4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
4KOVA 3EXNA 4XPLA 1S3ZA 4MY3A 3R9GA 2FIWA 2FT0A 3I3GA 2C27A 4XNHB 2A4NA 3WR7A 3D3SA 1NMTA 3ZJ0A 2P0WA 2JDCA 2K5TA 2FSRA 4E2AA 4MHDA 2VI7A 1MK4A 4KLVA 1GHEA 4CAWA 4H89A 4AG9A 1QSTA 2AE6A 4HNWB 1BO4A 4RI1A 3TTHA 1MJAA 3GYAA 4U5YA 3IWGA 2WPXA 2ZXVA 5JPHA 3H4QA 2B58A 5IX3A 1Z4RA 4JD6A 2VBQA 3P2HA 3CXSA 3JVNA 2OH1A 4XPKA 4B5PB 1S5KA 2Q4VA 5HH1A 5F46A 5H84A 5EC4A 1PU9A 2Q0YA 1FY7A 3T90A 4M3SA 2PR8A 2I79A 4HNYB 4ONUA 4AVAA 2Q04A 3QB8A 4R3KA 4ZBGA 3F8KA 2IL4A 2ZW5A 4QB9A 1Q2CA 5DWNA 1QSMA 1YLEA 4NSQA 2D4OA 2R98A 3C26A 2RC4A 2NMTA 4U9YA 3TFYA 5GCNA 2REEA 3D2MA 2GE3A 4UWIA 2G3AA 4LUAA 4HNXB 3S6KA 4UA3A 1RO5A 2G3TA 1M4DA 4MI4A 3OWCA 1K4JA 1VKCA 4FD6A 4KVME 5JQ4A 4IF5A 3R95A 2B4DB 3RYOA 2Z11A 1YGHA 1YVOA 2PRBA 3PZJA 3D8PA 3MGDA 4OADA 5J8CA 4Y49C 5I0CA 1IB1E 3TOAA 2BUEA 1RXTA 3FB3A 1M44A 5H86A 4KORA 3GY9A 3FYNA 2F5IA 3SHPA 2AJ6A 4F0YA 2EVNA 2CNMA 3K9UA 4KOSA 2GIVA 4PK3A 2OZHA 3CXPA 1S7LA 1YREA 2ZW7A 3FBUA 2PSWA 3B8GA 3R9FA 2B3VA 4R9MA 2BL1A 3NE7A 3TO6A 4AB7A 2VXKA 4XPDB 4JXQA 4JXRA 5IV0A 4NCZA 5KTCA 3W6XA 2EUIA 1Y9KA 1P0HA 4RS2A 3W91A 4CS0B 1M4IA 4QUSA 4JWPA 1VHSA 3TO7A 1QSOA 2VZYA 1YR0A 4U9ZA 1N71A 2OZUA 4I49A 3G3SA 4KZTA 2PDOA 2P6EA 1S7FA 4Y49B 4HKFA 3V8IA 1Z4EA 1NE9A 2J8RA 1YX0A 4QC6A 2HQYA 5KTDA 2JDDA 3EO4A 4QBJA 2ZW6A 2KCWA 4CAVA 1IICA 3S6FA 2BSWA 3FIXA 1NSLA 4II9A 2G0BA 2J8NA 4ORFA 2B5GA 4OLLA 1Y7RA 3CXQA 3DDDA 4EVYA 3S6HA 4QVTA 4UWJA 5EBVA 2P6FA 2R1IA 4B5PA 5J8FA 3BJ8A 3JUWA 2H5MA 4NF1A 1R57A 3G8WA 1XF8A 1KUYA 3FRMA 2FL4A 3FNCA 4BMHA 2FXFA 1CM0A 4E8OA 3BLNA 3R96A 3D2PA 2ARHA 3DR6A 1IYKA 3R9EA 5F48A 1PUAA 4UBRA 3KKWA 2VEZA 1BOBA 4PSWA 2JLMA 1B6BA 4F6AA 1TIQA 4CAXA 1ON0A 1XIXA 4FD7A 2B4BA 4R87A 1OZPA 2Z0ZA 4H6UA 4H6ZA 4KOYA 4MY0A 3E0KA 4DNCA 5KTAA 4KOTA 5F49A 3LODA 3FXTA 1V0CA 4NEXA 2OZGA 1LRZA 3R1KA 4R3LA 1Q2YA 2PC1A 1XEBA 1KZFA 5E96A 3DNSA 1CJWA 2QMLA 1MJ9A 2B4DA 2Q44A 4CRZB 2Y0MA 2X7BA 4KVOE 2ZW4A 1M1DA 1QSRA 2Q4YA 2D4PA 3DSBA 1J4JA 4KOXA 4FD4A 1Q2DA 5ISVA 5C82A 4YFJA 4NXYA 3SXNA 3N7ZA 5F47A 3GKRA 4PSXA 2Z10A 2WPWA 3SXOA 5C88A 4IUSA 1QSNA 4B5OA 4OAEA 4KOWA 4AVBA 4YGOA 2I00A 2CNTA 1KUXA 2JEVA 3F5BA 1M4GA 2DXQA 4AVCA 3PP9A 3VWEA 2FE7A 1L0CA 1S7KA 2ZPAA 2O28A 2P6GA 2VQYA 3TCVA 1SQHA 3QAHA 4KVXA 3ZZIA 1MJBA 4FD5A 4PV6A 2CNSA 4X5KA 2R8VA 4M85A 2FCKA 4MJ8A 1U6MA 2REFA 3UY5A 2R7HA 2B5GB 4KLWA 1XE4A 2FS5A 1Y9WA 2BEIA 4AG7A 2OB0A 3EY5A 2B3UA 1YVKA 1I21A 3EC4A 2J8MA 2FIAA 1Z9UA 1YK3A 3BJ7A 3S6GA 4L89A 2ATRA 5FVJA 1I12A 4R57A 1IIDA 4CRYB 1B87A 1I1DA 4JJXA 3P2FA 2HUZA 5CNPA 5HMNA 4PK2A 4JLYA 3DR8A 2OU2A 3IGRA 3EFAA 4KOUA 2PR1A 4XNHC 4LX9A 1WWZA 2QECA 4XPDC 3TT2A 3TOBA 2QIRA 1IYLA 1P4NA 4GS4A 4YRHA 4J3GA 3VWDA 3T9YA 2VZZA 4L8AA 3TE4A 4K30A 1S7NA 1KUVA 3I9SA 2Q7BA 3LD2A 3TO9A 1UFHA 4KUBA 4KUAA 3W6SA 4E0AA 5IB0A 4MBUA 2PQ8A 1S60A 1XMTA 2CY2A 2GANA 3PGPA 5DWMA 3F0AA 1WK4A 2HV2A
chains in the Genus database with same CATH superfamily
3B3CA 5LYIA 4KOVA 3EXNA 4XPLA 1S3ZA 4MY3A 5D29A 5G21A 4IAVA 5AG5A 3R9GA 5AGEA 2FIWA 2FT0A 2YGWA 3I3GA 4Z65A 2C27A 2EWBA 3PEIA 4XNHB 3CDXA 4P4BA 2A4NA 3WR7A 3D3SA 3H8GA 2O4HA 1NMTA 3IEHA 1F2PA 2P0WA 2ZEDA 1ELMP 2Q51A 2JDCA 4UFWA 3ZJ0A 4F8ZA 5BWAB 2K5TA 3WC7A 2FSRA 4C7HA 3PB6X 4E2AA 1FNOA 4MHDA 2AFUA 2PJ1A 2VI7A 1LANA 5G20A 4EWTA 1MK4A 1DE4C 4KLVA 4P6YA 2PIZA 1GHEA 1Y0RA 1FT7A 4CGNA 4P44A 4CAWA 2YNCC 4H89A 4AG9A 1QSTA 2AE6A 1LAMA 1M4LA 4ZY2A 1VHEA 4HNWB 5ELYA 1ZLHA 1HDUA 1BO4A 1PYTB 3BHXA 3KL9A 1MJAA 4RI1A 3GYAA 3TTHA 5J1QA 1VGYA 2GREA 4F0XA 2PJAA 1RTQA 4U5YA 4UCMA 5G1ZA 1HDQA 4CPAA 3IWGA 4A95A 1Y7EA 2WPXA 4UIBA 2ZXVA 4GXHA 5G22A 3B35A 4F9UA 4W9YA 3KHZA 5JPHA 5I4MA 3H4QA 2B58A 5IX3A 1Z4RA 4PXBA 2PJ8A 4JD6A 4UF4A 4A2ZA 2C1CA 2V8DA 2VBQA 1OBRA 3P2HA 4P4FA 5F09A 3CXSA 3JVNA 2Z3LA 4UCNA 4UEZA 2OH1A 4XPKA 4B5PB 5THWA 5LYLA 1AYEA 1S5KA 4M6HA 2Q4VA 2Z3PA 5HH1A 2HC9A 5F46A 5H84A 5EC4A 1PU9A 2PRQA 3LWUA 2V77A 1JWQA 2C6GA 4CYOA 2Q0YA 1FY7A 3T90A 4M3SA 1TF8A 2PR8A 3JRUA 2JEWA 2I79A 4HNYB 5LRJA 3WC5A 6CPAA 1ZLIA 4ONUA 1ARMA 3JTKA 4AVAA 2RB7A 3ISZA 5HVHA 3PB9X 2Q04A 2WUUA 3QB8A 3IJ3A 3NH4A 4R3KA 3F8KA 4ZBGA 4C2XA 3S9LA 5EMIA 2IL4A 5D8NA 2ZW5A 4K3NA 4QB9A 1Q2CA 5DWNA 1QSMA 1YLEA 4NSQA 2D4OA 1LCPA 4EFDA 4FAIA 2F7VA 1IY7A 2V8HA 2R98A 3C26A 2RC4A 1XBUA 2ZEHA 2NMTA 3LMSA 4U9YA 3TFYA 5GCNA 1YMEA 2REEA 3D2MA 3SI0A 2AFZA 1LOKA 2GE3A 4M6GA 1R3NA 1Z8WA 3B3WA 4UWIA 3HLPA 2G3AA 4LUAA 4HNXB 3PFOA 2AFOA 1IGBA 4MHZA 3S6KA 4UA3A 3RO0A 1CPSA 3H8FA 2QVPA 1RO5A 2G3TA 1CP7A 2V8GA 2Z3OA 1M4DA 4MI4A 3OWCA 1K4JA 2ZEMA 4EMEA 1VKCA 1BPMA 2PCUA 4MFLA 2JBJA 4FD6A 4KVME 3FF3A 5JQ4A 4IF5A 2O53A 4MCRA 3D4UA 3LACA 4NJRA 3R95A 2B4DB 1IU8A 4KSFA 4OC2A 3RYOA 1BPNA 4H2KA 2Z11A 3VATA 4B14A 3CPXA 4CYPA 4C2ZA 3KQXA 1YGHA 1YVOA 2PRBA 3PZJA 4Q36A 3D8PA 3MGDA 4P4EA 1Z2LA 4OADA 5J8CA 4Y49C 5I0CA 1IB1E 1F2OA 3TOAA 2POKA 5HXDA 3DLJA 2CTCA 2BUEA 1RXTA 4RUHA 3FB3A 1M44A 5H86A 4CYNA 2ODFA 3GY9A 4KORA 4JZ0A 3FYNA 1DTDA 2F5IA 3SHPA 1XOVA 2ANPA 4DJLA 2AJ6A 2EO8A 4F0YA 2Z3KA 2EVNA 4UIAA 2YNDA 4PQAA 2PE3A 5A28A 2CNMA 5JH9A 3K9UA 4RN7A 4KOSA 4YU9A 2GIVA 4PK3A 4YWYA 2OZHA 4OMEA 3CXPA 1S7LA 1YREA 2ZW7A 3FBUA 3GUXA 2PSWA 3B8GA 3R9FA 2B3VA 5LYDA 1TKJA 4R9MA 2BL1A 1ZG9A 3NE7A 3TO6A 4AB7A 4R6TA 2VXKA 1TF9A 1QMUA 4XPDB 4JXQA 4ZI6A 4JXRA 5IV0A 4NCZA 5KTCA 3ISXA 3W6XA 4NGMA 2EUIA 1TKHA 1Y9KA 1P0HA 4RS2A 2ABZA 3W91A 5HVGA 3FECA 1XJOA 5LRGA 3L2NA 4GM5A 3WABA 4CS0B 8CPAA 1M4IA 4QUSA 4JWPA 1VHSA 3TO7A 1QSOA 2VZYA 3V38A 1UWYA 1YR0A 4U9ZA 2I3CA 1N71A 2ZELA 4KSAA 3QAYA 4MHYA 4NGQA 4Q38A 4HPSA 5K8PA 1KWMA 2OZUA 2PJBA 4I49A 4A31A 4B10A 3G3SA 4KZTA 5K8MA 2PDOA 2CIJA 3SJGA 2WSAA 4NFRA 4OC1A 3FH4A 2P6EA 2C6CA 1S7FA 4IHMA 1A2ZA 4Y49B 4HKFA 3RAMA 1LFWA 1IOFA 5DS0A 3V8IA 1Z4EA 1NE9A 2J8RA 1ZG8A 1YX0A 4QC6A 2HQYA 2PJ7A 4CGMA 3K9TA 4KSIA 5KTDA 2JDDA 3EO4A 2ZEPA 4QBJA 2ZW6A 1Y0YA 4MRIA 3D67A 2BO9A 2KCWA 4CAVA 4NJQA 1IICA 4B12A 3S6FA 2BSWA 3FIXA 4WJBA 1H8LA 3DGVA 1NSLA 4G1PA 2GLJA 3PBBA 1PCAA 3GLJA 4II9A 2PJCA 2G0BA 2J8NA 4ORFA 2WYRA 2B5GA 3KR4A 4OLLA 1Y7RA 4UEEA 4CGLA 7CPAA 2GFQA 3CXQA 3DDDA 4EVYA 3S6HA 2PJ2A 4QVTA 4UWJA 4X8IA 5EBVA 2QYVA 4A33A 1NSAA 2P6FA 2PJ3A 4MCQA 2R1IA 4B5PA 5J8FA 3HUVA 3S9NA 3PRTA 1QQ9A 2HB6A 4CAFA 3BJ8A 3JUWA 2EK9A 1X12A 2H5MA 4NF1A 3TC8A 2FVGA 4NGTA 1R57A 3G8WA 1XF8A 3GIUA 1KUYA 4BD9A 3FRMA 4B11A 2FL4A 3FNCA 3N5FA 4UCPA 4LQ6A 4BMHA 1ARLA 4NGSA 2FXFA 1CM0A 4UFVA 3KASA 4E8OA 2PVVA 3BLNA 3R96A 3KGQA 3D2PA 4OC0A 2ARHA 3DR6A 1IYKA 3R9EA 5F48A 2OOTA 1PUAA 3MRUA 4UBRA 3RBUA 3KKWA 4ZGYB 4OC4A 3IC1A 4CGOA 2VEZA 3GB0A 1BOBA 1JQGA 4PSWA 4X3RA 3SI2A 2JLMA 1B6BA 3FVLA 4F6AA 3B2YA 1TIQA 2Q4ZA 4MCSA 4CAXA 1ON0A 1XIXA 2PJ4A 4FD7A 4CYQA 4CGPA 4A32A 2B4BA 4R87A 1OZPA 1R43A 2ZEGA 2Z0ZA 4H6UA 1TXRA 4H6ZA 4KOYA 4NGRA 2OR4A 3H5ZA 3IFEA 4OKOA 4PXEA 4MFZA 3SJXA 4MY0A 3E0KA 4O23A 5K8NA 3KHXA 4DNCA 5KTAA 4KOTA 2BOAA 5F49A 3BI1A 3LODA 4MFJA 3WC6A 3FXTA 3S9MA 1V0CA 1CX8A 5HVFA 4NEXA 1CPXA 2OZGA 4P4JA 1LRZA 3R1KA 3B3TA 2PJ0A 4R3LA 1Q2YA 4PXDA 2PC1A 5CBMA 4PPZA 1XEBA 1KZFA 5E96A 3I1UA 2ZOGA 3DNSA 2PIYA 3RNZA 4X2TA 1CJWA 3PB7X 5LYFA 3FMCA 2QMLA 4OIWA 2QJ8A 1MJ9A 2B4DA 2Q44A 4CRZB 2Y0MA 2DPTA 2X7BA 3A9LA 3NE8A 2C6PA 3SJEA 4TWEA 3PBEA 3SI1A 2Z3MA 2F8HA 2ZW4A 4KVOE 4M6IA 1M1DA 1QSRA 4MHNA 2Q4YA 2NYQA 5AG6A 2D4PA 3NH5A 3DSBA 1J4JA 3D68A 3H8EA 3NA6A 4KOXA 4ZY0A 4FD4A 3PFEA 4BBHA 4IK2A 1Q2DA 5ISVA 3D7FA 3CZXA 2PJ9A 4FBEA 5C82A 4YFJA 4NXYA 3SXNA 3RZAA 2GLFA 3N7ZA 2Z3NA 2EK8A 1CG2A 5F47A 2PVWA 3GKRA 5K8OA 5LRKA 4PSXA 2Z10A 2WPWA 3SXOA 2BCOA 1Z8XA 3KR5A 4ZX8A 4ONWA 5C88A 1X10A 1YW4A 4UFXA 1CP6A 1XRYA 4IUSA 1QSNA 2Q43A 1Z8TA 4B5OA 4B6ZA 2CTBA 4OP4A 4MXUA 4OAEA 4AXVA 4KOWA 3IIBA 1Q7LA 4AVBA 4YGOA 2I00A 2CNTA 1KUXA 1VHOA 2JEVA 3IWWA 3F5BA 4NGPA 1HEEA 4MFPA 1M4GA 3IU1A 3PB8X 2DXQA 4OIDA 4C7IA 2DF5A 1Z5RA 4AVCA 3PP9A 2GU2A 3FEEA 3VWEA 4KS9A 2FE7A 2ZEEA 1L0CA 1Z8LA 1S7KA 4MFKA 4MFQA 2ZPAA 2ZEOA 4R7MA 3D7HA 2O28A 2ZENA 3NFZA 2P6GA 3D7DA 4PXCA 2ZEFA 2VQYA 3TCVA 1SQHA 3QAHA 2G9DA 3V7ZA 4KVXA 1ZO0A 4TNUA 3ZZIA 1MJBA 4FD5A 4PV6A 4BINA 1EE3P 2CNSA 4X5KA 3B7IA 2R8VA 3CPAA 4DUKA 4M85A 4CAEA 5JGFA 2FCKA 4C2YA 3KI9A 4MJ8A 1U6MA 2REFA 3FX6A 3CT9A 3UY5A 2R7HA 2B5GB 4KLWA 1YQEA 2WZNA 1XE4A 1ELLP 2FS5A 4B13A 2XEGA 1BLLE 4FWUA 4P4IA 2PJ6A 1Y9WA 2BEIA 3D66A 4AG7A 3B3SA 2OB0A 1LAPA 3EY5A 2JBKA 2B3UA 1YVKA 1I21A 4A38A 3EC4A 2J8MA 2CXAA 3FJUA 2FIAA 3BXMA 1Z9UA 4NGNA 1YK3A 3BJ7A 3S6GA 1CBXA 4L89A 2ATRA 4MCPA 5FVJA 1I12A 3BI0A 2IQ6A 4R57A 3IWEA 1IIDA 1AUGA 2AFSA 2Q7SA 4CRYB 1B87A 1I1DA 4JJXA 4LQGA 3P2FA 3B3VA 4MMOA 4MHPA 4ZY1A 2HUZA 5CNPA 2AFXA 2YNCA 5HMNA 4PK2A 4R8FA 4JLYA 3DR8A 1GYTA 3VH9A 2OU2A 1YSJA 3IGRA 3EFAA 4KOUA 2XEIA 4C68A 2PR1A 3D7GA 4DYOA 2CF4A 2AFWA 5JM6A 2J9AA 4XNHC 3SJFA 3IU2A 2IJZA 4LX9A 1WWZA 5IB9A 3TX8A 2QECA 1YLOA 2AFMA 4P10A 4XPDC 3TT2A 3TOBA 2QIRA 1IYLA 3T8WA 1P4NA 4GS4A 2NSMA 4R76A 3FEDA 4P45A 2ZOFA 2DEAA 4J3GA 4YRHA 4A39A 3VWDA 1ZG7A 4FUUA 5AG4A 2YNEA 3PB4X 3VARA 4ZYQA 3T9YA 4A94A 2VZZA 4L8AA 3QNVA 3TE4A 4K30A 1S7NA 1KUVA 3I9SA 3KQZA 2VL1A 1XMBA 3LD2A 2IMOA 5AG7A 1UFHA 2Q7BA 2EBJA 3TO9A 1VIXA 4KUBA 2XEJA 4KUAA 5CPAA 4A30A 4P4DA 4ZX9A 3W6SA 5A27A 2RFHA 4OC3A 4JYWA 4E0AA 1BAVA 3K2KA 2V8VA 5IB0A 4MBUA 2PQ8A 3MN8A 4WWVA 4F9VA 1S60A 1XMTA 1XFOA 2CY2A 2GANA 2PJ5A 1IOIA 2XEFA 3KZWA 3PGPA 2DPSA 4A37A 3WT4A 4OC5A 5DWMA 1TKFA 3NH8A 3IO1A 4UEFA 3F0AA 1F57A 1AMPA 1WK4A 4Q7AA 1YW6A 2HV2A
chains in the Genus database with same CATH topology
4KOVA 3EXNA 4XPLA 1S3ZA 4MY3A 5G21A 5AG5A 3R9GA 5AGEA 2FIWA 2FT0A 2YGWA 3I3GA 2C27A 4XNHB 2A4NA 3WR7A 3D3SA 1NMTA 3ZJ0A 2P0WA 4UFWA 2JDCA 5BWAB 2K5TA 4C7HA 2FSRA 4E2AA 4MHDA 2VI7A 5G20A 1MK4A 4KLVA 1GHEA 4CGNA 4CAWA 2YNCC 4H89A 4AG9A 1QSTA 2AE6A 4HNWB 1BO4A 4RI1A 3TTHA 1MJAA 3GYAA 4F0XA 4U5YA 4UCMA 5G1ZA 3IWGA 4A95A 2WPXA 2ZXVA 5G22A 5JPHA 3H4QA 2B58A 5IX3A 1Z4RA 4JD6A 4A2ZA 2VBQA 3P2HA 3CXSA 3JVNA 2Z3LA 4UCNA 2OH1A 4XPKA 4B5PB 1S5KA 2Q4VA 2Z3PA 5HH1A 5F46A 5H84A 5EC4A 1PU9A 4CYOA 2Q0YA 1FY7A 3T90A 4M3SA 2PR8A 2I79A 4HNYB 4ONUA 4AVAA 3JTKA 2Q04A 2WUUA 3QB8A 4R3KA 4ZBGA 3F8KA 4C2XA 2IL4A 2ZW5A 4QB9A 1Q2CA 5DWNA 1QSMA 1YLEA 4NSQA 2D4OA 2R98A 3C26A 2RC4A 2NMTA 4U9YA 3TFYA 5GCNA 2REEA 3D2MA 2GE3A 4UWIA 2G3AA 4LUAA 4HNXB 3S6KA 4UA3A 1RO5A 2G3TA 2Z3OA 1M4DA 4MI4A 3OWCA 1K4JA 1VKCA 4MFLA 4FD6A 4KVME 5JQ4A 4IF5A 3R95A 2B4DB 4KSFA 3RYOA 4B14A 2Z11A 4CYPA 4C2ZA 4Q36A 1YGHA 1YVOA 2PRBA 3PZJA 3D8PA 3MGDA 4OADA 5J8CA 4Y49C 5I0CA 1IB1E 3TOAA 2BUEA 1RXTA 3FB3A 1M44A 5H86A 4CYNA 4KORA 3GY9A 3FYNA 2F5IA 3SHPA 2AJ6A 4F0YA 2Z3KA 2EVNA 2YNDA 5A28A 2CNMA 3K9UA 4KOSA 2GIVA 4PK3A 2OZHA 3CXPA 1S7LA 1YREA 2ZW7A 3FBUA 2PSWA 3B8GA 3R9FA 2B3VA 4R9MA 2BL1A 3NE7A 3TO6A 4AB7A 2VXKA 4XPDB 4JXQA 4JXRA 5IV0A 4NCZA 5KTCA 3W6XA 2EUIA 1Y9KA 1P0HA 4RS2A 3W91A 4CS0B 1M4IA 4QUSA 4JWPA 1VHSA 3TO7A 1QSOA 2VZYA 1YR0A 4U9ZA 1N71A 4KSAA 4Q38A 2OZUA 4I49A 4B10A 4A31A 3G3SA 4KZTA 2PDOA 2WSAA 2P6EA 1S7FA 4Y49B 4HKFA 3V8IA 1Z4EA 1NE9A 2J8RA 1YX0A 4QC6A 2HQYA 4CGMA 5KTDA 2JDDA 3EO4A 4QBJA 2ZW6A 2KCWA 4CAVA 1IICA 4B12A 3S6FA 2BSWA 3FIXA 1NSLA 4II9A 2G0BA 2J8NA 4ORFA 2B5GA 4OLLA 1Y7RA 4CGLA 3CXQA 3DDDA 4EVYA 3S6HA 4QVTA 4UWJA 5EBVA 4A33A 2P6FA 2R1IA 4B5PA 5J8FA 4CAFA 3BJ8A 3JUWA 2H5MA 4NF1A 1R57A 3G8WA 1XF8A 1KUYA 3FRMA 4B11A 2FL4A 3FNCA 4UCPA 4BMHA 2FXFA 1CM0A 4UFVA 4E8OA 3BLNA 3R96A 3D2PA 2ARHA 3DR6A 1IYKA 3R9EA 5F48A 1PUAA 4UBRA 3KKWA 4ZGYB 4CGOA 2VEZA 1BOBA 4PSWA 2JLMA 1B6BA 4F6AA 1TIQA 4CAXA 1ON0A 1XIXA 4FD7A 4CYQA 4CGPA 2B4BA 4R87A 1OZPA 2Z0ZA 4H6UA 4H6ZA 4KOYA 3H5ZA 4MFZA 4MY0A 3E0KA 4DNCA 5KTAA 4KOTA 5F49A 3LODA 4MFJA 3FXTA 1V0CA 4NEXA 2OZGA 1LRZA 3R1KA 4R3LA 1Q2YA 2PC1A 1XEBA 1KZFA 5E96A 3DNSA 1CJWA 2QMLA 1MJ9A 2B4DA 2Q44A 4CRZB 2Y0MA 2DPTA 2X7BA 3A9LA 2Z3MA 4KVOE 2ZW4A 1M1DA 1QSRA 2Q4YA 5AG6A 2D4PA 3DSBA 1J4JA 4KOXA 4FD4A 4BBHA 1Q2DA 5ISVA 5C82A 4YFJA 4NXYA 3SXNA 3N7ZA 2Z3NA 5F47A 3GKRA 4PSXA 2Z10A 2WPWA 3SXOA 5C88A 4UFXA 4IUSA 1QSNA 4B5OA 4OAEA 4KOWA 4AVBA 4YGOA 2I00A 2CNTA 1KUXA 2JEVA 3F5BA 4MFPA 1M4GA 3IU1A 4C7IA 2DXQA 4AVCA 3PP9A 3VWEA 4KS9A 2FE7A 4MFQA 1L0CA 1S7KA 4MFKA 2ZPAA 2O28A 2P6GA 2VQYA 3TCVA 1SQHA 3QAHA 4KVXA 1ZO0A 3ZZIA 1MJBA 4FD5A 4PV6A 2CNSA 4X5KA 2R8VA 4M85A 4CAEA 2FCKA 4C2YA 4MJ8A 1U6MA 2REFA 3UY5A 2R7HA 2B5GB 4KLWA 1XE4A 2FS5A 4B13A 1Y9WA 2BEIA 4AG7A 2OB0A 3EY5A 2B3UA 1YVKA 1I21A 3EC4A 2J8MA 2CXAA 2FIAA 1Z9UA 1YK3A 3BJ7A 3S6GA 4L89A 2ATRA 5FVJA 1I12A 4R57A 3IWEA 1IIDA 4CRYB 1B87A 1I1DA 4JJXA 3P2FA 2HUZA 5CNPA 5HMNA 2YNCA 4PK2A 4JLYA 3DR8A 2OU2A 3IGRA 3EFAA 4KOUA 4C68A 2PR1A 4XNHC 3IU2A 4LX9A 1WWZA 2QECA 4XPDC 3TT2A 3TOBA 2QIRA 1IYLA 1P4NA 4GS4A 4YRHA 4J3GA 3VWDA 5AG4A 2YNEA 3T9YA 2VZZA 4L8AA 3TE4A 4K30A 1S7NA 1KUVA 3I9SA 2Q7BA 3LD2A 5AG7A 3TO9A 4A32A 1UFHA 4KUBA 4KUAA 4A30A 5A27A 3W6SA 4E0AA 5IB0A 4MBUA 2PQ8A 1S60A 1XMTA 2CY2A 2GANA 3PGPA 2DPSA 5DWMA 3F0AA 1WK4A 2HV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOV A;  3EXN A;  4XPL A;  1S3Z A;  4MY3 A;  3R9G A;  2FIW A;  2FT0 A;  3I3G A;  2C27 A;  4XNH B;  2A4N A;  3WR7 A;  3D3S A;  1NMT A;  3ZJ0 A;  2P0W A;  2JDC A;  2K5T A;  2FSR A;  4E2A A;  4MHD A;  2VI7 A;  1MK4 A;  4KLV A;  1GHE A;  4CAW A;  4H89 A;  4AG9 A;  1QST A;  2AE6 A;  4HNW B;  1BO4 A;  4RI1 A;  3TTH A;  1MJA A;  3GYA A;  4U5Y A;  3IWG A;  2WPX A;  2ZXV A;  5JPH A;  3H4Q A;  2B58 A;  5IX3 A;  1Z4R A;  4JD6 A;  2VBQ A;  3P2H A;  3CXS A;  3JVN A;  2OH1 A;  4XPK A;  4B5P B;  1S5K A;  2Q4V A;  5HH1 A;  5F46 A;  5H84 A;  5EC4 A;  1PU9 A;  2Q0Y A;  1FY7 A;  3T90 A;  4M3S A;  2PR8 A;  2I79 A;  4HNY B;  4ONU A;  4AVA A;  2Q04 A;  3QB8 A;  4R3K A;  4ZBG A;  3F8K A;  2IL4 A;  2ZW5 A;  4QB9 A;  1Q2C A;  5DWN A;  1QSM A;  1YLE A;  4NSQ A;  2D4O A;  2R98 A;  3C26 A;  2RC4 A;  2NMT A;  4U9Y A;  3TFY A;  5GCN A;  2REE A;  3D2M A;  2GE3 A;  4UWI A;  2G3A A;  4LUA A;  4HNX B;  3S6K A;  4UA3 A;  1RO5 A;  2G3T A;  1M4D A;  4MI4 A;  3OWC A;  1K4J A;  1VKC A;  4FD6 A;  4KVM E;  5JQ4 A;  4IF5 A;  3R95 A;  2B4D B;  3RYO A;  2Z11 A;  1YGH A;  1YVO A;  2PRB A;  3PZJ A;  3D8P A;  3MGD A;  4OAD A;  5J8C A;  4Y49 C;  5I0C A;  1IB1 E;  3TOA A;  2BUE A;  1RXT A;  3FB3 A;  1M44 A;  5H86 A;  4KOR A;  3GY9 A;  3FYN A;  2F5I A;  3SHP A;  2AJ6 A;  4F0Y A;  2EVN A;  2CNM A;  3K9U A;  4KOS A;  2GIV A;  4PK3 A;  2OZH A;  3CXP A;  1S7L A;  1YRE A;  2ZW7 A;  3FBU A;  2PSW A;  3B8G A;  3R9F A;  2B3V A;  4R9M A;  2BL1 A;  3NE7 A;  3TO6 A;  4AB7 A;  2VXK A;  4XPD B;  4JXQ A;  4JXR A;  5IV0 A;  4NCZ A;  5KTC A;  3W6X A;  2EUI A;  1Y9K A;  1P0H A;  4RS2 A;  3W91 A;  4CS0 B;  1M4I A;  4QUS A;  4JWP A;  1VHS A;  3TO7 A;  1QSO A;  2VZY A;  1YR0 A;  4U9Z A;  1N71 A;  2OZU A;  4I49 A;  3G3S A;  4KZT A;  2PDO A;  2P6E A;  1S7F A;  4Y49 B;  4HKF A;  3V8I A;  1Z4E A;  1NE9 A;  2J8R A;  1YX0 A;  4QC6 A;  2HQY A;  5KTD A;  2JDD A;  3EO4 A;  4QBJ A;  2ZW6 A;  2KCW A;  4CAV A;  1IIC A;  3S6F A;  2BSW A;  3FIX A;  1NSL A;  4II9 A;  2G0B A;  2J8N A;  4ORF A;  2B5G A;  4OLL A;  1Y7R A;  3CXQ A;  3DDD A;  4EVY A;  3S6H A;  4QVT A;  4UWJ A;  5EBV A;  2P6F A;  2R1I A;  4B5P A;  5J8F A;  3BJ8 A;  3JUW A;  2H5M A;  4NF1 A;  1R57 A;  3G8W A;  1XF8 A;  1KUY A;  3FRM A;  2FL4 A;  3FNC A;  4BMH A;  2FXF A;  1CM0 A;  4E8O A;  3BLN A;  3R96 A;  3D2P A;  2ARH A;  3DR6 A;  1IYK A;  3R9E A;  5F48 A;  1PUA A;  4UBR A;  3KKW A;  2VEZ A;  1BOB A;  4PSW A;  2JLM A;  1B6B A;  4F6A A;  1TIQ A;  4CAX A;  1ON0 A;  1XIX A;  4FD7 A;  2B4B A;  4R87 A;  1OZP A;  2Z0Z A;  4H6U A;  4H6Z A;  4KOY A;  4MY0 A;  3E0K A;  4DNC A;  5KTA A;  4KOT A;  5F49 A;  3LOD A;  3FXT A;  1V0C A;  4NEX A;  2OZG A;  1LRZ A;  3R1K A;  4R3L A;  1Q2Y A;  2PC1 A;  1XEB A;  1KZF A;  5E96 A;  3DNS A;  1CJW A;  2QML A;  1MJ9 A;  2B4D A;  2Q44 A;  4CRZ B;  2Y0M A;  2X7B A;  4KVO E;  2ZW4 A;  1M1D A;  1QSR A;  2Q4Y A;  2D4P A;  3DSB A;  1J4J A;  4KOX A;  4FD4 A;  1Q2D A;  5ISV A;  5C82 A;  4YFJ A;  4NXY A;  3SXN A;  3N7Z A;  5F47 A;  3GKR A;  4PSX A;  2Z10 A;  2WPW A;  3SXO A;  5C88 A;  4IUS A;  1QSN A;  4B5O A;  4OAE A;  4KOW A;  4AVB A;  4YGO A;  2I00 A;  2CNT A;  1KUX A;  2JEV A;  3F5B A;  1M4G A;  2DXQ A;  4AVC A;  3PP9 A;  3VWE A;  2FE7 A;  1L0C A;  1S7K A;  2ZPA A;  2O28 A;  2P6G A;  2VQY A;  3TCV A;  1SQH A;  3QAH A;  4KVX A;  3ZZI A;  1MJB A;  4FD5 A;  4PV6 A;  2CNS A;  4X5K A;  2R8V A;  4M85 A;  2FCK A;  4MJ8 A;  1U6M A;  2REF A;  3UY5 A;  2R7H A;  2B5G B;  4KLW A;  1XE4 A;  2FS5 A;  1Y9W A;  2BEI A;  4AG7 A;  2OB0 A;  3EY5 A;  2B3U A;  1YVK A;  1I21 A;  3EC4 A;  2J8M A;  2FIA A;  1Z9U A;  1YK3 A;  3BJ7 A;  3S6G A;  4L89 A;  2ATR A;  5FVJ A;  1I12 A;  4R57 A;  1IID A;  4CRY B;  1B87 A;  1I1D A;  4JJX A;  3P2F A;  2HUZ A;  5CNP A;  5HMN A;  4PK2 A;  4JLY A;  3DR8 A;  2OU2 A;  3IGR A;  3EFA A;  4KOU A;  2PR1 A;  4XNH C;  4LX9 A;  1WWZ A;  2QEC A;  4XPD C;  3TT2 A;  3TOB A;  2QIR A;  1IYL A;  1P4N A;  4GS4 A;  4YRH A;  4J3G A;  3VWD A;  3T9Y A;  2VZZ A;  4L8A A;  3TE4 A;  4K30 A;  1S7N A;  1KUV A;  3I9S A;  2Q7B A;  3LD2 A;  3TO9 A;  1UFH A;  4KUB A;  4KUA A;  3W6S A;  4E0A A;  5IB0 A;  4MBU A;  2PQ8 A;  1S60 A;  1XMT A;  2CY2 A;  2GAN A;  3PGP A;  5DWM A;  3F0A A;  1WK4 A;  2HV2 A; 
#chains in the Genus database with same CATH topology
 3B3C A;  5LYI A;  4KOV A;  3EXN A;  4XPL A;  1S3Z A;  4MY3 A;  5D29 A;  5G21 A;  4IAV A;  5AG5 A;  3R9G A;  5AGE A;  2FIW A;  2FT0 A;  2YGW A;  3I3G A;  4Z65 A;  2C27 A;  2EWB A;  3PEI A;  4XNH B;  3CDX A;  4P4B A;  2A4N A;  3WR7 A;  3D3S A;  3H8G A;  2O4H A;  1NMT A;  3IEH A;  1F2P A;  2P0W A;  2ZED A;  1ELM P;  2Q51 A;  2JDC A;  4UFW A;  3ZJ0 A;  4F8Z A;  5BWA B;  2K5T A;  3WC7 A;  2FSR A;  4C7H A;  3PB6 X;  4E2A A;  1FNO A;  4MHD A;  2AFU A;  2PJ1 A;  2VI7 A;  1LAN A;  5G20 A;  4EWT A;  1MK4 A;  1DE4 C;  4KLV A;  4P6Y A;  2PIZ A;  1GHE A;  1Y0R A;  1FT7 A;  4CGN A;  4P44 A;  4CAW A;  2YNC C;  4H89 A;  4AG9 A;  1QST A;  2AE6 A;  1LAM A;  1M4L A;  4ZY2 A;  1VHE A;  4HNW B;  5ELY A;  1ZLH A;  1HDU A;  1BO4 A;  1PYT B;  3BHX A;  3KL9 A;  1MJA A;  4RI1 A;  3GYA A;  3TTH A;  5J1Q A;  1VGY A;  2GRE A;  4F0X A;  2PJA A;  1RTQ A;  4U5Y A;  4UCM A;  5G1Z A;  1HDQ A;  4CPA A;  3IWG A;  4A95 A;  1Y7E A;  2WPX A;  4UIB A;  2ZXV A;  4GXH A;  5G22 A;  3B35 A;  4F9U A;  4W9Y A;  3KHZ A;  5JPH A;  5I4M A;  3H4Q A;  2B58 A;  5IX3 A;  1Z4R A;  4PXB A;  2PJ8 A;  4JD6 A;  4UF4 A;  4A2Z A;  2C1C A;  2V8D A;  2VBQ A;  1OBR A;  3P2H A;  4P4F A;  5F09 A;  3CXS A;  3JVN A;  2Z3L A;  4UCN A;  4UEZ A;  2OH1 A;  4XPK A;  4B5P B;  5THW A;  5LYL A;  1AYE A;  1S5K A;  4M6H A;  2Q4V A;  2Z3P A;  5HH1 A;  2HC9 A;  5F46 A;  5H84 A;  5EC4 A;  1PU9 A;  2PRQ A;  3LWU A;  2V77 A;  1JWQ A;  2C6G A;  4CYO A;  2Q0Y A;  1FY7 A;  3T90 A;  4M3S A;  1TF8 A;  2PR8 A;  3JRU A;  2JEW A;  2I79 A;  4HNY B;  5LRJ A;  3WC5 A;  6CPA A;  1ZLI A;  4ONU A;  1ARM A;  3JTK A;  4AVA A;  2RB7 A;  3ISZ A;  5HVH A;  3PB9 X;  2Q04 A;  2WUU A;  3QB8 A;  3IJ3 A;  3NH4 A;  4R3K A;  3F8K A;  4ZBG A;  4C2X A;  3S9L A;  5EMI A;  2IL4 A;  5D8N A;  2ZW5 A;  4K3N A;  4QB9 A;  1Q2C A;  5DWN A;  1QSM A;  1YLE A;  4NSQ A;  2D4O A;  1LCP A;  4EFD A;  4FAI A;  2F7V A;  1IY7 A;  2V8H A;  2R98 A;  3C26 A;  2RC4 A;  1XBU A;  2ZEH A;  2NMT A;  3LMS A;  4U9Y A;  3TFY A;  5GCN A;  1YME A;  2REE A;  3D2M A;  3SI0 A;  2AFZ A;  1LOK A;  2GE3 A;  4M6G A;  1R3N A;  1Z8W A;  3B3W A;  4UWI A;  3HLP A;  2G3A A;  4LUA A;  4HNX B;  3PFO A;  2AFO A;  1IGB A;  4MHZ A;  3S6K A;  4UA3 A;  3RO0 A;  1CPS A;  3H8F A;  2QVP A;  1RO5 A;  2G3T A;  1CP7 A;  2V8G A;  2Z3O A;  1M4D A;  4MI4 A;  3OWC A;  1K4J A;  2ZEM A;  4EME A;  1VKC A;  1BPM A;  2PCU A;  4MFL A;  2JBJ A;  4FD6 A;  4KVM E;  3FF3 A;  5JQ4 A;  4IF5 A;  2O53 A;  4MCR A;  3D4U A;  3LAC A;  4NJR A;  3R95 A;  2B4D B;  1IU8 A;  4KSF A;  4OC2 A;  3RYO A;  1BPN A;  4H2K A;  2Z11 A;  3VAT A;  4B14 A;  3CPX A;  4CYP A;  4C2Z A;  3KQX A;  1YGH A;  1YVO A;  2PRB A;  3PZJ A;  4Q36 A;  3D8P A;  3MGD A;  4P4E A;  1Z2L A;  4OAD A;  5J8C A;  4Y49 C;  5I0C A;  1IB1 E;  1F2O A;  3TOA A;  2POK A;  5HXD A;  3DLJ A;  2CTC A;  2BUE A;  1RXT A;  4RUH A;  3FB3 A;  1M44 A;  5H86 A;  4CYN A;  2ODF A;  3GY9 A;  4KOR A;  4JZ0 A;  3FYN A;  1DTD A;  2F5I A;  3SHP A;  1XOV A;  2ANP A;  4DJL A;  2AJ6 A;  2EO8 A;  4F0Y A;  2Z3K A;  2EVN A;  4UIA A;  2YND A;  4PQA A;  2PE3 A;  5A28 A;  2CNM A;  5JH9 A;  3K9U A;  4RN7 A;  4KOS A;  4YU9 A;  2GIV A;  4PK3 A;  4YWY A;  2OZH A;  4OME A;  3CXP A;  1S7L A;  1YRE A;  2ZW7 A;  3FBU A;  3GUX A;  2PSW A;  3B8G A;  3R9F A;  2B3V A;  5LYD A;  1TKJ A;  4R9M A;  2BL1 A;  1ZG9 A;  3NE7 A;  3TO6 A;  4AB7 A;  4R6T A;  2VXK A;  1TF9 A;  1QMU A;  4XPD B;  4JXQ A;  4ZI6 A;  4JXR A;  5IV0 A;  4NCZ A;  5KTC A;  3ISX A;  3W6X A;  4NGM A;  2EUI A;  1TKH A;  1Y9K A;  1P0H A;  4RS2 A;  2ABZ A;  3W91 A;  5HVG A;  3FEC A;  1XJO A;  5LRG A;  3L2N A;  4GM5 A;  3WAB A;  4CS0 B;  8CPA A;  1M4I A;  4QUS A;  4JWP A;  1VHS A;  3TO7 A;  1QSO A;  2VZY A;  3V38 A;  1UWY A;  1YR0 A;  4U9Z A;  2I3C A;  1N71 A;  2ZEL A;  4KSA A;  3QAY A;  4MHY A;  4NGQ A;  4Q38 A;  4HPS A;  5K8P A;  1KWM A;  2OZU A;  2PJB A;  4I49 A;  4A31 A;  4B10 A;  3G3S A;  4KZT A;  5K8M A;  2PDO A;  2CIJ A;  3SJG A;  2WSA A;  4NFR A;  4OC1 A;  3FH4 A;  2P6E A;  2C6C A;  1S7F A;  4IHM A;  1A2Z A;  4Y49 B;  4HKF A;  3RAM A;  1LFW A;  1IOF A;  5DS0 A;  3V8I A;  1Z4E A;  1NE9 A;  2J8R A;  1ZG8 A;  1YX0 A;  4QC6 A;  2HQY A;  2PJ7 A;  4CGM A;  3K9T A;  4KSI A;  5KTD A;  2JDD A;  3EO4 A;  2ZEP A;  4QBJ A;  2ZW6 A;  1Y0Y A;  4MRI A;  3D67 A;  2BO9 A;  2KCW A;  4CAV A;  4NJQ A;  1IIC A;  4B12 A;  3S6F A;  2BSW A;  3FIX A;  4WJB A;  1H8L A;  3DGV A;  1NSL A;  4G1P A;  2GLJ A;  3PBB A;  1PCA A;  3GLJ A;  4II9 A;  2PJC A;  2G0B A;  2J8N A;  4ORF A;  2WYR A;  2B5G A;  3KR4 A;  4OLL A;  1Y7R A;  4UEE A;  4CGL A;  7CPA A;  2GFQ A;  3CXQ A;  3DDD A;  4EVY A;  3S6H A;  2PJ2 A;  4QVT A;  4UWJ A;  4X8I A;  5EBV A;  2QYV A;  4A33 A;  1NSA A;  2P6F A;  2PJ3 A;  4MCQ A;  2R1I A;  4B5P A;  5J8F A;  3HUV A;  3S9N A;  3PRT A;  1QQ9 A;  2HB6 A;  4CAF A;  3BJ8 A;  3JUW A;  2EK9 A;  1X12 A;  2H5M A;  4NF1 A;  3TC8 A;  2FVG A;  4NGT A;  1R57 A;  3G8W A;  1XF8 A;  3GIU A;  1KUY A;  4BD9 A;  3FRM A;  4B11 A;  2FL4 A;  3FNC A;  3N5F A;  4UCP A;  4LQ6 A;  4BMH A;  1ARL A;  4NGS A;  2FXF A;  1CM0 A;  4UFV A;  3KAS A;  4E8O A;  2PVV A;  3BLN A;  3R96 A;  3KGQ A;  3D2P A;  4OC0 A;  2ARH A;  3DR6 A;  1IYK A;  3R9E A;  5F48 A;  2OOT A;  1PUA A;  3MRU A;  4UBR A;  3RBU A;  3KKW A;  4ZGY B;  4OC4 A;  3IC1 A;  4CGO A;  2VEZ A;  3GB0 A;  1BOB A;  1JQG A;  4PSW A;  4X3R A;  3SI2 A;  2JLM A;  1B6B A;  3FVL A;  4F6A A;  3B2Y A;  1TIQ A;  2Q4Z A;  4MCS A;  4CAX A;  1ON0 A;  1XIX A;  2PJ4 A;  4FD7 A;  4CYQ A;  4CGP A;  4A32 A;  2B4B A;  4R87 A;  1OZP A;  1R43 A;  2ZEG A;  2Z0Z A;  4H6U A;  1TXR A;  4H6Z A;  4KOY A;  4NGR A;  2OR4 A;  3H5Z A;  3IFE A;  4OKO A;  4PXE A;  4MFZ A;  3SJX A;  4MY0 A;  3E0K A;  4O23 A;  5K8N A;  3KHX A;  4DNC A;  5KTA A;  4KOT A;  2BOA A;  5F49 A;  3BI1 A;  3LOD A;  4MFJ A;  3WC6 A;  3FXT A;  3S9M A;  1V0C A;  1CX8 A;  5HVF A;  4NEX A;  1CPX A;  2OZG A;  4P4J A;  1LRZ A;  3R1K A;  3B3T A;  2PJ0 A;  4R3L A;  1Q2Y A;  4PXD A;  2PC1 A;  5CBM A;  4PPZ A;  1XEB A;  1KZF A;  5E96 A;  3I1U A;  2ZOG A;  3DNS A;  2PIY A;  3RNZ A;  4X2T A;  1CJW A;  3PB7 X;  5LYF A;  3FMC A;  2QML A;  4OIW A;  2QJ8 A;  1MJ9 A;  2B4D A;  2Q44 A;  4CRZ B;  2Y0M A;  2DPT A;  2X7B A;  3A9L A;  3NE8 A;  2C6P A;  3SJE A;  4TWE A;  3PBE A;  3SI1 A;  2Z3M A;  2F8H A;  2ZW4 A;  4KVO E;  4M6I A;  1M1D A;  1QSR A;  4MHN A;  2Q4Y A;  2NYQ A;  5AG6 A;  2D4P A;  3NH5 A;  3DSB A;  1J4J A;  3D68 A;  3H8E A;  3NA6 A;  4KOX A;  4ZY0 A;  4FD4 A;  3PFE A;  4BBH A;  4IK2 A;  1Q2D A;  5ISV A;  3D7F A;  3CZX A;  2PJ9 A;  4FBE A;  5C82 A;  4YFJ A;  4NXY A;  3SXN A;  3RZA A;  2GLF A;  3N7Z A;  2Z3N A;  2EK8 A;  1CG2 A;  5F47 A;  2PVW A;  3GKR A;  5K8O A;  5LRK A;  4PSX A;  2Z10 A;  2WPW A;  3SXO A;  2BCO A;  1Z8X A;  3KR5 A;  4ZX8 A;  4ONW A;  5C88 A;  1X10 A;  1YW4 A;  4UFX A;  1CP6 A;  1XRY A;  4IUS A;  1QSN A;  2Q43 A;  1Z8T A;  4B5O A;  4B6Z A;  2CTB A;  4OP4 A;  4MXU A;  4OAE A;  4AXV A;  4KOW A;  3IIB A;  1Q7L A;  4AVB A;  4YGO A;  2I00 A;  2CNT A;  1KUX A;  1VHO A;  2JEV A;  3IWW A;  3F5B A;  4NGP A;  1HEE A;  4MFP A;  1M4G A;  3IU1 A;  3PB8 X;  2DXQ A;  4OID A;  4C7I A;  2DF5 A;  1Z5R A;  4AVC A;  3PP9 A;  2GU2 A;  3FEE A;  3VWE A;  4KS9 A;  2FE7 A;  2ZEE A;  1L0C A;  1Z8L A;  1S7K A;  4MFK A;  4MFQ A;  2ZPA A;  2ZEO A;  4R7M A;  3D7H A;  2O28 A;  2ZEN A;  3NFZ A;  2P6G A;  3D7D A;  4PXC A;  2ZEF A;  2VQY A;  3TCV A;  1SQH A;  3QAH A;  2G9D A;  3V7Z A;  4KVX A;  1ZO0 A;  4TNU A;  3ZZI A;  1MJB A;  4FD5 A;  4PV6 A;  4BIN A;  1EE3 P;  2CNS A;  4X5K A;  3B7I A;  2R8V A;  3CPA A;  4DUK A;  4M85 A;  4CAE A;  5JGF A;  2FCK A;  4C2Y A;  3KI9 A;  4MJ8 A;  1U6M A;  2REF A;  3FX6 A;  3CT9 A;  3UY5 A;  2R7H A;  2B5G B;  4KLW A;  1YQE A;  2WZN A;  1XE4 A;  1ELL P;  2FS5 A;  4B13 A;  2XEG A;  1BLL E;  4FWU A;  4P4I A;  2PJ6 A;  1Y9W A;  2BEI A;  3D66 A;  4AG7 A;  3B3S A;  2OB0 A;  1LAP A;  3EY5 A;  2JBK A;  2B3U A;  1YVK A;  1I21 A;  4A38 A;  3EC4 A;  2J8M A;  2CXA A;  3FJU A;  2FIA A;  3BXM A;  1Z9U A;  4NGN A;  1YK3 A;  3BJ7 A;  3S6G A;  1CBX A;  4L89 A;  2ATR A;  4MCP A;  5FVJ A;  1I12 A;  3BI0 A;  2IQ6 A;  4R57 A;  3IWE A;  1IID A;  1AUG A;  2AFS A;  2Q7S A;  4CRY B;  1B87 A;  1I1D A;  4JJX A;  4LQG A;  3P2F A;  3B3V A;  4MMO A;  4MHP A;  4ZY1 A;  2HUZ A;  5CNP A;  2AFX A;  2YNC A;  5HMN A;  4PK2 A;  4R8F A;  4JLY A;  3DR8 A;  1GYT A;  3VH9 A;  2OU2 A;  1YSJ A;  3IGR A;  3EFA A;  4KOU A;  2XEI A;  4C68 A;  2PR1 A;  3D7G A;  4DYO A;  2CF4 A;  2AFW A;  5JM6 A;  2J9A A;  4XNH C;  3SJF A;  3IU2 A;  2IJZ A;  4LX9 A;  1WWZ A;  5IB9 A;  3TX8 A;  2QEC A;  1YLO A;  2AFM A;  4P10 A;  4XPD C;  3TT2 A;  3TOB A;  2QIR A;  1IYL A;  3T8W A;  1P4N A;  4GS4 A;  2NSM A;  4R76 A;  3FED A;  4P45 A;  2ZOF A;  2DEA A;  4J3G A;  4YRH A;  4A39 A;  3VWD A;  1ZG7 A;  4FUU A;  5AG4 A;  2YNE A;  3PB4 X;  3VAR A;  4ZYQ A;  3T9Y A;  4A94 A;  2VZZ A;  4L8A A;  3QNV A;  3TE4 A;  4K30 A;  1S7N A;  1KUV A;  3I9S A;  3KQZ A;  2VL1 A;  1XMB A;  3LD2 A;  2IMO A;  5AG7 A;  1UFH A;  2Q7B A;  2EBJ A;  3TO9 A;  1VIX A;  4KUB A;  2XEJ A;  4KUA A;  5CPA A;  4A30 A;  4P4D A;  4ZX9 A;  3W6S A;  5A27 A;  2RFH A;  4OC3 A;  4JYW A;  4E0A A;  1BAV A;  3K2K A;  2V8V A;  5IB0 A;  4MBU A;  2PQ8 A;  3MN8 A;  4WWV A;  4F9V A;  1S60 A;  1XMT A;  1XFO A;  2CY2 A;  2GAN A;  2PJ5 A;  1IOI A;  2XEF A;  3KZW A;  3PGP A;  2DPS A;  4A37 A;  3WT4 A;  4OC5 A;  5DWM A;  1TKF A;  3NH8 A;  3IO1 A;  4UEF A;  3F0A A;  1F57 A;  1AMP A;  1WK4 A;  4Q7A A;  1YW6 A;  2HV2 A; 
#chains in the Genus database with same CATH homology
 4KOV A;  3EXN A;  4XPL A;  1S3Z A;  4MY3 A;  5G21 A;  5AG5 A;  3R9G A;  5AGE A;  2FIW A;  2FT0 A;  2YGW A;  3I3G A;  2C27 A;  4XNH B;  2A4N A;  3WR7 A;  3D3S A;  1NMT A;  3ZJ0 A;  2P0W A;  4UFW A;  2JDC A;  5BWA B;  2K5T A;  4C7H A;  2FSR A;  4E2A A;  4MHD A;  2VI7 A;  5G20 A;  1MK4 A;  4KLV A;  1GHE A;  4CGN A;  4CAW A;  2YNC C;  4H89 A;  4AG9 A;  1QST A;  2AE6 A;  4HNW B;  1BO4 A;  4RI1 A;  3TTH A;  1MJA A;  3GYA A;  4F0X A;  4U5Y A;  4UCM A;  5G1Z A;  3IWG A;  4A95 A;  2WPX A;  2ZXV A;  5G22 A;  5JPH A;  3H4Q A;  2B58 A;  5IX3 A;  1Z4R A;  4JD6 A;  4A2Z A;  2VBQ A;  3P2H A;  3CXS A;  3JVN A;  2Z3L A;  4UCN A;  2OH1 A;  4XPK A;  4B5P B;  1S5K A;  2Q4V A;  2Z3P A;  5HH1 A;  5F46 A;  5H84 A;  5EC4 A;  1PU9 A;  4CYO A;  2Q0Y A;  1FY7 A;  3T90 A;  4M3S A;  2PR8 A;  2I79 A;  4HNY B;  4ONU A;  4AVA A;  3JTK A;  2Q04 A;  2WUU A;  3QB8 A;  4R3K A;  4ZBG A;  3F8K A;  4C2X A;  2IL4 A;  2ZW5 A;  4QB9 A;  1Q2C A;  5DWN A;  1QSM A;  1YLE A;  4NSQ A;  2D4O A;  2R98 A;  3C26 A;  2RC4 A;  2NMT A;  4U9Y A;  3TFY A;  5GCN A;  2REE A;  3D2M A;  2GE3 A;  4UWI A;  2G3A A;  4LUA A;  4HNX B;  3S6K A;  4UA3 A;  1RO5 A;  2G3T A;  2Z3O A;  1M4D A;  4MI4 A;  3OWC A;  1K4J A;  1VKC A;  4MFL A;  4FD6 A;  4KVM E;  5JQ4 A;  4IF5 A;  3R95 A;  2B4D B;  4KSF A;  3RYO A;  4B14 A;  2Z11 A;  4CYP A;  4C2Z A;  4Q36 A;  1YGH A;  1YVO A;  2PRB A;  3PZJ A;  3D8P A;  3MGD A;  4OAD A;  5J8C A;  4Y49 C;  5I0C A;  1IB1 E;  3TOA A;  2BUE A;  1RXT A;  3FB3 A;  1M44 A;  5H86 A;  4CYN A;  4KOR A;  3GY9 A;  3FYN A;  2F5I A;  3SHP A;  2AJ6 A;  4F0Y A;  2Z3K A;  2EVN A;  2YND A;  5A28 A;  2CNM A;  3K9U A;  4KOS A;  2GIV A;  4PK3 A;  2OZH A;  3CXP A;  1S7L A;  1YRE A;  2ZW7 A;  3FBU A;  2PSW A;  3B8G A;  3R9F A;  2B3V A;  4R9M A;  2BL1 A;  3NE7 A;  3TO6 A;  4AB7 A;  2VXK A;  4XPD B;  4JXQ A;  4JXR A;  5IV0 A;  4NCZ A;  5KTC A;  3W6X A;  2EUI A;  1Y9K A;  1P0H A;  4RS2 A;  3W91 A;  4CS0 B;  1M4I A;  4QUS A;  4JWP A;  1VHS A;  3TO7 A;  1QSO A;  2VZY A;  1YR0 A;  4U9Z A;  1N71 A;  4KSA A;  4Q38 A;  2OZU A;  4I49 A;  4B10 A;  4A31 A;  3G3S A;  4KZT A;  2PDO A;  2WSA A;  2P6E A;  1S7F A;  4Y49 B;  4HKF A;  3V8I A;  1Z4E A;  1NE9 A;  2J8R A;  1YX0 A;  4QC6 A;  2HQY A;  4CGM A;  5KTD A;  2JDD A;  3EO4 A;  4QBJ A;  2ZW6 A;  2KCW A;  4CAV A;  1IIC A;  4B12 A;  3S6F A;  2BSW A;  3FIX A;  1NSL A;  4II9 A;  2G0B A;  2J8N A;  4ORF A;  2B5G A;  4OLL A;  1Y7R A;  4CGL A;  3CXQ A;  3DDD A;  4EVY A;  3S6H A;  4QVT A;  4UWJ A;  5EBV A;  4A33 A;  2P6F A;  2R1I A;  4B5P A;  5J8F A;  4CAF A;  3BJ8 A;  3JUW A;  2H5M A;  4NF1 A;  1R57 A;  3G8W A;  1XF8 A;  1KUY A;  3FRM A;  4B11 A;  2FL4 A;  3FNC A;  4UCP A;  4BMH A;  2FXF A;  1CM0 A;  4UFV A;  4E8O A;  3BLN A;  3R96 A;  3D2P A;  2ARH A;  3DR6 A;  1IYK A;  3R9E A;  5F48 A;  1PUA A;  4UBR A;  3KKW A;  4ZGY B;  4CGO A;  2VEZ A;  1BOB A;  4PSW A;  2JLM A;  1B6B A;  4F6A A;  1TIQ A;  4CAX A;  1ON0 A;  1XIX A;  4FD7 A;  4CYQ A;  4CGP A;  2B4B A;  4R87 A;  1OZP A;  2Z0Z A;  4H6U A;  4H6Z A;  4KOY A;  3H5Z A;  4MFZ A;  4MY0 A;  3E0K A;  4DNC A;  5KTA A;  4KOT A;  5F49 A;  3LOD A;  4MFJ A;  3FXT A;  1V0C A;  4NEX A;  2OZG A;  1LRZ A;  3R1K A;  4R3L A;  1Q2Y A;  2PC1 A;  1XEB A;  1KZF A;  5E96 A;  3DNS A;  1CJW A;  2QML A;  1MJ9 A;  2B4D A;  2Q44 A;  4CRZ B;  2Y0M A;  2DPT A;  2X7B A;  3A9L A;  2Z3M A;  4KVO E;  2ZW4 A;  1M1D A;  1QSR A;  2Q4Y A;  5AG6 A;  2D4P A;  3DSB A;  1J4J A;  4KOX A;  4FD4 A;  4BBH A;  1Q2D A;  5ISV A;  5C82 A;  4YFJ A;  4NXY A;  3SXN A;  3N7Z A;  2Z3N A;  5F47 A;  3GKR A;  4PSX A;  2Z10 A;  2WPW A;  3SXO A;  5C88 A;  4UFX A;  4IUS A;  1QSN A;  4B5O A;  4OAE A;  4KOW A;  4AVB A;  4YGO A;  2I00 A;  2CNT A;  1KUX A;  2JEV A;  3F5B A;  4MFP A;  1M4G A;  3IU1 A;  4C7I A;  2DXQ A;  4AVC A;  3PP9 A;  3VWE A;  4KS9 A;  2FE7 A;  4MFQ A;  1L0C A;  1S7K A;  4MFK A;  2ZPA A;  2O28 A;  2P6G A;  2VQY A;  3TCV A;  1SQH A;  3QAH A;  4KVX A;  1ZO0 A;  3ZZI A;  1MJB A;  4FD5 A;  4PV6 A;  2CNS A;  4X5K A;  2R8V A;  4M85 A;  4CAE A;  2FCK A;  4C2Y A;  4MJ8 A;  1U6M A;  2REF A;  3UY5 A;  2R7H A;  2B5G B;  4KLW A;  1XE4 A;  2FS5 A;  4B13 A;  1Y9W A;  2BEI A;  4AG7 A;  2OB0 A;  3EY5 A;  2B3U A;  1YVK A;  1I21 A;  3EC4 A;  2J8M A;  2CXA A;  2FIA A;  1Z9U A;  1YK3 A;  3BJ7 A;  3S6G A;  4L89 A;  2ATR A;  5FVJ A;  1I12 A;  4R57 A;  3IWE A;  1IID A;  4CRY B;  1B87 A;  1I1D A;  4JJX A;  3P2F A;  2HUZ A;  5CNP A;  5HMN A;  2YNC A;  4PK2 A;  4JLY A;  3DR8 A;  2OU2 A;  3IGR A;  3EFA A;  4KOU A;  4C68 A;  2PR1 A;  4XNH C;  3IU2 A;  4LX9 A;  1WWZ A;  2QEC A;  4XPD C;  3TT2 A;  3TOB A;  2QIR A;  1IYL A;  1P4N A;  4GS4 A;  4YRH A;  4J3G A;  3VWD A;  5AG4 A;  2YNE A;  3T9Y A;  2VZZ A;  4L8A A;  3TE4 A;  4K30 A;  1S7N A;  1KUV A;  3I9S A;  2Q7B A;  3LD2 A;  5AG7 A;  3TO9 A;  4A32 A;  1UFH A;  4KUB A;  4KUA A;  4A30 A;  5A27 A;  3W6S A;  4E0A A;  5IB0 A;  4MBU A;  2PQ8 A;  1S60 A;  1XMT A;  2CY2 A;  2GAN A;  3PGP A;  2DPS A;  5DWM A;  3F0A A;  1WK4 A;  2HV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...