4FWUA

Crystal structure of glutaminyl cyclase from drosophila melanogaster in space group i4
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
299
Chain Sequence
QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG32412
publication title Structure of glutaminyl cyclase from Drosophila melanogaster in space group I4.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 106
structure length 299
sequence length 305
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fwuA00
3ISXA 1ELLP 2C1CA 1CX8A 2GU2A 3TC8A 4RUHA 2HB6A 3RBUA 8CPAA 4IHMA 3IFEA 3PFEA 1ZG8A 2V8VA 2ZOGA 2AFSA 3D4UA 1AMPA 4ZX9A 4F8ZA 4P4FA 3MN8A 2AFOA 1CBXA 3LMSA 3VARA 1R43A 1DE4C 2ZOFA 5LYFA 3PFOA 1VGYA 3RAMA 4P4EA 4R76A 1VIXA 3SI0A 4AXVA 1YW4A 1ZG9A 2WYRA 4EMEA 4ZY1A 3PB6X 3VATA 2XEIA 3BXMA 4H2KA 3D66A 4MHYA 1H8LA 3PBBA 1YLOA 3PRTA 5K8NA 4FAIA 1ELMP 2EK8A 5LRKA 3PB9X 4Z65A 1TXRA 1QMUA 1F2OA 3BI1A 4PXBA 4IK2A 4OC1A 1HDQA 2PJCA 1TF9A 1CPXA 3CPAA 3GUXA 1XJOA 1VHOA 1BPMA 3PBEA 2V8GA 3D7GA 4MXUA 4WWVA 4NGPA 4K3NA 4MCQA 2PRQA 2RB7A 2ZENA 4WJBA 3KZWA 2WZNA 4OC5A 1CPSA 2ANPA 2PJ5A 2PIZA 4PPZA 3SJFA 2PVVA 4A39A 4KSIA 4OMEA 4F9VA 2I3CA 1OBRA 6CPAA 4Q7AA 1PCAA 4FUUA 2PJ7A 1Q7LA 5K8MA 3B3VA 3NH8A 4CPAA 4GM5A 5LYIA 5HVGA 3IWWA 2V8DA 3PB4X 3PEIA 3IJ3A 4DJLA 3PB8X 2CIJA 3CDXA 3TX8A 1GYTA 2FVGA 3S9NA 4UIAA 2EWBA 2ZEEA 2HC9A 1XFOA 4MRIA 3BHXA 5K8PA 1CP6A 1XBUA 2JBKA 4ZY0A 3IEHA 4ONWA 1DTDA 2ABZA 5LRGA 3KGQA 4NGMA 4R6TA 4MHZA 3D68A 2PVWA 3RZAA 3S9MA 4OC3A 3B2YA 3BI0A 5DS0A 2BO9A 1LAMA 2PJAA 5CBMA 3WC5A 1IGBA 3SI1A 3KASA 2QJ8A 3KQZA 4UIBA 4BD9A 3WC7A 4NGNA 4NFRA 1ARMA 2EK9A 1ZLHA 2RFHA 1AYEA 3V38A 1UWYA 1CP7A 4P4IA 2AFZA 5IB9A 5CPAA 3DGVA 2AFXA 3PB7X 4OC4A 5HVHA 2ZEFA 4JYWA 2OOTA 5ELYA 4F9UA 3B3TA 4OC0A 4P45A 2C6PA 2Q51A 3HUVA 3S9LA 1Y0RA 1Z2LA 2QVPA 3K2KA 2IMOA 2C6GA 4MHNA 4R7MA 2ZEDA 2CTCA 5F09A 3L2NA 2F7VA 4P6YA 3SI2A 4OP4A 4X2TA 3B35A 4P44A 2ZELA 4UEZA 5I4MA 1XRYA 1FT7A 4FBEA 3QNVA 4O23A 4A38A 4G1PA 4OKOA 3CT9A 3LWUA 4YWYA 4P10A 2O4HA 2GREA 1R3NA 5D29A 3WT4A 4P4BA 4MCPA 3IO1A 1KWMA 3FEEA 4MHPA 2PJ6A 1RTQA 4UEFA 3NFZA 1QQ9A 2PIYA 1F57A 3FF3A 2QYVA 1YW6A 1BPNA 1FNOA 2J9AA 3B3WA 1Y7EA 4EFDA 4NGRA 2ZEPA 3GB0A 1TKFA 2ZEMA 1CG2A 4X8IA 3DLJA 2XEGA 2Q43A 3H8GA 3H8FA 3WC6A 2AFUA 1EE3P 1IY7A 5JGFA 2POKA 2PJ2A 4P4DA 4DYOA 1F2PA 4JZ0A 4LQGA 1YMEA 3H8EA 5D8NA 5LYLA 4MCSA 3KR5A 5LYDA 2PJ8A 1ARLA 1LOKA 1ZG7A 3FEDA 3IIBA 2JEWA 5JM6A 4UEEA 3FMCA 4NJQA 3D7HA 4NGSA 2BCOA 3WABA 2XEFA 3V7ZA 2O53A 4DUKA 4ZX8A 2XEJA 4NJRA 3FH4A 7CPAA 4UF4A 2CF4A 3NA6A 5JH9A 1ZLIA 4X3RA 2IQ6A 3N5FA 2IJZA 1Z5RA 4FWUA 3B3CA 3GLJA 2PCUA 4OIWA 1HEEA 2ZEGA 2ZEHA 1LAPA 4TWEA 2V77A 1TKHA 2PJ4A 1Y0YA 2F8HA 3SJXA 2PJ3A 3SJEA 1Z8LA 4ZYQA 2AFWA 1M4LA 3NH5A 2CTBA 2PJBA 2GLFA 3FVLA 1LCPA 2GLJA 2G9DA 4B6ZA 4A37A 3SJGA 3K9TA 1LFWA 1LANA 3CPXA 4IAVA 4A94A 1NSAA 3JRUA 4OC2A 4EWTA 4ZY2A 4PXEA 2Q4ZA 3T8WA 2BOAA 3FJUA 4PQAA 3FX6A 1BLLE 5LRJA 1PYTB 3IC1A 3FECA 3D7FA 4NGQA 4OIDA 1XMBA 3KL9A 2PE3A 3NH4A 2PJ9A 2VL1A 2V8HA 1BAVA 3HLPA 3KHXA 1TKJA 2NYQA 4MMOA 4PXDA 4MCRA 4ZI6A 1VHEA 3KR4A 2PJ1A 2C6CA 3KI9A 3KQXA 4R8FA 2AFMA 3B7IA 2OR4A 3I1UA 4NGTA 5HVFA 3D67A 2NSMA 3MRUA 1HDUA 2ZEOA 1YSJA 1TF8A 5THWA 5HXDA 1JQGA 4P4JA 3KHZA 4YU9A 3D7DA 5J1QA 3ISZA 2DEAA 3B3SA 4PXCA 4TNUA 3VH9A 2PJ0A 4W9YA 5K8OA 2JBJA
chains in the Genus database with same CATH superfamily
1ZO0A 3ISXA 3DR8A 4BINA 3RO0A 3JUWA 2FIWA 4KVME 4KVXA 1M4GA 4K30A 1ELLP 2C1CA 1CX8A 1ON0A 4B5PB 1X12A 2GU2A 3TC8A 2F5IA 4RUHA 2HB6A 3RBUA 1LRZA 4B13A 4KUBA 2BL1A 8CPAA 4JXQA 4IHMA 3IFEA 3PFEA 4CYQA 1PU9A 1ZG8A 2V8VA 2P6GA 2AFSA 2I79A 1RO5A 2ZOGA 3D4UA 4A32A 4QBJA 5F46A 1MJAA 2FCKA 1AMPA 2Q44A 4UCMA 4ZX9A 4M6GA 4F8ZA 4P4FA 3MN8A 3NE8A 5G21A 1YK3A 2AFOA 1CBXA 1AUGA 3LMSA 1R43A 3PZJA 1DE4C 2ZXVA 3VARA 4C2YA 3R95A 1IICA 2ZOFA 3IU2A 2HV2A 3PFOA 4R87A 3TO7A 1VGYA 2R7HA 4CAVA 2YNCC 4A95A 3RAMA 4P4EA 4R76A 4A2ZA 5AG6A 3F8KA 4YFJA 4CGOA 1VIXA 3SI0A 4AXVA 1YW4A 4Y49C 1ZG9A 4AVBA 5G22A 1IOIA 2WYRA 4HNYB 4EMEA 2J8MA 3PB6X 3VATA 4ZY1A 1Y9KA 2XEIA 4M6IA 4XPKA 2ZW5A 1L0CA 2CNTA 2PQ8A 4KSAA 3BXMA 4R57A 4H2KA 3D66A 4MFPA 4MHYA 1H8LA 4H89A 4X5KA 4KOVA 5JPHA 1XIXA 2YNCA 3PBBA 1YLOA 4BMHA 3PRTA 2Z3PA 2ZW4A 5K8NA 5CNPA 3V8IA 4FAIA 4NCZA 1ELMP 2EK8A 3A9LA 1MJ9A 1Q2CA 5LRKA 3PB9X 4CGLA 4JXRA 4PK3A 4Z65A 1QMUA 1TXRA 1F2OA 3BI1A 4PXBA 2VI7A 1I21A 4IK2A 4OC1A 4L8AA 2D4OA 4CYOA 4KS9A 1TIQA 2HUZA 2Z3OA 2JLMA 4XNHC 1HDQA 4C68A 1Z4EA 2PJCA 1TF9A 1CPXA 2B5GA 2B4BA 3CPAA 3GUXA 4GXHA 1XJOA 1P0HA 1VHOA 1BPMA 3PBEA 4MHDA 2V8GA 3D7GA 4MXUA 4WWVA 4NGPA 3R96A 3EO4A 3TT2A 4H6ZA 4K3NA 2QECA 4MCQA 1IOFA 2PRQA 2RB7A 2ZENA 3KZWA 2WZNA 4QVTA 4WJBA 3VWEA 1XOVA 3H5ZA 4OC5A 4Q38A 1CPSA 2ANPA 2PJ5A 2PIZA 4PPZA 3SJFA 3TOAA 4C2XA 2PVVA 4A39A 4KSIA 4OMEA 4F9VA 2I3CA 1OBRA 4KOSA 1OZPA 4BBHA 4CYNA 2HQYA 6CPAA 4B10A 4Q7AA 4C7HA 1PCAA 2CNSA 4FUUA 3S6GA 4F6AA 2PJ7A 1Q7LA 3TOBA 5H84A 5K8MA 3B3VA 3NH8A 4CPAA 1NE9A 4GM5A 5LYIA 5HVGA 1QSNA 3IWWA 4MY3A 1KUYA 2V8DA 4U5YA 3PB4X 4UCNA 1M1DA 4GS4A 1XE4A 2KCWA 1QSRA 1RXTA 2QIRA 3IJ3A 2K5TA 3PEIA 4IF5A 3RYOA 3KKWA 3QB8A 4CGMA 3DR6A 3PB8X 2CIJA 2CXAA 3CDXA 4DJLA 1YVOA 5FVJA 3TX8A 4CAXA 1GYTA 2FVGA 3BJ8A 3P2HA 4IUSA 4UIAA 4F0XA 2VBQA 5A28A 3S9NA 2EWBA 2GANA 2ZEEA 2J8NA 4UBRA 4KOXA 2HC9A 4KOTA 4M3SA 1XFOA 2ATRA 4YRHA 1NSLA 4CRYB 4CAEA 4MRIA 1Z8WA 1YX0A 3BHXA 5K8PA 1CP6A 1XBUA 5AG4A 4J3GA 2JBKA 4ZY0A 1S7LA 3IEHA 2B4DB 4ONWA 2BUEA 3TO6A 1DTDA 5EBVA 1QSTA 2B3VA 2ABZA 5LRGA 2DPTA 3KGQA 5F48A 2OZHA 4NGMA 1VKCA 4R6TA 1XEBA 4MHZA 3D68A 2PVWA 2ZW6A 3OWCA 3RZAA 3S9MA 4CYPA 4ORFA 4R3LA 4OC3A 5HH1A 3DSBA 3EC4A 2J8RA 3B2YA 5A27A 1IB1E 3W91A 3BI0A 4KUAA 5DS0A 4ZBGA 4MFZA 4E0AA 2BO9A 4HNWB 1IYLA 1QSMA 2R98A 1I1DA 1LAMA 2PJAA 2CY2A 3FXTA 3WC5A 2DPSA 4MI4A 4C7IA 5CBMA 1IGBA 3SI1A 1X10A 3KASA 2QJ8A 2QMLA 1JWQA 4QUSA 4HPSA 3EFAA 3KQZA 4UIBA 4BD9A 2YNDA 3WC7A 1U6MA 4NGNA 3LODA 4NFRA 4UFWA 1ARMA 4LUAA 4OADA 4MFJA 2EK9A 1ZLHA 1R57A 2RFHA 1AYEA 3D2MA 2GFQA 5BWAB 3V38A 3S6HA 2OU2A 3E0KA 1BO4A 1UWYA 1CP7A 3F5BA 3JTKA 4B5OA 4P4IA 4MFQA 3TCVA 2AFZA 5IB9A 2G0BA 5CPAA 3D3SA 2ODFA 3DGVA 2EO8A 4DNCA 2Q7SA 2AFXA 1YGHA 3PB7X 4UFXA 3R9EA 2P6EA 2Q4VA 3CXSA 4OC4A 2B3UA 4UFVA 2ZEFA 4JYWA 4JJXA 5ELYA 2OOTA 5HVHA 4KVOE 4F9UA 3B3TA 2GE3A 2P6FA 4OC0A 4P45A 4A30A 5IX3A 2VXKA 2BSWA 3K9UA 2C6PA 3GYAA 2Q51A 3HUVA 3S9LA 2Q7BA 1Y0RA 1Z2LA 4MFLA 2QVPA 3K2KA 3W6XA 2O28A 5F49A 2IMOA 2C6GA 4MHNA 4B5PA 4R7MA 1Q2DA 2C27A 2ZEDA 2CTCA 4XPLA 5AGEA 5F09A 3L2NA 2F7VA 1YVKA 4CAFA 2PRBA 4P6YA 3SI2A 1B87A 4OP4A 4X2TA 3B35A 4P44A 4R3KA 2ZELA 4UEZA 5I4MA 1XRYA 1FT7A 4FBEA 3FNCA 3QNVA 4O23A 4A38A 4G1PA 4OKOA 2EVNA 2CNMA 4CGPA 1VHSA 4U9ZA 3D8PA 3IGRA 3CT9A 4A33A 3WR7A 3P2FA 3LWUA 4YWYA 2WPWA 4P10A 2WUUA 4OLLA 3CXPA 1M4DA 4XPDB 2O4HA 2GREA 4U9YA 2BEIA 1R3NA 5D29A 3WT4A 4E2AA 3DDDA 1FY7A 3PGPA 4P4BA 5G1ZA 2Z3NA 2PSWA 1XMTA 2PDOA 2YNEA 1Y7RA 4MCPA 2G3TA 2P0WA 3FBUA 3IO1A 2WPXA 4QC6A 4MFKA 2Q4YA 1KWMA 1IYKA 3FEEA 2OH1A 4MHPA 2PJ6A 3ZZIA 4B11A 1RTQA 4UEFA 3TFYA 3NFZA 1QQ9A 2X7BA 1Z4RA 2PIYA 2Z0ZA 1V0CA 3VWDA 1F57A 2Z11A 1A2ZA 3BLNA 3FF3A 4NF1A 5C88A 2QYVA 3IWGA 1YW6A 1BPNA 1FNOA 2J9AA 3B3WA 1Y7EA 4NSQA 2I00A 4EFDA 2JDCA 2FT0A 5AG5A 5LYFA 4NGRA 2PR8A 2ZEPA 3GB0A 5EC4A 1TKFA 2FXFA 4KOUA 2ZEMA 1CG2A 4X8IA 1KUXA 3IWEA 4CS0B 3DLJA 3F0AA 5IB0A 3IU1A 4UWJA 2XEGA 2Q43A 3H8GA 3H8FA 3FRMA 1BOBA 1YR0A 4CGNA 1SQHA 2NMTA 4Y49B 2Z3MA 1S7FA 2FSRA 3ZJ0A 2ARHA 5HMNA 4PK2A 3EY5A 1YREA 4FD7A 3WC6A 1S3ZA 1EE3P 1M4IA 2AFUA 1IY7A 2FE7A 5GCNA 2POKA 3TO9A 4E8OA 2A4NA 2PJ2A 5JGFA 3LACA 1M44A 3QAYA 1MJBA 4JD6A 4P4DA 2G3AA 3GIUA 4A31A 4B12A 5C82A 4II9A 4DYOA 1F2PA 4JZ0A 2ZW7A 4NXYA 1S7NA 3G3SA 5I0CA 2B5GB 3DNSA 5DWMA 3D2PA 4LQGA 1YMEA 3H8EA 5D8NA 5LYLA 4MCSA 2PC1A 4HNXB 4KOYA 2Q04A 3S6FA 2FS5A 3KR5A 5LYDA 2PJ8A 2JEVA 4L89A 1S60A 4XNHB 2B58A 1XF8A 1ARLA 1LOKA 1ZG7A 3CZXA 3SXNA 3FEDA 2JDDA 1IU8A 3IIBA 2JEWA 5JM6A 4CAWA 1P4NA 4UEEA 5F47A 3FMCA 4NJQA 4KOWA 4AG9A 1Q2YA 3D7HA 4NGSA 1QSOA 2BCOA 4RI1A 3WABA 3TE4A 3TTHA 2XEFA 3G8WA 3V7ZA 2O53A 5H86A 4DUKA 4ZX8A 2XEJA 4NJRA 1YLEA 3FH4A 2RC4A 3B8GA 4F0YA 7CPAA 4UF4A 2CF4A 3NA6A 4I49A 4CRZB 1GHEA 2VEZA 5JH9A 1B6BA 4KLVA 4KZTA 5KTAA 4AB7A 1ZLIA 3FB3A 4NEXA 4OAEA 4X3RA 2IQ6A 4JWPA 3N5FA 4LX9A 4UCPA 1CJWA 1S7KA 2IJZA 1Z5RA 3S6KA 4FWUA 4KORA 4Q36A 3B3CA 3GLJA 1Z8XA 2VZYA 2DXQA 1Z8TA 2PCUA 4MY0A 4OIWA 1HEEA 1YQEA 2ZEGA 3LD2A 2ZEHA 2Z3KA 3CXQA 1WK4A 2GIVA 5DWNA 5J8FA 1LAPA 2R8VA 4TWEA 2V77A 2YGWA 4MJ8A 1TKHA 2PR1A 4PSWA 5KTDA 2REFA 2PJ4A 1Z9UA 3RNZA 1WWZA 4AG7A 1Y0YA 2WSAA 3C26A 2B4DA 2F8HA 4H6UA 3BJ7A 3SJXA 4FD4A 2DF5A 2PJ3A 3SJEA 3SXOA 1Z8LA 4ZYQA 3PP9A 4C2ZA 2AFWA 3GY9A 2EUIA 1M4LA 3NH5A 2Z10A 1I12A 5G20A 3SHPA 4UA3A 2CTBA 5J8CA 5ISVA 4AVAA 3UY5A 2PJBA 3JVNA 4EVYA 4YGOA 2GLFA 3FVLA 1KZFA 2H5MA 4PSXA 1LCPA 2GLJA 2G9DA 4B6ZA 5E96A 2OB0A 1UFHA 4RN7A 4A37A 3SJGA 2ZPAA 1LFWA 1LANA 3K9TA 5KTCA 3GKRA 3CPXA 4IAVA 4A94A 1NSAA 3JRUA 1KUVA 4MBUA 4OC2A 3R9FA 4EWTA 2IL4A 4ZY2A 1S5KA 4PXEA 2Q4ZA 4M85A 3FIXA 3T8WA 2BOAA 3FJUA 2FIAA 2OZGA 1BLLE 1MK4A 3FX6A 4PQAA 5LRJA 2AE6A 1PYTB 1IIDA 4HKFA 3IC1A 3W6SA 2VZZA 3FECA 3D7FA 4NGQA 4ONUA 4OIDA 3QAHA 1Y9WA 1J4JA 5JQ4A 1XMBA 3KL9A 2R1IA 2PE3A 3NH4A 2PJ9A 2VL1A 2V8HA 1BAVA 3HLPA 3KHXA 4FD6A 4KLWA 1TKJA 2Q0YA 2VQYA 4QB9A 2NYQA 5EMIA 4AVCA 4MMOA 4PXDA 4MCRA 4ZI6A 4ZGYB 1VHEA 1NMTA 3KR4A 4M6HA 2PJ1A 3I9SA 3FYNA 2C6CA 3KI9A 3KQXA 4R8FA 2AFMA 3B7IA 2OR4A 3NE7A 5AG7A 3I1UA 4NGTA 5HVFA 3D67A 2NSMA 3MRUA 2OZUA 3R1KA 2Y0MA 1HDUA 2ZEOA 3T90A 3H4QA 3MGDA 1YSJA 2AJ6A 1TF8A 4KSFA 5THWA 3R9GA 5HXDA 1JQGA 4RS2A 1K4JA 4P4JA 3KHZA 4R9MA 4YU9A 3D7DA 5J1QA 1PUAA 2Z3LA 5IV0A 1CM0A 4UWIA 3EXNA 3ISZA 2REEA 2DEAA 3N7ZA 3B3SA 4PXCA 4TNUA 4PV6A 3VH9A 2PJ0A 3I3GA 1N71A 4XPDC 4B14A 2EBJA 2FL4A 4JLYA 2D4PA 4LQ6A 3T9YA 4W9YA 5K8OA 4FD5A 2JBJA
chains in the Genus database with same CATH topology
3ISXA 1ELLP 2C1CA 1CX8A 2GU2A 3TC8A 4RUHA 2HB6A 3RBUA 8CPAA 4IHMA 3IFEA 3PFEA 1ZG8A 2V8VA 2ZOGA 2AFSA 3D4UA 1AMPA 4ZX9A 4F8ZA 4P4FA 3MN8A 2AFOA 1CBXA 3LMSA 3VARA 1R43A 1DE4C 2ZOFA 5LYFA 3PFOA 1VGYA 3RAMA 4P4EA 4R76A 1VIXA 3SI0A 4AXVA 1YW4A 1ZG9A 2WYRA 4EMEA 4ZY1A 3PB6X 3VATA 2XEIA 3BXMA 4H2KA 3D66A 4MHYA 1H8LA 3PBBA 1YLOA 3PRTA 5K8NA 4FAIA 1ELMP 2EK8A 5LRKA 3PB9X 4Z65A 1TXRA 1QMUA 1F2OA 3BI1A 4PXBA 4IK2A 4OC1A 1HDQA 2PJCA 1TF9A 1CPXA 3CPAA 3GUXA 1XJOA 1VHOA 1BPMA 3PBEA 2V8GA 3D7GA 4MXUA 4WWVA 4NGPA 4K3NA 4MCQA 2PRQA 2RB7A 2ZENA 4WJBA 3KZWA 2WZNA 4OC5A 1CPSA 2ANPA 2PJ5A 2PIZA 4PPZA 3SJFA 2PVVA 4A39A 4KSIA 4OMEA 4F9VA 2I3CA 1OBRA 6CPAA 4Q7AA 1PCAA 4FUUA 2PJ7A 1Q7LA 5K8MA 3B3VA 3NH8A 4CPAA 4GM5A 5LYIA 5HVGA 3IWWA 2V8DA 3PB4X 3PEIA 3IJ3A 4DJLA 3PB8X 2CIJA 3CDXA 3TX8A 1GYTA 2FVGA 3S9NA 4UIAA 2EWBA 2ZEEA 2HC9A 1XFOA 4MRIA 3BHXA 5K8PA 1CP6A 1XBUA 2JBKA 4ZY0A 3IEHA 4ONWA 1DTDA 2ABZA 5LRGA 3KGQA 4NGMA 4R6TA 4MHZA 3D68A 2PVWA 3RZAA 3S9MA 4OC3A 3B2YA 3BI0A 5DS0A 2BO9A 1LAMA 2PJAA 5CBMA 3WC5A 1IGBA 3SI1A 3KASA 2QJ8A 3KQZA 4UIBA 4BD9A 3WC7A 4NGNA 4NFRA 1ARMA 2EK9A 1ZLHA 2RFHA 1AYEA 3V38A 1UWYA 1CP7A 4P4IA 2AFZA 5IB9A 5CPAA 3DGVA 2AFXA 3PB7X 4OC4A 5HVHA 2ZEFA 4JYWA 2OOTA 5ELYA 4F9UA 3B3TA 4OC0A 4P45A 2C6PA 2Q51A 3HUVA 3S9LA 1Y0RA 1Z2LA 2QVPA 3K2KA 2IMOA 2C6GA 4MHNA 4R7MA 2ZEDA 2CTCA 5F09A 3L2NA 2F7VA 4P6YA 3SI2A 4OP4A 4X2TA 3B35A 4P44A 2ZELA 4UEZA 5I4MA 1XRYA 1FT7A 4FBEA 3QNVA 4O23A 4A38A 4G1PA 4OKOA 3CT9A 3LWUA 4YWYA 4P10A 2O4HA 2GREA 1R3NA 5D29A 3WT4A 4P4BA 4MCPA 3IO1A 1KWMA 3FEEA 4MHPA 2PJ6A 1RTQA 4UEFA 3NFZA 1QQ9A 2PIYA 1F57A 3FF3A 2QYVA 1YW6A 1BPNA 1FNOA 2J9AA 3B3WA 1Y7EA 4EFDA 4NGRA 2ZEPA 3GB0A 1TKFA 2ZEMA 1CG2A 4X8IA 3DLJA 2XEGA 2Q43A 3H8GA 3H8FA 3WC6A 2AFUA 1EE3P 1IY7A 5JGFA 2POKA 2PJ2A 4P4DA 4DYOA 1F2PA 4JZ0A 4LQGA 1YMEA 3H8EA 5D8NA 5LYLA 4MCSA 3KR5A 5LYDA 2PJ8A 1ARLA 1LOKA 1ZG7A 3FEDA 3IIBA 2JEWA 5JM6A 4UEEA 3FMCA 4NJQA 3D7HA 4NGSA 2BCOA 3WABA 2XEFA 3V7ZA 2O53A 4DUKA 4ZX8A 2XEJA 4NJRA 3FH4A 7CPAA 4UF4A 2CF4A 3NA6A 5JH9A 1ZLIA 4X3RA 2IQ6A 3N5FA 2IJZA 1Z5RA 4FWUA 3B3CA 3GLJA 2PCUA 4OIWA 1HEEA 2ZEGA 2ZEHA 1LAPA 4TWEA 2V77A 1TKHA 2PJ4A 1Y0YA 2F8HA 3SJXA 2PJ3A 3SJEA 1Z8LA 4ZYQA 2AFWA 1M4LA 3NH5A 2CTBA 2PJBA 2GLFA 3FVLA 1LCPA 2GLJA 2G9DA 4B6ZA 4A37A 3SJGA 3K9TA 1LFWA 1LANA 3CPXA 4IAVA 4A94A 1NSAA 3JRUA 4OC2A 4EWTA 4ZY2A 4PXEA 2Q4ZA 3T8WA 2BOAA 3FJUA 4PQAA 3FX6A 1BLLE 5LRJA 1PYTB 3IC1A 3FECA 3D7FA 4NGQA 4OIDA 1XMBA 3KL9A 2PE3A 3NH4A 2PJ9A 2VL1A 2V8HA 1BAVA 3HLPA 3KHXA 1TKJA 2NYQA 4MMOA 4PXDA 4MCRA 4ZI6A 1VHEA 3KR4A 2PJ1A 2C6CA 3KI9A 3KQXA 4R8FA 2AFMA 3B7IA 2OR4A 3I1UA 4NGTA 5HVFA 3D67A 2NSMA 3MRUA 1HDUA 2ZEOA 1YSJA 1TF8A 5THWA 5HXDA 1JQGA 4P4JA 3KHZA 4YU9A 3D7DA 5J1QA 3ISZA 2DEAA 3B3SA 4PXCA 4TNUA 3VH9A 2PJ0A 4W9YA 5K8OA 2JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISX A;  1ELL P;  2C1C A;  1CX8 A;  2GU2 A;  3TC8 A;  4RUH A;  2HB6 A;  3RBU A;  8CPA A;  4IHM A;  3IFE A;  3PFE A;  1ZG8 A;  2V8V A;  2ZOG A;  2AFS A;  3D4U A;  1AMP A;  4ZX9 A;  4F8Z A;  4P4F A;  3MN8 A;  2AFO A;  1CBX A;  3LMS A;  3VAR A;  1R43 A;  1DE4 C;  2ZOF A;  5LYF A;  3PFO A;  1VGY A;  3RAM A;  4P4E A;  4R76 A;  1VIX A;  3SI0 A;  4AXV A;  1YW4 A;  1ZG9 A;  2WYR A;  4EME A;  4ZY1 A;  3PB6 X;  3VAT A;  2XEI A;  3BXM A;  4H2K A;  3D66 A;  4MHY A;  1H8L A;  3PBB A;  1YLO A;  3PRT A;  5K8N A;  4FAI A;  1ELM P;  2EK8 A;  5LRK A;  3PB9 X;  4Z65 A;  1TXR A;  1QMU A;  1F2O A;  3BI1 A;  4PXB A;  4IK2 A;  4OC1 A;  1HDQ A;  2PJC A;  1TF9 A;  1CPX A;  3CPA A;  3GUX A;  1XJO A;  1VHO A;  1BPM A;  3PBE A;  2V8G A;  3D7G A;  4MXU A;  4WWV A;  4NGP A;  4K3N A;  4MCQ A;  2PRQ A;  2RB7 A;  2ZEN A;  4WJB A;  3KZW A;  2WZN A;  4OC5 A;  1CPS A;  2ANP A;  2PJ5 A;  2PIZ A;  4PPZ A;  3SJF A;  2PVV A;  4A39 A;  4KSI A;  4OME A;  4F9V A;  2I3C A;  1OBR A;  6CPA A;  4Q7A A;  1PCA A;  4FUU A;  2PJ7 A;  1Q7L A;  5K8M A;  3B3V A;  3NH8 A;  4CPA A;  4GM5 A;  5LYI A;  5HVG A;  3IWW A;  2V8D A;  3PB4 X;  3PEI A;  3IJ3 A;  4DJL A;  3PB8 X;  2CIJ A;  3CDX A;  3TX8 A;  1GYT A;  2FVG A;  3S9N A;  4UIA A;  2EWB A;  2ZEE A;  2HC9 A;  1XFO A;  4MRI A;  3BHX A;  5K8P A;  1CP6 A;  1XBU A;  2JBK A;  4ZY0 A;  3IEH A;  4ONW A;  1DTD A;  2ABZ A;  5LRG A;  3KGQ A;  4NGM A;  4R6T A;  4MHZ A;  3D68 A;  2PVW A;  3RZA A;  3S9M A;  4OC3 A;  3B2Y A;  3BI0 A;  5DS0 A;  2BO9 A;  1LAM A;  2PJA A;  5CBM A;  3WC5 A;  1IGB A;  3SI1 A;  3KAS A;  2QJ8 A;  3KQZ A;  4UIB A;  4BD9 A;  3WC7 A;  4NGN A;  4NFR A;  1ARM A;  2EK9 A;  1ZLH A;  2RFH A;  1AYE A;  3V38 A;  1UWY A;  1CP7 A;  4P4I A;  2AFZ A;  5IB9 A;  5CPA A;  3DGV A;  2AFX A;  3PB7 X;  4OC4 A;  5HVH A;  2ZEF A;  4JYW A;  2OOT A;  5ELY A;  4F9U A;  3B3T A;  4OC0 A;  4P45 A;  2C6P A;  2Q51 A;  3HUV A;  3S9L A;  1Y0R A;  1Z2L A;  2QVP A;  3K2K A;  2IMO A;  2C6G A;  4MHN A;  4R7M A;  2ZED A;  2CTC A;  5F09 A;  3L2N A;  2F7V A;  4P6Y A;  3SI2 A;  4OP4 A;  4X2T A;  3B35 A;  4P44 A;  2ZEL A;  4UEZ A;  5I4M A;  1XRY A;  1FT7 A;  4FBE A;  3QNV A;  4O23 A;  4A38 A;  4G1P A;  4OKO A;  3CT9 A;  3LWU A;  4YWY A;  4P10 A;  2O4H A;  2GRE A;  1R3N A;  5D29 A;  3WT4 A;  4P4B A;  4MCP A;  3IO1 A;  1KWM A;  3FEE A;  4MHP A;  2PJ6 A;  1RTQ A;  4UEF A;  3NFZ A;  1QQ9 A;  2PIY A;  1F57 A;  3FF3 A;  2QYV A;  1YW6 A;  1BPN A;  1FNO A;  2J9A A;  3B3W A;  1Y7E A;  4EFD A;  4NGR A;  2ZEP A;  3GB0 A;  1TKF A;  2ZEM A;  1CG2 A;  4X8I A;  3DLJ A;  2XEG A;  2Q43 A;  3H8G A;  3H8F A;  3WC6 A;  2AFU A;  1EE3 P;  1IY7 A;  5JGF A;  2POK A;  2PJ2 A;  4P4D A;  4DYO A;  1F2P A;  4JZ0 A;  4LQG A;  1YME A;  3H8E A;  5D8N A;  5LYL A;  4MCS A;  3KR5 A;  5LYD A;  2PJ8 A;  1ARL A;  1LOK A;  1ZG7 A;  3FED A;  3IIB A;  2JEW A;  5JM6 A;  4UEE A;  3FMC A;  4NJQ A;  3D7H A;  4NGS A;  2BCO A;  3WAB A;  2XEF A;  3V7Z A;  2O53 A;  4DUK A;  4ZX8 A;  2XEJ A;  4NJR A;  3FH4 A;  7CPA A;  4UF4 A;  2CF4 A;  3NA6 A;  5JH9 A;  1ZLI A;  4X3R A;  2IQ6 A;  3N5F A;  2IJZ A;  1Z5R A;  4FWU A;  3B3C A;  3GLJ A;  2PCU A;  4OIW A;  1HEE A;  2ZEG A;  2ZEH A;  1LAP A;  4TWE A;  2V77 A;  1TKH A;  2PJ4 A;  1Y0Y A;  2F8H A;  3SJX A;  2PJ3 A;  3SJE A;  1Z8L A;  4ZYQ A;  2AFW A;  1M4L A;  3NH5 A;  2CTB A;  2PJB A;  2GLF A;  3FVL A;  1LCP A;  2GLJ A;  2G9D A;  4B6Z A;  4A37 A;  3SJG A;  3K9T A;  1LFW A;  1LAN A;  3CPX A;  4IAV A;  4A94 A;  1NSA A;  3JRU A;  4OC2 A;  4EWT A;  4ZY2 A;  4PXE A;  2Q4Z A;  3T8W A;  2BOA A;  3FJU A;  4PQA A;  3FX6 A;  1BLL E;  5LRJ A;  1PYT B;  3IC1 A;  3FEC A;  3D7F A;  4NGQ A;  4OID A;  1XMB A;  3KL9 A;  2PE3 A;  3NH4 A;  2PJ9 A;  2VL1 A;  2V8H A;  1BAV A;  3HLP A;  3KHX A;  1TKJ A;  2NYQ A;  4MMO A;  4PXD A;  4MCR A;  4ZI6 A;  1VHE A;  3KR4 A;  2PJ1 A;  2C6C A;  3KI9 A;  3KQX A;  4R8F A;  2AFM A;  3B7I A;  2OR4 A;  3I1U A;  4NGT A;  5HVF A;  3D67 A;  2NSM A;  3MRU A;  1HDU A;  2ZEO A;  1YSJ A;  1TF8 A;  5THW A;  5HXD A;  1JQG A;  4P4J A;  3KHZ A;  4YU9 A;  3D7D A;  5J1Q A;  3ISZ A;  2DEA A;  3B3S A;  4PXC A;  4TNU A;  3VH9 A;  2PJ0 A;  4W9Y A;  5K8O A;  2JBJ A; 
#chains in the Genus database with same CATH topology
 1ZO0 A;  3ISX A;  3DR8 A;  4BIN A;  3RO0 A;  3JUW A;  2FIW A;  4KVM E;  4KVX A;  1M4G A;  4K30 A;  1ELL P;  2C1C A;  1CX8 A;  1ON0 A;  4B5P B;  1X12 A;  2GU2 A;  3TC8 A;  2F5I A;  4RUH A;  2HB6 A;  3RBU A;  1LRZ A;  4B13 A;  4KUB A;  2BL1 A;  8CPA A;  4JXQ A;  4IHM A;  3IFE A;  3PFE A;  4CYQ A;  1PU9 A;  1ZG8 A;  2V8V A;  2P6G A;  2AFS A;  2I79 A;  1RO5 A;  2ZOG A;  3D4U A;  4A32 A;  4QBJ A;  5F46 A;  1MJA A;  2FCK A;  1AMP A;  2Q44 A;  4UCM A;  4ZX9 A;  4M6G A;  4F8Z A;  4P4F A;  3MN8 A;  3NE8 A;  5G21 A;  1YK3 A;  2AFO A;  1CBX A;  1AUG A;  3LMS A;  1R43 A;  3PZJ A;  1DE4 C;  2ZXV A;  3VAR A;  4C2Y A;  3R95 A;  1IIC A;  2ZOF A;  3IU2 A;  2HV2 A;  3PFO A;  4R87 A;  3TO7 A;  1VGY A;  2R7H A;  4CAV A;  2YNC C;  4A95 A;  3RAM A;  4P4E A;  4R76 A;  4A2Z A;  5AG6 A;  3F8K A;  4YFJ A;  4CGO A;  1VIX A;  3SI0 A;  4AXV A;  1YW4 A;  4Y49 C;  1ZG9 A;  4AVB A;  5G22 A;  1IOI A;  2WYR A;  4HNY B;  4EME A;  2J8M A;  3PB6 X;  3VAT A;  4ZY1 A;  1Y9K A;  2XEI A;  4M6I A;  4XPK A;  2ZW5 A;  1L0C A;  2CNT A;  2PQ8 A;  4KSA A;  3BXM A;  4R57 A;  4H2K A;  3D66 A;  4MFP A;  4MHY A;  1H8L A;  4H89 A;  4X5K A;  4KOV A;  5JPH A;  1XIX A;  2YNC A;  3PBB A;  1YLO A;  4BMH A;  3PRT A;  2Z3P A;  2ZW4 A;  5K8N A;  5CNP A;  3V8I A;  4FAI A;  4NCZ A;  1ELM P;  2EK8 A;  3A9L A;  1MJ9 A;  1Q2C A;  5LRK A;  3PB9 X;  4CGL A;  4JXR A;  4PK3 A;  4Z65 A;  1QMU A;  1TXR A;  1F2O A;  3BI1 A;  4PXB A;  2VI7 A;  1I21 A;  4IK2 A;  4OC1 A;  4L8A A;  2D4O A;  4CYO A;  4KS9 A;  1TIQ A;  2HUZ A;  2Z3O A;  2JLM A;  4XNH C;  1HDQ A;  4C68 A;  1Z4E A;  2PJC A;  1TF9 A;  1CPX A;  2B5G A;  2B4B A;  3CPA A;  3GUX A;  4GXH A;  1XJO A;  1P0H A;  1VHO A;  1BPM A;  3PBE A;  4MHD A;  2V8G A;  3D7G A;  4MXU A;  4WWV A;  4NGP A;  3R96 A;  3EO4 A;  3TT2 A;  4H6Z A;  4K3N A;  2QEC A;  4MCQ A;  1IOF A;  2PRQ A;  2RB7 A;  2ZEN A;  3KZW A;  2WZN A;  4QVT A;  4WJB A;  3VWE A;  1XOV A;  3H5Z A;  4OC5 A;  4Q38 A;  1CPS A;  2ANP A;  2PJ5 A;  2PIZ A;  4PPZ A;  3SJF A;  3TOA A;  4C2X A;  2PVV A;  4A39 A;  4KSI A;  4OME A;  4F9V A;  2I3C A;  1OBR A;  4KOS A;  1OZP A;  4BBH A;  4CYN A;  2HQY A;  6CPA A;  4B10 A;  4Q7A A;  4C7H A;  1PCA A;  2CNS A;  4FUU A;  3S6G A;  4F6A A;  2PJ7 A;  1Q7L A;  3TOB A;  5H84 A;  5K8M A;  3B3V A;  3NH8 A;  4CPA A;  1NE9 A;  4GM5 A;  5LYI A;  5HVG A;  1QSN A;  3IWW A;  4MY3 A;  1KUY A;  2V8D A;  4U5Y A;  3PB4 X;  4UCN A;  1M1D A;  4GS4 A;  1XE4 A;  2KCW A;  1QSR A;  1RXT A;  2QIR A;  3IJ3 A;  2K5T A;  3PEI A;  4IF5 A;  3RYO A;  3KKW A;  3QB8 A;  4CGM A;  3DR6 A;  3PB8 X;  2CIJ A;  2CXA A;  3CDX A;  4DJL A;  1YVO A;  5FVJ A;  3TX8 A;  4CAX A;  1GYT A;  2FVG A;  3BJ8 A;  3P2H A;  4IUS A;  4UIA A;  4F0X A;  2VBQ A;  5A28 A;  3S9N A;  2EWB A;  2GAN A;  2ZEE A;  2J8N A;  4UBR A;  4KOX A;  2HC9 A;  4KOT A;  4M3S A;  1XFO A;  2ATR A;  4YRH A;  1NSL A;  4CRY B;  4CAE A;  4MRI A;  1Z8W A;  1YX0 A;  3BHX A;  5K8P A;  1CP6 A;  1XBU A;  5AG4 A;  4J3G A;  2JBK A;  4ZY0 A;  1S7L A;  3IEH A;  2B4D B;  4ONW A;  2BUE A;  3TO6 A;  1DTD A;  5EBV A;  1QST A;  2B3V A;  2ABZ A;  5LRG A;  2DPT A;  3KGQ A;  5F48 A;  2OZH A;  4NGM A;  1VKC A;  4R6T A;  1XEB A;  4MHZ A;  3D68 A;  2PVW A;  2ZW6 A;  3OWC A;  3RZA A;  3S9M A;  4CYP A;  4ORF A;  4R3L A;  4OC3 A;  5HH1 A;  3DSB A;  3EC4 A;  2J8R A;  3B2Y A;  5A27 A;  1IB1 E;  3W91 A;  3BI0 A;  4KUA A;  5DS0 A;  4ZBG A;  4MFZ A;  4E0A A;  2BO9 A;  4HNW B;  1IYL A;  1QSM A;  2R98 A;  1I1D A;  1LAM A;  2PJA A;  2CY2 A;  3FXT A;  3WC5 A;  2DPS A;  4MI4 A;  4C7I A;  5CBM A;  1IGB A;  3SI1 A;  1X10 A;  3KAS A;  2QJ8 A;  2QML A;  1JWQ A;  4QUS A;  4HPS A;  3EFA A;  3KQZ A;  4UIB A;  4BD9 A;  2YND A;  3WC7 A;  1U6M A;  4NGN A;  3LOD A;  4NFR A;  4UFW A;  1ARM A;  4LUA A;  4OAD A;  4MFJ A;  2EK9 A;  1ZLH A;  1R57 A;  2RFH A;  1AYE A;  3D2M A;  2GFQ A;  5BWA B;  3V38 A;  3S6H A;  2OU2 A;  3E0K A;  1BO4 A;  1UWY A;  1CP7 A;  3F5B A;  3JTK A;  4B5O A;  4P4I A;  4MFQ A;  3TCV A;  2AFZ A;  5IB9 A;  2G0B A;  5CPA A;  3D3S A;  2ODF A;  3DGV A;  2EO8 A;  4DNC A;  2Q7S A;  2AFX A;  1YGH A;  3PB7 X;  4UFX A;  3R9E A;  2P6E A;  2Q4V A;  3CXS A;  4OC4 A;  2B3U A;  4UFV A;  2ZEF A;  4JYW A;  4JJX A;  5ELY A;  2OOT A;  5HVH A;  4KVO E;  4F9U A;  3B3T A;  2GE3 A;  2P6F A;  4OC0 A;  4P45 A;  4A30 A;  5IX3 A;  2VXK A;  2BSW A;  3K9U A;  2C6P A;  3GYA A;  2Q51 A;  3HUV A;  3S9L A;  2Q7B A;  1Y0R A;  1Z2L A;  4MFL A;  2QVP A;  3K2K A;  3W6X A;  2O28 A;  5F49 A;  2IMO A;  2C6G A;  4MHN A;  4B5P A;  4R7M A;  1Q2D A;  2C27 A;  2ZED A;  2CTC A;  4XPL A;  5AGE A;  5F09 A;  3L2N A;  2F7V A;  1YVK A;  4CAF A;  2PRB A;  4P6Y A;  3SI2 A;  1B87 A;  4OP4 A;  4X2T A;  3B35 A;  4P44 A;  4R3K A;  2ZEL A;  4UEZ A;  5I4M A;  1XRY A;  1FT7 A;  4FBE A;  3FNC A;  3QNV A;  4O23 A;  4A38 A;  4G1P A;  4OKO A;  2EVN A;  2CNM A;  4CGP A;  1VHS A;  4U9Z A;  3D8P A;  3IGR A;  3CT9 A;  4A33 A;  3WR7 A;  3P2F A;  3LWU A;  4YWY A;  2WPW A;  4P10 A;  2WUU A;  4OLL A;  3CXP A;  1M4D A;  4XPD B;  2O4H A;  2GRE A;  4U9Y A;  2BEI A;  1R3N A;  5D29 A;  3WT4 A;  4E2A A;  3DDD A;  1FY7 A;  3PGP A;  4P4B A;  5G1Z A;  2Z3N A;  2PSW A;  1XMT A;  2PDO A;  2YNE A;  1Y7R A;  4MCP A;  2G3T A;  2P0W A;  3FBU A;  3IO1 A;  2WPX A;  4QC6 A;  4MFK A;  2Q4Y A;  1KWM A;  1IYK A;  3FEE A;  2OH1 A;  4MHP A;  2PJ6 A;  3ZZI A;  4B11 A;  1RTQ A;  4UEF A;  3TFY A;  3NFZ A;  1QQ9 A;  2X7B A;  1Z4R A;  2PIY A;  2Z0Z A;  1V0C A;  3VWD A;  1F57 A;  2Z11 A;  1A2Z A;  3BLN A;  3FF3 A;  4NF1 A;  5C88 A;  2QYV A;  3IWG A;  1YW6 A;  1BPN A;  1FNO A;  2J9A A;  3B3W A;  1Y7E A;  4NSQ A;  2I00 A;  4EFD A;  2JDC A;  2FT0 A;  5AG5 A;  5LYF A;  4NGR A;  2PR8 A;  2ZEP A;  3GB0 A;  5EC4 A;  1TKF A;  2FXF A;  4KOU A;  2ZEM A;  1CG2 A;  4X8I A;  1KUX A;  3IWE A;  4CS0 B;  3DLJ A;  3F0A A;  5IB0 A;  3IU1 A;  4UWJ A;  2XEG A;  2Q43 A;  3H8G A;  3H8F A;  3FRM A;  1BOB A;  1YR0 A;  4CGN A;  1SQH A;  2NMT A;  4Y49 B;  2Z3M A;  1S7F A;  2FSR A;  3ZJ0 A;  2ARH A;  5HMN A;  4PK2 A;  3EY5 A;  1YRE A;  4FD7 A;  3WC6 A;  1S3Z A;  1EE3 P;  1M4I A;  2AFU A;  1IY7 A;  2FE7 A;  5GCN A;  2POK A;  3TO9 A;  4E8O A;  2A4N A;  2PJ2 A;  5JGF A;  3LAC A;  1M44 A;  3QAY A;  1MJB A;  4JD6 A;  4P4D A;  2G3A A;  3GIU A;  4A31 A;  4B12 A;  5C82 A;  4II9 A;  4DYO A;  1F2P A;  4JZ0 A;  2ZW7 A;  4NXY A;  1S7N A;  3G3S A;  5I0C A;  2B5G B;  3DNS A;  5DWM A;  3D2P A;  4LQG A;  1YME A;  3H8E A;  5D8N A;  5LYL A;  4MCS A;  2PC1 A;  4HNX B;  4KOY A;  2Q04 A;  3S6F A;  2FS5 A;  3KR5 A;  5LYD A;  2PJ8 A;  2JEV A;  4L89 A;  1S60 A;  4XNH B;  2B58 A;  1XF8 A;  1ARL A;  1LOK A;  1ZG7 A;  3CZX A;  3SXN A;  3FED A;  2JDD A;  1IU8 A;  3IIB A;  2JEW A;  5JM6 A;  4CAW A;  1P4N A;  4UEE A;  5F47 A;  3FMC A;  4NJQ A;  4KOW A;  4AG9 A;  1Q2Y A;  3D7H A;  4NGS A;  1QSO A;  2BCO A;  4RI1 A;  3WAB A;  3TE4 A;  3TTH A;  2XEF A;  3G8W A;  3V7Z A;  2O53 A;  5H86 A;  4DUK A;  4ZX8 A;  2XEJ A;  4NJR A;  1YLE A;  3FH4 A;  2RC4 A;  3B8G A;  4F0Y A;  7CPA A;  4UF4 A;  2CF4 A;  3NA6 A;  4I49 A;  4CRZ B;  1GHE A;  2VEZ A;  5JH9 A;  1B6B A;  4KLV A;  4KZT A;  5KTA A;  4AB7 A;  1ZLI A;  3FB3 A;  4NEX A;  4OAE A;  4X3R A;  2IQ6 A;  4JWP A;  3N5F A;  4LX9 A;  4UCP A;  1CJW A;  1S7K A;  2IJZ A;  1Z5R A;  3S6K A;  4FWU A;  4KOR A;  4Q36 A;  3B3C A;  3GLJ A;  1Z8X A;  2VZY A;  2DXQ A;  1Z8T A;  2PCU A;  4MY0 A;  4OIW A;  1HEE A;  1YQE A;  2ZEG A;  3LD2 A;  2ZEH A;  2Z3K A;  3CXQ A;  1WK4 A;  2GIV A;  5DWN A;  5J8F A;  1LAP A;  2R8V A;  4TWE A;  2V77 A;  2YGW A;  4MJ8 A;  1TKH A;  2PR1 A;  4PSW A;  5KTD A;  2REF A;  2PJ4 A;  1Z9U A;  3RNZ A;  1WWZ A;  4AG7 A;  1Y0Y A;  2WSA A;  3C26 A;  2B4D A;  2F8H A;  4H6U A;  3BJ7 A;  3SJX A;  4FD4 A;  2DF5 A;  2PJ3 A;  3SJE A;  3SXO A;  1Z8L A;  4ZYQ A;  3PP9 A;  4C2Z A;  2AFW A;  3GY9 A;  2EUI A;  1M4L A;  3NH5 A;  2Z10 A;  1I12 A;  5G20 A;  3SHP A;  4UA3 A;  2CTB A;  5J8C A;  5ISV A;  4AVA A;  3UY5 A;  2PJB A;  3JVN A;  4EVY A;  4YGO A;  2GLF A;  3FVL A;  1KZF A;  2H5M A;  4PSX A;  1LCP A;  2GLJ A;  2G9D A;  4B6Z A;  5E96 A;  2OB0 A;  1UFH A;  4RN7 A;  4A37 A;  3SJG A;  2ZPA A;  1LFW A;  1LAN A;  3K9T A;  5KTC A;  3GKR A;  3CPX A;  4IAV A;  4A94 A;  1NSA A;  3JRU A;  1KUV A;  4MBU A;  4OC2 A;  3R9F A;  4EWT A;  2IL4 A;  4ZY2 A;  1S5K A;  4PXE A;  2Q4Z A;  4M85 A;  3FIX A;  3T8W A;  2BOA A;  3FJU A;  2FIA A;  2OZG A;  1BLL E;  1MK4 A;  3FX6 A;  4PQA A;  5LRJ A;  2AE6 A;  1PYT B;  1IID A;  4HKF A;  3IC1 A;  3W6S A;  2VZZ A;  3FEC A;  3D7F A;  4NGQ A;  4ONU A;  4OID A;  3QAH A;  1Y9W A;  1J4J A;  5JQ4 A;  1XMB A;  3KL9 A;  2R1I A;  2PE3 A;  3NH4 A;  2PJ9 A;  2VL1 A;  2V8H A;  1BAV A;  3HLP A;  3KHX A;  4FD6 A;  4KLW A;  1TKJ A;  2Q0Y A;  2VQY A;  4QB9 A;  2NYQ A;  5EMI A;  4AVC A;  4MMO A;  4PXD A;  4MCR A;  4ZI6 A;  4ZGY B;  1VHE A;  1NMT A;  3KR4 A;  4M6H A;  2PJ1 A;  3I9S A;  3FYN A;  2C6C A;  3KI9 A;  3KQX A;  4R8F A;  2AFM A;  3B7I A;  2OR4 A;  3NE7 A;  5AG7 A;  3I1U A;  4NGT A;  5HVF A;  3D67 A;  2NSM A;  3MRU A;  2OZU A;  3R1K A;  2Y0M A;  1HDU A;  2ZEO A;  3T90 A;  3H4Q A;  3MGD A;  1YSJ A;  2AJ6 A;  1TF8 A;  4KSF A;  5THW A;  3R9G A;  5HXD A;  1JQG A;  4RS2 A;  1K4J A;  4P4J A;  3KHZ A;  4R9M A;  4YU9 A;  3D7D A;  5J1Q A;  1PUA A;  2Z3L A;  5IV0 A;  1CM0 A;  4UWI A;  3EXN A;  3ISZ A;  2REE A;  2DEA A;  3N7Z A;  3B3S A;  4PXC A;  4TNU A;  4PV6 A;  3VH9 A;  2PJ0 A;  3I3G A;  1N71 A;  4XPD C;  4B14 A;  2EBJ A;  2FL4 A;  4JLY A;  2D4P A;  4LQ6 A;  3T9Y A;  4W9Y A;  5K8O A;  4FD5 A;  2JBJ A; 
#chains in the Genus database with same CATH homology
 3ISX A;  1ELL P;  2C1C A;  1CX8 A;  2GU2 A;  3TC8 A;  4RUH A;  2HB6 A;  3RBU A;  8CPA A;  4IHM A;  3IFE A;  3PFE A;  1ZG8 A;  2V8V A;  2ZOG A;  2AFS A;  3D4U A;  1AMP A;  4ZX9 A;  4F8Z A;  4P4F A;  3MN8 A;  2AFO A;  1CBX A;  3LMS A;  3VAR A;  1R43 A;  1DE4 C;  2ZOF A;  5LYF A;  3PFO A;  1VGY A;  3RAM A;  4P4E A;  4R76 A;  1VIX A;  3SI0 A;  4AXV A;  1YW4 A;  1ZG9 A;  2WYR A;  4EME A;  4ZY1 A;  3PB6 X;  3VAT A;  2XEI A;  3BXM A;  4H2K A;  3D66 A;  4MHY A;  1H8L A;  3PBB A;  1YLO A;  3PRT A;  5K8N A;  4FAI A;  1ELM P;  2EK8 A;  5LRK A;  3PB9 X;  4Z65 A;  1TXR A;  1QMU A;  1F2O A;  3BI1 A;  4PXB A;  4IK2 A;  4OC1 A;  1HDQ A;  2PJC A;  1TF9 A;  1CPX A;  3CPA A;  3GUX A;  1XJO A;  1VHO A;  1BPM A;  3PBE A;  2V8G A;  3D7G A;  4MXU A;  4WWV A;  4NGP A;  4K3N A;  4MCQ A;  2PRQ A;  2RB7 A;  2ZEN A;  4WJB A;  3KZW A;  2WZN A;  4OC5 A;  1CPS A;  2ANP A;  2PJ5 A;  2PIZ A;  4PPZ A;  3SJF A;  2PVV A;  4A39 A;  4KSI A;  4OME A;  4F9V A;  2I3C A;  1OBR A;  6CPA A;  4Q7A A;  1PCA A;  4FUU A;  2PJ7 A;  1Q7L A;  5K8M A;  3B3V A;  3NH8 A;  4CPA A;  4GM5 A;  5LYI A;  5HVG A;  3IWW A;  2V8D A;  3PB4 X;  3PEI A;  3IJ3 A;  4DJL A;  3PB8 X;  2CIJ A;  3CDX A;  3TX8 A;  1GYT A;  2FVG A;  3S9N A;  4UIA A;  2EWB A;  2ZEE A;  2HC9 A;  1XFO A;  4MRI A;  3BHX A;  5K8P A;  1CP6 A;  1XBU A;  2JBK A;  4ZY0 A;  3IEH A;  4ONW A;  1DTD A;  2ABZ A;  5LRG A;  3KGQ A;  4NGM A;  4R6T A;  4MHZ A;  3D68 A;  2PVW A;  3RZA A;  3S9M A;  4OC3 A;  3B2Y A;  3BI0 A;  5DS0 A;  2BO9 A;  1LAM A;  2PJA A;  5CBM A;  3WC5 A;  1IGB A;  3SI1 A;  3KAS A;  2QJ8 A;  3KQZ A;  4UIB A;  4BD9 A;  3WC7 A;  4NGN A;  4NFR A;  1ARM A;  2EK9 A;  1ZLH A;  2RFH A;  1AYE A;  3V38 A;  1UWY A;  1CP7 A;  4P4I A;  2AFZ A;  5IB9 A;  5CPA A;  3DGV A;  2AFX A;  3PB7 X;  4OC4 A;  5HVH A;  2ZEF A;  4JYW A;  2OOT A;  5ELY A;  4F9U A;  3B3T A;  4OC0 A;  4P45 A;  2C6P A;  2Q51 A;  3HUV A;  3S9L A;  1Y0R A;  1Z2L A;  2QVP A;  3K2K A;  2IMO A;  2C6G A;  4MHN A;  4R7M A;  2ZED A;  2CTC A;  5F09 A;  3L2N A;  2F7V A;  4P6Y A;  3SI2 A;  4OP4 A;  4X2T A;  3B35 A;  4P44 A;  2ZEL A;  4UEZ A;  5I4M A;  1XRY A;  1FT7 A;  4FBE A;  3QNV A;  4O23 A;  4A38 A;  4G1P A;  4OKO A;  3CT9 A;  3LWU A;  4YWY A;  4P10 A;  2O4H A;  2GRE A;  1R3N A;  5D29 A;  3WT4 A;  4P4B A;  4MCP A;  3IO1 A;  1KWM A;  3FEE A;  4MHP A;  2PJ6 A;  1RTQ A;  4UEF A;  3NFZ A;  1QQ9 A;  2PIY A;  1F57 A;  3FF3 A;  2QYV A;  1YW6 A;  1BPN A;  1FNO A;  2J9A A;  3B3W A;  1Y7E A;  4EFD A;  4NGR A;  2ZEP A;  3GB0 A;  1TKF A;  2ZEM A;  1CG2 A;  4X8I A;  3DLJ A;  2XEG A;  2Q43 A;  3H8G A;  3H8F A;  3WC6 A;  2AFU A;  1EE3 P;  1IY7 A;  5JGF A;  2POK A;  2PJ2 A;  4P4D A;  4DYO A;  1F2P A;  4JZ0 A;  4LQG A;  1YME A;  3H8E A;  5D8N A;  5LYL A;  4MCS A;  3KR5 A;  5LYD A;  2PJ8 A;  1ARL A;  1LOK A;  1ZG7 A;  3FED A;  3IIB A;  2JEW A;  5JM6 A;  4UEE A;  3FMC A;  4NJQ A;  3D7H A;  4NGS A;  2BCO A;  3WAB A;  2XEF A;  3V7Z A;  2O53 A;  4DUK A;  4ZX8 A;  2XEJ A;  4NJR A;  3FH4 A;  7CPA A;  4UF4 A;  2CF4 A;  3NA6 A;  5JH9 A;  1ZLI A;  4X3R A;  2IQ6 A;  3N5F A;  2IJZ A;  1Z5R A;  4FWU A;  3B3C A;  3GLJ A;  2PCU A;  4OIW A;  1HEE A;  2ZEG A;  2ZEH A;  1LAP A;  4TWE A;  2V77 A;  1TKH A;  2PJ4 A;  1Y0Y A;  2F8H A;  3SJX A;  2PJ3 A;  3SJE A;  1Z8L A;  4ZYQ A;  2AFW A;  1M4L A;  3NH5 A;  2CTB A;  2PJB A;  2GLF A;  3FVL A;  1LCP A;  2GLJ A;  2G9D A;  4B6Z A;  4A37 A;  3SJG A;  3K9T A;  1LFW A;  1LAN A;  3CPX A;  4IAV A;  4A94 A;  1NSA A;  3JRU A;  4OC2 A;  4EWT A;  4ZY2 A;  4PXE A;  2Q4Z A;  3T8W A;  2BOA A;  3FJU A;  4PQA A;  3FX6 A;  1BLL E;  5LRJ A;  1PYT B;  3IC1 A;  3FEC A;  3D7F A;  4NGQ A;  4OID A;  1XMB A;  3KL9 A;  2PE3 A;  3NH4 A;  2PJ9 A;  2VL1 A;  2V8H A;  1BAV A;  3HLP A;  3KHX A;  1TKJ A;  2NYQ A;  4MMO A;  4PXD A;  4MCR A;  4ZI6 A;  1VHE A;  3KR4 A;  2PJ1 A;  2C6C A;  3KI9 A;  3KQX A;  4R8F A;  2AFM A;  3B7I A;  2OR4 A;  3I1U A;  4NGT A;  5HVF A;  3D67 A;  2NSM A;  3MRU A;  1HDU A;  2ZEO A;  1YSJ A;  1TF8 A;  5THW A;  5HXD A;  1JQG A;  4P4J A;  3KHZ A;  4YU9 A;  3D7D A;  5J1Q A;  3ISZ A;  2DEA A;  3B3S A;  4PXC A;  4TNU A;  3VH9 A;  2PJ0 A;  4W9Y A;  5K8O A;  2JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...