4KOSA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefmetazole
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4kosA00
5J8FA 1Y9WA 3C26A 4M3SA 3ZZIA 4KOYA 1I21A 4JJXA 2J8NA 4YRHA 1RXTA 3SXNA 3S6FA 4NEXA 2JEVA 2ZW7A 5IB0A 2QMLA 2OU2A 2VXKA 4IUSA 4K30A 4KORA 3SXOA 1M44A 2ATRA 2Q4VA 1VKCA 4B5PA 1S3ZA 4AVBA 2P6EA 1L0CA 2B4BA 2J8RA 3E0KA 3R1KA 2ZW6A 4HNWB 5H84A 4YGOA 3KKWA 2OH1A 4UWJA 4FD4A 1WK4A 3D3SA 1N71A 4MY0A 4KVXA 1Q2CA 4X5KA 4QB9A 3R9GA 3V8IA 4MY3A 3BJ8A 2AE6A 2K5TA 1IB1E 2F5IA 1S7LA 2G3AA 3S6KA 4F6AA 1OZPA 2P6FA 1Z4EA 4H89A 2AJ6A 3P2HA 1QSMA 1BOBA 3TCVA 2PR8A 4UBRA 1CJWA 3FXTA 4J3GA 4U9ZA 3W6SA 2EVNA 1K4JA 4XPKA 2D4OA 1XIXA 2NMTA 3SHPA 4E2AA 1Q2YA 3F0AA 4JLYA 3GY9A 3GKRA 4L89A 5EBVA 3EXNA 2Q44A 4NCZA 4CS0B 4FD7A 1NE9A 2CNMA 3S6GA 1QSTA 2PRBA 5JPHA 1BO4A 2CNTA 1PU9A 3DSBA 3FBUA 4UWIA 3NE7A 1MJBA 1M4IA 2EUIA 3QAHA 2FT0A 2JDCA 1IYKA 1IICA 4KLWA 4KOSA 5JQ4A 4H6UA 2OB0A 2JLMA 1IIDA 2BL1A 1S60A 4FD6A 1YK3A 3R9EA 4I49A 1P4NA 1YX0A 3FB3A 1S5KA 1XF8A 4R87A 1FY7A 2P6GA 4CAXA 2BEIA 2FL4A 3R95A 4F0YA 4OADA 4E0AA 4Y49C 1PUAA 4AB7A 4GS4A 3R96A 3TO7A 4KLVA 3LODA 2CNSA 2R1IA 1MK4A 3TOBA 1IYLA 3DR6A 2QECA 5HMNA 2GANA 1M4GA 3W6XA 5IX3A 4KOVA 4NSQA 3UY5A 2BSWA 3BJ7A 4HKFA 4B5PB 4QUSA 1Y9KA 5I0CA 1B87A 3GYAA 2HUZA 2PSWA 1KUXA 4MI4A 2Q0YA 1I12A 2GE3A 2H5MA 3ZJ0A 4E8OA 4CAWA 4R57A 3TE4A 4CAVA 4QC6A 1YR0A 2KCWA 2ZW4A 4PV6A 3LD2A 3RYOA 1Y7RA 2ZPAA 3TOAA 2DXQA 5F48A 4KVOE 1YLEA 2FIAA 2Y0MA 2I00A 1MJ9A 2WPXA 4AVCA 3IWGA 3FNCA 2B5GA 4KUAA 2ARHA 3T90A 1QSNA 5DWMA 4YFJA 1ON0A 3JUWA 1QSRA 2ZW5A 4NXYA 4OAEA 3TFYA 2VBQA 3D2PA 2BUEA 2Z10A 2OZHA 2B3UA 4QVTA 4PK2A 3IGRA 1J4JA 2Q7BA 2FS5A 4LUAA 4XPLA 1KUVA 3EY5A 5GCNA 4PSXA 2PC1A 4JWPA 5FVJA 2PQ8A 2FXFA 2FIWA 1KZFA 3DR8A 5F47A 3CXQA 2B4DB 3I9SA 3FIXA 4FD5A 1KUYA 1S7NA 3MGDA 1P0HA 5F49A 3F5BA 1NMTA 2GIVA 4LX9A 4KOUA 2C27A 3PGPA 2Q04A 2OZGA 3PZJA 2WPWA 3QB8A 4MJ8A 1YVOA 3H4QA 4R3KA 3OWCA 4NF1A 4KUBA 5HH1A 2G0BA 5IV0A 4PSWA 2R98A 3PP9A 2A4NA 2Z0ZA 4U9YA 5KTCA 1Q2DA 4XNHB 3DNSA 4IF5A 2VZYA 1YGHA 4ORFA 4L8AA 2PR1A 4KOWA 2HQYA 3B8GA 4HNXB 2OZUA 4CRYB 1XE4A 4PK3A 3N7ZA 5H86A 3W91A 2P0WA 1CM0A 1S7FA 2B58A 2REFA 3G8WA 4MBUA 2Q4YA 4KVME 4H6ZA 3VWEA 5KTDA 2REEA 2G3TA 3S6HA 4BMHA 2FCKA 3CXSA 4ZBGA 4II9A 2CY2A 4AG9A 1V0CA 4RS2A 4XPDB 2Z11A 4EVYA 2B5GB 1YVKA 1U6MA 1Z9UA 3D2MA 3F8KA 1VHSA 2FE7A 3G3SA 4MHDA 4UA3A 4Y49B 2HV2A 4R9MA 2RC4A 5C88A 1NSLA 3R9FA 1QSOA 4CRZB 1GHEA 2JDDA 4U5YA 3VWDA 1XEBA 3I3GA 4JXRA 1I1DA 3CXPA 4B5OA 2D4PA 2O28A 1RO5A 3TO6A 2I79A 2PDOA 3EC4A 3T9YA 5EC4A 3WR7A 3BLNA 3TTHA 3DDDA 1M4DA 3TO9A 1YREA 5KTAA 2ZXVA 2FSRA 2VZZA 4R3LA 3EO4A 5J8CA 4QBJA 5ISVA 4M85A 3FRMA 4AVAA 4XNHC 5C82A 2QIRA 3EFAA 3D8PA 2VQYA 4KOTA 4AG7A 2VI7A 4OLLA 1SQHA 3TT2A 1B6BA 5F46A 4DNCA 1WWZA 3P2FA 1UFHA 2B4DA 3FYNA 1XMTA 4HNYB 1S7KA 4KZTA 2X7BA 3JVNA 4XPDC 4KOXA 5E96A 2J8MA 2R7HA 2IL4A 1LRZA 1TIQA 2R8VA 1Z4RA 4JXQA 1MJAA 4RI1A 2VEZA 1M1DA 5DWNA 2B3VA 5CNPA 4JD6A 1R57A 3K9UA 4ONUA
chains in the Genus database with same CATH superfamily
2CTCA 4MHNA 3VARA 5J8FA 1Y9WA 3D67A 3V7ZA 3C26A 4M3SA 3ZZIA 3WC7A 4KOYA 4DUKA 1I21A 4JJXA 2J8NA 4YRHA 4YWYA 1RXTA 3SXNA 4JYWA 3S6FA 4NEXA 2JEVA 1ZLHA 2PJ6A 1CX8A 2YNDA 2ZW7A 2PJ3A 5IB0A 4NJRA 2QMLA 4JZ0A 2OU2A 2VXKA 4IUSA 4MFQA 4MCRA 4K30A 4KORA 4A95A 3SXOA 1LAMA 1M44A 2ATRA 2Q4VA 1XMBA 1VKCA 4ONWA 4AXVA 4B5PA 1DTDA 4MRIA 2PRQA 1PCAA 4OC1A 4KS9A 3GB0A 1S3ZA 5G20A 4B14A 4C7HA 4AVBA 3BI0A 1XJOA 3DGVA 4F9UA 1H8LA 2P6EA 2CTBA 3IC1A 1L0CA 4PXBA 5LRGA 4F0XA 4KSFA 2B4BA 3RNZA 2J8RA 3E0KA 1BPMA 2ZEEA 3CT9A 3H5ZA 2ZW6A 3R1KA 4HNWB 5H84A 4YGOA 3KKWA 4CYNA 2OH1A 4UWJA 2AFMA 5G21A 4FD4A 1WK4A 4MFLA 3D3SA 1N71A 4MY0A 6CPAA 4KVXA 1Q2CA 4NGNA 4P44A 3D66A 4X5KA 4QB9A 3R9GA 1F57A 3V8IA 1Q7LA 3NE8A 4MY3A 3BJ8A 2AE6A 2K5TA 2O53A 4UEEA 1IB1E 2F5IA 1S7LA 2ZEPA 2G3AA 4MCQA 4ZYQA 3S6KA 4F6AA 3BI1A 5HXDA 1OZPA 2P6FA 1Z4EA 3S9MA 3RBUA 4H89A 2AJ6A 3KR5A 3P2HA 1QSMA 3SJEA 1BOBA 5AG6A 2QJ8A 3TCVA 2PR8A 4UBRA 1R3NA 2EWBA 3GUXA 1CJWA 3FXTA 1FT7A 3JTKA 4J3GA 4U9ZA 1CP6A 4MHYA 1BAVA 1JWQA 3IJ3A 2ZEMA 2QVPA 3D7DA 3W6SA 2EVNA 1K4JA 4XPKA 2D4OA 1XIXA 2NMTA 3SHPA 4E2AA 1ZG9A 3NFZA 1Q2YA 3PBEA 3F0AA 3SJXA 4DYOA 4JLYA 3GY9A 3NH5A 3GKRA 4L89A 5EBVA 3EXNA 4NGTA 4NGRA 2Q44A 4NCZA 4FWUA 4CS0B 2AFWA 4FD7A 1IU8A 1NE9A 2CNMA 2Q4ZA 1QSTA 2PRBA 3BXMA 3S6GA 4C68A 5JH9A 5JPHA 1BO4A 4MCSA 5K8NA 2CNTA 2C6CA 3PB4X 1X10A 4CGNA 3B3TA 1QMUA 3KASA 3LMSA 1PU9A 4IAVA 3DSBA 3FBUA 5F09A 1TKFA 4UWIA 3KQZA 3NE7A 1MJBA 4LQ6A 1M4IA 3D7FA 3NA6A 2EUIA 2G9DA 3GIUA 2FT0A 3QAHA 5HVFA 2JDCA 2PJ1A 7CPAA 2PIZA 3JRUA 1IYKA 4UIAA 2C6GA 2V77A 1IICA 4OC4A 4KLWA 4KOSA 1YQEA 5JQ4A 1ZG8A 2ODFA 4PPZA 2ZOGA 2OB0A 2JLMA 4H6UA 3CPXA 4X2TA 2YNCC 1IIDA 2BL1A 2C6PA 4OIWA 1TKJA 2GLFA 4CPAA 4F8ZA 1S60A 4FD6A 1YK3A 3R9EA 4I49A 3WT4A 1P4NA 1YX0A 5AG5A 4ZGYB 3FB3A 3FH4A 5LYIA 1S5KA 1XF8A 1HEEA 4R87A 4ZX8A 3IWWA 2V8HA 1BLLE 1FY7A 2P6GA 3FVLA 3KQXA 4X8IA 1RTQA 4C2ZA 4CAXA 2BEIA 2FL4A 3PBBA 2YGWA 4C7IA 3R95A 4F0YA 5LRKA 4OADA 4E0AA 4Y49C 4A94A 1PUAA 4AB7A 4GS4A 4A32A 4P4FA 4M6HA 3R96A 3TO7A 4KLVA 3LODA 3WC6A 2CNSA 2R1IA 2Z3NA 1MK4A 3TOBA 1IYLA 3DR6A 4NGMA 4B11A 1A2ZA 2QECA 2AFZA 4FUUA 2VL1A 5HMNA 3V38A 4EFDA 5LYFA 1Z8TA 2GANA 4KSIA 4CYOA 1M4GA 2JBKA 3W6XA 3WC5A 4ZY0A 5IX3A 4P4DA 4KOVA 4NSQA 3UY5A 2BSWA 3D7GA 3BJ7A 4HKFA 4B5PB 3S9NA 4QUSA 4O23A 2AFSA 1Y9KA 5I0CA 2PE3A 5AG7A 5I4MA 1B87A 3GYAA 4B12A 1Y7EA 2HUZA 2PSWA 1KUXA 1AUGA 4MI4A 4UFXA 2IMOA 2Q0YA 1I12A 4UEZA 3KZWA 2GE3A 2AFXA 2H5MA 3ZJ0A 2ZENA 4PXEA 4E8OA 3WABA 4CAWA 1ARMA 4R57A 3TE4A 1ELLP 4CAVA 3A9LA 1JQGA 4OC5A 1YR0A 4QC6A 4A31A 1PYTB 2KCWA 2ZW4A 4PV6A 3LD2A 2WYRA 4H2KA 4BINA 5LYLA 1EE3P 2HC9A 2PJCA 3KHXA 3IU1A 3RYOA 1YSJA 4WWVA 5LRJA 1Y0YA 1Y7RA 2Z3PA 2ZPAA 3TOAA 5CPAA 2DXQA 4UF4A 5F48A 4KVOE 1LOKA 1YLEA 3N5FA 1IOIA 2FIAA 3IIBA 3IWEA 5HVGA 5A27A 3VATA 2Y0MA 2I00A 1MJ9A 3B35A 3B7IA 3B3CA 2WPXA 4CAFA 3K9TA 4OC3A 4AVCA 3IWGA 3RAMA 3FNCA 4UIBA 2PVVA 2B5GA 4KUAA 2EBJA 2GREA 2ARHA 2YNEA 4OC2A 1X12A 2OOTA 2BOAA 4A38A 1ZO0A 3T90A 3FECA 1FNOA 2PJAA 1ZLIA 1QSNA 5DWMA 2DPTA 1ON0A 4YFJA 3JUWA 1Z8LA 1QSRA 2CIJA 2ZW5A 4RUHA 3PEIA 4NXYA 4UCMA 3HLPA 4OAEA 4W9YA 3TFYA 2J9AA 2VBQA 3D2PA 2BUEA 2Z10A 2OZHA 3NH8A 2PJ8A 2B3UA 4QVTA 3SI1A 2NYQA 4P4IA 2Q7SA 4PK2A 1OBRA 1IOFA 1YW4A 4A2ZA 2ZEOA 3IGRA 3PB7X 4NFRA 5A28A 5K8OA 4OP4A 1J4JA 2PJBA 4GXHA 2Z3KA 2Q7BA 2FS5A 3KI9A 4PQAA 1LFWA 2WSAA 4LUAA 4XPLA 1KUVA 5J1QA 4OMEA 3EY5A 5GCNA 2DPSA 5CBMA 4PSXA 2PC1A 2JBJA 4JWPA 5FVJA 2PQ8A 2FXFA 3KHZA 2FIWA 3TC8A 1KZFA 3ISXA 2DF5A 4MFPA 3DR8A 2IQ6A 3B3VA 5F47A 1XFOA 2F7VA 3PFEA 3B3WA 3CXQA 1HDUA 2B4DB 2PJ0A 3I9SA 2GU2A 3FIXA 1YLOA 4BD9A 4CGLA 4FD5A 1KUYA 3PFOA 3GLJA 1M4LA 4A37A 5IB9A 3K2KA 1S7NA 3MGDA 1P0HA 4R7MA 3KGQA 4PXCA 3F5BA 5DS0A 5F49A 1NMTA 2GIVA 4LX9A 4NGSA 4KOUA 4P4EA 5AGEA 2WZNA 2F8HA 4G1PA 1DE4C 4F9VA 5EMIA 2XEJA 4HPSA 2C27A 1LANA 3PGPA 2Q04A 5G1ZA 5AG4A 2OZGA 3I1UA 1XBUA 4UFWA 3B2YA 3PZJA 4UCPA 4R76A 4OIDA 4R6TA 1R43A 1ELMP 2Q51A 3H8GA 4P4JA 2WPWA 3QB8A 4MJ8A 4P10A 1YVOA 3H4QA 4R3KA 4OC0A 3FX6A 5THWA 3OWCA 4ZI6A 2PCUA 2PJ9A 4NF1A 2GFQA 5K8PA 4CGPA 4KUBA 3MN8A 5JGFA 3D7HA 4P6YA 4IHMA 4CYQA 2EK9A 2C1CA 3IFEA 2PJ5A 3PB6X 4UEFA 2G0BA 5HH1A 2DEAA 5IV0A 2AFOA 4PSWA 2R98A 3PP9A 5JM6A 2A4NA 1TF8A 2GLJA 2Z0ZA 4U9YA 5KTCA 1Q2DA 2O4HA 3DNSA 4XNHB 4IF5A 2V8DA 5D29A 2IJZA 5HVHA 2VZYA 1YGHA 2PJ4A 1IGBA 4ORFA 4L8AA 4GM5A 2PR1A 4KOWA 2HQYA 4R8FA 3B8GA 1VHOA 4HNXB 2OZUA 5D8NA 4B10A 3FMCA 2JEWA 4CRYB 4P45A 1TF9A 3NH4A 1XE4A 4PK3A 3N7ZA 4MFKA 4ZX9A 5H86A 3SI0A 2P0WA 3D4UA 3HUVA 1CM0A 1S7FA 2B58A 3W91A 2REFA 3G8WA 1XRYA 1CG2A 4MBUA 2Q4YA 4KVME 1VIXA 4H6ZA 4PXDA 4NGQA 5G22A 3VWEA 5KTDA 3ISZA 2REEA 4K3NA 2G3TA 4CYPA 3S6HA 3LWUA 4BMHA 2FCKA 3CXSA 4ZBGA 2YNCA 3IU2A 2EO8A 4II9A 2CY2A 4Q38A 4MFZA 4AG9A 1V0CA 4OKOA 4RS2A 2ZEGA 4FBEA 3MRUA 4XPDB 2Z11A 3BHXA 4EVYA 2B5GB 1YVKA 3H8EA 1U6MA 1Z2LA 1Z9UA 1AMPA 4P4BA 3D2MA 4YU9A 1F2OA 2I3CA 3F8KA 5K8MA 1VHSA 2FE7A 3G3SA 4CGMA 4MHDA 2PJ7A 4UA3A 1UWYA 1CP7A 3QNVA 4Y49B 2HV2A 4R9MA 4B13A 2RC4A 1AYEA 1GYTA 2PIYA 5C88A 4UCNA 1NSLA 1BPNA 2PVWA 3R9FA 4FAIA 1QSOA 2RB7A 2BCOA 1YMEA 4ZY1A 4WJBA 1XOVA 4LQGA 2CF4A 1GHEA 2CXAA 2JDDA 4A30A 4CRZB 4MMOA 3LACA 4U5YA 3VWDA 1TXRA 1XEBA 1IY7A 3I3GA 4JXRA 4MHPA 2ZELA 1I1DA 3CXPA 4C2XA 3IEHA 4B5OA 2NSMA 2D4PA 1CPXA 2O28A 1RO5A 3TO6A 2I79A 2HB6A 2PDOA 1QQ9A 2ZEHA 4X3RA 3EC4A 3T9YA 5EC4A 3WR7A 3BLNA 2Z3LA 4RN7A 2XEGA 3PRTA 4MCPA 3QAYA 1ZG7A 3S9LA 2ZEFA 1HDQA 4Z65A 1KWMA 4M6GA 3TTHA 3KL9A 2Z3MA 3DDDA 1M4DA 3TO9A 1YREA 2Z3OA 5KTAA 1VGYA 2ZXVA 4UFVA 2EK8A 2FSRA 4NJQA 2VZZA 4R3LA 1Y0RA 3RZAA 3EO4A 3H8FA 1F2PA 3TX8A 5J8CA 3VH9A 1TKHA 4NGPA 4QBJA 2AFUA 5ISVA 1LCPA 3B3SA 4EMEA 3SI2A 4M85A 3SJGA 4A39A 4CAEA 3FRMA 4AVAA 4XNHC 4ZY2A 2PJ2A 5C82A 5LYDA 3KR4A 2ABZA 3FJUA 4MFJA 4EWTA 3PB9X 1VHEA 3FEEA 4CGOA 4A33A 2QIRA 4IK2A 3EFAA 3D8PA 3IO1A 2VQYA 4KOTA 5BWAB 4AG7A 2VI7A 4OLLA 1SQHA 1Z5RA 4C2YA 3TT2A 3CPAA 5ELYA 2FVGA 1YW6A 2ZEDA 1B6BA 5F46A 2BO9A 4DNCA 4TNUA 1WWZA 4Q7AA 2RFHA 3P2FA 1CBXA 1Z8XA 1UFHA 2B4DA 3FYNA 1XMTA 4HNYB 2WUUA 4B6ZA 4Q36A 3SJFA 2ANPA 1S7KA 3PB8X 1Z8WA 2QYVA 3FEDA 4KZTA 2OR4A 3T8WA 8CPAA 2V8GA 1CPSA 2X7BA 2XEFA 3JVNA 4XPDC 1NSAA 3D68A 4KOXA 5E96A 2Q43A 4DJLA 4M6IA 2J8MA 2ZOFA 4MXUA 3CDXA 4TWEA 1ARLA 2R7HA 2XEIA 4KSAA 4BBHA 2IL4A 4MHZA 1LAPA 1LRZA 1TIQA 2R8VA 1Z4RA 3DLJA 4JXQA 3CZXA 1MJAA 2POKA 4RI1A 2VEZA 1M1DA 3RO0A 5DWNA 3L2NA 2B3VA 3FF3A 5CNPA 4JD6A 2V8VA 1R57A 3K9UA 4ONUA
chains in the Genus database with same CATH topology
5J8FA 1Y9WA 3C26A 4M3SA 3ZZIA 4KOYA 1I21A 4JJXA 2J8NA 4YRHA 1RXTA 3SXNA 3S6FA 4NEXA 2JEVA 2ZW7A 2YNDA 5IB0A 2QMLA 2OU2A 2VXKA 4IUSA 4MFQA 4K30A 4KORA 4A95A 3SXOA 1M44A 2ATRA 2Q4VA 1VKCA 4B5PA 4KS9A 4B14A 1S3ZA 5G20A 4C7HA 4AVBA 2P6EA 1L0CA 4F0XA 4KSFA 2B4BA 2J8RA 3E0KA 3H5ZA 3R1KA 2ZW6A 4HNWB 5H84A 4YGOA 3KKWA 4CYNA 2OH1A 4UWJA 5G21A 4FD4A 1WK4A 4MFLA 3D3SA 1N71A 4MY0A 4KVXA 1Q2CA 4X5KA 4QB9A 3R9GA 3V8IA 4MY3A 3BJ8A 2AE6A 2K5TA 1IB1E 2F5IA 1S7LA 2G3AA 3S6KA 4F6AA 1OZPA 2P6FA 1Z4EA 4H89A 2AJ6A 3P2HA 1QSMA 1BOBA 5AG6A 3TCVA 2PR8A 4UBRA 1CJWA 3FXTA 3JTKA 4J3GA 4U9ZA 3W6SA 2EVNA 1K4JA 4XPKA 2D4OA 1XIXA 2NMTA 3SHPA 4E2AA 1Q2YA 3F0AA 4JLYA 3GY9A 3GKRA 4L89A 5EBVA 3EXNA 2Q44A 4NCZA 4CS0B 4FD7A 1NE9A 2CNMA 3S6GA 1QSTA 2PRBA 4C68A 5JPHA 1BO4A 2CNTA 4CGNA 1PU9A 3DSBA 3FBUA 4UWIA 3NE7A 1MJBA 1M4IA 2EUIA 3QAHA 2FT0A 2JDCA 1IYKA 1IICA 4KLWA 4KOSA 5JQ4A 4H6UA 2OB0A 2JLMA 2YNCC 1IIDA 2BL1A 1S60A 4FD6A 1YK3A 3R9EA 4I49A 1P4NA 1YX0A 5AG5A 4ZGYB 3FB3A 1S5KA 1XF8A 4R87A 1FY7A 2P6GA 4C2ZA 4CAXA 2BEIA 2FL4A 2YGWA 4C7IA 3R95A 4F0YA 4OADA 4E0AA 4Y49C 1PUAA 4AB7A 4GS4A 4A32A 3R96A 3TO7A 4KLVA 3LODA 2CNSA 2R1IA 2Z3NA 1MK4A 3TOBA 1IYLA 3DR6A 4B11A 2QECA 5HMNA 2GANA 4CYOA 1M4GA 3W6XA 5IX3A 4KOVA 4NSQA 3UY5A 2BSWA 3BJ7A 4HKFA 4B5PB 4QUSA 1Y9KA 5I0CA 5AG7A 1B87A 3GYAA 4B12A 2HUZA 2PSWA 1KUXA 4MI4A 4UFXA 2Q0YA 1I12A 2GE3A 2H5MA 3ZJ0A 4E8OA 4CAWA 4R57A 3TE4A 4CAVA 3A9LA 4QC6A 1YR0A 4A31A 2KCWA 2ZW4A 4PV6A 3LD2A 3IU1A 3RYOA 1Y7RA 2Z3PA 2ZPAA 3TOAA 2DXQA 5F48A 4KVOE 1YLEA 2FIAA 3IWEA 5A27A 2Y0MA 2I00A 1MJ9A 4CAFA 2WPXA 4AVCA 3IWGA 3FNCA 2B5GA 4KUAA 2ARHA 2YNEA 1ZO0A 3T90A 1QSNA 5DWMA 2DPTA 1ON0A 4YFJA 3JUWA 1QSRA 2ZW5A 4NXYA 4UCMA 4OAEA 3TFYA 3D2PA 2VBQA 2BUEA 2Z10A 2OZHA 2B3UA 4QVTA 4PK2A 4A2ZA 3IGRA 5A28A 1J4JA 2Q7BA 2Z3KA 2FS5A 2WSAA 4LUAA 4XPLA 1KUVA 3EY5A 5GCNA 2DPSA 4PSXA 2PC1A 4JWPA 5FVJA 2PQ8A 2FXFA 2FIWA 1KZFA 4MFPA 3DR8A 5F47A 3CXQA 2B4DB 3I9SA 3FIXA 4CGLA 4FD5A 1KUYA 1S7NA 3MGDA 1P0HA 5F49A 3F5BA 1NMTA 2GIVA 4LX9A 4KOUA 5AGEA 2C27A 5G1ZA 3PGPA 2Q04A 5AG4A 2OZGA 4UFWA 3PZJA 4UCPA 2WPWA 3QB8A 4MJ8A 1YVOA 3H4QA 4R3KA 3OWCA 4NF1A 4CGPA 4KUBA 4CYQA 5HH1A 2G0BA 5IV0A 4PSWA 2R98A 3PP9A 2A4NA 2Z0ZA 4U9YA 5KTCA 1Q2DA 4XNHB 3DNSA 4IF5A 2VZYA 1YGHA 4ORFA 4L8AA 2PR1A 4KOWA 2HQYA 3B8GA 4HNXB 2OZUA 4B10A 4CRYB 1XE4A 4PK3A 3N7ZA 4MFKA 5H86A 3W91A 2P0WA 1CM0A 1S7FA 2B58A 2REFA 3G8WA 4MBUA 2Q4YA 4KVME 4H6ZA 3VWEA 5G22A 5KTDA 2REEA 2G3TA 4CYPA 3S6HA 4BMHA 2FCKA 3CXSA 4ZBGA 2YNCA 3IU2A 4II9A 2CY2A 4Q38A 4MFZA 4AG9A 1V0CA 4RS2A 4XPDB 2Z11A 4EVYA 2B5GB 1YVKA 1U6MA 1Z9UA 3D2MA 3F8KA 1VHSA 2FE7A 3G3SA 4CGMA 4MHDA 4UA3A 4B13A 4Y49B 2HV2A 4R9MA 2RC4A 5C88A 4UCNA 1NSLA 3R9FA 1QSOA 4A30A 2CXAA 1GHEA 4CRZB 2JDDA 4U5YA 3VWDA 1XEBA 3I3GA 4C2XA 4JXRA 1I1DA 3CXPA 4B5OA 2D4PA 2O28A 1RO5A 3TO6A 2I79A 2PDOA 3EC4A 3T9YA 5EC4A 3WR7A 3BLNA 2Z3LA 3TTHA 2Z3MA 3DDDA 1M4DA 3TO9A 1YREA 2Z3OA 5KTAA 2ZXVA 4UFVA 2FSRA 2VZZA 4R3LA 3EO4A 5J8CA 4QBJA 5ISVA 4M85A 4CAEA 3FRMA 4AVAA 4XNHC 5C82A 4MFJA 4CGOA 4A33A 2QIRA 3EFAA 3D8PA 2VQYA 4KOTA 5BWAB 4AG7A 2VI7A 4OLLA 1SQHA 4C2YA 3TT2A 1B6BA 5F46A 4DNCA 1WWZA 3P2FA 1UFHA 2B4DA 3FYNA 1XMTA 4HNYB 2WUUA 4Q36A 1S7KA 4KZTA 2X7BA 3JVNA 4XPDC 4KOXA 5E96A 2J8MA 2R7HA 4KSAA 4BBHA 2IL4A 1LRZA 1TIQA 2R8VA 1Z4RA 4JXQA 1MJAA 4RI1A 2VEZA 1M1DA 5DWNA 2B3VA 5CNPA 4JD6A 1R57A 3K9UA 4ONUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8F A;  1Y9W A;  3C26 A;  4M3S A;  3ZZI A;  4KOY A;  1I21 A;  4JJX A;  2J8N A;  4YRH A;  1RXT A;  3SXN A;  3S6F A;  4NEX A;  2JEV A;  2ZW7 A;  5IB0 A;  2QML A;  2OU2 A;  2VXK A;  4IUS A;  4K30 A;  4KOR A;  3SXO A;  1M44 A;  2ATR A;  2Q4V A;  1VKC A;  4B5P A;  1S3Z A;  4AVB A;  2P6E A;  1L0C A;  2B4B A;  2J8R A;  3E0K A;  3R1K A;  2ZW6 A;  4HNW B;  5H84 A;  4YGO A;  3KKW A;  2OH1 A;  4UWJ A;  4FD4 A;  1WK4 A;  3D3S A;  1N71 A;  4MY0 A;  4KVX A;  1Q2C A;  4X5K A;  4QB9 A;  3R9G A;  3V8I A;  4MY3 A;  3BJ8 A;  2AE6 A;  2K5T A;  1IB1 E;  2F5I A;  1S7L A;  2G3A A;  3S6K A;  4F6A A;  1OZP A;  2P6F A;  1Z4E A;  4H89 A;  2AJ6 A;  3P2H A;  1QSM A;  1BOB A;  3TCV A;  2PR8 A;  4UBR A;  1CJW A;  3FXT A;  4J3G A;  4U9Z A;  3W6S A;  2EVN A;  1K4J A;  4XPK A;  2D4O A;  1XIX A;  2NMT A;  3SHP A;  4E2A A;  1Q2Y A;  3F0A A;  4JLY A;  3GY9 A;  3GKR A;  4L89 A;  5EBV A;  3EXN A;  2Q44 A;  4NCZ A;  4CS0 B;  4FD7 A;  1NE9 A;  2CNM A;  3S6G A;  1QST A;  2PRB A;  5JPH A;  1BO4 A;  2CNT A;  1PU9 A;  3DSB A;  3FBU A;  4UWI A;  3NE7 A;  1MJB A;  1M4I A;  2EUI A;  3QAH A;  2FT0 A;  2JDC A;  1IYK A;  1IIC A;  4KLW A;  4KOS A;  5JQ4 A;  4H6U A;  2OB0 A;  2JLM A;  1IID A;  2BL1 A;  1S60 A;  4FD6 A;  1YK3 A;  3R9E A;  4I49 A;  1P4N A;  1YX0 A;  3FB3 A;  1S5K A;  1XF8 A;  4R87 A;  1FY7 A;  2P6G A;  4CAX A;  2BEI A;  2FL4 A;  3R95 A;  4F0Y A;  4OAD A;  4E0A A;  4Y49 C;  1PUA A;  4AB7 A;  4GS4 A;  3R96 A;  3TO7 A;  4KLV A;  3LOD A;  2CNS A;  2R1I A;  1MK4 A;  3TOB A;  1IYL A;  3DR6 A;  2QEC A;  5HMN A;  2GAN A;  1M4G A;  3W6X A;  5IX3 A;  4KOV A;  4NSQ A;  3UY5 A;  2BSW A;  3BJ7 A;  4HKF A;  4B5P B;  4QUS A;  1Y9K A;  5I0C A;  1B87 A;  3GYA A;  2HUZ A;  2PSW A;  1KUX A;  4MI4 A;  2Q0Y A;  1I12 A;  2GE3 A;  2H5M A;  3ZJ0 A;  4E8O A;  4CAW A;  4R57 A;  3TE4 A;  4CAV A;  4QC6 A;  1YR0 A;  2KCW A;  2ZW4 A;  4PV6 A;  3LD2 A;  3RYO A;  1Y7R A;  2ZPA A;  3TOA A;  2DXQ A;  5F48 A;  4KVO E;  1YLE A;  2FIA A;  2Y0M A;  2I00 A;  1MJ9 A;  2WPX A;  4AVC A;  3IWG A;  3FNC A;  2B5G A;  4KUA A;  2ARH A;  3T90 A;  1QSN A;  5DWM A;  4YFJ A;  1ON0 A;  3JUW A;  1QSR A;  2ZW5 A;  4NXY A;  4OAE A;  3TFY A;  2VBQ A;  3D2P A;  2BUE A;  2Z10 A;  2OZH A;  2B3U A;  4QVT A;  4PK2 A;  3IGR A;  1J4J A;  2Q7B A;  2FS5 A;  4LUA A;  4XPL A;  1KUV A;  3EY5 A;  5GCN A;  4PSX A;  2PC1 A;  4JWP A;  5FVJ A;  2PQ8 A;  2FXF A;  2FIW A;  1KZF A;  3DR8 A;  5F47 A;  3CXQ A;  2B4D B;  3I9S A;  3FIX A;  4FD5 A;  1KUY A;  1S7N A;  3MGD A;  1P0H A;  5F49 A;  3F5B A;  1NMT A;  2GIV A;  4LX9 A;  4KOU A;  2C27 A;  3PGP A;  2Q04 A;  2OZG A;  3PZJ A;  2WPW A;  3QB8 A;  4MJ8 A;  1YVO A;  3H4Q A;  4R3K A;  3OWC A;  4NF1 A;  4KUB A;  5HH1 A;  2G0B A;  5IV0 A;  4PSW A;  2R98 A;  3PP9 A;  2A4N A;  2Z0Z A;  4U9Y A;  5KTC A;  1Q2D A;  4XNH B;  3DNS A;  4IF5 A;  2VZY A;  1YGH A;  4ORF A;  4L8A A;  2PR1 A;  4KOW A;  2HQY A;  3B8G A;  4HNX B;  2OZU A;  4CRY B;  1XE4 A;  4PK3 A;  3N7Z A;  5H86 A;  3W91 A;  2P0W A;  1CM0 A;  1S7F A;  2B58 A;  2REF A;  3G8W A;  4MBU A;  2Q4Y A;  4KVM E;  4H6Z A;  3VWE A;  5KTD A;  2REE A;  2G3T A;  3S6H A;  4BMH A;  2FCK A;  3CXS A;  4ZBG A;  4II9 A;  2CY2 A;  4AG9 A;  1V0C A;  4RS2 A;  4XPD B;  2Z11 A;  4EVY A;  2B5G B;  1YVK A;  1U6M A;  1Z9U A;  3D2M A;  3F8K A;  1VHS A;  2FE7 A;  3G3S A;  4MHD A;  4UA3 A;  4Y49 B;  2HV2 A;  4R9M A;  2RC4 A;  5C88 A;  1NSL A;  3R9F A;  1QSO A;  4CRZ B;  1GHE A;  2JDD A;  4U5Y A;  3VWD A;  1XEB A;  3I3G A;  4JXR A;  1I1D A;  3CXP A;  4B5O A;  2D4P A;  2O28 A;  1RO5 A;  3TO6 A;  2I79 A;  2PDO A;  3EC4 A;  3T9Y A;  5EC4 A;  3WR7 A;  3BLN A;  3TTH A;  3DDD A;  1M4D A;  3TO9 A;  1YRE A;  5KTA A;  2ZXV A;  2FSR A;  2VZZ A;  4R3L A;  3EO4 A;  5J8C A;  4QBJ A;  5ISV A;  4M85 A;  3FRM A;  4AVA A;  4XNH C;  5C82 A;  2QIR A;  3EFA A;  3D8P A;  2VQY A;  4KOT A;  4AG7 A;  2VI7 A;  4OLL A;  1SQH A;  3TT2 A;  1B6B A;  5F46 A;  4DNC A;  1WWZ A;  3P2F A;  1UFH A;  2B4D A;  3FYN A;  1XMT A;  4HNY B;  1S7K A;  4KZT A;  2X7B A;  3JVN A;  4XPD C;  4KOX A;  5E96 A;  2J8M A;  2R7H A;  2IL4 A;  1LRZ A;  1TIQ A;  2R8V A;  1Z4R A;  4JXQ A;  1MJA A;  4RI1 A;  2VEZ A;  1M1D A;  5DWN A;  2B3V A;  5CNP A;  4JD6 A;  1R57 A;  3K9U A;  4ONU A; 
#chains in the Genus database with same CATH topology
 2CTC A;  4MHN A;  3VAR A;  5J8F A;  1Y9W A;  3D67 A;  3V7Z A;  3C26 A;  4M3S A;  3ZZI A;  3WC7 A;  4KOY A;  4DUK A;  1I21 A;  4JJX A;  2J8N A;  4YRH A;  4YWY A;  1RXT A;  3SXN A;  4JYW A;  3S6F A;  4NEX A;  2JEV A;  1ZLH A;  2PJ6 A;  1CX8 A;  2YND A;  2ZW7 A;  2PJ3 A;  5IB0 A;  4NJR A;  2QML A;  4JZ0 A;  2OU2 A;  2VXK A;  4IUS A;  4MFQ A;  4MCR A;  4K30 A;  4KOR A;  4A95 A;  3SXO A;  1LAM A;  1M44 A;  2ATR A;  2Q4V A;  1XMB A;  1VKC A;  4ONW A;  4AXV A;  4B5P A;  1DTD A;  4MRI A;  2PRQ A;  1PCA A;  4OC1 A;  4KS9 A;  3GB0 A;  1S3Z A;  5G20 A;  4B14 A;  4C7H A;  4AVB A;  3BI0 A;  1XJO A;  3DGV A;  4F9U A;  1H8L A;  2P6E A;  2CTB A;  3IC1 A;  1L0C A;  4PXB A;  5LRG A;  4F0X A;  4KSF A;  2B4B A;  3RNZ A;  2J8R A;  3E0K A;  1BPM A;  2ZEE A;  3CT9 A;  3H5Z A;  2ZW6 A;  3R1K A;  4HNW B;  5H84 A;  4YGO A;  3KKW A;  4CYN A;  2OH1 A;  4UWJ A;  2AFM A;  5G21 A;  4FD4 A;  1WK4 A;  4MFL A;  3D3S A;  1N71 A;  4MY0 A;  6CPA A;  4KVX A;  1Q2C A;  4NGN A;  4P44 A;  3D66 A;  4X5K A;  4QB9 A;  3R9G A;  1F57 A;  3V8I A;  1Q7L A;  3NE8 A;  4MY3 A;  3BJ8 A;  2AE6 A;  2K5T A;  2O53 A;  4UEE A;  1IB1 E;  2F5I A;  1S7L A;  2ZEP A;  2G3A A;  4MCQ A;  4ZYQ A;  3S6K A;  4F6A A;  3BI1 A;  5HXD A;  1OZP A;  2P6F A;  1Z4E A;  3S9M A;  3RBU A;  4H89 A;  2AJ6 A;  3KR5 A;  3P2H A;  1QSM A;  3SJE A;  1BOB A;  5AG6 A;  2QJ8 A;  3TCV A;  2PR8 A;  4UBR A;  1R3N A;  2EWB A;  3GUX A;  1CJW A;  3FXT A;  1FT7 A;  3JTK A;  4J3G A;  4U9Z A;  1CP6 A;  4MHY A;  1BAV A;  1JWQ A;  3IJ3 A;  2ZEM A;  2QVP A;  3D7D A;  3W6S A;  2EVN A;  1K4J A;  4XPK A;  2D4O A;  1XIX A;  2NMT A;  3SHP A;  4E2A A;  1ZG9 A;  3NFZ A;  1Q2Y A;  3PBE A;  3F0A A;  3SJX A;  4DYO A;  4JLY A;  3GY9 A;  3NH5 A;  3GKR A;  4L89 A;  5EBV A;  3EXN A;  4NGT A;  4NGR A;  2Q44 A;  4NCZ A;  4FWU A;  4CS0 B;  2AFW A;  4FD7 A;  1IU8 A;  1NE9 A;  2CNM A;  2Q4Z A;  1QST A;  2PRB A;  3BXM A;  3S6G A;  4C68 A;  5JH9 A;  5JPH A;  1BO4 A;  4MCS A;  5K8N A;  2CNT A;  2C6C A;  3PB4 X;  1X10 A;  4CGN A;  3B3T A;  1QMU A;  3KAS A;  3LMS A;  1PU9 A;  4IAV A;  3DSB A;  3FBU A;  5F09 A;  1TKF A;  4UWI A;  3KQZ A;  3NE7 A;  1MJB A;  4LQ6 A;  1M4I A;  3D7F A;  3NA6 A;  2EUI A;  2G9D A;  3GIU A;  2FT0 A;  3QAH A;  5HVF A;  2JDC A;  2PJ1 A;  7CPA A;  2PIZ A;  3JRU A;  1IYK A;  4UIA A;  2C6G A;  2V77 A;  1IIC A;  4OC4 A;  4KLW A;  4KOS A;  1YQE A;  5JQ4 A;  1ZG8 A;  2ODF A;  4PPZ A;  2ZOG A;  2OB0 A;  2JLM A;  4H6U A;  3CPX A;  4X2T A;  2YNC C;  1IID A;  2BL1 A;  2C6P A;  4OIW A;  1TKJ A;  2GLF A;  4CPA A;  4F8Z A;  1S60 A;  4FD6 A;  1YK3 A;  3R9E A;  4I49 A;  3WT4 A;  1P4N A;  1YX0 A;  5AG5 A;  4ZGY B;  3FB3 A;  3FH4 A;  5LYI A;  1S5K A;  1XF8 A;  1HEE A;  4R87 A;  4ZX8 A;  3IWW A;  2V8H A;  1BLL E;  1FY7 A;  2P6G A;  3FVL A;  3KQX A;  4X8I A;  1RTQ A;  4C2Z A;  4CAX A;  2BEI A;  2FL4 A;  3PBB A;  2YGW A;  4C7I A;  3R95 A;  4F0Y A;  5LRK A;  4OAD A;  4E0A A;  4Y49 C;  4A94 A;  1PUA A;  4AB7 A;  4GS4 A;  4A32 A;  4P4F A;  4M6H A;  3R96 A;  3TO7 A;  4KLV A;  3LOD A;  3WC6 A;  2CNS A;  2R1I A;  2Z3N A;  1MK4 A;  3TOB A;  1IYL A;  3DR6 A;  4NGM A;  4B11 A;  1A2Z A;  2QEC A;  2AFZ A;  4FUU A;  2VL1 A;  5HMN A;  3V38 A;  4EFD A;  5LYF A;  1Z8T A;  2GAN A;  4KSI A;  4CYO A;  1M4G A;  2JBK A;  3W6X A;  3WC5 A;  4ZY0 A;  5IX3 A;  4P4D A;  4KOV A;  4NSQ A;  3UY5 A;  2BSW A;  3D7G A;  3BJ7 A;  4HKF A;  4B5P B;  3S9N A;  4QUS A;  4O23 A;  2AFS A;  1Y9K A;  5I0C A;  2PE3 A;  5AG7 A;  5I4M A;  1B87 A;  3GYA A;  4B12 A;  1Y7E A;  2HUZ A;  2PSW A;  1KUX A;  1AUG A;  4MI4 A;  4UFX A;  2IMO A;  2Q0Y A;  1I12 A;  4UEZ A;  3KZW A;  2GE3 A;  2AFX A;  2H5M A;  3ZJ0 A;  2ZEN A;  4PXE A;  4E8O A;  3WAB A;  4CAW A;  1ARM A;  4R57 A;  3TE4 A;  1ELL P;  4CAV A;  3A9L A;  1JQG A;  4OC5 A;  1YR0 A;  4QC6 A;  4A31 A;  1PYT B;  2KCW A;  2ZW4 A;  4PV6 A;  3LD2 A;  2WYR A;  4H2K A;  4BIN A;  5LYL A;  1EE3 P;  2HC9 A;  2PJC A;  3KHX A;  3IU1 A;  3RYO A;  1YSJ A;  4WWV A;  5LRJ A;  1Y0Y A;  1Y7R A;  2Z3P A;  2ZPA A;  3TOA A;  5CPA A;  2DXQ A;  4UF4 A;  5F48 A;  4KVO E;  1LOK A;  1YLE A;  3N5F A;  1IOI A;  2FIA A;  3IIB A;  3IWE A;  5HVG A;  5A27 A;  3VAT A;  2Y0M A;  2I00 A;  1MJ9 A;  3B35 A;  3B7I A;  3B3C A;  2WPX A;  4CAF A;  3K9T A;  4OC3 A;  4AVC A;  3IWG A;  3RAM A;  3FNC A;  4UIB A;  2PVV A;  2B5G A;  4KUA A;  2EBJ A;  2GRE A;  2ARH A;  2YNE A;  4OC2 A;  1X12 A;  2OOT A;  2BOA A;  4A38 A;  1ZO0 A;  3T90 A;  3FEC A;  1FNO A;  2PJA A;  1ZLI A;  1QSN A;  5DWM A;  2DPT A;  1ON0 A;  4YFJ A;  3JUW A;  1Z8L A;  1QSR A;  2CIJ A;  2ZW5 A;  4RUH A;  3PEI A;  4NXY A;  4UCM A;  3HLP A;  4OAE A;  4W9Y A;  3TFY A;  2J9A A;  2VBQ A;  3D2P A;  2BUE A;  2Z10 A;  2OZH A;  3NH8 A;  2PJ8 A;  2B3U A;  4QVT A;  3SI1 A;  2NYQ A;  4P4I A;  2Q7S A;  4PK2 A;  1OBR A;  1IOF A;  1YW4 A;  4A2Z A;  2ZEO A;  3IGR A;  3PB7 X;  4NFR A;  5A28 A;  5K8O A;  4OP4 A;  1J4J A;  2PJB A;  4GXH A;  2Z3K A;  2Q7B A;  2FS5 A;  3KI9 A;  4PQA A;  1LFW A;  2WSA A;  4LUA A;  4XPL A;  1KUV A;  5J1Q A;  4OME A;  3EY5 A;  5GCN A;  2DPS A;  5CBM A;  4PSX A;  2PC1 A;  2JBJ A;  4JWP A;  5FVJ A;  2PQ8 A;  2FXF A;  3KHZ A;  2FIW A;  3TC8 A;  1KZF A;  3ISX A;  2DF5 A;  4MFP A;  3DR8 A;  2IQ6 A;  3B3V A;  5F47 A;  1XFO A;  2F7V A;  3PFE A;  3B3W A;  3CXQ A;  1HDU A;  2B4D B;  2PJ0 A;  3I9S A;  2GU2 A;  3FIX A;  1YLO A;  4BD9 A;  4CGL A;  4FD5 A;  1KUY A;  3PFO A;  3GLJ A;  1M4L A;  4A37 A;  5IB9 A;  3K2K A;  1S7N A;  3MGD A;  1P0H A;  4R7M A;  3KGQ A;  4PXC A;  3F5B A;  5DS0 A;  5F49 A;  1NMT A;  2GIV A;  4LX9 A;  4NGS A;  4KOU A;  4P4E A;  5AGE A;  2WZN A;  2F8H A;  4G1P A;  1DE4 C;  4F9V A;  5EMI A;  2XEJ A;  4HPS A;  2C27 A;  1LAN A;  3PGP A;  2Q04 A;  5G1Z A;  5AG4 A;  2OZG A;  3I1U A;  1XBU A;  4UFW A;  3B2Y A;  3PZJ A;  4UCP A;  4R76 A;  4OID A;  4R6T A;  1R43 A;  1ELM P;  2Q51 A;  3H8G A;  4P4J A;  2WPW A;  3QB8 A;  4MJ8 A;  4P10 A;  1YVO A;  3H4Q A;  4R3K A;  4OC0 A;  3FX6 A;  5THW A;  3OWC A;  4ZI6 A;  2PCU A;  2PJ9 A;  4NF1 A;  2GFQ A;  5K8P A;  4CGP A;  4KUB A;  3MN8 A;  5JGF A;  3D7H A;  4P6Y A;  4IHM A;  4CYQ A;  2EK9 A;  2C1C A;  3IFE A;  2PJ5 A;  3PB6 X;  4UEF A;  2G0B A;  5HH1 A;  2DEA A;  5IV0 A;  2AFO A;  4PSW A;  2R98 A;  3PP9 A;  5JM6 A;  2A4N A;  1TF8 A;  2GLJ A;  2Z0Z A;  4U9Y A;  5KTC A;  1Q2D A;  2O4H A;  3DNS A;  4XNH B;  4IF5 A;  2V8D A;  5D29 A;  2IJZ A;  5HVH A;  2VZY A;  1YGH A;  2PJ4 A;  1IGB A;  4ORF A;  4L8A A;  4GM5 A;  2PR1 A;  4KOW A;  2HQY A;  4R8F A;  3B8G A;  1VHO A;  4HNX B;  2OZU A;  5D8N A;  4B10 A;  3FMC A;  2JEW A;  4CRY B;  4P45 A;  1TF9 A;  3NH4 A;  1XE4 A;  4PK3 A;  3N7Z A;  4MFK A;  4ZX9 A;  5H86 A;  3SI0 A;  2P0W A;  3D4U A;  3HUV A;  1CM0 A;  1S7F A;  2B58 A;  3W91 A;  2REF A;  3G8W A;  1XRY A;  1CG2 A;  4MBU A;  2Q4Y A;  4KVM E;  1VIX A;  4H6Z A;  4PXD A;  4NGQ A;  5G22 A;  3VWE A;  5KTD A;  3ISZ A;  2REE A;  4K3N A;  2G3T A;  4CYP A;  3S6H A;  3LWU A;  4BMH A;  2FCK A;  3CXS A;  4ZBG A;  2YNC A;  3IU2 A;  2EO8 A;  4II9 A;  2CY2 A;  4Q38 A;  4MFZ A;  4AG9 A;  1V0C A;  4OKO A;  4RS2 A;  2ZEG A;  4FBE A;  3MRU A;  4XPD B;  2Z11 A;  3BHX A;  4EVY A;  2B5G B;  1YVK A;  3H8E A;  1U6M A;  1Z2L A;  1Z9U A;  1AMP A;  4P4B A;  3D2M A;  4YU9 A;  1F2O A;  2I3C A;  3F8K A;  5K8M A;  1VHS A;  2FE7 A;  3G3S A;  4CGM A;  4MHD A;  2PJ7 A;  4UA3 A;  1UWY A;  1CP7 A;  3QNV A;  4Y49 B;  2HV2 A;  4R9M A;  4B13 A;  2RC4 A;  1AYE A;  1GYT A;  2PIY A;  5C88 A;  4UCN A;  1NSL A;  1BPN A;  2PVW A;  3R9F A;  4FAI A;  1QSO A;  2RB7 A;  2BCO A;  1YME A;  4ZY1 A;  4WJB A;  1XOV A;  4LQG A;  2CF4 A;  1GHE A;  2CXA A;  2JDD A;  4A30 A;  4CRZ B;  4MMO A;  3LAC A;  4U5Y A;  3VWD A;  1TXR A;  1XEB A;  1IY7 A;  3I3G A;  4JXR A;  4MHP A;  2ZEL A;  1I1D A;  3CXP A;  4C2X A;  3IEH A;  4B5O A;  2NSM A;  2D4P A;  1CPX A;  2O28 A;  1RO5 A;  3TO6 A;  2I79 A;  2HB6 A;  2PDO A;  1QQ9 A;  2ZEH A;  4X3R A;  3EC4 A;  3T9Y A;  5EC4 A;  3WR7 A;  3BLN A;  2Z3L A;  4RN7 A;  2XEG A;  3PRT A;  4MCP A;  3QAY A;  1ZG7 A;  3S9L A;  2ZEF A;  1HDQ A;  4Z65 A;  1KWM A;  4M6G A;  3TTH A;  3KL9 A;  2Z3M A;  3DDD A;  1M4D A;  3TO9 A;  1YRE A;  2Z3O A;  5KTA A;  1VGY A;  2ZXV A;  4UFV A;  2EK8 A;  2FSR A;  4NJQ A;  2VZZ A;  4R3L A;  1Y0R A;  3RZA A;  3EO4 A;  3H8F A;  1F2P A;  3TX8 A;  5J8C A;  3VH9 A;  1TKH A;  4NGP A;  4QBJ A;  2AFU A;  5ISV A;  1LCP A;  3B3S A;  4EME A;  3SI2 A;  4M85 A;  3SJG A;  4A39 A;  4CAE A;  3FRM A;  4AVA A;  4XNH C;  4ZY2 A;  2PJ2 A;  5C82 A;  5LYD A;  3KR4 A;  2ABZ A;  3FJU A;  4MFJ A;  4EWT A;  3PB9 X;  1VHE A;  3FEE A;  4CGO A;  4A33 A;  2QIR A;  4IK2 A;  3EFA A;  3D8P A;  3IO1 A;  2VQY A;  4KOT A;  5BWA B;  4AG7 A;  2VI7 A;  4OLL A;  1SQH A;  1Z5R A;  4C2Y A;  3TT2 A;  3CPA A;  5ELY A;  2FVG A;  1YW6 A;  2ZED A;  1B6B A;  5F46 A;  2BO9 A;  4DNC A;  4TNU A;  1WWZ A;  4Q7A A;  2RFH A;  3P2F A;  1CBX A;  1Z8X A;  1UFH A;  2B4D A;  3FYN A;  1XMT A;  4HNY B;  2WUU A;  4B6Z A;  4Q36 A;  3SJF A;  2ANP A;  1S7K A;  3PB8 X;  1Z8W A;  2QYV A;  3FED A;  4KZT A;  2OR4 A;  3T8W A;  8CPA A;  2V8G A;  1CPS A;  2X7B A;  2XEF A;  3JVN A;  4XPD C;  1NSA A;  3D68 A;  4KOX A;  5E96 A;  2Q43 A;  4DJL A;  4M6I A;  2J8M A;  2ZOF A;  4MXU A;  3CDX A;  4TWE A;  1ARL A;  2R7H A;  2XEI A;  4KSA A;  4BBH A;  2IL4 A;  4MHZ A;  1LAP A;  1LRZ A;  1TIQ A;  2R8V A;  1Z4R A;  3DLJ A;  4JXQ A;  3CZX A;  1MJA A;  2POK A;  4RI1 A;  2VEZ A;  1M1D A;  3RO0 A;  5DWN A;  3L2N A;  2B3V A;  3FF3 A;  5CNP A;  4JD6 A;  2V8V A;  1R57 A;  3K9U A;  4ONU A; 
#chains in the Genus database with same CATH homology
 5J8F A;  1Y9W A;  3C26 A;  4M3S A;  3ZZI A;  4KOY A;  1I21 A;  4JJX A;  2J8N A;  4YRH A;  1RXT A;  3SXN A;  3S6F A;  4NEX A;  2JEV A;  2ZW7 A;  2YND A;  5IB0 A;  2QML A;  2OU2 A;  2VXK A;  4IUS A;  4MFQ A;  4K30 A;  4KOR A;  4A95 A;  3SXO A;  1M44 A;  2ATR A;  2Q4V A;  1VKC A;  4B5P A;  4KS9 A;  4B14 A;  1S3Z A;  5G20 A;  4C7H A;  4AVB A;  2P6E A;  1L0C A;  4F0X A;  4KSF A;  2B4B A;  2J8R A;  3E0K A;  3H5Z A;  3R1K A;  2ZW6 A;  4HNW B;  5H84 A;  4YGO A;  3KKW A;  4CYN A;  2OH1 A;  4UWJ A;  5G21 A;  4FD4 A;  1WK4 A;  4MFL A;  3D3S A;  1N71 A;  4MY0 A;  4KVX A;  1Q2C A;  4X5K A;  4QB9 A;  3R9G A;  3V8I A;  4MY3 A;  3BJ8 A;  2AE6 A;  2K5T A;  1IB1 E;  2F5I A;  1S7L A;  2G3A A;  3S6K A;  4F6A A;  1OZP A;  2P6F A;  1Z4E A;  4H89 A;  2AJ6 A;  3P2H A;  1QSM A;  1BOB A;  5AG6 A;  3TCV A;  2PR8 A;  4UBR A;  1CJW A;  3FXT A;  3JTK A;  4J3G A;  4U9Z A;  3W6S A;  2EVN A;  1K4J A;  4XPK A;  2D4O A;  1XIX A;  2NMT A;  3SHP A;  4E2A A;  1Q2Y A;  3F0A A;  4JLY A;  3GY9 A;  3GKR A;  4L89 A;  5EBV A;  3EXN A;  2Q44 A;  4NCZ A;  4CS0 B;  4FD7 A;  1NE9 A;  2CNM A;  3S6G A;  1QST A;  2PRB A;  4C68 A;  5JPH A;  1BO4 A;  2CNT A;  4CGN A;  1PU9 A;  3DSB A;  3FBU A;  4UWI A;  3NE7 A;  1MJB A;  1M4I A;  2EUI A;  3QAH A;  2FT0 A;  2JDC A;  1IYK A;  1IIC A;  4KLW A;  4KOS A;  5JQ4 A;  4H6U A;  2OB0 A;  2JLM A;  2YNC C;  1IID A;  2BL1 A;  1S60 A;  4FD6 A;  1YK3 A;  3R9E A;  4I49 A;  1P4N A;  1YX0 A;  5AG5 A;  4ZGY B;  3FB3 A;  1S5K A;  1XF8 A;  4R87 A;  1FY7 A;  2P6G A;  4C2Z A;  4CAX A;  2BEI A;  2FL4 A;  2YGW A;  4C7I A;  3R95 A;  4F0Y A;  4OAD A;  4E0A A;  4Y49 C;  1PUA A;  4AB7 A;  4GS4 A;  4A32 A;  3R96 A;  3TO7 A;  4KLV A;  3LOD A;  2CNS A;  2R1I A;  2Z3N A;  1MK4 A;  3TOB A;  1IYL A;  3DR6 A;  4B11 A;  2QEC A;  5HMN A;  2GAN A;  4CYO A;  1M4G A;  3W6X A;  5IX3 A;  4KOV A;  4NSQ A;  3UY5 A;  2BSW A;  3BJ7 A;  4HKF A;  4B5P B;  4QUS A;  1Y9K A;  5I0C A;  5AG7 A;  1B87 A;  3GYA A;  4B12 A;  2HUZ A;  2PSW A;  1KUX A;  4MI4 A;  4UFX A;  2Q0Y A;  1I12 A;  2GE3 A;  2H5M A;  3ZJ0 A;  4E8O A;  4CAW A;  4R57 A;  3TE4 A;  4CAV A;  3A9L A;  4QC6 A;  1YR0 A;  4A31 A;  2KCW A;  2ZW4 A;  4PV6 A;  3LD2 A;  3IU1 A;  3RYO A;  1Y7R A;  2Z3P A;  2ZPA A;  3TOA A;  2DXQ A;  5F48 A;  4KVO E;  1YLE A;  2FIA A;  3IWE A;  5A27 A;  2Y0M A;  2I00 A;  1MJ9 A;  4CAF A;  2WPX A;  4AVC A;  3IWG A;  3FNC A;  2B5G A;  4KUA A;  2ARH A;  2YNE A;  1ZO0 A;  3T90 A;  1QSN A;  5DWM A;  2DPT A;  1ON0 A;  4YFJ A;  3JUW A;  1QSR A;  2ZW5 A;  4NXY A;  4UCM A;  4OAE A;  3TFY A;  3D2P A;  2VBQ A;  2BUE A;  2Z10 A;  2OZH A;  2B3U A;  4QVT A;  4PK2 A;  4A2Z A;  3IGR A;  5A28 A;  1J4J A;  2Q7B A;  2Z3K A;  2FS5 A;  2WSA A;  4LUA A;  4XPL A;  1KUV A;  3EY5 A;  5GCN A;  2DPS A;  4PSX A;  2PC1 A;  4JWP A;  5FVJ A;  2PQ8 A;  2FXF A;  2FIW A;  1KZF A;  4MFP A;  3DR8 A;  5F47 A;  3CXQ A;  2B4D B;  3I9S A;  3FIX A;  4CGL A;  4FD5 A;  1KUY A;  1S7N A;  3MGD A;  1P0H A;  5F49 A;  3F5B A;  1NMT A;  2GIV A;  4LX9 A;  4KOU A;  5AGE A;  2C27 A;  5G1Z A;  3PGP A;  2Q04 A;  5AG4 A;  2OZG A;  4UFW A;  3PZJ A;  4UCP A;  2WPW A;  3QB8 A;  4MJ8 A;  1YVO A;  3H4Q A;  4R3K A;  3OWC A;  4NF1 A;  4CGP A;  4KUB A;  4CYQ A;  5HH1 A;  2G0B A;  5IV0 A;  4PSW A;  2R98 A;  3PP9 A;  2A4N A;  2Z0Z A;  4U9Y A;  5KTC A;  1Q2D A;  4XNH B;  3DNS A;  4IF5 A;  2VZY A;  1YGH A;  4ORF A;  4L8A A;  2PR1 A;  4KOW A;  2HQY A;  3B8G A;  4HNX B;  2OZU A;  4B10 A;  4CRY B;  1XE4 A;  4PK3 A;  3N7Z A;  4MFK A;  5H86 A;  3W91 A;  2P0W A;  1CM0 A;  1S7F A;  2B58 A;  2REF A;  3G8W A;  4MBU A;  2Q4Y A;  4KVM E;  4H6Z A;  3VWE A;  5G22 A;  5KTD A;  2REE A;  2G3T A;  4CYP A;  3S6H A;  4BMH A;  2FCK A;  3CXS A;  4ZBG A;  2YNC A;  3IU2 A;  4II9 A;  2CY2 A;  4Q38 A;  4MFZ A;  4AG9 A;  1V0C A;  4RS2 A;  4XPD B;  2Z11 A;  4EVY A;  2B5G B;  1YVK A;  1U6M A;  1Z9U A;  3D2M A;  3F8K A;  1VHS A;  2FE7 A;  3G3S A;  4CGM A;  4MHD A;  4UA3 A;  4B13 A;  4Y49 B;  2HV2 A;  4R9M A;  2RC4 A;  5C88 A;  4UCN A;  1NSL A;  3R9F A;  1QSO A;  4A30 A;  2CXA A;  1GHE A;  4CRZ B;  2JDD A;  4U5Y A;  3VWD A;  1XEB A;  3I3G A;  4C2X A;  4JXR A;  1I1D A;  3CXP A;  4B5O A;  2D4P A;  2O28 A;  1RO5 A;  3TO6 A;  2I79 A;  2PDO A;  3EC4 A;  3T9Y A;  5EC4 A;  3WR7 A;  3BLN A;  2Z3L A;  3TTH A;  2Z3M A;  3DDD A;  1M4D A;  3TO9 A;  1YRE A;  2Z3O A;  5KTA A;  2ZXV A;  4UFV A;  2FSR A;  2VZZ A;  4R3L A;  3EO4 A;  5J8C A;  4QBJ A;  5ISV A;  4M85 A;  4CAE A;  3FRM A;  4AVA A;  4XNH C;  5C82 A;  4MFJ A;  4CGO A;  4A33 A;  2QIR A;  3EFA A;  3D8P A;  2VQY A;  4KOT A;  5BWA B;  4AG7 A;  2VI7 A;  4OLL A;  1SQH A;  4C2Y A;  3TT2 A;  1B6B A;  5F46 A;  4DNC A;  1WWZ A;  3P2F A;  1UFH A;  2B4D A;  3FYN A;  1XMT A;  4HNY B;  2WUU A;  4Q36 A;  1S7K A;  4KZT A;  2X7B A;  3JVN A;  4XPD C;  4KOX A;  5E96 A;  2J8M A;  2R7H A;  4KSA A;  4BBH A;  2IL4 A;  1LRZ A;  1TIQ A;  2R8V A;  1Z4R A;  4JXQ A;  1MJA A;  4RI1 A;  2VEZ A;  1M1D A;  5DWN A;  2B3V A;  5CNP A;  4JD6 A;  1R57 A;  3K9U A;  4ONU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...