4FWUA

Crystal structure of glutaminyl cyclase from drosophila melanogaster in space group i4
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
299
Chain Sequence
QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of glutaminyl cyclase from Drosophila melanogaster in space group I4.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords CG32412
total genus 106
structure length 299
sequence length 305
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fwuA00
2AFOA 3LMSA 3TC8A 4NGTA 1PYTB 3B35A 4P4EA 3K2KA 3NA6A 4JYWA 4IAVA 2IQ6A 3CPXA 3SJGA 5LYIA 4BD9A 6CPAA 2IJZA 1YW6A 2JEWA 5J1QA 2WZNA 3KASA 1XBUA 1JQGA 3FX6A 2PIZA 1BPNA 3IC1A 5LRKA 2JBKA 4F9VA 4NFRA 3KR4A 2O53A 4OP4A 3N5FA 3CDXA 1QQ9A 2PJ2A 3NH8A 2C6CA 4UEEA 2DEAA 2ZEPA 3SI2A 3ISZA 2C6PA 2PJCA 4NGQA 4NGMA 4DUKA 1R3NA 3KQXA 1FNOA 4CPAA 2PJ5A 2GLFA 3RAMA 1VGYA 4ZY2A 1TF9A 3GB0A 3K9TA 4A94A 2G9DA 1BPMA 3PB8X 2V8GA 4F8ZA 4P4DA 3WC6A 4NJRA 1BAVA 1KWMA 1F57A 3L2NA 2ZOFA 4EWTA 2AFSA 7CPAA 1XJOA 2HC9A 3KI9A 1LOKA 3PEIA 4KSIA 2EK9A 4K3NA 3LWUA 3NH4A 3QNVA 1ZLIA 4OMEA 5K8PA 4F9UA 1Y0YA 3TX8A 2IMOA 4FUUA 5K8NA 5LRGA 3PRTA 3T8WA 2JBJA 4P45A 3B3CA 2GU2A 1ZLHA 4UIBA 3PB4X 3B3VA 4PXBA 4YU9A 4ZI6A 3WT4A 1ZG9A 3V38A 5LRJA 1ZG7A 5HXDA 2ZEEA 5LYLA 5I4MA 2NSMA 1VHOA 1HDQA 3B3TA 4ZY1A 1Z5RA 4YWYA 3FH4A 4DYOA 3FMCA 5K8MA 4UEZA 3IO1A 2PRQA 1XMBA 3FVLA 2ZEFA 8CPAA 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4P10A 1LANA 2V8VA 4OIWA 1DE4C 3KZWA 2V8HA 1QMUA 3B7IA 3FEEA 2V8DA 4NGRA 3KL9A 1IGBA 4ZX9A 1H8LA 1EE3P 3HLPA 3FF3A 2CF4A 4MRIA 4R8FA 3V7ZA 1LAMA 4MCSA 4EFDA 3BI0A 3D68A 1ARMA 2QYVA 2CIJA 2ZEMA 4OC4A 3ISXA 3MN8A 2F8HA 3D67A 3H8GA 4PXEA 2PE3A 2ZEOA 2BOAA 4MCPA 3SI0A 4NGSA 3PB9X 5CBMA 3KQZA 4OC5A 2QJ8A 2PJBA 3VH9A 4PXCA 3S9NA 2XEIA 4IHMA 4WWVA 3BHXA 1TXRA 2FVGA 1Y0RA 2Q51A 1CP7A 2GLJA 3D66A 5CPAA 1ARLA 4X8IA 4RUHA 1YW4A 2F7VA 3GLJA 3IFEA 4LQGA 2I3CA 1CX8A 3B3WA 4X3RA 4P4IA 1R43A 3I1UA 3PB7X 2CTBA 3MRUA 1YLOA 2V77A 1ZG8A 3IWWA 3VATA 1YMEA 4Z65A 4NGNA 1XRYA 1NSAA 3H8FA 1RTQA 1BLLE 2ZEHA 3WABA 2AFUA 4B6ZA 3HUVA 1TKJA 1F2PA 2PJ6A 1IY7A 2CTCA 4H2KA 4R76A 3D4UA 4MCRA 3BXMA 1Y7EA 2PJ3A 1Q7LA 4P4FA 2PVWA 1TKFA 3KGQA 2PJ4A 4OC0A 3IEHA 4FWUA 3NH5A 3S9LA 4PXDA 5HVGA 4MHZA 4DJLA 4FBEA 5JH9A 4AXVA 3RZAA 5JM6A 2PVVA 3SJEA 5K8OA 1DTDA 2PJAA 1HEEA 5THWA 3IJ3A 3FEDA 1VIXA 3KHXA 5IB9A 2NYQA 2EWBA 3S9MA 5F09A 4WJBA 3B3SA 4UIAA 3GUXA 2HB6A 4UF4A 2BO9A 3SJFA 3PFEA 4FAIA 3B2YA 2VL1A 1AYEA 4PPZA 1OBRA 4P4JA 4X2TA 4UEFA 4TWEA 5LYDA 1CPXA 4MMOA 2XEFA 3DLJA 3PFOA 2Q4ZA 3PBBA 2Q43A 3CT9A 1VHEA 3CPAA 2OOTA 3DGVA 1GYTA 2AFZA 2OR4A 1LCPA 1UWYA 4G1PA 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 4ZY0A 1YSJA 3D7HA 2POKA 2RFHA 3D7FA 4NJQA 4P6YA 2ZEDA 1CPSA 2C1CA 1AMPA 2PJ9A 5DS0A 2PCUA 4OC1A 1Z8LA 1CG2A 4R6TA 3SJXA 1LAPA 2ZELA 4MXUA 2PJ1A 4O23A 1HDUA 3FJUA 2GREA 1LFWA 2AFWA 1Z2LA 1CBXA 3SI1A 4NGPA 4OC3A 4R7MA 5D8NA 4TNUA 4A38A 4PQAA 4GM5A 4P44A 3PB6X 1TKHA 4OIDA 3WC5A 4W9YA 4Q7AA 2O4HA 2EK8A 1ELLP 4MCQA 2ZOGA 2XEJA 4A39A 3NFZA 4P4BA 4MHNA 2ABZA 2ZENA 1ELMP 3FECA 3D7DA 4MHPA 4A37A 4ZX8A 3BI1A 4MHYA 1M4LA 1F2OA 2ZEGA 4ZYQA 2AFXA 3KHZA 3H8EA 4IK2A 1FT7A 3VARA 3JRUA 5HVFA 2AFMA 3WC7A 3D7GA 3PBEA 2RB7A 4JZ0A 1TF8A 2J9AA 2PIYA 5LYFA 4EMEA 2WYRA 3IIBA 5ELYA 2XEGA 4OC2A 1PCAA 2PJ0A 2QVPA 5HVHA 2C6GA 5D29A
chains in the Genus database with same CATH superfamily
3H5ZA 2AFOA 3LMSA 4A33A 5AG7A 3TC8A 4CAXA 5IB0A 1S7KA 4KS9A 4QC6A 4M3SA 2Z3PA 1N71A 1M44A 1PYTB 4NGTA 2R98A 4R57A 3SXNA 4MBUA 5DWNA 2CNMA 3B35A 4NCZA 3K2KA 3NA6A 4P4EA 4A32A 4C2ZA 1U6MA 4JJXA 1QSRA 4MY3A 4MY0A 4Y49C 4K30A 4RI1A 4JYWA 4IAVA 2IQ6A 2YGWA 3CPXA 4KZTA 5F47A 4PK3A 3SJGA 2IL4A 4A95A 3FYNA 2FIAA 5LYIA 4R87A 2DPTA 4BD9A 6CPAA 3DSBA 2IJZA 2B4DB 1YW6A 3F8KA 2JEWA 2HQYA 1I1DA 2WZNA 3KASA 4UCPA 5J1QA 4B12A 4C68A 1S7FA 1XBUA 1JQGA 3FRMA 2JDDA 3FX6A 2BEIA 1BPNA 2PIZA 3IC1A 4IF5A 1NSLA 2JBKA 5LRKA 4YFJA 4KOUA 1IOFA 2PC1A 4F9VA 4NFRA 4XPLA 3KR4A 3BLNA 1Q2YA 2J8MA 3VWEA 4CGOA 2O53A 2P0WA 1QSOA 4OP4A 2EVNA 3N5FA 4JD6A 2HUZA 3CDXA 4CAEA 1QQ9A 2EBJA 2PJ2A 4PK2A 2BUEA 4E0AA 3NH8A 2C6CA 4UEEA 2EO8A 2Z0ZA 2DEAA 1YK3A 2ZEPA 2AJ6A 4JWPA 2GFQA 3ISZA 3SI2A 5C88A 2C6PA 2PJCA 5IX3A 4FD5A 2Y0MA 4NGQA 2PRBA 1LRZA 2ODFA 4I49A 4KSFA 4M6HA 4NGMA 4XNHB 4DUKA 1R3NA 2REEA 5GCNA 2ZW4A 3KQXA 5G22A 1FNOA 3JUWA 4FD4A 4CPAA 2OH1A 2PJ5A 4QVTA 2GLFA 4CYQA 1OZPA 3RAMA 2VZZA 2Z3LA 1VGYA 4NEXA 4ZY2A 3FB3A 1TF9A 3GB0A 3K9TA 4H89A 4KOWA 2B58A 4UCNA 3B8GA 4A94A 2DF5A 3F5BA 5JQ4A 2G9DA 1BPMA 1JWQA 3PB8X 4ZBGA 2V8GA 4C7HA 4F8ZA 4P4DA 1CM0A 4BMHA 3CXSA 5G1ZA 3D2MA 4CAVA 4B5PA 3WC6A 2RC4A 1YREA 1BAVA 4NJRA 1KWMA 1F57A 3L2NA 2ZOFA 3FBUA 2AFSA 4PSXA 4EWTA 7CPAA 3S9NA 4BINA 1Z8WA 2J8NA 2ZW7A 4CRYB 5J8CA 1XJOA 2HC9A 3I9SA 4KOYA 4M85A 1UFHA 3KI9A 1LOKA 3PEIA 4KSIA 1MJBA 2EK9A 3D8PA 4UFVA 4PSWA 1J4JA 4K3NA 3RO0A 3LWUA 3NH4A 3QNVA 1IU8A 1ZLIA 4HNXB 4OMEA 3OWCA 1FY7A 5K8PA 2R7HA 4B5PB 4Q36A 3QAHA 4F9UA 5IV0A 1Y0YA 3LACA 3H4QA 4M6IA 3TX8A 2IMOA 4FUUA 4MJ8A 3LD2A 5K8NA 2JLMA 4LX9A 5LRGA 3PRTA 3T8WA 4F0YA 2JBJA 2PDOA 4ZGYB 4CYPA 4ORFA 4AVAA 4P45A 4CRZB 3B3CA 1S3ZA 1P0HA 2GU2A 4Q38A 1ZLHA 3S6FA 4DNCA 1X12A 4U9ZA 3G3SA 3TOAA 4UIBA 4L8AA 4KOVA 3PB4X 3B3VA 3CXQA 4PXBA 1IYLA 4A30A 4YU9A 4ZI6A 3EFAA 4H6ZA 3PGPA 1XF8A 4HPSA 3WT4A 2FSRA 4XNHC 4MFLA 2B3VA 4F0XA 1ZG9A 3GYAA 3DR8A 3V38A 5LRJA 4MFZA 1IOIA 1ZG7A 5HXDA 2ZEEA 5LYLA 3IWGA 4KORA 5I4MA 2NSMA 3LODA 1MK4A 1VHOA 1HDQA 3B3TA 4ZY1A 2Q44A 1M4DA 1Z5RA 4YWYA 4E2AA 4YRHA 3FH4A 4DYOA 3FMCA 5J8FA 2YNEA 4UEZA 3IO1A 3RNZA 2YNCC 5K8MA 3IWEA 2OZUA 2PRQA 1MJAA 3W6SA 1I21A 1RO5A 1XMBA 3PZJA 3FVLA 2ZEFA 8CPAA 2Q7SA 5F46A 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4CYOA 4P10A 1LANA 2PQ8A 2CNSA 2V8VA 5D29A 2Q0YA 4OIWA 1DE4C 4ONUA 3KZWA 2V8HA 4MFKA 2PR8A 1QMUA 3B7IA 4KVXA 3FEEA 2A4NA 2OB0A 2V8DA 4GXHA 3D3SA 4NGRA 3KL9A 1IGBA 2Q04A 4X5KA 2ARHA 2G3AA 2CXAA 2YNCA 4Y49B 4ZX9A 1H8LA 2I00A 1EE3P 2P6GA 3EO4A 3DDDA 3HLPA 1NE9A 2ZPAA 3WR7A 3FF3A 2CF4A 1RXTA 3G8WA 1Y9WA 4MRIA 4R8FA 3V7ZA 1LAMA 4NF1A 4MCSA 4C7IA 4EFDA 3BI0A 3D68A 1ARMA 2QYVA 2CIJA 2ZEMA 4LUAA 1IB1E 4OC4A 3ISXA 3MN8A 2F8HA 1YR0A 4J3GA 1B6BA 3D67A 3H8GA 4PXEA 3TTHA 3RYOA 4U9YA 5F49A 2PE3A 2ZEOA 4UFXA 5KTCA 2BOAA 1IIDA 4MCPA 4MI4A 2VZYA 3V8IA 3SI0A 4NGSA 3PB9X 3SXOA 5CBMA 2G0BA 3T90A 3PP9A 3IGRA 4CGLA 3KQZA 4MHDA 4OC5A 2QJ8A 2PJBA 3VH9A 3C26A 2PR1A 1YGHA 2XEIA 2EUIA 4IHMA 4KVME 4PXCA 4WWVA 3TO6A 3R95A 3BHXA 4UWIA 3GIUA 1TXRA 3CZXA 2FVGA 1Y0RA 2B4DA 2Q51A 1CP7A 2GLJA 4MFPA 4CGPA 3D66A 5CPAA 5I0CA 4NXYA 1ARLA 2R1IA 4JXRA 3ZZIA 5BWAB 4X8IA 4RUHA 1YW4A 2CY2A 5JPHA 2F7VA 3GLJA 3IFEA 4LQGA 5EMIA 2I3CA 1CX8A 4QBJA 3B3WA 3TFYA 1YQEA 2JDCA 4X3RA 1K4JA 1TIQA 1ZO0A 3QB8A 2Z3KA 4P4IA 1R43A 3I1UA 3PB7X 4JXQA 4KVOE 2CTBA 3MRUA 1YLEA 1YLOA 2VQYA 2V77A 1ZG8A 4KOXA 3IWWA 3VATA 1YMEA 2DPSA 4Z65A 3FNCA 4NGNA 1IICA 1XRYA 1NSAA 3H8FA 1S60A 3UY5A 1PUAA 4CAFA 3SHPA 1RTQA 3EC4A 1BLLE 2H5MA 2ZEHA 1V0CA 3WABA 4B14A 2FCKA 2AFUA 4B6ZA 3HUVA 1TKJA 4QUSA 4B10A 1F2PA 3E0KA 3TE4A 4U5YA 2X7BA 2ZW6A 2PJ6A 3TCVA 1IY7A 1I12A 2CTCA 4H2KA 2Z3MA 4R76A 3D4UA 3R1KA 4MCRA 4PV6A 4A31A 3BXMA 1Y7EA 1Z8TA 2PJ3A 1Q7LA 3GY9A 5HMNA 4FD6A 2PVWA 4P4FA 1TKFA 3KGQA 2PJ4A 2P6EA 4OC0A 3DR6A 3IEHA 4UCMA 4FWUA 3NH5A 3S9LA 1MJ9A 4CGNA 4AG9A 4PXDA 5HVGA 1Y7RA 3TO7A 4MHZA 1VKCA 4DJLA 4FBEA 5JH9A 4AXVA 5DWMA 3RZAA 1KZFA 2KCWA 4C2YA 5JM6A 1YVKA 2OU2A 2B4BA 3R96A 2OZGA 2PVVA 4FD7A 3SJEA 2F5IA 2G3TA 2FXFA 5AG4A 5K8OA 1DTDA 2PJAA 1HEEA 1BO4A 5THWA 4XPDC 4AVBA 4OLLA 2ZXVA 1KUXA 3IJ3A 3FEDA 4KLWA 1VIXA 3KHXA 4BBHA 3S6HA 1NMTA 2I79A 5IB9A 2NYQA 2EWBA 3S9MA 5F09A 1S7LA 2FIWA 4WJBA 3B3SA 4UIAA 3GUXA 2O28A 2HB6A 4UF4A 3BJ8A 1WWZA 5EC4A 2K5TA 2ATRA 3S6GA 2BO9A 2ZW5A 2GE3A 3SJFA 1Z4EA 4E8OA 3PFEA 4UWJA 5CNPA 3P2FA 4RS2A 3JTKA 4FAIA 3B2YA 1Z8XA 2VL1A 2WPWA 5KTDA 1Z4RA 5AGEA 1AYEA 1KUVA 4L89A 4PPZA 1S7NA 2FL4A 1OBRA 2FS5A 1Y9KA 4P4JA 4B11A 3GKRA 4X2TA 4UEFA 2YNDA 4TWEA 5LYDA 4UFWA 1CPXA 2D4OA 2Z10A 4MMOA 3CXPA 1X10A 1WK4A 2VBQA 2XEFA 3DLJA 3ZJ0A 3PFOA 2Q4ZA 1PU9A 2B3UA 4CS0B 3PBBA 3S6KA 1XEBA 2WSAA 1Q2DA 2OZHA 2DXQA 2Q43A 3CT9A 2NMTA 1M4GA 5H86A 5G20A 1VHEA 3CPAA 1YX0A 2BSWA 5AG5A 2OOTA 3DGVA 3T9YA 1GYTA 3EXNA 2AFZA 2OR4A 5EBVA 4AVCA 5F48A 1LCPA 4NSQA 3R9EA 4II9A 4QB9A 1UWYA 3I3GA 5A27A 4G1PA 2VEZA 1XMTA 2HV2A 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 5E96A 4ZY0A 4HNYB 5C82A 1IYKA 4MFQA 2QECA 4HNWB 2VXKA 4B5OA 1YSJA 3D7HA 2POKA 3F0AA 4KLVA 2RFHA 3D7FA 3W91A 5H84A 4NJQA 2AE6A 2ZEDA 4P6YA 2PSWA 1CPSA 2C1CA 1AMPA 4GS4A 2PJ9A 5DS0A 1VHSA 2PCUA 3P2HA 2FE7A 4EVYA 2Q4VA 1ON0A 2D4PA 1BOBA 4OC1A 3JVNA 1Z8LA 1AUGA 1CG2A 2QMLA 2VI7A 1LAPA 4KUBA 4R6TA 4UA3A 3SJXA 1S5KA 4R3KA 3VWDA 2ZELA 4MXUA 4AB7A 2B5GA 2PJ1A 4O23A 2J8RA 3QAYA 4XPKA 1L0CA 4MFJA 1HDUA 3K9UA 1B87A 3FJUA 4UBRA 2Q4YA 4JLYA 1XIXA 3TOBA 5G21A 2GREA 1LFWA 1QSMA 2FT0A 4OADA 2WPXA 2AFWA 1Z2LA 1CBXA 3SI1A 4NGPA 4OC3A 5FVJA 5KTAA 1XE4A 3FIXA 4R7MA 5D8NA 4TNUA 1QSNA 3R9FA 1KUYA 2GIVA 4A38A 3NE8A 4PQAA 4GM5A 5AG6A 2BL1A 1A2ZA 4CGMA 4P44A 2REFA 1M1DA 4B13A 3DNSA 3PB6X 1TKHA 2R8VA 4AG7A 1M4IA 2QIRA 1CJWA 4OIDA 2C27A 4R3LA 3A9LA 3WC5A 3FXTA 3BJ7A 4Q7AA 4W9YA 4C2XA 3NE7A 4LQ6A 5HH1A 4CYNA 2O4HA 1YVOA 4KSAA 2EK8A 1SQHA 4RN7A 1ELLP 1Z9UA 2CNTA 2ZOGA 4MCQA 2XEJA 4KUAA 4A39A 3NFZA 4P4BA 5A28A 4MHNA 2ABZA 2ZENA 1ELMP 3FECA 4A2ZA 1Q2CA 3D7DA 4MHPA 4A37A 4ZX8A 5ISVA 3BI1A 3W6XA 1XOVA 3IU2A 4MHYA 1M4LA 1F2OA 2Z3NA 2ZEGA 4ZYQA 2AFXA 2B5GB 3KHZA 3H8EA 4R9MA 2JEVA 3N7ZA 4KOSA 1P4NA 4CAWA 4IK2A 1FT7A 3TO9A 3VARA 3JRUA 2Q7BA 5HVFA 2AFMA 1R57A 3WC7A 3D7GA 2Z3OA 3PBEA 2RB7A 4YGOA 3D2PA 3TT2A 4JZ0A 4H6UA 4F6AA 1GHEA 1TF8A 2J9AA 2WUUA 2PIYA 4IUSA 3R9GA 5LYFA 4EMEA 2WYRA 4HKFA 3MGDA 3IIBA 4OAEA 5ELYA 2XEGA 4M6GA 1PCAA 3EY5A 4OC2A 2Z11A 3IU1A 1QSTA 2PJ0A 4KOTA 2P6FA 2GANA 2QVPA 5HVHA 2C6GA 3KKWA 4XPDB
chains in the Genus database with same CATH topology
2AFOA 3LMSA 3TC8A 4NGTA 1PYTB 3B35A 4P4EA 3K2KA 3NA6A 4JYWA 4IAVA 2IQ6A 3CPXA 3SJGA 5LYIA 4BD9A 6CPAA 2IJZA 1YW6A 2JEWA 5J1QA 2WZNA 3KASA 1XBUA 1JQGA 3FX6A 2PIZA 1BPNA 3IC1A 5LRKA 2JBKA 4F9VA 4NFRA 3KR4A 2O53A 4OP4A 3N5FA 3CDXA 1QQ9A 2PJ2A 3NH8A 2C6CA 4UEEA 2DEAA 2ZEPA 3SI2A 3ISZA 2C6PA 2PJCA 4NGQA 4NGMA 4DUKA 1R3NA 3KQXA 1FNOA 4CPAA 2PJ5A 2GLFA 3RAMA 1VGYA 4ZY2A 1TF9A 3GB0A 3K9TA 4A94A 2G9DA 1BPMA 3PB8X 2V8GA 4F8ZA 4P4DA 3WC6A 4NJRA 1BAVA 1KWMA 1F57A 3L2NA 2ZOFA 4EWTA 2AFSA 7CPAA 1XJOA 2HC9A 3KI9A 1LOKA 3PEIA 4KSIA 2EK9A 4K3NA 3LWUA 3NH4A 3QNVA 1ZLIA 4OMEA 5K8PA 4F9UA 1Y0YA 3TX8A 2IMOA 4FUUA 5K8NA 5LRGA 3PRTA 3T8WA 2JBJA 4P45A 3B3CA 2GU2A 1ZLHA 4UIBA 3PB4X 3B3VA 4PXBA 4YU9A 4ZI6A 3WT4A 1ZG9A 3V38A 5LRJA 1ZG7A 5HXDA 2ZEEA 5LYLA 5I4MA 2NSMA 1VHOA 1HDQA 3B3TA 4ZY1A 1Z5RA 4YWYA 3FH4A 4DYOA 3FMCA 5K8MA 4UEZA 3IO1A 2PRQA 1XMBA 3FVLA 2ZEFA 8CPAA 1XFOA 5JGFA 2PJ7A 2ANPA 3KR5A 2BCOA 4P10A 1LANA 2V8VA 4OIWA 1DE4C 3KZWA 2V8HA 1QMUA 3B7IA 3FEEA 2V8DA 4NGRA 3KL9A 1IGBA 4ZX9A 1H8LA 1EE3P 3HLPA 3FF3A 2CF4A 4MRIA 4R8FA 3V7ZA 1LAMA 4MCSA 4EFDA 3BI0A 3D68A 1ARMA 2QYVA 2CIJA 2ZEMA 4OC4A 3ISXA 3MN8A 2F8HA 3D67A 3H8GA 4PXEA 2PE3A 2ZEOA 2BOAA 4MCPA 3SI0A 4NGSA 3PB9X 5CBMA 3KQZA 4OC5A 2QJ8A 2PJBA 3VH9A 4PXCA 3S9NA 2XEIA 4IHMA 4WWVA 3BHXA 1TXRA 2FVGA 1Y0RA 2Q51A 1CP7A 2GLJA 3D66A 5CPAA 1ARLA 4X8IA 4RUHA 1YW4A 2F7VA 3GLJA 3IFEA 4LQGA 2I3CA 1CX8A 3B3WA 4X3RA 4P4IA 1R43A 3I1UA 3PB7X 2CTBA 3MRUA 1YLOA 2V77A 1ZG8A 3IWWA 3VATA 1YMEA 4Z65A 4NGNA 1XRYA 1NSAA 3H8FA 1RTQA 1BLLE 2ZEHA 3WABA 2AFUA 4B6ZA 3HUVA 1TKJA 1F2PA 2PJ6A 1IY7A 2CTCA 4H2KA 4R76A 3D4UA 4MCRA 3BXMA 1Y7EA 2PJ3A 1Q7LA 4P4FA 2PVWA 1TKFA 3KGQA 2PJ4A 4OC0A 3IEHA 4FWUA 3NH5A 3S9LA 4PXDA 5HVGA 4MHZA 4DJLA 4FBEA 5JH9A 4AXVA 3RZAA 5JM6A 2PVVA 3SJEA 5K8OA 1DTDA 2PJAA 1HEEA 5THWA 3IJ3A 3FEDA 1VIXA 3KHXA 5IB9A 2NYQA 2EWBA 3S9MA 5F09A 4WJBA 3B3SA 4UIAA 3GUXA 2HB6A 4UF4A 2BO9A 3SJFA 3PFEA 4FAIA 3B2YA 2VL1A 1AYEA 4PPZA 1OBRA 4P4JA 4X2TA 4UEFA 4TWEA 5LYDA 1CPXA 4MMOA 2XEFA 3DLJA 3PFOA 2Q4ZA 3PBBA 2Q43A 3CT9A 1VHEA 3CPAA 2OOTA 3DGVA 1GYTA 2AFZA 2OR4A 1LCPA 1UWYA 4G1PA 1CP6A 4ONWA 3RBUA 4OKOA 2PJ8A 4ZY0A 1YSJA 3D7HA 2POKA 2RFHA 3D7FA 4NJQA 4P6YA 2ZEDA 1CPSA 2C1CA 1AMPA 2PJ9A 5DS0A 2PCUA 4OC1A 1Z8LA 1CG2A 4R6TA 3SJXA 1LAPA 2ZELA 4MXUA 2PJ1A 4O23A 1HDUA 3FJUA 2GREA 1LFWA 2AFWA 1Z2LA 1CBXA 3SI1A 4NGPA 4OC3A 4R7MA 5D8NA 4TNUA 4A38A 4PQAA 4GM5A 4P44A 3PB6X 1TKHA 4OIDA 3WC5A 4W9YA 4Q7AA 2O4HA 2EK8A 1ELLP 4MCQA 2ZOGA 2XEJA 4A39A 3NFZA 4P4BA 4MHNA 2ABZA 2ZENA 1ELMP 3FECA 3D7DA 4MHPA 4A37A 4ZX8A 3BI1A 4MHYA 1M4LA 1F2OA 2ZEGA 4ZYQA 2AFXA 3KHZA 3H8EA 4IK2A 1FT7A 3VARA 3JRUA 5HVFA 2AFMA 3WC7A 3D7GA 3PBEA 2RB7A 4JZ0A 1TF8A 2J9AA 2PIYA 5LYFA 4EMEA 2WYRA 3IIBA 5ELYA 2XEGA 4OC2A 1PCAA 2PJ0A 2QVPA 5HVHA 2C6GA 5D29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFO A;  3LMS A;  3TC8 A;  4NGT A;  1PYT B;  3B35 A;  4P4E A;  3K2K A;  3NA6 A;  4JYW A;  4IAV A;  2IQ6 A;  3CPX A;  3SJG A;  5LYI A;  4BD9 A;  6CPA A;  2IJZ A;  1YW6 A;  2JEW A;  5J1Q A;  2WZN A;  3KAS A;  1XBU A;  1JQG A;  3FX6 A;  2PIZ A;  1BPN A;  3IC1 A;  5LRK A;  2JBK A;  4F9V A;  4NFR A;  3KR4 A;  2O53 A;  4OP4 A;  3N5F A;  3CDX A;  1QQ9 A;  2PJ2 A;  3NH8 A;  2C6C A;  4UEE A;  2DEA A;  2ZEP A;  3SI2 A;  3ISZ A;  2C6P A;  2PJC A;  4NGQ A;  4NGM A;  4DUK A;  1R3N A;  3KQX A;  1FNO A;  4CPA A;  2PJ5 A;  2GLF A;  3RAM A;  1VGY A;  4ZY2 A;  1TF9 A;  3GB0 A;  3K9T A;  4A94 A;  2G9D A;  1BPM A;  3PB8 X;  2V8G A;  4F8Z A;  4P4D A;  3WC6 A;  4NJR A;  1BAV A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  4EWT A;  2AFS A;  7CPA A;  1XJO A;  2HC9 A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  2EK9 A;  4K3N A;  3LWU A;  3NH4 A;  3QNV A;  1ZLI A;  4OME A;  5K8P A;  4F9U A;  1Y0Y A;  3TX8 A;  2IMO A;  4FUU A;  5K8N A;  5LRG A;  3PRT A;  3T8W A;  2JBJ A;  4P45 A;  3B3C A;  2GU2 A;  1ZLH A;  4UIB A;  3PB4 X;  3B3V A;  4PXB A;  4YU9 A;  4ZI6 A;  3WT4 A;  1ZG9 A;  3V38 A;  5LRJ A;  1ZG7 A;  5HXD A;  2ZEE A;  5LYL A;  5I4M A;  2NSM A;  1VHO A;  1HDQ A;  3B3T A;  4ZY1 A;  1Z5R A;  4YWY A;  3FH4 A;  4DYO A;  3FMC A;  5K8M A;  4UEZ A;  3IO1 A;  2PRQ A;  1XMB A;  3FVL A;  2ZEF A;  8CPA A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4P10 A;  1LAN A;  2V8V A;  4OIW A;  1DE4 C;  3KZW A;  2V8H A;  1QMU A;  3B7I A;  3FEE A;  2V8D A;  4NGR A;  3KL9 A;  1IGB A;  4ZX9 A;  1H8L A;  1EE3 P;  3HLP A;  3FF3 A;  2CF4 A;  4MRI A;  4R8F A;  3V7Z A;  1LAM A;  4MCS A;  4EFD A;  3BI0 A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  2ZEM A;  4OC4 A;  3ISX A;  3MN8 A;  2F8H A;  3D67 A;  3H8G A;  4PXE A;  2PE3 A;  2ZEO A;  2BOA A;  4MCP A;  3SI0 A;  4NGS A;  3PB9 X;  5CBM A;  3KQZ A;  4OC5 A;  2QJ8 A;  2PJB A;  3VH9 A;  4PXC A;  3S9N A;  2XEI A;  4IHM A;  4WWV A;  3BHX A;  1TXR A;  2FVG A;  1Y0R A;  2Q51 A;  1CP7 A;  2GLJ A;  3D66 A;  5CPA A;  1ARL A;  4X8I A;  4RUH A;  1YW4 A;  2F7V A;  3GLJ A;  3IFE A;  4LQG A;  2I3C A;  1CX8 A;  3B3W A;  4X3R A;  4P4I A;  1R43 A;  3I1U A;  3PB7 X;  2CTB A;  3MRU A;  1YLO A;  2V77 A;  1ZG8 A;  3IWW A;  3VAT A;  1YME A;  4Z65 A;  4NGN A;  1XRY A;  1NSA A;  3H8F A;  1RTQ A;  1BLL E;  2ZEH A;  3WAB A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  1F2P A;  2PJ6 A;  1IY7 A;  2CTC A;  4H2K A;  4R76 A;  3D4U A;  4MCR A;  3BXM A;  1Y7E A;  2PJ3 A;  1Q7L A;  4P4F A;  2PVW A;  1TKF A;  3KGQ A;  2PJ4 A;  4OC0 A;  3IEH A;  4FWU A;  3NH5 A;  3S9L A;  4PXD A;  5HVG A;  4MHZ A;  4DJL A;  4FBE A;  5JH9 A;  4AXV A;  3RZA A;  5JM6 A;  2PVV A;  3SJE A;  5K8O A;  1DTD A;  2PJA A;  1HEE A;  5THW A;  3IJ3 A;  3FED A;  1VIX A;  3KHX A;  5IB9 A;  2NYQ A;  2EWB A;  3S9M A;  5F09 A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2HB6 A;  4UF4 A;  2BO9 A;  3SJF A;  3PFE A;  4FAI A;  3B2Y A;  2VL1 A;  1AYE A;  4PPZ A;  1OBR A;  4P4J A;  4X2T A;  4UEF A;  4TWE A;  5LYD A;  1CPX A;  4MMO A;  2XEF A;  3DLJ A;  3PFO A;  2Q4Z A;  3PBB A;  2Q43 A;  3CT9 A;  1VHE A;  3CPA A;  2OOT A;  3DGV A;  1GYT A;  2AFZ A;  2OR4 A;  1LCP A;  1UWY A;  4G1P A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  4ZY0 A;  1YSJ A;  3D7H A;  2POK A;  2RFH A;  3D7F A;  4NJQ A;  4P6Y A;  2ZED A;  1CPS A;  2C1C A;  1AMP A;  2PJ9 A;  5DS0 A;  2PCU A;  4OC1 A;  1Z8L A;  1CG2 A;  4R6T A;  3SJX A;  1LAP A;  2ZEL A;  4MXU A;  2PJ1 A;  4O23 A;  1HDU A;  3FJU A;  2GRE A;  1LFW A;  2AFW A;  1Z2L A;  1CBX A;  3SI1 A;  4NGP A;  4OC3 A;  4R7M A;  5D8N A;  4TNU A;  4A38 A;  4PQA A;  4GM5 A;  4P44 A;  3PB6 X;  1TKH A;  4OID A;  3WC5 A;  4W9Y A;  4Q7A A;  2O4H A;  2EK8 A;  1ELL P;  4MCQ A;  2ZOG A;  2XEJ A;  4A39 A;  3NFZ A;  4P4B A;  4MHN A;  2ABZ A;  2ZEN A;  1ELM P;  3FEC A;  3D7D A;  4MHP A;  4A37 A;  4ZX8 A;  3BI1 A;  4MHY A;  1M4L A;  1F2O A;  2ZEG A;  4ZYQ A;  2AFX A;  3KHZ A;  3H8E A;  4IK2 A;  1FT7 A;  3VAR A;  3JRU A;  5HVF A;  2AFM A;  3WC7 A;  3D7G A;  3PBE A;  2RB7 A;  4JZ0 A;  1TF8 A;  2J9A A;  2PIY A;  5LYF A;  4EME A;  2WYR A;  3IIB A;  5ELY A;  2XEG A;  4OC2 A;  1PCA A;  2PJ0 A;  2QVP A;  5HVH A;  2C6G A;  5D29 A; 
#chains in the Genus database with same CATH topology
 3H5Z A;  2AFO A;  3LMS A;  4A33 A;  5AG7 A;  3TC8 A;  4CAX A;  5IB0 A;  1S7K A;  4KS9 A;  4QC6 A;  4M3S A;  2Z3P A;  1N71 A;  1M44 A;  1PYT B;  4NGT A;  2R98 A;  4R57 A;  3SXN A;  4MBU A;  5DWN A;  2CNM A;  3B35 A;  4NCZ A;  3K2K A;  3NA6 A;  4P4E A;  4A32 A;  4C2Z A;  1U6M A;  4JJX A;  1QSR A;  4MY3 A;  4MY0 A;  4Y49 C;  4K30 A;  4RI1 A;  4JYW A;  4IAV A;  2IQ6 A;  2YGW A;  3CPX A;  4KZT A;  5F47 A;  4PK3 A;  3SJG A;  2IL4 A;  4A95 A;  3FYN A;  2FIA A;  5LYI A;  4R87 A;  2DPT A;  4BD9 A;  6CPA A;  3DSB A;  2IJZ A;  2B4D B;  1YW6 A;  3F8K A;  2JEW A;  2HQY A;  1I1D A;  2WZN A;  3KAS A;  4UCP A;  5J1Q A;  4B12 A;  4C68 A;  1S7F A;  1XBU A;  1JQG A;  3FRM A;  2JDD A;  3FX6 A;  2BEI A;  1BPN A;  2PIZ A;  3IC1 A;  4IF5 A;  1NSL A;  2JBK A;  5LRK A;  4YFJ A;  4KOU A;  1IOF A;  2PC1 A;  4F9V A;  4NFR A;  4XPL A;  3KR4 A;  3BLN A;  1Q2Y A;  2J8M A;  3VWE A;  4CGO A;  2O53 A;  2P0W A;  1QSO A;  4OP4 A;  2EVN A;  3N5F A;  4JD6 A;  2HUZ A;  3CDX A;  4CAE A;  1QQ9 A;  2EBJ A;  2PJ2 A;  4PK2 A;  2BUE A;  4E0A A;  3NH8 A;  2C6C A;  4UEE A;  2EO8 A;  2Z0Z A;  2DEA A;  1YK3 A;  2ZEP A;  2AJ6 A;  4JWP A;  2GFQ A;  3ISZ A;  3SI2 A;  5C88 A;  2C6P A;  2PJC A;  5IX3 A;  4FD5 A;  2Y0M A;  4NGQ A;  2PRB A;  1LRZ A;  2ODF A;  4I49 A;  4KSF A;  4M6H A;  4NGM A;  4XNH B;  4DUK A;  1R3N A;  2REE A;  5GCN A;  2ZW4 A;  3KQX A;  5G22 A;  1FNO A;  3JUW A;  4FD4 A;  4CPA A;  2OH1 A;  2PJ5 A;  4QVT A;  2GLF A;  4CYQ A;  1OZP A;  3RAM A;  2VZZ A;  2Z3L A;  1VGY A;  4NEX A;  4ZY2 A;  3FB3 A;  1TF9 A;  3GB0 A;  3K9T A;  4H89 A;  4KOW A;  2B58 A;  4UCN A;  3B8G A;  4A94 A;  2DF5 A;  3F5B A;  5JQ4 A;  2G9D A;  1BPM A;  1JWQ A;  3PB8 X;  4ZBG A;  2V8G A;  4C7H A;  4F8Z A;  4P4D A;  1CM0 A;  4BMH A;  3CXS A;  5G1Z A;  3D2M A;  4CAV A;  4B5P A;  3WC6 A;  2RC4 A;  1YRE A;  1BAV A;  4NJR A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  3FBU A;  2AFS A;  4PSX A;  4EWT A;  7CPA A;  3S9N A;  4BIN A;  1Z8W A;  2J8N A;  2ZW7 A;  4CRY B;  5J8C A;  1XJO A;  2HC9 A;  3I9S A;  4KOY A;  4M85 A;  1UFH A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  1MJB A;  2EK9 A;  3D8P A;  4UFV A;  4PSW A;  1J4J A;  4K3N A;  3RO0 A;  3LWU A;  3NH4 A;  3QNV A;  1IU8 A;  1ZLI A;  4HNX B;  4OME A;  3OWC A;  1FY7 A;  5K8P A;  2R7H A;  4B5P B;  4Q36 A;  3QAH A;  4F9U A;  5IV0 A;  1Y0Y A;  3LAC A;  3H4Q A;  4M6I A;  3TX8 A;  2IMO A;  4FUU A;  4MJ8 A;  3LD2 A;  5K8N A;  2JLM A;  4LX9 A;  5LRG A;  3PRT A;  3T8W A;  4F0Y A;  2JBJ A;  2PDO A;  4ZGY B;  4CYP A;  4ORF A;  4AVA A;  4P45 A;  4CRZ B;  3B3C A;  1S3Z A;  1P0H A;  2GU2 A;  4Q38 A;  1ZLH A;  3S6F A;  4DNC A;  1X12 A;  4U9Z A;  3G3S A;  3TOA A;  4UIB A;  4L8A A;  4KOV A;  3PB4 X;  3B3V A;  3CXQ A;  4PXB A;  1IYL A;  4A30 A;  4YU9 A;  4ZI6 A;  3EFA A;  4H6Z A;  3PGP A;  1XF8 A;  4HPS A;  3WT4 A;  2FSR A;  4XNH C;  4MFL A;  2B3V A;  4F0X A;  1ZG9 A;  3GYA A;  3DR8 A;  3V38 A;  5LRJ A;  4MFZ A;  1IOI A;  1ZG7 A;  5HXD A;  2ZEE A;  5LYL A;  3IWG A;  4KOR A;  5I4M A;  2NSM A;  3LOD A;  1MK4 A;  1VHO A;  1HDQ A;  3B3T A;  4ZY1 A;  2Q44 A;  1M4D A;  1Z5R A;  4YWY A;  4E2A A;  4YRH A;  3FH4 A;  4DYO A;  3FMC A;  5J8F A;  2YNE A;  4UEZ A;  3IO1 A;  3RNZ A;  2YNC C;  5K8M A;  3IWE A;  2OZU A;  2PRQ A;  1MJA A;  3W6S A;  1I21 A;  1RO5 A;  1XMB A;  3PZJ A;  3FVL A;  2ZEF A;  8CPA A;  2Q7S A;  5F46 A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4CYO A;  4P10 A;  1LAN A;  2PQ8 A;  2CNS A;  2V8V A;  5D29 A;  2Q0Y A;  4OIW A;  1DE4 C;  4ONU A;  3KZW A;  2V8H A;  4MFK A;  2PR8 A;  1QMU A;  3B7I A;  4KVX A;  3FEE A;  2A4N A;  2OB0 A;  2V8D A;  4GXH A;  3D3S A;  4NGR A;  3KL9 A;  1IGB A;  2Q04 A;  4X5K A;  2ARH A;  2G3A A;  2CXA A;  2YNC A;  4Y49 B;  4ZX9 A;  1H8L A;  2I00 A;  1EE3 P;  2P6G A;  3EO4 A;  3DDD A;  3HLP A;  1NE9 A;  2ZPA A;  3WR7 A;  3FF3 A;  2CF4 A;  1RXT A;  3G8W A;  1Y9W A;  4MRI A;  4R8F A;  3V7Z A;  1LAM A;  4NF1 A;  4MCS A;  4C7I A;  4EFD A;  3BI0 A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  2ZEM A;  4LUA A;  1IB1 E;  4OC4 A;  3ISX A;  3MN8 A;  2F8H A;  1YR0 A;  4J3G A;  1B6B A;  3D67 A;  3H8G A;  4PXE A;  3TTH A;  3RYO A;  4U9Y A;  5F49 A;  2PE3 A;  2ZEO A;  4UFX A;  5KTC A;  2BOA A;  1IID A;  4MCP A;  4MI4 A;  2VZY A;  3V8I A;  3SI0 A;  4NGS A;  3PB9 X;  3SXO A;  5CBM A;  2G0B A;  3T90 A;  3PP9 A;  3IGR A;  4CGL A;  3KQZ A;  4MHD A;  4OC5 A;  2QJ8 A;  2PJB A;  3VH9 A;  3C26 A;  2PR1 A;  1YGH A;  2XEI A;  2EUI A;  4IHM A;  4KVM E;  4PXC A;  4WWV A;  3TO6 A;  3R95 A;  3BHX A;  4UWI A;  3GIU A;  1TXR A;  3CZX A;  2FVG A;  1Y0R A;  2B4D A;  2Q51 A;  1CP7 A;  2GLJ A;  4MFP A;  4CGP A;  3D66 A;  5CPA A;  5I0C A;  4NXY A;  1ARL A;  2R1I A;  4JXR A;  3ZZI A;  5BWA B;  4X8I A;  4RUH A;  1YW4 A;  2CY2 A;  5JPH A;  2F7V A;  3GLJ A;  3IFE A;  4LQG A;  5EMI A;  2I3C A;  1CX8 A;  4QBJ A;  3B3W A;  3TFY A;  1YQE A;  2JDC A;  4X3R A;  1K4J A;  1TIQ A;  1ZO0 A;  3QB8 A;  2Z3K A;  4P4I A;  1R43 A;  3I1U A;  3PB7 X;  4JXQ A;  4KVO E;  2CTB A;  3MRU A;  1YLE A;  1YLO A;  2VQY A;  2V77 A;  1ZG8 A;  4KOX A;  3IWW A;  3VAT A;  1YME A;  2DPS A;  4Z65 A;  3FNC A;  4NGN A;  1IIC A;  1XRY A;  1NSA A;  3H8F A;  1S60 A;  3UY5 A;  1PUA A;  4CAF A;  3SHP A;  1RTQ A;  3EC4 A;  1BLL E;  2H5M A;  2ZEH A;  1V0C A;  3WAB A;  4B14 A;  2FCK A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  4QUS A;  4B10 A;  1F2P A;  3E0K A;  3TE4 A;  4U5Y A;  2X7B A;  2ZW6 A;  2PJ6 A;  3TCV A;  1IY7 A;  1I12 A;  2CTC A;  4H2K A;  2Z3M A;  4R76 A;  3D4U A;  3R1K A;  4MCR A;  4PV6 A;  4A31 A;  3BXM A;  1Y7E A;  1Z8T A;  2PJ3 A;  1Q7L A;  3GY9 A;  5HMN A;  4FD6 A;  2PVW A;  4P4F A;  1TKF A;  3KGQ A;  2PJ4 A;  2P6E A;  4OC0 A;  3DR6 A;  3IEH A;  4UCM A;  4FWU A;  3NH5 A;  3S9L A;  1MJ9 A;  4CGN A;  4AG9 A;  4PXD A;  5HVG A;  1Y7R A;  3TO7 A;  4MHZ A;  1VKC A;  4DJL A;  4FBE A;  5JH9 A;  4AXV A;  5DWM A;  3RZA A;  1KZF A;  2KCW A;  4C2Y A;  5JM6 A;  1YVK A;  2OU2 A;  2B4B A;  3R96 A;  2OZG A;  2PVV A;  4FD7 A;  3SJE A;  2F5I A;  2G3T A;  2FXF A;  5AG4 A;  5K8O A;  1DTD A;  2PJA A;  1HEE A;  1BO4 A;  5THW A;  4XPD C;  4AVB A;  4OLL A;  2ZXV A;  1KUX A;  3IJ3 A;  3FED A;  4KLW A;  1VIX A;  3KHX A;  4BBH A;  3S6H A;  1NMT A;  2I79 A;  5IB9 A;  2NYQ A;  2EWB A;  3S9M A;  5F09 A;  1S7L A;  2FIW A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2O28 A;  2HB6 A;  4UF4 A;  3BJ8 A;  1WWZ A;  5EC4 A;  2K5T A;  2ATR A;  3S6G A;  2BO9 A;  2ZW5 A;  2GE3 A;  3SJF A;  1Z4E A;  4E8O A;  3PFE A;  4UWJ A;  5CNP A;  3P2F A;  4RS2 A;  3JTK A;  4FAI A;  3B2Y A;  1Z8X A;  2VL1 A;  2WPW A;  5KTD A;  1Z4R A;  5AGE A;  1AYE A;  1KUV A;  4L89 A;  4PPZ A;  1S7N A;  2FL4 A;  1OBR A;  2FS5 A;  1Y9K A;  4P4J A;  4B11 A;  3GKR A;  4X2T A;  4UEF A;  2YND A;  4TWE A;  5LYD A;  4UFW A;  1CPX A;  2D4O A;  2Z10 A;  4MMO A;  3CXP A;  1X10 A;  1WK4 A;  2VBQ A;  2XEF A;  3DLJ A;  3ZJ0 A;  3PFO A;  2Q4Z A;  1PU9 A;  2B3U A;  4CS0 B;  3PBB A;  3S6K A;  1XEB A;  2WSA A;  1Q2D A;  2OZH A;  2DXQ A;  2Q43 A;  3CT9 A;  2NMT A;  1M4G A;  5H86 A;  5G20 A;  1VHE A;  3CPA A;  1YX0 A;  2BSW A;  5AG5 A;  2OOT A;  3DGV A;  3T9Y A;  1GYT A;  3EXN A;  2AFZ A;  2OR4 A;  5EBV A;  4AVC A;  5F48 A;  1LCP A;  4NSQ A;  3R9E A;  4II9 A;  4QB9 A;  1UWY A;  3I3G A;  5A27 A;  4G1P A;  2VEZ A;  1XMT A;  2HV2 A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  5E96 A;  4ZY0 A;  4HNY B;  5C82 A;  1IYK A;  4MFQ A;  2QEC A;  4HNW B;  2VXK A;  4B5O A;  1YSJ A;  3D7H A;  2POK A;  3F0A A;  4KLV A;  2RFH A;  3D7F A;  3W91 A;  5H84 A;  4NJQ A;  2AE6 A;  2ZED A;  4P6Y A;  2PSW A;  1CPS A;  2C1C A;  1AMP A;  4GS4 A;  2PJ9 A;  5DS0 A;  1VHS A;  2PCU A;  3P2H A;  2FE7 A;  4EVY A;  2Q4V A;  1ON0 A;  2D4P A;  1BOB A;  4OC1 A;  3JVN A;  1Z8L A;  1AUG A;  1CG2 A;  2QML A;  2VI7 A;  1LAP A;  4KUB A;  4R6T A;  4UA3 A;  3SJX A;  1S5K A;  4R3K A;  3VWD A;  2ZEL A;  4MXU A;  4AB7 A;  2B5G A;  2PJ1 A;  4O23 A;  2J8R A;  3QAY A;  4XPK A;  1L0C A;  4MFJ A;  1HDU A;  3K9U A;  1B87 A;  3FJU A;  4UBR A;  2Q4Y A;  4JLY A;  1XIX A;  3TOB A;  5G21 A;  2GRE A;  1LFW A;  1QSM A;  2FT0 A;  4OAD A;  2WPX A;  2AFW A;  1Z2L A;  1CBX A;  3SI1 A;  4NGP A;  4OC3 A;  5FVJ A;  5KTA A;  1XE4 A;  3FIX A;  4R7M A;  5D8N A;  4TNU A;  1QSN A;  3R9F A;  1KUY A;  2GIV A;  4A38 A;  3NE8 A;  4PQA A;  4GM5 A;  5AG6 A;  2BL1 A;  1A2Z A;  4CGM A;  4P44 A;  2REF A;  1M1D A;  4B13 A;  3DNS A;  3PB6 X;  1TKH A;  2R8V A;  4AG7 A;  1M4I A;  2QIR A;  1CJW A;  4OID A;  2C27 A;  4R3L A;  3A9L A;  3WC5 A;  3FXT A;  3BJ7 A;  4Q7A A;  4W9Y A;  4C2X A;  3NE7 A;  4LQ6 A;  5HH1 A;  4CYN A;  2O4H A;  1YVO A;  4KSA A;  2EK8 A;  1SQH A;  4RN7 A;  1ELL P;  1Z9U A;  2CNT A;  2ZOG A;  4MCQ A;  2XEJ A;  4KUA A;  4A39 A;  3NFZ A;  4P4B A;  5A28 A;  4MHN A;  2ABZ A;  2ZEN A;  1ELM P;  3FEC A;  4A2Z A;  1Q2C A;  3D7D A;  4MHP A;  4A37 A;  4ZX8 A;  5ISV A;  3BI1 A;  3W6X A;  1XOV A;  3IU2 A;  4MHY A;  1M4L A;  1F2O A;  2Z3N A;  2ZEG A;  4ZYQ A;  2AFX A;  2B5G B;  3KHZ A;  3H8E A;  4R9M A;  2JEV A;  3N7Z A;  4KOS A;  1P4N A;  4CAW A;  4IK2 A;  1FT7 A;  3TO9 A;  3VAR A;  3JRU A;  2Q7B A;  5HVF A;  2AFM A;  1R57 A;  3WC7 A;  3D7G A;  2Z3O A;  3PBE A;  2RB7 A;  4YGO A;  3D2P A;  3TT2 A;  4JZ0 A;  4H6U A;  4F6A A;  1GHE A;  1TF8 A;  2J9A A;  2WUU A;  2PIY A;  4IUS A;  3R9G A;  5LYF A;  4EME A;  2WYR A;  4HKF A;  3MGD A;  3IIB A;  4OAE A;  5ELY A;  2XEG A;  4M6G A;  1PCA A;  3EY5 A;  4OC2 A;  2Z11 A;  3IU1 A;  1QST A;  2PJ0 A;  4KOT A;  2P6F A;  2GAN A;  2QVP A;  5HVH A;  2C6G A;  3KKW A;  4XPD B; 
#chains in the Genus database with same CATH homology
 2AFO A;  3LMS A;  3TC8 A;  4NGT A;  1PYT B;  3B35 A;  4P4E A;  3K2K A;  3NA6 A;  4JYW A;  4IAV A;  2IQ6 A;  3CPX A;  3SJG A;  5LYI A;  4BD9 A;  6CPA A;  2IJZ A;  1YW6 A;  2JEW A;  5J1Q A;  2WZN A;  3KAS A;  1XBU A;  1JQG A;  3FX6 A;  2PIZ A;  1BPN A;  3IC1 A;  5LRK A;  2JBK A;  4F9V A;  4NFR A;  3KR4 A;  2O53 A;  4OP4 A;  3N5F A;  3CDX A;  1QQ9 A;  2PJ2 A;  3NH8 A;  2C6C A;  4UEE A;  2DEA A;  2ZEP A;  3SI2 A;  3ISZ A;  2C6P A;  2PJC A;  4NGQ A;  4NGM A;  4DUK A;  1R3N A;  3KQX A;  1FNO A;  4CPA A;  2PJ5 A;  2GLF A;  3RAM A;  1VGY A;  4ZY2 A;  1TF9 A;  3GB0 A;  3K9T A;  4A94 A;  2G9D A;  1BPM A;  3PB8 X;  2V8G A;  4F8Z A;  4P4D A;  3WC6 A;  4NJR A;  1BAV A;  1KWM A;  1F57 A;  3L2N A;  2ZOF A;  4EWT A;  2AFS A;  7CPA A;  1XJO A;  2HC9 A;  3KI9 A;  1LOK A;  3PEI A;  4KSI A;  2EK9 A;  4K3N A;  3LWU A;  3NH4 A;  3QNV A;  1ZLI A;  4OME A;  5K8P A;  4F9U A;  1Y0Y A;  3TX8 A;  2IMO A;  4FUU A;  5K8N A;  5LRG A;  3PRT A;  3T8W A;  2JBJ A;  4P45 A;  3B3C A;  2GU2 A;  1ZLH A;  4UIB A;  3PB4 X;  3B3V A;  4PXB A;  4YU9 A;  4ZI6 A;  3WT4 A;  1ZG9 A;  3V38 A;  5LRJ A;  1ZG7 A;  5HXD A;  2ZEE A;  5LYL A;  5I4M A;  2NSM A;  1VHO A;  1HDQ A;  3B3T A;  4ZY1 A;  1Z5R A;  4YWY A;  3FH4 A;  4DYO A;  3FMC A;  5K8M A;  4UEZ A;  3IO1 A;  2PRQ A;  1XMB A;  3FVL A;  2ZEF A;  8CPA A;  1XFO A;  5JGF A;  2PJ7 A;  2ANP A;  3KR5 A;  2BCO A;  4P10 A;  1LAN A;  2V8V A;  4OIW A;  1DE4 C;  3KZW A;  2V8H A;  1QMU A;  3B7I A;  3FEE A;  2V8D A;  4NGR A;  3KL9 A;  1IGB A;  4ZX9 A;  1H8L A;  1EE3 P;  3HLP A;  3FF3 A;  2CF4 A;  4MRI A;  4R8F A;  3V7Z A;  1LAM A;  4MCS A;  4EFD A;  3BI0 A;  3D68 A;  1ARM A;  2QYV A;  2CIJ A;  2ZEM A;  4OC4 A;  3ISX A;  3MN8 A;  2F8H A;  3D67 A;  3H8G A;  4PXE A;  2PE3 A;  2ZEO A;  2BOA A;  4MCP A;  3SI0 A;  4NGS A;  3PB9 X;  5CBM A;  3KQZ A;  4OC5 A;  2QJ8 A;  2PJB A;  3VH9 A;  4PXC A;  3S9N A;  2XEI A;  4IHM A;  4WWV A;  3BHX A;  1TXR A;  2FVG A;  1Y0R A;  2Q51 A;  1CP7 A;  2GLJ A;  3D66 A;  5CPA A;  1ARL A;  4X8I A;  4RUH A;  1YW4 A;  2F7V A;  3GLJ A;  3IFE A;  4LQG A;  2I3C A;  1CX8 A;  3B3W A;  4X3R A;  4P4I A;  1R43 A;  3I1U A;  3PB7 X;  2CTB A;  3MRU A;  1YLO A;  2V77 A;  1ZG8 A;  3IWW A;  3VAT A;  1YME A;  4Z65 A;  4NGN A;  1XRY A;  1NSA A;  3H8F A;  1RTQ A;  1BLL E;  2ZEH A;  3WAB A;  2AFU A;  4B6Z A;  3HUV A;  1TKJ A;  1F2P A;  2PJ6 A;  1IY7 A;  2CTC A;  4H2K A;  4R76 A;  3D4U A;  4MCR A;  3BXM A;  1Y7E A;  2PJ3 A;  1Q7L A;  4P4F A;  2PVW A;  1TKF A;  3KGQ A;  2PJ4 A;  4OC0 A;  3IEH A;  4FWU A;  3NH5 A;  3S9L A;  4PXD A;  5HVG A;  4MHZ A;  4DJL A;  4FBE A;  5JH9 A;  4AXV A;  3RZA A;  5JM6 A;  2PVV A;  3SJE A;  5K8O A;  1DTD A;  2PJA A;  1HEE A;  5THW A;  3IJ3 A;  3FED A;  1VIX A;  3KHX A;  5IB9 A;  2NYQ A;  2EWB A;  3S9M A;  5F09 A;  4WJB A;  3B3S A;  4UIA A;  3GUX A;  2HB6 A;  4UF4 A;  2BO9 A;  3SJF A;  3PFE A;  4FAI A;  3B2Y A;  2VL1 A;  1AYE A;  4PPZ A;  1OBR A;  4P4J A;  4X2T A;  4UEF A;  4TWE A;  5LYD A;  1CPX A;  4MMO A;  2XEF A;  3DLJ A;  3PFO A;  2Q4Z A;  3PBB A;  2Q43 A;  3CT9 A;  1VHE A;  3CPA A;  2OOT A;  3DGV A;  1GYT A;  2AFZ A;  2OR4 A;  1LCP A;  1UWY A;  4G1P A;  1CP6 A;  4ONW A;  3RBU A;  4OKO A;  2PJ8 A;  4ZY0 A;  1YSJ A;  3D7H A;  2POK A;  2RFH A;  3D7F A;  4NJQ A;  4P6Y A;  2ZED A;  1CPS A;  2C1C A;  1AMP A;  2PJ9 A;  5DS0 A;  2PCU A;  4OC1 A;  1Z8L A;  1CG2 A;  4R6T A;  3SJX A;  1LAP A;  2ZEL A;  4MXU A;  2PJ1 A;  4O23 A;  1HDU A;  3FJU A;  2GRE A;  1LFW A;  2AFW A;  1Z2L A;  1CBX A;  3SI1 A;  4NGP A;  4OC3 A;  4R7M A;  5D8N A;  4TNU A;  4A38 A;  4PQA A;  4GM5 A;  4P44 A;  3PB6 X;  1TKH A;  4OID A;  3WC5 A;  4W9Y A;  4Q7A A;  2O4H A;  2EK8 A;  1ELL P;  4MCQ A;  2ZOG A;  2XEJ A;  4A39 A;  3NFZ A;  4P4B A;  4MHN A;  2ABZ A;  2ZEN A;  1ELM P;  3FEC A;  3D7D A;  4MHP A;  4A37 A;  4ZX8 A;  3BI1 A;  4MHY A;  1M4L A;  1F2O A;  2ZEG A;  4ZYQ A;  2AFX A;  3KHZ A;  3H8E A;  4IK2 A;  1FT7 A;  3VAR A;  3JRU A;  5HVF A;  2AFM A;  3WC7 A;  3D7G A;  3PBE A;  2RB7 A;  4JZ0 A;  1TF8 A;  2J9A A;  2PIY A;  5LYF A;  4EME A;  2WYR A;  3IIB A;  5ELY A;  2XEG A;  4OC2 A;  1PCA A;  2PJ0 A;  2QVP A;  5HVH A;  2C6G A;  5D29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...