5AG6A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
402
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 120
structure length 402
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag6A00
4C7IA 5A28A 4C2XA 4CGOA 4CYQA 4A33A 4B11A 4CAEA 4CGMA 2WUUA 5AG6A 4UFWA 4CYPA 2YNEA 4UCMA 4B13A 4A30A 5AGEA 4A31A 2YNCA 2YNDA 4CGLA 5G22A 4CGNA 3IU1A 5A27A 3H5ZA 3JTKA 5AG5A 4CYNA 2WSAA 4A95A 4B10A 4UCPA 4CGPA 4C7HA 5AG4A 4BBHA 4B12A 4UFXA 5AG7A 4CYOA 4C2ZA 4A2ZA 3IWEA 4A32A 2YNCC 4C2YA 5G1ZA 4C68A 4UCNA 4B14A 4CAFA 5G20A 3IU2A 5G21A 4UFVA
chains in the Genus database with same CATH superfamily
1TIQA 4F0YA 1CPSA 4R8FA 5FVJA 1H8LA 2VL1A 4FAIA 2WUUA 2ZEDA 4MY3A 3TO9A 3TTHA 2PJ6A 2YNEA 4QB9A 2PR8A 4TNUA 3PGPA 2Z11A 2CTCA 1CX8A 1AUGA 3IFEA 1M4LA 2VZZA 3TX8A 1XRYA 3CZXA 4UEFA 4OMEA 5F48A 1CBXA 2D4PA 4MRIA 4MCPA 3CXSA 4CGPA 2P6GA 4KOTA 5DWMA 3D8PA 4B5OA 3PFOA 3NH4A 2EK8A 3CPXA 4Y49C 4L89A 1I1DA 4CAFA 2C6PA 3N7ZA 3K9UA 3R96A 3IWWA 3LD2A 1IYLA 4UWJA 3TOAA 1Z8XA 4B11A 3G8WA 1TF8A 4KLWA 3RBUA 5LRJA 2V8VA 5CPAA 5AGEA 2O53A 1B87A 1Q2CA 8CPAA 5IV0A 4AVCA 1IGBA 1L0CA 2G3AA 2PJ8A 3ZJ0A 1I21A 3JVNA 1LANA 4LQ6A 4NXYA 4MI4A 2VZYA 3D3SA 4FWUA 3H5ZA 4KVOE 1Y9WA 3KASA 4QBJA 3LMSA 5JQ4A 3DR8A 2ZW6A 3R1KA 4NGTA 4OC4A 5CBMA 2Q0YA 4PXBA 4UCPA 3FB3A 1Z8TA 4B12A 1PUAA 4UFXA 4CAXA 4CYOA 1Y7EA 3D68A 1R57A 2WPXA 4MXUA 1YVOA 5G1ZA 5I0CA 2OOTA 2V77A 3FJUA 2NMTA 3I9SA 4UBRA 4UIBA 4MFKA 1TKJA 4B6ZA 4E8OA 4P44A 2PJBA 3PB7X 1S7KA 1PU9A 4CGMA 1YMEA 3R9EA 2G0BA 3WR7A 3D7DA 4I49A 4ONUA 4F0XA 4ZYQA 2JEWA 2BCOA 1MJAA 2AFXA 2PCUA 4AVBA 4NFRA 4LX9A 1Z2LA 5F46A 2IQ6A 5DS0A 3RYOA 3PZJA 5LYDA 2WZNA 1BOBA 1YX0A 1HDUA 1FT7A 3BI1A 4C2YA 1JQGA 2PIZA 2BUEA 4P4JA 2ZW7A 4P4EA 3BI0A 2OB0A 4RS2A 4M6IA 3R95A 2PIYA 3DGVA 3SHPA 3SI1A 2PQ8A 4JYWA 2VQYA 3FVLA 5H86A 3B2YA 5AG6A 2EK9A 2ATRA 3D2PA 4R6TA 2GLFA 2JBJA 2JEVA 2PR1A 2REFA 2YNCA 4A31A 3FMCA 4E0AA 3TFYA 2F5IA 2B4BA 3IU1A 4R3LA 2GU2A 3MN8A 5K8PA 1QMUA 2AFOA 4U9ZA 1UWYA 2B58A 2PVVA 3H8FA 5LRKA 2IMOA 2Z3OA 1AMPA 3QAHA 4MFZA 1MJBA 4A2ZA 1IIDA 3GKRA 2AE6A 1S7LA 2PVWA 3S6FA 4LUAA 1R3NA 4RUHA 3B3CA 1NE9A 3QAYA 2C27A 3IU2A 2Z3MA 3OWCA 4BD9A 2HC9A 2C1CA 1DTDA 3JUWA 3S9LA 2WYRA 4IUSA 3K2KA 4MFPA 4A33A 2Z3KA 4K3NA 4R3KA 2POKA 3TT2A 1NMTA 4A38A 3MRUA 2FSRA 4JLYA 1XMBA 3ZZIA 1VHOA 2JDDA 2PJ4A 5ISVA 2FIWA 2PDOA 4EVYA 4XPDB 4BMHA 3R9FA 1Q2DA 2BSWA 4NGQA 4H2KA 2HV2A 3PP9A 2ODFA 2JBKA 1OZPA 4CPAA 4MMOA 1XE4A 3KL9A 2RC4A 2V8HA 3SJEA 2ZEHA 2FIAA 4WWVA 5JPHA 2Q04A 2ZEFA 4R57A 3T8WA 2B5GB 5KTAA 2GREA 3FXTA 4HKFA 2J9AA 4B14A 3BLNA 1B6BA 2AFSA 2ZEGA 2FVGA 2ZEPA 5G20A 2GLJA 4AG7A 3VWEA 5LYFA 4X2TA 2REEA 4MCQA 3W6XA 1EE3P 5ELYA 3MGDA 4IAVA 3GY9A 3CXPA 4ZGYB 5D8NA 1F2OA 1A2ZA 2J8RA 5JH9A 1Q2YA 5IB9A 3WC5A 2OU2A 2JLMA 4PXEA 3DDDA 2CTBA 2BL1A 4KVME 2V8DA 3GLJA 3EFAA 3B7IA 3PBEA 4R7MA 4KOSA 4L8AA 4F8ZA 4CYNA 2FCKA 2C6GA 4IK2A 4NJQA 2QIRA 4OAEA 2O28A 2PJ9A 4C7HA 3ISXA 4AG9A 1UFHA 3IWEA 4XNHC 1IICA 1DE4C 2HQYA 4Z65A 1RXTA 4O23A 3TO7A 2KCWA 3SJFA 2GFQA 5A28A 2OH1A 4Q7AA 2DEAA 2ZEEA 1LAPA 1SQHA 3A9LA 5C82A 2YGWA 4F6AA 2YNDA 3FH4A 3DNSA 2PJ7A 3KHZA 1IY7A 1YW4A 3KR5A 2RB7A 4KUBA 4UIAA 5K8OA 1YK3A 3QNVA 1LAMA 2AFZA 4OP4A 4FD7A 5C88A 2GE3A 4X3RA 3KQZA 4Y49B 4C2ZA 1XIXA 2VBQA 3S9NA 3IGRA 3I3GA 1N71A 1LOKA 2I00A 3GIUA 2FL4A 2ZOFA 4P45A 4LQGA 1M4DA 4P4FA 1M4GA 5G21A 3RAMA 5HXDA 1XF8A 1LCPA 4C7IA 4TWEA 5JGFA 4M6HA 5KTDA 3FEEA 3B8GA 4NEXA 3FYNA 1RTQA 3S9MA 4CAWA 2CNMA 5E96A 1VKCA 1Y0YA 2Q51A 5G22A 2H5MA 4NGRA 3H4QA 2PE3A 4H6UA 3D7HA 3B3WA 3NA6A 5H84A 4MHNA 4CRYB 4RI1A 4OC0A 2EUIA 2WSAA 1CPXA 4EWTA 5AG4A 4BBHA 2EWBA 4NJRA 2BOAA 2BO9A 1VIXA 3FIXA 1U6MA 3ISZA 2ARHA 4EFDA 4P10A 1BLLE 4HPSA 4QVTA 1S7FA 3CXQA 2DF5A 1IB1E 1MJ9A 2OZHA 2R98A 4CGOA 4YWYA 3QB8A 4JXRA 4MFQA 5THWA 3NE8A 4CGLA 2QYVA 1XJOA 3VATA 1ARMA 1CJWA 3C26A 2B3UA 4PK3A 4A39A 2HUZA 5EBVA 4JD6A 4FD6A 3TCVA 5K8MA 4MJ8A 1AYEA 4OIDA 5F49A 5CNPA 3HUVA 3F5BA 1Z4EA 1P0HA 3VARA 4MCRA 1KZFA 3CPAA 5EMIA 4FBEA 4QUSA 2FT0A 4A32A 2Q4ZA 3WABA 1YR0A 4JZ0A 4KSIA 3GUXA 3PB8X 2EBJA 5KTCA 7CPAA 1QSTA 1LFWA 5K8NA 4Q36A 2QJ8A 3B35A 3D4UA 4PK2A 1S7NA 3H8GA 4AB7A 4MFJA 4UFWA 1IU8A 3EO4A 4A30A 4KOXA 1Y9KA 1XFOA 2ZEOA 4ZX8A 3S6KA 4KVXA 1S3ZA 4KOVA 3VWDA 5LRGA 1KUXA 1Q7LA 2PRBA 4IHMA 1J4JA 1Y0RA 4JJXA 5DWNA 1Z9UA 1RO5A 2ZW5A 4U9YA 4MFLA 2A4NA 2PSWA 1LRZA 2Q7BA 2VI7A 2FS5A 4MHDA 3PB4X 3PFEA 4H89A 3FX6A 5I4MA 4UEEA 4NF1A 1YW6A 3T90A 4MHPA 4ZY2A 2RFHA 1XMTA 3P2FA 4JWPA 2Z3NA 3SI0A 3PBBA 2R7HA 2R8VA 1BPMA 4XPKA 3PRTA 4MBUA 1FY7A 2I3CA 4MY0A 4WJBA 3B3TA 3LACA 2OZGA 4M6GA 4UCMA 2C6CA 2Y0MA 1BAVA 1YVKA 2IL4A 3DLJA 1M44A 4OC3A 2IJZA 2J8MA 4ZY0A 3EXNA 2ANPA 1F57A 1KWMA 4NSQA 1BO4A 2HB6A 1VGYA 2EVNA 4PSWA 4ZX9A 2WPWA 1ELMP 3JTKA 4K30A 2R1IA 2ZEMA 2B3VA 2PRQA 4A95A 4PXCA 4P4IA 2CXAA 1WWZA 3NH8A 4MHZA 2P6EA 2B4DA 3RO0A 4YU9A 5AG7A 4CRZB 4ZBGA 2QMLA 4OIWA 1Z4RA 2CF4A 2P6FA 4J3GA 2OZUA 2AFMA 1KUYA 2PJ3A 5HVHA 1GHEA 4YFJA 4EMEA 4HNYB 1MK4A 4M85A 3VH9A 4C2XA 3I1UA 3CDXA 3SJGA 4CYQA 1YQEA 2Q4YA 4CYPA 2CNSA 1X12A 4KOYA 3NFZA 2B4DB 2ZELA 3EY5A 3P2HA 2PJ5A 4OC1A 2PC1A 3H8EA 3W91A 3G3SA 4KOWA 1YSJA 4QC6A 1HEEA 3T9YA 2NSMA 1CG2A 3V38A 3UY5A 3BHXA 3V7ZA 1HDQA 3FF3A 2D4OA 2FE7A 1NSAA 4B10A 1WK4A 1TKHA 4OADA 4P4BA 2AFWA 4PV6A 4ORFA 4PQAA 4R9MA 4XNHB 3GYAA 1YGHA 5F09A 3LODA 3GB0A 4UCNA 4YGOA 4DUKA 1QSMA 4ZI6A 2PJ1A 3BXMA 4JXQA 4KORA 4P4DA 3NH5A 5HVGA 4KUAA 2X7BA 3KR4A 2PJ0A 4HNWB 4UF4A 2Q43A 2JDCA 2OR4A 3WC7A 3FECA 2ZENA 4F9UA 3TO6A 5LYLA 4KLVA 4XPLA 4B5PA 4B13A 1ZG9A 5HMNA 3RNZA 3FNCA 4M3SA 3PEIA 1PYTB 4PXDA 4AXVA 1IOIA 1K4JA 1VHSA 1YLOA 1IYKA 1V0CA 3IEHA 5JM6A 4CS0B 3B3SA 1CM0A 2F7VA 4H6ZA 3E0KA 3KI9A 1CP7A 3N5FA 3R9GA 1QSRA 1ZG8A 2FXFA 3IO1A 3IWGA 1GYTA 2CY2A 3KGQA 4B5PB 4BINA 1QSNA 3HLPA 4OKOA 1Z5RA 3L2NA 1S5KA 3PB6X 3CT9A 2ZOGA 4FD4A 4OC2A 4DNCA 2K5TA 2DPSA 5GCNA 5HH1A 4F9VA 4NGSA 1QQ9A 2VXKA 4RN7A 4P6YA 2F8HA 2CNTA 2Z0ZA 3B3VA 1QSOA 3JRUA 3K9TA 4GS4A 1TXRA 2XEIA 4X5KA 5D29A 2CIJA 1Z8LA 1IOFA 2J8NA 3KZWA 4R87A 2Q4VA 3WT4A 1TKFA 3NE7A 3SI2A 5J1QA 2DPTA 3KQXA 4KSFA 3D7GA 2G3TA 2PJ2A 6CPAA 4OLLA 4AVAA 1M1DA 2EO8A 3KKWA 1ELLP 4GM5A 1YREA 3TC8A 4CAVA 5IB0A 3SXNA 1XEBA 4OC5A 3IIBA 3LWUA 2GIVA 2ZPAA 4MHYA 2Q7SA 2G9DA 2YNCC 5F47A 4YRHA 4C68A 4X8IA 3TOBA 1XBUA 2Z3LA 2PJCA 3KHXA 4UA3A 4MCSA 1ARLA 1TF9A 3D7FA 4Q38A 4E2AA 1NSLA 3D67A 1CP6A 2AFUA 1YLEA 3DR6A 1XOVA 3S6GA 1F2PA 2ABZA 2Z3PA 5BWAB 4FD5A 2QECA 1P4NA 4G1PA 4ZY1A 5IX3A 4NGPA 5HVFA 2GANA 5EC4A 4XPDC 4KOUA 3D66A 4KSAA 4PSXA 3D2MA 1Z8WA 3TE4A 3BJ7A 5AG5A 2V8GA 4W9YA 1ON0A 4UEZA 4KZTA 1FNOA 2P0WA 3RZAA 5J8CA 1PCAA 2O4HA 2XEGA 1ZO0A 2Q44A 1ZG7A 2Z10A 3V8IA 1VHEA 4DJLA 3SJXA 2NYQA 2QVPA 1ZLIA 4U5YA 4II9A 3IJ3A 4UFVA 4ONWA 1Y7RA 2BEIA 3DSBA 3FBUA 4UWIA 4CAEA 3FRMA 3F8KA 1OBRA 4IF5A 2PJAA 2B5GA 2ZXVA 2VEZA 4DYOA 1I12A 1BPNA 3WC6A 1X10A 2I79A 4CGNA 4NGNA 2XEFA 4R76A 3S6HA 1M4IA 2ZW4A 5A27A 2DXQA 1ZLHA 1KUVA 4A37A 5LYIA 3IC1A 2XEJA 3BJ8A 4HNXB 3SXOA 3F0AA 5J8FA 4PPZA 4A94A 4FUUA 1JWQA 4GXHA 4NCZA 1S60A 4NGMA 3EC4A 3W6SA 4KS9A 1R43A 2AJ6A 3FEDA 3PB9X
chains in the Genus database with same CATH topology
1TIQA 4F0YA 5FVJA 2WUUA 4MY3A 3TO9A 3TTHA 2YNEA 4QB9A 2PR8A 3PGPA 2Z11A 2VZZA 5F48A 2D4PA 3CXSA 4CGPA 2P6GA 4KOTA 5DWMA 3D8PA 4B5OA 4Y49C 4L89A 1I1DA 4CAFA 3N7ZA 3K9UA 3R96A 3LD2A 1IYLA 4UWJA 3TOAA 4B11A 3G8WA 4KLWA 5AGEA 1B87A 1Q2CA 4AVCA 1L0CA 2G3AA 3ZJ0A 1I21A 3JVNA 4NXYA 4MI4A 2VZYA 3D3SA 3H5ZA 4KVOE 1Y9WA 5JQ4A 4QBJA 3DR8A 2ZW6A 3R1KA 2Q0YA 4UCPA 3FB3A 4B12A 1PUAA 4UFXA 4CAXA 4CYOA 1R57A 2WPXA 1YVOA 5G1ZA 5I0CA 2NMTA 3I9SA 4UBRA 4MFKA 4E8OA 4CGMA 1S7KA 1PU9A 3R9EA 2G0BA 3WR7A 4I49A 4ONUA 4F0XA 1MJAA 4AVBA 4LX9A 5F46A 3RYOA 3PZJA 1BOBA 1YX0A 4C2YA 2BUEA 2ZW7A 2OB0A 4RS2A 3R95A 3SHPA 2PQ8A 2VQYA 5H86A 5AG6A 3D2PA 2ATRA 2PR1A 2JEVA 2YNCA 2REFA 4A31A 3TFYA 4E0AA 2F5IA 2B4BA 3IU1A 4R3LA 4U9ZA 2B58A 2Z3OA 3QAHA 4MFZA 1MJBA 4A2ZA 1IIDA 3GKRA 2AE6A 1S7LA 3S6FA 4LUAA 1NE9A 2C27A 3IU2A 2Z3MA 3OWCA 3JUWA 4IUSA 4MFPA 4A33A 2Z3KA 4R3KA 3TT2A 1NMTA 2FSRA 4JLYA 3ZZIA 2JDDA 5ISVA 2FIWA 2PDOA 4EVYA 4XPDB 4BMHA 3R9FA 1Q2DA 2BSWA 2HV2A 3PP9A 1OZPA 1XE4A 2RC4A 2FIAA 5JPHA 2Q04A 4R57A 2B5GB 5KTAA 3FXTA 4HKFA 4B14A 3BLNA 1B6BA 5G20A 4AG7A 3VWEA 3W6XA 2REEA 3MGDA 3GY9A 3CXPA 4ZGYB 2J8RA 1Q2YA 2OU2A 2JLMA 3DDDA 2BL1A 4KVME 3EFAA 4KOSA 4L8AA 4CYNA 2FCKA 2QIRA 4OAEA 2O28A 4C7HA 4AG9A 1UFHA 3IWEA 4XNHC 1IICA 2HQYA 1RXTA 3TO7A 2KCWA 5A28A 2OH1A 1SQHA 3A9LA 5C82A 2YGWA 4F6AA 2YNDA 3DNSA 4KUBA 1YK3A 4FD7A 5C88A 2GE3A 4Y49B 4C2ZA 1XIXA 2VBQA 3IGRA 3I3GA 1N71A 2I00A 2FL4A 5G21A 1M4DA 1M4GA 1XF8A 4C7IA 5KTDA 3B8GA 4NEXA 3FYNA 4CAWA 2CNMA 5E96A 1VKCA 5G22A 2H5MA 3H4QA 4H6UA 5H84A 4RI1A 2EUIA 2WSAA 5AG4A 4BBHA 3FIXA 1U6MA 2ARHA 4QVTA 1S7FA 3CXQA 1IB1E 1MJ9A 2OZHA 2R98A 4CGOA 3QB8A 4JXRA 4MFQA 4CGLA 1CJWA 3C26A 4PK3A 2B3UA 2HUZA 5EBVA 4JD6A 4FD6A 3TCVA 4MJ8A 5F49A 5CNPA 3F5BA 1Z4EA 1P0HA 1KZFA 4QUSA 2FT0A 4A32A 1YR0A 5KTCA 1QSTA 4Q36A 4PK2A 1S7NA 4AB7A 4MFJA 4UFWA 3EO4A 4A30A 4KOXA 1Y9KA 3S6KA 4KVXA 1S3ZA 4KOVA 3VWDA 1KUXA 2PRBA 1J4JA 4JJXA 5DWNA 1Z9UA 1RO5A 2ZW5A 4U9YA 4MFLA 2A4NA 2PSWA 1LRZA 2Q7BA 2VI7A 2FS5A 4MHDA 4H89A 4NF1A 3T90A 1XMTA 3P2FA 4JWPA 2Z3NA 2R7HA 2R8VA 4XPKA 4MBUA 1FY7A 4MY0A 2OZGA 4UCMA 2Y0MA 1YVKA 2IL4A 1M44A 2J8MA 3EXNA 4NSQA 1BO4A 2EVNA 4PSWA 2WPWA 3JTKA 4K30A 2R1IA 2B3VA 4A95A 2CXAA 1WWZA 2P6EA 2B4DA 4CRZB 5AG7A 4ZBGA 2QMLA 1Z4RA 2P6FA 4J3GA 2OZUA 1KUYA 1GHEA 4YFJA 4HNYB 1MK4A 4M85A 4C2XA 4CYQA 4CYPA 2Q4YA 2CNSA 4KOYA 2B4DB 3EY5A 3P2HA 2PC1A 3W91A 3G3SA 4KOWA 4QC6A 3T9YA 3UY5A 2D4OA 2FE7A 4B10A 1WK4A 4OADA 4XNHB 4PV6A 4ORFA 4R9MA 3GYAA 1YGHA 3LODA 4UCNA 4YGOA 1QSMA 4KORA 4JXQA 4KUAA 2X7BA 4HNWB 2JDCA 3TO6A 4KLVA 4XPLA 4B5PA 4B13A 5HMNA 3FNCA 4M3SA 1K4JA 1VHSA 1IYKA 1V0CA 4CS0B 1CM0A 4H6ZA 3E0KA 3R9GA 1QSRA 2FXFA 3IWGA 2CY2A 4B5PB 1QSNA 4FD4A 1S5KA 4DNCA 2K5TA 2DPSA 5GCNA 5HH1A 2VXKA 2Z0ZA 2CNTA 4GS4A 1QSOA 4X5KA 4CRYB 2J8NA 5IV0A 4R87A 2Q4VA 3NE7A 2DPTA 4KSFA 2G3TA 4OLLA 4AVAA 1M1DA 3KKWA 4CAVA 1YREA 5IB0A 3SXNA 1XEBA 2GIVA 2ZPAA 5F47A 2YNCC 4YRHA 4C68A 3TOBA 2Z3LA 4UA3A 4Q38A 4E2AA 1NSLA 3DR6A 1YLEA 3S6GA 2Z3PA 5BWAB 4FD5A 2QECA 1P4NA 5IX3A 2GANA 5EC4A 4XPDC 4KOUA 4KSAA 4PSXA 3D2MA 3TE4A 3BJ7A 5AG5A 1ON0A 4KZTA 2P0WA 5J8CA 1ZO0A 2Q44A 2Z10A 3V8IA 4U5YA 4II9A 4UFVA 4UWIA 1Y7RA 2BEIA 3DSBA 3FBUA 4CAEA 3FRMA 3F8KA 4IF5A 2B5GA 2ZXVA 2VEZA 1I12A 2I79A 4CGNA 3S6HA 1M4IA 2ZW4A 5A27A 2DXQA 1KUVA 3BJ8A 4HNXB 3SXOA 3F0AA 5J8FA 4NCZA 1S60A 3EC4A 3W6SA 4KS9A 2AJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7I A;  5A28 A;  4C2X A;  4CGO A;  4CYQ A;  4A33 A;  4B11 A;  4CAE A;  4CGM A;  2WUU A;  5AG6 A;  4UFW A;  4CYP A;  2YNE A;  4UCM A;  4B13 A;  4A30 A;  5AGE A;  4A31 A;  2YNC A;  2YND A;  4CGL A;  5G22 A;  4CGN A;  3IU1 A;  5A27 A;  3H5Z A;  3JTK A;  5AG5 A;  4CYN A;  2WSA A;  4A95 A;  4B10 A;  4UCP A;  4CGP A;  4C7H A;  5AG4 A;  4BBH A;  4B12 A;  4UFX A;  5AG7 A;  4CYO A;  4C2Z A;  4A2Z A;  3IWE A;  4A32 A;  2YNC C;  4C2Y A;  5G1Z A;  4C68 A;  4UCN A;  4B14 A;  4CAF A;  5G20 A;  3IU2 A;  5G21 A;  4UFV A; 
#chains in the Genus database with same CATH topology
 1TIQ A;  4F0Y A;  1CPS A;  4R8F A;  5FVJ A;  1H8L A;  2VL1 A;  4FAI A;  2WUU A;  2ZED A;  4MY3 A;  3TO9 A;  3TTH A;  2PJ6 A;  2YNE A;  4QB9 A;  2PR8 A;  4TNU A;  3PGP A;  2Z11 A;  2CTC A;  1CX8 A;  1AUG A;  3IFE A;  1M4L A;  2VZZ A;  3TX8 A;  1XRY A;  3CZX A;  4UEF A;  4OME A;  5F48 A;  1CBX A;  2D4P A;  4MRI A;  4MCP A;  3CXS A;  4CGP A;  2P6G A;  4KOT A;  5DWM A;  3D8P A;  4B5O A;  3PFO A;  3NH4 A;  2EK8 A;  3CPX A;  4Y49 C;  4L89 A;  1I1D A;  4CAF A;  2C6P A;  3N7Z A;  3K9U A;  3R96 A;  3IWW A;  3LD2 A;  1IYL A;  4UWJ A;  3TOA A;  1Z8X A;  4B11 A;  3G8W A;  1TF8 A;  4KLW A;  3RBU A;  5LRJ A;  2V8V A;  5CPA A;  5AGE A;  2O53 A;  1B87 A;  1Q2C A;  8CPA A;  5IV0 A;  4AVC A;  1IGB A;  1L0C A;  2G3A A;  2PJ8 A;  3ZJ0 A;  1I21 A;  3JVN A;  1LAN A;  4LQ6 A;  4NXY A;  4MI4 A;  2VZY A;  3D3S A;  4FWU A;  3H5Z A;  4KVO E;  1Y9W A;  3KAS A;  4QBJ A;  3LMS A;  5JQ4 A;  3DR8 A;  2ZW6 A;  3R1K A;  4NGT A;  4OC4 A;  5CBM A;  2Q0Y A;  4PXB A;  4UCP A;  3FB3 A;  1Z8T A;  4B12 A;  1PUA A;  4UFX A;  4CAX A;  4CYO A;  1Y7E A;  3D68 A;  1R57 A;  2WPX A;  4MXU A;  1YVO A;  5G1Z A;  5I0C A;  2OOT A;  2V77 A;  3FJU A;  2NMT A;  3I9S A;  4UBR A;  4UIB A;  4MFK A;  1TKJ A;  4B6Z A;  4E8O A;  4P44 A;  2PJB A;  3PB7 X;  1S7K A;  1PU9 A;  4CGM A;  1YME A;  3R9E A;  2G0B A;  3WR7 A;  3D7D A;  4I49 A;  4ONU A;  4F0X A;  4ZYQ A;  2JEW A;  2BCO A;  1MJA A;  2AFX A;  2PCU A;  4AVB A;  4NFR A;  4LX9 A;  1Z2L A;  5F46 A;  2IQ6 A;  5DS0 A;  3RYO A;  3PZJ A;  5LYD A;  2WZN A;  1BOB A;  1YX0 A;  1HDU A;  1FT7 A;  3BI1 A;  4C2Y A;  1JQG A;  2PIZ A;  2BUE A;  4P4J A;  2ZW7 A;  4P4E A;  3BI0 A;  2OB0 A;  4RS2 A;  4M6I A;  3R95 A;  2PIY A;  3DGV A;  3SHP A;  3SI1 A;  2PQ8 A;  4JYW A;  2VQY A;  3FVL A;  5H86 A;  3B2Y A;  5AG6 A;  2EK9 A;  2ATR A;  3D2P A;  4R6T A;  2GLF A;  2JBJ A;  2JEV A;  2PR1 A;  2REF A;  2YNC A;  4A31 A;  3FMC A;  4E0A A;  3TFY A;  2F5I A;  2B4B A;  3IU1 A;  4R3L A;  2GU2 A;  3MN8 A;  5K8P A;  1QMU A;  2AFO A;  4U9Z A;  1UWY A;  2B58 A;  2PVV A;  3H8F A;  5LRK A;  2IMO A;  2Z3O A;  1AMP A;  3QAH A;  4MFZ A;  1MJB A;  4A2Z A;  1IID A;  3GKR A;  2AE6 A;  1S7L A;  2PVW A;  3S6F A;  4LUA A;  1R3N A;  4RUH A;  3B3C A;  1NE9 A;  3QAY A;  2C27 A;  3IU2 A;  2Z3M A;  3OWC A;  4BD9 A;  2HC9 A;  2C1C A;  1DTD A;  3JUW A;  3S9L A;  2WYR A;  4IUS A;  3K2K A;  4MFP A;  4A33 A;  2Z3K A;  4K3N A;  4R3K A;  2POK A;  3TT2 A;  1NMT A;  4A38 A;  3MRU A;  2FSR A;  4JLY A;  1XMB A;  3ZZI A;  1VHO A;  2JDD A;  2PJ4 A;  5ISV A;  2FIW A;  2PDO A;  4EVY A;  4XPD B;  4BMH A;  3R9F A;  1Q2D A;  2BSW A;  4NGQ A;  4H2K A;  2HV2 A;  3PP9 A;  2ODF A;  2JBK A;  1OZP A;  4CPA A;  4MMO A;  1XE4 A;  3KL9 A;  2RC4 A;  2V8H A;  3SJE A;  2ZEH A;  2FIA A;  4WWV A;  5JPH A;  2Q04 A;  2ZEF A;  4R57 A;  3T8W A;  2B5G B;  5KTA A;  2GRE A;  3FXT A;  4HKF A;  2J9A A;  4B14 A;  3BLN A;  1B6B A;  2AFS A;  2ZEG A;  2FVG A;  2ZEP A;  5G20 A;  2GLJ A;  4AG7 A;  3VWE A;  5LYF A;  4X2T A;  2REE A;  4MCQ A;  3W6X A;  1EE3 P;  5ELY A;  3MGD A;  4IAV A;  3GY9 A;  3CXP A;  4ZGY B;  5D8N A;  1F2O A;  1A2Z A;  2J8R A;  5JH9 A;  1Q2Y A;  5IB9 A;  3WC5 A;  2OU2 A;  2JLM A;  4PXE A;  3DDD A;  2CTB A;  2BL1 A;  4KVM E;  2V8D A;  3GLJ A;  3EFA A;  3B7I A;  3PBE A;  4R7M A;  4KOS A;  4L8A A;  4F8Z A;  4CYN A;  2FCK A;  2C6G A;  4IK2 A;  4NJQ A;  2QIR A;  4OAE A;  2O28 A;  2PJ9 A;  4C7H A;  3ISX A;  4AG9 A;  1UFH A;  3IWE A;  4XNH C;  1IIC A;  1DE4 C;  2HQY A;  4Z65 A;  1RXT A;  4O23 A;  3TO7 A;  2KCW A;  3SJF A;  2GFQ A;  5A28 A;  2OH1 A;  4Q7A A;  2DEA A;  2ZEE A;  1LAP A;  1SQH A;  3A9L A;  5C82 A;  2YGW A;  4F6A A;  2YND A;  3FH4 A;  3DNS A;  2PJ7 A;  3KHZ A;  1IY7 A;  1YW4 A;  3KR5 A;  2RB7 A;  4KUB A;  4UIA A;  5K8O A;  1YK3 A;  3QNV A;  1LAM A;  2AFZ A;  4OP4 A;  4FD7 A;  5C88 A;  2GE3 A;  4X3R A;  3KQZ A;  4Y49 B;  4C2Z A;  1XIX A;  2VBQ A;  3S9N A;  3IGR A;  3I3G A;  1N71 A;  1LOK A;  2I00 A;  3GIU A;  2FL4 A;  2ZOF A;  4P45 A;  4LQG A;  1M4D A;  4P4F A;  1M4G A;  5G21 A;  3RAM A;  5HXD A;  1XF8 A;  1LCP A;  4C7I A;  4TWE A;  5JGF A;  4M6H A;  5KTD A;  3FEE A;  3B8G A;  4NEX A;  3FYN A;  1RTQ A;  3S9M A;  4CAW A;  2CNM A;  5E96 A;  1VKC A;  1Y0Y A;  2Q51 A;  5G22 A;  2H5M A;  4NGR A;  3H4Q A;  2PE3 A;  4H6U A;  3D7H A;  3B3W A;  3NA6 A;  5H84 A;  4MHN A;  4CRY B;  4RI1 A;  4OC0 A;  2EUI A;  2WSA A;  1CPX A;  4EWT A;  5AG4 A;  4BBH A;  2EWB A;  4NJR A;  2BOA A;  2BO9 A;  1VIX A;  3FIX A;  1U6M A;  3ISZ A;  2ARH A;  4EFD A;  4P10 A;  1BLL E;  4HPS A;  4QVT A;  1S7F A;  3CXQ A;  2DF5 A;  1IB1 E;  1MJ9 A;  2OZH A;  2R98 A;  4CGO A;  4YWY A;  3QB8 A;  4JXR A;  4MFQ A;  5THW A;  3NE8 A;  4CGL A;  2QYV A;  1XJO A;  3VAT A;  1ARM A;  1CJW A;  3C26 A;  2B3U A;  4PK3 A;  4A39 A;  2HUZ A;  5EBV A;  4JD6 A;  4FD6 A;  3TCV A;  5K8M A;  4MJ8 A;  1AYE A;  4OID A;  5F49 A;  5CNP A;  3HUV A;  3F5B A;  1Z4E A;  1P0H A;  3VAR A;  4MCR A;  1KZF A;  3CPA A;  5EMI A;  4FBE A;  4QUS A;  2FT0 A;  4A32 A;  2Q4Z A;  3WAB A;  1YR0 A;  4JZ0 A;  4KSI A;  3GUX A;  3PB8 X;  2EBJ A;  5KTC A;  7CPA A;  1QST A;  1LFW A;  5K8N A;  4Q36 A;  2QJ8 A;  3B35 A;  3D4U A;  4PK2 A;  1S7N A;  3H8G A;  4AB7 A;  4MFJ A;  4UFW A;  1IU8 A;  3EO4 A;  4A30 A;  4KOX A;  1Y9K A;  1XFO A;  2ZEO A;  4ZX8 A;  3S6K A;  4KVX A;  1S3Z A;  4KOV A;  3VWD A;  5LRG A;  1KUX A;  1Q7L A;  2PRB A;  4IHM A;  1J4J A;  1Y0R A;  4JJX A;  5DWN A;  1Z9U A;  1RO5 A;  2ZW5 A;  4U9Y A;  4MFL A;  2A4N A;  2PSW A;  1LRZ A;  2Q7B A;  2VI7 A;  2FS5 A;  4MHD A;  3PB4 X;  3PFE A;  4H89 A;  3FX6 A;  5I4M A;  4UEE A;  4NF1 A;  1YW6 A;  3T90 A;  4MHP A;  4ZY2 A;  2RFH A;  1XMT A;  3P2F A;  4JWP A;  2Z3N A;  3SI0 A;  3PBB A;  2R7H A;  2R8V A;  1BPM A;  4XPK A;  3PRT A;  4MBU A;  1FY7 A;  2I3C A;  4MY0 A;  4WJB A;  3B3T A;  3LAC A;  2OZG A;  4M6G A;  4UCM A;  2C6C A;  2Y0M A;  1BAV A;  1YVK A;  2IL4 A;  3DLJ A;  1M44 A;  4OC3 A;  2IJZ A;  2J8M A;  4ZY0 A;  3EXN A;  2ANP A;  1F57 A;  1KWM A;  4NSQ A;  1BO4 A;  2HB6 A;  1VGY A;  2EVN A;  4PSW A;  4ZX9 A;  2WPW A;  1ELM P;  3JTK A;  4K30 A;  2R1I A;  2ZEM A;  2B3V A;  2PRQ A;  4A95 A;  4PXC A;  4P4I A;  2CXA A;  1WWZ A;  3NH8 A;  4MHZ A;  2P6E A;  2B4D A;  3RO0 A;  4YU9 A;  5AG7 A;  4CRZ B;  4ZBG A;  2QML A;  4OIW A;  1Z4R A;  2CF4 A;  2P6F A;  4J3G A;  2OZU A;  2AFM A;  1KUY A;  2PJ3 A;  5HVH A;  1GHE A;  4YFJ A;  4EME A;  4HNY B;  1MK4 A;  4M85 A;  3VH9 A;  4C2X A;  3I1U A;  3CDX A;  3SJG A;  4CYQ A;  1YQE A;  2Q4Y A;  4CYP A;  2CNS A;  1X12 A;  4KOY A;  3NFZ A;  2B4D B;  2ZEL A;  3EY5 A;  3P2H A;  2PJ5 A;  4OC1 A;  2PC1 A;  3H8E A;  3W91 A;  3G3S A;  4KOW A;  1YSJ A;  4QC6 A;  1HEE A;  3T9Y A;  2NSM A;  1CG2 A;  3V38 A;  3UY5 A;  3BHX A;  3V7Z A;  1HDQ A;  3FF3 A;  2D4O A;  2FE7 A;  1NSA A;  4B10 A;  1WK4 A;  1TKH A;  4OAD A;  4P4B A;  2AFW A;  4PV6 A;  4ORF A;  4PQA A;  4R9M A;  4XNH B;  3GYA A;  1YGH A;  5F09 A;  3LOD A;  3GB0 A;  4UCN A;  4YGO A;  4DUK A;  1QSM A;  4ZI6 A;  2PJ1 A;  3BXM A;  4JXQ A;  4KOR A;  4P4D A;  3NH5 A;  5HVG A;  4KUA A;  2X7B A;  3KR4 A;  2PJ0 A;  4HNW B;  4UF4 A;  2Q43 A;  2JDC A;  2OR4 A;  3WC7 A;  3FEC A;  2ZEN A;  4F9U A;  3TO6 A;  5LYL A;  4KLV A;  4XPL A;  4B5P A;  4B13 A;  1ZG9 A;  5HMN A;  3RNZ A;  3FNC A;  4M3S A;  3PEI A;  1PYT B;  4PXD A;  4AXV A;  1IOI A;  1K4J A;  1VHS A;  1YLO A;  1IYK A;  1V0C A;  3IEH A;  5JM6 A;  4CS0 B;  3B3S A;  1CM0 A;  2F7V A;  4H6Z A;  3E0K A;  3KI9 A;  1CP7 A;  3N5F A;  3R9G A;  1QSR A;  1ZG8 A;  2FXF A;  3IO1 A;  3IWG A;  1GYT A;  2CY2 A;  3KGQ A;  4B5P B;  4BIN A;  1QSN A;  3HLP A;  4OKO A;  1Z5R A;  3L2N A;  1S5K A;  3PB6 X;  3CT9 A;  2ZOG A;  4FD4 A;  4OC2 A;  4DNC A;  2K5T A;  2DPS A;  5GCN A;  5HH1 A;  4F9V A;  4NGS A;  1QQ9 A;  2VXK A;  4RN7 A;  4P6Y A;  2F8H A;  2CNT A;  2Z0Z A;  3B3V A;  1QSO A;  3JRU A;  3K9T A;  4GS4 A;  1TXR A;  2XEI A;  4X5K A;  5D29 A;  2CIJ A;  1Z8L A;  1IOF A;  2J8N A;  3KZW A;  4R87 A;  2Q4V A;  3WT4 A;  1TKF A;  3NE7 A;  3SI2 A;  5J1Q A;  2DPT A;  3KQX A;  4KSF A;  3D7G A;  2G3T A;  2PJ2 A;  6CPA A;  4OLL A;  4AVA A;  1M1D A;  2EO8 A;  3KKW A;  1ELL P;  4GM5 A;  1YRE A;  3TC8 A;  4CAV A;  5IB0 A;  3SXN A;  1XEB A;  4OC5 A;  3IIB A;  3LWU A;  2GIV A;  2ZPA A;  4MHY A;  2Q7S A;  2G9D A;  2YNC C;  5F47 A;  4YRH A;  4C68 A;  4X8I A;  3TOB A;  1XBU A;  2Z3L A;  2PJC A;  3KHX A;  4UA3 A;  4MCS A;  1ARL A;  1TF9 A;  3D7F A;  4Q38 A;  4E2A A;  1NSL A;  3D67 A;  1CP6 A;  2AFU A;  1YLE A;  3DR6 A;  1XOV A;  3S6G A;  1F2P A;  2ABZ A;  2Z3P A;  5BWA B;  4FD5 A;  2QEC A;  1P4N A;  4G1P A;  4ZY1 A;  5IX3 A;  4NGP A;  5HVF A;  2GAN A;  5EC4 A;  4XPD C;  4KOU A;  3D66 A;  4KSA A;  4PSX A;  3D2M A;  1Z8W A;  3TE4 A;  3BJ7 A;  5AG5 A;  2V8G A;  4W9Y A;  1ON0 A;  4UEZ A;  4KZT A;  1FNO A;  2P0W A;  3RZA A;  5J8C A;  1PCA A;  2O4H A;  2XEG A;  1ZO0 A;  2Q44 A;  1ZG7 A;  2Z10 A;  3V8I A;  1VHE A;  4DJL A;  3SJX A;  2NYQ A;  2QVP A;  1ZLI A;  4U5Y A;  4II9 A;  3IJ3 A;  4UFV A;  4ONW A;  1Y7R A;  2BEI A;  3DSB A;  3FBU A;  4UWI A;  4CAE A;  3FRM A;  3F8K A;  1OBR A;  4IF5 A;  2PJA A;  2B5G A;  2ZXV A;  2VEZ A;  4DYO A;  1I12 A;  1BPN A;  3WC6 A;  1X10 A;  2I79 A;  4CGN A;  4NGN A;  2XEF A;  4R76 A;  3S6H A;  1M4I A;  2ZW4 A;  5A27 A;  2DXQ A;  1ZLH A;  1KUV A;  4A37 A;  5LYI A;  3IC1 A;  2XEJ A;  3BJ8 A;  4HNX B;  3SXO A;  3F0A A;  5J8F A;  4PPZ A;  4A94 A;  4FUU A;  1JWQ A;  4GXH A;  4NCZ A;  1S60 A;  4NGM A;  3EC4 A;  3W6S A;  4KS9 A;  1R43 A;  2AJ6 A;  3FED A;  3PB9 X; 
#chains in the Genus database with same CATH homology
 1TIQ A;  4F0Y A;  5FVJ A;  2WUU A;  4MY3 A;  3TO9 A;  3TTH A;  2YNE A;  4QB9 A;  2PR8 A;  3PGP A;  2Z11 A;  2VZZ A;  5F48 A;  2D4P A;  3CXS A;  4CGP A;  2P6G A;  4KOT A;  5DWM A;  3D8P A;  4B5O A;  4Y49 C;  4L89 A;  1I1D A;  4CAF A;  3N7Z A;  3K9U A;  3R96 A;  3LD2 A;  1IYL A;  4UWJ A;  3TOA A;  4B11 A;  3G8W A;  4KLW A;  5AGE A;  1B87 A;  1Q2C A;  4AVC A;  1L0C A;  2G3A A;  3ZJ0 A;  1I21 A;  3JVN A;  4NXY A;  4MI4 A;  2VZY A;  3D3S A;  3H5Z A;  4KVO E;  1Y9W A;  5JQ4 A;  4QBJ A;  3DR8 A;  2ZW6 A;  3R1K A;  2Q0Y A;  4UCP A;  3FB3 A;  4B12 A;  1PUA A;  4UFX A;  4CAX A;  4CYO A;  1R57 A;  2WPX A;  1YVO A;  5G1Z A;  5I0C A;  2NMT A;  3I9S A;  4UBR A;  4MFK A;  4E8O A;  4CGM A;  1S7K A;  1PU9 A;  3R9E A;  2G0B A;  3WR7 A;  4I49 A;  4ONU A;  4F0X A;  1MJA A;  4AVB A;  4LX9 A;  5F46 A;  3RYO A;  3PZJ A;  1BOB A;  1YX0 A;  4C2Y A;  2BUE A;  2ZW7 A;  2OB0 A;  4RS2 A;  3R95 A;  3SHP A;  2PQ8 A;  2VQY A;  5H86 A;  5AG6 A;  3D2P A;  2ATR A;  2PR1 A;  2JEV A;  2YNC A;  2REF A;  4A31 A;  3TFY A;  4E0A A;  2F5I A;  2B4B A;  3IU1 A;  4R3L A;  4U9Z A;  2B58 A;  2Z3O A;  3QAH A;  4MFZ A;  1MJB A;  4A2Z A;  1IID A;  3GKR A;  2AE6 A;  1S7L A;  3S6F A;  4LUA A;  1NE9 A;  2C27 A;  3IU2 A;  2Z3M A;  3OWC A;  3JUW A;  4IUS A;  4MFP A;  4A33 A;  2Z3K A;  4R3K A;  3TT2 A;  1NMT A;  2FSR A;  4JLY A;  3ZZI A;  2JDD A;  5ISV A;  2FIW A;  2PDO A;  4EVY A;  4XPD B;  4BMH A;  3R9F A;  1Q2D A;  2BSW A;  2HV2 A;  3PP9 A;  1OZP A;  1XE4 A;  2RC4 A;  2FIA A;  5JPH A;  2Q04 A;  4R57 A;  2B5G B;  5KTA A;  3FXT A;  4HKF A;  4B14 A;  3BLN A;  1B6B A;  5G20 A;  4AG7 A;  3VWE A;  3W6X A;  2REE A;  3MGD A;  3GY9 A;  3CXP A;  4ZGY B;  2J8R A;  1Q2Y A;  2OU2 A;  2JLM A;  3DDD A;  2BL1 A;  4KVM E;  3EFA A;  4KOS A;  4L8A A;  4CYN A;  2FCK A;  2QIR A;  4OAE A;  2O28 A;  4C7H A;  4AG9 A;  1UFH A;  3IWE A;  4XNH C;  1IIC A;  2HQY A;  1RXT A;  3TO7 A;  2KCW A;  5A28 A;  2OH1 A;  1SQH A;  3A9L A;  5C82 A;  2YGW A;  4F6A A;  2YND A;  3DNS A;  4KUB A;  1YK3 A;  4FD7 A;  5C88 A;  2GE3 A;  4Y49 B;  4C2Z A;  1XIX A;  2VBQ A;  3IGR A;  3I3G A;  1N71 A;  2I00 A;  2FL4 A;  5G21 A;  1M4D A;  1M4G A;  1XF8 A;  4C7I A;  5KTD A;  3B8G A;  4NEX A;  3FYN A;  4CAW A;  2CNM A;  5E96 A;  1VKC A;  5G22 A;  2H5M A;  3H4Q A;  4H6U A;  5H84 A;  4RI1 A;  2EUI A;  2WSA A;  5AG4 A;  4BBH A;  3FIX A;  1U6M A;  2ARH A;  4QVT A;  1S7F A;  3CXQ A;  1IB1 E;  1MJ9 A;  2OZH A;  2R98 A;  4CGO A;  3QB8 A;  4JXR A;  4MFQ A;  4CGL A;  1CJW A;  3C26 A;  4PK3 A;  2B3U A;  2HUZ A;  5EBV A;  4JD6 A;  4FD6 A;  3TCV A;  4MJ8 A;  5F49 A;  5CNP A;  3F5B A;  1Z4E A;  1P0H A;  1KZF A;  4QUS A;  2FT0 A;  4A32 A;  1YR0 A;  5KTC A;  1QST A;  4Q36 A;  4PK2 A;  1S7N A;  4AB7 A;  4MFJ A;  4UFW A;  3EO4 A;  4A30 A;  4KOX A;  1Y9K A;  3S6K A;  4KVX A;  1S3Z A;  4KOV A;  3VWD A;  1KUX A;  2PRB A;  1J4J A;  4JJX A;  5DWN A;  1Z9U A;  1RO5 A;  2ZW5 A;  4U9Y A;  4MFL A;  2A4N A;  2PSW A;  1LRZ A;  2Q7B A;  2VI7 A;  2FS5 A;  4MHD A;  4H89 A;  4NF1 A;  3T90 A;  1XMT A;  3P2F A;  4JWP A;  2Z3N A;  2R7H A;  2R8V A;  4XPK A;  4MBU A;  1FY7 A;  4MY0 A;  2OZG A;  4UCM A;  2Y0M A;  1YVK A;  2IL4 A;  1M44 A;  2J8M A;  3EXN A;  4NSQ A;  1BO4 A;  2EVN A;  4PSW A;  2WPW A;  3JTK A;  4K30 A;  2R1I A;  2B3V A;  4A95 A;  2CXA A;  1WWZ A;  2P6E A;  2B4D A;  4CRZ B;  5AG7 A;  4ZBG A;  2QML A;  1Z4R A;  2P6F A;  4J3G A;  2OZU A;  1KUY A;  1GHE A;  4YFJ A;  4HNY B;  1MK4 A;  4M85 A;  4C2X A;  4CYQ A;  4CYP A;  2Q4Y A;  2CNS A;  4KOY A;  2B4D B;  3EY5 A;  3P2H A;  2PC1 A;  3W91 A;  3G3S A;  4KOW A;  4QC6 A;  3T9Y A;  3UY5 A;  2D4O A;  2FE7 A;  4B10 A;  1WK4 A;  4OAD A;  4XNH B;  4PV6 A;  4ORF A;  4R9M A;  3GYA A;  1YGH A;  3LOD A;  4UCN A;  4YGO A;  1QSM A;  4KOR A;  4JXQ A;  4KUA A;  2X7B A;  4HNW B;  2JDC A;  3TO6 A;  4KLV A;  4XPL A;  4B5P A;  4B13 A;  5HMN A;  3FNC A;  4M3S A;  1K4J A;  1VHS A;  1IYK A;  1V0C A;  4CS0 B;  1CM0 A;  4H6Z A;  3E0K A;  3R9G A;  1QSR A;  2FXF A;  3IWG A;  2CY2 A;  4B5P B;  1QSN A;  4FD4 A;  1S5K A;  4DNC A;  2K5T A;  2DPS A;  5GCN A;  5HH1 A;  2VXK A;  2Z0Z A;  2CNT A;  4GS4 A;  1QSO A;  4X5K A;  4CRY B;  2J8N A;  5IV0 A;  4R87 A;  2Q4V A;  3NE7 A;  2DPT A;  4KSF A;  2G3T A;  4OLL A;  4AVA A;  1M1D A;  3KKW A;  4CAV A;  1YRE A;  5IB0 A;  3SXN A;  1XEB A;  2GIV A;  2ZPA A;  5F47 A;  2YNC C;  4YRH A;  4C68 A;  3TOB A;  2Z3L A;  4UA3 A;  4Q38 A;  4E2A A;  1NSL A;  3DR6 A;  1YLE A;  3S6G A;  2Z3P A;  5BWA B;  4FD5 A;  2QEC A;  1P4N A;  5IX3 A;  2GAN A;  5EC4 A;  4XPD C;  4KOU A;  4KSA A;  4PSX A;  3D2M A;  3TE4 A;  3BJ7 A;  5AG5 A;  1ON0 A;  4KZT A;  2P0W A;  5J8C A;  1ZO0 A;  2Q44 A;  2Z10 A;  3V8I A;  4U5Y A;  4II9 A;  4UFV A;  4UWI A;  1Y7R A;  2BEI A;  3DSB A;  3FBU A;  4CAE A;  3FRM A;  3F8K A;  4IF5 A;  2B5G A;  2ZXV A;  2VEZ A;  1I12 A;  2I79 A;  4CGN A;  3S6H A;  1M4I A;  2ZW4 A;  5A27 A;  2DXQ A;  1KUV A;  3BJ8 A;  4HNX B;  3SXO A;  3F0A A;  5J8F A;  4NCZ A;  1S60 A;  3EC4 A;  3W6S A;  4KS9 A;  2AJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...