4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
1M44A 1KZFA 3EC4A 3I3GA 1Y9WA 2J8NA 1Z4RA 4JWPA 4QUSA 1SQHA 2HQYA 2AJ6A 4K30A 2JDCA 3LD2A 2AE6A 3W91A 1UFHA 3RYOA 2Z0ZA 4LX9A 1Z4EA 1WK4A 3T9YA 3WR7A 1YGHA 1Q2CA 2FIWA 4KOVA 4Y49C 1P4NA 4MY3A 2OZGA 4L8AA 2ZW6A 4R87A 4AVAA 3DDDA 3KKWA 4KOWA 1XEBA 1KUXA 3R9FA 2D4OA 2X7BA 3P2FA 4CS0B 2I79A 2FE7A 2P6FA 3B8GA 2IL4A 4KOSA 4F6AA 2J8RA 2FCKA 3QB8A 1FY7A 1YX0A 4KLWA 1L0CA 4E8OA 4R9MA 4E2AA 2HV2A 5IB0A 1S7KA 4OLLA 4CAWA 4ZBGA 5H84A 4M3SA 4DNCA 1RXTA 2DXQA 4HKFA 1YLEA 2A4NA 2R1IA 2OH1A 2Q4YA 1PU9A 4JLYA 2OZUA 4H6UA 1I12A 2G0BA 3DR6A 4XNHC 3D3SA 2ZPAA 3CXSA 3ZZIA 4UWIA 4ONUA 4KVXA 2CNSA 2P0WA 2Q7BA 1Y7RA 1M1DA 4KVOE 4AG9A 2FSRA 1QSOA 4CRYB 1Q2YA 2EVNA 1XMTA 2PRBA 3LODA 2B5GB 3IWGA 4OADA 4YRHA 1B6BA 4MBUA 5C82A 1ON0A 4FD5A 1I1DA 2PR8A 4KOTA 2C27A 4JJXA 3BLNA 4RS2A 1M4DA 3V8IA 4MI4A 5EBVA 3CXPA 3TT2A 4YGOA 4M85A 3F0AA 3DNSA 4JXQA 1Z9UA 5KTCA 2H5MA 2ZW4A 2REEA 3S6GA 2B3UA 5J8FA 2ZW5A 5DWNA 3TFYA 1OZPA 1WWZA 4R57A 4IUSA 2O28A 3TO6A 3EY5A 2VXKA 3H4QA 3PP9A 4ORFA 1S60A 4U5YA 2JDDA 3CXQA 1S7NA 2PDOA 4CAXA 5H86A 3EXNA 3JVNA 5F47A 2WPWA 3TO9A 3S6KA 4I49A 1MK4A 3GKRA 4FD6A 3P2HA 2ZXVA 3D2PA 2K5TA 2Q44A 3EO4A 1TIQA 4KUAA 4MY0A 3K9UA 2I00A 2REFA 4J3GA 3TOAA 1NSLA 2P6GA 1GHEA 1YR0A 1YK3A 4FD4A 2RC4A 4QB9A 4B5OA 2Y0MA 4KOUA 2VBQA 3S6HA 3F8KA 5HH1A 2B58A 2BEIA 2BUEA 2OZHA 4OAEA 4XPDB 3R9EA 5KTDA 1BO4A 1MJAA 2Q0YA 5CNPA 1KUVA 4UBRA 1PUAA 1YVOA 4AVBA 2CNMA 3OWCA 2GE3A 3IGRA 2JEVA 2R8VA 3R95A 1J4JA 3GY9A 3TE4A 4RI1A 3R96A 2CY2A 2NMTA 4GS4A 1XIXA 5E96A 3T90A 3SHPA 4KZTA 1Y9KA 2G3AA 5F46A 3PZJA 1R57A 2HUZA 3F5BA 5DWMA 4II9A 3DR8A 1Q2DA 2CNTA 2FL4A 3FIXA 2PSWA 4E0AA 5IV0A 3EFAA 2JLMA 1P0HA 4FD7A 3UY5A 2B5GA 1IB1E 5JPHA 5ISVA 1QSNA 3FBUA 4UWJA 4XPKA 4KORA 5C88A 2P6EA 4F0YA 4XPLA 3FB3A 1NE9A 1S7LA 2B4DA 1VKCA 4KOYA 4U9ZA 1B87A 4NCZA 4R3KA 3MGDA 4L89A 3BJ7A 3PGPA 3E0KA 2QIRA 1KUYA 4EVYA 3TO7A 1IIDA 2FT0A 1YREA 3VWDA 4AVCA 2D4PA 4HNYB 1S7FA 4NF1A 4PK2A 4PSWA 4R3LA 4XPDC 2OU2A 4H89A 2Z10A 2ARHA 4KUBA 1MJBA 1IYLA 2G3TA 2Z11A 4PSXA 4BMHA 2B4BA 4Y49B 4AB7A 5HMNA 3R9GA 2ATRA 4B5PB 2R98A 4IF5A 4NSQA 3R1KA 1S5KA 2KCWA 4PV6A 3TTHA 2GANA 5F49A 1I21A 4LUAA 3TOBA 4CAVA 2QECA 4KOXA 2J8MA 1QSTA 1XE4A 2F5IA 4JXRA 5F48A 4KVME 3G3SA 1S3ZA 1M4IA 4U9YA 1YVKA 1NMTA 1LRZA 4UA3A 1QSRA 2Q04A 2FIAA 1CJWA 2VI7A 1IYKA 2VQYA 4HNWB 4YFJA 1CM0A 1IICA 3W6XA 5IX3A 1XF8A 1M4GA 3D2MA 4JD6A 1V0CA 2B3VA 1U6MA 4AG7A 1MJ9A 4MJ8A 5JQ4A 3N7ZA 2B4DB 3S6FA 4B5PA 5KTAA 4X5KA 1VHSA 4H6ZA 2OB0A 3VWEA 5GCNA 5FVJA 3FYNA 2QMLA 3TCVA 4QC6A 3JUWA 4KLVA 1N71A 2EUIA 3QAHA 3BJ8A 1QSMA 2BL1A 4NEXA 4QBJA 3FXTA 4QVTA 5I0CA 3SXNA 3SXOA 2BSWA 2PQ8A 3D8PA 3FNCA 3I9SA 2R7HA 2ZW7A 1K4JA 3GYAA 2PR1A 2VZZA 4HNXB 3DSBA 4CRZB 3G8WA 2PC1A 2VEZA 4PK3A 1BOBA 5EC4A 2GIVA 3ZJ0A 2FXFA 5J8CA 4MHDA 3FRMA 4NXYA 2VZYA 2Q4VA 4XNHB 2FS5A 3W6SA 2WPXA 3NE7A 3C26A 1RO5A
chains in the Genus database with same CATH superfamily
1M44A 1KZFA 3EC4A 3KASA 1LAPA 1YMEA 3I3GA 1Y9WA 2J8NA 5JH9A 4ZYQA 1Z4RA 4JWPA 4QUSA 1SQHA 2HQYA 2AJ6A 1CBXA 4K30A 1LANA 3BXMA 2JDCA 3LD2A 4OC2A 4MFPA 5J1QA 4YU9A 2AE6A 5AGEA 3W91A 1PYTB 3WC7A 1UFHA 3RYOA 4ZY0A 2Z0ZA 4LX9A 3B7IA 2WZNA 1Z4EA 1WK4A 3FMCA 3T9YA 3WR7A 1YGHA 1Q2CA 2FIWA 4KOVA 4YWYA 3WC6A 4Y49C 3D7GA 1ARMA 2GU2A 1P4NA 4MY3A 1A2ZA 5F09A 5AG6A 2AFMA 1IOIA 4Z65A 2OZGA 4L8AA 2XEGA 2ZW6A 4R87A 4AVAA 3DDDA 3KKWA 4KOWA 4OC4A 1XEBA 2Q51A 4B12A 4UCMA 2YNCA 2HC9A 1KUXA 4OMEA 3R9FA 2D4OA 2X7BA 3P2FA 4FAIA 4R7MA 4CS0B 5A28A 2I79A 3L2NA 1TXRA 2AFWA 2FE7A 4MXUA 1IU8A 4F9VA 4BINA 4MMOA 2P6FA 3B8GA 4LQGA 2IL4A 3B3CA 4KOSA 3PEIA 3QNVA 1F2OA 2V77A 1R3NA 2PJ5A 3JRUA 4F6AA 1X12A 3H5ZA 4PQAA 3GUXA 2J8RA 2FCKA 3QB8A 3SJFA 1FY7A 4P4FA 3D67A 1YX0A 4KLWA 1L0CA 3NH4A 4E8OA 1F57A 4R9MA 4E2AA 2HV2A 3IC1A 1Z2LA 2PCUA 5IB0A 1S7KA 4OLLA 2GREA 4CAWA 3B3SA 3PRTA 4UCPA 4ZBGA 4M3SA 5H84A 3SJEA 2PE3A 2YNEA 1RXTA 2DEAA 2DXQA 4B11A 4DNCA 2PIZA 2WYRA 4HKFA 2AFXA 1YLEA 2Z3LA 4UFVA 2A4NA 2R1IA 3WC5A 3D7FA 2OH1A 2Q4YA 1PU9A 3PB6X 2ZOGA 4JLYA 2OZUA 4H6UA 1I12A 4PXEA 2G0BA 3DR6A 4MFJA 4XNHC 4H2KA 7CPAA 3KHZA 3D3SA 2NSMA 4MRIA 3PBBA 1XFOA 3KZWA 2ZPAA 1XBUA 3CXSA 3HLPA 4MCPA 4ONUA 4UWIA 3ZZIA 4CYNA 4KVXA 4M6IA 2CNSA 3B3WA 3FEEA 1TF9A 2EBJA 1ZG8A 2EK9A 2P0WA 3D7DA 2Q7BA 1Y7RA 1GYTA 2QYVA 3IWWA 1M1DA 4KVOE 3SI0A 4AG9A 3FX6A 1ZG9A 3PFEA 5K8NA 4KS9A 4NGPA 4JZ0A 2AFZA 2FSRA 3ISZA 5K8MA 1QSOA 3NE8A 4IAVA 4CRYB 4UEEA 1Q2YA 2EVNA 1XMTA 2PRBA 3LODA 4RN7A 1TKHA 4RUHA 2B5GB 3IWGA 4OADA 4YRHA 2J9AA 1B6BA 4MBUA 4GXHA 1ZO0A 5C82A 1ON0A 4FD5A 4A38A 3RNZA 1YQEA 1I1DA 3V38A 1VHOA 2PR8A 3PB9X 3VH9A 5IB9A 4KOTA 2C27A 4JJXA 3BLNA 4RS2A 3IU1A 5LYFA 3TC8A 1M4DA 3KQZA 3KGQA 2ZEEA 3V8IA 4MI4A 5EBVA 3CXPA 1ZLHA 3TT2A 4YGOA 4MHYA 1CG2A 1Z8WA 2IJZA 1BPMA 3F0AA 3DNSA 4M85A 4G1PA 4JXQA 4O23A 2F8HA 1ZLIA 3KI9A 3KR4A 1Z9UA 5KTCA 2H5MA 2ZW4A 4FUUA 2REEA 3S6GA 2HB6A 1HDUA 4ZGYB 2B3UA 1H8LA 2Z3MA 5AG4A 3SJGA 2ANPA 5J8FA 2ZW5A 5DWNA 4PXBA 4PXDA 3TFYA 1OZPA 3RBUA 3B3VA 4UEZA 1WWZA 1AUGA 2EWBA 3K9TA 4P4BA 5G20A 5LRJA 4R57A 2YGWA 4OIDA 1YLOA 4IUSA 4ZX8A 1XMBA 2O28A 3TO6A 2OR4A 1X10A 1ELLP 2PJ0A 3EY5A 2VXKA 4NGQA 1HEEA 4C2ZA 4PPZA 3TX8A 3H4QA 4B14A 1Z5RA 3PP9A 4ORFA 1S60A 3IJ3A 2EK8A 3FH4A 3JTKA 2JDDA 4U5YA 3CXQA 3DLJA 2OOTA 2Z3NA 1S7NA 2PDOA 2ZEDA 1BLLE 4CAXA 2JBJA 5H86A 3NA6A 1R43A 2IMOA 2PJAA 3EXNA 3JVNA 5F47A 4BD9A 2V8VA 4A94A 2O53A 2WPWA 5D29A 5LYIA 3S6KA 1M4LA 3SI2A 3TO9A 2BOAA 4I49A 2C1CA 1MK4A 3N5FA 3GKRA 1QMUA 2C6GA 4CGNA 1YW6A 3T8WA 4FD6A 4UF4A 2EO8A 2ZXVA 2K5TA 2Q44A 2PJ3A 3D2PA 1TIQA 3EO4A 3P2HA 4KUAA 4MFKA 4OKOA 4MY0A 1F2PA 4MHZA 3SJXA 1ZG7A 2DF5A 3K9UA 4CYQA 2F7VA 2I00A 3VATA 4C7IA 5K8OA 2REFA 4J3GA 4Q7AA 5LYDA 3TOAA 1NSLA 4A95A 2P6GA 3KQXA 5LRGA 1GHEA 4ZI6A 1YR0A 2CTBA 1YK3A 5G22A 4FD4A 4A39A 5CPAA 2RC4A 4QB9A 4B5OA 3PBEA 1Q7LA 2PVWA 1LCPA 3B2YA 2V8DA 2Y0MA 1NSAA 4KOUA 4P4EA 4B10A 2VBQA 2PJBA 5K8PA 5HVFA 4DYOA 3S6HA 3F8KA 4KSIA 1CPSA 4ZY2A 3H8EA 5HH1A 5CBMA 2B58A 2BEIA 5DS0A 2BUEA 5JGFA 2OZHA 4OAEA 1JQGA 3KL9A 4XPDB 3R9EA 2PIYA 1ARLA 1BO4A 2RFHA 1MJAA 3BI1A 5KTDA 2Q0YA 5A27A 2GFQA 4CGMA 5CNPA 1KUVA 4UBRA 1PUAA 1YVOA 5EMIA 4TWEA 2POKA 4A32A 1IY7A 2CNMA 2PRQA 3OWCA 5ELYA 1Z8LA 4AVBA 2GE3A 3IGRA 2JEVA 3PFOA 3NH5A 1XJOA 2R8VA 3ISXA 4Q36A 1J4JA 3R95A 4IHMA 2V8GA 3GY9A 4CGOA 4KSFA 3TE4A 4RI1A 5D8NA 3R96A 2C6PA 4OC0A 4CYPA 1Y0YA 2CY2A 2ZELA 1LAMA 2ZEFA 3VWEA 2NMTA 4GS4A 2DPSA 2CF4A 4KSAA 3WABA 4AXVA 4CGPA 1XIXA 4UFXA 5E96A 2IQ6A 4NGTA 3T90A 3SHPA 4ZY1A 4X2TA 4CAEA 1DTDA 4KZTA 4R76A 3RZAA 1Y9KA 1LFWA 4MFZA 3KR5A 3S9LA 2G3AA 5F46A 4TNUA 2ZEPA 3PZJA 1R57A 4CYOA 2Z3KA 2HUZA 4PXCA 3V7ZA 3F5BA 4R8FA 2ZEOA 2XEIA 2JEWA 4MFLA 5DWMA 3SI1A 3QAYA 4II9A 3DR8A 1Q2DA 2CNTA 2FL4A 3FIXA 2PSWA 3MN8A 4E0AA 4F9UA 2PJ6A 4X3RA 3IO1A 5IV0A 2JBKA 4OC3A 1XOVA 2JLMA 3EFAA 1EE3P 3WT4A 3FECA 3LMSA 1P0HA 4FD7A 3UY5A 2B5GA 3H8GA 1IB1E 4B6ZA 5JPHA 2G9DA 4WWVA 5ISVA 1QSNA 1LOKA 2RB7A 3FBUA 4UWJA 4XPKA 4KORA 5C88A 1OBRA 2P6EA 2ZOFA 4EWTA 4F0YA 5AG5A 4XPLA 2BO9A 2DPTA 2I3CA 3A9LA 4NGRA 2O4HA 3D66A 1NE9A 3CPAA 1S7LA 3FB3A 2B4DA 5G21A 1VKCA 4KOYA 4U9ZA 1B87A 1BAVA 2Z3PA 3GLJA 1CP7A 1YSJA 4NCZA 4NFRA 4NGSA 4R3KA 4UFWA 4C2YA 3MGDA 4A2ZA 4ONWA 4L89A 4CPAA 2CXAA 3VARA 4EFDA 3IEHA 1KWMA 3BJ7A 2QVPA 3PGPA 4P4IA 3E0KA 2QIRA 4FWUA 1KUYA 3PB7X 4EVYA 1ELMP 4MHPA 3TO7A 3CDXA 1IIDA 2FT0A 4DJLA 4F8ZA 1YREA 4UCNA 2AFSA 2D4PA 3VWDA 4AVCA 2FVGA 1S7FA 4HNYB 4NF1A 3CPXA 1UWYA 4PK2A 2C6CA 3DGVA 4PSWA 4R3LA 4XPDC 3PB8X 2OU2A 4H89A 2ODFA 2Z10A 2ARHA 2GLJA 4GM5A 2XEJA 4KUBA 1MJBA 1IYLA 4C68A 8CPAA 2G3TA 2Z11A 4PSXA 2GLFA 4M6HA 5HXDA 1AYEA 4F0XA 4P45A 4BMHA 4A37A 2B4BA 4NJQA 4Y49B 4AB7A 4CAFA 5HMNA 5JM6A 3R9GA 3CT9A 4IK2A 2AFOA 2ATRA 1BPNA 3IU2A 4B5PB 2R98A 5BWAB 2PJ2A 4IF5A 4NSQA 3R1KA 1S5KA 2XEFA 3D7HA 2KCWA 4JYWA 4PV6A 5G1ZA 3RO0A 3TTHA 4P4DA 2GANA 2ZEMA 5F49A 3MRUA 1I21A 4NGNA 4UIBA 5THWA 4LUAA 2PVVA 3TOBA 4CAVA 1CPXA 2QECA 4KOXA 2CIJA 1JWQA 2J8MA 1QSTA 2PJCA 1XE4A 4K3NA 4C2XA 2F5IA 2ZEGA 2PJ7A 4MCQA 2VL1A 1IGBA 4JXRA 4P44A 5F48A 3B3TA 3GIUA 4KVME 1CP6A 3G3SA 1IOFA 2WUUA 2V8HA 3BI0A 6CPAA 2AFUA 3FEDA 2PJ8A 4A30A 1S3ZA 1M4IA 1QQ9A 4U9YA 5I4MA 1YVKA 1NMTA 1LRZA 4UA3A 1QSRA 3IIBA 2Q04A 3KHXA 2FIAA 3RAMA 1CJWA 2VI7A 1IYKA 1Y7EA 2VQYA 4HNWB 3S9NA 4HPSA 4YFJA 4W9YA 1CM0A 1IICA 3W6XA 5IX3A 1XF8A 1M4GA 3D2MA 1XRYA 2NYQA 3FF3A 4JD6A 1Y0RA 5AG7A 1VGYA 4M6GA 1TKJA 1V0CA 4ZX9A 4CGLA 2B3VA 4MCSA 4C7HA 1U6MA 2Q4ZA 3H8FA 3FJUA 3LWUA 4AG7A 5HVGA 1CX8A 1MJ9A 1RTQA 4MJ8A 3B35A 5JQ4A 5LRKA 2ABZA 2Q7SA 3N7ZA 4A33A 5LYLA 2PJ4A 2B4DB 5HVHA 4DUKA 4OP4A 3S6FA 3CZXA 4B5PA 2PJ1A 5KTAA 4LQ6A 1DE4C 1VHSA 4X5KA 2WSAA 3GB0A 3LACA 2QJ8A 2OB0A 3BHXA 4H6ZA 3K2KA 4Q38A 2YNCC 5FVJA 3FYNA 3PB4X 5GCNA 3NFZA 2QMLA 3TCVA 4QC6A 4MCRA 3JUWA 4KLVA 1N71A 2EUIA 3QAHA 4P10A 3BJ8A 4NJRA 2ZENA 4UEFA 1QSMA 2BCOA 2BL1A 4NEXA 4QBJA 1Z8XA 3FXTA 2PJ9A 4P6YA 4A31A 3D68A 3I1UA 4WJBA 4QVTA 3IFEA 5I0CA 3SXNA 3SXOA 4X8IA 4MHNA 1FNOA 4MFQA 2BSWA 2PQ8A 3D8PA 4FBEA 1TKFA 3FNCA 3NH8A 4OC1A 1TF8A 3FVLA 3I9SA 2R7HA 2ZW7A 1K4JA 2Z3OA 4OC5A 1PCAA 2ZEHA 3GYAA 3HUVA 2PR1A 4UIAA 4B13A 1HDQA 2VZZA 4HNXB 3DSBA 4OIWA 1Z8TA 3G8WA 4CRZB 2PC1A 2VEZA 1FT7A 4PK3A 1BOBA 5EC4A 2GIVA 2YNDA 3D4UA 3ZJ0A 1YW4A 2FXFA 5J8CA 2CTCA 4MHDA 3FRMA 4EMEA 4NXYA 2VZYA 1VHEA 4R6TA 2Q4VA 4XNHB 2FS5A 1AMPA 4NGMA 4BBHA 3W6SA 2WPXA 1VIXA 3NE7A 3C26A 4P4JA 1RO5A 3S9MA 2Q43A 3IWEA
chains in the Genus database with same CATH topology
1M44A 1KZFA 3EC4A 3I3GA 1Y9WA 2J8NA 1Z4RA 4JWPA 4QUSA 1SQHA 2HQYA 2AJ6A 4K30A 2JDCA 3LD2A 4MFPA 2AE6A 5AGEA 3W91A 1UFHA 3RYOA 2Z0ZA 4LX9A 1Z4EA 1WK4A 3T9YA 3WR7A 1YGHA 1Q2CA 2FIWA 4KOVA 4Y49C 1P4NA 4MY3A 5AG6A 2OZGA 4L8AA 2ZW6A 4R87A 4AVAA 3DDDA 3KKWA 4KOWA 4B12A 1XEBA 4UCMA 2YNCA 1KUXA 3R9FA 2D4OA 2X7BA 3P2FA 5A28A 4CS0B 2I79A 2FE7A 2P6FA 3B8GA 2IL4A 4KOSA 4F6AA 3H5ZA 2J8RA 2FCKA 3QB8A 1FY7A 1YX0A 4KLWA 1L0CA 4E8OA 4R9MA 4E2AA 2HV2A 5IB0A 1S7KA 4OLLA 4CAWA 4UCPA 4ZBGA 5H84A 4M3SA 4B11A 4DNCA 2YNEA 1RXTA 2DXQA 4HKFA 1YLEA 2Z3LA 4UFVA 2A4NA 2R1IA 2OH1A 2Q4YA 1PU9A 4JLYA 2OZUA 4H6UA 1I12A 2G0BA 3DR6A 4MFJA 4XNHC 3D3SA 2ZPAA 3CXSA 3ZZIA 4CYNA 4UWIA 4ONUA 4KVXA 2CNSA 2P0WA 2Q7BA 1Y7RA 1M1DA 4KVOE 4AG9A 4KS9A 2FSRA 1QSOA 4CRYB 1Q2YA 2EVNA 1XMTA 3LODA 2PRBA 2B5GB 3IWGA 4OADA 4YRHA 1B6BA 4MBUA 1ZO0A 5C82A 1ON0A 4FD5A 1I1DA 2PR8A 4KOTA 2C27A 4JJXA 3BLNA 4RS2A 3IU1A 1M4DA 3V8IA 4MI4A 5EBVA 3CXPA 3TT2A 4YGOA 4M85A 3F0AA 3DNSA 4JXQA 1Z9UA 5KTCA 2H5MA 2ZW4A 2REEA 3S6GA 4ZGYB 2B3UA 2Z3MA 5AG4A 5J8FA 2ZW5A 5DWNA 3TFYA 1OZPA 1WWZA 5G20A 4R57A 2YGWA 4IUSA 2O28A 3TO6A 3EY5A 2VXKA 4C2ZA 3H4QA 4B14A 3PP9A 4ORFA 1S60A 3JTKA 2JDDA 4U5YA 3CXQA 2Z3NA 1S7NA 2PDOA 4CAXA 5H86A 3EXNA 3JVNA 5F47A 2WPWA 3TO9A 3S6KA 4I49A 1MK4A 3GKRA 4CGNA 4FD6A 3P2HA 2ZXVA 3D2PA 4MFKA 2K5TA 2Q44A 3EO4A 1TIQA 4KUAA 4MY0A 3K9UA 4CYQA 2I00A 4C7IA 2REFA 4J3GA 3TOAA 1NSLA 4A95A 2P6GA 1GHEA 1YR0A 5G22A 1YK3A 4FD4A 2RC4A 4QB9A 4B5OA 2Y0MA 4B10A 4KOUA 2VBQA 3S6HA 3F8KA 5HH1A 2B58A 2BEIA 2BUEA 2OZHA 4OAEA 4XPDB 3R9EA 5KTDA 1BO4A 1MJAA 2Q0YA 5A27A 5CNPA 1KUVA 4UBRA 1PUAA 1YVOA 4A32A 4AVBA 2CNMA 3OWCA 4CGMA 2GE3A 3IGRA 2JEVA 2R8VA 4Q36A 3R95A 1J4JA 3GY9A 4CGOA 4KSFA 3TE4A 4RI1A 3R96A 4CYPA 2CY2A 2NMTA 4GS4A 2DPSA 4KSAA 4CGPA 1XIXA 4UFXA 5E96A 3T90A 3SHPA 4CAEA 4KZTA 1Y9KA 4MFZA 2G3AA 5F46A 3PZJA 1R57A 4CYOA 2Z3KA 2HUZA 3F5BA 4MFLA 5DWMA 4II9A 3DR8A 1Q2DA 2CNTA 2FL4A 3FIXA 2PSWA 4E0AA 5IV0A 3EFAA 2JLMA 1P0HA 4FD7A 3UY5A 2B5GA 1IB1E 5JPHA 5ISVA 1QSNA 3FBUA 4UWJA 4XPKA 4KORA 5C88A 2P6EA 4F0YA 5AG5A 4XPLA 2DPTA 3A9LA 3FB3A 1NE9A 1S7LA 2B4DA 5G21A 1VKCA 4KOYA 4U9ZA 1B87A 2Z3PA 4NCZA 4UFWA 4C2YA 4R3KA 3MGDA 4A2ZA 4L89A 2CXAA 3BJ7A 3PGPA 3E0KA 2QIRA 1KUYA 4EVYA 3TO7A 1IIDA 2FT0A 1YREA 4UCNA 3VWDA 2D4PA 4AVCA 4HNYB 1S7FA 4NF1A 4PK2A 4PSWA 4R3LA 4XPDC 4H89A 2OU2A 2Z10A 2ARHA 4KUBA 1MJBA 1IYLA 4C68A 2G3TA 2Z11A 4PSXA 4F0XA 4BMHA 2B4BA 4Y49B 4AB7A 5HMNA 4CAFA 3R9GA 2ATRA 3IU2A 4B5PB 2R98A 5BWAB 4IF5A 4NSQA 3R1KA 1S5KA 2KCWA 4PV6A 5G1ZA 3TTHA 2GANA 5F49A 1I21A 4LUAA 3TOBA 4CAVA 2QECA 4KOXA 2J8MA 1QSTA 1XE4A 4C2XA 2F5IA 4JXRA 5F48A 4KVME 3G3SA 2WUUA 4A30A 1S3ZA 1M4IA 4U9YA 1YVKA 1NMTA 1LRZA 4UA3A 1QSRA 2Q04A 2FIAA 1CJWA 2VI7A 1IYKA 2VQYA 4HNWB 4YFJA 1CM0A 1IICA 3W6XA 5IX3A 1XF8A 1M4GA 3D2MA 4JD6A 5AG7A 4CGLA 1V0CA 2B3VA 4C7HA 1U6MA 4AG7A 1MJ9A 4MJ8A 5JQ4A 4A33A 3N7ZA 2B4DB 3S6FA 4B5PA 5KTAA 4X5KA 1VHSA 2WSAA 4H6ZA 2OB0A 3VWEA 4Q38A 2YNCC 5FVJA 3FYNA 5GCNA 2QMLA 3TCVA 4QC6A 3JUWA 4KLVA 1N71A 2EUIA 3QAHA 3BJ8A 1QSMA 2BL1A 4NEXA 4QBJA 3FXTA 4A31A 4QVTA 5I0CA 3SXNA 3SXOA 4MFQA 2BSWA 2PQ8A 3D8PA 3FNCA 3I9SA 2R7HA 2ZW7A 1K4JA 2Z3OA 3GYAA 2PR1A 4B13A 2VZZA 4HNXB 3DSBA 4CRZB 3G8WA 2PC1A 2VEZA 4PK3A 1BOBA 5EC4A 2GIVA 2YNDA 3ZJ0A 2FXFA 5J8CA 4MHDA 3FRMA 4NXYA 2VZYA 2Q4VA 4XNHB 2FS5A 4BBHA 3W6SA 2WPXA 3NE7A 3C26A 1RO5A 3IWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M44 A;  1KZF A;  3EC4 A;  3I3G A;  1Y9W A;  2J8N A;  1Z4R A;  4JWP A;  4QUS A;  1SQH A;  2HQY A;  2AJ6 A;  4K30 A;  2JDC A;  3LD2 A;  2AE6 A;  3W91 A;  1UFH A;  3RYO A;  2Z0Z A;  4LX9 A;  1Z4E A;  1WK4 A;  3T9Y A;  3WR7 A;  1YGH A;  1Q2C A;  2FIW A;  4KOV A;  4Y49 C;  1P4N A;  4MY3 A;  2OZG A;  4L8A A;  2ZW6 A;  4R87 A;  4AVA A;  3DDD A;  3KKW A;  4KOW A;  1XEB A;  1KUX A;  3R9F A;  2D4O A;  2X7B A;  3P2F A;  4CS0 B;  2I79 A;  2FE7 A;  2P6F A;  3B8G A;  2IL4 A;  4KOS A;  4F6A A;  2J8R A;  2FCK A;  3QB8 A;  1FY7 A;  1YX0 A;  4KLW A;  1L0C A;  4E8O A;  4R9M A;  4E2A A;  2HV2 A;  5IB0 A;  1S7K A;  4OLL A;  4CAW A;  4ZBG A;  5H84 A;  4M3S A;  4DNC A;  1RXT A;  2DXQ A;  4HKF A;  1YLE A;  2A4N A;  2R1I A;  2OH1 A;  2Q4Y A;  1PU9 A;  4JLY A;  2OZU A;  4H6U A;  1I12 A;  2G0B A;  3DR6 A;  4XNH C;  3D3S A;  2ZPA A;  3CXS A;  3ZZI A;  4UWI A;  4ONU A;  4KVX A;  2CNS A;  2P0W A;  2Q7B A;  1Y7R A;  1M1D A;  4KVO E;  4AG9 A;  2FSR A;  1QSO A;  4CRY B;  1Q2Y A;  2EVN A;  1XMT A;  2PRB A;  3LOD A;  2B5G B;  3IWG A;  4OAD A;  4YRH A;  1B6B A;  4MBU A;  5C82 A;  1ON0 A;  4FD5 A;  1I1D A;  2PR8 A;  4KOT A;  2C27 A;  4JJX A;  3BLN A;  4RS2 A;  1M4D A;  3V8I A;  4MI4 A;  5EBV A;  3CXP A;  3TT2 A;  4YGO A;  4M85 A;  3F0A A;  3DNS A;  4JXQ A;  1Z9U A;  5KTC A;  2H5M A;  2ZW4 A;  2REE A;  3S6G A;  2B3U A;  5J8F A;  2ZW5 A;  5DWN A;  3TFY A;  1OZP A;  1WWZ A;  4R57 A;  4IUS A;  2O28 A;  3TO6 A;  3EY5 A;  2VXK A;  3H4Q A;  3PP9 A;  4ORF A;  1S60 A;  4U5Y A;  2JDD A;  3CXQ A;  1S7N A;  2PDO A;  4CAX A;  5H86 A;  3EXN A;  3JVN A;  5F47 A;  2WPW A;  3TO9 A;  3S6K A;  4I49 A;  1MK4 A;  3GKR A;  4FD6 A;  3P2H A;  2ZXV A;  3D2P A;  2K5T A;  2Q44 A;  3EO4 A;  1TIQ A;  4KUA A;  4MY0 A;  3K9U A;  2I00 A;  2REF A;  4J3G A;  3TOA A;  1NSL A;  2P6G A;  1GHE A;  1YR0 A;  1YK3 A;  4FD4 A;  2RC4 A;  4QB9 A;  4B5O A;  2Y0M A;  4KOU A;  2VBQ A;  3S6H A;  3F8K A;  5HH1 A;  2B58 A;  2BEI A;  2BUE A;  2OZH A;  4OAE A;  4XPD B;  3R9E A;  5KTD A;  1BO4 A;  1MJA A;  2Q0Y A;  5CNP A;  1KUV A;  4UBR A;  1PUA A;  1YVO A;  4AVB A;  2CNM A;  3OWC A;  2GE3 A;  3IGR A;  2JEV A;  2R8V A;  3R95 A;  1J4J A;  3GY9 A;  3TE4 A;  4RI1 A;  3R96 A;  2CY2 A;  2NMT A;  4GS4 A;  1XIX A;  5E96 A;  3T90 A;  3SHP A;  4KZT A;  1Y9K A;  2G3A A;  5F46 A;  3PZJ A;  1R57 A;  2HUZ A;  3F5B A;  5DWM A;  4II9 A;  3DR8 A;  1Q2D A;  2CNT A;  2FL4 A;  3FIX A;  2PSW A;  4E0A A;  5IV0 A;  3EFA A;  2JLM A;  1P0H A;  4FD7 A;  3UY5 A;  2B5G A;  1IB1 E;  5JPH A;  5ISV A;  1QSN A;  3FBU A;  4UWJ A;  4XPK A;  4KOR A;  5C88 A;  2P6E A;  4F0Y A;  4XPL A;  3FB3 A;  1NE9 A;  1S7L A;  2B4D A;  1VKC A;  4KOY A;  4U9Z A;  1B87 A;  4NCZ A;  4R3K A;  3MGD A;  4L89 A;  3BJ7 A;  3PGP A;  3E0K A;  2QIR A;  1KUY A;  4EVY A;  3TO7 A;  1IID A;  2FT0 A;  1YRE A;  3VWD A;  4AVC A;  2D4P A;  4HNY B;  1S7F A;  4NF1 A;  4PK2 A;  4PSW A;  4R3L A;  4XPD C;  2OU2 A;  4H89 A;  2Z10 A;  2ARH A;  4KUB A;  1MJB A;  1IYL A;  2G3T A;  2Z11 A;  4PSX A;  4BMH A;  2B4B A;  4Y49 B;  4AB7 A;  5HMN A;  3R9G A;  2ATR A;  4B5P B;  2R98 A;  4IF5 A;  4NSQ A;  3R1K A;  1S5K A;  2KCW A;  4PV6 A;  3TTH A;  2GAN A;  5F49 A;  1I21 A;  4LUA A;  3TOB A;  4CAV A;  2QEC A;  4KOX A;  2J8M A;  1QST A;  1XE4 A;  2F5I A;  4JXR A;  5F48 A;  4KVM E;  3G3S A;  1S3Z A;  1M4I A;  4U9Y A;  1YVK A;  1NMT A;  1LRZ A;  4UA3 A;  1QSR A;  2Q04 A;  2FIA A;  1CJW A;  2VI7 A;  1IYK A;  2VQY A;  4HNW B;  4YFJ A;  1CM0 A;  1IIC A;  3W6X A;  5IX3 A;  1XF8 A;  1M4G A;  3D2M A;  4JD6 A;  1V0C A;  2B3V A;  1U6M A;  4AG7 A;  1MJ9 A;  4MJ8 A;  5JQ4 A;  3N7Z A;  2B4D B;  3S6F A;  4B5P A;  5KTA A;  4X5K A;  1VHS A;  4H6Z A;  2OB0 A;  3VWE A;  5GCN A;  5FVJ A;  3FYN A;  2QML A;  3TCV A;  4QC6 A;  3JUW A;  4KLV A;  1N71 A;  2EUI A;  3QAH A;  3BJ8 A;  1QSM A;  2BL1 A;  4NEX A;  4QBJ A;  3FXT A;  4QVT A;  5I0C A;  3SXN A;  3SXO A;  2BSW A;  2PQ8 A;  3D8P A;  3FNC A;  3I9S A;  2R7H A;  2ZW7 A;  1K4J A;  3GYA A;  2PR1 A;  2VZZ A;  4HNX B;  3DSB A;  4CRZ B;  3G8W A;  2PC1 A;  2VEZ A;  4PK3 A;  1BOB A;  5EC4 A;  2GIV A;  3ZJ0 A;  2FXF A;  5J8C A;  4MHD A;  3FRM A;  4NXY A;  2VZY A;  2Q4V A;  4XNH B;  2FS5 A;  3W6S A;  2WPX A;  3NE7 A;  3C26 A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 1M44 A;  1KZF A;  3EC4 A;  3KAS A;  1LAP A;  1YME A;  3I3G A;  1Y9W A;  2J8N A;  5JH9 A;  4ZYQ A;  1Z4R A;  4JWP A;  4QUS A;  1SQH A;  2HQY A;  2AJ6 A;  1CBX A;  4K30 A;  1LAN A;  3BXM A;  2JDC A;  3LD2 A;  4OC2 A;  4MFP A;  5J1Q A;  4YU9 A;  2AE6 A;  5AGE A;  3W91 A;  1PYT B;  3WC7 A;  1UFH A;  3RYO A;  4ZY0 A;  2Z0Z A;  4LX9 A;  3B7I A;  2WZN A;  1Z4E A;  1WK4 A;  3FMC A;  3T9Y A;  3WR7 A;  1YGH A;  1Q2C A;  2FIW A;  4KOV A;  4YWY A;  3WC6 A;  4Y49 C;  3D7G A;  1ARM A;  2GU2 A;  1P4N A;  4MY3 A;  1A2Z A;  5F09 A;  5AG6 A;  2AFM A;  1IOI A;  4Z65 A;  2OZG A;  4L8A A;  2XEG A;  2ZW6 A;  4R87 A;  4AVA A;  3DDD A;  3KKW A;  4KOW A;  4OC4 A;  1XEB A;  2Q51 A;  4B12 A;  4UCM A;  2YNC A;  2HC9 A;  1KUX A;  4OME A;  3R9F A;  2D4O A;  2X7B A;  3P2F A;  4FAI A;  4R7M A;  4CS0 B;  5A28 A;  2I79 A;  3L2N A;  1TXR A;  2AFW A;  2FE7 A;  4MXU A;  1IU8 A;  4F9V A;  4BIN A;  4MMO A;  2P6F A;  3B8G A;  4LQG A;  2IL4 A;  3B3C A;  4KOS A;  3PEI A;  3QNV A;  1F2O A;  2V77 A;  1R3N A;  2PJ5 A;  3JRU A;  4F6A A;  1X12 A;  3H5Z A;  4PQA A;  3GUX A;  2J8R A;  2FCK A;  3QB8 A;  3SJF A;  1FY7 A;  4P4F A;  3D67 A;  1YX0 A;  4KLW A;  1L0C A;  3NH4 A;  4E8O A;  1F57 A;  4R9M A;  4E2A A;  2HV2 A;  3IC1 A;  1Z2L A;  2PCU A;  5IB0 A;  1S7K A;  4OLL A;  2GRE A;  4CAW A;  3B3S A;  3PRT A;  4UCP A;  4ZBG A;  4M3S A;  5H84 A;  3SJE A;  2PE3 A;  2YNE A;  1RXT A;  2DEA A;  2DXQ A;  4B11 A;  4DNC A;  2PIZ A;  2WYR A;  4HKF A;  2AFX A;  1YLE A;  2Z3L A;  4UFV A;  2A4N A;  2R1I A;  3WC5 A;  3D7F A;  2OH1 A;  2Q4Y A;  1PU9 A;  3PB6 X;  2ZOG A;  4JLY A;  2OZU A;  4H6U A;  1I12 A;  4PXE A;  2G0B A;  3DR6 A;  4MFJ A;  4XNH C;  4H2K A;  7CPA A;  3KHZ A;  3D3S A;  2NSM A;  4MRI A;  3PBB A;  1XFO A;  3KZW A;  2ZPA A;  1XBU A;  3CXS A;  3HLP A;  4MCP A;  4ONU A;  4UWI A;  3ZZI A;  4CYN A;  4KVX A;  4M6I A;  2CNS A;  3B3W A;  3FEE A;  1TF9 A;  2EBJ A;  1ZG8 A;  2EK9 A;  2P0W A;  3D7D A;  2Q7B A;  1Y7R A;  1GYT A;  2QYV A;  3IWW A;  1M1D A;  4KVO E;  3SI0 A;  4AG9 A;  3FX6 A;  1ZG9 A;  3PFE A;  5K8N A;  4KS9 A;  4NGP A;  4JZ0 A;  2AFZ A;  2FSR A;  3ISZ A;  5K8M A;  1QSO A;  3NE8 A;  4IAV A;  4CRY B;  4UEE A;  1Q2Y A;  2EVN A;  1XMT A;  2PRB A;  3LOD A;  4RN7 A;  1TKH A;  4RUH A;  2B5G B;  3IWG A;  4OAD A;  4YRH A;  2J9A A;  1B6B A;  4MBU A;  4GXH A;  1ZO0 A;  5C82 A;  1ON0 A;  4FD5 A;  4A38 A;  3RNZ A;  1YQE A;  1I1D A;  3V38 A;  1VHO A;  2PR8 A;  3PB9 X;  3VH9 A;  5IB9 A;  4KOT A;  2C27 A;  4JJX A;  3BLN A;  4RS2 A;  3IU1 A;  5LYF A;  3TC8 A;  1M4D A;  3KQZ A;  3KGQ A;  2ZEE A;  3V8I A;  4MI4 A;  5EBV A;  3CXP A;  1ZLH A;  3TT2 A;  4YGO A;  4MHY A;  1CG2 A;  1Z8W A;  2IJZ A;  1BPM A;  3F0A A;  3DNS A;  4M85 A;  4G1P A;  4JXQ A;  4O23 A;  2F8H A;  1ZLI A;  3KI9 A;  3KR4 A;  1Z9U A;  5KTC A;  2H5M A;  2ZW4 A;  4FUU A;  2REE A;  3S6G A;  2HB6 A;  1HDU A;  4ZGY B;  2B3U A;  1H8L A;  2Z3M A;  5AG4 A;  3SJG A;  2ANP A;  5J8F A;  2ZW5 A;  5DWN A;  4PXB A;  4PXD A;  3TFY A;  1OZP A;  3RBU A;  3B3V A;  4UEZ A;  1WWZ A;  1AUG A;  2EWB A;  3K9T A;  4P4B A;  5G20 A;  5LRJ A;  4R57 A;  2YGW A;  4OID A;  1YLO A;  4IUS A;  4ZX8 A;  1XMB A;  2O28 A;  3TO6 A;  2OR4 A;  1X10 A;  1ELL P;  2PJ0 A;  3EY5 A;  2VXK A;  4NGQ A;  1HEE A;  4C2Z A;  4PPZ A;  3TX8 A;  3H4Q A;  4B14 A;  1Z5R A;  3PP9 A;  4ORF A;  1S60 A;  3IJ3 A;  2EK8 A;  3FH4 A;  3JTK A;  2JDD A;  4U5Y A;  3CXQ A;  3DLJ A;  2OOT A;  2Z3N A;  1S7N A;  2PDO A;  2ZED A;  1BLL E;  4CAX A;  2JBJ A;  5H86 A;  3NA6 A;  1R43 A;  2IMO A;  2PJA A;  3EXN A;  3JVN A;  5F47 A;  4BD9 A;  2V8V A;  4A94 A;  2O53 A;  2WPW A;  5D29 A;  5LYI A;  3S6K A;  1M4L A;  3SI2 A;  3TO9 A;  2BOA A;  4I49 A;  2C1C A;  1MK4 A;  3N5F A;  3GKR A;  1QMU A;  2C6G A;  4CGN A;  1YW6 A;  3T8W A;  4FD6 A;  4UF4 A;  2EO8 A;  2ZXV A;  2K5T A;  2Q44 A;  2PJ3 A;  3D2P A;  1TIQ A;  3EO4 A;  3P2H A;  4KUA A;  4MFK A;  4OKO A;  4MY0 A;  1F2P A;  4MHZ A;  3SJX A;  1ZG7 A;  2DF5 A;  3K9U A;  4CYQ A;  2F7V A;  2I00 A;  3VAT A;  4C7I A;  5K8O A;  2REF A;  4J3G A;  4Q7A A;  5LYD A;  3TOA A;  1NSL A;  4A95 A;  2P6G A;  3KQX A;  5LRG A;  1GHE A;  4ZI6 A;  1YR0 A;  2CTB A;  1YK3 A;  5G22 A;  4FD4 A;  4A39 A;  5CPA A;  2RC4 A;  4QB9 A;  4B5O A;  3PBE A;  1Q7L A;  2PVW A;  1LCP A;  3B2Y A;  2V8D A;  2Y0M A;  1NSA A;  4KOU A;  4P4E A;  4B10 A;  2VBQ A;  2PJB A;  5K8P A;  5HVF A;  4DYO A;  3S6H A;  3F8K A;  4KSI A;  1CPS A;  4ZY2 A;  3H8E A;  5HH1 A;  5CBM A;  2B58 A;  2BEI A;  5DS0 A;  2BUE A;  5JGF A;  2OZH A;  4OAE A;  1JQG A;  3KL9 A;  4XPD B;  3R9E A;  2PIY A;  1ARL A;  1BO4 A;  2RFH A;  1MJA A;  3BI1 A;  5KTD A;  2Q0Y A;  5A27 A;  2GFQ A;  4CGM A;  5CNP A;  1KUV A;  4UBR A;  1PUA A;  1YVO A;  5EMI A;  4TWE A;  2POK A;  4A32 A;  1IY7 A;  2CNM A;  2PRQ A;  3OWC A;  5ELY A;  1Z8L A;  4AVB A;  2GE3 A;  3IGR A;  2JEV A;  3PFO A;  3NH5 A;  1XJO A;  2R8V A;  3ISX A;  4Q36 A;  1J4J A;  3R95 A;  4IHM A;  2V8G A;  3GY9 A;  4CGO A;  4KSF A;  3TE4 A;  4RI1 A;  5D8N A;  3R96 A;  2C6P A;  4OC0 A;  4CYP A;  1Y0Y A;  2CY2 A;  2ZEL A;  1LAM A;  2ZEF A;  3VWE A;  2NMT A;  4GS4 A;  2DPS A;  2CF4 A;  4KSA A;  3WAB A;  4AXV A;  4CGP A;  1XIX A;  4UFX A;  5E96 A;  2IQ6 A;  4NGT A;  3T90 A;  3SHP A;  4ZY1 A;  4X2T A;  4CAE A;  1DTD A;  4KZT A;  4R76 A;  3RZA A;  1Y9K A;  1LFW A;  4MFZ A;  3KR5 A;  3S9L A;  2G3A A;  5F46 A;  4TNU A;  2ZEP A;  3PZJ A;  1R57 A;  4CYO A;  2Z3K A;  2HUZ A;  4PXC A;  3V7Z A;  3F5B A;  4R8F A;  2ZEO A;  2XEI A;  2JEW A;  4MFL A;  5DWM A;  3SI1 A;  3QAY A;  4II9 A;  3DR8 A;  1Q2D A;  2CNT A;  2FL4 A;  3FIX A;  2PSW A;  3MN8 A;  4E0A A;  4F9U A;  2PJ6 A;  4X3R A;  3IO1 A;  5IV0 A;  2JBK A;  4OC3 A;  1XOV A;  2JLM A;  3EFA A;  1EE3 P;  3WT4 A;  3FEC A;  3LMS A;  1P0H A;  4FD7 A;  3UY5 A;  2B5G A;  3H8G A;  1IB1 E;  4B6Z A;  5JPH A;  2G9D A;  4WWV A;  5ISV A;  1QSN A;  1LOK A;  2RB7 A;  3FBU A;  4UWJ A;  4XPK A;  4KOR A;  5C88 A;  1OBR A;  2P6E A;  2ZOF A;  4EWT A;  4F0Y A;  5AG5 A;  4XPL A;  2BO9 A;  2DPT A;  2I3C A;  3A9L A;  4NGR A;  2O4H A;  3D66 A;  1NE9 A;  3CPA A;  1S7L A;  3FB3 A;  2B4D A;  5G21 A;  1VKC A;  4KOY A;  4U9Z A;  1B87 A;  1BAV A;  2Z3P A;  3GLJ A;  1CP7 A;  1YSJ A;  4NCZ A;  4NFR A;  4NGS A;  4R3K A;  4UFW A;  4C2Y A;  3MGD A;  4A2Z A;  4ONW A;  4L89 A;  4CPA A;  2CXA A;  3VAR A;  4EFD A;  3IEH A;  1KWM A;  3BJ7 A;  2QVP A;  3PGP A;  4P4I A;  3E0K A;  2QIR A;  4FWU A;  1KUY A;  3PB7 X;  4EVY A;  1ELM P;  4MHP A;  3TO7 A;  3CDX A;  1IID A;  2FT0 A;  4DJL A;  4F8Z A;  1YRE A;  4UCN A;  2AFS A;  2D4P A;  3VWD A;  4AVC A;  2FVG A;  1S7F A;  4HNY B;  4NF1 A;  3CPX A;  1UWY A;  4PK2 A;  2C6C A;  3DGV A;  4PSW A;  4R3L A;  4XPD C;  3PB8 X;  2OU2 A;  4H89 A;  2ODF A;  2Z10 A;  2ARH A;  2GLJ A;  4GM5 A;  2XEJ A;  4KUB A;  1MJB A;  1IYL A;  4C68 A;  8CPA A;  2G3T A;  2Z11 A;  4PSX A;  2GLF A;  4M6H A;  5HXD A;  1AYE A;  4F0X A;  4P45 A;  4BMH A;  4A37 A;  2B4B A;  4NJQ A;  4Y49 B;  4AB7 A;  4CAF A;  5HMN A;  5JM6 A;  3R9G A;  3CT9 A;  4IK2 A;  2AFO A;  2ATR A;  1BPN A;  3IU2 A;  4B5P B;  2R98 A;  5BWA B;  2PJ2 A;  4IF5 A;  4NSQ A;  3R1K A;  1S5K A;  2XEF A;  3D7H A;  2KCW A;  4JYW A;  4PV6 A;  5G1Z A;  3RO0 A;  3TTH A;  4P4D A;  2GAN A;  2ZEM A;  5F49 A;  3MRU A;  1I21 A;  4NGN A;  4UIB A;  5THW A;  4LUA A;  2PVV A;  3TOB A;  4CAV A;  1CPX A;  2QEC A;  4KOX A;  2CIJ A;  1JWQ A;  2J8M A;  1QST A;  2PJC A;  1XE4 A;  4K3N A;  4C2X A;  2F5I A;  2ZEG A;  2PJ7 A;  4MCQ A;  2VL1 A;  1IGB A;  4JXR A;  4P44 A;  5F48 A;  3B3T A;  3GIU A;  4KVM E;  1CP6 A;  3G3S A;  1IOF A;  2WUU A;  2V8H A;  3BI0 A;  6CPA A;  2AFU A;  3FED A;  2PJ8 A;  4A30 A;  1S3Z A;  1M4I A;  1QQ9 A;  4U9Y A;  5I4M A;  1YVK A;  1NMT A;  1LRZ A;  4UA3 A;  1QSR A;  3IIB A;  2Q04 A;  3KHX A;  2FIA A;  3RAM A;  1CJW A;  2VI7 A;  1IYK A;  1Y7E A;  2VQY A;  4HNW B;  3S9N A;  4HPS A;  4YFJ A;  4W9Y A;  1CM0 A;  1IIC A;  3W6X A;  5IX3 A;  1XF8 A;  1M4G A;  3D2M A;  1XRY A;  2NYQ A;  3FF3 A;  4JD6 A;  1Y0R A;  5AG7 A;  1VGY A;  4M6G A;  1TKJ A;  1V0C A;  4ZX9 A;  4CGL A;  2B3V A;  4MCS A;  4C7H A;  1U6M A;  2Q4Z A;  3H8F A;  3FJU A;  3LWU A;  4AG7 A;  5HVG A;  1CX8 A;  1MJ9 A;  1RTQ A;  4MJ8 A;  3B35 A;  5JQ4 A;  5LRK A;  2ABZ A;  2Q7S A;  3N7Z A;  4A33 A;  5LYL A;  2PJ4 A;  2B4D B;  5HVH A;  4DUK A;  4OP4 A;  3S6F A;  3CZX A;  4B5P A;  2PJ1 A;  5KTA A;  4LQ6 A;  1DE4 C;  1VHS A;  4X5K A;  2WSA A;  3GB0 A;  3LAC A;  2QJ8 A;  2OB0 A;  3BHX A;  4H6Z A;  3K2K A;  4Q38 A;  2YNC C;  5FVJ A;  3FYN A;  3PB4 X;  5GCN A;  3NFZ A;  2QML A;  3TCV A;  4QC6 A;  4MCR A;  3JUW A;  4KLV A;  1N71 A;  2EUI A;  3QAH A;  4P10 A;  3BJ8 A;  4NJR A;  2ZEN A;  4UEF A;  1QSM A;  2BCO A;  2BL1 A;  4NEX A;  4QBJ A;  1Z8X A;  3FXT A;  2PJ9 A;  4P6Y A;  4A31 A;  3D68 A;  3I1U A;  4WJB A;  4QVT A;  3IFE A;  5I0C A;  3SXN A;  3SXO A;  4X8I A;  4MHN A;  1FNO A;  4MFQ A;  2BSW A;  2PQ8 A;  3D8P A;  4FBE A;  1TKF A;  3FNC A;  3NH8 A;  4OC1 A;  1TF8 A;  3FVL A;  3I9S A;  2R7H A;  2ZW7 A;  1K4J A;  2Z3O A;  4OC5 A;  1PCA A;  2ZEH A;  3GYA A;  3HUV A;  2PR1 A;  4UIA A;  4B13 A;  1HDQ A;  2VZZ A;  4HNX B;  3DSB A;  4OIW A;  1Z8T A;  3G8W A;  4CRZ B;  2PC1 A;  2VEZ A;  1FT7 A;  4PK3 A;  1BOB A;  5EC4 A;  2GIV A;  2YND A;  3D4U A;  3ZJ0 A;  1YW4 A;  2FXF A;  5J8C A;  2CTC A;  4MHD A;  3FRM A;  4EME A;  4NXY A;  2VZY A;  1VHE A;  4R6T A;  2Q4V A;  4XNH B;  2FS5 A;  1AMP A;  4NGM A;  4BBH A;  3W6S A;  2WPX A;  1VIX A;  3NE7 A;  3C26 A;  4P4J A;  1RO5 A;  3S9M A;  2Q43 A;  3IWE A; 
#chains in the Genus database with same CATH homology
 1M44 A;  1KZF A;  3EC4 A;  3I3G A;  1Y9W A;  2J8N A;  1Z4R A;  4JWP A;  4QUS A;  1SQH A;  2HQY A;  2AJ6 A;  4K30 A;  2JDC A;  3LD2 A;  4MFP A;  2AE6 A;  5AGE A;  3W91 A;  1UFH A;  3RYO A;  2Z0Z A;  4LX9 A;  1Z4E A;  1WK4 A;  3T9Y A;  3WR7 A;  1YGH A;  1Q2C A;  2FIW A;  4KOV A;  4Y49 C;  1P4N A;  4MY3 A;  5AG6 A;  2OZG A;  4L8A A;  2ZW6 A;  4R87 A;  4AVA A;  3DDD A;  3KKW A;  4KOW A;  4B12 A;  1XEB A;  4UCM A;  2YNC A;  1KUX A;  3R9F A;  2D4O A;  2X7B A;  3P2F A;  5A28 A;  4CS0 B;  2I79 A;  2FE7 A;  2P6F A;  3B8G A;  2IL4 A;  4KOS A;  4F6A A;  3H5Z A;  2J8R A;  2FCK A;  3QB8 A;  1FY7 A;  1YX0 A;  4KLW A;  1L0C A;  4E8O A;  4R9M A;  4E2A A;  2HV2 A;  5IB0 A;  1S7K A;  4OLL A;  4CAW A;  4UCP A;  4ZBG A;  5H84 A;  4M3S A;  4B11 A;  4DNC A;  2YNE A;  1RXT A;  2DXQ A;  4HKF A;  1YLE A;  2Z3L A;  4UFV A;  2A4N A;  2R1I A;  2OH1 A;  2Q4Y A;  1PU9 A;  4JLY A;  2OZU A;  4H6U A;  1I12 A;  2G0B A;  3DR6 A;  4MFJ A;  4XNH C;  3D3S A;  2ZPA A;  3CXS A;  3ZZI A;  4CYN A;  4UWI A;  4ONU A;  4KVX A;  2CNS A;  2P0W A;  2Q7B A;  1Y7R A;  1M1D A;  4KVO E;  4AG9 A;  4KS9 A;  2FSR A;  1QSO A;  4CRY B;  1Q2Y A;  2EVN A;  1XMT A;  3LOD A;  2PRB A;  2B5G B;  3IWG A;  4OAD A;  4YRH A;  1B6B A;  4MBU A;  1ZO0 A;  5C82 A;  1ON0 A;  4FD5 A;  1I1D A;  2PR8 A;  4KOT A;  2C27 A;  4JJX A;  3BLN A;  4RS2 A;  3IU1 A;  1M4D A;  3V8I A;  4MI4 A;  5EBV A;  3CXP A;  3TT2 A;  4YGO A;  4M85 A;  3F0A A;  3DNS A;  4JXQ A;  1Z9U A;  5KTC A;  2H5M A;  2ZW4 A;  2REE A;  3S6G A;  4ZGY B;  2B3U A;  2Z3M A;  5AG4 A;  5J8F A;  2ZW5 A;  5DWN A;  3TFY A;  1OZP A;  1WWZ A;  5G20 A;  4R57 A;  2YGW A;  4IUS A;  2O28 A;  3TO6 A;  3EY5 A;  2VXK A;  4C2Z A;  3H4Q A;  4B14 A;  3PP9 A;  4ORF A;  1S60 A;  3JTK A;  2JDD A;  4U5Y A;  3CXQ A;  2Z3N A;  1S7N A;  2PDO A;  4CAX A;  5H86 A;  3EXN A;  3JVN A;  5F47 A;  2WPW A;  3TO9 A;  3S6K A;  4I49 A;  1MK4 A;  3GKR A;  4CGN A;  4FD6 A;  3P2H A;  2ZXV A;  3D2P A;  4MFK A;  2K5T A;  2Q44 A;  3EO4 A;  1TIQ A;  4KUA A;  4MY0 A;  3K9U A;  4CYQ A;  2I00 A;  4C7I A;  2REF A;  4J3G A;  3TOA A;  1NSL A;  4A95 A;  2P6G A;  1GHE A;  1YR0 A;  5G22 A;  1YK3 A;  4FD4 A;  2RC4 A;  4QB9 A;  4B5O A;  2Y0M A;  4B10 A;  4KOU A;  2VBQ A;  3S6H A;  3F8K A;  5HH1 A;  2B58 A;  2BEI A;  2BUE A;  2OZH A;  4OAE A;  4XPD B;  3R9E A;  5KTD A;  1BO4 A;  1MJA A;  2Q0Y A;  5A27 A;  5CNP A;  1KUV A;  4UBR A;  1PUA A;  1YVO A;  4A32 A;  4AVB A;  2CNM A;  3OWC A;  4CGM A;  2GE3 A;  3IGR A;  2JEV A;  2R8V A;  4Q36 A;  3R95 A;  1J4J A;  3GY9 A;  4CGO A;  4KSF A;  3TE4 A;  4RI1 A;  3R96 A;  4CYP A;  2CY2 A;  2NMT A;  4GS4 A;  2DPS A;  4KSA A;  4CGP A;  1XIX A;  4UFX A;  5E96 A;  3T90 A;  3SHP A;  4CAE A;  4KZT A;  1Y9K A;  4MFZ A;  2G3A A;  5F46 A;  3PZJ A;  1R57 A;  4CYO A;  2Z3K A;  2HUZ A;  3F5B A;  4MFL A;  5DWM A;  4II9 A;  3DR8 A;  1Q2D A;  2CNT A;  2FL4 A;  3FIX A;  2PSW A;  4E0A A;  5IV0 A;  3EFA A;  2JLM A;  1P0H A;  4FD7 A;  3UY5 A;  2B5G A;  1IB1 E;  5JPH A;  5ISV A;  1QSN A;  3FBU A;  4UWJ A;  4XPK A;  4KOR A;  5C88 A;  2P6E A;  4F0Y A;  5AG5 A;  4XPL A;  2DPT A;  3A9L A;  3FB3 A;  1NE9 A;  1S7L A;  2B4D A;  5G21 A;  1VKC A;  4KOY A;  4U9Z A;  1B87 A;  2Z3P A;  4NCZ A;  4UFW A;  4C2Y A;  4R3K A;  3MGD A;  4A2Z A;  4L89 A;  2CXA A;  3BJ7 A;  3PGP A;  3E0K A;  2QIR A;  1KUY A;  4EVY A;  3TO7 A;  1IID A;  2FT0 A;  1YRE A;  4UCN A;  3VWD A;  2D4P A;  4AVC A;  4HNY B;  1S7F A;  4NF1 A;  4PK2 A;  4PSW A;  4R3L A;  4XPD C;  4H89 A;  2OU2 A;  2Z10 A;  2ARH A;  4KUB A;  1MJB A;  1IYL A;  4C68 A;  2G3T A;  2Z11 A;  4PSX A;  4F0X A;  4BMH A;  2B4B A;  4Y49 B;  4AB7 A;  5HMN A;  4CAF A;  3R9G A;  2ATR A;  3IU2 A;  4B5P B;  2R98 A;  5BWA B;  4IF5 A;  4NSQ A;  3R1K A;  1S5K A;  2KCW A;  4PV6 A;  5G1Z A;  3TTH A;  2GAN A;  5F49 A;  1I21 A;  4LUA A;  3TOB A;  4CAV A;  2QEC A;  4KOX A;  2J8M A;  1QST A;  1XE4 A;  4C2X A;  2F5I A;  4JXR A;  5F48 A;  4KVM E;  3G3S A;  2WUU A;  4A30 A;  1S3Z A;  1M4I A;  4U9Y A;  1YVK A;  1NMT A;  1LRZ A;  4UA3 A;  1QSR A;  2Q04 A;  2FIA A;  1CJW A;  2VI7 A;  1IYK A;  2VQY A;  4HNW B;  4YFJ A;  1CM0 A;  1IIC A;  3W6X A;  5IX3 A;  1XF8 A;  1M4G A;  3D2M A;  4JD6 A;  5AG7 A;  4CGL A;  1V0C A;  2B3V A;  4C7H A;  1U6M A;  4AG7 A;  1MJ9 A;  4MJ8 A;  5JQ4 A;  4A33 A;  3N7Z A;  2B4D B;  3S6F A;  4B5P A;  5KTA A;  4X5K A;  1VHS A;  2WSA A;  4H6Z A;  2OB0 A;  3VWE A;  4Q38 A;  2YNC C;  5FVJ A;  3FYN A;  5GCN A;  2QML A;  3TCV A;  4QC6 A;  3JUW A;  4KLV A;  1N71 A;  2EUI A;  3QAH A;  3BJ8 A;  1QSM A;  2BL1 A;  4NEX A;  4QBJ A;  3FXT A;  4A31 A;  4QVT A;  5I0C A;  3SXN A;  3SXO A;  4MFQ A;  2BSW A;  2PQ8 A;  3D8P A;  3FNC A;  3I9S A;  2R7H A;  2ZW7 A;  1K4J A;  2Z3O A;  3GYA A;  2PR1 A;  4B13 A;  2VZZ A;  4HNX B;  3DSB A;  4CRZ B;  3G8W A;  2PC1 A;  2VEZ A;  4PK3 A;  1BOB A;  5EC4 A;  2GIV A;  2YND A;  3ZJ0 A;  2FXF A;  5J8C A;  4MHD A;  3FRM A;  4NXY A;  2VZY A;  2Q4V A;  4XNH B;  2FS5 A;  4BBH A;  3W6S A;  2WPX A;  3NE7 A;  3C26 A;  1RO5 A;  3IWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...