5AG6A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
402
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
total genus 120
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag6A00
4C2ZA 4A95A 4CGPA 3IWEA 4CYPA 5AG4A 4C2XA 4A30A 2YNCA 4UCMA 4BBHA 4C7IA 4CYNA 3JTKA 4CGOA 4A32A 4B11A 2WUUA 3IU2A 5AG5A 4B12A 4UCNA 4UFXA 4A31A 4UCPA 5AG7A 5G20A 4C2YA 4C68A 4CGMA 2YNEA 5G21A 5AGEA 4CAEA 4A33A 4CAFA 4CGNA 4C7HA 5G1ZA 5A28A 4UFWA 5A27A 2YNCC 4B10A 4B13A 3IU1A 2YNDA 4A2ZA 4B14A 4UFVA 4CYOA 4CGLA 3H5ZA 5AG6A 2WSAA 5G22A 4CYQA
chains in the Genus database with same CATH superfamily
3QB8A 2RC4A 2PJAA 2BL1A 1MJBA 2PIYA 4UCMA 2FSRA 4BD9A 5JPHA 1Y9WA 4MJ8A 2IQ6A 5LRJA 4WWVA 1Q2CA 4E0AA 4KORA 4UWJA 4XNHB 1S7KA 3KL9A 5JQ4A 4R3KA 2B5GB 4IAVA 3KHZA 3TCVA 4AG9A 5THWA 1XBUA 2Q04A 1Y7EA 5DS0A 4MMOA 4C7HA 3I9SA 2PJ8A 3R9EA 2YNCC 4X3RA 4FBEA 5HMNA 1IIDA 3PBEA 4MY3A 2BEIA 1XRYA 5J8FA 4BBHA 2EK8A 5F46A 5C82A 3F0AA 4KOUA 4H89A 3DR6A 3TOAA 1PU9A 2YNCA 1AMPA 4X5KA 1VKCA 3IEHA 2IMOA 2JBKA 3H8FA 3B3TA 4UIBA 3SI0A 4M6IA 4O23A 3B8GA 1CBXA 1ZG8A 2VL1A 3CXPA 4F0YA 1F2PA 2PR8A 4A39A 1HEEA 5E96A 2GLJA 1YGHA 4LQ6A 4IHMA 4JD6A 4P4IA 2HC9A 2EVNA 5IV0A 4JZ0A 1HDUA 2RFHA 4CS0B 1VHSA 5G21A 4GM5A 3FECA 1NE9A 1QMUA 4ZI6A 1IU8A 5G1ZA 1PUAA 2IL4A 2VXKA 2AFWA 1KZFA 1Z4EA 2XEFA 4OADA 4FD4A 3FNCA 4A2ZA 3WR7A 2CIJA 4KOXA 5HH1A 3UY5A 4H6UA 4B12A 3BJ7A 3IO1A 3K2KA 5JH9A 4ZY0A 3GYAA 1XEBA 3GIUA 4HKFA 4ONWA 4XPLA 2F8HA 5LYIA 1Z8TA 3HLPA 1Z8WA 4NGSA 3PB9X 4CYNA 3QAHA 4Q38A 2ZEPA 3W6XA 3FB3A 2GE3A 3WC5A 5EC4A 1ZLIA 3IFEA 3K9UA 4UCPA 3S6GA 3D8PA 1N71A 1BOBA 3R95A 1RTQA 2B3VA 1TF9A 5JGFA 4A94A 1ARMA 2CNMA 1M4GA 4YRHA 4CAWA 1S3ZA 2HB6A 3CDXA 1I12A 1QSMA 1CPXA 2V8VA 2Q4VA 2K5TA 3C26A 2ZOGA 2V8HA 1TF8A 4PXCA 4U9YA 4P4BA 2KCWA 4KVME 5H84A 2R1IA 4P4EA 3R9GA 2WYRA 4KUAA 3SJFA 4XNHC 3PFEA 4W9YA 2Q0YA 2FCKA 4HNWB 3SJGA 4CRZB 3KGQA 3EFAA 4RS2A 3SJXA 1GYTA 3ISXA 3IJ3A 4GXHA 4MCPA 1TKJA 4LQGA 2B3UA 5G20A 1S60A 2FIAA 3LMSA 2WPXA 3QAYA 2FT0A 5DWNA 4A33A 1YLOA 1Y0YA 2QECA 3PB7X 4F8ZA 5F49A 1F57A 1FY7A 2FS5A 3GLJA 3S9NA 5IB9A 4WJBA 4CGLA 2JEVA 3FF3A 4I49A 1YW4A 1CP6A 4KSFA 4PXBA 2GREA 4CYQA 2V8GA 2ZEEA 4MI4A 4ZX9A 4Z65A 2DEAA 2R98A 3NH4A 2Q44A 1OZPA 2ODFA 1LAMA 1HDQA 4YFJA 3LACA 3BLNA 2AFXA 1YK3A 5D29A 4CGOA 2PVVA 2REEA 3IIBA 5ISVA 4LUAA 2PSWA 3FVLA 1VHEA 2P6EA 4F9VA 3RNZA 1KUYA 2PDOA 3A9LA 4PK3A 1NSLA 1ZG7A 2I79A 3KQXA 2ANPA 1VIXA 4KOVA 2GANA 4MFZA 1AYEA 4NGRA 3H4QA 3V38A 1GHEA 2CTBA 4K3NA 3MGDA 5K8OA 3BHXA 3SI1A 1EE3P 1YVOA 2FVGA 2F5IA 1H8LA 1M44A 2ZXVA 2V8DA 3FIXA 2JEWA 7CPAA 3NH8A 3JVNA 3NA6A 3TTHA 3T8WA 1L0CA 2OR4A 3MN8A 3EY5A 4IK2A 3BI0A 3I1UA 4RI1A 1S5KA 1FNOA 4NJRA 2AFMA 2C1CA 1IOIA 1YX0A 4OKOA 4OP4A 3DDDA 4H6ZA 4EFDA 3D67A 5IB0A 3WC7A 2GLFA 2ZW7A 4CAVA 1M1DA 4MHZA 3FXTA 3D2MA 4E2AA 2F7VA 5F47A 1AUGA 1XIXA 4OC2A 2C6PA 2D4OA 1ON0A 2WPWA 3PB6X 4A37A 3G8WA 5K8NA 2ZEHA 4EVYA 4OAEA 3D4UA 2CNSA 2YNDA 4MFJA 3S6KA 3D66A 3CT9A 2POKA 3GY9A 4ZGYB 1I21A 1S7LA 2P6FA 4R3LA 5G22A 2XEGA 2EUIA 4UIAA 4II9A 2C6CA 4TNUA 4CGPA 4KS9A 1Q2YA 2PVWA 2ABZA 4FWUA 4BMHA 4OMEA 1X12A 3EXNA 2B4BA 4QC6A 2X7BA 4MHNA 1M4IA 1RO5A 1Z5RA 2Q4ZA 2HUZA 4UCNA 3G3SA 4PQAA 4R7MA 4CRYB 4DYOA 2J8RA 5J8CA 3TE4A 3BJ8A 4KVXA 1Y7RA 3FRMA 4R76A 5D8NA 2VBQA 1P4NA 3K9TA 4OC3A 3ZJ0A 3GB0A 5AGEA 1S7NA 4PSWA 2FE7A 4FUUA 2G3AA 2Z3OA 3DNSA 4U9ZA 1QSNA 2XEIA 2AE6A 4B14A 3WC6A 2Z3MA 4CYOA 3I3GA 4Y49C 2Z3KA 1BPNA 2B58A 4FAIA 3TC8A 3FEEA 3FH4A 2D4PA 2PJ3A 2GU2A 4B6ZA 4NGTA 2Z10A 4R9MA 4C7IA 3KHXA 2R7HA 3KR4A 5ELYA 4ZBGA 4AVBA 1TIQA 1YLEA 3TO6A 4BINA 3H8GA 3PGPA 4P4DA 3ZZIA 4KSAA 3TT2A 4ORFA 3SI2A 4C68A 4PSXA 4UBRA 3IC1A 3NE7A 5KTDA 3B35A 2PJ7A 5K8PA 3TX8A 3PB4X 2PC1A 5A28A 2HQYA 2WZNA 2CY2A 3R1KA 4J3GA 4UWIA 2EK9A 1R43A 1P0HA 5LRGA 5DWMA 2BUEA 2OB0A 3RO0A 1LFWA 4E8OA 1JWQA 1KWMA 2FIWA 1DTDA 1IYLA 3TO7A 4C2ZA 3N5FA 2HV2A 4C2XA 1B6BA 1DE4C 4EMEA 3GUXA 4X8IA 4MY0A 3D3SA 3R96A 2QYVA 2ZW5A 3JUWA 1ZLHA 3NFZA 4KOSA 2ZW4A 4MFKA 2ZEDA 2ZEOA 4U5YA 2ZEFA 3CZXA 1F2OA 3BI1A 4NGNA 1YQEA 4HNYB 4QB9A 4X2TA 4KUBA 1MK4A 1QQ9A 3CPXA 4L89A 2PJBA 2G0BA 5IX3A 3D7HA 4CGNA 2ARHA 3DSBA 1IICA 4JXQA 4PPZA 2ATRA 1ZG9A 4KLVA 4MCQA 4UFVA 4L8AA 1CP7A 1Z8XA 3P2FA 1CG2A 2PJ5A 5AG6A 2Q4YA 1BPMA 2IJZA 4AVCA 2Q43A 3B3WA 4PXEA 2RB7A 3IWEA 4CYPA 3D68A 2CXAA 3R9FA 3D7GA 3PEIA 3LWUA 4Y49B 2JDCA 3WABA 1CJWA 3W6SA 1WWZA 4A32A 4RUHA 2PJ0A 4ZYQA 1SQHA 1Z2LA 5CPAA 4YU9A 2OU2A 3PRTA 4Q7AA 4F6AA 3TOBA 4PXDA 1IY7A 2NYQA 5I4MA 4C2YA 2XEJA 5HVFA 1YSJA 5LYDA 3VATA 2G3TA 5LRKA 1U6MA 2BOAA 2PJ9A 3IWWA 2AFOA 5LYLA 3KQZA 4JLYA 2QJ8A 1UWYA 4AB7A 2Z3NA 3EO4A 4NGMA 2PJ1A 1TKHA 2G9DA 4MFLA 4A38A 2Z11A 2GFQA 2O53A 1Z4RA 4GS4A 3RYOA 2DPSA 2J9AA 1XFOA 4FD7A 4A30A 2FXFA 1OBRA 2Q7SA 4FD6A 8CPAA 2O4HA 1QSRA 4NFRA 4JYWA 3S6FA 3IWGA 4HNXB 1XMBA 1K4JA 2J8NA 2VEZA 1R57A 1QSOA 4R8FA 1LAPA 4UFXA 3DLJA 2OZHA 1ARLA 2DPTA 3NE8A 1A2ZA 2PCUA 4CAFA 1Z9UA 3PFOA 2QVPA 2OH1A 2PR1A 2PRQA 5J1QA 2C6GA 2QMLA 1WK4A 1NMTA 3SXOA 2PJ2A 4RN7A 1M4DA 2A4NA 2PJCA 3CXSA 4NF1A 2OOTA 1YREA 2R8VA 4K30A 3S6HA 4OC5A 1YW6A 4MXUA 4IUSA 2JDDA 5H86A 4UF4A 2PJ6A 3VH9A 4A95A 1CX8A 2REFA 4B5OA 1LCPA 2OZUA 2VI7A 3H8EA 3SHPA 3DGVA 4HPSA 1XMTA 2ZENA 3EC4A 3JTKA 5HXDA 2WUUA 3PB8X 4OIWA 3RZAA 4TWEA 2B4DA 5AG5A 2PRBA 4YGOA 2I3CA 4CAXA 2ZPAA 4R87A 4B5PA 1MJAA 5EMIA 4G1PA 4KSIA 4M85A 3B3SA 3VWDA 3OWCA 2EO8A 4JWPA 1TXRA 4UFWA 4UEZA 1ELMP 5A27A 2DXQA 1M4LA 3FX6A 1LANA 3CXQA 5GCNA 2VQYA 3IGRA 4ZX8A 2DF5A 4QVTA 2BSWA 5HVGA 2P0WA 3CPAA 2VZZA 4NCZA 1QSTA 3FYNA 4M6GA 2OZGA 3D7FA 3P2HA 3DR8A 3FMCA 4EWTA 3NH5A 4KOTA 2NSMA 1YR0A 2YGWA 4PV6A 3TFYA 3VWEA 3KZWA 3LODA 4NGQA 1ELLP 1V0CA 3D7DA 4QUSA 4MFQA 6CPAA 4IF5A 5KTAA 5KTCA 2Z3PA 4R6TA 4UEFA 3KI9A 3VARA 1YMEA 3D2PA 3F8KA 2CNTA 2GIVA 2I00A 1IOFA 2ZEGA 2J8MA 1XF8A 4B10A 4B13A 4KOYA 4UA3A 4F9UA 5LYFA 4AG7A 2H5MA 2WSAA 4OLLA 5AG4A 3V8IA 2VZYA 5CBMA 2BCOA 1RXTA 4MHPA 3RBUA 4ONUA 4OIDA 3FJUA 5HVHA 1I1DA 4XPDC 1LOKA 1BO4A 3B3VA 4JXRA 1MJ9A 1KUXA 4AVAA 3FBUA 2PJ4A 4M6HA 4F0XA 4M3SA 4B11A 5K8MA 4NJQA 2ZOFA 4AXVA 2B4DB 1S7FA 2PQ8A 2JLMA 4A31A 4DNCA 5AG7A 4B5PB 4NGPA 3KASA 4NXYA 1XOVA 2YNEA 4ZY2A 3LD2A 3B2YA 3L2NA 5JM6A 2EBJA 4CAEA 4P4FA 1ZO0A 2BO9A 2CTCA 3KKWA 4Q36A 1R3NA 5F09A 2AJ6A 2Z0ZA 3S9MA 3HUVA 2AFUA 1Y0RA 1Z8LA 2P6GA 4H2KA 2ZW6A 4OC4A 5C88A 2O28A 2Q7BA 1JQGA 4PK2A 1IYKA 3WT4A 4QBJA 3PZJA 3TO9A 3KR5A 4LX9A 3MRUA 4MCSA 4NSQA 1LRZA 2JBJA 4KOWA 2Z3LA 4MFPA 1J4JA 3ISZA 2C27A 4UEEA 2CF4A 4CGMA 4P6YA 4JJXA 3B7IA 4KZTA 2B5GA 2NMTA 4OC1A 3V7ZA 4P45A 5BWAB 1BAVA 5I0CA 4YWYA 1NSAA 4P4JA 4MBUA 3B3CA 5FVJA 2PIZA 3IU1A 4CPAA 5EBVA 3FEDA 3H5ZA 1IB1E 4XPKA 1UFHA 1YVKA 1CPSA 4OC0A 4NEXA 3W91A 1CM0A 1VGYA 2ZELA 4MCRA 1VHOA 3GKRA 3SXNA 3JRUA 3S9LA 4MRIA 1PCAA 4FD5A 1FT7A 1X10A 4P44A 4DUKA 1Y9KA 1Q7LA 3RAMA 1TKFA 3IU2A 5F48A 3F5BA 4P10A 3PP9A 1Q2DA 4MHDA 4XPDB 2EWBA 1XJOA 3PBBA 3SJEA 4MHYA 1PYTB 4KLWA 2PE3A 2Q51A 5CNPA 4ZY1A 1B87A 1BLLE 4DJLA 1IGBA 1XE4A 2QIRA 4R57A 2AFSA 3T9YA 3BXMA 2V77A 4KVOE 2Y0MA 2FL4A 3E0KA 3N7ZA 2ZEMA 1KUVA 3T90A 3QNVA 2AFZA
chains in the Genus database with same CATH topology
3QB8A 2RC4A 2BL1A 1MJBA 4UCMA 2FSRA 5JPHA 1Y9WA 4MJ8A 1Q2CA 4E0AA 4KORA 4UWJA 4XNHB 1S7KA 5JQ4A 4R3KA 2B5GB 3TCVA 4AG9A 2Q04A 4C7HA 3I9SA 3R9EA 2YNCC 5HMNA 1IIDA 4MY3A 2BEIA 5J8FA 4BBHA 5F46A 5C82A 3F0AA 4KOUA 4H89A 3DR6A 3TOAA 1PU9A 2YNCA 4X5KA 1VKCA 3B8GA 3CXPA 4F0YA 2PR8A 5E96A 1YGHA 4JD6A 2EVNA 5IV0A 4CS0B 1VHSA 5G21A 1NE9A 5G1ZA 1PUAA 2IL4A 2VXKA 1KZFA 1Z4EA 4OADA 4FD4A 3FNCA 4A2ZA 3WR7A 4KOXA 5HH1A 3UY5A 4H6UA 4B12A 3BJ7A 3GYAA 1XEBA 4HKFA 4XPLA 4CYNA 3QAHA 4Q38A 3W6XA 3FB3A 2GE3A 5EC4A 3K9UA 4UCPA 3S6GA 3D8PA 1N71A 1BOBA 3R95A 2B3VA 2CNMA 1M4GA 4YRHA 4CAWA 1S3ZA 1I12A 1QSMA 2Q4VA 2K5TA 3C26A 4U9YA 2KCWA 4KVME 5H84A 2R1IA 3R9GA 4KUAA 4XNHC 2Q0YA 2FCKA 4HNWB 4CRZB 3EFAA 4RS2A 2B3UA 5G20A 1S60A 2FIAA 2WPXA 2FT0A 5DWNA 4A33A 2QECA 5F49A 1FY7A 2FS5A 4CGLA 2JEVA 4I49A 4KSFA 4CYQA 4MI4A 2R98A 2Q44A 1OZPA 4YFJA 3BLNA 1YK3A 5ISVA 4CGOA 2REEA 4LUAA 2PSWA 2P6EA 1KUYA 2PDOA 3A9LA 4PK3A 1NSLA 2I79A 4KOVA 2GANA 4MFZA 3H4QA 1GHEA 3MGDA 1YVOA 2F5IA 1M44A 2ZXVA 3FIXA 3JVNA 3TTHA 1L0CA 3EY5A 4RI1A 1S5KA 1YX0A 3DDDA 4H6ZA 5IB0A 4CAVA 2ZW7A 1M1DA 3FXTA 3D2MA 4E2AA 5F47A 1XIXA 2D4OA 1ON0A 2WPWA 3G8WA 4EVYA 4OAEA 2CNSA 2YNDA 4MFJA 3S6KA 3GY9A 4ZGYB 1S7LA 1I21A 2P6FA 4R3LA 5G22A 2EUIA 4II9A 4CGPA 4KS9A 1Q2YA 4BMHA 3EXNA 2B4BA 4QC6A 2X7BA 1M4IA 1RO5A 2HUZA 4UCNA 3G3SA 5J8CA 4CRYB 3TE4A 2J8RA 3BJ8A 4KVXA 1Y7RA 3FRMA 2VBQA 1P4NA 3ZJ0A 5AGEA 1S7NA 4PSWA 2FE7A 2G3AA 2Z3OA 3DNSA 4U9ZA 1QSNA 2AE6A 4B14A 4CYOA 2Z3MA 3I3GA 4Y49C 2Z3KA 2B58A 2D4PA 2Z10A 4R9MA 4C7IA 2R7HA 4ZBGA 4AVBA 1TIQA 1YLEA 3TO6A 3PGPA 3ZZIA 4KSAA 3TT2A 4ORFA 4C68A 4PSXA 4UBRA 3NE7A 5KTDA 2PC1A 5A28A 2HQYA 3R1KA 2CY2A 4J3GA 4UWIA 1P0HA 5DWMA 2BUEA 2OB0A 4E8OA 2FIWA 1IYLA 3TO7A 4C2ZA 2HV2A 4C2XA 1B6BA 4MY0A 3D3SA 3R96A 2ZW5A 3JUWA 4KOSA 2ZW4A 4MFKA 4U5YA 4HNYB 4QB9A 4KUBA 1MK4A 4L89A 5IX3A 2G0BA 4CGNA 2ARHA 3DSBA 1IICA 4JXQA 2ATRA 4KLVA 4UFVA 4L8AA 3P2FA 5AG6A 2Q4YA 4AVCA 3IWEA 4CYPA 2CXAA 3R9FA 4Y49B 2JDCA 1CJWA 3W6SA 1WWZA 4A32A 1SQHA 2OU2A 4F6AA 3TOBA 4C2YA 2G3TA 1U6MA 4JLYA 4AB7A 2Z3NA 3EO4A 4MFLA 2Z11A 1Z4RA 4GS4A 3RYOA 2DPSA 4FD7A 4A30A 2FXFA 4FD6A 1QSRA 3S6FA 3IWGA 4HNXB 1K4JA 2J8NA 2VEZA 1R57A 1QSOA 4UFXA 2OZHA 2DPTA 4CAFA 1Z9UA 2OH1A 2PR1A 2QMLA 1WK4A 1NMTA 3SXOA 1M4DA 2A4NA 3CXSA 4NF1A 3S6HA 1YREA 2R8VA 4K30A 4IUSA 2JDDA 5H86A 4A95A 2REFA 4B5OA 2OZUA 2VI7A 3SHPA 1XMTA 3EC4A 3JTKA 2WUUA 2B4DA 5AG5A 2PRBA 4YGOA 4CAXA 2ZPAA 4R87A 4B5PA 1MJAA 4M85A 3VWDA 3OWCA 4JWPA 4UFWA 5A27A 2DXQA 3CXQA 5GCNA 2VQYA 3IGRA 4QVTA 2BSWA 2P0WA 2VZZA 4NCZA 1QSTA 3FYNA 2OZGA 3P2HA 3DR8A 4KOTA 2YGWA 1YR0A 4PV6A 3TFYA 3VWEA 3LODA 1V0CA 4QUSA 5KTAA 4MFQA 4IF5A 5KTCA 2Z3PA 3D2PA 3F8KA 2CNTA 2GIVA 2I00A 2J8MA 1XF8A 4B10A 4B13A 4KOYA 4UA3A 4AG7A 2H5MA 2WSAA 4OLLA 5AG4A 3V8IA 2VZYA 1RXTA 4ONUA 1I1DA 4XPDC 1BO4A 4JXRA 4AVAA 1MJ9A 1KUXA 3FBUA 4F0XA 4M3SA 4B11A 2B4DB 1S7FA 2PQ8A 2JLMA 4A31A 4DNCA 5AG7A 4B5PB 4NXYA 2YNEA 3LD2A 4CAEA 1ZO0A 3KKWA 4Q36A 2AJ6A 2Z0ZA 2P6GA 2ZW6A 5C88A 2O28A 2Q7BA 4PK2A 1IYKA 4QBJA 3PZJA 3TO9A 4LX9A 4NSQA 1LRZA 4KOWA 2Z3LA 4MFPA 1J4JA 2C27A 4CGMA 4JJXA 4KZTA 2B5GA 2NMTA 5BWAB 5I0CA 4MBUA 5FVJA 3IU1A 5EBVA 3H5ZA 1IB1E 4XPKA 1UFHA 1YVKA 4NEXA 3W91A 1CM0A 3SXNA 3GKRA 4FD5A 1Y9KA 3IU2A 5F48A 3F5BA 3PP9A 1Q2DA 4MHDA 4XPDB 4KLWA 5CNPA 1B87A 1XE4A 2QIRA 4R57A 3T9YA 4KVOE 2Y0MA 2FL4A 3E0KA 3N7ZA 1KUVA 3T90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  4A95 A;  4CGP A;  3IWE A;  4CYP A;  5AG4 A;  4C2X A;  4A30 A;  2YNC A;  4UCM A;  4BBH A;  4C7I A;  4CYN A;  3JTK A;  4CGO A;  4A32 A;  4B11 A;  2WUU A;  3IU2 A;  5AG5 A;  4B12 A;  4UCN A;  4UFX A;  4A31 A;  4UCP A;  5AG7 A;  5G20 A;  4C2Y A;  4C68 A;  4CGM A;  2YNE A;  5G21 A;  5AGE A;  4CAE A;  4A33 A;  4CAF A;  4CGN A;  4C7H A;  5G1Z A;  5A28 A;  4UFW A;  5A27 A;  2YNC C;  4B10 A;  4B13 A;  3IU1 A;  2YND A;  4A2Z A;  4B14 A;  4UFV A;  4CYO A;  4CGL A;  3H5Z A;  5AG6 A;  2WSA A;  5G22 A;  4CYQ A; 
#chains in the Genus database with same CATH topology
 3QB8 A;  2RC4 A;  2PJA A;  2BL1 A;  1MJB A;  2PIY A;  4UCM A;  2FSR A;  4BD9 A;  5JPH A;  1Y9W A;  4MJ8 A;  2IQ6 A;  5LRJ A;  4WWV A;  1Q2C A;  4E0A A;  4KOR A;  4UWJ A;  4XNH B;  1S7K A;  3KL9 A;  5JQ4 A;  4R3K A;  2B5G B;  4IAV A;  3KHZ A;  3TCV A;  4AG9 A;  5THW A;  1XBU A;  2Q04 A;  1Y7E A;  5DS0 A;  4MMO A;  4C7H A;  3I9S A;  2PJ8 A;  3R9E A;  2YNC C;  4X3R A;  4FBE A;  5HMN A;  1IID A;  3PBE A;  4MY3 A;  2BEI A;  1XRY A;  5J8F A;  4BBH A;  2EK8 A;  5F46 A;  5C82 A;  3F0A A;  4KOU A;  4H89 A;  3DR6 A;  3TOA A;  1PU9 A;  2YNC A;  1AMP A;  4X5K A;  1VKC A;  3IEH A;  2IMO A;  2JBK A;  3H8F A;  3B3T A;  4UIB A;  3SI0 A;  4M6I A;  4O23 A;  3B8G A;  1CBX A;  1ZG8 A;  2VL1 A;  3CXP A;  4F0Y A;  1F2P A;  2PR8 A;  4A39 A;  1HEE A;  5E96 A;  2GLJ A;  1YGH A;  4LQ6 A;  4IHM A;  4JD6 A;  4P4I A;  2HC9 A;  2EVN A;  5IV0 A;  4JZ0 A;  1HDU A;  2RFH A;  4CS0 B;  1VHS A;  5G21 A;  4GM5 A;  3FEC A;  1NE9 A;  1QMU A;  4ZI6 A;  1IU8 A;  5G1Z A;  1PUA A;  2IL4 A;  2VXK A;  2AFW A;  1KZF A;  1Z4E A;  2XEF A;  4OAD A;  4FD4 A;  3FNC A;  4A2Z A;  3WR7 A;  2CIJ A;  4KOX A;  5HH1 A;  3UY5 A;  4H6U A;  4B12 A;  3BJ7 A;  3IO1 A;  3K2K A;  5JH9 A;  4ZY0 A;  3GYA A;  1XEB A;  3GIU A;  4HKF A;  4ONW A;  4XPL A;  2F8H A;  5LYI A;  1Z8T A;  3HLP A;  1Z8W A;  4NGS A;  3PB9 X;  4CYN A;  3QAH A;  4Q38 A;  2ZEP A;  3W6X A;  3FB3 A;  2GE3 A;  3WC5 A;  5EC4 A;  1ZLI A;  3IFE A;  3K9U A;  4UCP A;  3S6G A;  3D8P A;  1N71 A;  1BOB A;  3R95 A;  1RTQ A;  2B3V A;  1TF9 A;  5JGF A;  4A94 A;  1ARM A;  2CNM A;  1M4G A;  4YRH A;  4CAW A;  1S3Z A;  2HB6 A;  3CDX A;  1I12 A;  1QSM A;  1CPX A;  2V8V A;  2Q4V A;  2K5T A;  3C26 A;  2ZOG A;  2V8H A;  1TF8 A;  4PXC A;  4U9Y A;  4P4B A;  2KCW A;  4KVM E;  5H84 A;  2R1I A;  4P4E A;  3R9G A;  2WYR A;  4KUA A;  3SJF A;  4XNH C;  3PFE A;  4W9Y A;  2Q0Y A;  2FCK A;  4HNW B;  3SJG A;  4CRZ B;  3KGQ A;  3EFA A;  4RS2 A;  3SJX A;  1GYT A;  3ISX A;  3IJ3 A;  4GXH A;  4MCP A;  1TKJ A;  4LQG A;  2B3U A;  5G20 A;  1S60 A;  2FIA A;  3LMS A;  2WPX A;  3QAY A;  2FT0 A;  5DWN A;  4A33 A;  1YLO A;  1Y0Y A;  2QEC A;  3PB7 X;  4F8Z A;  5F49 A;  1F57 A;  1FY7 A;  2FS5 A;  3GLJ A;  3S9N A;  5IB9 A;  4WJB A;  4CGL A;  2JEV A;  3FF3 A;  4I49 A;  1YW4 A;  1CP6 A;  4KSF A;  4PXB A;  2GRE A;  4CYQ A;  2V8G A;  2ZEE A;  4MI4 A;  4ZX9 A;  4Z65 A;  2DEA A;  2R98 A;  3NH4 A;  2Q44 A;  1OZP A;  2ODF A;  1LAM A;  1HDQ A;  4YFJ A;  3LAC A;  3BLN A;  2AFX A;  1YK3 A;  5D29 A;  4CGO A;  2PVV A;  2REE A;  3IIB A;  5ISV A;  4LUA A;  2PSW A;  3FVL A;  1VHE A;  2P6E A;  4F9V A;  3RNZ A;  1KUY A;  2PDO A;  3A9L A;  4PK3 A;  1NSL A;  1ZG7 A;  2I79 A;  3KQX A;  2ANP A;  1VIX A;  4KOV A;  2GAN A;  4MFZ A;  1AYE A;  4NGR A;  3H4Q A;  3V38 A;  1GHE A;  2CTB A;  4K3N A;  3MGD A;  5K8O A;  3BHX A;  3SI1 A;  1EE3 P;  1YVO A;  2FVG A;  2F5I A;  1H8L A;  1M44 A;  2ZXV A;  2V8D A;  3FIX A;  2JEW A;  7CPA A;  3NH8 A;  3JVN A;  3NA6 A;  3TTH A;  3T8W A;  1L0C A;  2OR4 A;  3MN8 A;  3EY5 A;  4IK2 A;  3BI0 A;  3I1U A;  4RI1 A;  1S5K A;  1FNO A;  4NJR A;  2AFM A;  2C1C A;  1IOI A;  1YX0 A;  4OKO A;  4OP4 A;  3DDD A;  4H6Z A;  4EFD A;  3D67 A;  5IB0 A;  3WC7 A;  2GLF A;  2ZW7 A;  4CAV A;  1M1D A;  4MHZ A;  3FXT A;  3D2M A;  4E2A A;  2F7V A;  5F47 A;  1AUG A;  1XIX A;  4OC2 A;  2C6P A;  2D4O A;  1ON0 A;  2WPW A;  3PB6 X;  4A37 A;  3G8W A;  5K8N A;  2ZEH A;  4EVY A;  4OAE A;  3D4U A;  2CNS A;  2YND A;  4MFJ A;  3S6K A;  3D66 A;  3CT9 A;  2POK A;  3GY9 A;  4ZGY B;  1I21 A;  1S7L A;  2P6F A;  4R3L A;  5G22 A;  2XEG A;  2EUI A;  4UIA A;  4II9 A;  2C6C A;  4TNU A;  4CGP A;  4KS9 A;  1Q2Y A;  2PVW A;  2ABZ A;  4FWU A;  4BMH A;  4OME A;  1X12 A;  3EXN A;  2B4B A;  4QC6 A;  2X7B A;  4MHN A;  1M4I A;  1RO5 A;  1Z5R A;  2Q4Z A;  2HUZ A;  4UCN A;  3G3S A;  4PQA A;  4R7M A;  4CRY B;  4DYO A;  2J8R A;  5J8C A;  3TE4 A;  3BJ8 A;  4KVX A;  1Y7R A;  3FRM A;  4R76 A;  5D8N A;  2VBQ A;  1P4N A;  3K9T A;  4OC3 A;  3ZJ0 A;  3GB0 A;  5AGE A;  1S7N A;  4PSW A;  2FE7 A;  4FUU A;  2G3A A;  2Z3O A;  3DNS A;  4U9Z A;  1QSN A;  2XEI A;  2AE6 A;  4B14 A;  3WC6 A;  2Z3M A;  4CYO A;  3I3G A;  4Y49 C;  2Z3K A;  1BPN A;  2B58 A;  4FAI A;  3TC8 A;  3FEE A;  3FH4 A;  2D4P A;  2PJ3 A;  2GU2 A;  4B6Z A;  4NGT A;  2Z10 A;  4R9M A;  4C7I A;  3KHX A;  2R7H A;  3KR4 A;  5ELY A;  4ZBG A;  4AVB A;  1TIQ A;  1YLE A;  3TO6 A;  4BIN A;  3H8G A;  3PGP A;  4P4D A;  3ZZI A;  4KSA A;  3TT2 A;  4ORF A;  3SI2 A;  4C68 A;  4PSX A;  4UBR A;  3IC1 A;  3NE7 A;  5KTD A;  3B35 A;  2PJ7 A;  5K8P A;  3TX8 A;  3PB4 X;  2PC1 A;  5A28 A;  2HQY A;  2WZN A;  2CY2 A;  3R1K A;  4J3G A;  4UWI A;  2EK9 A;  1R43 A;  1P0H A;  5LRG A;  5DWM A;  2BUE A;  2OB0 A;  3RO0 A;  1LFW A;  4E8O A;  1JWQ A;  1KWM A;  2FIW A;  1DTD A;  1IYL A;  3TO7 A;  4C2Z A;  3N5F A;  2HV2 A;  4C2X A;  1B6B A;  1DE4 C;  4EME A;  3GUX A;  4X8I A;  4MY0 A;  3D3S A;  3R96 A;  2QYV A;  2ZW5 A;  3JUW A;  1ZLH A;  3NFZ A;  4KOS A;  2ZW4 A;  4MFK A;  2ZED A;  2ZEO A;  4U5Y A;  2ZEF A;  3CZX A;  1F2O A;  3BI1 A;  4NGN A;  1YQE A;  4HNY B;  4QB9 A;  4X2T A;  4KUB A;  1MK4 A;  1QQ9 A;  3CPX A;  4L89 A;  2PJB A;  2G0B A;  5IX3 A;  3D7H A;  4CGN A;  2ARH A;  3DSB A;  1IIC A;  4JXQ A;  4PPZ A;  2ATR A;  1ZG9 A;  4KLV A;  4MCQ A;  4UFV A;  4L8A A;  1CP7 A;  1Z8X A;  3P2F A;  1CG2 A;  2PJ5 A;  5AG6 A;  2Q4Y A;  1BPM A;  2IJZ A;  4AVC A;  2Q43 A;  3B3W A;  4PXE A;  2RB7 A;  3IWE A;  4CYP A;  3D68 A;  2CXA A;  3R9F A;  3D7G A;  3PEI A;  3LWU A;  4Y49 B;  2JDC A;  3WAB A;  1CJW A;  3W6S A;  1WWZ A;  4A32 A;  4RUH A;  2PJ0 A;  4ZYQ A;  1SQH A;  1Z2L A;  5CPA A;  4YU9 A;  2OU2 A;  3PRT A;  4Q7A A;  4F6A A;  3TOB A;  4PXD A;  1IY7 A;  2NYQ A;  5I4M A;  4C2Y A;  2XEJ A;  5HVF A;  1YSJ A;  5LYD A;  3VAT A;  2G3T A;  5LRK A;  1U6M A;  2BOA A;  2PJ9 A;  3IWW A;  2AFO A;  5LYL A;  3KQZ A;  4JLY A;  2QJ8 A;  1UWY A;  4AB7 A;  2Z3N A;  3EO4 A;  4NGM A;  2PJ1 A;  1TKH A;  2G9D A;  4MFL A;  4A38 A;  2Z11 A;  2GFQ A;  2O53 A;  1Z4R A;  4GS4 A;  3RYO A;  2DPS A;  2J9A A;  1XFO A;  4FD7 A;  4A30 A;  2FXF A;  1OBR A;  2Q7S A;  4FD6 A;  8CPA A;  2O4H A;  1QSR A;  4NFR A;  4JYW A;  3S6F A;  3IWG A;  4HNX B;  1XMB A;  1K4J A;  2J8N A;  2VEZ A;  1R57 A;  1QSO A;  4R8F A;  1LAP A;  4UFX A;  3DLJ A;  2OZH A;  1ARL A;  2DPT A;  3NE8 A;  1A2Z A;  2PCU A;  4CAF A;  1Z9U A;  3PFO A;  2QVP A;  2OH1 A;  2PR1 A;  2PRQ A;  5J1Q A;  2C6G A;  2QML A;  1WK4 A;  1NMT A;  3SXO A;  2PJ2 A;  4RN7 A;  1M4D A;  2A4N A;  2PJC A;  3CXS A;  4NF1 A;  2OOT A;  1YRE A;  2R8V A;  4K30 A;  3S6H A;  4OC5 A;  1YW6 A;  4MXU A;  4IUS A;  2JDD A;  5H86 A;  4UF4 A;  2PJ6 A;  3VH9 A;  4A95 A;  1CX8 A;  2REF A;  4B5O A;  1LCP A;  2OZU A;  2VI7 A;  3H8E A;  3SHP A;  3DGV A;  4HPS A;  1XMT A;  2ZEN A;  3EC4 A;  3JTK A;  5HXD A;  2WUU A;  3PB8 X;  4OIW A;  3RZA A;  4TWE A;  2B4D A;  5AG5 A;  2PRB A;  4YGO A;  2I3C A;  4CAX A;  2ZPA A;  4R87 A;  4B5P A;  1MJA A;  5EMI A;  4G1P A;  4KSI A;  4M85 A;  3B3S A;  3VWD A;  3OWC A;  2EO8 A;  4JWP A;  1TXR A;  4UFW A;  4UEZ A;  1ELM P;  5A27 A;  2DXQ A;  1M4L A;  3FX6 A;  1LAN A;  3CXQ A;  5GCN A;  2VQY A;  3IGR A;  4ZX8 A;  2DF5 A;  4QVT A;  2BSW A;  5HVG A;  2P0W A;  3CPA A;  2VZZ A;  4NCZ A;  1QST A;  3FYN A;  4M6G A;  2OZG A;  3D7F A;  3P2H A;  3DR8 A;  3FMC A;  4EWT A;  3NH5 A;  4KOT A;  2NSM A;  1YR0 A;  2YGW A;  4PV6 A;  3TFY A;  3VWE A;  3KZW A;  3LOD A;  4NGQ A;  1ELL P;  1V0C A;  3D7D A;  4QUS A;  4MFQ A;  6CPA A;  4IF5 A;  5KTA A;  5KTC A;  2Z3P A;  4R6T A;  4UEF A;  3KI9 A;  3VAR A;  1YME A;  3D2P A;  3F8K A;  2CNT A;  2GIV A;  2I00 A;  1IOF A;  2ZEG A;  2J8M A;  1XF8 A;  4B10 A;  4B13 A;  4KOY A;  4UA3 A;  4F9U A;  5LYF A;  4AG7 A;  2H5M A;  2WSA A;  4OLL A;  5AG4 A;  3V8I A;  2VZY A;  5CBM A;  2BCO A;  1RXT A;  4MHP A;  3RBU A;  4ONU A;  4OID A;  3FJU A;  5HVH A;  1I1D A;  4XPD C;  1LOK A;  1BO4 A;  3B3V A;  4JXR A;  1MJ9 A;  1KUX A;  4AVA A;  3FBU A;  2PJ4 A;  4M6H A;  4F0X A;  4M3S A;  4B11 A;  5K8M A;  4NJQ A;  2ZOF A;  4AXV A;  2B4D B;  1S7F A;  2PQ8 A;  2JLM A;  4A31 A;  4DNC A;  5AG7 A;  4B5P B;  4NGP A;  3KAS A;  4NXY A;  1XOV A;  2YNE A;  4ZY2 A;  3LD2 A;  3B2Y A;  3L2N A;  5JM6 A;  2EBJ A;  4CAE A;  4P4F A;  1ZO0 A;  2BO9 A;  2CTC A;  3KKW A;  4Q36 A;  1R3N A;  5F09 A;  2AJ6 A;  2Z0Z A;  3S9M A;  3HUV A;  2AFU A;  1Y0R A;  1Z8L A;  2P6G A;  4H2K A;  2ZW6 A;  4OC4 A;  5C88 A;  2O28 A;  2Q7B A;  1JQG A;  4PK2 A;  1IYK A;  3WT4 A;  4QBJ A;  3PZJ A;  3TO9 A;  3KR5 A;  4LX9 A;  3MRU A;  4MCS A;  4NSQ A;  1LRZ A;  2JBJ A;  4KOW A;  2Z3L A;  4MFP A;  1J4J A;  3ISZ A;  2C27 A;  4UEE A;  2CF4 A;  4CGM A;  4P6Y A;  4JJX A;  3B7I A;  4KZT A;  2B5G A;  2NMT A;  4OC1 A;  3V7Z A;  4P45 A;  5BWA B;  1BAV A;  5I0C A;  4YWY A;  1NSA A;  4P4J A;  4MBU A;  3B3C A;  5FVJ A;  2PIZ A;  3IU1 A;  4CPA A;  5EBV A;  3FED A;  3H5Z A;  1IB1 E;  4XPK A;  1UFH A;  1YVK A;  1CPS A;  4OC0 A;  4NEX A;  3W91 A;  1CM0 A;  1VGY A;  2ZEL A;  4MCR A;  1VHO A;  3GKR A;  3SXN A;  3JRU A;  3S9L A;  4MRI A;  1PCA A;  4FD5 A;  1FT7 A;  1X10 A;  4P44 A;  4DUK A;  1Y9K A;  1Q7L A;  3RAM A;  1TKF A;  3IU2 A;  5F48 A;  3F5B A;  4P10 A;  3PP9 A;  1Q2D A;  4MHD A;  4XPD B;  2EWB A;  1XJO A;  3PBB A;  3SJE A;  4MHY A;  1PYT B;  4KLW A;  2PE3 A;  2Q51 A;  5CNP A;  4ZY1 A;  1B87 A;  1BLL E;  4DJL A;  1IGB A;  1XE4 A;  2QIR A;  4R57 A;  2AFS A;  3T9Y A;  3BXM A;  2V77 A;  4KVO E;  2Y0M A;  2FL4 A;  3E0K A;  3N7Z A;  2ZEM A;  1KUV A;  3T90 A;  3QNV A;  2AFZ A; 
#chains in the Genus database with same CATH homology
 3QB8 A;  2RC4 A;  2BL1 A;  1MJB A;  4UCM A;  2FSR A;  5JPH A;  1Y9W A;  4MJ8 A;  1Q2C A;  4E0A A;  4KOR A;  4UWJ A;  4XNH B;  1S7K A;  5JQ4 A;  4R3K A;  2B5G B;  3TCV A;  4AG9 A;  2Q04 A;  4C7H A;  3I9S A;  3R9E A;  2YNC C;  5HMN A;  1IID A;  4MY3 A;  2BEI A;  5J8F A;  4BBH A;  5F46 A;  5C82 A;  3F0A A;  4KOU A;  4H89 A;  3DR6 A;  3TOA A;  1PU9 A;  2YNC A;  4X5K A;  1VKC A;  3B8G A;  3CXP A;  4F0Y A;  2PR8 A;  5E96 A;  1YGH A;  4JD6 A;  2EVN A;  5IV0 A;  4CS0 B;  1VHS A;  5G21 A;  1NE9 A;  5G1Z A;  1PUA A;  2IL4 A;  2VXK A;  1KZF A;  1Z4E A;  4OAD A;  4FD4 A;  3FNC A;  4A2Z A;  3WR7 A;  4KOX A;  5HH1 A;  3UY5 A;  4H6U A;  4B12 A;  3BJ7 A;  3GYA A;  1XEB A;  4HKF A;  4XPL A;  4CYN A;  3QAH A;  4Q38 A;  3W6X A;  3FB3 A;  2GE3 A;  5EC4 A;  3K9U A;  4UCP A;  3S6G A;  3D8P A;  1N71 A;  1BOB A;  3R95 A;  2B3V A;  2CNM A;  1M4G A;  4YRH A;  4CAW A;  1S3Z A;  1I12 A;  1QSM A;  2Q4V A;  2K5T A;  3C26 A;  4U9Y A;  2KCW A;  4KVM E;  5H84 A;  2R1I A;  3R9G A;  4KUA A;  4XNH C;  2Q0Y A;  2FCK A;  4HNW B;  4CRZ B;  3EFA A;  4RS2 A;  2B3U A;  5G20 A;  1S60 A;  2FIA A;  2WPX A;  2FT0 A;  5DWN A;  4A33 A;  2QEC A;  5F49 A;  1FY7 A;  2FS5 A;  4CGL A;  2JEV A;  4I49 A;  4KSF A;  4CYQ A;  4MI4 A;  2R98 A;  2Q44 A;  1OZP A;  4YFJ A;  3BLN A;  1YK3 A;  5ISV A;  4CGO A;  2REE A;  4LUA A;  2PSW A;  2P6E A;  1KUY A;  2PDO A;  3A9L A;  4PK3 A;  1NSL A;  2I79 A;  4KOV A;  2GAN A;  4MFZ A;  3H4Q A;  1GHE A;  3MGD A;  1YVO A;  2F5I A;  1M44 A;  2ZXV A;  3FIX A;  3JVN A;  3TTH A;  1L0C A;  3EY5 A;  4RI1 A;  1S5K A;  1YX0 A;  3DDD A;  4H6Z A;  5IB0 A;  4CAV A;  2ZW7 A;  1M1D A;  3FXT A;  3D2M A;  4E2A A;  5F47 A;  1XIX A;  2D4O A;  1ON0 A;  2WPW A;  3G8W A;  4EVY A;  4OAE A;  2CNS A;  2YND A;  4MFJ A;  3S6K A;  3GY9 A;  4ZGY B;  1S7L A;  1I21 A;  2P6F A;  4R3L A;  5G22 A;  2EUI A;  4II9 A;  4CGP A;  4KS9 A;  1Q2Y A;  4BMH A;  3EXN A;  2B4B A;  4QC6 A;  2X7B A;  1M4I A;  1RO5 A;  2HUZ A;  4UCN A;  3G3S A;  5J8C A;  4CRY B;  3TE4 A;  2J8R A;  3BJ8 A;  4KVX A;  1Y7R A;  3FRM A;  2VBQ A;  1P4N A;  3ZJ0 A;  5AGE A;  1S7N A;  4PSW A;  2FE7 A;  2G3A A;  2Z3O A;  3DNS A;  4U9Z A;  1QSN A;  2AE6 A;  4B14 A;  4CYO A;  2Z3M A;  3I3G A;  4Y49 C;  2Z3K A;  2B58 A;  2D4P A;  2Z10 A;  4R9M A;  4C7I A;  2R7H A;  4ZBG A;  4AVB A;  1TIQ A;  1YLE A;  3TO6 A;  3PGP A;  3ZZI A;  4KSA A;  3TT2 A;  4ORF A;  4C68 A;  4PSX A;  4UBR A;  3NE7 A;  5KTD A;  2PC1 A;  5A28 A;  2HQY A;  3R1K A;  2CY2 A;  4J3G A;  4UWI A;  1P0H A;  5DWM A;  2BUE A;  2OB0 A;  4E8O A;  2FIW A;  1IYL A;  3TO7 A;  4C2Z A;  2HV2 A;  4C2X A;  1B6B A;  4MY0 A;  3D3S A;  3R96 A;  2ZW5 A;  3JUW A;  4KOS A;  2ZW4 A;  4MFK A;  4U5Y A;  4HNY B;  4QB9 A;  4KUB A;  1MK4 A;  4L89 A;  5IX3 A;  2G0B A;  4CGN A;  2ARH A;  3DSB A;  1IIC A;  4JXQ A;  2ATR A;  4KLV A;  4UFV A;  4L8A A;  3P2F A;  5AG6 A;  2Q4Y A;  4AVC A;  3IWE A;  4CYP A;  2CXA A;  3R9F A;  4Y49 B;  2JDC A;  1CJW A;  3W6S A;  1WWZ A;  4A32 A;  1SQH A;  2OU2 A;  4F6A A;  3TOB A;  4C2Y A;  2G3T A;  1U6M A;  4JLY A;  4AB7 A;  2Z3N A;  3EO4 A;  4MFL A;  2Z11 A;  1Z4R A;  4GS4 A;  3RYO A;  2DPS A;  4FD7 A;  4A30 A;  2FXF A;  4FD6 A;  1QSR A;  3S6F A;  3IWG A;  4HNX B;  1K4J A;  2J8N A;  2VEZ A;  1R57 A;  1QSO A;  4UFX A;  2OZH A;  2DPT A;  4CAF A;  1Z9U A;  2OH1 A;  2PR1 A;  2QML A;  1WK4 A;  1NMT A;  3SXO A;  1M4D A;  2A4N A;  3CXS A;  4NF1 A;  3S6H A;  1YRE A;  2R8V A;  4K30 A;  4IUS A;  2JDD A;  5H86 A;  4A95 A;  2REF A;  4B5O A;  2OZU A;  2VI7 A;  3SHP A;  1XMT A;  3EC4 A;  3JTK A;  2WUU A;  2B4D A;  5AG5 A;  2PRB A;  4YGO A;  4CAX A;  2ZPA A;  4R87 A;  4B5P A;  1MJA A;  4M85 A;  3VWD A;  3OWC A;  4JWP A;  4UFW A;  5A27 A;  2DXQ A;  3CXQ A;  5GCN A;  2VQY A;  3IGR A;  4QVT A;  2BSW A;  2P0W A;  2VZZ A;  4NCZ A;  1QST A;  3FYN A;  2OZG A;  3P2H A;  3DR8 A;  4KOT A;  2YGW A;  1YR0 A;  4PV6 A;  3TFY A;  3VWE A;  3LOD A;  1V0C A;  4QUS A;  5KTA A;  4MFQ A;  4IF5 A;  5KTC A;  2Z3P A;  3D2P A;  3F8K A;  2CNT A;  2GIV A;  2I00 A;  2J8M A;  1XF8 A;  4B10 A;  4B13 A;  4KOY A;  4UA3 A;  4AG7 A;  2H5M A;  2WSA A;  4OLL A;  5AG4 A;  3V8I A;  2VZY A;  1RXT A;  4ONU A;  1I1D A;  4XPD C;  1BO4 A;  4JXR A;  4AVA A;  1MJ9 A;  1KUX A;  3FBU A;  4F0X A;  4M3S A;  4B11 A;  2B4D B;  1S7F A;  2PQ8 A;  2JLM A;  4A31 A;  4DNC A;  5AG7 A;  4B5P B;  4NXY A;  2YNE A;  3LD2 A;  4CAE A;  1ZO0 A;  3KKW A;  4Q36 A;  2AJ6 A;  2Z0Z A;  2P6G A;  2ZW6 A;  5C88 A;  2O28 A;  2Q7B A;  4PK2 A;  1IYK A;  4QBJ A;  3PZJ A;  3TO9 A;  4LX9 A;  4NSQ A;  1LRZ A;  4KOW A;  2Z3L A;  4MFP A;  1J4J A;  2C27 A;  4CGM A;  4JJX A;  4KZT A;  2B5G A;  2NMT A;  5BWA B;  5I0C A;  4MBU A;  5FVJ A;  3IU1 A;  5EBV A;  3H5Z A;  1IB1 E;  4XPK A;  1UFH A;  1YVK A;  4NEX A;  3W91 A;  1CM0 A;  3SXN A;  3GKR A;  4FD5 A;  1Y9K A;  3IU2 A;  5F48 A;  3F5B A;  3PP9 A;  1Q2D A;  4MHD A;  4XPD B;  4KLW A;  5CNP A;  1B87 A;  1XE4 A;  2QIR A;  4R57 A;  3T9Y A;  4KVO E;  2Y0M A;  2FL4 A;  3E0K A;  3N7Z A;  1KUV A;  3T90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...