 2FSRA 1R57A 2ARHA 2ZEHA 3D7HA 2V77A 2XEIA 3G8WA 3KHXA 2GANA 1XEBA 1BLLE 3FIXA 2EBJA 3KL9A 4KOYA 4X3RA 1YREA 2AFSA 3SJXA 4CGPA 3F0AA 2GIVA 2CY2A 3TCVA 3CPXA 4E0AA 4FBEA 5J8FA 1XOVA 2Z3PA 3NFZA 2B5GB 3R1KA 4MFPA 4R3KA 1V0CA 2PVVA 4OC3A 4UCPA 5FVJA 2FCKA 3PFOA 4OMEA 4B5PB 1CPXA 5AG6A 3S9LA 3R96A 2KCWA 1QSRA 2JLMA 2AFZA 3SXNA 1EE3P 4UCMA 1TXRA 3LWUA 3D8PA 2JBKA 4MFJA 3PZJA 4A39A 2R7HA 5A27A 1B87A 5HVHA 4FD6A 2VQYA 5KTAA 1CBXA 1Z4RA 4XPKA 3IU1A 3GYAA 4K3NA 4BINA 1XRYA 1YMEA 2ZELA 1YR0A 2Q51A 3BJ8A 2VXKA 3B35A 3L2NA 4HNXB 2DEAA 2REFA 2AJ6A 3SXOA 5JPHA 4A38A 2IQ6A 1RO5A 2QIRA 2AFWA 4FAIA 5K8PA 2YNDA 1MJBA 2C6CA 3R9GA 3K9UA 4UEZA 4FUUA 5BWAB 1ARMA 1CX8A 4WWVA 3N7ZA 3VARA 2QECA 2PQ8A 2G3AA 4PXCA 2PJBA 4HKFA 1TF9A 1X10A 2XEFA 4KVOE 4R87A 4R6TA 5LYLA 1Q2DA 2Z11A 5IB9A 1ON0A 3KR4A 3TOAA 4KSFA 4M6GA 2PJAA 5AG4A 1M44A 2F7VA 5ELYA 1SQHA 4OIWA 4M85A 1OBRA 4L89A 4CS0B 4A94A 2B5GA 4C7IA 2GLFA 2PJ5A 2ZOFA 4HNYB 4Z65A 4MRIA 5G21A 2FXFA 4R57A 4YFJA 2P6GA 3ZZIA 4UFVA 3B2YA 1YSJA 4R76A 1KZFA 3PBEA 4P4FA 1K4JA 4XNHC 2VEZA 2ODFA 3IGRA 1Y7EA 3R9FA 2B58A 2CTBA 2PE3A 3EC4A 4U9ZA 2OOTA 3TO9A 1H8LA 1VHSA 5CPAA 2REEA 2K5TA 4A33A 2FT0A 2AFXA 4NGRA 2RC4A 2F8HA 3S6FA 1RXTA 2ZEMA 1TKHA 1JWQA 1FNOA 2HV2A 3CXPA 3SI2A 1S7FA 4C2ZA 4Q36A 4NGMA 4ZGYB 3D2PA 3KZWA 2Q7BA 4LX9A 1KUXA 5EC4A 1YW4A 4MCSA 1DE4C 4I49A 4JD6A 1TKFA 3WC7A 4A95A 4J3GA 4CRYB 1VHOA 1R3NA 1BPNA 1S5KA 2DPSA 2Q43A 2YGWA 4UWIA 2B3VA 2Q4YA 3LACA 4KZTA 4MMOA 3GB0A 4M6HA 2Z3NA 1IOIA 3FXTA 4KSAA 1MJAA 3RO0A 1J4JA 3LD2A 3IC1A 2BOAA 2BUEA 2WYRA 3FRMA 4QBJA 4KS9A 1LFWA 2CIJA 3ISZA 4CGLA 2O4HA 3TOBA 5JM6A 4E8OA
chains in the Genus database with same CATH topology
4KOXA 2NMTA 1Z4EA 4ONUA 4F0XA 4H6UA 1Y9KA 4XPDB 1P4NA 1VKCA 5AG5A 1XE4A 2YNCC 1UFHA 4JJXA 4UWJA 1I12A 2FIWA 3SHPA 4IF5A 4MFZA 4B11A 1GHEA 3KKWA 4KOSA 2P0WA 2BL1A 2PRBA 2I00A 4DNCA 1I1DA 4CYPA 4K30A 3DR8A 3JVNA 2J8MA 4QB9A 2F5IA 3B8GA 4R3LA 5E96A 4GS4A 4UCNA 4CGNA 4CYOA 4CYQA 1S7LA 4C2XA 2HQYA 2DXQA 2PDOA 4MFLA 3W91A 1NMTA 4NF1A 3C26A 2HUZA 4MI4A 4JXQA 4B10A 3VWEA 4A30A 4JWPA 3G3SA 1Z9UA 2FL4A 2ZXVA 5H84A 5GCNA 3FB3A 1U6MA 2FS5A 5C88A 2OZHA 4YGOA 1S7NA 4EVYA 1S3ZA 3EXNA 1WK4A 5J8CA 3IWGA 4C2YA 3TTHA 2JDCA 3TFYA 1S60A 1L0CA 2OZGA 2D4PA 4KUBA 4Y49C 4CAVA 4XNHB 2J8RA 2ZW4A 4B5OA 4CYNA 2OH1A 2OB0A 3MGDA 4CRZB 4F6AA 5AGEA 3IU2A 5EBVA 4BMHA 2GE3A 2Q0YA 4R9MA 5F49A 1Y9WA 3CXSA 4A2ZA 4F0YA 3TE4A 1MJ9A 2PC1A 2Z3LA 2Z10A 2Q44A 2A4NA 2Z3OA 3TO6A 2C27A 1M1DA 3T90A 1YGHA 2OU2A 1YX0A 2ZW5A 5JQ4A 1NE9A 4PSXA 2AE6A 4KVME 2O28A 3OWCA 3GKRA 1M4IA 3BJ7A 2Z0ZA 4PK3A 2QMLA 4BBHA 2Q4VA 4B5PA 5I0CA 1QSMA 2R8VA 4MFQA 5A28A 3EY5A 4NCZA 4KOWA 1CJWA 4CAWA 3FNCA 5IB0A 5G20A 2G0BA 1Q2CA 5F47A 2JEVA 1FY7A 4LUAA 3DR6A 4Q38A 2WUUA 2PSWA 1Q2YA 3S6HA 1Y7RA 4Y49B 3WR7A 3QAHA 4II9A 2B3UA 2OZUA 3H5ZA 4H89A 3DDDA 4KOUA 2YNCA 4UFWA 3R95A 1YVOA 3D2MA 4CAEA 3TO7A 2WSAA 4A31A 2VZZA 4NEXA 3PP9A 4MJ8A 3I9SA 4JLYA 2Q04A 2PR8A 4HNWB 2ATRA 2Y0MA 1OZPA 4KOTA 4RI1A 4PK2A 3JUWA 2P6FA 3EO4A 1YLEA 3QB8A 4B14A 1PU9A 1LRZA 4L8AA 4KOVA 4FD7A 4CAXA 1IYLA 2R98A 4M3SA 3EFAA 3F8KA 1PUAA 2I79A 4XPDC 4YRHA 3BLNA 1MK4A 4KLWA 4AVAA 1QSNA 4RS2A 4AG7A 2FE7A 5IV0A 5HH1A 2EVNA 3FYNA 3W6SA 1YK3A 2WPXA 4MY3A 4MBUA 2PR1A 3VWDA 2JDDA 4NXYA 2CNTA 5H86A 4ZBGA 1KUVA 4JXRA 4C7HA 1N71A 2ZPAA 1NSLA 2P6EA 3D3SA 4OADA 3FBUA 2D4OA 2J8NA 3F5BA 1WWZA 4CGOA 4CAFA 5G22A 3W6XA 3TT2A 4PV6A 2B4DA 4UA3A 1XF8A 3R9EA 1BO4A 3RYOA 4MHDA 4AB7A 5KTCA 3GY9A 3PGPA 1YVKA 1KUYA 1QSOA 3A9LA 3LODA 5F46A 2ZW7A 5DWNA 4NSQA 4OAEA 3DSBA 5IX3A 2Z3KA 3JTKA 1M4DA 4UFXA 4AG9A 5DWMA 2BSWA 4ORFA 2CXAA 1CM0A 5G1ZA 4X5KA 5C82A 5F48A 4QVTA 4MY0A 4AVBA 2B4DB 2H5MA 3V8IA 3DNSA 2BEIA 4E2AA 5ISVA 2B4BA 5HMNA 4U5YA 1IIDA 3I3GA 3P2HA 4KLVA 4IUSA 2G3TA 2EUIA 4FD5A 2IL4A 4UBRA 4PSWA 2VI7A 2DPTA 4QUSA 3E0KA 2WPWA 1IB1E 4MFKA 3ZJ0A 1BOBA 1ZO0A 4C68A 2R1IA 5KTDA 4B12A 3H4QA 1IYKA 4CGMA 2YNEA 2CNMA 4XPLA 5AG7A 1B6BA 1P0HA 1XMTA 1TIQA 4OLLA 3S6GA 2Z3MA 4U9YA 5CNPA 3NE7A 4KORA 4QC6A 1M4GA 2CNSA 3S6KA 4FD4A 4A32A 2FIAA 1IICA 2X7BA 4B13A 1S7KA 2ZW6A 3UY5A 3P2FA 4AVCA 3CXQA 1I21A 3IWEA 2VZYA 2VBQA 1QSTA 1XIXA 4KUAA 2FSRA 1R57A 4H6ZA 2ARHA 3G8WA 3T9YA 4KOYA 3TOBA 2GANA 1XEBA 3FIXA 4CGPA 1YREA 3F0AA 2GIVA 2CY2A 3TCVA 5J8FA 4E0AA 2Z3PA 3R1KA 2B5GB 4MFPA 4R3KA 1V0CA 4UCPA 5FVJA 2FCKA 4B5PB 5AG6A 3R96A 2KCWA 1QSRA 2JLMA 3SXNA 4UCMA 3D8PA 4MFJA 3PZJA 2R7HA 5A27A 1B87A 4FD6A 2VQYA 5KTAA 1Z4RA 4XPKA 3IU1A 3GYAA 1YR0A 3BJ8A 2VXKA 4HNXB 2REFA 2AJ6A 3SXOA 5JPHA 1RO5A 2QIRA 2YNDA 1MJBA 3R9GA 3K9UA 5BWAB 3N7ZA 2QECA 2PQ8A 2G3AA 4HKFA 4KVOE 4R87A 1Q2DA 2Z11A 1ON0A 3TOAA 4KSFA 5AG4A 1M44A 1SQHA 4M85A 4L89A 4CS0B 2B5GA 4C7IA 4HNYB 5G21A 2FXFA 4R57A 4YFJA 2P6GA 3ZZIA 4UFVA 1KZFA 4XNHC 1K4JA 2VEZA 3IGRA 3R9FA 2B58A 3EC4A 4U9ZA 3TO9A 1VHSA 2REEA 2K5TA 4A33A 2FT0A 2RC4A 3S6FA 1RXTA 3CXPA 2HV2A 1S7FA 4C2ZA 4Q36A 4ZGYB 3D2PA 2Q7BA 4LX9A 1KUXA 5EC4A 4I49A 4JD6A 4A95A 4J3GA 4CRYB 1S5KA 2DPSA 2YGWA 4UWIA 2B3VA 2Q4YA 4KZTA 2Z3NA 3FXTA 4KSAA 1MJAA 1J4JA 3LD2A 2BUEA 3FRMA 4QBJA 4KS9A 4CGLA 4KVXA 4E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOX A;  2NMT A;  1Z4E A;  4ONU A;  4H6U A;  1Y9K A;  4XPD B;  1P4N A;  1VKC A;  1XE4 A;  1UFH A;  4JJX A;  4UWJ A;  1I12 A;  2FIW A;  3SHP A;  4IF5 A;  1GHE A;  3KKW A;  4KOS A;  2P0W A;  2BL1 A;  2PRB A;  2I00 A;  4DNC A;  1I1D A;  4K30 A;  3DR8 A;  3JVN A;  2J8M A;  4QB9 A;  2F5I A;  3B8G A;  4R3L A;  5E96 A;  4GS4 A;  1S7L A;  2HQY A;  2DXQ A;  2PDO A;  3W91 A;  1NMT A;  4NF1 A;  3C26 A;  2HUZ A;  4MI4 A;  4JXQ A;  3VWE A;  4JWP A;  3G3S A;  1Z9U A;  2FL4 A;  2ZXV A;  5H84 A;  5GCN A;  3FB3 A;  1U6M A;  2FS5 A;  5C88 A;  2OZH A;  4YGO A;  1S7N A;  4EVY A;  1S3Z A;  3EXN A;  1WK4 A;  5J8C A;  3IWG A;  3TTH A;  2JDC A;  3TFY A;  1S60 A;  1L0C A;  2OZG A;  2D4P A;  4KUB A;  4Y49 C;  4CAV A;  4XNH B;  2J8R A;  2ZW4 A;  4B5O A;  2OH1 A;  2OB0 A;  3MGD A;  4CRZ B;  4F6A A;  5EBV A;  4BMH A;  2GE3 A;  2Q0Y A;  4R9M A;  5F49 A;  1Y9W A;  3CXS A;  3TE4 A;  4F0Y A;  1MJ9 A;  2PC1 A;  2Z10 A;  2Q44 A;  2A4N A;  3TO6 A;  2C27 A;  1M1D A;  3T90 A;  1YGH A;  2OU2 A;  1YX0 A;  2ZW5 A;  5JQ4 A;  1NE9 A;  4PSX A;  2AE6 A;  4KVM E;  2O28 A;  3OWC A;  3GKR A;  1M4I A;  3BJ7 A;  2Z0Z A;  4PK3 A;  2QML A;  2Q4V A;  4B5P A;  5I0C A;  1QSM A;  2R8V A;  3EY5 A;  4NCZ A;  4KOW A;  1CJW A;  4CAW A;  3FNC A;  5IB0 A;  2G0B A;  1Q2C A;  5F47 A;  2JEV A;  1FY7 A;  4LUA A;  3DR6 A;  2PSW A;  1Q2Y A;  3S6H A;  1Y7R A;  4Y49 B;  3WR7 A;  3QAH A;  4II9 A;  2B3U A;  2OZU A;  4H89 A;  3DDD A;  4KOU A;  3R95 A;  1YVO A;  3D2M A;  3TO7 A;  2VZZ A;  4NEX A;  3PP9 A;  4MJ8 A;  3I9S A;  4JLY A;  2Q04 A;  2PR8 A;  4HNW B;  2ATR A;  2Y0M A;  1OZP A;  4KOT A;  4RI1 A;  4PK2 A;  3JUW A;  2P6F A;  3EO4 A;  1YLE A;  3QB8 A;  1PU9 A;  1LRZ A;  4L8A A;  4KOV A;  4FD7 A;  4CAX A;  1IYL A;  2R98 A;  4M3S A;  3EFA A;  3F8K A;  1PUA A;  2I79 A;  4XPD C;  4YRH A;  3BLN A;  1MK4 A;  4KLW A;  4AVA A;  1QSN A;  4RS2 A;  4AG7 A;  2FE7 A;  5IV0 A;  5HH1 A;  2EVN A;  3FYN A;  3W6S A;  1YK3 A;  2WPX A;  4MY3 A;  4MBU A;  2PR1 A;  3VWD A;  2JDD A;  4NXY A;  2CNT A;  5H86 A;  4ZBG A;  1KUV A;  4JXR A;  1N71 A;  2ZPA A;  1NSL A;  2P6E A;  3D3S A;  4OAD A;  3FBU A;  2D4O A;  2J8N A;  3F5B A;  1WWZ A;  3W6X A;  3TT2 A;  4PV6 A;  2B4D A;  4UA3 A;  1XF8 A;  3R9E A;  1BO4 A;  3RYO A;  4MHD A;  4AB7 A;  5KTC A;  3GY9 A;  3PGP A;  1YVK A;  1KUY A;  1QSO A;  3LOD A;  5F46 A;  2ZW7 A;  5DWN A;  4NSQ A;  4OAE A;  3DSB A;  5IX3 A;  1M4D A;  4AG9 A;  5DWM A;  2BSW A;  4ORF A;  1CM0 A;  4X5K A;  5C82 A;  5F48 A;  4QVT A;  4MY0 A;  4AVB A;  2B4D B;  2H5M A;  3V8I A;  3DNS A;  2BEI A;  4E2A A;  5ISV A;  2B4B A;  5HMN A;  4U5Y A;  1IID A;  3I3G A;  3P2H A;  4KLV A;  4IUS A;  2G3T A;  2EUI A;  4FD5 A;  2IL4 A;  4UBR A;  4PSW A;  2VI7 A;  4QUS A;  3E0K A;  2WPW A;  1IB1 E;  3ZJ0 A;  1BOB A;  5KTD A;  2R1I A;  3H4Q A;  1IYK A;  2CNM A;  4XPL A;  1B6B A;  1P0H A;  1XMT A;  1TIQ A;  4OLL A;  3S6G A;  4U9Y A;  5CNP A;  3NE7 A;  4KOR A;  4QC6 A;  1M4G A;  2CNS A;  3S6K A;  4FD4 A;  2FIA A;  1IIC A;  2X7B A;  1S7K A;  2ZW6 A;  3UY5 A;  3P2F A;  4AVC A;  3CXQ A;  1I21 A;  2VZY A;  2VBQ A;  1QST A;  1XIX A;  4KUA A;  2FSR A;  1R57 A;  4H6Z A;  2ARH A;  3G8W A;  3T9Y A;  4KOY A;  3TOB A;  2GAN A;  1XEB A;  3FIX A;  1YRE A;  3F0A A;  2GIV A;  2CY2 A;  3TCV A;  5J8F A;  4E0A A;  3R1K A;  2B5G B;  4R3K A;  1V0C A;  5FVJ A;  4B5P B;  2FCK A;  3R96 A;  2KCW A;  1QSR A;  2JLM A;  3SXN A;  3D8P A;  3PZJ A;  2R7H A;  1B87 A;  4FD6 A;  2VQY A;  5KTA A;  1Z4R A;  4XPK A;  3GYA A;  1YR0 A;  3BJ8 A;  2VXK A;  4HNX B;  2REF A;  2AJ6 A;  3SXO A;  5JPH A;  1RO5 A;  2QIR A;  1MJB A;  3R9G A;  3K9U A;  3N7Z A;  2QEC A;  2PQ8 A;  2G3A A;  4HKF A;  4R87 A;  4KVO E;  1Q2D A;  2Z11 A;  1ON0 A;  3TOA A;  1M44 A;  1SQH A;  4M85 A;  4L89 A;  4CS0 B;  2B5G A;  4HNY B;  2FXF A;  4R57 A;  4YFJ A;  2P6G A;  3ZZI A;  1KZF A;  4XNH C;  1K4J A;  2VEZ A;  3IGR A;  3R9F A;  2B58 A;  3EC4 A;  4U9Z A;  3TO9 A;  1VHS A;  2REE A;  2K5T A;  2FT0 A;  2RC4 A;  3S6F A;  1RXT A;  3CXP A;  2HV2 A;  1S7F A;  3D2P A;  2Q7B A;  4LX9 A;  1KUX A;  5EC4 A;  4I49 A;  4JD6 A;  4J3G A;  4CRY B;  1S5K A;  4UWI A;  2B3V A;  2Q4Y A;  4KZT A;  3FXT A;  1MJA A;  1J4J A;  3LD2 A;  2BUE A;  3FRM A;  4QBJ A;  4KVX A;  4E8O A; 
#chains in the Genus database with same CATH topology
 5D29 A;  4KOX A;  3K9T A;  1IGB A;  1AYE A;  2NMT A;  1Z4E A;  4ONU A;  4F0X A;  4F8Z A;  4H6U A;  4OID A;  1LAP A;  1Y9K A;  1YW6 A;  4XPD B;  4EFD A;  1P4N A;  3KR5 A;  1VKC A;  3B3S A;  5AG5 A;  1F2O A;  3SJE A;  5LYF A;  1XE4 A;  2YNC C;  4P6Y A;  2PJ9 A;  1UFH A;  4JJX A;  3FEE A;  4UWJ A;  3NH4 A;  1I12 A;  1ZG7 A;  4IK2 A;  2FIW A;  3SHP A;  4IF5 A;  4MFZ A;  3GUX A;  4B11 A;  3CZX A;  1GHE A;  1Z8W A;  3KKW A;  3WC5 A;  4KOS A;  3FH4 A;  2P0W A;  5HVF A;  2BL1 A;  2PJ2 A;  2PRB A;  1LOK A;  2I00 A;  4DNC A;  1LAM A;  1I1D A;  4CYP A;  4PXD A;  1YQE A;  4NGP A;  2PJ3 A;  4K30 A;  3DR8 A;  3JVN A;  3B3T A;  4NGN A;  2J8M A;  4QB9 A;  2F5I A;  3B8G A;  2CF4 A;  2PJ7 A;  4R3L A;  5E96 A;  4GS4 A;  4UIB A;  4UCN A;  1TKJ A;  4CGN A;  4CYO A;  3PB8 X;  3WC6 A;  4CYQ A;  1S7L A;  4C2X A;  1R43 A;  5F09 A;  2HQY A;  2DXQ A;  1JQG A;  2PDO A;  4MFL A;  3W91 A;  1NMT A;  4NF1 A;  3C26 A;  2HUZ A;  4FWU A;  4PPZ A;  5HVG A;  3GLJ A;  4MI4 A;  3CPA A;  4JXQ A;  3D7G A;  4X2T A;  2ZEG A;  1Y0R A;  4B10 A;  3FVL A;  1Y0Y A;  4F9U A;  1AMP A;  4NGT A;  3VWE A;  4A30 A;  3KQZ A;  4JWP A;  3G3S A;  3H8G A;  4EWT A;  1Z9U A;  2FL4 A;  5JH9 A;  2ZXV A;  2PJ4 A;  5H84 A;  2V8H A;  3H8F A;  5GCN A;  3FB3 A;  1U6M A;  2FS5 A;  5C88 A;  2OZH A;  3PB7 X;  2POK A;  3B3C A;  4YGO A;  1S7N A;  3KHZ A;  4MCR A;  4EVY A;  4MXU A;  1S3Z A;  5D8N A;  3EXN A;  1WK4 A;  5J8C A;  5LYI A;  1M4L A;  3D66 A;  3IWG A;  3TTH A;  3V38 A;  4C2Y A;  2JDC A;  4UEF A;  3TFY A;  1S60 A;  1L0C A;  1LAN A;  2OZG A;  4WJB A;  3TX8 A;  4MCQ A;  5JGF A;  2D4P A;  4KUB A;  2EWB A;  4Y49 C;  4CAV A;  4NGS A;  2PJ6 A;  4XNH B;  2J8R A;  3PB6 X;  1DTD A;  3FMC A;  2ZW4 A;  4R7M A;  4B5O A;  4CYN A;  2OH1 A;  4P4D A;  2OB0 A;  3MGD A;  4CRZ B;  4OP4 A;  3I1U A;  3ISX A;  4F6A A;  5K8M A;  5AGE A;  3IU2 A;  1PYT B;  5EBV A;  3MN8 A;  4BMH A;  2DF5 A;  2Q0Y A;  2GE3 A;  4R9M A;  5F49 A;  1Y9W A;  1YLO A;  3CXS A;  2XEG A;  4A2Z A;  4F0Y A;  3TE4 A;  2IMO A;  1MJ9 A;  2PC1 A;  4OC4 A;  4MHN A;  5CBM A;  2Z3L A;  2Z10 A;  4ZI6 A;  2Q44 A;  1QMU A;  2A4N A;  2Z3O A;  5DS0 A;  3TO6 A;  2C27 A;  1M1D A;  3T90 A;  1YGH A;  3FEC A;  2OU2 A;  1YX0 A;  2ZW5 A;  5JQ4 A;  1NE9 A;  4PSX A;  4OC1 A;  3T8W A;  4B6Z A;  2AE6 A;  4KVM E;  2O28 A;  3JRU A;  1A2Z A;  2I3C A;  1HEE A;  4ONW A;  3RNZ A;  3RAM A;  3OWC A;  3S9N A;  2GU2 A;  3GKR A;  1M4I A;  3BJ7 A;  1CG2 A;  2Z0Z A;  4PK3 A;  2ZEO A;  1RTQ A;  2BO9 A;  2PJC A;  2QML A;  4NGQ A;  2Q4V A;  4W9Y A;  3SI0 A;  4B5P A;  4BBH A;  5I0C A;  2WZN A;  3NA6 A;  4MHZ A;  1QSM A;  1VGY A;  2R8V A;  1ZLH A;  4LQG A;  2AFU A;  2XEJ A;  3FX6 A;  4MFQ A;  4UIA A;  5A28 A;  3EY5 A;  4NCZ A;  3HLP A;  4KOW A;  1CJW A;  4MHY A;  2GRE A;  3FNC A;  4JYW A;  4O23 A;  4CAW A;  4DYO A;  5THW A;  1IOF A;  3BHX A;  2J9A A;  3DGV A;  5IB0 A;  4ZX8 A;  1VIX A;  7CPA A;  1UWY A;  1ZG8 A;  5G20 A;  3FF3 A;  2G0B A;  1Q2C A;  3B3W A;  3FED A;  5F47 A;  4P4E A;  4P10 A;  4X8I A;  2JEV A;  1FY7 A;  4LUA A;  3DR6 A;  4Q38 A;  4YU9 A;  2WUU A;  1ELL P;  3PB4 X;  2PSW A;  5K8N A;  2AFO A;  3PFE A;  3KQX A;  1PCA A;  1Q2Y A;  4P4I A;  3S6H A;  4CPA A;  4ZY1 A;  1Y7R A;  4Y49 B;  3T9Y A;  4KSI A;  3WR7 A;  3QAH A;  4II9 A;  3D7F A;  2B3U A;  3TC8 A;  2OZU A;  3H5Z A;  4H89 A;  2ZED A;  3DDD A;  3WT4 A;  4KOU A;  2YNC A;  4UFW A;  4P44 A;  3R95 A;  1YVO A;  4H6Z A;  5HXD A;  3BI1 A;  3D2M A;  5LYD A;  1BAV A;  4CAE A;  3TO7 A;  2HC9 A;  2WSA A;  3BI0 A;  1XJO A;  2ZEF A;  3WAB A;  4A31 A;  2VZZ A;  4MHP A;  4NEX A;  4PXE A;  3PP9 A;  4MJ8 A;  3I9S A;  4JLY A;  2PIY A;  2RFH A;  1XFO A;  1LCP A;  2Q04 A;  2PR8 A;  4JZ0 A;  4HNW B;  2ATR A;  2Y0M A;  5LRJ A;  3KAS A;  1OZP A;  4KOT A;  2VL1 A;  4RI1 A;  4PK2 A;  3JUW A;  2ZEP A;  2V8D A;  2P6F A;  1Z2L A;  1YLE A;  3EO4 A;  3QB8 A;  3QNV A;  4B14 A;  4F9V A;  2Q4Z A;  5K8O A;  1PU9 A;  1X12 A;  1LRZ A;  4L8A A;  4KOV A;  4FD7 A;  1ARL A;  4CAX A;  3D68 A;  4TNU A;  1IYL A;  4MCP A;  8CPA A;  2R98 A;  2C6G A;  3DLJ A;  3PB9 X;  4NFR A;  1Z8T A;  3EFA A;  3F8K A;  4M3S A;  1PUA A;  4GM5 A;  4OC0 A;  2I79 A;  2PVW A;  4XPD C;  4YRH A;  3BLN A;  2JBJ A;  1MK4 A;  4KLW A;  2GFQ A;  4HPS A;  4AVA A;  1QSN A;  4RS2 A;  4AG7 A;  2FE7 A;  5IV0 A;  3KGQ A;  5J1Q A;  2G9D A;  3HUV A;  2V8G A;  5HH1 A;  1NSA A;  1HDU A;  3D67 A;  4OC5 A;  2EVN A;  4P4B A;  3FYN A;  3W6S A;  1YK3 A;  2PJ0 A;  3IIB A;  1FT7 A;  2WPX A;  4M6I A;  3SJG A;  4DUK A;  4ZX9 A;  4MY3 A;  4MBU A;  3BXM A;  2C1C A;  2EK9 A;  4YWY A;  2IJZ A;  2PR1 A;  3NH8 A;  4OC2 A;  3VWD A;  2JDD A;  4NXY A;  2CNT A;  2PCU A;  5H86 A;  2PJ1 A;  4ZBG A;  1KUV A;  4EME A;  2NSM A;  3MRU A;  4JXR A;  2C6P A;  1CP7 A;  2PJ8 A;  3N5F A;  5LRG A;  4C7H A;  4ZYQ A;  1N71 A;  2O53 A;  2EO8 A;  2ZPA A;  4Q7A A;  1NSL A;  2P6E A;  3D3S A;  3KI9 A;  2ZEE A;  1GYT A;  4OAD A;  2Q7S A;  3FBU A;  4A37 A;  5EMI A;  2D4O A;  1IY7 A;  2PIZ A;  2J8N A;  3F5B A;  1WWZ A;  4CGO A;  2V8V A;  3IJ3 A;  4TWE A;  4CAF A;  5G22 A;  3W6X A;  3PBB A;  3D7D A;  2BCO A;  3VH9 A;  3TT2 A;  4PV6 A;  4R8F A;  2B4D A;  4UA3 A;  1XF8 A;  3R9E A;  4OKO A;  1BO4 A;  3RYO A;  4MHD A;  1Z5R A;  4AB7 A;  4AXV A;  2ABZ A;  5KTC A;  4NJQ A;  3GY9 A;  3PGP A;  1YVK A;  1KUY A;  1QSO A;  3A9L A;  4UF4 A;  3FJU A;  3LOD A;  5F46 A;  2ZW7 A;  5DWN A;  4NSQ A;  3B7I A;  4OAE A;  3DSB A;  5IX3 A;  2Z3K A;  3JTK A;  1M4D A;  4UFX A;  1F57 A;  4AG9 A;  5DWM A;  2BSW A;  1HDQ A;  2GLJ A;  4ORF A;  2CXA A;  4LQ6 A;  1CM0 A;  5G1Z A;  4X5K A;  5C82 A;  3NE8 A;  2QYV A;  3H8E A;  4QVT A;  5F48 A;  3K2K A;  4MY0 A;  4AVB A;  2B4D B;  2H5M A;  3V8I A;  3B3V A;  3DNS A;  2BEI A;  4E2A A;  5ISV A;  2B4B A;  3RBU A;  5HMN A;  4U5Y A;  1IID A;  3I3G A;  3P2H A;  4KLV A;  4IUS A;  3V7Z A;  3IFE A;  2G3T A;  2ZEN A;  2EUI A;  4UEE A;  1Z8X A;  4FD5 A;  2IL4 A;  3CT9 A;  4UBR A;  6CPA A;  4PSW A;  2EK8 A;  2VI7 A;  4H2K A;  4DJL A;  1Q7L A;  2DPT A;  4QUS A;  3E0K A;  4BD9 A;  2NYQ A;  2WPW A;  1IB1 E;  2QJ8 A;  2ANP A;  1CP6 A;  4MFK A;  5I4M A;  3ZJ0 A;  3S9M A;  4G1P A;  1BOB A;  2RB7 A;  3CDX A;  4P45 A;  1ZO0 A;  4C68 A;  2R1I A;  3SJF A;  3PRT A;  5KTD A;  1KWM A;  2CTC A;  4B12 A;  3H4Q A;  3SI1 A;  1IYK A;  2ZOG A;  4P4J A;  4CGM A;  1ZG9 A;  4RN7 A;  2YNE A;  2CNM A;  4IAV A;  4XPL A;  4ZY0 A;  5AG7 A;  1B6B A;  1P0H A;  1QQ9 A;  1XMT A;  1TIQ A;  3IEH A;  1TF8 A;  1BPM A;  4PQA A;  1Z8L A;  4NJR A;  4OLL A;  2OR4 A;  1F2P A;  2AFM A;  3S6G A;  3VAT A;  2Z3M A;  4U9Y A;  3IWW A;  4ZY2 A;  3D4U A;  3GIU A;  3PEI A;  4GXH A;  5CNP A;  3NE7 A;  1CPS A;  1ZLI A;  4KOR A;  1M4G A;  4QC6 A;  4IHM A;  1VHE A;  1AUG A;  2CNS A;  3S6K A;  3LMS A;  4FD4 A;  2PRQ A;  5LRK A;  1IU8 A;  2QVP A;  3RZA A;  2FVG A;  2HB6 A;  4A32 A;  2FIA A;  1IIC A;  2X7B A;  4B13 A;  1S7K A;  2ZW6 A;  3UY5 A;  3NH5 A;  3P2F A;  4AVC A;  3CXQ A;  4PXB A;  1XMB A;  1XBU A;  1I21 A;  3IWE A;  2VZY A;  2VBQ A;  2JEW A;  1QST A;  4RUH A;  4KVX A;  1XIX A;  4KUA A;  3IO1 A;  3QAY A;  1ELM P;  2FSR A;  1R57 A;  2ARH A;  2ZEH A;  3D7H A;  2V77 A;  2XEI A;  3G8W A;  3KHX A;  2GAN A;  1XEB A;  1BLL E;  3FIX A;  2EBJ A;  3KL9 A;  4KOY A;  4X3R A;  1YRE A;  2AFS A;  3SJX A;  4CGP A;  3F0A A;  2GIV A;  2CY2 A;  3TCV A;  3CPX A;  4E0A A;  4FBE A;  5J8F A;  1XOV A;  2Z3P A;  3NFZ A;  2B5G B;  3R1K A;  4MFP A;  4R3K A;  1V0C A;  2PVV A;  4OC3 A;  4UCP A;  5FVJ A;  2FCK A;  3PFO A;  4OME A;  4B5P B;  1CPX A;  5AG6 A;  3S9L A;  3R96 A;  2KCW A;  1QSR A;  2JLM A;  2AFZ A;  3SXN A;  1EE3 P;  4UCM A;  1TXR A;  3LWU A;  3D8P A;  2JBK A;  4MFJ A;  3PZJ A;  4A39 A;  2R7H A;  5A27 A;  1B87 A;  5HVH A;  4FD6 A;  2VQY A;  5KTA A;  1CBX A;  1Z4R A;  4XPK A;  3IU1 A;  3GYA A;  4K3N A;  4BIN A;  1XRY A;  1YME A;  2ZEL A;  1YR0 A;  2Q51 A;  3BJ8 A;  2VXK A;  3B35 A;  3L2N A;  4HNX B;  2DEA A;  2REF A;  2AJ6 A;  3SXO A;  5JPH A;  4A38 A;  2IQ6 A;  1RO5 A;  2QIR A;  2AFW A;  4FAI A;  5K8P A;  2YND A;  1MJB A;  2C6C A;  3R9G A;  3K9U A;  4UEZ A;  4FUU A;  5BWA B;  1ARM A;  1CX8 A;  4WWV A;  3N7Z A;  3VAR A;  2QEC A;  2PQ8 A;  2G3A A;  4PXC A;  2PJB A;  4HKF A;  1TF9 A;  1X10 A;  2XEF A;  4KVO E;  4R87 A;  4R6T A;  5LYL A;  1Q2D A;  2Z11 A;  5IB9 A;  1ON0 A;  3KR4 A;  3TOA A;  4KSF A;  4M6G A;  2PJA A;  5AG4 A;  1M44 A;  2F7V A;  5ELY A;  1SQH A;  4OIW A;  4M85 A;  1OBR A;  4L89 A;  4CS0 B;  4A94 A;  2B5G A;  4C7I A;  2GLF A;  2PJ5 A;  2ZOF A;  4HNY B;  4Z65 A;  4MRI A;  5G21 A;  2FXF A;  4R57 A;  4YFJ A;  2P6G A;  3ZZI A;  4UFV A;  3B2Y A;  1YSJ A;  4R76 A;  1KZF A;  3PBE A;  4P4F A;  1K4J A;  4XNH C;  2VEZ A;  2ODF A;  3IGR A;  1Y7E A;  3R9F A;  2B58 A;  2CTB A;  2PE3 A;  3EC4 A;  4U9Z A;  2OOT A;  3TO9 A;  1H8L A;  1VHS A;  5CPA A;  2REE A;  2K5T A;  4A33 A;  2FT0 A;  2AFX A;  4NGR A;  2RC4 A;  2F8H A;  3S6F A;  1RXT A;  2ZEM A;  1TKH A;  1JWQ A;  1FNO A;  2HV2 A;  3CXP A;  3SI2 A;  1S7F A;  4C2Z A;  4Q36 A;  4NGM A;  4ZGY B;  3D2P A;  3KZW A;  2Q7B A;  4LX9 A;  1KUX A;  5EC4 A;  1YW4 A;  4MCS A;  1DE4 C;  4I49 A;  4JD6 A;  1TKF A;  3WC7 A;  4A95 A;  4J3G A;  4CRY B;  1VHO A;  1R3N A;  1BPN A;  1S5K A;  2DPS A;  2Q43 A;  2YGW A;  4UWI A;  2B3V A;  2Q4Y A;  3LAC A;  4KZT A;  4MMO A;  3GB0 A;  4M6H A;  2Z3N A;  1IOI A;  3FXT A;  4KSA A;  1MJA A;  3RO0 A;  1J4J A;  3LD2 A;  3IC1 A;  2BOA A;  2BUE A;  2WYR A;  3FRM A;  4QBJ A;  4KS9 A;  1LFW A;  2CIJ A;  3ISZ A;  4CGL A;  2O4H A;  3TOB A;  5JM6 A;  4E8O A; 
#chains in the Genus database with same CATH homology
 4KOX A;  2NMT A;  1Z4E A;  4ONU A;  4F0X A;  4H6U A;  1Y9K A;  4XPD B;  1P4N A;  1VKC A;  5AG5 A;  1XE4 A;  2YNC C;  1UFH A;  4JJX A;  4UWJ A;  1I12 A;  2FIW A;  3SHP A;  4IF5 A;  4MFZ A;  4B11 A;  1GHE A;  3KKW A;  4KOS A;  2P0W A;  2BL1 A;  2PRB A;  2I00 A;  4DNC A;  1I1D A;  4CYP A;  4K30 A;  3DR8 A;  3JVN A;  2J8M A;  4QB9 A;  2F5I A;  3B8G A;  4R3L A;  5E96 A;  4GS4 A;  4UCN A;  4CGN A;  4CYO A;  4CYQ A;  1S7L A;  4C2X A;  2HQY A;  2DXQ A;  2PDO A;  4MFL A;  3W91 A;  1NMT A;  4NF1 A;  3C26 A;  2HUZ A;  4MI4 A;  4JXQ A;  4B10 A;  3VWE A;  4A30 A;  4JWP A;  3G3S A;  1Z9U A;  2FL4 A;  2ZXV A;  5H84 A;  5GCN A;  3FB3 A;  1U6M A;  2FS5 A;  5C88 A;  2OZH A;  4YGO A;  1S7N A;  4EVY A;  1S3Z A;  3EXN A;  1WK4 A;  5J8C A;  3IWG A;  4C2Y A;  3TTH A;  2JDC A;  3TFY A;  1S60 A;  1L0C A;  2OZG A;  2D4P A;  4KUB A;  4Y49 C;  4CAV A;  4XNH B;  2J8R A;  2ZW4 A;  4B5O A;  4CYN A;  2OH1 A;  2OB0 A;  3MGD A;  4CRZ B;  4F6A A;  5AGE A;  3IU2 A;  5EBV A;  4BMH A;  2GE3 A;  2Q0Y A;  4R9M A;  5F49 A;  1Y9W A;  3CXS A;  4A2Z A;  4F0Y A;  3TE4 A;  1MJ9 A;  2PC1 A;  2Z3L A;  2Z10 A;  2Q44 A;  2A4N A;  2Z3O A;  3TO6 A;  2C27 A;  1M1D A;  3T90 A;  1YGH A;  2OU2 A;  1YX0 A;  2ZW5 A;  5JQ4 A;  1NE9 A;  4PSX A;  2AE6 A;  4KVM E;  2O28 A;  3OWC A;  3GKR A;  1M4I A;  3BJ7 A;  2Z0Z A;  4PK3 A;  2QML A;  4BBH A;  2Q4V A;  4B5P A;  5I0C A;  1QSM A;  2R8V A;  4MFQ A;  5A28 A;  3EY5 A;  4NCZ A;  4KOW A;  1CJW A;  4CAW A;  3FNC A;  5IB0 A;  5G20 A;  2G0B A;  1Q2C A;  5F47 A;  2JEV A;  1FY7 A;  4LUA A;  3DR6 A;  4Q38 A;  2WUU A;  2PSW A;  1Q2Y A;  3S6H A;  1Y7R A;  4Y49 B;  3WR7 A;  3QAH A;  4II9 A;  2B3U A;  2OZU A;  3H5Z A;  4H89 A;  3DDD A;  4KOU A;  2YNC A;  4UFW A;  3R95 A;  1YVO A;  3D2M A;  4CAE A;  3TO7 A;  2WSA A;  4A31 A;  2VZZ A;  4NEX A;  3PP9 A;  4MJ8 A;  3I9S A;  4JLY A;  2Q04 A;  2PR8 A;  4HNW B;  2ATR A;  2Y0M A;  1OZP A;  4KOT A;  4RI1 A;  4PK2 A;  3JUW A;  2P6F A;  3EO4 A;  1YLE A;  3QB8 A;  4B14 A;  1PU9 A;  1LRZ A;  4L8A A;  4KOV A;  4FD7 A;  4CAX A;  1IYL A;  2R98 A;  4M3S A;  3EFA A;  3F8K A;  1PUA A;  2I79 A;  4XPD C;  4YRH A;  3BLN A;  1MK4 A;  4KLW A;  4AVA A;  1QSN A;  4RS2 A;  4AG7 A;  2FE7 A;  5IV0 A;  5HH1 A;  2EVN A;  3FYN A;  3W6S A;  1YK3 A;  2WPX A;  4MY3 A;  4MBU A;  2PR1 A;  3VWD A;  2JDD A;  4NXY A;  2CNT A;  5H86 A;  4ZBG A;  1KUV A;  4JXR A;  4C7H A;  1N71 A;  2ZPA A;  1NSL A;  2P6E A;  3D3S A;  4OAD A;  3FBU A;  2D4O A;  2J8N A;  3F5B A;  1WWZ A;  4CGO A;  4CAF A;  5G22 A;  3W6X A;  3TT2 A;  4PV6 A;  2B4D A;  4UA3 A;  1XF8 A;  3R9E A;  1BO4 A;  3RYO A;  4MHD A;  4AB7 A;  5KTC A;  3GY9 A;  3PGP A;  1YVK A;  1KUY A;  1QSO A;  3A9L A;  3LOD A;  5F46 A;  2ZW7 A;  5DWN A;  4NSQ A;  4OAE A;  3DSB A;  5IX3 A;  2Z3K A;  3JTK A;  1M4D A;  4UFX A;  4AG9 A;  5DWM A;  2BSW A;  4ORF A;  2CXA A;  1CM0 A;  5G1Z A;  4X5K A;  5C82 A;  5F48 A;  4QVT A;  4MY0 A;  4AVB A;  2B4D B;  2H5M A;  3V8I A;  3DNS A;  2BEI A;  4E2A A;  5ISV A;  2B4B A;  5HMN A;  4U5Y A;  1IID A;  3I3G A;  3P2H A;  4KLV A;  4IUS A;  2G3T A;  2EUI A;  4FD5 A;  2IL4 A;  4UBR A;  4PSW A;  2VI7 A;  2DPT A;  4QUS A;  3E0K A;  2WPW A;  1IB1 E;  4MFK A;  3ZJ0 A;  1BOB A;  1ZO0 A;  4C68 A;  2R1I A;  5KTD A;  4B12 A;  3H4Q A;  1IYK A;  4CGM A;  2YNE A;  2CNM A;  4XPL A;  5AG7 A;  1B6B A;  1P0H A;  1XMT A;  1TIQ A;  4OLL A;  3S6G A;  2Z3M A;  4U9Y A;  5CNP A;  3NE7 A;  4KOR A;  4QC6 A;  1M4G A;  2CNS A;  3S6K A;  4FD4 A;  4A32 A;  2FIA A;  1IIC A;  2X7B A;  4B13 A;  1S7K A;  2ZW6 A;  3UY5 A;  3P2F A;  4AVC A;  3CXQ A;  1I21 A;  3IWE A;  2VZY A;  2VBQ A;  1QST A;  1XIX A;  4KUA A;  2FSR A;  1R57 A;  4H6Z A;  2ARH A;  3G8W A;  3T9Y A;  4KOY A;  3TOB A;  2GAN A;  1XEB A;  3FIX A;  4CGP A;  1YRE A;  3F0A A;  2GIV A;  2CY2 A;  3TCV A;  5J8F A;  4E0A A;  2Z3P A;  3R1K A;  2B5G B;  4MFP A;  4R3K A;  1V0C A;  4UCP A;  5FVJ A;  2FCK A;  4B5P B;  5AG6 A;  3R96 A;  2KCW A;  1QSR A;  2JLM A;  3SXN A;  4UCM A;  3D8P A;  4MFJ A;  3PZJ A;  2R7H A;  5A27 A;  1B87 A;  4FD6 A;  2VQY A;  5KTA A;  1Z4R A;  4XPK A;  3IU1 A;  3GYA A;  1YR0 A;  3BJ8 A;  2VXK A;  4HNX B;  2REF A;  2AJ6 A;  3SXO A;  5JPH A;  1RO5 A;  2QIR A;  2YND A;  1MJB A;  3R9G A;  3K9U A;  5BWA B;  3N7Z A;  2QEC A;  2PQ8 A;  2G3A A;  4HKF A;  4KVO E;  4R87 A;  1Q2D A;  2Z11 A;  1ON0 A;  3TOA A;  4KSF A;  5AG4 A;  1M44 A;  1SQH A;  4M85 A;  4L89 A;  4CS0 B;  2B5G A;  4C7I A;  4HNY B;  5G21 A;  2FXF A;  4R57 A;  4YFJ A;  2P6G A;  3ZZI A;  4UFV A;  1KZF A;  4XNH C;  1K4J A;  2VEZ A;  3IGR A;  3R9F A;  2B58 A;  3EC4 A;  4U9Z A;  3TO9 A;  1VHS A;  2REE A;  2K5T A;  4A33 A;  2FT0 A;  2RC4 A;  3S6F A;  1RXT A;  3CXP A;  2HV2 A;  1S7F A;  4C2Z A;  4Q36 A;  4ZGY B;  3D2P A;  2Q7B A;  4LX9 A;  1KUX A;  5EC4 A;  4I49 A;  4JD6 A;  4A95 A;  4J3G A;  4CRY B;  1S5K A;  2DPS A;  2YGW A;  4UWI A;  2B3V A;  2Q4Y A;  4KZT A;  2Z3N A;  3FXT A;  4KSA A;  1MJA A;  1J4J A;  3LD2 A;  2BUE A;  3FRM A;  4QBJ A;  4KS9 A;  4CGL A;  4KVX A;  4E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...