4FWUA

Crystal structure of glutaminyl cyclase from drosophila melanogaster in space group i4
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
299
Chain Sequence
QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CG32412
publication title Structure of glutaminyl cyclase from Drosophila melanogaster in space group I4.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 106
structure length 299
sequence length 305
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fwuA00
4P10A 3B2YA 4UIBA 4NFRA 4IAVA 5LYDA 2AFSA 3IIBA 5JGFA 4WWVA 2PCUA 3CPXA 3K9TA 2ZEHA 2FVGA 2PJ8A 3S9NA 2G9DA 4P4BA 2EWBA 3FMCA 2PRQA 3KASA 3JRUA 4TWEA 1TF9A 1Z5RA 2GREA 3TC8A 3FH4A 1XFOA 3IC1A 3B3VA 3NA6A 4MHPA 3TX8A 4CPAA 3BHXA 1BPMA 1NSAA 3GLJA 1UWYA 2I3CA 1QQ9A 3NFZA 1LAMA 2PE3A 8CPAA 4Q7AA 1CPSA 1XMBA 1Y0YA 4NGQA 1YLOA 2IJZA 5ELYA 3VATA 4A39A 2Q43A 4KSIA 4R7MA 2F7VA 2JBJA 3D4UA 1YW6A 4OIWA 5THWA 4FAIA 3D7FA 1Z2LA 1TKHA 2V8GA 1DTDA 3KHZA 3V7ZA 2V77A 3FECA 4MHNA 2ZOGA 4MRIA 3NH4A 2XEJA 2PJ5A 4X8IA 1LOKA 3S9MA 1DE4C 1KWMA 2C1CA 1TKJA 2VL1A 4MHYA 3IJ3A 3H8GA 4ZX9A 3WC7A 5K8PA 1TXRA 3V38A 2QYVA 2JBKA 7CPAA 3KR5A 2QVPA 4NGMA 3RAMA 1FNOA 2AFMA 3T8WA 4ONWA 2QJ8A 2PJ9A 2Q4ZA 3RBUA 4NGPA 1XBUA 3SJEA 3KI9A 1PCAA 4FWUA 2EK8A 5F09A 1OBRA 2PJBA 5LYFA 2WYRA 1RTQA 4MHZA 1HEEA 3FVLA 3K2KA 4UEZA 1CG2A 2XEFA 3PB9X 5JM6A 1H8LA 1R43A 3WC6A 2PJ1A 2ZEDA 1CP7A 1HDUA 3FJUA 2V8HA 4UF4A 5CPAA 5J1QA 3LWUA 4ZYQA 4OP4A 2WZNA 4O23A 4UEFA 4H2KA 2XEGA 2O53A 2O4HA 2CF4A 4P44A 5HVGA 1VHOA 2CTBA 3CT9A 4FBEA 4IHMA 4PXDA 1ARMA 2AFWA 2Q51A 2IMOA 5HXDA 1AMPA 2JEWA 4A94A 3PB4X 3SJGA 1IY7A 4EFDA 4A38A 3N5FA 1VGYA 3KL9A 3D7DA 4GM5A 3PRTA 4ZY1A 2V8VA 4ZX8A 1FT7A 1VHEA 2PJ7A 4P4EA 4MXUA 4P45A 2HB6A 2NSMA 3PBBA 2CIJA 4MCRA 2PJCA 3KR4A 2V8DA 4X3RA 4DUKA 2NYQA 4YWYA 3ISXA 5K8MA 4W9YA 1LCPA 2CTCA 3PB7X 4DJLA 3H8EA 2F8HA 4JYWA 4WJBA 1ZG9A 4UIAA 1CX8A 3FX6A 3SI1A 1BPNA 6CPAA 4PXCA 4OKOA 4NGNA 4NGTA 5K8NA 1CBXA 1ARLA 1ELMP 1YW4A 4MCSA 1TKFA 3HLPA 4A37A 4ZY2A 1PYTB 4YU9A 3PBEA 2AFOA 5HVFA 1Y7EA 5K8OA 3MN8A 5D29A 2ABZA 3KGQA 5LRJA 5LYIA 4R6TA 1BLLE 2PJ6A 3I1UA 3RZAA 4NGRA 3HUVA 4F8ZA 3S9LA 3NH5A 2AFUA 3VH9A 2EK9A 2ZEPA 2C6PA 2ZENA 3NH8A 1F2PA 4FUUA 2BO9A 2OOTA 3PB6X 4F9VA 3BXMA 2DEAA 1JQGA 2ZEFA 2PIYA 1VIXA 5LRKA 1AYEA 3SJXA 4UEEA 1IGBA 3KHXA 2AFXA 1QMUA 3IO1A 1ZLHA 4B6ZA 2BOAA 1CPXA 3PB8X 1YMEA 3SJFA 3B3TA 2PJ0A 1Z8LA 4LQGA 4BD9A 2C6GA 1R3NA 2PJ3A 2IQ6A 3LMSA 3B3WA 3PEIA 5IB9A 2RB7A 4OC2A 5I4MA 4NJRA 5JH9A 2GLFA 5CBMA 2GU2A 1ZG7A 2PJ4A 1M4LA 3DLJA 2ZEMA 3D7HA 3SI2A 3FEDA 4RUHA 1LAPA 1ZG8A 1YSJA 4PXBA 1XRYA 4OIDA 2PJ2A 3IFEA 2ZEOA 4P4FA 3H8FA 3D68A 4MCQA 4EMEA 5LRGA 1GYTA 4X2TA 4Z65A 2POKA 1ELLP 4MCPA 3FF3A 2PVWA 4NJQA 3CPAA 2ZEEA 1F57A 3CDXA 4MMOA 3KQZA 4OC1A 4P4DA 3FEEA 4OC0A 1TF8A 1Q7LA 5D8NA 3ISZA 4G1PA 2RFHA 3BI0A 4IK2A 4F9UA 4OMEA 2ZOFA 4R8FA 1Y0RA 1HDQA 3B7IA 2PJAA 3D66A 3GUXA 4OC5A 5DS0A 3IEHA 3WT4A 3PFEA 3DGVA 3IWWA 4PPZA 4K3NA 4P6YA 2BCOA 1EE3P 2PIZA 4ZY0A 2GLJA 4JZ0A 4TNUA 1ZLIA 4PXEA 3SI0A 4NGSA 4P4JA 4ZI6A 1BAVA 5LYLA 3GB0A 3B3CA 5HVHA 2ZELA 4AXVA 3KZWA 1CP6A 3B35A 4R76A 2C6CA 1F2OA 2PVVA 4OC3A 4OC4A 3PFOA 3L2NA 3WABA 4PQAA 2AFZA 3MRUA 4DYOA 3WC5A 3QNVA 1XJOA 3BI1A 4EWTA 3KQXA 2J9AA 4P4IA 3B3SA 1LANA 2XEIA 2HC9A 3D7GA 2ZEGA 2OR4A 2ANPA 1LFWA 3VARA 3D67A
chains in the Genus database with same CATH superfamily
3H4QA 2B4DA 1Z9UA 1CM0A 4P10A 4AVBA 3R95A 3B2YA 4UIBA 4NFRA 4CAEA 5HH1A 3JVNA 4IAVA 1S7FA 1WWZA 5LYDA 4UWIA 2AFSA 4CYPA 3IIBA 5JGFA 4WWVA 3F5BA 4J3GA 2PCUA 3CPXA 3K9TA 4MFPA 2ZEHA 4QB9A 1XMTA 1YK3A 2FVGA 2PJ8A 2VZZA 1AUGA 3S9NA 4B5PA 2G9DA 2YNDA 4P4BA 5IB0A 4M6IA 5A28A 2EWBA 3FMCA 5H86A 2PRQA 5G1ZA 3F8KA 4B5OA 3KASA 3JRUA 1S5KA 4UBRA 4TWEA 1TF9A 1Z5RA 2GREA 3TC8A 2JEVA 3FH4A 5F47A 1XFOA 3IC1A 3B3VA 3NA6A 4MHPA 4CYOA 3TX8A 2ZW5A 3BHXA 1BPMA 1NSAA 3DNSA 4BBHA 4CPAA 1A2ZA 3GLJA 1UWYA 5EBVA 3W6XA 3TO6A 2I3CA 1QQ9A 4ORFA 4PSWA 4KUAA 3NFZA 1LAMA 5KTAA 4MI4A 2PE3A 4PSXA 4CAVA 8CPAA 4Q7AA 3LACA 1CPSA 1KUVA 3TCVA 4MFKA 2QECA 4RN7A 3FBUA 1XMBA 3TE4A 1Y0YA 3GKRA 4NGQA 4KSFA 2FIWA 2P6EA 4MY3A 3C26A 2A4NA 1JWQA 2Q04A 2ZW7A 1YLOA 3CXSA 2IJZA 1IB1E 2CXAA 5ELYA 2Z3OA 3VATA 4A39A 2IL4A 3TO9A 2Q43A 4KSIA 4R7MA 2F7VA 2JBJA 3D4UA 1YW6A 4OIWA 5THWA 4FAIA 1YVOA 3FRMA 3W6SA 4A95A 1Z8XA 1YLEA 4YFJA 3D7FA 2OU2A 3A9LA 2ZXVA 2Q7BA 3T90A 1TKHA 1Z2LA 2V8GA 1DTDA 3KHZA 3QAHA 4KSAA 2FS5A 4CAFA 4Y49C 3P2HA 3V7ZA 4H6ZA 4JXQA 2V77A 4C2YA 3FECA 4MHNA 2B4BA 2Z3NA 2ZOGA 4MRIA 3NH4A 2XEJA 1XF8A 2BSWA 2PJ5A 4KVOE 4X8IA 1LOKA 4JWPA 4A33A 5F46A 3SHPA 2VEZA 2DXQA 4FD7A 1DE4C 1KWMA 2C1CA 1TKJA 2VL1A 3S9MA 1S7KA 4MHYA 3IJ3A 1M44A 3TOBA 2GANA 3VWEA 2QMLA 3H8GA 4KOWA 4ZX9A 2Y0MA 4C68A 2G3TA 3WC7A 5K8PA 2BEIA 3R9FA 3T9YA 2FIAA 4KS9A 4LQ6A 1M4IA 2Q4YA 1TXRA 2DPTA 3V38A 2QYVA 2ZW4A 3ZJ0A 2JBKA 2J8NA 3FNCA 7CPAA 3KR5A 2QVPA 4AG7A 4KOXA 4NGMA 1I1DA 4KOSA 3B8GA 2B3UA 3RAMA 1FNOA 2AFMA 2PSWA 3T8WA 1QSNA 3GIUA 3R1KA 4ONWA 4EVYA 2QJ8A 3D2PA 4KVME 2PJ9A 2FT0A 2B3VA 2Q4ZA 3RBUA 4NGPA 1XBUA 3S6HA 3SJEA 1PUAA 3K9UA 5GCNA 3KI9A 1PCAA 4FWUA 2EK8A 4IUSA 5F09A 1OBRA 3WR7A 1B87A 1S7NA 2B5GA 2PJBA 2WYRA 5LYFA 4UA3A 1RTQA 1M4DA 4MHZA 1HEEA 1MK4A 1UFHA 3FVLA 3K2KA 4QVTA 4A30A 4UEZA 1CG2A 1XEBA 4MBUA 4Q38A 4RS2A 5E96A 4ONUA 5AG7A 3BJ7A 4RI1A 3SXNA 2XEFA 2NMTA 1QSOA 4A31A 3LODA 2VBQA 3N7ZA 3PB9X 2FL4A 2YNEA 2ZW6A 4E8OA 1QSTA 5JM6A 3G8WA 4CRYB 1H8LA 2B4DB 1R43A 3WC6A 5G20A 2PJ1A 2ZEDA 1CP7A 1HDUA 3FJUA 2V8HA 2VZYA 4UF4A 3S6KA 5CPAA 5J1QA 1XIXA 3LWUA 2P6FA 4GS4A 4ZYQA 4AB7A 5C82A 4OP4A 2WZNA 1J4JA 2YNCC 4XPLA 4O23A 2ARHA 4FD5A 4H2KA 4UEFA 2XEGA 2O53A 2WPWA 4KOVA 5G22A 2O4HA 2CF4A 4P44A 2BUEA 4B5PB 3CXPA 5HVGA 4F0YA 5G21A 2VXKA 1VHOA 2CTBA 1U6MA 3CT9A 1M4GA 5AG4A 2Z3PA 4FBEA 4CGMA 2PR8A 1Q2CA 2OZGA 4YRHA 4IHMA 4PXDA 1ARMA 4U9ZA 2AFWA 2Q0YA 2Q51A 2WSAA 5J8CA 2IMOA 5HXDA 1AMPA 2JEWA 4KOUA 4MFJA 4A94A 3PB4X 4MFLA 3SJGA 1IY7A 4EFDA 4QBJA 4A38A 4AG9A 1QSMA 3N5FA 1VGYA 2YNCA 3CZXA 4M3SA 1MJ9A 3KL9A 1P0HA 3D7DA 2HQYA 1Z4RA 2RC4A 4GM5A 4HKFA 4MHDA 3PRTA 2PR1A 4ZY1A 2V8VA 4MJ8A 4ZX8A 4UFVA 1FT7A 1VHEA 2CY2A 2P6GA 1QSRA 2PJ7A 4H6UA 4P4EA 5EMIA 1NSLA 4MXUA 3D2MA 4P45A 4UCNA 2HB6A 2NSMA 2R1IA 3PBBA 2CIJA 2DPSA 4KOYA 4MFQA 4MCRA 3MGDA 4LUAA 2PJCA 3KR4A 2V8DA 3IWGA 4B11A 1Y9KA 2G3AA 4X3RA 3GY9A 2NYQA 4DUKA 2EBJA 4YWYA 3ISXA 5K8MA 3G3SA 1TIQA 3P2FA 1SQHA 1Q2YA 4W9YA 1LCPA 2CTCA 2CNTA 3PB7X 4DJLA 3H8EA 2F8HA 4JYWA 4WJBA 4MY0A 4BMHA 1ZG9A 4UIAA 1CX8A 5DWNA 3FX6A 4XPDC 2AE6A 3SI1A 1IIDA 4OAEA 1BPNA 2JDCA 4CAWA 6CPAA 4I49A 4PXCA 4OKOA 4JXRA 2REEA 3W91A 4B13A 1IYLA 4NGTA 4NGNA 1FY7A 1YX0A 2Z0ZA 5A27A 3GYAA 5K8NA 1CBXA 2X7BA 4NSQA 4M6HA 1BO4A 1ARLA 1ELMP 1YW4A 1B6BA 1TKFA 2G0BA 2FXFA 4MCSA 4CAXA 5J8FA 3HLPA 4NXYA 4A37A 1V0CA 4ZY2A 4Y49B 2EVNA 2GFQA 1PYTB 4YU9A 4HPSA 3PGPA 3PBEA 2GE3A 4XNHC 1S60A 2BL1A 2AFOA 4MFZA 4AVCA 3EO4A 1YR0A 1Y7EA 2VI7A 5HVFA 5C88A 5K8OA 4CYQA 3MN8A 5D29A 2ABZA 3KGQA 5LRJA 3FB3A 5LYIA 3LD2A 4R6TA 5DWMA 3R9GA 1NMTA 4C7HA 1CJWA 1L0CA 2B5GB 3JUWA 1BLLE 2PJ6A 1XOVA 3I1UA 1MJBA 1S7LA 4NF1A 3HUVA 4NGRA 3RZAA 4F8ZA 2Z10A 1RXTA 3S9LA 1Z8TA 2AFUA 3NH5A 3VH9A 2EK9A 2ZEPA 4UCMA 4XPKA 2C6PA 2ZENA 3NH8A 1F2PA 1VKCA 2BO9A 3EY5A 4FUUA 4JLYA 2OOTA 3VWDA 3ZZIA 2PDOA 2F5IA 3PB6X 3TTHA 2Q7SA 5I0CA 3NE7A 3S6GA 5HMNA 1Z8WA 4F9VA 3BXMA 2DEAA 1JQGA 2ZEFA 2PIYA 3TOAA 1VIXA 3SXOA 5LRKA 1AYEA 3SJXA 4UEEA 5KTDA 1IGBA 4KLVA 3KHXA 1Z4EA 2AFXA 1MJAA 1QMUA 2ODFA 1YREA 3FYNA 2PQ8A 3IO1A 1GHEA 2I79A 1BOBA 2VQYA 2WUUA 2C27A 3EFAA 4LX9A 3KKWA 4PK3A 3IWEA 1ZLHA 4E0AA 2R98A 4B6ZA 2BOAA 1YGHA 2O28A 3FXTA 4CGNA 1CPXA 3PB8X 4CGOA 2Z3KA 2JDDA 1IICA 2OH1A 4K30A 2D4PA 2FCKA 1KZFA 4DNCA 1I21A 1YMEA 4KORA 4C7IA 3SJFA 4HNXB 1KUYA 3B3TA 5EC4A 5BWAB 1X12A 2PJ0A 4B10A 1Z8LA 2EUIA 4UWJA 3I9SA 4LQGA 3PZJA 2JLMA 4BD9A 2J8MA 2C6GA 3JTKA 3D3SA 1R3NA 4KZTA 1RO5A 2H5MA 2PJ3A 2Q4VA 2QIRA 1Y7RA 1LRZA 2IQ6A 3TT2A 4HNYB 3LMSA 3B3WA 3PEIA 2Z3LA 3H5ZA 5IB9A 2RB7A 4OC2A 5I4MA 4NJRA 5JH9A 2GLFA 5CBMA 2GU2A 4ZBGA 1ZG7A 2OB0A 2PRBA 2PJ4A 4GXHA 1P4NA 1M4LA 3DLJA 2PC1A 5F49A 4M85A 3TFYA 5KTCA 2GIVA 2ZEMA 3D7HA 4C2XA 2OZHA 1KUXA 3FIXA 2D4OA 3FEDA 3SI2A 4RUHA 3E0KA 1LAPA 1ZG8A 1Q2DA 1YSJA 3DR6A 4PXBA 4QUSA 4QC6A 1XRYA 4OIDA 2PJ2A 3IFEA 2ZEOA 2OZUA 3BJ8A 3EXNA 4P4FA 3H8FA 1I12A 4B14A 4KLWA 4R9MA 3BLNA 4F6AA 3D68A 4L89A 4UCPA 4MCQA 4EMEA 4KUBA 4YGOA 2KCWA 4JD6A 5LRGA 4UFXA 1WK4A 4KVXA 1GYTA 3RO0A 4FD4A 4X2TA 3RYOA 4CGLA 3V8IA 4Z65A 2POKA 1ELLP 2P0WA 4MCPA 3QB8A 2DF5A 3RNZA 4JJXA 1OZPA 2J8RA 4PK2A 3IGRA 4A32A 5JPHA 3FF3A 2CNSA 2PVWA 3UY5A 4NJQA 3CXQA 5AG5A 4CYNA 2WPXA 3QAYA 2ATRA 1YQEA 5JQ4A 1PU9A 3R9EA 4BINA 2EO8A 2Q44A 5CNPA 3CPAA 2ZEEA 4PV6A 1F57A 1IOFA 3CDXA 4MMOA 3KQZA 2AJ6A 4OADA 2B58A 2CNMA 4CRZB 4OC1A 4P4DA 3FEEA 4OC0A 1TF8A 3NE8A 1Q7LA 3DR8A 5D8NA 3ISZA 4G1PA 4NEXA 2RFHA 2Z3MA 1NE9A 3BI0A 4IK2A 3I3GA 4F9UA 4OMEA 3DSBA 2ZOFA 4R8FA 1Y0RA 4H89A 2HUZA 2R8VA 2Z11A 1HDQA 1ON0A 1YVKA 2PJAA 3B7IA 5FVJA 3D66A 3GUXA 4OC5A 3TO7A 2I00A 4C2ZA 2K5TA 4II9A 4KOTA 5DS0A 1N71A 4XPDB 3F0AA 3IEHA 2ZPAA 4NCZA 3WT4A 3PFEA 3DGVA 3IWWA 3R96A 4L8AA 4PPZA 5AG6A 3OWCA 4K3NA 4U5YA 4P6YA 4R3KA 1XE4A 2BCOA 2R7HA 1EE3P 1Y9WA 2PIZA 4CS0B 5F48A 4ZY0A 3EC4A 1IU8A 2GLJA 4JZ0A 4TNUA 1ZLIA 4PXEA 4AVAA 3SI0A 3D8PA 4NGSA 4P4JA 4U9YA 1BAVA 4ZI6A 1K4JA 4X5KA 3IU1A 4CGPA 4XNHB 2REFA 5LYLA 1X10A 3GB0A 3B3CA 1S3ZA 5H84A 4FD6A 1IOIA 4F0XA 5HVHA 4R87A 2ZELA 4UFWA 1R57A 4AXVA 3KZWA 1CP6A 5AGEA 5IX3A 3B35A 2FE7A 4IF5A 4Q36A 4R76A 2C6CA 1F2OA 2PVVA 4OLLA 4OC3A 4OC4A 4ZGYB 3PFOA 3L2NA 3WABA 4PQAA 2HV2A 3IU2A 3DDDA 4HNWB 1VHSA 2AFZA 2YGWA 3MRUA 4M6GA 4R57A 4DYOA 3WC5A 3QNVA 1M1DA 1XJOA 1ZO0A 3BI1A 4EWTA 4R3LA 3KQXA 2J9AA 4E2AA 5IV0A 4P4IA 5ISVA 4A2ZA 2FSRA 3B3SA 1LANA 1IYKA 2XEIA 2HC9A 3PP9A 3D7GA 3S6FA 2ZEGA 2OR4A 2ANPA 1LFWA 3VARA 3D67A 4B12A
chains in the Genus database with same CATH topology
4P10A 3B2YA 4UIBA 4NFRA 4IAVA 5LYDA 2AFSA 3IIBA 5JGFA 4WWVA 2PCUA 3CPXA 3K9TA 2ZEHA 2FVGA 2PJ8A 3S9NA 2G9DA 4P4BA 2EWBA 3FMCA 2PRQA 3KASA 3JRUA 4TWEA 1TF9A 1Z5RA 2GREA 3TC8A 3FH4A 1XFOA 3IC1A 3B3VA 3NA6A 4MHPA 3TX8A 4CPAA 3BHXA 1BPMA 1NSAA 3GLJA 1UWYA 2I3CA 1QQ9A 3NFZA 1LAMA 2PE3A 8CPAA 4Q7AA 1CPSA 1XMBA 1Y0YA 4NGQA 1YLOA 2IJZA 5ELYA 3VATA 4A39A 2Q43A 4KSIA 4R7MA 2F7VA 2JBJA 3D4UA 1YW6A 4OIWA 5THWA 4FAIA 3D7FA 1Z2LA 1TKHA 2V8GA 1DTDA 3KHZA 3V7ZA 2V77A 3FECA 4MHNA 2ZOGA 4MRIA 3NH4A 2XEJA 2PJ5A 4X8IA 1LOKA 3S9MA 1DE4C 1KWMA 2C1CA 1TKJA 2VL1A 4MHYA 3IJ3A 3H8GA 4ZX9A 3WC7A 5K8PA 1TXRA 3V38A 2QYVA 2JBKA 7CPAA 3KR5A 2QVPA 4NGMA 3RAMA 1FNOA 2AFMA 3T8WA 4ONWA 2QJ8A 2PJ9A 2Q4ZA 3RBUA 4NGPA 1XBUA 3SJEA 3KI9A 1PCAA 4FWUA 2EK8A 5F09A 1OBRA 2PJBA 5LYFA 2WYRA 1RTQA 4MHZA 1HEEA 3FVLA 3K2KA 4UEZA 1CG2A 2XEFA 3PB9X 5JM6A 1H8LA 1R43A 3WC6A 2PJ1A 2ZEDA 1CP7A 1HDUA 3FJUA 2V8HA 4UF4A 5CPAA 5J1QA 3LWUA 4ZYQA 4OP4A 2WZNA 4O23A 4UEFA 4H2KA 2XEGA 2O53A 2O4HA 2CF4A 4P44A 5HVGA 1VHOA 2CTBA 3CT9A 4FBEA 4IHMA 4PXDA 1ARMA 2AFWA 2Q51A 2IMOA 5HXDA 1AMPA 2JEWA 4A94A 3PB4X 3SJGA 1IY7A 4EFDA 4A38A 3N5FA 1VGYA 3KL9A 3D7DA 4GM5A 3PRTA 4ZY1A 2V8VA 4ZX8A 1FT7A 1VHEA 2PJ7A 4P4EA 4MXUA 4P45A 2HB6A 2NSMA 3PBBA 2CIJA 4MCRA 2PJCA 3KR4A 2V8DA 4X3RA 4DUKA 2NYQA 4YWYA 3ISXA 5K8MA 4W9YA 1LCPA 2CTCA 3PB7X 4DJLA 3H8EA 2F8HA 4JYWA 4WJBA 1ZG9A 4UIAA 1CX8A 3FX6A 3SI1A 1BPNA 6CPAA 4PXCA 4OKOA 4NGNA 4NGTA 5K8NA 1CBXA 1ARLA 1ELMP 1YW4A 4MCSA 1TKFA 3HLPA 4A37A 4ZY2A 1PYTB 4YU9A 3PBEA 2AFOA 5HVFA 1Y7EA 5K8OA 3MN8A 5D29A 2ABZA 3KGQA 5LRJA 5LYIA 4R6TA 1BLLE 2PJ6A 3I1UA 3RZAA 4NGRA 3HUVA 4F8ZA 3S9LA 3NH5A 2AFUA 3VH9A 2EK9A 2ZEPA 2C6PA 2ZENA 3NH8A 1F2PA 4FUUA 2BO9A 2OOTA 3PB6X 4F9VA 3BXMA 2DEAA 1JQGA 2ZEFA 2PIYA 1VIXA 5LRKA 1AYEA 3SJXA 4UEEA 1IGBA 3KHXA 2AFXA 1QMUA 3IO1A 1ZLHA 4B6ZA 2BOAA 1CPXA 3PB8X 1YMEA 3SJFA 3B3TA 2PJ0A 1Z8LA 4LQGA 4BD9A 2C6GA 1R3NA 2PJ3A 2IQ6A 3LMSA 3B3WA 3PEIA 5IB9A 2RB7A 4OC2A 5I4MA 4NJRA 5JH9A 2GLFA 5CBMA 2GU2A 1ZG7A 2PJ4A 1M4LA 3DLJA 2ZEMA 3D7HA 3SI2A 3FEDA 4RUHA 1LAPA 1ZG8A 1YSJA 4PXBA 1XRYA 4OIDA 2PJ2A 3IFEA 2ZEOA 4P4FA 3H8FA 3D68A 4MCQA 4EMEA 5LRGA 1GYTA 4X2TA 4Z65A 2POKA 1ELLP 4MCPA 3FF3A 2PVWA 4NJQA 3CPAA 2ZEEA 1F57A 3CDXA 4MMOA 3KQZA 4OC1A 4P4DA 3FEEA 4OC0A 1TF8A 1Q7LA 5D8NA 3ISZA 4G1PA 2RFHA 3BI0A 4IK2A 4F9UA 4OMEA 2ZOFA 4R8FA 1Y0RA 1HDQA 3B7IA 2PJAA 3D66A 3GUXA 4OC5A 5DS0A 3IEHA 3WT4A 3PFEA 3DGVA 3IWWA 4PPZA 4K3NA 4P6YA 2BCOA 1EE3P 2PIZA 4ZY0A 2GLJA 4JZ0A 4TNUA 1ZLIA 4PXEA 3SI0A 4NGSA 4P4JA 4ZI6A 1BAVA 5LYLA 3GB0A 3B3CA 5HVHA 2ZELA 4AXVA 3KZWA 1CP6A 3B35A 4R76A 2C6CA 1F2OA 2PVVA 4OC3A 4OC4A 3PFOA 3L2NA 3WABA 4PQAA 2AFZA 3MRUA 4DYOA 3WC5A 3QNVA 1XJOA 3BI1A 4EWTA 3KQXA 2J9AA 4P4IA 3B3SA 1LANA 2XEIA 2HC9A 3D7GA 2ZEGA 2OR4A 2ANPA 1LFWA 3VARA 3D67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P10 A;  3B2Y A;  4UIB A;  4NFR A;  4IAV A;  5LYD A;  2AFS A;  3IIB A;  5JGF A;  4WWV A;  2PCU A;  3CPX A;  3K9T A;  2ZEH A;  2FVG A;  2PJ8 A;  3S9N A;  2G9D A;  4P4B A;  2EWB A;  3FMC A;  2PRQ A;  3KAS A;  3JRU A;  4TWE A;  1TF9 A;  1Z5R A;  2GRE A;  3TC8 A;  3FH4 A;  1XFO A;  3IC1 A;  3B3V A;  3NA6 A;  4MHP A;  3TX8 A;  4CPA A;  3BHX A;  1BPM A;  1NSA A;  3GLJ A;  1UWY A;  2I3C A;  1QQ9 A;  3NFZ A;  1LAM A;  2PE3 A;  8CPA A;  4Q7A A;  1CPS A;  1XMB A;  1Y0Y A;  4NGQ A;  1YLO A;  2IJZ A;  5ELY A;  3VAT A;  4A39 A;  2Q43 A;  4KSI A;  4R7M A;  2F7V A;  2JBJ A;  3D4U A;  1YW6 A;  4OIW A;  5THW A;  4FAI A;  3D7F A;  1Z2L A;  1TKH A;  2V8G A;  1DTD A;  3KHZ A;  3V7Z A;  2V77 A;  3FEC A;  4MHN A;  2ZOG A;  4MRI A;  3NH4 A;  2XEJ A;  2PJ5 A;  4X8I A;  1LOK A;  3S9M A;  1DE4 C;  1KWM A;  2C1C A;  1TKJ A;  2VL1 A;  4MHY A;  3IJ3 A;  3H8G A;  4ZX9 A;  3WC7 A;  5K8P A;  1TXR A;  3V38 A;  2QYV A;  2JBK A;  7CPA A;  3KR5 A;  2QVP A;  4NGM A;  3RAM A;  1FNO A;  2AFM A;  3T8W A;  4ONW A;  2QJ8 A;  2PJ9 A;  2Q4Z A;  3RBU A;  4NGP A;  1XBU A;  3SJE A;  3KI9 A;  1PCA A;  4FWU A;  2EK8 A;  5F09 A;  1OBR A;  2PJB A;  5LYF A;  2WYR A;  1RTQ A;  4MHZ A;  1HEE A;  3FVL A;  3K2K A;  4UEZ A;  1CG2 A;  2XEF A;  3PB9 X;  5JM6 A;  1H8L A;  1R43 A;  3WC6 A;  2PJ1 A;  2ZED A;  1CP7 A;  1HDU A;  3FJU A;  2V8H A;  4UF4 A;  5CPA A;  5J1Q A;  3LWU A;  4ZYQ A;  4OP4 A;  2WZN A;  4O23 A;  4UEF A;  4H2K A;  2XEG A;  2O53 A;  2O4H A;  2CF4 A;  4P44 A;  5HVG A;  1VHO A;  2CTB A;  3CT9 A;  4FBE A;  4IHM A;  4PXD A;  1ARM A;  2AFW A;  2Q51 A;  2IMO A;  5HXD A;  1AMP A;  2JEW A;  4A94 A;  3PB4 X;  3SJG A;  1IY7 A;  4EFD A;  4A38 A;  3N5F A;  1VGY A;  3KL9 A;  3D7D A;  4GM5 A;  3PRT A;  4ZY1 A;  2V8V A;  4ZX8 A;  1FT7 A;  1VHE A;  2PJ7 A;  4P4E A;  4MXU A;  4P45 A;  2HB6 A;  2NSM A;  3PBB A;  2CIJ A;  4MCR A;  2PJC A;  3KR4 A;  2V8D A;  4X3R A;  4DUK A;  2NYQ A;  4YWY A;  3ISX A;  5K8M A;  4W9Y A;  1LCP A;  2CTC A;  3PB7 X;  4DJL A;  3H8E A;  2F8H A;  4JYW A;  4WJB A;  1ZG9 A;  4UIA A;  1CX8 A;  3FX6 A;  3SI1 A;  1BPN A;  6CPA A;  4PXC A;  4OKO A;  4NGN A;  4NGT A;  5K8N A;  1CBX A;  1ARL A;  1ELM P;  1YW4 A;  4MCS A;  1TKF A;  3HLP A;  4A37 A;  4ZY2 A;  1PYT B;  4YU9 A;  3PBE A;  2AFO A;  5HVF A;  1Y7E A;  5K8O A;  3MN8 A;  5D29 A;  2ABZ A;  3KGQ A;  5LRJ A;  5LYI A;  4R6T A;  1BLL E;  2PJ6 A;  3I1U A;  3RZA A;  4NGR A;  3HUV A;  4F8Z A;  3S9L A;  3NH5 A;  2AFU A;  3VH9 A;  2EK9 A;  2ZEP A;  2C6P A;  2ZEN A;  3NH8 A;  1F2P A;  4FUU A;  2BO9 A;  2OOT A;  3PB6 X;  4F9V A;  3BXM A;  2DEA A;  1JQG A;  2ZEF A;  2PIY A;  1VIX A;  5LRK A;  1AYE A;  3SJX A;  4UEE A;  1IGB A;  3KHX A;  2AFX A;  1QMU A;  3IO1 A;  1ZLH A;  4B6Z A;  2BOA A;  1CPX A;  3PB8 X;  1YME A;  3SJF A;  3B3T A;  2PJ0 A;  1Z8L A;  4LQG A;  4BD9 A;  2C6G A;  1R3N A;  2PJ3 A;  2IQ6 A;  3LMS A;  3B3W A;  3PEI A;  5IB9 A;  2RB7 A;  4OC2 A;  5I4M A;  4NJR A;  5JH9 A;  2GLF A;  5CBM A;  2GU2 A;  1ZG7 A;  2PJ4 A;  1M4L A;  3DLJ A;  2ZEM A;  3D7H A;  3SI2 A;  3FED A;  4RUH A;  1LAP A;  1ZG8 A;  1YSJ A;  4PXB A;  1XRY A;  4OID A;  2PJ2 A;  3IFE A;  2ZEO A;  4P4F A;  3H8F A;  3D68 A;  4MCQ A;  4EME A;  5LRG A;  1GYT A;  4X2T A;  4Z65 A;  2POK A;  1ELL P;  4MCP A;  3FF3 A;  2PVW A;  4NJQ A;  3CPA A;  2ZEE A;  1F57 A;  3CDX A;  4MMO A;  3KQZ A;  4OC1 A;  4P4D A;  3FEE A;  4OC0 A;  1TF8 A;  1Q7L A;  5D8N A;  3ISZ A;  4G1P A;  2RFH A;  3BI0 A;  4IK2 A;  4F9U A;  4OME A;  2ZOF A;  4R8F A;  1Y0R A;  1HDQ A;  3B7I A;  2PJA A;  3D66 A;  3GUX A;  4OC5 A;  5DS0 A;  3IEH A;  3WT4 A;  3PFE A;  3DGV A;  3IWW A;  4PPZ A;  4K3N A;  4P6Y A;  2BCO A;  1EE3 P;  2PIZ A;  4ZY0 A;  2GLJ A;  4JZ0 A;  4TNU A;  1ZLI A;  4PXE A;  3SI0 A;  4NGS A;  4P4J A;  4ZI6 A;  1BAV A;  5LYL A;  3GB0 A;  3B3C A;  5HVH A;  2ZEL A;  4AXV A;  3KZW A;  1CP6 A;  3B35 A;  4R76 A;  2C6C A;  1F2O A;  2PVV A;  4OC3 A;  4OC4 A;  3PFO A;  3L2N A;  3WAB A;  4PQA A;  2AFZ A;  3MRU A;  4DYO A;  3WC5 A;  3QNV A;  1XJO A;  3BI1 A;  4EWT A;  3KQX A;  2J9A A;  4P4I A;  3B3S A;  1LAN A;  2XEI A;  2HC9 A;  3D7G A;  2ZEG A;  2OR4 A;  2ANP A;  1LFW A;  3VAR A;  3D67 A; 
#chains in the Genus database with same CATH topology
 3H4Q A;  2B4D A;  1Z9U A;  1CM0 A;  4P10 A;  4AVB A;  3R95 A;  3B2Y A;  4UIB A;  4NFR A;  4CAE A;  5HH1 A;  3JVN A;  4IAV A;  1S7F A;  1WWZ A;  5LYD A;  4UWI A;  2AFS A;  4CYP A;  3IIB A;  5JGF A;  4WWV A;  3F5B A;  4J3G A;  2PCU A;  3CPX A;  3K9T A;  4MFP A;  2ZEH A;  4QB9 A;  1XMT A;  1YK3 A;  2FVG A;  2PJ8 A;  2VZZ A;  1AUG A;  3S9N A;  4B5P A;  2G9D A;  2YND A;  4P4B A;  5IB0 A;  4M6I A;  5A28 A;  2EWB A;  3FMC A;  5H86 A;  2PRQ A;  5G1Z A;  3F8K A;  4B5O A;  3KAS A;  3JRU A;  1S5K A;  4UBR A;  4TWE A;  1TF9 A;  1Z5R A;  2GRE A;  3TC8 A;  2JEV A;  3FH4 A;  5F47 A;  1XFO A;  3IC1 A;  3B3V A;  3NA6 A;  4MHP A;  4CYO A;  3TX8 A;  2ZW5 A;  3BHX A;  1BPM A;  1NSA A;  3DNS A;  4BBH A;  4CPA A;  1A2Z A;  3GLJ A;  1UWY A;  5EBV A;  3W6X A;  3TO6 A;  2I3C A;  1QQ9 A;  4ORF A;  4PSW A;  4KUA A;  3NFZ A;  1LAM A;  5KTA A;  4MI4 A;  2PE3 A;  4PSX A;  4CAV A;  8CPA A;  4Q7A A;  3LAC A;  1CPS A;  1KUV A;  3TCV A;  4MFK A;  2QEC A;  4RN7 A;  3FBU A;  1XMB A;  3TE4 A;  1Y0Y A;  3GKR A;  4NGQ A;  4KSF A;  2FIW A;  2P6E A;  4MY3 A;  3C26 A;  2A4N A;  1JWQ A;  2Q04 A;  2ZW7 A;  1YLO A;  3CXS A;  2IJZ A;  1IB1 E;  2CXA A;  5ELY A;  2Z3O A;  3VAT A;  4A39 A;  2IL4 A;  3TO9 A;  2Q43 A;  4KSI A;  4R7M A;  2F7V A;  2JBJ A;  3D4U A;  1YW6 A;  4OIW A;  5THW A;  4FAI A;  1YVO A;  3FRM A;  3W6S A;  4A95 A;  1Z8X A;  1YLE A;  4YFJ A;  3D7F A;  2OU2 A;  3A9L A;  2ZXV A;  2Q7B A;  3T90 A;  1TKH A;  1Z2L A;  2V8G A;  1DTD A;  3KHZ A;  3QAH A;  4KSA A;  2FS5 A;  4CAF A;  4Y49 C;  3P2H A;  3V7Z A;  4H6Z A;  4JXQ A;  2V77 A;  4C2Y A;  3FEC A;  4MHN A;  2B4B A;  2Z3N A;  2ZOG A;  4MRI A;  3NH4 A;  2XEJ A;  1XF8 A;  2BSW A;  2PJ5 A;  4KVO E;  4X8I A;  1LOK A;  4JWP A;  4A33 A;  5F46 A;  3SHP A;  2VEZ A;  2DXQ A;  4FD7 A;  1DE4 C;  1KWM A;  2C1C A;  1TKJ A;  2VL1 A;  3S9M A;  1S7K A;  4MHY A;  3IJ3 A;  1M44 A;  3TOB A;  2GAN A;  3VWE A;  2QML A;  3H8G A;  4KOW A;  4ZX9 A;  2Y0M A;  4C68 A;  2G3T A;  3WC7 A;  5K8P A;  2BEI A;  3R9F A;  3T9Y A;  2FIA A;  4KS9 A;  4LQ6 A;  1M4I A;  2Q4Y A;  1TXR A;  2DPT A;  3V38 A;  2QYV A;  2ZW4 A;  3ZJ0 A;  2JBK A;  2J8N A;  3FNC A;  7CPA A;  3KR5 A;  2QVP A;  4AG7 A;  4KOX A;  4NGM A;  1I1D A;  4KOS A;  3B8G A;  2B3U A;  3RAM A;  1FNO A;  2AFM A;  2PSW A;  3T8W A;  1QSN A;  3GIU A;  3R1K A;  4ONW A;  4EVY A;  2QJ8 A;  3D2P A;  4KVM E;  2PJ9 A;  2FT0 A;  2B3V A;  2Q4Z A;  3RBU A;  4NGP A;  1XBU A;  3S6H A;  3SJE A;  1PUA A;  3K9U A;  5GCN A;  3KI9 A;  1PCA A;  4FWU A;  2EK8 A;  4IUS A;  5F09 A;  1OBR A;  3WR7 A;  1B87 A;  1S7N A;  2B5G A;  2PJB A;  2WYR A;  5LYF A;  4UA3 A;  1RTQ A;  1M4D A;  4MHZ A;  1HEE A;  1MK4 A;  1UFH A;  3FVL A;  3K2K A;  4QVT A;  4A30 A;  4UEZ A;  1CG2 A;  1XEB A;  4MBU A;  4Q38 A;  4RS2 A;  5E96 A;  4ONU A;  5AG7 A;  3BJ7 A;  4RI1 A;  3SXN A;  2XEF A;  2NMT A;  1QSO A;  4A31 A;  3LOD A;  2VBQ A;  3N7Z A;  3PB9 X;  2FL4 A;  2YNE A;  2ZW6 A;  4E8O A;  1QST A;  5JM6 A;  3G8W A;  4CRY B;  1H8L A;  2B4D B;  1R43 A;  3WC6 A;  5G20 A;  2PJ1 A;  2ZED A;  1CP7 A;  1HDU A;  3FJU A;  2V8H A;  2VZY A;  4UF4 A;  3S6K A;  5CPA A;  5J1Q A;  1XIX A;  3LWU A;  2P6F A;  4GS4 A;  4ZYQ A;  4AB7 A;  5C82 A;  4OP4 A;  2WZN A;  1J4J A;  2YNC C;  4XPL A;  4O23 A;  2ARH A;  4FD5 A;  4H2K A;  4UEF A;  2XEG A;  2O53 A;  2WPW A;  4KOV A;  5G22 A;  2O4H A;  2CF4 A;  4P44 A;  2BUE A;  4B5P B;  3CXP A;  5HVG A;  4F0Y A;  5G21 A;  2VXK A;  1VHO A;  2CTB A;  1U6M A;  3CT9 A;  1M4G A;  5AG4 A;  2Z3P A;  4FBE A;  4CGM A;  2PR8 A;  1Q2C A;  2OZG A;  4YRH A;  4IHM A;  4PXD A;  1ARM A;  4U9Z A;  2AFW A;  2Q0Y A;  2Q51 A;  2WSA A;  5J8C A;  2IMO A;  5HXD A;  1AMP A;  2JEW A;  4KOU A;  4MFJ A;  4A94 A;  3PB4 X;  4MFL A;  3SJG A;  1IY7 A;  4EFD A;  4QBJ A;  4A38 A;  4AG9 A;  1QSM A;  3N5F A;  1VGY A;  2YNC A;  3CZX A;  4M3S A;  1MJ9 A;  3KL9 A;  1P0H A;  3D7D A;  2HQY A;  1Z4R A;  2RC4 A;  4GM5 A;  4HKF A;  4MHD A;  3PRT A;  2PR1 A;  4ZY1 A;  2V8V A;  4MJ8 A;  4ZX8 A;  4UFV A;  1FT7 A;  1VHE A;  2CY2 A;  2P6G A;  1QSR A;  2PJ7 A;  4H6U A;  4P4E A;  5EMI A;  1NSL A;  4MXU A;  3D2M A;  4P45 A;  4UCN A;  2HB6 A;  2NSM A;  2R1I A;  3PBB A;  2CIJ A;  2DPS A;  4KOY A;  4MFQ A;  4MCR A;  3MGD A;  4LUA A;  2PJC A;  3KR4 A;  2V8D A;  3IWG A;  4B11 A;  1Y9K A;  2G3A A;  4X3R A;  3GY9 A;  2NYQ A;  4DUK A;  2EBJ A;  4YWY A;  3ISX A;  5K8M A;  3G3S A;  1TIQ A;  3P2F A;  1SQH A;  1Q2Y A;  4W9Y A;  1LCP A;  2CTC A;  2CNT A;  3PB7 X;  4DJL A;  3H8E A;  2F8H A;  4JYW A;  4WJB A;  4MY0 A;  4BMH A;  1ZG9 A;  4UIA A;  1CX8 A;  5DWN A;  3FX6 A;  4XPD C;  2AE6 A;  3SI1 A;  1IID A;  4OAE A;  1BPN A;  2JDC A;  4CAW A;  6CPA A;  4I49 A;  4PXC A;  4OKO A;  4JXR A;  2REE A;  3W91 A;  4B13 A;  1IYL A;  4NGT A;  4NGN A;  1FY7 A;  1YX0 A;  2Z0Z A;  5A27 A;  3GYA A;  5K8N A;  1CBX A;  2X7B A;  4NSQ A;  4M6H A;  1BO4 A;  1ARL A;  1ELM P;  1YW4 A;  1B6B A;  1TKF A;  2G0B A;  2FXF A;  4MCS A;  4CAX A;  5J8F A;  3HLP A;  4NXY A;  4A37 A;  1V0C A;  4ZY2 A;  4Y49 B;  2EVN A;  2GFQ A;  1PYT B;  4YU9 A;  4HPS A;  3PGP A;  3PBE A;  2GE3 A;  4XNH C;  1S60 A;  2BL1 A;  2AFO A;  4MFZ A;  4AVC A;  3EO4 A;  1YR0 A;  1Y7E A;  2VI7 A;  5HVF A;  5C88 A;  5K8O A;  4CYQ A;  3MN8 A;  5D29 A;  2ABZ A;  3KGQ A;  5LRJ A;  3FB3 A;  5LYI A;  3LD2 A;  4R6T A;  5DWM A;  3R9G A;  1NMT A;  4C7H A;  1CJW A;  1L0C A;  2B5G B;  3JUW A;  1BLL E;  2PJ6 A;  1XOV A;  3I1U A;  1MJB A;  1S7L A;  4NF1 A;  3HUV A;  4NGR A;  3RZA A;  4F8Z A;  2Z10 A;  1RXT A;  3S9L A;  1Z8T A;  2AFU A;  3NH5 A;  3VH9 A;  2EK9 A;  2ZEP A;  4UCM A;  4XPK A;  2C6P A;  2ZEN A;  3NH8 A;  1F2P A;  1VKC A;  2BO9 A;  3EY5 A;  4FUU A;  4JLY A;  2OOT A;  3VWD A;  3ZZI A;  2PDO A;  2F5I A;  3PB6 X;  3TTH A;  2Q7S A;  5I0C A;  3NE7 A;  3S6G A;  5HMN A;  1Z8W A;  4F9V A;  3BXM A;  2DEA A;  1JQG A;  2ZEF A;  2PIY A;  3TOA A;  1VIX A;  3SXO A;  5LRK A;  1AYE A;  3SJX A;  4UEE A;  5KTD A;  1IGB A;  4KLV A;  3KHX A;  1Z4E A;  2AFX A;  1MJA A;  1QMU A;  2ODF A;  1YRE A;  3FYN A;  2PQ8 A;  3IO1 A;  1GHE A;  2I79 A;  1BOB A;  2VQY A;  2WUU A;  2C27 A;  3EFA A;  4LX9 A;  3KKW A;  4PK3 A;  3IWE A;  1ZLH A;  4E0A A;  2R98 A;  4B6Z A;  2BOA A;  1YGH A;  2O28 A;  3FXT A;  4CGN A;  1CPX A;  3PB8 X;  4CGO A;  2Z3K A;  2JDD A;  1IIC A;  2OH1 A;  4K30 A;  2D4P A;  2FCK A;  1KZF A;  4DNC A;  1I21 A;  1YME A;  4KOR A;  4C7I A;  3SJF A;  4HNX B;  1KUY A;  3B3T A;  5EC4 A;  5BWA B;  1X12 A;  2PJ0 A;  4B10 A;  1Z8L A;  2EUI A;  4UWJ A;  3I9S A;  4LQG A;  3PZJ A;  2JLM A;  4BD9 A;  2J8M A;  2C6G A;  3JTK A;  3D3S A;  1R3N A;  4KZT A;  1RO5 A;  2H5M A;  2PJ3 A;  2Q4V A;  2QIR A;  1Y7R A;  1LRZ A;  2IQ6 A;  3TT2 A;  4HNY B;  3LMS A;  3B3W A;  3PEI A;  2Z3L A;  3H5Z A;  5IB9 A;  2RB7 A;  4OC2 A;  5I4M A;  4NJR A;  5JH9 A;  2GLF A;  5CBM A;  2GU2 A;  4ZBG A;  1ZG7 A;  2OB0 A;  2PRB A;  2PJ4 A;  4GXH A;  1P4N A;  1M4L A;  3DLJ A;  2PC1 A;  5F49 A;  4M85 A;  3TFY A;  5KTC A;  2GIV A;  2ZEM A;  3D7H A;  4C2X A;  2OZH A;  1KUX A;  3FIX A;  2D4O A;  3FED A;  3SI2 A;  4RUH A;  3E0K A;  1LAP A;  1ZG8 A;  1Q2D A;  1YSJ A;  3DR6 A;  4PXB A;  4QUS A;  4QC6 A;  1XRY A;  4OID A;  2PJ2 A;  3IFE A;  2ZEO A;  2OZU A;  3BJ8 A;  3EXN A;  4P4F A;  3H8F A;  1I12 A;  4B14 A;  4KLW A;  4R9M A;  3BLN A;  4F6A A;  3D68 A;  4L89 A;  4UCP A;  4MCQ A;  4EME A;  4KUB A;  4YGO A;  2KCW A;  4JD6 A;  5LRG A;  4UFX A;  1WK4 A;  4KVX A;  1GYT A;  3RO0 A;  4FD4 A;  4X2T A;  3RYO A;  4CGL A;  3V8I A;  4Z65 A;  2POK A;  1ELL P;  2P0W A;  4MCP A;  3QB8 A;  2DF5 A;  3RNZ A;  4JJX A;  1OZP A;  2J8R A;  4PK2 A;  3IGR A;  4A32 A;  5JPH A;  3FF3 A;  2CNS A;  2PVW A;  3UY5 A;  4NJQ A;  3CXQ A;  5AG5 A;  4CYN A;  2WPX A;  3QAY A;  2ATR A;  1YQE A;  5JQ4 A;  1PU9 A;  3R9E A;  4BIN A;  2EO8 A;  2Q44 A;  5CNP A;  3CPA A;  2ZEE A;  4PV6 A;  1F57 A;  1IOF A;  3CDX A;  4MMO A;  3KQZ A;  2AJ6 A;  4OAD A;  2B58 A;  2CNM A;  4CRZ B;  4OC1 A;  4P4D A;  3FEE A;  4OC0 A;  1TF8 A;  3NE8 A;  1Q7L A;  3DR8 A;  5D8N A;  3ISZ A;  4G1P A;  4NEX A;  2RFH A;  2Z3M A;  1NE9 A;  3BI0 A;  4IK2 A;  3I3G A;  4F9U A;  4OME A;  3DSB A;  2ZOF A;  4R8F A;  1Y0R A;  4H89 A;  2HUZ A;  2R8V A;  2Z11 A;  1HDQ A;  1ON0 A;  1YVK A;  2PJA A;  3B7I A;  5FVJ A;  3D66 A;  3GUX A;  4OC5 A;  3TO7 A;  2I00 A;  4C2Z A;  2K5T A;  4II9 A;  4KOT A;  5DS0 A;  1N71 A;  4XPD B;  3F0A A;  3IEH A;  2ZPA A;  4NCZ A;  3WT4 A;  3PFE A;  3DGV A;  3IWW A;  3R96 A;  4L8A A;  4PPZ A;  5AG6 A;  3OWC A;  4K3N A;  4U5Y A;  4P6Y A;  4R3K A;  1XE4 A;  2BCO A;  2R7H A;  1EE3 P;  1Y9W A;  2PIZ A;  4CS0 B;  5F48 A;  4ZY0 A;  3EC4 A;  1IU8 A;  2GLJ A;  4JZ0 A;  4TNU A;  1ZLI A;  4PXE A;  4AVA A;  3SI0 A;  3D8P A;  4NGS A;  4P4J A;  4U9Y A;  1BAV A;  4ZI6 A;  1K4J A;  4X5K A;  3IU1 A;  4CGP A;  4XNH B;  2REF A;  5LYL A;  1X10 A;  3GB0 A;  3B3C A;  1S3Z A;  5H84 A;  4FD6 A;  1IOI A;  4F0X A;  5HVH A;  4R87 A;  2ZEL A;  4UFW A;  1R57 A;  4AXV A;  3KZW A;  1CP6 A;  5AGE A;  5IX3 A;  3B35 A;  2FE7 A;  4IF5 A;  4Q36 A;  4R76 A;  2C6C A;  1F2O A;  2PVV A;  4OLL A;  4OC3 A;  4OC4 A;  4ZGY B;  3PFO A;  3L2N A;  3WAB A;  4PQA A;  2HV2 A;  3IU2 A;  3DDD A;  4HNW B;  1VHS A;  2AFZ A;  2YGW A;  3MRU A;  4M6G A;  4R57 A;  4DYO A;  3WC5 A;  3QNV A;  1M1D A;  1XJO A;  1ZO0 A;  3BI1 A;  4EWT A;  4R3L A;  3KQX A;  2J9A A;  4E2A A;  5IV0 A;  4P4I A;  5ISV A;  4A2Z A;  2FSR A;  3B3S A;  1LAN A;  1IYK A;  2XEI A;  2HC9 A;  3PP9 A;  3D7G A;  3S6F A;  2ZEG A;  2OR4 A;  2ANP A;  1LFW A;  3VAR A;  3D67 A;  4B12 A; 
#chains in the Genus database with same CATH homology
 4P10 A;  3B2Y A;  4UIB A;  4NFR A;  4IAV A;  5LYD A;  2AFS A;  3IIB A;  5JGF A;  4WWV A;  2PCU A;  3CPX A;  3K9T A;  2ZEH A;  2FVG A;  2PJ8 A;  3S9N A;  2G9D A;  4P4B A;  2EWB A;  3FMC A;  2PRQ A;  3KAS A;  3JRU A;  4TWE A;  1TF9 A;  1Z5R A;  2GRE A;  3TC8 A;  3FH4 A;  1XFO A;  3IC1 A;  3B3V A;  3NA6 A;  4MHP A;  3TX8 A;  4CPA A;  3BHX A;  1BPM A;  1NSA A;  3GLJ A;  1UWY A;  2I3C A;  1QQ9 A;  3NFZ A;  1LAM A;  2PE3 A;  8CPA A;  4Q7A A;  1CPS A;  1XMB A;  1Y0Y A;  4NGQ A;  1YLO A;  2IJZ A;  5ELY A;  3VAT A;  4A39 A;  2Q43 A;  4KSI A;  4R7M A;  2F7V A;  2JBJ A;  3D4U A;  1YW6 A;  4OIW A;  5THW A;  4FAI A;  3D7F A;  1Z2L A;  1TKH A;  2V8G A;  1DTD A;  3KHZ A;  3V7Z A;  2V77 A;  3FEC A;  4MHN A;  2ZOG A;  4MRI A;  3NH4 A;  2XEJ A;  2PJ5 A;  4X8I A;  1LOK A;  3S9M A;  1DE4 C;  1KWM A;  2C1C A;  1TKJ A;  2VL1 A;  4MHY A;  3IJ3 A;  3H8G A;  4ZX9 A;  3WC7 A;  5K8P A;  1TXR A;  3V38 A;  2QYV A;  2JBK A;  7CPA A;  3KR5 A;  2QVP A;  4NGM A;  3RAM A;  1FNO A;  2AFM A;  3T8W A;  4ONW A;  2QJ8 A;  2PJ9 A;  2Q4Z A;  3RBU A;  4NGP A;  1XBU A;  3SJE A;  3KI9 A;  1PCA A;  4FWU A;  2EK8 A;  5F09 A;  1OBR A;  2PJB A;  5LYF A;  2WYR A;  1RTQ A;  4MHZ A;  1HEE A;  3FVL A;  3K2K A;  4UEZ A;  1CG2 A;  2XEF A;  3PB9 X;  5JM6 A;  1H8L A;  1R43 A;  3WC6 A;  2PJ1 A;  2ZED A;  1CP7 A;  1HDU A;  3FJU A;  2V8H A;  4UF4 A;  5CPA A;  5J1Q A;  3LWU A;  4ZYQ A;  4OP4 A;  2WZN A;  4O23 A;  4UEF A;  4H2K A;  2XEG A;  2O53 A;  2O4H A;  2CF4 A;  4P44 A;  5HVG A;  1VHO A;  2CTB A;  3CT9 A;  4FBE A;  4IHM A;  4PXD A;  1ARM A;  2AFW A;  2Q51 A;  2IMO A;  5HXD A;  1AMP A;  2JEW A;  4A94 A;  3PB4 X;  3SJG A;  1IY7 A;  4EFD A;  4A38 A;  3N5F A;  1VGY A;  3KL9 A;  3D7D A;  4GM5 A;  3PRT A;  4ZY1 A;  2V8V A;  4ZX8 A;  1FT7 A;  1VHE A;  2PJ7 A;  4P4E A;  4MXU A;  4P45 A;  2HB6 A;  2NSM A;  3PBB A;  2CIJ A;  4MCR A;  2PJC A;  3KR4 A;  2V8D A;  4X3R A;  4DUK A;  2NYQ A;  4YWY A;  3ISX A;  5K8M A;  4W9Y A;  1LCP A;  2CTC A;  3PB7 X;  4DJL A;  3H8E A;  2F8H A;  4JYW A;  4WJB A;  1ZG9 A;  4UIA A;  1CX8 A;  3FX6 A;  3SI1 A;  1BPN A;  6CPA A;  4PXC A;  4OKO A;  4NGN A;  4NGT A;  5K8N A;  1CBX A;  1ARL A;  1ELM P;  1YW4 A;  4MCS A;  1TKF A;  3HLP A;  4A37 A;  4ZY2 A;  1PYT B;  4YU9 A;  3PBE A;  2AFO A;  5HVF A;  1Y7E A;  5K8O A;  3MN8 A;  5D29 A;  2ABZ A;  3KGQ A;  5LRJ A;  5LYI A;  4R6T A;  1BLL E;  2PJ6 A;  3I1U A;  3RZA A;  4NGR A;  3HUV A;  4F8Z A;  3S9L A;  3NH5 A;  2AFU A;  3VH9 A;  2EK9 A;  2ZEP A;  2C6P A;  2ZEN A;  3NH8 A;  1F2P A;  4FUU A;  2BO9 A;  2OOT A;  3PB6 X;  4F9V A;  3BXM A;  2DEA A;  1JQG A;  2ZEF A;  2PIY A;  1VIX A;  5LRK A;  1AYE A;  3SJX A;  4UEE A;  1IGB A;  3KHX A;  2AFX A;  1QMU A;  3IO1 A;  1ZLH A;  4B6Z A;  2BOA A;  1CPX A;  3PB8 X;  1YME A;  3SJF A;  3B3T A;  2PJ0 A;  1Z8L A;  4LQG A;  4BD9 A;  2C6G A;  1R3N A;  2PJ3 A;  2IQ6 A;  3LMS A;  3B3W A;  3PEI A;  5IB9 A;  2RB7 A;  4OC2 A;  5I4M A;  4NJR A;  5JH9 A;  2GLF A;  5CBM A;  2GU2 A;  1ZG7 A;  2PJ4 A;  1M4L A;  3DLJ A;  2ZEM A;  3D7H A;  3SI2 A;  3FED A;  4RUH A;  1LAP A;  1ZG8 A;  1YSJ A;  4PXB A;  1XRY A;  4OID A;  2PJ2 A;  3IFE A;  2ZEO A;  4P4F A;  3H8F A;  3D68 A;  4MCQ A;  4EME A;  5LRG A;  1GYT A;  4X2T A;  4Z65 A;  2POK A;  1ELL P;  4MCP A;  3FF3 A;  2PVW A;  4NJQ A;  3CPA A;  2ZEE A;  1F57 A;  3CDX A;  4MMO A;  3KQZ A;  4OC1 A;  4P4D A;  3FEE A;  4OC0 A;  1TF8 A;  1Q7L A;  5D8N A;  3ISZ A;  4G1P A;  2RFH A;  3BI0 A;  4IK2 A;  4F9U A;  4OME A;  2ZOF A;  4R8F A;  1Y0R A;  1HDQ A;  3B7I A;  2PJA A;  3D66 A;  3GUX A;  4OC5 A;  5DS0 A;  3IEH A;  3WT4 A;  3PFE A;  3DGV A;  3IWW A;  4PPZ A;  4K3N A;  4P6Y A;  2BCO A;  1EE3 P;  2PIZ A;  4ZY0 A;  2GLJ A;  4JZ0 A;  4TNU A;  1ZLI A;  4PXE A;  3SI0 A;  4NGS A;  4P4J A;  4ZI6 A;  1BAV A;  5LYL A;  3GB0 A;  3B3C A;  5HVH A;  2ZEL A;  4AXV A;  3KZW A;  1CP6 A;  3B35 A;  4R76 A;  2C6C A;  1F2O A;  2PVV A;  4OC3 A;  4OC4 A;  3PFO A;  3L2N A;  3WAB A;  4PQA A;  2AFZ A;  3MRU A;  4DYO A;  3WC5 A;  3QNV A;  1XJO A;  3BI1 A;  4EWT A;  3KQX A;  2J9A A;  4P4I A;  3B3S A;  1LAN A;  2XEI A;  2HC9 A;  3D7G A;  2ZEG A;  2OR4 A;  2ANP A;  1LFW A;  3VAR A;  3D67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...