4FWUA

Crystal structure of glutaminyl cyclase from drosophila melanogaster in space group i4
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
305
structure length
299
Chain Sequence
QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG32412
publication title Structure of glutaminyl cyclase from Drosophila melanogaster in space group I4.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 106
structure length 299
sequence length 305
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fwuA00
4MRIA 1CPXA 4F9VA 5HXDA 1CX8A 3B2YA 1Y7EA 3BXMA 2EWBA 2C6PA 3V38A 2PJ8A 4UEFA 2PIZA 3BHXA 2J9AA 1UWYA 1GYTA 2XEJA 4P44A 3VATA 1BAVA 1TKJA 4A37A 4YU9A 4ZI6A 1CG2A 2IQ6A 3B3WA 3KHZA 1Z2LA 3IEHA 4P4DA 2BOAA 3IWWA 5F09A 5CBMA 6CPAA 2IMOA 2C1CA 3KR5A 3MRUA 4MMOA 3CDXA 2ZEMA 2I3CA 3FJUA 2IJZA 2ABZA 4UEZA 4NJQA 2ZEPA 3JRUA 2O4HA 5CPAA 1AMPA 1BLLE 1CP7A 4G1PA 3D4UA 2ZOFA 2EK8A 2JBKA 3NH4A 4GM5A 5THWA 1DE4C 3D68A 4DUKA 1TXRA 1IY7A 1ELMP 2CIJA 3K2KA 3FEEA 3PBEA 4B6ZA 3NA6A 4EMEA 2XEGA 3DGVA 4TWEA 4P6YA 4P4FA 5K8MA 3WC5A 2O53A 1FT7A 4FAIA 3S9MA 2AFOA 3FMCA 3IJ3A 3ISXA 1AYEA 4CPAA 2PJAA 4F8ZA 1TF9A 2PJ9A 3H8FA 1M4LA 3KR4A 1IGBA 2ANPA 4PXCA 5K8PA 1CPSA 3MN8A 4MHYA 2HB6A 1LAPA 4OKOA 2PJ3A 2QVPA 3H8GA 4RUHA 5LYIA 4P4EA 4FUUA 4NFRA 4IHMA 3KQXA 2V8VA 4X2TA 3PRTA 2PJ5A 4MXUA 2CF4A 4IAVA 3WC6A 3S9LA 3L2NA 4TNUA 2PCUA 2POKA 4ZX8A 1RTQA 2ZEFA 5HVGA 3PEIA 4NJRA 5LRKA 2NSMA 3IFEA 5IB9A 2XEFA 5HVFA 3T8WA 2WYRA 1TKHA 4ZYQA 1YW6A 1HDUA 2ZEHA 2Q4ZA 1HEEA 2XEIA 3SI1A 1VIXA 4MHNA 5JGFA 2V8GA 2DEAA 5JM6A 1LANA 4FWUA 4R8FA 1ZG8A 3D66A 4OIDA 1XRYA 4UEEA 4NGNA 3B3TA 3KASA 2WZNA 3TX8A 4JYWA 2PJ7A 5HVHA 4ZY2A 3NFZA 4PXDA 4ZY1A 4MCPA 1ELLP 3GB0A 1LFWA 3HLPA 4NGTA 3RBUA 4A38A 1ZG9A 2PVWA 1Z5RA 1ZLIA 1VHEA 2GU2A 1ZG7A 4OC5A 3KI9A 2PRQA 3FVLA 2ZEEA 4KSIA 2ZELA 5K8OA 2CTBA 3PB9X 3B3SA 3PB8X 1YMEA 4EWTA 2BCOA 4P4IA 2V8DA 1F2PA 4UIAA 1F2OA 1Z8LA 4F9UA 2GREA 2C6CA 4W9YA 4NGSA 5J1QA 1HDQA 2VL1A 4PPZA 2F7VA 4Z65A 1PCAA 3VARA 5D8NA 4OMEA 3D7FA 4X3RA 3CPAA 3HUVA 1XFOA 1OBRA 1QMUA 2ZOGA 1R3NA 1BPMA 2V77A 4P4JA 2AFMA 2AFUA 3FH4A 4OC3A 3FX6A 2EK9A 4LQGA 4MCQA 3B35A 4PQAA 1EE3P 4MHZA 5DS0A 4EFDA 2ZEOA 4P45A 4PXBA 2RB7A 2FVGA 3IIBA 1ZLHA 2F8HA 3DLJA 3VH9A 3TC8A 3I1UA 3SJFA 3WABA 3B3CA 2AFWA 2ZEDA 2RFHA 1XMBA 3KHXA 3NH8A 4UF4A 4WJBA 3LMSA 3LWUA 5LRGA 4WWVA 2OR4A 4DYOA 3PB7X 3KZWA 2PE3A 5LYDA 4UIBA 2G9DA 5I4MA 2AFZA 4AXVA 1LCPA 2PVVA 1F57A 3ISZA 4H2KA 3SJXA 5D29A 2Q51A 2JBJA 2CTCA 1LAMA 3H8EA 3PB4X 2QYVA 1XJOA 2C6GA 3PFEA 1TF8A 4A94A 5LYFA 8CPAA 1YSJA 4R6TA 2PJCA 3SJEA 3BI1A 4A39A 2NYQA 2ZEGA 4NGPA 2AFSA 4X8IA 3SJGA 3D7DA 2HC9A 4P4BA 1XBUA 3WC7A 1FNOA 4OC2A 4P10A 3WT4A 3PBBA 1CP6A 5LYLA 1PYTB 4IK2A 3GLJA 3QNVA 2GLFA 1KWMA 4PXEA 4JZ0A 4K3NA 3SI0A 2OOTA 3IC1A 2PIYA 4ZY0A 5JH9A 3NH5A 1ARLA 1BPNA 4Q7AA 3GUXA 4YWYA 4BD9A 2PJ6A 4OIWA 1YW4A 3PB6X 4OC4A 1Y0YA 3B3VA 2AFXA 4R76A 1YLOA 4FBEA 1LOKA 4OP4A 1Q7LA 3D67A 4OC1A 1ARMA 2PJ4A 4NGMA 5ELYA 4DJLA 3V7ZA 3KL9A 3FEDA 4O23A 3RZAA 3D7HA 3FF3A 5K8NA 1DTDA 2GLJA 1VGYA 4MCSA 3SI2A 2V8HA 5LRJA 2ZENA 1VHOA 4MHPA 7CPAA 1JQGA 1R43A 4NGRA 4ZX9A 3BI0A 3KQZA 3FECA 2PJ1A 3K9TA 1H8LA 1CBXA 4ONWA 3N5FA 4OC0A 2BO9A 2PJBA 2PJ0A 4MCRA 3B7IA 1QQ9A 1Y0RA 4NGQA 3IO1A 2Q43A 3KGQA 3S9NA 3CT9A 1TKFA 1NSAA 3CPXA 4R7MA 3D7GA 3RAMA 2PJ2A 2JEWA 3PFOA 2QJ8A
chains in the Genus database with same CATH superfamily
2OH1A 1SQHA 4MRIA 4YFJA 1CPXA 4F9VA 2PR1A 5HXDA 2Q7SA 3JVNA 1CJWA 3JTKA 1YLEA 3V8IA 2C27A 3MGDA 1CX8A 3B2YA 1Y7EA 3BXMA 2EWBA 3F0AA 2C6PA 3DR8A 2Z3NA 4KS9A 4PSWA 3V38A 2PJ8A 3CZXA 4UEFA 3SXNA 2PIZA 3BHXA 4R9MA 2J9AA 1UWYA 4MFKA 2A4NA 3R9GA 1Z4RA 4KLVA 1GYTA 3H5ZA 4AG9A 2XEJA 1QSMA 4P44A 3VATA 3BLNA 4E2AA 1BAVA 4MHDA 4RS2A 2EO8A 1TKJA 3G3SA 4YU9A 3VWDA 3EC4A 4X5KA 4A37A 1CG2A 4ZI6A 4J3GA 2IQ6A 3B3WA 4C2XA 2JDCA 2PSWA 3KHZA 1Z2LA 3IEHA 3KKWA 3VWEA 4P4DA 4B12A 1PU9A 1AUGA 4ZBGA 2BOAA 3EY5A 3IWWA 5F09A 4U9ZA 4AVAA 5CBMA 4JJXA 6CPAA 1B87A 2IMOA 4M85A 3EFAA 4PK2A 2C1CA 3KR5A 2B5GB 3MRUA 4MMOA 3CDXA 3CXQA 1MJAA 4U9YA 4K30A 4FD4A 2ODFA 2ZEMA 4UCNA 2I3CA 1MJ9A 3FJUA 4C2ZA 2IJZA 1M4GA 2ABZA 4UEZA 1U6MA 4NJQA 4CYNA 2ZEPA 3JRUA 2O4HA 2REEA 5CPAA 4KOWA 4MFPA 1AMPA 1BLLE 4OAEA 1CP7A 3D4UA 4G1PA 5G21A 1OZPA 2EK8A 2ZOFA 2B4DA 1I1DA 2G3TA 2JBKA 2HV2A 4UFXA 3NH4A 4KORA 4GM5A 5AGEA 5THWA 1RO5A 3IGRA 1DE4C 1QSTA 2Q4YA 3D68A 2K5TA 4MBUA 4CYPA 4DUKA 1TXRA 1IY7A 1ELMP 3ZJ0A 4C7HA 4YRHA 2CIJA 2G0BA 3K2KA 5DWNA 1IB1E 3FEEA 1XMTA 3PBEA 4B6ZA 3NA6A 4OLLA 4UA3A 4B5PA 1J4JA 4EMEA 2XEGA 3DGVA 2G3AA 3EXNA 1QSOA 2VQYA 2OZHA 1XE4A 4TWEA 2FSRA 4MFJA 4P6YA 4PV6A 4P4FA 5K8MA 2D4PA 4CGOA 1S7LA 1IOIA 1BO4A 3WC5A 2O53A 1FT7A 3F5BA 4LQ6A 4KOVA 2P6EA 4CGNA 4CAWA 4FAIA 5DWMA 4A32A 3S9MA 2AFOA 3S6GA 4OADA 4RI1A 5AG7A 3A9LA 3FMCA 3IJ3A 3ISXA 1AYEA 4CPAA 2B4DB 2PJAA 3I3GA 1WWZA 4F8ZA 2FIAA 1TF9A 4YGOA 1IYLA 1FY7A 1MK4A 2PJ9A 3H8FA 1JWQA 4R3KA 3PP9A 1M1DA 4FD6A 1M4LA 2Z3PA 1IGBA 3D2MA 3KR4A 4M6IA 1NE9A 2GANA 2ANPA 4PXCA 5K8PA 1NMTA 4MFZA 3W91A 5I0CA 5A27A 2AJ6A 1CPSA 3MN8A 4B11A 2F5IA 4CRYB 3TE4A 4MHYA 2OZUA 2HB6A 1LAPA 4OKOA 3TFYA 2PJ3A 2QVPA 2KCWA 3GYAA 2NMTA 3H8GA 4RUHA 4FBEA 4PSXA 5LYIA 4P4EA 4FUUA 4JLYA 2YNCC 1V0CA 2FIWA 4NFRA 4IHMA 2DXQA 2X7BA 4E8OA 3KQXA 2V8VA 4X2TA 2FXFA 3PRTA 2PJ5A 2WUUA 4MXUA 2REFA 2YGWA 2CF4A 4IAVA 2VXKA 1M4DA 3WC6A 2ZW6A 3S9LA 3R96A 3L2NA 4TNUA 2PCUA 2POKA 5IV0A 4ZX8A 1RTQA 2P0WA 1A2ZA 2ZW4A 3JUWA 2I00A 2ZEFA 3DSBA 2B58A 1L0CA 3PEIA 1Z9UA 5HVGA 4JD6A 4NJRA 4B5OA 3BJ8A 5LRKA 2NSMA 4H6UA 3IFEA 1XEBA 4FD5A 1KUYA 5IB9A 5GCNA 2XEFA 5HVFA 4UWJA 4ORFA 3S6FA 3T8WA 2QIRA 2WYRA 4R87A 3SHPA 4KSFA 1TKHA 4ZYQA 3G8WA 1YW6A 1HDUA 5J8FA 4XPLA 4NXYA 2ZEHA 4R3LA 4BBHA 2Q4ZA 1HEEA 2XEIA 3TCVA 3SI1A 1VIXA 4MHNA 4RN7A 3IU2A 5JGFA 2V8GA 2DEAA 5KTAA 4CYQA 5JM6A 1LANA 2CNMA 4ONUA 2ZW5A 3H4QA 5G22A 5IX3A 4FWUA 4R8FA 1ZG8A 4GS4A 3D66A 3PZJA 4OIDA 1XRYA 5ISVA 4UEEA 4NGNA 3B3TA 5E96A 3KASA 2GIVA 2QECA 1B6BA 2WZNA 4HNWB 4JYWA 3TX8A 2PJ7A 5HVHA 3N7ZA 4ZY2A 4AG7A 3TOAA 2R7HA 3R1KA 2JLMA 3NFZA 4PXDA 4QVTA 3LD2A 4ZY1A 4KOYA 1YX0A 4MCPA 1ELLP 2QMLA 1ZO0A 3TOBA 2Q04A 3GB0A 1LFWA 3HLPA 1M44A 4NGTA 3S6KA 1S3ZA 3RBUA 4A38A 1Z4EA 1ZG9A 2PVWA 1Z5RA 2YNCA 3DDDA 1ZLIA 5F49A 1VHEA 2GU2A 1ZG7A 4OC5A 3IWEA 3KI9A 5KTCA 2AE6A 2PRQA 2VZZA 3RYOA 3FVLA 4CGPA 2ZEEA 1YVOA 4KSIA 4CAXA 3NE8A 2ZELA 3DR6A 2ARHA 5K8OA 2CTBA 3SXOA 3PB9X 2ZPAA 4KVOE 3B3SA 3PB8X 4PK3A 5AG5A 1YMEA 4EWTA 4A33A 2BCOA 2FCKA 4NCZA 3QB8A 4UFWA 4P4IA 2V8DA 1F2PA 4CGMA 2I79A 3QAHA 4UIAA 1F2OA 4JXQA 3TT2A 1Z8LA 3LACA 2YNEA 1X12A 2Q0YA 4F9UA 4A31A 2GREA 2C6CA 2CNSA 4W9YA 3IU1A 4NGSA 2GFQA 4R57A 3S6HA 1HDQA 2VL1A 4PPZA 2F7VA 5J1QA 4Z65A 1PCAA 3VARA 2H5MA 2WPXA 4UCPA 5HH1A 4CAEA 5C88A 5D8NA 4OMEA 1VKCA 3D7FA 4X3RA 1KUXA 2EBJA 2GE3A 5F46A 3CPAA 3HUVA 4II9A 3R9EA 1IU8A 1S7FA 1XFOA 1OBRA 1QMUA 4XPDC 2ZOGA 3TO6A 4UWIA 4LX9A 2B3VA 1XOVA 1X10A 1R3NA 3B8GA 3BJ7A 1BPMA 2Z11A 4NSQA 4HNYB 4UCMA 2V77A 5C82A 5EMIA 4KSAA 4B5PB 4GXHA 2Y0MA 4P4JA 2R98A 2VBQA 3FNCA 1UFHA 2AFMA 4MFQA 4KOSA 2AFUA 4XNHB 1TIQA 1Z8WA 3FH4A 4OC3A 4MJ8A 2WSAA 4KUBA 3FX6A 2EK9A 4LQGA 4MCQA 3B35A 3GIUA 4PQAA 3FB3A 1EE3P 4MHZA 5DS0A 5JPHA 4EFDA 2ZEOA 1IOFA 4KUAA 4P45A 3TTHA 4PXBA 2JEVA 2RB7A 2FVGA 4QC6A 3IIBA 1ZLHA 5H86A 2F8HA 1Y9WA 3DLJA 4M6HA 5EBVA 3T90A 4B10A 3TO9A 3VH9A 5G1ZA 2B3UA 3TC8A 2OU2A 4U5YA 3RO0A 4DJLA 3I1UA 3SJFA 3WABA 3B3CA 2AFWA 1BOBA 2ZEDA 2RFHA 1XMBA 3FBUA 2PDOA 4XNHC 4CGLA 3KHXA 3NH8A 5G20A 4UF4A 4WJBA 4L8AA 3RNZA 4CAVA 4AVCA 3FXTA 3LMSA 4KVME 3W6XA 3LWUA 4H6ZA 4NEXA 4UFVA 5LRGA 4WWVA 1YK3A 2OR4A 5EC4A 1YVKA 2B4BA 2J8MA 3PB7X 4DYOA 3KZWA 2PE3A 3E0KA 5LYDA 3PGPA 1M4IA 4Y49C 4CYOA 4UIBA 2G9DA 5I4MA 2AFZA 2HQYA 4AXVA 1LCPA 2PVVA 1F57A 3ISZA 4H2KA 1Q2YA 3SJXA 5D29A 2Q51A 2JBJA 2CTCA 1LAMA 3FYNA 3W6SA 2PR8A 3H8EA 3PB4X 1MJBA 5IB0A 2QYVA 2B5GA 1IICA 1XJOA 2C6GA 3PFEA 1TF8A 2EUIA 4IUSA 4KVXA 1NSLA 3T9YA 3C26A 4A94A 4F0YA 4E0AA 5LYFA 2R8VA 8CPAA 1YSJA 2ZXVA 2P6FA 4R6TA 3FIXA 5FVJA 4LUAA 2OZGA 3GY9A 2EVNA 1K4JA 1XIXA 1KUVA 2PJCA 2Z3OA 3SJEA 2DF5A 4KZTA 5BWAB 3BI1A 4A39A 2NYQA 4AVBA 4BINA 5J8CA 2ZEGA 3IWGA 4NGPA 2AFSA 2Z0ZA 4X8IA 2YNDA 3SJGA 4CAFA 1YR0A 3D7DA 3CXSA 2HC9A 2CY2A 4P4BA 1XBUA 2FT0A 4C7IA 4A95A 1KZFA 3WC7A 2WPWA 1FNOA 2BSWA 2R1IA 4OC2A 4P10A 1XF8A 1VHSA 3WT4A 3PBBA 1CP6A 3P2FA 4XPDB 1P4NA 4A2ZA 5LYLA 1PYTB 2DPSA 4IK2A 3GLJA 3QNVA 2Q7BA 2PC1A 2GLFA 1KWMA 4PXEA 1IYKA 4JZ0A 2BL1A 4K3NA 4HNXB 3SI0A 2OOTA 4DNCA 2VEZA 3IC1A 3R9FA 1YREA 5F48A 4I49A 2PIYA 4F0XA 4KOUA 4ZY0A 3LODA 4A30A 5JH9A 2BEIA 3NH5A 4H89A 4QB9A 1S60A 1ARLA 4CS0B 2FE7A 1YQEA 3ZZIA 3K9UA 1BPNA 4HKFA 4Q7AA 2BUEA 4KLWA 3GUXA 5CNPA 1LRZA 1IIDA 2Z3MA 4YWYA 3QAYA 4BD9A 4EVYA 4ZGYB 2PJ6A 1QSRA 4OIWA 3OWCA 1YW4A 1PUAA 3PB6X 1Z8TA 4AB7A 1Y7RA 2IL4A 4OC4A 3UY5A 5KTDA 1Y0YA 3B3VA 4MI4A 5AG6A 5JQ4A 1I12A 4Q38A 2AFXA 2HUZA 1Q2CA 4R76A 1YLOA 2CXAA 5HMNA 1I21A 1P0HA 2VI7A 2Q44A 4JWPA 1LOKA 2P6GA 1Q7LA 4M6GA 3D67A 2ZW7A 4OP4A 1ARMA 2PJ4A 4M3SA 4NGMA 4OC1A 3NE7A 5ELYA 3V7ZA 2Q4VA 4F6AA 4MFLA 3FRMA 4QBJA 4C2YA 4NF1A 3TO7A 3KL9A 1GHEA 2Z10A 3FEDA 4O23A 3RZAA 4UBRA 3D7HA 3FF3A 4MY3A 5K8NA 1DTDA 2GLJA 4C68A 2PQ8A 1VGYA 5A28A 4HPSA 4JXRA 4BMHA 4MCSA 2Z3LA 3SI2A 2J8RA 2Z3KA 2V8HA 2O28A 4KOXA 2FS5A 5LRJA 4CRZB 4XPKA 2ZENA 1VHOA 2JDDA 4Y49B 4MHPA 4MY0A 7CPAA 3D3SA 2DPTA 2CNTA 2OB0A 2D4OA 4B13A 1JQGA 2PRBA 1R43A 4NGRA 5F47A 4ZX9A 1S7NA 3BI0A 3KQZA 1R57A 3FECA 2PJ1A 1Z8XA 3D8PA 3P2HA 1WK4A 3K9TA 3F8KA 1H8LA 1CBXA 4ONWA 3N5FA 4OC0A 1S7KA 2BO9A 2PJBA 3EO4A 2PJ0A 3DNSA 2ATRA 4Q36A 4MCRA 3B7IA 1S5KA 1CM0A 3GKRA 3R95A 4QUSA 3WR7A 1QQ9A 4IF5A 3D2PA 2RC4A 2J8NA 5H84A 1Y0RA 3I9SA 4NGQA 2VZYA 1YGHA 1Q2DA 3IO1A 2Q43A 2FL4A 3KGQA 3S9NA 3CT9A 4L89A 1Y9KA 1RXTA 1TKFA 1NSAA 4KOTA 5AG4A 3CPXA 4R7MA 1N71A 1ON0A 3CXPA 3D7GA 3RAMA 2PJ2A 1QSNA 4FD7A 2JEWA 3PFOA 2QJ8A 4B14A
chains in the Genus database with same CATH topology
4MRIA 1CPXA 4F9VA 5HXDA 1CX8A 3B2YA 1Y7EA 3BXMA 2EWBA 2C6PA 3V38A 2PJ8A 4UEFA 2PIZA 3BHXA 2J9AA 1UWYA 1GYTA 2XEJA 4P44A 3VATA 1BAVA 1TKJA 4A37A 4YU9A 4ZI6A 1CG2A 2IQ6A 3B3WA 3KHZA 1Z2LA 3IEHA 4P4DA 2BOAA 3IWWA 5F09A 5CBMA 6CPAA 2IMOA 2C1CA 3KR5A 3MRUA 4MMOA 3CDXA 2ZEMA 2I3CA 3FJUA 2IJZA 2ABZA 4UEZA 4NJQA 2ZEPA 3JRUA 2O4HA 5CPAA 1AMPA 1BLLE 1CP7A 4G1PA 3D4UA 2ZOFA 2EK8A 2JBKA 3NH4A 4GM5A 5THWA 1DE4C 3D68A 4DUKA 1TXRA 1IY7A 1ELMP 2CIJA 3K2KA 3FEEA 3PBEA 4B6ZA 3NA6A 4EMEA 2XEGA 3DGVA 4TWEA 4P6YA 4P4FA 5K8MA 3WC5A 2O53A 1FT7A 4FAIA 3S9MA 2AFOA 3FMCA 3IJ3A 3ISXA 1AYEA 4CPAA 2PJAA 4F8ZA 1TF9A 2PJ9A 3H8FA 1M4LA 3KR4A 1IGBA 2ANPA 4PXCA 5K8PA 1CPSA 3MN8A 4MHYA 2HB6A 1LAPA 4OKOA 2PJ3A 2QVPA 3H8GA 4RUHA 5LYIA 4P4EA 4FUUA 4NFRA 4IHMA 3KQXA 2V8VA 4X2TA 3PRTA 2PJ5A 4MXUA 2CF4A 4IAVA 3WC6A 3S9LA 3L2NA 4TNUA 2PCUA 2POKA 4ZX8A 1RTQA 2ZEFA 5HVGA 3PEIA 4NJRA 5LRKA 2NSMA 3IFEA 5IB9A 2XEFA 5HVFA 3T8WA 2WYRA 1TKHA 4ZYQA 1YW6A 1HDUA 2ZEHA 2Q4ZA 1HEEA 2XEIA 3SI1A 1VIXA 4MHNA 5JGFA 2V8GA 2DEAA 5JM6A 1LANA 4FWUA 4R8FA 1ZG8A 3D66A 4OIDA 1XRYA 4UEEA 4NGNA 3B3TA 3KASA 2WZNA 3TX8A 4JYWA 2PJ7A 5HVHA 4ZY2A 3NFZA 4PXDA 4ZY1A 4MCPA 1ELLP 3GB0A 1LFWA 3HLPA 4NGTA 3RBUA 4A38A 1ZG9A 2PVWA 1Z5RA 1ZLIA 1VHEA 2GU2A 1ZG7A 4OC5A 3KI9A 2PRQA 3FVLA 2ZEEA 4KSIA 2ZELA 5K8OA 2CTBA 3PB9X 3B3SA 3PB8X 1YMEA 4EWTA 2BCOA 4P4IA 2V8DA 1F2PA 4UIAA 1F2OA 1Z8LA 4F9UA 2GREA 2C6CA 4W9YA 4NGSA 5J1QA 1HDQA 2VL1A 4PPZA 2F7VA 4Z65A 1PCAA 3VARA 5D8NA 4OMEA 3D7FA 4X3RA 3CPAA 3HUVA 1XFOA 1OBRA 1QMUA 2ZOGA 1R3NA 1BPMA 2V77A 4P4JA 2AFMA 2AFUA 3FH4A 4OC3A 3FX6A 2EK9A 4LQGA 4MCQA 3B35A 4PQAA 1EE3P 4MHZA 5DS0A 4EFDA 2ZEOA 4P45A 4PXBA 2RB7A 2FVGA 3IIBA 1ZLHA 2F8HA 3DLJA 3VH9A 3TC8A 3I1UA 3SJFA 3WABA 3B3CA 2AFWA 2ZEDA 2RFHA 1XMBA 3KHXA 3NH8A 4UF4A 4WJBA 3LMSA 3LWUA 5LRGA 4WWVA 2OR4A 4DYOA 3PB7X 3KZWA 2PE3A 5LYDA 4UIBA 2G9DA 5I4MA 2AFZA 4AXVA 1LCPA 2PVVA 1F57A 3ISZA 4H2KA 3SJXA 5D29A 2Q51A 2JBJA 2CTCA 1LAMA 3H8EA 3PB4X 2QYVA 1XJOA 2C6GA 3PFEA 1TF8A 4A94A 5LYFA 8CPAA 1YSJA 4R6TA 2PJCA 3SJEA 3BI1A 4A39A 2NYQA 2ZEGA 4NGPA 2AFSA 4X8IA 3SJGA 3D7DA 2HC9A 4P4BA 1XBUA 3WC7A 1FNOA 4OC2A 4P10A 3WT4A 3PBBA 1CP6A 5LYLA 1PYTB 4IK2A 3GLJA 3QNVA 2GLFA 1KWMA 4PXEA 4JZ0A 4K3NA 3SI0A 2OOTA 3IC1A 2PIYA 4ZY0A 5JH9A 3NH5A 1ARLA 1BPNA 4Q7AA 3GUXA 4YWYA 4BD9A 2PJ6A 4OIWA 1YW4A 3PB6X 4OC4A 1Y0YA 3B3VA 2AFXA 4R76A 1YLOA 4FBEA 1LOKA 4OP4A 1Q7LA 3D67A 4OC1A 1ARMA 2PJ4A 4NGMA 5ELYA 4DJLA 3V7ZA 3KL9A 3FEDA 4O23A 3RZAA 3D7HA 3FF3A 5K8NA 1DTDA 2GLJA 1VGYA 4MCSA 3SI2A 2V8HA 5LRJA 2ZENA 1VHOA 4MHPA 7CPAA 1JQGA 1R43A 4NGRA 4ZX9A 3BI0A 3KQZA 3FECA 2PJ1A 3K9TA 1H8LA 1CBXA 4ONWA 3N5FA 4OC0A 2BO9A 2PJBA 2PJ0A 4MCRA 3B7IA 1QQ9A 1Y0RA 4NGQA 3IO1A 2Q43A 3KGQA 3S9NA 3CT9A 1TKFA 1NSAA 3CPXA 4R7MA 3D7GA 3RAMA 2PJ2A 2JEWA 3PFOA 2QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRI A;  1CPX A;  4F9V A;  5HXD A;  1CX8 A;  3B2Y A;  1Y7E A;  3BXM A;  2EWB A;  2C6P A;  3V38 A;  2PJ8 A;  4UEF A;  2PIZ A;  3BHX A;  2J9A A;  1UWY A;  1GYT A;  2XEJ A;  4P44 A;  3VAT A;  1BAV A;  1TKJ A;  4A37 A;  4YU9 A;  4ZI6 A;  1CG2 A;  2IQ6 A;  3B3W A;  3KHZ A;  1Z2L A;  3IEH A;  4P4D A;  2BOA A;  3IWW A;  5F09 A;  5CBM A;  6CPA A;  2IMO A;  2C1C A;  3KR5 A;  3MRU A;  4MMO A;  3CDX A;  2ZEM A;  2I3C A;  3FJU A;  2IJZ A;  2ABZ A;  4UEZ A;  4NJQ A;  2ZEP A;  3JRU A;  2O4H A;  5CPA A;  1AMP A;  1BLL E;  1CP7 A;  4G1P A;  3D4U A;  2ZOF A;  2EK8 A;  2JBK A;  3NH4 A;  4GM5 A;  5THW A;  1DE4 C;  3D68 A;  4DUK A;  1TXR A;  1IY7 A;  1ELM P;  2CIJ A;  3K2K A;  3FEE A;  3PBE A;  4B6Z A;  3NA6 A;  4EME A;  2XEG A;  3DGV A;  4TWE A;  4P6Y A;  4P4F A;  5K8M A;  3WC5 A;  2O53 A;  1FT7 A;  4FAI A;  3S9M A;  2AFO A;  3FMC A;  3IJ3 A;  3ISX A;  1AYE A;  4CPA A;  2PJA A;  4F8Z A;  1TF9 A;  2PJ9 A;  3H8F A;  1M4L A;  3KR4 A;  1IGB A;  2ANP A;  4PXC A;  5K8P A;  1CPS A;  3MN8 A;  4MHY A;  2HB6 A;  1LAP A;  4OKO A;  2PJ3 A;  2QVP A;  3H8G A;  4RUH A;  5LYI A;  4P4E A;  4FUU A;  4NFR A;  4IHM A;  3KQX A;  2V8V A;  4X2T A;  3PRT A;  2PJ5 A;  4MXU A;  2CF4 A;  4IAV A;  3WC6 A;  3S9L A;  3L2N A;  4TNU A;  2PCU A;  2POK A;  4ZX8 A;  1RTQ A;  2ZEF A;  5HVG A;  3PEI A;  4NJR A;  5LRK A;  2NSM A;  3IFE A;  5IB9 A;  2XEF A;  5HVF A;  3T8W A;  2WYR A;  1TKH A;  4ZYQ A;  1YW6 A;  1HDU A;  2ZEH A;  2Q4Z A;  1HEE A;  2XEI A;  3SI1 A;  1VIX A;  4MHN A;  5JGF A;  2V8G A;  2DEA A;  5JM6 A;  1LAN A;  4FWU A;  4R8F A;  1ZG8 A;  3D66 A;  4OID A;  1XRY A;  4UEE A;  4NGN A;  3B3T A;  3KAS A;  2WZN A;  3TX8 A;  4JYW A;  2PJ7 A;  5HVH A;  4ZY2 A;  3NFZ A;  4PXD A;  4ZY1 A;  4MCP A;  1ELL P;  3GB0 A;  1LFW A;  3HLP A;  4NGT A;  3RBU A;  4A38 A;  1ZG9 A;  2PVW A;  1Z5R A;  1ZLI A;  1VHE A;  2GU2 A;  1ZG7 A;  4OC5 A;  3KI9 A;  2PRQ A;  3FVL A;  2ZEE A;  4KSI A;  2ZEL A;  5K8O A;  2CTB A;  3PB9 X;  3B3S A;  3PB8 X;  1YME A;  4EWT A;  2BCO A;  4P4I A;  2V8D A;  1F2P A;  4UIA A;  1F2O A;  1Z8L A;  4F9U A;  2GRE A;  2C6C A;  4W9Y A;  4NGS A;  5J1Q A;  1HDQ A;  2VL1 A;  4PPZ A;  2F7V A;  4Z65 A;  1PCA A;  3VAR A;  5D8N A;  4OME A;  3D7F A;  4X3R A;  3CPA A;  3HUV A;  1XFO A;  1OBR A;  1QMU A;  2ZOG A;  1R3N A;  1BPM A;  2V77 A;  4P4J A;  2AFM A;  2AFU A;  3FH4 A;  4OC3 A;  3FX6 A;  2EK9 A;  4LQG A;  4MCQ A;  3B35 A;  4PQA A;  1EE3 P;  4MHZ A;  5DS0 A;  4EFD A;  2ZEO A;  4P45 A;  4PXB A;  2RB7 A;  2FVG A;  3IIB A;  1ZLH A;  2F8H A;  3DLJ A;  3VH9 A;  3TC8 A;  3I1U A;  3SJF A;  3WAB A;  3B3C A;  2AFW A;  2ZED A;  2RFH A;  1XMB A;  3KHX A;  3NH8 A;  4UF4 A;  4WJB A;  3LMS A;  3LWU A;  5LRG A;  4WWV A;  2OR4 A;  4DYO A;  3PB7 X;  3KZW A;  2PE3 A;  5LYD A;  4UIB A;  2G9D A;  5I4M A;  2AFZ A;  4AXV A;  1LCP A;  2PVV A;  1F57 A;  3ISZ A;  4H2K A;  3SJX A;  5D29 A;  2Q51 A;  2JBJ A;  2CTC A;  1LAM A;  3H8E A;  3PB4 X;  2QYV A;  1XJO A;  2C6G A;  3PFE A;  1TF8 A;  4A94 A;  5LYF A;  8CPA A;  1YSJ A;  4R6T A;  2PJC A;  3SJE A;  3BI1 A;  4A39 A;  2NYQ A;  2ZEG A;  4NGP A;  2AFS A;  4X8I A;  3SJG A;  3D7D A;  2HC9 A;  4P4B A;  1XBU A;  3WC7 A;  1FNO A;  4OC2 A;  4P10 A;  3WT4 A;  3PBB A;  1CP6 A;  5LYL A;  1PYT B;  4IK2 A;  3GLJ A;  3QNV A;  2GLF A;  1KWM A;  4PXE A;  4JZ0 A;  4K3N A;  3SI0 A;  2OOT A;  3IC1 A;  2PIY A;  4ZY0 A;  5JH9 A;  3NH5 A;  1ARL A;  1BPN A;  4Q7A A;  3GUX A;  4YWY A;  4BD9 A;  2PJ6 A;  4OIW A;  1YW4 A;  3PB6 X;  4OC4 A;  1Y0Y A;  3B3V A;  2AFX A;  4R76 A;  1YLO A;  4FBE A;  1LOK A;  4OP4 A;  1Q7L A;  3D67 A;  4OC1 A;  1ARM A;  2PJ4 A;  4NGM A;  5ELY A;  4DJL A;  3V7Z A;  3KL9 A;  3FED A;  4O23 A;  3RZA A;  3D7H A;  3FF3 A;  5K8N A;  1DTD A;  2GLJ A;  1VGY A;  4MCS A;  3SI2 A;  2V8H A;  5LRJ A;  2ZEN A;  1VHO A;  4MHP A;  7CPA A;  1JQG A;  1R43 A;  4NGR A;  4ZX9 A;  3BI0 A;  3KQZ A;  3FEC A;  2PJ1 A;  3K9T A;  1H8L A;  1CBX A;  4ONW A;  3N5F A;  4OC0 A;  2BO9 A;  2PJB A;  2PJ0 A;  4MCR A;  3B7I A;  1QQ9 A;  1Y0R A;  4NGQ A;  3IO1 A;  2Q43 A;  3KGQ A;  3S9N A;  3CT9 A;  1TKF A;  1NSA A;  3CPX A;  4R7M A;  3D7G A;  3RAM A;  2PJ2 A;  2JEW A;  3PFO A;  2QJ8 A; 
#chains in the Genus database with same CATH topology
 2OH1 A;  1SQH A;  4MRI A;  4YFJ A;  1CPX A;  4F9V A;  2PR1 A;  5HXD A;  2Q7S A;  3JVN A;  1CJW A;  3JTK A;  1YLE A;  3V8I A;  2C27 A;  3MGD A;  1CX8 A;  3B2Y A;  1Y7E A;  3BXM A;  2EWB A;  3F0A A;  2C6P A;  3DR8 A;  2Z3N A;  4KS9 A;  4PSW A;  3V38 A;  2PJ8 A;  3CZX A;  4UEF A;  3SXN A;  2PIZ A;  3BHX A;  4R9M A;  2J9A A;  1UWY A;  4MFK A;  2A4N A;  3R9G A;  1Z4R A;  4KLV A;  1GYT A;  3H5Z A;  4AG9 A;  2XEJ A;  1QSM A;  4P44 A;  3VAT A;  3BLN A;  4E2A A;  1BAV A;  4MHD A;  4RS2 A;  2EO8 A;  1TKJ A;  3G3S A;  4YU9 A;  3VWD A;  3EC4 A;  4X5K A;  4A37 A;  1CG2 A;  4ZI6 A;  4J3G A;  2IQ6 A;  3B3W A;  4C2X A;  2JDC A;  2PSW A;  3KHZ A;  1Z2L A;  3IEH A;  3KKW A;  3VWE A;  4P4D A;  4B12 A;  1PU9 A;  1AUG A;  4ZBG A;  2BOA A;  3EY5 A;  3IWW A;  5F09 A;  4U9Z A;  4AVA A;  5CBM A;  4JJX A;  6CPA A;  1B87 A;  2IMO A;  4M85 A;  3EFA A;  4PK2 A;  2C1C A;  3KR5 A;  2B5G B;  3MRU A;  4MMO A;  3CDX A;  3CXQ A;  1MJA A;  4U9Y A;  4K30 A;  4FD4 A;  2ODF A;  2ZEM A;  4UCN A;  2I3C A;  1MJ9 A;  3FJU A;  4C2Z A;  2IJZ A;  1M4G A;  2ABZ A;  4UEZ A;  1U6M A;  4NJQ A;  4CYN A;  2ZEP A;  3JRU A;  2O4H A;  2REE A;  5CPA A;  4KOW A;  4MFP A;  1AMP A;  1BLL E;  4OAE A;  1CP7 A;  3D4U A;  4G1P A;  5G21 A;  1OZP A;  2EK8 A;  2ZOF A;  2B4D A;  1I1D A;  2G3T A;  2JBK A;  2HV2 A;  4UFX A;  3NH4 A;  4KOR A;  4GM5 A;  5AGE A;  5THW A;  1RO5 A;  3IGR A;  1DE4 C;  1QST A;  2Q4Y A;  3D68 A;  2K5T A;  4MBU A;  4CYP A;  4DUK A;  1TXR A;  1IY7 A;  1ELM P;  3ZJ0 A;  4C7H A;  4YRH A;  2CIJ A;  2G0B A;  3K2K A;  5DWN A;  1IB1 E;  3FEE A;  1XMT A;  3PBE A;  4B6Z A;  3NA6 A;  4OLL A;  4UA3 A;  4B5P A;  1J4J A;  4EME A;  2XEG A;  3DGV A;  2G3A A;  3EXN A;  1QSO A;  2VQY A;  2OZH A;  1XE4 A;  4TWE A;  2FSR A;  4MFJ A;  4P6Y A;  4PV6 A;  4P4F A;  5K8M A;  2D4P A;  4CGO A;  1S7L A;  1IOI A;  1BO4 A;  3WC5 A;  2O53 A;  1FT7 A;  3F5B A;  4LQ6 A;  4KOV A;  2P6E A;  4CGN A;  4CAW A;  4FAI A;  5DWM A;  4A32 A;  3S9M A;  2AFO A;  3S6G A;  4OAD A;  4RI1 A;  5AG7 A;  3A9L A;  3FMC A;  3IJ3 A;  3ISX A;  1AYE A;  4CPA A;  2B4D B;  2PJA A;  3I3G A;  1WWZ A;  4F8Z A;  2FIA A;  1TF9 A;  4YGO A;  1IYL A;  1FY7 A;  1MK4 A;  2PJ9 A;  3H8F A;  1JWQ A;  4R3K A;  3PP9 A;  1M1D A;  4FD6 A;  1M4L A;  2Z3P A;  1IGB A;  3D2M A;  3KR4 A;  4M6I A;  1NE9 A;  2GAN A;  2ANP A;  4PXC A;  5K8P A;  1NMT A;  4MFZ A;  3W91 A;  5I0C A;  5A27 A;  2AJ6 A;  1CPS A;  3MN8 A;  4B11 A;  2F5I A;  4CRY B;  3TE4 A;  4MHY A;  2OZU A;  2HB6 A;  1LAP A;  4OKO A;  3TFY A;  2PJ3 A;  2QVP A;  2KCW A;  3GYA A;  2NMT A;  3H8G A;  4RUH A;  4FBE A;  4PSX A;  5LYI A;  4P4E A;  4FUU A;  4JLY A;  2YNC C;  1V0C A;  2FIW A;  4NFR A;  4IHM A;  2DXQ A;  2X7B A;  4E8O A;  3KQX A;  2V8V A;  4X2T A;  2FXF A;  3PRT A;  2PJ5 A;  2WUU A;  4MXU A;  2REF A;  2YGW A;  2CF4 A;  4IAV A;  2VXK A;  1M4D A;  3WC6 A;  2ZW6 A;  3S9L A;  3R96 A;  3L2N A;  4TNU A;  2PCU A;  2POK A;  5IV0 A;  4ZX8 A;  1RTQ A;  2P0W A;  1A2Z A;  2ZW4 A;  3JUW A;  2I00 A;  2ZEF A;  3DSB A;  2B58 A;  1L0C A;  3PEI A;  1Z9U A;  5HVG A;  4JD6 A;  4NJR A;  4B5O A;  3BJ8 A;  5LRK A;  2NSM A;  4H6U A;  3IFE A;  1XEB A;  4FD5 A;  1KUY A;  5IB9 A;  5GCN A;  2XEF A;  5HVF A;  4UWJ A;  4ORF A;  3S6F A;  3T8W A;  2QIR A;  2WYR A;  4R87 A;  3SHP A;  4KSF A;  1TKH A;  4ZYQ A;  3G8W A;  1YW6 A;  1HDU A;  5J8F A;  4XPL A;  4NXY A;  2ZEH A;  4R3L A;  4BBH A;  2Q4Z A;  1HEE A;  2XEI A;  3TCV A;  3SI1 A;  1VIX A;  4MHN A;  4RN7 A;  3IU2 A;  5JGF A;  2V8G A;  2DEA A;  5KTA A;  4CYQ A;  5JM6 A;  1LAN A;  2CNM A;  4ONU A;  2ZW5 A;  3H4Q A;  5G22 A;  5IX3 A;  4FWU A;  4R8F A;  1ZG8 A;  4GS4 A;  3D66 A;  3PZJ A;  4OID A;  1XRY A;  5ISV A;  4UEE A;  4NGN A;  3B3T A;  5E96 A;  3KAS A;  2GIV A;  2QEC A;  1B6B A;  2WZN A;  4HNW B;  4JYW A;  3TX8 A;  2PJ7 A;  5HVH A;  3N7Z A;  4ZY2 A;  4AG7 A;  3TOA A;  2R7H A;  3R1K A;  2JLM A;  3NFZ A;  4PXD A;  4QVT A;  3LD2 A;  4ZY1 A;  4KOY A;  1YX0 A;  4MCP A;  1ELL P;  2QML A;  1ZO0 A;  3TOB A;  2Q04 A;  3GB0 A;  1LFW A;  3HLP A;  1M44 A;  4NGT A;  3S6K A;  1S3Z A;  3RBU A;  4A38 A;  1Z4E A;  1ZG9 A;  2PVW A;  1Z5R A;  2YNC A;  3DDD A;  1ZLI A;  5F49 A;  1VHE A;  2GU2 A;  1ZG7 A;  4OC5 A;  3IWE A;  3KI9 A;  5KTC A;  2AE6 A;  2PRQ A;  2VZZ A;  3RYO A;  3FVL A;  4CGP A;  2ZEE A;  1YVO A;  4KSI A;  4CAX A;  3NE8 A;  2ZEL A;  3DR6 A;  2ARH A;  5K8O A;  2CTB A;  3SXO A;  3PB9 X;  2ZPA A;  4KVO E;  3B3S A;  3PB8 X;  4PK3 A;  5AG5 A;  1YME A;  4EWT A;  4A33 A;  2BCO A;  2FCK A;  4NCZ A;  3QB8 A;  4UFW A;  4P4I A;  2V8D A;  1F2P A;  4CGM A;  2I79 A;  3QAH A;  4UIA A;  1F2O A;  4JXQ A;  3TT2 A;  1Z8L A;  3LAC A;  2YNE A;  1X12 A;  2Q0Y A;  4F9U A;  4A31 A;  2GRE A;  2C6C A;  2CNS A;  4W9Y A;  3IU1 A;  4NGS A;  2GFQ A;  4R57 A;  3S6H A;  1HDQ A;  2VL1 A;  4PPZ A;  2F7V A;  5J1Q A;  4Z65 A;  1PCA A;  3VAR A;  2H5M A;  2WPX A;  4UCP A;  5HH1 A;  4CAE A;  5C88 A;  5D8N A;  4OME A;  1VKC A;  3D7F A;  4X3R A;  1KUX A;  2EBJ A;  2GE3 A;  5F46 A;  3CPA A;  3HUV A;  4II9 A;  3R9E A;  1IU8 A;  1S7F A;  1XFO A;  1OBR A;  1QMU A;  4XPD C;  2ZOG A;  3TO6 A;  4UWI A;  4LX9 A;  2B3V A;  1XOV A;  1X10 A;  1R3N A;  3B8G A;  3BJ7 A;  1BPM A;  2Z11 A;  4NSQ A;  4HNY B;  4UCM A;  2V77 A;  5C82 A;  5EMI A;  4KSA A;  4B5P B;  4GXH A;  2Y0M A;  4P4J A;  2R98 A;  2VBQ A;  3FNC A;  1UFH A;  2AFM A;  4MFQ A;  4KOS A;  2AFU A;  4XNH B;  1TIQ A;  1Z8W A;  3FH4 A;  4OC3 A;  4MJ8 A;  2WSA A;  4KUB A;  3FX6 A;  2EK9 A;  4LQG A;  4MCQ A;  3B35 A;  3GIU A;  4PQA A;  3FB3 A;  1EE3 P;  4MHZ A;  5DS0 A;  5JPH A;  4EFD A;  2ZEO A;  1IOF A;  4KUA A;  4P45 A;  3TTH A;  4PXB A;  2JEV A;  2RB7 A;  2FVG A;  4QC6 A;  3IIB A;  1ZLH A;  5H86 A;  2F8H A;  1Y9W A;  3DLJ A;  4M6H A;  5EBV A;  3T90 A;  4B10 A;  3TO9 A;  3VH9 A;  5G1Z A;  2B3U A;  3TC8 A;  2OU2 A;  4U5Y A;  3RO0 A;  4DJL A;  3I1U A;  3SJF A;  3WAB A;  3B3C A;  2AFW A;  1BOB A;  2ZED A;  2RFH A;  1XMB A;  3FBU A;  2PDO A;  4XNH C;  4CGL A;  3KHX A;  3NH8 A;  5G20 A;  4UF4 A;  4WJB A;  4L8A A;  3RNZ A;  4CAV A;  4AVC A;  3FXT A;  3LMS A;  4KVM E;  3W6X A;  3LWU A;  4H6Z A;  4NEX A;  4UFV A;  5LRG A;  4WWV A;  1YK3 A;  2OR4 A;  5EC4 A;  1YVK A;  2B4B A;  2J8M A;  3PB7 X;  4DYO A;  3KZW A;  2PE3 A;  3E0K A;  5LYD A;  3PGP A;  1M4I A;  4Y49 C;  4CYO A;  4UIB A;  2G9D A;  5I4M A;  2AFZ A;  2HQY A;  4AXV A;  1LCP A;  2PVV A;  1F57 A;  3ISZ A;  4H2K A;  1Q2Y A;  3SJX A;  5D29 A;  2Q51 A;  2JBJ A;  2CTC A;  1LAM A;  3FYN A;  3W6S A;  2PR8 A;  3H8E A;  3PB4 X;  1MJB A;  5IB0 A;  2QYV A;  2B5G A;  1IIC A;  1XJO A;  2C6G A;  3PFE A;  1TF8 A;  2EUI A;  4IUS A;  4KVX A;  1NSL A;  3T9Y A;  3C26 A;  4A94 A;  4F0Y A;  4E0A A;  5LYF A;  2R8V A;  8CPA A;  1YSJ A;  2ZXV A;  2P6F A;  4R6T A;  3FIX A;  5FVJ A;  4LUA A;  2OZG A;  3GY9 A;  2EVN A;  1K4J A;  1XIX A;  1KUV A;  2PJC A;  2Z3O A;  3SJE A;  2DF5 A;  4KZT A;  5BWA B;  3BI1 A;  4A39 A;  2NYQ A;  4AVB A;  4BIN A;  5J8C A;  2ZEG A;  3IWG A;  4NGP A;  2AFS A;  2Z0Z A;  4X8I A;  2YND A;  3SJG A;  4CAF A;  1YR0 A;  3D7D A;  3CXS A;  2HC9 A;  2CY2 A;  4P4B A;  1XBU A;  2FT0 A;  4C7I A;  4A95 A;  1KZF A;  3WC7 A;  2WPW A;  1FNO A;  2BSW A;  2R1I A;  4OC2 A;  4P10 A;  1XF8 A;  1VHS A;  3WT4 A;  3PBB A;  1CP6 A;  3P2F A;  4XPD B;  1P4N A;  4A2Z A;  5LYL A;  1PYT B;  2DPS A;  4IK2 A;  3GLJ A;  3QNV A;  2Q7B A;  2PC1 A;  2GLF A;  1KWM A;  4PXE A;  1IYK A;  4JZ0 A;  2BL1 A;  4K3N A;  4HNX B;  3SI0 A;  2OOT A;  4DNC A;  2VEZ A;  3IC1 A;  3R9F A;  1YRE A;  5F48 A;  4I49 A;  2PIY A;  4F0X A;  4KOU A;  4ZY0 A;  3LOD A;  4A30 A;  5JH9 A;  2BEI A;  3NH5 A;  4H89 A;  4QB9 A;  1S60 A;  1ARL A;  4CS0 B;  2FE7 A;  1YQE A;  3ZZI A;  3K9U A;  1BPN A;  4HKF A;  4Q7A A;  2BUE A;  4KLW A;  3GUX A;  5CNP A;  1LRZ A;  1IID A;  2Z3M A;  4YWY A;  3QAY A;  4BD9 A;  4EVY A;  4ZGY B;  2PJ6 A;  1QSR A;  4OIW A;  3OWC A;  1YW4 A;  1PUA A;  3PB6 X;  1Z8T A;  4AB7 A;  1Y7R A;  2IL4 A;  4OC4 A;  3UY5 A;  5KTD A;  1Y0Y A;  3B3V A;  4MI4 A;  5AG6 A;  5JQ4 A;  1I12 A;  4Q38 A;  2AFX A;  2HUZ A;  1Q2C A;  4R76 A;  1YLO A;  2CXA A;  5HMN A;  1I21 A;  1P0H A;  2VI7 A;  2Q44 A;  4JWP A;  1LOK A;  2P6G A;  1Q7L A;  4M6G A;  3D67 A;  2ZW7 A;  4OP4 A;  1ARM A;  2PJ4 A;  4M3S A;  4NGM A;  4OC1 A;  3NE7 A;  5ELY A;  3V7Z A;  2Q4V A;  4F6A A;  4MFL A;  3FRM A;  4QBJ A;  4C2Y A;  4NF1 A;  3TO7 A;  3KL9 A;  1GHE A;  2Z10 A;  3FED A;  4O23 A;  3RZA A;  4UBR A;  3D7H A;  3FF3 A;  4MY3 A;  5K8N A;  1DTD A;  2GLJ A;  4C68 A;  2PQ8 A;  1VGY A;  5A28 A;  4HPS A;  4JXR A;  4BMH A;  4MCS A;  2Z3L A;  3SI2 A;  2J8R A;  2Z3K A;  2V8H A;  2O28 A;  4KOX A;  2FS5 A;  5LRJ A;  4CRZ B;  4XPK A;  2ZEN A;  1VHO A;  2JDD A;  4Y49 B;  4MHP A;  4MY0 A;  7CPA A;  3D3S A;  2DPT A;  2CNT A;  2OB0 A;  2D4O A;  4B13 A;  1JQG A;  2PRB A;  1R43 A;  4NGR A;  5F47 A;  4ZX9 A;  1S7N A;  3BI0 A;  3KQZ A;  1R57 A;  3FEC A;  2PJ1 A;  1Z8X A;  3D8P A;  3P2H A;  1WK4 A;  3K9T A;  3F8K A;  1H8L A;  1CBX A;  4ONW A;  3N5F A;  4OC0 A;  1S7K A;  2BO9 A;  2PJB A;  3EO4 A;  2PJ0 A;  3DNS A;  2ATR A;  4Q36 A;  4MCR A;  3B7I A;  1S5K A;  1CM0 A;  3GKR A;  3R95 A;  4QUS A;  3WR7 A;  1QQ9 A;  4IF5 A;  3D2P A;  2RC4 A;  2J8N A;  5H84 A;  1Y0R A;  3I9S A;  4NGQ A;  2VZY A;  1YGH A;  1Q2D A;  3IO1 A;  2Q43 A;  2FL4 A;  3KGQ A;  3S9N A;  3CT9 A;  4L89 A;  1Y9K A;  1RXT A;  1TKF A;  1NSA A;  4KOT A;  5AG4 A;  3CPX A;  4R7M A;  1N71 A;  1ON0 A;  3CXP A;  3D7G A;  3RAM A;  2PJ2 A;  1QSN A;  4FD7 A;  2JEW A;  3PFO A;  2QJ8 A;  4B14 A; 
#chains in the Genus database with same CATH homology
 4MRI A;  1CPX A;  4F9V A;  5HXD A;  1CX8 A;  3B2Y A;  1Y7E A;  3BXM A;  2EWB A;  2C6P A;  3V38 A;  2PJ8 A;  4UEF A;  2PIZ A;  3BHX A;  2J9A A;  1UWY A;  1GYT A;  2XEJ A;  4P44 A;  3VAT A;  1BAV A;  1TKJ A;  4A37 A;  4YU9 A;  4ZI6 A;  1CG2 A;  2IQ6 A;  3B3W A;  3KHZ A;  1Z2L A;  3IEH A;  4P4D A;  2BOA A;  3IWW A;  5F09 A;  5CBM A;  6CPA A;  2IMO A;  2C1C A;  3KR5 A;  3MRU A;  4MMO A;  3CDX A;  2ZEM A;  2I3C A;  3FJU A;  2IJZ A;  2ABZ A;  4UEZ A;  4NJQ A;  2ZEP A;  3JRU A;  2O4H A;  5CPA A;  1AMP A;  1BLL E;  1CP7 A;  4G1P A;  3D4U A;  2ZOF A;  2EK8 A;  2JBK A;  3NH4 A;  4GM5 A;  5THW A;  1DE4 C;  3D68 A;  4DUK A;  1TXR A;  1IY7 A;  1ELM P;  2CIJ A;  3K2K A;  3FEE A;  3PBE A;  4B6Z A;  3NA6 A;  4EME A;  2XEG A;  3DGV A;  4TWE A;  4P6Y A;  4P4F A;  5K8M A;  3WC5 A;  2O53 A;  1FT7 A;  4FAI A;  3S9M A;  2AFO A;  3FMC A;  3IJ3 A;  3ISX A;  1AYE A;  4CPA A;  2PJA A;  4F8Z A;  1TF9 A;  2PJ9 A;  3H8F A;  1M4L A;  3KR4 A;  1IGB A;  2ANP A;  4PXC A;  5K8P A;  1CPS A;  3MN8 A;  4MHY A;  2HB6 A;  1LAP A;  4OKO A;  2PJ3 A;  2QVP A;  3H8G A;  4RUH A;  5LYI A;  4P4E A;  4FUU A;  4NFR A;  4IHM A;  3KQX A;  2V8V A;  4X2T A;  3PRT A;  2PJ5 A;  4MXU A;  2CF4 A;  4IAV A;  3WC6 A;  3S9L A;  3L2N A;  4TNU A;  2PCU A;  2POK A;  4ZX8 A;  1RTQ A;  2ZEF A;  5HVG A;  3PEI A;  4NJR A;  5LRK A;  2NSM A;  3IFE A;  5IB9 A;  2XEF A;  5HVF A;  3T8W A;  2WYR A;  1TKH A;  4ZYQ A;  1YW6 A;  1HDU A;  2ZEH A;  2Q4Z A;  1HEE A;  2XEI A;  3SI1 A;  1VIX A;  4MHN A;  5JGF A;  2V8G A;  2DEA A;  5JM6 A;  1LAN A;  4FWU A;  4R8F A;  1ZG8 A;  3D66 A;  4OID A;  1XRY A;  4UEE A;  4NGN A;  3B3T A;  3KAS A;  2WZN A;  3TX8 A;  4JYW A;  2PJ7 A;  5HVH A;  4ZY2 A;  3NFZ A;  4PXD A;  4ZY1 A;  4MCP A;  1ELL P;  3GB0 A;  1LFW A;  3HLP A;  4NGT A;  3RBU A;  4A38 A;  1ZG9 A;  2PVW A;  1Z5R A;  1ZLI A;  1VHE A;  2GU2 A;  1ZG7 A;  4OC5 A;  3KI9 A;  2PRQ A;  3FVL A;  2ZEE A;  4KSI A;  2ZEL A;  5K8O A;  2CTB A;  3PB9 X;  3B3S A;  3PB8 X;  1YME A;  4EWT A;  2BCO A;  4P4I A;  2V8D A;  1F2P A;  4UIA A;  1F2O A;  1Z8L A;  4F9U A;  2GRE A;  2C6C A;  4W9Y A;  4NGS A;  5J1Q A;  1HDQ A;  2VL1 A;  4PPZ A;  2F7V A;  4Z65 A;  1PCA A;  3VAR A;  5D8N A;  4OME A;  3D7F A;  4X3R A;  3CPA A;  3HUV A;  1XFO A;  1OBR A;  1QMU A;  2ZOG A;  1R3N A;  1BPM A;  2V77 A;  4P4J A;  2AFM A;  2AFU A;  3FH4 A;  4OC3 A;  3FX6 A;  2EK9 A;  4LQG A;  4MCQ A;  3B35 A;  4PQA A;  1EE3 P;  4MHZ A;  5DS0 A;  4EFD A;  2ZEO A;  4P45 A;  4PXB A;  2RB7 A;  2FVG A;  3IIB A;  1ZLH A;  2F8H A;  3DLJ A;  3VH9 A;  3TC8 A;  3I1U A;  3SJF A;  3WAB A;  3B3C A;  2AFW A;  2ZED A;  2RFH A;  1XMB A;  3KHX A;  3NH8 A;  4UF4 A;  4WJB A;  3LMS A;  3LWU A;  5LRG A;  4WWV A;  2OR4 A;  4DYO A;  3PB7 X;  3KZW A;  2PE3 A;  5LYD A;  4UIB A;  2G9D A;  5I4M A;  2AFZ A;  4AXV A;  1LCP A;  2PVV A;  1F57 A;  3ISZ A;  4H2K A;  3SJX A;  5D29 A;  2Q51 A;  2JBJ A;  2CTC A;  1LAM A;  3H8E A;  3PB4 X;  2QYV A;  1XJO A;  2C6G A;  3PFE A;  1TF8 A;  4A94 A;  5LYF A;  8CPA A;  1YSJ A;  4R6T A;  2PJC A;  3SJE A;  3BI1 A;  4A39 A;  2NYQ A;  2ZEG A;  4NGP A;  2AFS A;  4X8I A;  3SJG A;  3D7D A;  2HC9 A;  4P4B A;  1XBU A;  3WC7 A;  1FNO A;  4OC2 A;  4P10 A;  3WT4 A;  3PBB A;  1CP6 A;  5LYL A;  1PYT B;  4IK2 A;  3GLJ A;  3QNV A;  2GLF A;  1KWM A;  4PXE A;  4JZ0 A;  4K3N A;  3SI0 A;  2OOT A;  3IC1 A;  2PIY A;  4ZY0 A;  5JH9 A;  3NH5 A;  1ARL A;  1BPN A;  4Q7A A;  3GUX A;  4YWY A;  4BD9 A;  2PJ6 A;  4OIW A;  1YW4 A;  3PB6 X;  4OC4 A;  1Y0Y A;  3B3V A;  2AFX A;  4R76 A;  1YLO A;  4FBE A;  1LOK A;  4OP4 A;  1Q7L A;  3D67 A;  4OC1 A;  1ARM A;  2PJ4 A;  4NGM A;  5ELY A;  4DJL A;  3V7Z A;  3KL9 A;  3FED A;  4O23 A;  3RZA A;  3D7H A;  3FF3 A;  5K8N A;  1DTD A;  2GLJ A;  1VGY A;  4MCS A;  3SI2 A;  2V8H A;  5LRJ A;  2ZEN A;  1VHO A;  4MHP A;  7CPA A;  1JQG A;  1R43 A;  4NGR A;  4ZX9 A;  3BI0 A;  3KQZ A;  3FEC A;  2PJ1 A;  3K9T A;  1H8L A;  1CBX A;  4ONW A;  3N5F A;  4OC0 A;  2BO9 A;  2PJB A;  2PJ0 A;  4MCR A;  3B7I A;  1QQ9 A;  1Y0R A;  4NGQ A;  3IO1 A;  2Q43 A;  3KGQ A;  3S9N A;  3CT9 A;  1TKF A;  1NSA A;  3CPX A;  4R7M A;  3D7G A;  3RAM A;  2PJ2 A;  2JEW A;  3PFO A;  2QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...