4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
2QMLA 3P2HA 3C26A 2B5GB 4JXRA 2AE6A 4QUSA 4M3SA 4Y49C 3TO9A 3I9SA 4KLWA 4UWJA 1B6BA 1XEBA 1SQHA 1N71A 2VEZA 4CS0B 3W6XA 4NXYA 3EC4A 4R3KA 1Z4EA 4JXQA 1CM0A 4KOXA 2Q4VA 4XNHC 1Y9WA 2PDOA 1NMTA 2B4BA 4CAXA 1BOBA 4YGOA 1XF8A 1YK3A 4MI4A 3TCVA 3FIXA 1NE9A 3P2FA 1S3ZA 4E2AA 2OH1A 4NF1A 1IYKA 2K5TA 2PSWA 4JWPA 2BUEA 1Y7RA 3GY9A 4UWIA 3SXNA 4H6ZA 1P4NA 3UY5A 5F46A 5IV0A 1J4JA 4CRYB 3ZZIA 2VZYA 2VXKA 4L8AA 4B5PB 2GIVA 4MHDA 2R1IA 2VZZA 4MJ8A 4JJXA 1YLEA 2VI7A 2F5IA 4XPDB 1NSLA 2B4DB 2G3AA 4CRZB 4AVBA 1S60A 4Y49B 1MJ9A 1PUAA 3R9FA 5IB0A 1KUXA 4AVCA 1MJBA 4L89A 4R87A 2ZXVA 1XE4A 2R8VA 3D3SA 3DDDA 3SXOA 2OU2A 4PSXA 1LRZA 1M4IA 1YVOA 2FCKA 2G3TA 2B58A 3KKWA 3PGPA 4HKFA 3VWDA 5CNPA 3DNSA 2PRBA 2AJ6A 2ATRA 5F48A 2ZPAA 1QSTA 4F6AA 4OADA 2FT0A 4IF5A 2RC4A 4U9YA 1M44A 2GE3A 4AG7A 1KUYA 4GS4A 1M4DA 4NEXA 2B3UA 3F8KA 1Z9UA 4XPKA 3FBUA 5EBVA 2JLMA 4I49A 2A4NA 1YGHA 4B5PA 3CXQA 1VKCA 4UBRA 2I79A 4M85A 2J8RA 2EUIA 4KOWA 2KCWA 2P6EA 2QIRA 3D8PA 3QAHA 1WWZA 5C88A 2JDDA 5DWMA 4E8OA 1WK4A 3OWCA 4KORA 5C82A 1IICA 3TOBA 2Q44A 2IL4A 1S7LA 5JPHA 1U6MA 2DXQA 3ZJ0A 1KUVA 3SHPA 2REFA 2PR1A 4KOUA 4FD5A 4PK3A 2CNMA 1M4GA 4X5KA 1S7FA 4AVAA 2GANA 1V0CA 4NSQA 2Q04A 2ARHA 2OZGA 4KOSA 3VWEA 2HUZA 2J8NA 1Q2YA 4FD6A 2REEA 2ZW4A 1QSMA 4HNYB 1M1DA 1IYLA 2O28A 2HV2A 3S6FA 3JVNA 4KOVA 4ZBGA 1Q2CA 3RYOA 1GHEA 2ZW7A 2X7BA 1UFHA 2ZW5A 1S7NA 4MY3A 4PSWA 2Z10A 2D4PA 3G3SA 4R57A 4R9MA 4AB7A 3D2MA 4CAWA 4IUSA 3W91A 4AG9A 4XPDC 5I0CA 3S6GA 2B4DA 3N7ZA 3I3GA 3BLNA 2OZHA 3IWGA 2H5MA 2PQ8A 5KTCA 3TE4A 5IX3A 3WR7A 2CNSA 3S6KA 1IB1E 3DSBA 2B3VA 2ZW6A 3R1KA 4RI1A 3JUWA 4XNHB 3TTHA 3DR8A 2WPWA 5FVJA 4QVTA 4MBUA 3FB3A 2JEVA 1Y9KA 4RS2A 4QBJA 3FNCA 1Q2DA 4B5OA 5J8FA 1P0HA 4LUAA 3B8GA 3T9YA 1ON0A 4QC6A 2Q7BA 2VBQA 2FS5A 2R7HA 3CXSA 3FYNA 3GYAA 3R95A 3F5BA 2Z0ZA 4R3LA 2JDCA 4HNWB 1TIQA 1YREA 4CAVA 1OZPA 3T90A 2PR8A 3QB8A 4ORFA 3R96A 4OAEA 1Z4RA 1BO4A 4JD6A 1XMTA 4QB9A 4H89A 4KUBA 2FIWA 2QECA 4HNXB 3TOAA 1QSRA 4KOYA 5JQ4A 2Q0YA 5J8CA 2D4OA 2FXFA 3GKRA 5HH1A 2WPXA 4H6UA 5E96A 1PU9A 4KLVA 2P6FA 2FIAA 4EVYA 4J3GA 2HQYA 3EFAA 1I12A 3H4QA 3D2PA 3EXNA 1K4JA 3E0KA 4U5YA 1FY7A 5KTAA 5F49A 3TT2A 3BJ7A 1IIDA 5DWNA 3IGRA 5ISVA 2G0BA 3V8IA 3TO7A 3LODA 1I21A 3FRMA 4DNCA 4KZTA 3BJ8A 4BMHA 1KZFA 1MK4A 1I1DA 4ONUA 3TO6A 2Q4YA 1VHSA 3EO4A 3MGDA 1QSNA 4MY0A 1YR0A 2FL4A 2B5GA 4F0YA 3K9UA 5GCNA 3DR6A 1XIXA 3TFYA 4K30A 3EY5A 2BSWA 1S5KA 2BEIA 4NCZA 3NE7A 2CNTA 3CXPA 1R57A 2PC1A 3LD2A 1QSOA 2OZUA 1MJAA 4KOTA 2C27A 3R9EA 1CJWA 2P0WA 5F47A 4FD4A 5HMNA 5EC4A 3S6HA 2FE7A 4XPLA 4KVXA 4U9ZA 1S7KA 2OB0A 1YVKA 4II9A 3PZJA 3W6SA 5KTDA 4PK2A 4OLLA 2CY2A 5H84A 1L0CA 5H86A 3PP9A 2EVNA 1RXTA 4KUAA 4KVOE 2R98A 2VQYA 4LX9A 2J8MA 4FD7A 2Y0MA 2FSRA 4UA3A 4JLYA 3FXTA 2P6GA 4E0AA 1RO5A 4YFJA 3G8WA 1B87A 2BL1A 3R9GA 2NMTA 1YX0A 3F0AA 4KVME 2I00A 2Z11A 4YRHA 4PV6A
chains in the Genus database with same CATH superfamily
2VL1A 2QMLA 3P2HA 3C26A 2B5GB 2GREA 4JXRA 1LFWA 1Z2LA 2AE6A 3RBUA 2DPSA 3K2KA 2C6GA 2WSAA 4M3SA 4QUSA 1FT7A 4Y49C 3TO9A 3I9SA 3V38A 1XMBA 4KLWA 4UWJA 1B6BA 4B11A 1F57A 1XEBA 5AG4A 1SQHA 2Q43A 1N71A 2WUUA 1YSJA 2VEZA 2IQ6A 4CS0B 3W6XA 4P10A 2ZEGA 2ODFA 4NXYA 4UCPA 3EC4A 4R3KA 1TF9A 1Y0YA 4C68A 1Z4EA 1M4LA 4R7MA 4B6ZA 4JXQA 1CM0A 4KOXA 2Q4VA 2FVGA 4XNHC 2CTBA 1ZLHA 1Y9WA 2PDOA 1NMTA 2QJ8A 1CP6A 3B3TA 4MMOA 1VGYA 2B4BA 3HLPA 4CAXA 1CBXA 1Z5RA 2JBJA 1BOBA 2HB6A 4YGOA 1TKFA 1XF8A 1YK3A 4IHMA 4X3RA 4MI4A 4OC2A 3TCVA 3FIXA 1NE9A 3P2FA 3S9MA 4A30A 1S3ZA 1Z8LA 3PFEA 4NJQA 4E2AA 4BD9A 3FX6A 2OH1A 4NF1A 2Z3NA 1IYKA 2K5TA 4MCSA 4YWYA 1ELMP 2NSMA 2ZOFA 2PSWA 4JWPA 2BUEA 3HUVA 4A94A 4NGPA 1Y7RA 3GY9A 4UWIA 3SXNA 4K3NA 2BCOA 4H6ZA 3BXMA 4BINA 1P4NA 3UY5A 5F46A 5IV0A 1J4JA 4CRYB 4Q7AA 3IU1A 4CYPA 3RO0A 1CPSA 3KR5A 4HPSA 3ZZIA 3VATA 2VZYA 1ZLIA 2VXKA 3IJ3A 4L8AA 4CGNA 4NCZA 4P4JA 4B5PB 4RUHA 2PJ4A 2GIVA 3B3SA 4MHDA 2R1IA 4KS9A 2DEAA 3N5FA 2PJ6A 2PE3A 2VZZA 4MJ8A 2G9DA 4C7IA 1YW6A 4JJXA 1YLEA 2VI7A 1XBUA 2AFUA 2F5IA 4XPDB 5THWA 2PJ2A 1QQ9A 1YQEA 4P4EA 1NSLA 3KR4A 2B4DB 2G3AA 4MFLA 2ABZA 4CRZB 5LRKA 2EK8A 4P4DA 3PBBA 4AVBA 1S60A 3GLJA 4Y49B 5CBMA 1MJ9A 1PUAA 4NGTA 3R9FA 5IB0A 1KUXA 3QNVA 4CPAA 2AFWA 4OKOA 5A28A 3FF3A 4AVCA 2JEWA 2V8VA 4MFZA 1MJBA 2Z3LA 4M6IA 4MHZA 3WC6A 3DGVA 4L89A 2ZXVA 4R87A 4A33A 1EE3P 1XE4A 2R8VA 2CIJA 3D3SA 3DDDA 2QYVA 3SXOA 1LAPA 1VIXA 2OU2A 4PSXA 1LRZA 1M4IA 1YVOA 2BOAA 2FCKA 2B58A 2G3TA 3KKWA 5HXDA 3PGPA 1PYTB 4HKFA 1CG2A 2RB7A 3CZXA 3VWDA 8CPAA 5CNPA 3I1UA 3IC1A 4MFKA 2Q7SA 2GLFA 4NGQA 1BLLE 3DNSA 1Y7EA 2PRBA 2AJ6A 2ATRA 2WYRA 5F48A 3D7FA 5JM6A 2ZPAA 3NH5A 1XFOA 1QSTA 1VHEA 1H8LA 5AG5A 4F6AA 4OADA 5K8OA 2FT0A 4IF5A 1ARMA 2RC4A 1BAVA 4C2ZA 3ISXA 4OC4A 4U9YA 5AGEA 1M44A 4UCMA 2GE3A 4AG7A 2XEGA 1KUYA 4GS4A 1M4DA 2PJAA 3V7ZA 3D7DA 4NEXA 5EMIA 2B3UA 2I3CA 3F8KA 2EWBA 1Z9UA 3FEDA 4XPKA 3FBUA 4R76A 5EBVA 4MRIA 1RTQA 3NFZA 2JLMA 4I49A 2A4NA 1YGHA 3D7GA 2YNEA 1VKCA 3CXQA 4UBRA 4B5PA 4FAIA 6CPAA 2XEJA 3RAMA 2I79A 4M85A 4ZY0A 2J8RA 2EUIA 5JH9A 4KOWA 1HDUA 2KCWA 2P6EA 2QIRA 2QVPA 3D8PA 1WWZA 3GUXA 3QAHA 4KSIA 5C88A 2JDDA 5DWMA 4E8OA 2PVWA 2C1CA 1WK4A 2DF5A 2ZEDA 3OWCA 2PJBA 4KORA 4W9YA 2PJ3A 3B3VA 5C82A 2YNCA 5ELYA 2RFHA 4UIAA 1IICA 3TOBA 1A2ZA 2PIYA 2Q44A 5IB9A 4GM5A 2IL4A 1JWQA 3MRUA 2V77A 1S7LA 3JRUA 4CAFA 1QMUA 3FJUA 4ZYQA 2AFMA 3TC8A 1U6MA 2DXQA 5JPHA 3ISZA 4RN7A 3WT4A 3ZJ0A 1KUVA 3SHPA 5G1ZA 2Z3MA 2REFA 3WC7A 3QAYA 2PR1A 2PRQA 3FECA 4KOUA 4FD5A 4KSFA 4PK3A 4P45A 4NJRA 2CNMA 2YNCC 4C7HA 4DYOA 4P4BA 1M4GA 4X5KA 1S7FA 4AVAA 3D4UA 1AUGA 1HDQA 2GANA 1V0CA 4NSQA 1AMPA 2Q04A 7CPAA 2ARHA 2Q4ZA 3RNZA 2OZGA 2PCUA 4KOSA 2EBJA 3GIUA 3VWEA 2HUZA 3T8WA 4CAEA 1FNOA 4CGPA 3IWEA 2J8NA 1UWYA 2PJ0A 1Q2YA 4FD6A 4MFJA 4X2TA 2REEA 3VARA 3SI2A 4B10A 2OOTA 2ZW4A 1QSMA 1CP7A 2V8HA 1M1DA 4HNYB 4LQ6A 1IYLA 3DLJA 2O28A 2HV2A 1VHOA 3JVNA 3S6FA 4BBHA 2Z3KA 3PBEA 4KOVA 5D8NA 4ZBGA 1Q2CA 2IMOA 2OR4A 3NA6A 1ZG7A 3RYOA 2AFSA 1GHEA 4UEZA 2ZW7A 2X7BA 1UFHA 5CPAA 2ZW5A 1S7NA 4MY3A 3RZAA 3D68A 4PSWA 2Z10A 4PPZA 2D4PA 1NSAA 2F8HA 3G3SA 3NH4A 5BWAB 1LANA 1TKHA 4R57A 3B3WA 4R9MA 4AB7A 3D2MA 4CAWA 2XEIA 1DE4C 2PIZA 1IOIA 4IUSA 3W91A 4AG9A 4XPDC 4ZY1A 3S6GA 5I0CA 2B4DA 3KZWA 4Q36A 3N7ZA 3I3GA 3SJXA 1LAMA 3BLNA 2OZHA 3IWGA 2H5MA 4PV6A 2PQ8A 2ZEMA 5KTCA 3TE4A 5IX3A 3WR7A 2CNSA 3D66A 3WABA 3TX8A 3S6KA 1IB1E 3DSBA 2B3VA 2HC9A 2ZW6A 3R1KA 5LRGA 2DPTA 2AFXA 2ZEEA 4RI1A 4A2ZA 3JUWA 1JQGA 2POKA 4EMEA 2ZENA 4XNHB 3TTHA 3DR8A 2ZEHA 2WPWA 5J1QA 2ZEPA 2C6CA 5FVJA 3FMCA 2O4HA 4MXUA 4FWUA 3PB6X 4C2XA 4QVTA 4MBUA 2GLJA 3FB3A 3B7IA 3K9TA 4ZI6A 2PJ9A 2JEVA 5D29A 2WZNA 1Y9KA 1OBRA 4RS2A 4TWEA 3FNCA 3SJGA 1Q2DA 4B5OA 4QBJA 5J8FA 4H2KA 1P0HA 4M6GA 4FUUA 2NYQA 4GXHA 3PEIA 1XOVA 1X10A 4LUAA 4A32A 3S9NA 3S9LA 2PJ1A 4NGRA 4CGMA 3B8GA 3T9YA 1ON0A 2AFZA 4QC6A 1IU8A 2Q7BA 5LYIA 3D7HA 2VBQA 3B35A 2FS5A 2R7HA 4AXVA 2V8GA 1TF8A 3CXSA 4NGMA 3FYNA 4A39A 3GYAA 3R95A 3D67A 3F5BA 2Z0ZA 3IIBA 4Q38A 4R3LA 2JDCA 4MFQA 4HNWB 1TIQA 1YREA 4CAVA 4UFWA 1OZPA 3T90A 2PR8A 3H5ZA 4A31A 3H8GA 4O23A 3CT9A 3QB8A 3SI1A 2PJ7A 4EWTA 4ORFA 1LCPA 3R96A 5F09A 4OAEA 3FH4A 4OC5A 1Z4RA 1BO4A 3LWUA 1XMTA 4JD6A 4UFVA 3IU2A 3NE8A 4QB9A 4H89A 4KUBA 2FIWA 2QECA 4HNXB 5HVGA 3TOAA 5AG6A 3BI0A 4UEEA 2BO9A 5LRJA 1QSRA 4KOYA 4X8IA 5JQ4A 2Q0YA 2F7VA 4FBEA 3PB9X 3VH9A 3PB8X 4MCPA 4B13A 2ZEFA 5J8CA 1Q7LA 2D4OA 3IEHA 4IK2A 3CPAA 2O53A 3JTKA 1Z8TA 4A38A 4F8ZA 4CGOA 5HVHA 3FEEA 3GB0A 5LYDA 4ZGYB 1BPMA 4PXCA 5A27A 2CTCA 2EO8A 2FXFA 3GKRA 3LMSA 5HH1A 4UCNA 4PXDA 4UFXA 2WPXA 2JBKA 1DTDA 4H6UA 4OC3A 5E96A 1PU9A 3KHZA 4ZX8A 4ZY2A 4OC1A 4R8FA 4KLVA 1XRYA 3BI1A 1IGBA 1R3NA 2P6FA 4JZ0A 2Q51A 2FIAA 4EVYA 2PJ8A 2HQYA 3EFAA 4J3GA 1I12A 4NFRA 1R43A 5LYLA 1AYEA 3H4QA 3D2PA 4MCRA 3KQXA 3EXNA 1K4JA 2CF4A 4YU9A 3E0KA 2CXAA 1FY7A 4U5YA 4F9VA 5KTAA 5F49A 3TT2A 5AG7A 3BJ7A 3KL9A 1IIDA 5DWNA 4CYOA 4OIDA 3IGRA 5ISVA 2G0BA 3V8IA 3WC5A 1ZO0A 1GYTA 3KHXA 4A95A 3TO7A 4PXBA 3LODA 4R6TA 3PRTA 1I21A 5I4MA 3FRMA 1BPNA 1X12A 3LACA 4B14A 4G1PA 2ZOGA 4MHPA 4DNCA 2XEFA 3BJ8A 4KZTA 1YW4A 4NGSA 4MCQA 4BMHA 4DJLA 3B3CA 1KZFA 1MK4A 1I1DA 4ONUA 3TO6A 2Q4YA 1TKJA 1VHSA 3BHXA 3EO4A 3MGDA 1F2OA 1QSNA 5LYFA 4IAVA 2PVVA 4F0XA 4MY0A 3SJEA 4UF4A 1CPXA 3L2NA 1YR0A 1KWMA 1Z8XA 2B5GA 2FL4A 4P4FA 4F0YA 5G20A 1YMEA 4TNUA 4F9UA 3PB7X 3K9UA 4OIWA 5GCNA 3DR6A 1XIXA 2Z3PA 4K30A 3EY5A 2BSWA 4ONWA 3CDXA 3TFYA 1S5KA 1YLOA 2BEIA 3H8FA 3IFEA 3NE7A 2CNTA 1ARLA 3CXPA 3NH8A 1R57A 2PC1A 3LD2A 4NGNA 2Z3OA 2ZELA 1QSOA 1IOFA 2OZUA 1MJAA 3H8EA 4KOTA 2C27A 4WJBA 3SI0A 3R9EA 1CJWA 4PXEA 2P0WA 1Y0RA 5F47A 3MN8A 4FD4A 5HMNA 5DS0A 3IO1A 5EC4A 5G22A 3S6HA 2FE7A 4XPLA 3FVLA 5HVFA 4KVXA 4DUKA 4M6HA 4U9ZA 1S7KA 2J9AA 2OB0A 1HEEA 1YVKA 2V8DA 2EK9A 4II9A 3PZJA 5K8PA 3W6SA 2PJ5A 4MHNA 3SJFA 5KTDA 4OLLA 4MHYA 4PK2A 4Z65A 2CY2A 3KASA 5H84A 2C6PA 3IWWA 4KSAA 1L0CA 5H86A 3PP9A 2ANPA 2EVNA 3KGQA 4P4IA 5K8NA 1RXTA 4KUAA 1ZG8A 3KI9A 2R98A 2VQYA 3B2YA 4KVOE 4UEFA 4A37A 3PFOA 5JGFA 4LX9A 2J8MA 2IJZA 4PQAA 4FD7A 2Y0MA 4OP4A 4JYWA 2FSRA 4CGLA 4CYQA 4UA3A 2YNDA 4P44A 4JLYA 4MFPA 4B12A 2ZEOA 2AFOA 2P6GA 2GU2A 3FXTA 4ZX9A 4OMEA 1RO5A 4CYNA 2GFQA 4E0AA 3PB4X 4YFJA 1ZG9A 2YGWA 3G8WA 4UIBA 1XJOA 1TXRA 4EFDA 5K8MA 1B87A 2BL1A 3R9GA 1F2PA 4P6YA 1ELLP 4WWVA 2NMTA 4C2YA 1YX0A 2PJCA 3F0AA 1PCAA 1Z8WA 3CPXA 4LQGA 1IY7A 4KVME 4OC0A 2I00A 2Z11A 4YRHA 5G21A 3A9LA 1LOKA 1CX8A 3KQZA
chains in the Genus database with same CATH topology
2QMLA 3P2HA 3C26A 2B5GB 4JXRA 2AE6A 2DPSA 4QUSA 2WSAA 4M3SA 4Y49C 3TO9A 3I9SA 4KLWA 4UWJA 1B6BA 4B11A 1XEBA 5AG4A 1SQHA 1N71A 2WUUA 2VEZA 4CS0B 3W6XA 4UCPA 4NXYA 3EC4A 4R3KA 4C68A 1Z4EA 4JXQA 1CM0A 4KOXA 2Q4VA 4XNHC 1Y9WA 2PDOA 1NMTA 2B4BA 4CAXA 1BOBA 4YGOA 1XF8A 1YK3A 4MI4A 3TCVA 3FIXA 1NE9A 3P2FA 4A30A 1S3ZA 4E2AA 2OH1A 4NF1A 2Z3NA 1IYKA 2K5TA 2PSWA 4JWPA 2BUEA 1Y7RA 3GY9A 4UWIA 3SXNA 4H6ZA 1P4NA 3UY5A 5F46A 5IV0A 1J4JA 4CRYB 3IU1A 4CYPA 3ZZIA 2VZYA 2VXKA 4L8AA 4CGNA 4B5PB 2GIVA 4MHDA 2R1IA 4KS9A 2VZZA 4MJ8A 4C7IA 4JJXA 1YLEA 2VI7A 2F5IA 4XPDB 1NSLA 2B4DB 2G3AA 4MFLA 4CRZB 4AVBA 1S60A 4Y49B 1MJ9A 1PUAA 3R9FA 5IB0A 1KUXA 5A28A 4AVCA 4MFZA 1MJBA 2Z3LA 4L89A 2ZXVA 4R87A 4A33A 1XE4A 2R8VA 3D3SA 3DDDA 3SXOA 2OU2A 4PSXA 1LRZA 1M4IA 1YVOA 2FCKA 2G3TA 2B58A 3KKWA 3PGPA 4HKFA 3VWDA 5CNPA 4MFKA 3DNSA 2PRBA 2AJ6A 2ATRA 5F48A 2ZPAA 1QSTA 5AG5A 4F6AA 4OADA 2FT0A 4IF5A 2RC4A 4C2ZA 4U9YA 5AGEA 1M44A 4UCMA 2GE3A 4AG7A 1KUYA 4GS4A 1M4DA 4NEXA 2B3UA 3F8KA 1Z9UA 4XPKA 3FBUA 5EBVA 2JLMA 4I49A 2A4NA 1YGHA 4B5PA 2YNEA 1VKCA 3CXQA 4UBRA 2I79A 4M85A 2J8RA 2EUIA 4KOWA 2KCWA 2P6EA 2QIRA 3D8PA 3QAHA 1WWZA 5C88A 2JDDA 5DWMA 4E8OA 1WK4A 3OWCA 4KORA 5C82A 2YNCA 1IICA 3TOBA 2Q44A 2IL4A 4CAFA 1S7LA 5JPHA 1U6MA 2DXQA 3ZJ0A 1KUVA 3SHPA 5G1ZA 2Z3MA 2REFA 2PR1A 4KOUA 4FD5A 4KSFA 4PK3A 2CNMA 2YNCC 4C7HA 1M4GA 4X5KA 1S7FA 4AVAA 2GANA 1V0CA 4NSQA 2Q04A 2ARHA 2OZGA 4KOSA 3VWEA 2HUZA 4CAEA 4CGPA 3IWEA 2J8NA 1Q2YA 4FD6A 4MFJA 2REEA 4B10A 2ZW4A 1QSMA 4HNYB 1M1DA 1IYLA 4BBHA 2O28A 2HV2A 3S6FA 3JVNA 2Z3KA 4KOVA 4ZBGA 1Q2CA 3RYOA 1GHEA 2ZW7A 2X7BA 1UFHA 2ZW5A 1S7NA 4MY3A 4PSWA 2Z10A 2D4PA 3G3SA 5BWAB 4R57A 4R9MA 4AB7A 3D2MA 4CAWA 4IUSA 3W91A 4AG9A 4XPDC 5I0CA 3S6GA 2B4DA 4Q36A 3N7ZA 3I3GA 3BLNA 2OZHA 3IWGA 2H5MA 2PQ8A 5KTCA 3TE4A 5IX3A 3WR7A 2CNSA 3S6KA 1IB1E 3DSBA 2B3VA 2ZW6A 3R1KA 2DPTA 4RI1A 4A2ZA 3JUWA 4XNHB 3TTHA 3DR8A 2WPWA 5FVJA 4C2XA 4QVTA 4MBUA 3FB3A 2JEVA 1Y9KA 4RS2A 4QBJA 3FNCA 1Q2DA 4B5OA 5J8FA 1P0HA 4A32A 4LUAA 4CGMA 3B8GA 3T9YA 1ON0A 4QC6A 2Q7BA 2VBQA 2FS5A 2R7HA 3CXSA 3FYNA 3GYAA 3R95A 3F5BA 2Z0ZA 4R3LA 2JDCA 4MFQA 4HNWB 1TIQA 1YREA 4CAVA 4UFWA 1OZPA 3T90A 2PR8A 3H5ZA 4A31A 3QB8A 4ORFA 3R96A 4OAEA 1Z4RA 1BO4A 4JD6A 1XMTA 4UFVA 3IU2A 4QB9A 4H89A 4KUBA 2FIWA 2QECA 4HNXB 3TOAA 5AG6A 1QSRA 4KOYA 5JQ4A 2Q0YA 4B13A 5J8CA 2D4OA 3JTKA 4CGOA 4ZGYB 5A27A 2FXFA 3GKRA 5HH1A 4UCNA 4UFXA 2WPXA 4H6UA 5E96A 1PU9A 4KLVA 2P6FA 2FIAA 4EVYA 4J3GA 2HQYA 3EFAA 1I12A 3H4QA 3D2PA 3EXNA 1K4JA 3E0KA 2CXAA 1FY7A 4U5YA 5KTAA 5F49A 3TT2A 5AG7A 3BJ7A 1IIDA 5DWNA 4CYOA 3IGRA 5ISVA 2G0BA 3V8IA 1ZO0A 4A95A 3TO7A 3LODA 1I21A 3FRMA 4B14A 4DNCA 4KZTA 3BJ8A 4BMHA 1KZFA 1MK4A 1I1DA 4ONUA 3TO6A 2Q4YA 1VHSA 3EO4A 3MGDA 1QSNA 4F0XA 4MY0A 1YR0A 2FL4A 2B5GA 4F0YA 5G20A 3K9UA 5GCNA 3DR6A 1XIXA 2Z3PA 4K30A 3EY5A 2BSWA 3TFYA 1S5KA 2BEIA 4NCZA 3NE7A 2CNTA 3CXPA 1R57A 2PC1A 3LD2A 2Z3OA 1QSOA 2OZUA 1MJAA 4KOTA 2C27A 3R9EA 1CJWA 2P0WA 5F47A 4FD4A 5HMNA 5EC4A 3S6HA 5G22A 2FE7A 4XPLA 4KVXA 4U9ZA 1S7KA 2OB0A 1YVKA 4II9A 3PZJA 3W6SA 5KTDA 4OLLA 4PK2A 2CY2A 5H84A 4KSAA 1L0CA 5H86A 3PP9A 2EVNA 1RXTA 4KUAA 4KVOE 2R98A 2VQYA 4LX9A 2J8MA 4FD7A 2Y0MA 2FSRA 4CGLA 4CYQA 4UA3A 2YNDA 4JLYA 4MFPA 4B12A 3FXTA 2P6GA 4CYNA 4E0AA 1RO5A 4YFJA 2YGWA 3G8WA 1B87A 2BL1A 3R9GA 4C2YA 2NMTA 1YX0A 3F0AA 4KVME 2I00A 2Z11A 4YRHA 5G21A 3A9LA 4PV6A 4Q38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QML A;  3P2H A;  3C26 A;  2B5G B;  4JXR A;  2AE6 A;  4QUS A;  4M3S A;  4Y49 C;  3TO9 A;  3I9S A;  4KLW A;  4UWJ A;  1B6B A;  1XEB A;  1SQH A;  1N71 A;  2VEZ A;  4CS0 B;  3W6X A;  4NXY A;  3EC4 A;  4R3K A;  1Z4E A;  4JXQ A;  1CM0 A;  4KOX A;  2Q4V A;  4XNH C;  1Y9W A;  2PDO A;  1NMT A;  2B4B A;  4CAX A;  1BOB A;  4YGO A;  1XF8 A;  1YK3 A;  4MI4 A;  3TCV A;  3FIX A;  1NE9 A;  3P2F A;  1S3Z A;  4E2A A;  2OH1 A;  4NF1 A;  1IYK A;  2K5T A;  2PSW A;  4JWP A;  2BUE A;  1Y7R A;  3GY9 A;  4UWI A;  3SXN A;  4H6Z A;  1P4N A;  3UY5 A;  5F46 A;  5IV0 A;  1J4J A;  4CRY B;  3ZZI A;  2VZY A;  2VXK A;  4L8A A;  4B5P B;  2GIV A;  4MHD A;  2R1I A;  2VZZ A;  4MJ8 A;  4JJX A;  1YLE A;  2VI7 A;  2F5I A;  4XPD B;  1NSL A;  2B4D B;  2G3A A;  4CRZ B;  4AVB A;  1S60 A;  4Y49 B;  1MJ9 A;  1PUA A;  3R9F A;  5IB0 A;  1KUX A;  4AVC A;  1MJB A;  4L89 A;  4R87 A;  2ZXV A;  1XE4 A;  2R8V A;  3D3S A;  3DDD A;  3SXO A;  2OU2 A;  4PSX A;  1LRZ A;  1M4I A;  1YVO A;  2FCK A;  2G3T A;  2B58 A;  3KKW A;  3PGP A;  4HKF A;  3VWD A;  5CNP A;  3DNS A;  2PRB A;  2AJ6 A;  2ATR A;  5F48 A;  2ZPA A;  1QST A;  4F6A A;  4OAD A;  2FT0 A;  4IF5 A;  2RC4 A;  4U9Y A;  1M44 A;  2GE3 A;  4AG7 A;  1KUY A;  4GS4 A;  1M4D A;  4NEX A;  2B3U A;  3F8K A;  1Z9U A;  4XPK A;  3FBU A;  5EBV A;  2JLM A;  4I49 A;  2A4N A;  1YGH A;  4B5P A;  3CXQ A;  1VKC A;  4UBR A;  2I79 A;  4M85 A;  2J8R A;  2EUI A;  4KOW A;  2KCW A;  2P6E A;  2QIR A;  3D8P A;  3QAH A;  1WWZ A;  5C88 A;  2JDD A;  5DWM A;  4E8O A;  1WK4 A;  3OWC A;  4KOR A;  5C82 A;  1IIC A;  3TOB A;  2Q44 A;  2IL4 A;  1S7L A;  5JPH A;  1U6M A;  2DXQ A;  3ZJ0 A;  1KUV A;  3SHP A;  2REF A;  2PR1 A;  4KOU A;  4FD5 A;  4PK3 A;  2CNM A;  1M4G A;  4X5K A;  1S7F A;  4AVA A;  2GAN A;  1V0C A;  4NSQ A;  2Q04 A;  2ARH A;  2OZG A;  4KOS A;  3VWE A;  2HUZ A;  2J8N A;  1Q2Y A;  4FD6 A;  2REE A;  2ZW4 A;  1QSM A;  4HNY B;  1M1D A;  1IYL A;  2O28 A;  2HV2 A;  3S6F A;  3JVN A;  4KOV A;  4ZBG A;  1Q2C A;  3RYO A;  1GHE A;  2ZW7 A;  2X7B A;  1UFH A;  2ZW5 A;  1S7N A;  4MY3 A;  4PSW A;  2Z10 A;  2D4P A;  3G3S A;  4R57 A;  4R9M A;  4AB7 A;  3D2M A;  4CAW A;  4IUS A;  3W91 A;  4AG9 A;  4XPD C;  5I0C A;  3S6G A;  2B4D A;  3N7Z A;  3I3G A;  3BLN A;  2OZH A;  3IWG A;  2H5M A;  2PQ8 A;  5KTC A;  3TE4 A;  5IX3 A;  3WR7 A;  2CNS A;  3S6K A;  1IB1 E;  3DSB A;  2B3V A;  2ZW6 A;  3R1K A;  4RI1 A;  3JUW A;  4XNH B;  3TTH A;  3DR8 A;  2WPW A;  5FVJ A;  4QVT A;  4MBU A;  3FB3 A;  2JEV A;  1Y9K A;  4RS2 A;  4QBJ A;  3FNC A;  1Q2D A;  4B5O A;  5J8F A;  1P0H A;  4LUA A;  3B8G A;  3T9Y A;  1ON0 A;  4QC6 A;  2Q7B A;  2VBQ A;  2FS5 A;  2R7H A;  3CXS A;  3FYN A;  3GYA A;  3R95 A;  3F5B A;  2Z0Z A;  4R3L A;  2JDC A;  4HNW B;  1TIQ A;  1YRE A;  4CAV A;  1OZP A;  3T90 A;  2PR8 A;  3QB8 A;  4ORF A;  3R96 A;  4OAE A;  1Z4R A;  1BO4 A;  4JD6 A;  1XMT A;  4QB9 A;  4H89 A;  4KUB A;  2FIW A;  2QEC A;  4HNX B;  3TOA A;  1QSR A;  4KOY A;  5JQ4 A;  2Q0Y A;  5J8C A;  2D4O A;  2FXF A;  3GKR A;  5HH1 A;  2WPX A;  4H6U A;  5E96 A;  1PU9 A;  4KLV A;  2P6F A;  2FIA A;  4EVY A;  4J3G A;  2HQY A;  3EFA A;  1I12 A;  3H4Q A;  3D2P A;  3EXN A;  1K4J A;  3E0K A;  4U5Y A;  1FY7 A;  5KTA A;  5F49 A;  3TT2 A;  3BJ7 A;  1IID A;  5DWN A;  3IGR A;  5ISV A;  2G0B A;  3V8I A;  3TO7 A;  3LOD A;  1I21 A;  3FRM A;  4DNC A;  4KZT A;  3BJ8 A;  4BMH A;  1KZF A;  1MK4 A;  1I1D A;  4ONU A;  3TO6 A;  2Q4Y A;  1VHS A;  3EO4 A;  3MGD A;  1QSN A;  4MY0 A;  1YR0 A;  2FL4 A;  2B5G A;  4F0Y A;  3K9U A;  5GCN A;  3DR6 A;  1XIX A;  3TFY A;  4K30 A;  3EY5 A;  2BSW A;  1S5K A;  2BEI A;  4NCZ A;  3NE7 A;  2CNT A;  3CXP A;  1R57 A;  2PC1 A;  3LD2 A;  1QSO A;  2OZU A;  1MJA A;  4KOT A;  2C27 A;  3R9E A;  1CJW A;  2P0W A;  5F47 A;  4FD4 A;  5HMN A;  5EC4 A;  3S6H A;  2FE7 A;  4XPL A;  4KVX A;  4U9Z A;  1S7K A;  2OB0 A;  1YVK A;  4II9 A;  3PZJ A;  3W6S A;  5KTD A;  4PK2 A;  4OLL A;  2CY2 A;  5H84 A;  1L0C A;  5H86 A;  3PP9 A;  2EVN A;  1RXT A;  4KUA A;  4KVO E;  2R98 A;  2VQY A;  4LX9 A;  2J8M A;  4FD7 A;  2Y0M A;  2FSR A;  4UA3 A;  4JLY A;  3FXT A;  2P6G A;  4E0A A;  1RO5 A;  4YFJ A;  3G8W A;  1B87 A;  2BL1 A;  3R9G A;  2NMT A;  1YX0 A;  3F0A A;  4KVM E;  2I00 A;  2Z11 A;  4YRH A;  4PV6 A; 
#chains in the Genus database with same CATH topology
 2VL1 A;  2QML A;  3P2H A;  3C26 A;  2B5G B;  2GRE A;  4JXR A;  1LFW A;  1Z2L A;  2AE6 A;  3RBU A;  2DPS A;  3K2K A;  2C6G A;  2WSA A;  4M3S A;  4QUS A;  1FT7 A;  4Y49 C;  3TO9 A;  3I9S A;  3V38 A;  1XMB A;  4KLW A;  4UWJ A;  1B6B A;  4B11 A;  1F57 A;  1XEB A;  5AG4 A;  1SQH A;  2Q43 A;  1N71 A;  2WUU A;  1YSJ A;  2VEZ A;  2IQ6 A;  4CS0 B;  3W6X A;  4P10 A;  2ZEG A;  2ODF A;  4NXY A;  4UCP A;  3EC4 A;  4R3K A;  1TF9 A;  1Y0Y A;  4C68 A;  1Z4E A;  1M4L A;  4R7M A;  4B6Z A;  4JXQ A;  1CM0 A;  4KOX A;  2Q4V A;  2FVG A;  4XNH C;  2CTB A;  1ZLH A;  1Y9W A;  2PDO A;  1NMT A;  2QJ8 A;  1CP6 A;  3B3T A;  4MMO A;  1VGY A;  2B4B A;  3HLP A;  4CAX A;  1CBX A;  1Z5R A;  2JBJ A;  1BOB A;  2HB6 A;  4YGO A;  1TKF A;  1XF8 A;  1YK3 A;  4IHM A;  4X3R A;  4MI4 A;  4OC2 A;  3TCV A;  3FIX A;  1NE9 A;  3P2F A;  3S9M A;  4A30 A;  1S3Z A;  1Z8L A;  3PFE A;  4NJQ A;  4E2A A;  4BD9 A;  3FX6 A;  2OH1 A;  4NF1 A;  2Z3N A;  1IYK A;  2K5T A;  4MCS A;  4YWY A;  1ELM P;  2NSM A;  2ZOF A;  2PSW A;  4JWP A;  2BUE A;  3HUV A;  4A94 A;  4NGP A;  1Y7R A;  3GY9 A;  4UWI A;  3SXN A;  4K3N A;  2BCO A;  4H6Z A;  3BXM A;  4BIN A;  1P4N A;  3UY5 A;  5F46 A;  5IV0 A;  1J4J A;  4CRY B;  4Q7A A;  3IU1 A;  4CYP A;  3RO0 A;  1CPS A;  3KR5 A;  4HPS A;  3ZZI A;  3VAT A;  2VZY A;  1ZLI A;  2VXK A;  3IJ3 A;  4L8A A;  4CGN A;  4NCZ A;  4P4J A;  4B5P B;  4RUH A;  2PJ4 A;  2GIV A;  3B3S A;  4MHD A;  2R1I A;  4KS9 A;  2DEA A;  3N5F A;  2PJ6 A;  2PE3 A;  2VZZ A;  4MJ8 A;  2G9D A;  4C7I A;  1YW6 A;  4JJX A;  1YLE A;  2VI7 A;  1XBU A;  2AFU A;  2F5I A;  4XPD B;  5THW A;  2PJ2 A;  1QQ9 A;  1YQE A;  4P4E A;  1NSL A;  3KR4 A;  2B4D B;  2G3A A;  4MFL A;  2ABZ A;  4CRZ B;  5LRK A;  2EK8 A;  4P4D A;  3PBB A;  4AVB A;  1S60 A;  3GLJ A;  4Y49 B;  5CBM A;  1MJ9 A;  1PUA A;  4NGT A;  3R9F A;  5IB0 A;  1KUX A;  3QNV A;  4CPA A;  2AFW A;  4OKO A;  5A28 A;  3FF3 A;  4AVC A;  2JEW A;  2V8V A;  4MFZ A;  1MJB A;  2Z3L A;  4M6I A;  4MHZ A;  3WC6 A;  3DGV A;  4L89 A;  2ZXV A;  4R87 A;  4A33 A;  1EE3 P;  1XE4 A;  2R8V A;  2CIJ A;  3D3S A;  3DDD A;  2QYV A;  3SXO A;  1LAP A;  1VIX A;  2OU2 A;  4PSX A;  1LRZ A;  1M4I A;  1YVO A;  2BOA A;  2FCK A;  2B58 A;  2G3T A;  3KKW A;  5HXD A;  3PGP A;  1PYT B;  4HKF A;  1CG2 A;  2RB7 A;  3CZX A;  3VWD A;  8CPA A;  5CNP A;  3I1U A;  3IC1 A;  4MFK A;  2Q7S A;  2GLF A;  4NGQ A;  1BLL E;  3DNS A;  1Y7E A;  2PRB A;  2AJ6 A;  2ATR A;  2WYR A;  5F48 A;  3D7F A;  5JM6 A;  2ZPA A;  3NH5 A;  1XFO A;  1QST A;  1VHE A;  1H8L A;  5AG5 A;  4F6A A;  4OAD A;  5K8O A;  2FT0 A;  4IF5 A;  1ARM A;  2RC4 A;  1BAV A;  4C2Z A;  3ISX A;  4OC4 A;  4U9Y A;  5AGE A;  1M44 A;  4UCM A;  2GE3 A;  4AG7 A;  2XEG A;  1KUY A;  4GS4 A;  1M4D A;  2PJA A;  3V7Z A;  3D7D A;  4NEX A;  5EMI A;  2B3U A;  2I3C A;  3F8K A;  2EWB A;  1Z9U A;  3FED A;  4XPK A;  3FBU A;  4R76 A;  5EBV A;  4MRI A;  1RTQ A;  3NFZ A;  2JLM A;  4I49 A;  2A4N A;  1YGH A;  3D7G A;  2YNE A;  1VKC A;  3CXQ A;  4UBR A;  4B5P A;  4FAI A;  6CPA A;  2XEJ A;  3RAM A;  2I79 A;  4M85 A;  4ZY0 A;  2J8R A;  2EUI A;  5JH9 A;  4KOW A;  1HDU A;  2KCW A;  2P6E A;  2QIR A;  2QVP A;  3D8P A;  1WWZ A;  3GUX A;  3QAH A;  4KSI A;  5C88 A;  2JDD A;  5DWM A;  4E8O A;  2PVW A;  2C1C A;  1WK4 A;  2DF5 A;  2ZED A;  3OWC A;  2PJB A;  4KOR A;  4W9Y A;  2PJ3 A;  3B3V A;  5C82 A;  2YNC A;  5ELY A;  2RFH A;  4UIA A;  1IIC A;  3TOB A;  1A2Z A;  2PIY A;  2Q44 A;  5IB9 A;  4GM5 A;  2IL4 A;  1JWQ A;  3MRU A;  2V77 A;  1S7L A;  3JRU A;  4CAF A;  1QMU A;  3FJU A;  4ZYQ A;  2AFM A;  3TC8 A;  1U6M A;  2DXQ A;  5JPH A;  3ISZ A;  4RN7 A;  3WT4 A;  3ZJ0 A;  1KUV A;  3SHP A;  5G1Z A;  2Z3M A;  2REF A;  3WC7 A;  3QAY A;  2PR1 A;  2PRQ A;  3FEC A;  4KOU A;  4FD5 A;  4KSF A;  4PK3 A;  4P45 A;  4NJR A;  2CNM A;  2YNC C;  4C7H A;  4DYO A;  4P4B A;  1M4G A;  4X5K A;  1S7F A;  4AVA A;  3D4U A;  1AUG A;  1HDQ A;  2GAN A;  1V0C A;  4NSQ A;  1AMP A;  2Q04 A;  7CPA A;  2ARH A;  2Q4Z A;  3RNZ A;  2OZG A;  2PCU A;  4KOS A;  2EBJ A;  3GIU A;  3VWE A;  2HUZ A;  3T8W A;  4CAE A;  1FNO A;  4CGP A;  3IWE A;  2J8N A;  1UWY A;  2PJ0 A;  1Q2Y A;  4FD6 A;  4MFJ A;  4X2T A;  2REE A;  3VAR A;  3SI2 A;  4B10 A;  2OOT A;  2ZW4 A;  1QSM A;  1CP7 A;  2V8H A;  1M1D A;  4HNY B;  4LQ6 A;  1IYL A;  3DLJ A;  2O28 A;  2HV2 A;  1VHO A;  3JVN A;  3S6F A;  4BBH A;  2Z3K A;  3PBE A;  4KOV A;  5D8N A;  4ZBG A;  1Q2C A;  2IMO A;  2OR4 A;  3NA6 A;  1ZG7 A;  3RYO A;  2AFS A;  1GHE A;  4UEZ A;  2ZW7 A;  2X7B A;  1UFH A;  5CPA A;  2ZW5 A;  1S7N A;  4MY3 A;  3RZA A;  3D68 A;  4PSW A;  2Z10 A;  4PPZ A;  2D4P A;  1NSA A;  2F8H A;  3G3S A;  3NH4 A;  5BWA B;  1LAN A;  1TKH A;  4R57 A;  3B3W A;  4R9M A;  4AB7 A;  3D2M A;  4CAW A;  2XEI A;  1DE4 C;  2PIZ A;  1IOI A;  4IUS A;  3W91 A;  4AG9 A;  4XPD C;  4ZY1 A;  3S6G A;  5I0C A;  2B4D A;  3KZW A;  4Q36 A;  3N7Z A;  3I3G A;  3SJX A;  1LAM A;  3BLN A;  2OZH A;  3IWG A;  2H5M A;  4PV6 A;  2PQ8 A;  2ZEM A;  5KTC A;  3TE4 A;  5IX3 A;  3WR7 A;  2CNS A;  3D66 A;  3WAB A;  3TX8 A;  3S6K A;  1IB1 E;  3DSB A;  2B3V A;  2HC9 A;  2ZW6 A;  3R1K A;  5LRG A;  2DPT A;  2AFX A;  2ZEE A;  4RI1 A;  4A2Z A;  3JUW A;  1JQG A;  2POK A;  4EME A;  2ZEN A;  4XNH B;  3TTH A;  3DR8 A;  2ZEH A;  2WPW A;  5J1Q A;  2ZEP A;  2C6C A;  5FVJ A;  3FMC A;  2O4H A;  4MXU A;  4FWU A;  3PB6 X;  4C2X A;  4QVT A;  4MBU A;  2GLJ A;  3FB3 A;  3B7I A;  3K9T A;  4ZI6 A;  2PJ9 A;  2JEV A;  5D29 A;  2WZN A;  1Y9K A;  1OBR A;  4RS2 A;  4TWE A;  3FNC A;  3SJG A;  1Q2D A;  4B5O A;  4QBJ A;  5J8F A;  4H2K A;  1P0H A;  4M6G A;  4FUU A;  2NYQ A;  4GXH A;  3PEI A;  1XOV A;  1X10 A;  4LUA A;  4A32 A;  3S9N A;  3S9L A;  2PJ1 A;  4NGR A;  4CGM A;  3B8G A;  3T9Y A;  1ON0 A;  2AFZ A;  4QC6 A;  1IU8 A;  2Q7B A;  5LYI A;  3D7H A;  2VBQ A;  3B35 A;  2FS5 A;  2R7H A;  4AXV A;  2V8G A;  1TF8 A;  3CXS A;  4NGM A;  3FYN A;  4A39 A;  3GYA A;  3R95 A;  3D67 A;  3F5B A;  2Z0Z A;  3IIB A;  4Q38 A;  4R3L A;  2JDC A;  4MFQ A;  4HNW B;  1TIQ A;  1YRE A;  4CAV A;  4UFW A;  1OZP A;  3T90 A;  2PR8 A;  3H5Z A;  4A31 A;  3H8G A;  4O23 A;  3CT9 A;  3QB8 A;  3SI1 A;  2PJ7 A;  4EWT A;  4ORF A;  1LCP A;  3R96 A;  5F09 A;  4OAE A;  3FH4 A;  4OC5 A;  1Z4R A;  1BO4 A;  3LWU A;  1XMT A;  4JD6 A;  4UFV A;  3IU2 A;  3NE8 A;  4QB9 A;  4H89 A;  4KUB A;  2FIW A;  2QEC A;  4HNX B;  5HVG A;  3TOA A;  5AG6 A;  3BI0 A;  4UEE A;  2BO9 A;  5LRJ A;  1QSR A;  4KOY A;  4X8I A;  5JQ4 A;  2Q0Y A;  2F7V A;  4FBE A;  3PB9 X;  3VH9 A;  3PB8 X;  4MCP A;  4B13 A;  2ZEF A;  5J8C A;  1Q7L A;  2D4O A;  3IEH A;  4IK2 A;  3CPA A;  2O53 A;  3JTK A;  1Z8T A;  4A38 A;  4F8Z A;  4CGO A;  5HVH A;  3FEE A;  3GB0 A;  5LYD A;  4ZGY B;  1BPM A;  4PXC A;  5A27 A;  2CTC A;  2EO8 A;  2FXF A;  3GKR A;  3LMS A;  5HH1 A;  4UCN A;  4PXD A;  4UFX A;  2WPX A;  2JBK A;  1DTD A;  4H6U A;  4OC3 A;  5E96 A;  1PU9 A;  3KHZ A;  4ZX8 A;  4ZY2 A;  4OC1 A;  4R8F A;  4KLV A;  1XRY A;  3BI1 A;  1IGB A;  1R3N A;  2P6F A;  4JZ0 A;  2Q51 A;  2FIA A;  4EVY A;  2PJ8 A;  2HQY A;  3EFA A;  4J3G A;  1I12 A;  4NFR A;  1R43 A;  5LYL A;  1AYE A;  3H4Q A;  3D2P A;  4MCR A;  3KQX A;  3EXN A;  1K4J A;  2CF4 A;  4YU9 A;  3E0K A;  2CXA A;  1FY7 A;  4U5Y A;  4F9V A;  5KTA A;  5F49 A;  3TT2 A;  5AG7 A;  3BJ7 A;  3KL9 A;  1IID A;  5DWN A;  4CYO A;  4OID A;  3IGR A;  5ISV A;  2G0B A;  3V8I A;  3WC5 A;  1ZO0 A;  1GYT A;  3KHX A;  4A95 A;  3TO7 A;  4PXB A;  3LOD A;  4R6T A;  3PRT A;  1I21 A;  5I4M A;  3FRM A;  1BPN A;  1X12 A;  3LAC A;  4B14 A;  4G1P A;  2ZOG A;  4MHP A;  4DNC A;  2XEF A;  3BJ8 A;  4KZT A;  1YW4 A;  4NGS A;  4MCQ A;  4BMH A;  4DJL A;  3B3C A;  1KZF A;  1MK4 A;  1I1D A;  4ONU A;  3TO6 A;  2Q4Y A;  1TKJ A;  1VHS A;  3BHX A;  3EO4 A;  3MGD A;  1F2O A;  1QSN A;  5LYF A;  4IAV A;  2PVV A;  4F0X A;  4MY0 A;  3SJE A;  4UF4 A;  1CPX A;  3L2N A;  1YR0 A;  1KWM A;  1Z8X A;  2B5G A;  2FL4 A;  4P4F A;  4F0Y A;  5G20 A;  1YME A;  4TNU A;  4F9U A;  3PB7 X;  3K9U A;  4OIW A;  5GCN A;  3DR6 A;  1XIX A;  2Z3P A;  4K30 A;  3EY5 A;  2BSW A;  4ONW A;  3CDX A;  3TFY A;  1S5K A;  1YLO A;  2BEI A;  3H8F A;  3IFE A;  3NE7 A;  2CNT A;  1ARL A;  3CXP A;  3NH8 A;  1R57 A;  2PC1 A;  3LD2 A;  4NGN A;  2Z3O A;  2ZEL A;  1QSO A;  1IOF A;  2OZU A;  1MJA A;  3H8E A;  4KOT A;  2C27 A;  4WJB A;  3SI0 A;  3R9E A;  1CJW A;  4PXE A;  2P0W A;  1Y0R A;  5F47 A;  3MN8 A;  4FD4 A;  5HMN A;  5DS0 A;  3IO1 A;  5EC4 A;  5G22 A;  3S6H A;  2FE7 A;  4XPL A;  3FVL A;  5HVF A;  4KVX A;  4DUK A;  4M6H A;  4U9Z A;  1S7K A;  2J9A A;  2OB0 A;  1HEE A;  1YVK A;  2V8D A;  2EK9 A;  4II9 A;  3PZJ A;  5K8P A;  3W6S A;  2PJ5 A;  4MHN A;  3SJF A;  5KTD A;  4OLL A;  4MHY A;  4PK2 A;  4Z65 A;  2CY2 A;  3KAS A;  5H84 A;  2C6P A;  3IWW A;  4KSA A;  1L0C A;  5H86 A;  3PP9 A;  2ANP A;  2EVN A;  3KGQ A;  4P4I A;  5K8N A;  1RXT A;  4KUA A;  1ZG8 A;  3KI9 A;  2R98 A;  2VQY A;  3B2Y A;  4KVO E;  4UEF A;  4A37 A;  3PFO A;  5JGF A;  4LX9 A;  2J8M A;  2IJZ A;  4PQA A;  4FD7 A;  2Y0M A;  4OP4 A;  4JYW A;  2FSR A;  4CGL A;  4CYQ A;  4UA3 A;  2YND A;  4P44 A;  4JLY A;  4MFP A;  4B12 A;  2ZEO A;  2AFO A;  2P6G A;  2GU2 A;  3FXT A;  4ZX9 A;  4OME A;  1RO5 A;  4CYN A;  2GFQ A;  4E0A A;  3PB4 X;  4YFJ A;  1ZG9 A;  2YGW A;  3G8W A;  4UIB A;  1XJO A;  1TXR A;  4EFD A;  5K8M A;  1B87 A;  2BL1 A;  3R9G A;  1F2P A;  4P6Y A;  1ELL P;  4WWV A;  2NMT A;  4C2Y A;  1YX0 A;  2PJC A;  3F0A A;  1PCA A;  1Z8W A;  3CPX A;  4LQG A;  1IY7 A;  4KVM E;  4OC0 A;  2I00 A;  2Z11 A;  4YRH A;  5G21 A;  3A9L A;  1LOK A;  1CX8 A;  3KQZ A; 
#chains in the Genus database with same CATH homology
 2QML A;  3P2H A;  3C26 A;  2B5G B;  4JXR A;  2AE6 A;  2DPS A;  4QUS A;  2WSA A;  4M3S A;  4Y49 C;  3TO9 A;  3I9S A;  4KLW A;  4UWJ A;  1B6B A;  4B11 A;  1XEB A;  5AG4 A;  1SQH A;  1N71 A;  2WUU A;  2VEZ A;  4CS0 B;  3W6X A;  4UCP A;  4NXY A;  3EC4 A;  4R3K A;  4C68 A;  1Z4E A;  4JXQ A;  1CM0 A;  4KOX A;  2Q4V A;  4XNH C;  1Y9W A;  2PDO A;  1NMT A;  2B4B A;  4CAX A;  1BOB A;  4YGO A;  1XF8 A;  1YK3 A;  4MI4 A;  3TCV A;  3FIX A;  1NE9 A;  3P2F A;  4A30 A;  1S3Z A;  4E2A A;  2OH1 A;  4NF1 A;  2Z3N A;  1IYK A;  2K5T A;  2PSW A;  4JWP A;  2BUE A;  1Y7R A;  3GY9 A;  4UWI A;  3SXN A;  4H6Z A;  1P4N A;  3UY5 A;  5F46 A;  5IV0 A;  1J4J A;  4CRY B;  3IU1 A;  4CYP A;  3ZZI A;  2VZY A;  2VXK A;  4L8A A;  4CGN A;  4B5P B;  2GIV A;  4MHD A;  2R1I A;  4KS9 A;  2VZZ A;  4MJ8 A;  4C7I A;  4JJX A;  1YLE A;  2VI7 A;  2F5I A;  4XPD B;  1NSL A;  2B4D B;  2G3A A;  4MFL A;  4CRZ B;  4AVB A;  1S60 A;  4Y49 B;  1MJ9 A;  1PUA A;  3R9F A;  5IB0 A;  1KUX A;  5A28 A;  4AVC A;  4MFZ A;  1MJB A;  2Z3L A;  4L89 A;  2ZXV A;  4R87 A;  4A33 A;  1XE4 A;  2R8V A;  3D3S A;  3DDD A;  3SXO A;  2OU2 A;  4PSX A;  1LRZ A;  1M4I A;  1YVO A;  2FCK A;  2G3T A;  2B58 A;  3KKW A;  3PGP A;  4HKF A;  3VWD A;  5CNP A;  4MFK A;  3DNS A;  2PRB A;  2AJ6 A;  2ATR A;  5F48 A;  2ZPA A;  1QST A;  5AG5 A;  4F6A A;  4OAD A;  2FT0 A;  4IF5 A;  2RC4 A;  4C2Z A;  4U9Y A;  5AGE A;  1M44 A;  4UCM A;  2GE3 A;  4AG7 A;  1KUY A;  4GS4 A;  1M4D A;  4NEX A;  2B3U A;  3F8K A;  1Z9U A;  4XPK A;  3FBU A;  5EBV A;  2JLM A;  4I49 A;  2A4N A;  1YGH A;  4B5P A;  2YNE A;  1VKC A;  3CXQ A;  4UBR A;  2I79 A;  4M85 A;  2J8R A;  2EUI A;  4KOW A;  2KCW A;  2P6E A;  2QIR A;  3D8P A;  3QAH A;  1WWZ A;  5C88 A;  2JDD A;  5DWM A;  4E8O A;  1WK4 A;  3OWC A;  4KOR A;  5C82 A;  2YNC A;  1IIC A;  3TOB A;  2Q44 A;  2IL4 A;  4CAF A;  1S7L A;  5JPH A;  1U6M A;  2DXQ A;  3ZJ0 A;  1KUV A;  3SHP A;  5G1Z A;  2Z3M A;  2REF A;  2PR1 A;  4KOU A;  4FD5 A;  4KSF A;  4PK3 A;  2CNM A;  2YNC C;  4C7H A;  1M4G A;  4X5K A;  1S7F A;  4AVA A;  2GAN A;  1V0C A;  4NSQ A;  2Q04 A;  2ARH A;  2OZG A;  4KOS A;  3VWE A;  2HUZ A;  4CAE A;  4CGP A;  3IWE A;  2J8N A;  1Q2Y A;  4FD6 A;  4MFJ A;  2REE A;  4B10 A;  2ZW4 A;  1QSM A;  4HNY B;  1M1D A;  1IYL A;  4BBH A;  2O28 A;  2HV2 A;  3S6F A;  3JVN A;  2Z3K A;  4KOV A;  4ZBG A;  1Q2C A;  3RYO A;  1GHE A;  2ZW7 A;  2X7B A;  1UFH A;  2ZW5 A;  1S7N A;  4MY3 A;  4PSW A;  2Z10 A;  2D4P A;  3G3S A;  5BWA B;  4R57 A;  4R9M A;  4AB7 A;  3D2M A;  4CAW A;  4IUS A;  3W91 A;  4AG9 A;  4XPD C;  5I0C A;  3S6G A;  2B4D A;  4Q36 A;  3N7Z A;  3I3G A;  3BLN A;  2OZH A;  3IWG A;  2H5M A;  2PQ8 A;  5KTC A;  3TE4 A;  5IX3 A;  3WR7 A;  2CNS A;  3S6K A;  1IB1 E;  3DSB A;  2B3V A;  2ZW6 A;  3R1K A;  2DPT A;  4RI1 A;  4A2Z A;  3JUW A;  4XNH B;  3TTH A;  3DR8 A;  2WPW A;  5FVJ A;  4C2X A;  4QVT A;  4MBU A;  3FB3 A;  2JEV A;  1Y9K A;  4RS2 A;  4QBJ A;  3FNC A;  1Q2D A;  4B5O A;  5J8F A;  1P0H A;  4A32 A;  4LUA A;  4CGM A;  3B8G A;  3T9Y A;  1ON0 A;  4QC6 A;  2Q7B A;  2VBQ A;  2FS5 A;  2R7H A;  3CXS A;  3FYN A;  3GYA A;  3R95 A;  3F5B A;  2Z0Z A;  4R3L A;  2JDC A;  4MFQ A;  4HNW B;  1TIQ A;  1YRE A;  4CAV A;  4UFW A;  1OZP A;  3T90 A;  2PR8 A;  3H5Z A;  4A31 A;  3QB8 A;  4ORF A;  3R96 A;  4OAE A;  1Z4R A;  1BO4 A;  4JD6 A;  1XMT A;  4UFV A;  3IU2 A;  4QB9 A;  4H89 A;  4KUB A;  2FIW A;  2QEC A;  4HNX B;  3TOA A;  5AG6 A;  1QSR A;  4KOY A;  5JQ4 A;  2Q0Y A;  4B13 A;  5J8C A;  2D4O A;  3JTK A;  4CGO A;  4ZGY B;  5A27 A;  2FXF A;  3GKR A;  5HH1 A;  4UCN A;  4UFX A;  2WPX A;  4H6U A;  5E96 A;  1PU9 A;  4KLV A;  2P6F A;  2FIA A;  4EVY A;  4J3G A;  2HQY A;  3EFA A;  1I12 A;  3H4Q A;  3D2P A;  3EXN A;  1K4J A;  3E0K A;  2CXA A;  1FY7 A;  4U5Y A;  5KTA A;  5F49 A;  3TT2 A;  5AG7 A;  3BJ7 A;  1IID A;  5DWN A;  4CYO A;  3IGR A;  5ISV A;  2G0B A;  3V8I A;  1ZO0 A;  4A95 A;  3TO7 A;  3LOD A;  1I21 A;  3FRM A;  4B14 A;  4DNC A;  4KZT A;  3BJ8 A;  4BMH A;  1KZF A;  1MK4 A;  1I1D A;  4ONU A;  3TO6 A;  2Q4Y A;  1VHS A;  3EO4 A;  3MGD A;  1QSN A;  4F0X A;  4MY0 A;  1YR0 A;  2FL4 A;  2B5G A;  4F0Y A;  5G20 A;  3K9U A;  5GCN A;  3DR6 A;  1XIX A;  2Z3P A;  4K30 A;  3EY5 A;  2BSW A;  3TFY A;  1S5K A;  2BEI A;  4NCZ A;  3NE7 A;  2CNT A;  3CXP A;  1R57 A;  2PC1 A;  3LD2 A;  2Z3O A;  1QSO A;  2OZU A;  1MJA A;  4KOT A;  2C27 A;  3R9E A;  1CJW A;  2P0W A;  5F47 A;  4FD4 A;  5HMN A;  5EC4 A;  3S6H A;  5G22 A;  2FE7 A;  4XPL A;  4KVX A;  4U9Z A;  1S7K A;  2OB0 A;  1YVK A;  4II9 A;  3PZJ A;  3W6S A;  5KTD A;  4OLL A;  4PK2 A;  2CY2 A;  5H84 A;  4KSA A;  1L0C A;  5H86 A;  3PP9 A;  2EVN A;  1RXT A;  4KUA A;  4KVO E;  2R98 A;  2VQY A;  4LX9 A;  2J8M A;  4FD7 A;  2Y0M A;  2FSR A;  4CGL A;  4CYQ A;  4UA3 A;  2YND A;  4JLY A;  4MFP A;  4B12 A;  3FXT A;  2P6G A;  4CYN A;  4E0A A;  1RO5 A;  4YFJ A;  2YGW A;  3G8W A;  1B87 A;  2BL1 A;  3R9G A;  4C2Y A;  2NMT A;  1YX0 A;  3F0A A;  4KVM E;  2I00 A;  2Z11 A;  4YRH A;  5G21 A;  3A9L A;  4PV6 A;  4Q38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...