4C68A

Plasmodium vivax n-myristoyltransferase in complex with a peptidomimetic inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
383
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 383
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c68A00
2YNCC 4A2ZA 4B13A 5G21A 2YNCA 2WSAA 3IU2A 5AG6A 4A95A 4CAFA 4CAEA 4CGLA 4CYPA 4CGOA 4BBHA 4C7IA 5A28A 4C2YA 5G20A 4B10A 4C68A 2YNDA 5AGEA 4B12A 4CGPA 3IWEA 4C2ZA 4CGMA 3H5ZA 4UFXA 4UCMA 4B14A 5G1ZA 3IU1A 2WUUA 4B11A 4CYOA 4UCNA 5AG4A 4A32A 4UFWA 4C2XA 4CYQA 4A30A 2YNEA 3JTKA 5AG5A 4C7HA 5A27A 4UCPA 5G22A 4A33A 4UFVA 5AG7A 4CYNA 4A31A 4CGNA
chains in the Genus database with same CATH superfamily
1IOFA 3I9SA 4OC2A 4YFJA 4WJBA 2GLJA 1Y7EA 3DLJA 3E0KA 2AFSA 4KLWA 4CAFA 2IMOA 4FD5A 2B58A 2JDDA 1WK4A 3LODA 4C2YA 4IK2A 4DUKA 3P2FA 4M6IA 4KORA 4XPKA 3WC7A 3W91A 4UWIA 1VGYA 2DPTA 4X5KA 1HDQA 2V77A 1P0HA 3ZJ0A 2WYRA 1LOKA 2B5GA 3GUXA 5LRJA 2JLMA 1YLOA 2I79A 2ZOFA 2C1CA 2PSWA 1M4GA 4R7MA 2X7BA 3FVLA 1XJOA 2Z3NA 1YR0A 3KQXA 4NGQA 3KR4A 2R1IA 1AYEA 5KTDA 4KOVA 1Z2LA 4PK3A 3FEEA 3S6FA 1Q2YA 1R3NA 2Z3OA 4IF5A 2Q04A 3BJ7A 4E0AA 3R9GA 2R7HA 1S60A 1CPXA 5JH9A 4AG7A 4CYNA 4EVYA 4R87A 4HKFA 4C68A 2CF4A 1XBUA 1Z4RA 2F5IA 4IHMA 2ZEMA 1IGBA 5F48A 2J9AA 4IUSA 3QNVA 2Q4YA 2PC1A 4A32A 4Z65A 2ZW7A 2F8HA 1Y7RA 2JBJA 5EMIA 3UY5A 3VATA 3SJFA 2BOAA 3KKWA 1ELLP 4YWYA 1Y9WA 1OZPA 3LD2A 3R95A 2Z3LA 2PJ4A 2FT0A 1NMTA 3WC6A 3BLNA 4P6YA 1IYLA 2J8MA 2AJ6A 4YRHA 2D4OA 4MFLA 1XOVA 1H8LA 4GM5A 2JBKA 3LMSA 1IU8A 4K30A 4MY3A 2ZEPA 5EC4A 4CGPA 4DYOA 7CPAA 4O23A 4ZX8A 3TFYA 2ABZA 4LQGA 4OAEA 1NSLA 1VIXA 1WWZA 2B4BA 4UFXA 2WPWA 4L8AA 1RO5A 2EBJA 1ZLIA 2PRBA 2DF5A 1KUYA 4NXYA 4R9MA 2IJZA 3F5BA 3FXTA 2PCUA 3SJGA 4UCPA 1CM0A 3D67A 3PP9A 4UA3A 2VI7A 4RN7A 4ZI6A 1R43A 3PB6X 1LAMA 1EE3P 2Q0YA 4U9YA 3B8GA 4JJXA 1KUXA 2HUZA 2PJAA 2QJ8A 2ZENA 3I1UA 1QMUA 4UEFA 5F47A 4MHDA 4BBHA 1QSRA 2VEZA 4NGRA 4MRIA 3SJXA 3D7HA 2Z0ZA 1ZLHA 5LRGA 1QQ9A 2FCKA 3R96A 4KSIA 4KOWA 2R98A 1HEEA 4OP4A 4C2ZA 1R57A 2FIWA 3TO7A 3H5ZA 4CPAA 5I4MA 4XNHB 3SI0A 4NGMA 3MN8A 2JDCA 1ZG9A 2JEVA 2ZOGA 4NSQA 4OADA 4F9VA 5F49A 2PQ8A 4PXCA 4ONUA 3RBUA 3NE8A 1XE4A 5DS0A 4P44A 3BI0A 4CRZB 2CNSA 1Q2DA 3MRUA 2OR4A 4UFVA 1IOIA 3CDXA 3T8WA 2V8GA 4MHNA 4CAEA 5CNPA 4JYWA 3B3TA 3SI1A 4MMOA 4MCPA 3VARA 1BAVA 3I3GA 8CPAA 3BHXA 4OC4A 3SHPA 2I00A 5THWA 3S9LA 2ZELA 4UBRA 2ZEHA 4R76A 3RYOA 2ZPAA 2WPXA 1YREA 4G1PA 3FH4A 3HUVA 4Y49B 3R1KA 4JLYA 1BPNA 4QVTA 4CAWA 2R8VA 4NGPA 2OH1A 4H2KA 2DXQA 3B3VA 4ONWA 4B5PB 2QECA 1I1DA 4FWUA 4NGNA 3KASA 3H8FA 2ATRA 2BUEA 3BI1A 1M4IA 1DE4C 2G3TA 3PBEA 1YMEA 2AFUA 2OB0A 3PB4X 3TT2A 2H5MA 4F0XA 4F9UA 5G21A 1LFWA 2PJ6A 4TWEA 5ELYA 4E2AA 5JPHA 5I0CA 2G9DA 2D4PA 1HDUA 2Z3MA 2ZEOA 5LYIA 2ZXVA 3NFZA 4KVXA 3GY9A 5AGEA 3TCVA 4QUSA 1Q7LA 4ZBGA 4KVOE 2HV2A 4PSWA 1ZO0A 3V8IA 5HH1A 2O28A 3CXQA 1I21A 1M1DA 4NCZA 5AG4A 3WABA 3PFOA 4TNUA 3FECA 1N71A 4KOXA 3JVNA 1S7KA 4AB7A 4JZ0A 3FMCA 2PR8A 4ZYQA 3H8EA 4EWTA 4BD9A 3KHZA 1Y0YA 1QSTA 2OZUA 3KQZA 2FE7A 4H6UA 2PVVA 1YW4A 2CTCA 3IWGA 2ODFA 3TOBA 1Q2CA 3TE4A 3IO1A 4B5PA 2YNDA 2CNMA 2POKA 3IC1A 3IWEA 3OWCA 5HVGA 1L0CA 1TF8A 2EK8A 2OZGA 4OIDA 1BO4A 4UCMA 1MJAA 4MCQA 2WUUA 4U5YA 2VBQA 1TKFA 1PCAA 5C82A 1SQHA 5KTCA 2P0WA 3JTKA 3PGPA 5IB0A 4PSXA 2FSRA 3DDDA 4KSFA 3KHXA 4PXDA 3FRMA 4JXQA 2C27A 3WT4A 5F09A 4XPDC 1S7FA 2EUIA 3NE7A 1I12A 5HVFA 4ZX9A 4F6AA 1IICA 2FL4A 1S7LA 4UWJA 4X3RA 3F0AA 1PUAA 1B6BA 1MK4A 3K9UA 2PJ0A 3NH5A 1GYTA 5F46A 1ZG8A 4P10A 2Q4ZA 1JQGA 1YVKA 2EVNA 5G1ZA 3IU1A 1Z4EA 5LYLA 3PRTA 2AFZA 2OOTA 3RO0A 3D7GA 4KOYA 4PV6A 2VXKA 3IJ3A 2VQYA 4MFPA 4MY0A 2C6CA 1Y0RA 4KUAA 3D7FA 1QSOA 4HNYB 2PRQA 5DWMA 4KOTA 2B3UA 3JUWA 3VWEA 4B13A 4KSAA 3R9EA 4A95A 4CGLA 2REEA 3EY5A 1CP6A 2QIRA 3V7ZA 5K8PA 4P4JA 3G3SA 2ZEGA 2BCOA 1CJWA 3FYNA 1J4JA 2Z3PA 2AFMA 4MI4A 2AFOA 2PJ2A 4B10A 3GKRA 4OC0A 5H84A 4B12A 2FIAA 3GYAA 4AVCA 1P4NA 5GCNA 3FB3A 1TXRA 4UEZA 3DNSA 3W6XA 2V8DA 3LWUA 4MFQA 4LX9A 1FNOA 2PVWA 3GIUA 4MHZA 2I3CA 2J8RA 1RTQA 3FX6A 4L89A 4FUUA 4P4DA 4B11A 4F8ZA 4AVAA 4R3LA 4UCNA 5K8OA 5HVHA 1AUGA 4PPZA 1FY7A 3JRUA 5J1QA 3EXNA 2Z3KA 2ZW5A 4RI1A 2DPSA 1Y9KA 2PJ5A 4OLLA 4NEXA 3SXNA 2VZYA 2XEGA 3BJ8A 2G3AA 4P4FA 2KCWA 4A2ZA 4II9A 2YNCA 3IU2A 4BINA 3ISZA 2J8NA 5E96A 4RS2A 3KR5A 3PB8X 4ZY0A 2Q51A 5G20A 2BSWA 3FBUA 4P45A 4AVBA 2Q4VA 1TKJA 4UIBA 4P4EA 3D7DA 3CT9A 4MBUA 2HQYA 4ORFA 4U9ZA 4AG9A 3A9LA 4KZTA 3B3CA 2RB7A 4QC6A 4R8FA 4CGMA 1MJBA 1YW6A 4P4IA 3H4QA 2DEAA 3D66A 4JWPA 4MHYA 3B2YA 4KVME 4KLVA 1Z9UA 1QSNA 4J3GA 1VHEA 2VZZA 4FD7A 4MXUA 4A38A 1PYTB 4RUHA 3S9MA 4H89A 4C7HA 4JXRA 3RZAA 2ZW6A 4OC3A 1TIQA 4MFKA 2PJ7A 3S6HA 3N5FA 3F8KA 4GXHA 3D8PA 5CPAA 1XIXA 4QBJA 1Z8LA 1Z8WA 1LANA 5AG6A 2WSAA 3H8GA 4MFZA 2C6PA 3TTHA 3V38A 2F7VA 1DTDA 2CY2A 3EFAA 2BEIA 3DR6A 1BPMA 2QYVA 5A28A 3PZJA 3IFEA 4Q7AA 1XFOA 5C88A 4W9YA 1IB1E 2RC4A 4OKOA 4LUAA 4DJLA 2PIYA 2CIJA 3MGDA 4XPLA 3PB9X 4JD6A 4R57A 3RAMA 1M4LA 1K4JA 2XEIA 1CG2A 3NH8A 2ARHA 2PR1A 5JQ4A 5K8MA 4R3KA 4DNCA 3FF3A 4NJQA 4MCRA 3K2KA 5G22A 4FD4A 3GB0A 2GU2A 2Z10A 3FNCA 3IWWA 5BWAB 4A37A 3QAHA 2EO8A 4XNHC 2P6FA 2OU2A 4EMEA 2AFXA 6CPAA 3R9FA 2GFQA 2O4HA 3TO6A 2PDOA 4H6ZA 3TX8A 5LYFA 3B3WA 1NE9A 1UFHA 3CPXA 5HMNA 1YK3A 1KWMA 1ZG7A 3BXMA 2PIZA 4KS9A 5HXDA 5LRKA 3B35A 1NSAA 1YGHA 1YVOA 2ZEFA 3FEDA 2VL1A 2CXAA 4M6HA 4CYQA 4KOSA 5D29A 4A39A 5J8CA 1VHOA 2V8VA 2YNEA 4MFJA 4A94A 1OBRA 2P6GA 5IX3A 5JM6A 5J8FA 3EO4A 1Z8XA 3DR8A 4OMEA 3SXOA 3WC5A 4CGNA 5JGFA 3S9NA 2BO9A 1Z8TA 1S5KA 1JWQA 3D4UA 3W6SA 4Y49C 2O53A 3DSBA 4B6ZA 4CGOA 4CAXA 1RXTA 3WR7A 1BLLE 1XEBA 1PU9A 4CS0B 4WWVA 3T90A 3S6GA 4NGTA 5H86A 3FIXA 5CBMA 5EBVA 1S3ZA 3S6KA 1FT7A 3NA6A 1X10A 3LACA 4OIWA 3P2HA 2GE3A 4NJRA 5K8NA 1CBXA 4FAIA 1LRZA 3B3SA 3VH9A 4F0YA 2PJ9A 1B87A 2YGWA 4UF4A 5AG5A 1F2PA 1UWYA 4ZY2A 2B4DB 2RFHA 4A33A 5KTAA 3ZZIA 3DGVA 1TKHA 4LQ6A 2HB6A 1M4DA 5FVJA 3QAYA 4CYPA 3K9TA 4IAVA 4BMHA 1XMTA 4E8OA 3NH4A 2IQ6A 2ZEDA 1AMPA 2B3VA 2G0BA 4M85A 1F2OA 3CPAA 1BOBA 2NMTA 3TC8A 4CRYB 1F57A 3TOAA 3CZXA 2AFWA 3PEIA 2QVPA 3IEHA 2XEJA 2PJCA 5D8NA 2GLFA 2Q43A 1ON0A 3G8WA 2OZHA 2PJBA 1M44A 3D2MA 3N7ZA 3PFEA 4HPSA 4UFWA 4C2XA 3IGRA 4FD6A 4I49A 4EFDA 2EK9A 1MJ9A 2PE3A 1YQEA 3KGQA 4YU9A 1QSMA 4PK2A 2C6GA 2GREA 2IL4A 5A27A 1IIDA 4NGSA 4HNWB 2PJ1A 4M3SA 2FVGA 3QB8A 4CAVA 2EWBA 2FXFA 2Y0MA 3GLJA 2A4NA 4NF1A 1XF8A 4KOUA 4K3NA 1Z5RA 4KUBA 3D2PA 4OC1A 2Q7SA 2JEWA 3B7IA 3CXSA 1XMBA 2CTBA 2XEFA 1XRYA 2HC9A 2NYQA 2FS5A 3KL9A 1KUVA 1LCPA 1V0CA 2GIVA 2QMLA 1LAPA 1VKCA 3PB7X 2P6EA 2B4DA 4HNXB 5ISVA 1GHEA 1KZFA 5IV0A 4CYOA 4Q36A 2CNTA 4MJ8A 4A30A 2WZNA 4PQAA 3KZWA 4MHPA 2Q7BA 3C26A 3IIBA 3SJEA 4X8IA 2Q44A 2Z11A 3KI9A 4AXVA 4B5OA 2B5GB 5DWNA 4C7IA 3PBBA 4A31A 4UIAA 1YX0A 2AE6A 3D3SA 3ISXA 2YNCC 4YGOA 3RNZA 1X12A 3L2NA 2ZW4A 4P4BA 4ZY1A 1YLEA 3EC4A 1CX8A 3SI2A 5LYDA 3T9YA 2PJ3A 2PJ8A 2REFA 1S7NA 2NSMA 3CXPA 4QB9A 4UEEA 1ARLA 1IY7A 4XPDB 4OC5A 4M6GA 2GANA 4X2TA 1CPSA 4B14A 2K5TA 4FBEA 1VHSA 4GS4A 3FJUA 1A2ZA 2BL1A 4PXEA 4R6TA 3HLPA 4PXBA 1ELMP 5IB9A 3D68A 1IYKA 1TF9A 2ANPA 5AG7A 1U6MA 2V8HA 3VWDA 4NFRA 1CP7A 1YSJA 4ZGYB 4Q38A 4MCSA 3TO9A 1ARMA 2ZEEA
chains in the Genus database with same CATH topology
3I9SA 4YFJA 3E0KA 4KLWA 4CAFA 4FD5A 2B58A 2JDDA 1WK4A 3LODA 4C2YA 3P2FA 4XPKA 4KORA 3W91A 4UWIA 2DPTA 4X5KA 1P0HA 3ZJ0A 2B5GA 2JLMA 2I79A 2PSWA 1M4GA 2X7BA 2Z3NA 1YR0A 2R1IA 5KTDA 4KOVA 4PK3A 3S6FA 1Q2YA 4IF5A 2Z3OA 2Q04A 3BJ7A 4E0AA 3R9GA 2R7HA 1S60A 4AG7A 4EVYA 4R87A 4HKFA 4C68A 1Z4RA 2F5IA 5F48A 4IUSA 2Q4YA 2PC1A 4A32A 2ZW7A 1Y7RA 3UY5A 3KKWA 1Y9WA 1OZPA 3LD2A 3R95A 2Z3LA 2FT0A 1NMTA 3BLNA 1IYLA 2J8MA 2AJ6A 4YRHA 2D4OA 4MFLA 4K30A 4MY3A 5EC4A 4CGPA 3TFYA 4OAEA 1NSLA 1WWZA 2B4BA 4UFXA 2WPWA 4L8AA 1RO5A 2PRBA 1KUYA 4NXYA 4R9MA 3F5BA 3FXTA 4UCPA 1CM0A 3PP9A 4UA3A 2VI7A 2Q0YA 4U9YA 3B8GA 4JJXA 1KUXA 2HUZA 5F47A 4MHDA 4BBHA 1QSRA 2VEZA 2Z0ZA 2FCKA 3R96A 4KOWA 2R98A 4C2ZA 1R57A 2FIWA 3TO7A 3H5ZA 4XNHB 4OADA 2JDCA 2JEVA 4NSQA 5F49A 2PQ8A 4ONUA 1XE4A 4CRZB 2CNSA 1Q2DA 4UFVA 4CAEA 5CNPA 3I3GA 3SHPA 2I00A 4UBRA 3RYOA 2ZPAA 2WPXA 1YREA 4Y49B 3R1KA 4JLYA 4QVTA 4CAWA 2R8VA 2OH1A 2DXQA 4B5PB 2QECA 1I1DA 2ATRA 2BUEA 1M4IA 2G3TA 2OB0A 3TT2A 2H5MA 4F0XA 5G21A 4E2AA 5JPHA 5I0CA 2D4PA 2Z3MA 2ZXVA 4KVXA 3GY9A 5AGEA 3TCVA 4QUSA 4ZBGA 4KVOE 2HV2A 4PSWA 1ZO0A 3V8IA 5HH1A 2O28A 3CXQA 1I21A 1M1DA 4NCZA 5AG4A 1N71A 4KOXA 3JVNA 1S7KA 4AB7A 2PR8A 1QSTA 2OZUA 2FE7A 4H6UA 3IWGA 3TOBA 1Q2CA 3TE4A 4B5PA 2YNDA 2CNMA 3IWEA 3OWCA 1L0CA 2OZGA 1BO4A 4UCMA 1MJAA 2WUUA 4U5YA 2VBQA 5C82A 1SQHA 5KTCA 2P0WA 3JTKA 3PGPA 5IB0A 4PSXA 2FSRA 3DDDA 4KSFA 3FRMA 4JXQA 2C27A 4XPDC 1S7FA 2EUIA 3NE7A 1I12A 4F6AA 1IICA 2FL4A 1S7LA 4UWJA 3F0AA 1PUAA 1B6BA 1MK4A 3K9UA 5F46A 1YVKA 2EVNA 5G1ZA 3IU1A 1Z4EA 4KOYA 4PV6A 2VXKA 2VQYA 4MY0A 4KUAA 1QSOA 4HNYB 5DWMA 4KOTA 2B3UA 3JUWA 3VWEA 4B13A 4KSAA 3R9EA 4A95A 4CGLA 2REEA 3EY5A 2QIRA 3G3SA 1CJWA 3FYNA 1J4JA 2Z3PA 4MI4A 4B10A 3GKRA 5H84A 4B12A 2FIAA 3GYAA 4AVCA 1P4NA 5GCNA 3FB3A 3W6XA 3DNSA 4MFQA 4LX9A 2J8RA 4L89A 4B11A 4AVAA 4R3LA 4UCNA 1FY7A 3EXNA 2Z3KA 2ZW5A 4RI1A 2DPSA 1Y9KA 4OLLA 4NEXA 3SXNA 2VZYA 3BJ8A 2G3AA 2KCWA 4A2ZA 4II9A 2YNCA 3IU2A 2J8NA 5E96A 4RS2A 5G20A 2BSWA 3FBUA 4AVBA 2Q4VA 4MBUA 4ORFA 2HQYA 4AG9A 4U9ZA 3A9LA 4KZTA 4QC6A 4CGMA 1MJBA 3H4QA 4JWPA 4KVME 4KLVA 1Z9UA 1QSNA 4J3GA 2VZZA 4FD7A 4C7HA 4H89A 4JXRA 2ZW6A 1TIQA 4MFKA 3S6HA 3F8KA 3D8PA 1XIXA 4QBJA 5AG6A 2WSAA 4MFZA 3TTHA 2CY2A 3EFAA 2BEIA 3DR6A 5A28A 3PZJA 5C88A 1IB1E 2RC4A 4LUAA 3MGDA 4XPLA 4JD6A 4R57A 1K4JA 2ARHA 2PR1A 5JQ4A 4R3KA 4DNCA 5G22A 4FD4A 2Z10A 3FNCA 5BWAB 3QAHA 4XNHC 2P6FA 2OU2A 3R9FA 3TO6A 2PDOA 4H6ZA 1NE9A 1UFHA 5HMNA 1YK3A 4KS9A 1YGHA 1YVOA 2CXAA 4CYQA 4KOSA 5J8CA 2YNEA 4MFJA 5IX3A 2P6GA 5J8FA 3EO4A 3DR8A 3SXOA 4CGNA 1S5KA 3W6SA 4Y49C 3DSBA 4CGOA 4CAXA 1RXTA 3WR7A 1XEBA 1PU9A 4CS0B 3T90A 3S6GA 3FIXA 5EBVA 1S3ZA 3S6KA 3P2HA 2GE3A 1LRZA 4F0YA 5AG5A 1B87A 2YGWA 2B4DB 4A33A 5KTAA 3ZZIA 1M4DA 5FVJA 4CYPA 4BMHA 1XMTA 4E8OA 2B3VA 2G0BA 4M85A 1BOBA 2NMTA 4CRYB 3TOAA 1ON0A 3G8WA 2OZHA 3D2MA 1M44A 3N7ZA 4UFWA 4C2XA 3IGRA 4FD6A 4I49A 1MJ9A 1QSMA 4PK2A 2IL4A 5A27A 1IIDA 4HNWB 4M3SA 3QB8A 4CAVA 2FXFA 2Y0MA 2A4NA 4NF1A 1XF8A 4KOUA 4KUBA 3D2PA 3CXSA 4MFPA 5H86A 2FS5A 1KUVA 1V0CA 2GIVA 2QMLA 1VKCA 2P6EA 2B4DA 4HNXB 5ISVA 1GHEA 1KZFA 5IV0A 4CYOA 4Q36A 2CNTA 4MJ8A 4A30A 2Q7BA 3C26A 4B5OA 2Q44A 2Z11A 2B5GB 5DWNA 4C7IA 4CYNA 4A31A 1YX0A 2AE6A 3D3SA 4YGOA 2YNCC 2ZW4A 1YLEA 3EC4A 3T9YA 2REFA 1S7NA 3CXPA 4QB9A 4XPDB 2GANA 4B14A 2K5TA 1VHSA 4GS4A 2BL1A 1IYKA 1U6MA 3VWDA 4ZGYB 4Q38A 3TO9A 5AG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC C;  4A2Z A;  4B13 A;  5G21 A;  2YNC A;  2WSA A;  3IU2 A;  5AG6 A;  4A95 A;  4CAF A;  4CAE A;  4CGL A;  4CYP A;  4CGO A;  4BBH A;  4C7I A;  5A28 A;  4C2Y A;  5G20 A;  4B10 A;  4C68 A;  2YND A;  5AGE A;  4B12 A;  4CGP A;  3IWE A;  4C2Z A;  4CGM A;  3H5Z A;  4UFX A;  4UCM A;  4B14 A;  5G1Z A;  3IU1 A;  2WUU A;  4B11 A;  4CYO A;  4UCN A;  5AG4 A;  4A32 A;  4UFW A;  4C2X A;  4CYQ A;  4A30 A;  2YNE A;  3JTK A;  5AG5 A;  4C7H A;  5A27 A;  4UCP A;  5G22 A;  4A33 A;  4UFV A;  5AG7 A;  4CYN A;  4A31 A;  4CGN A; 
#chains in the Genus database with same CATH topology
 1IOF A;  3I9S A;  4OC2 A;  4YFJ A;  4WJB A;  2GLJ A;  1Y7E A;  3DLJ A;  3E0K A;  2AFS A;  4KLW A;  4CAF A;  2IMO A;  4FD5 A;  2B58 A;  2JDD A;  1WK4 A;  3LOD A;  4C2Y A;  4IK2 A;  4DUK A;  3P2F A;  4M6I A;  4KOR A;  4XPK A;  3WC7 A;  3W91 A;  4UWI A;  1VGY A;  2DPT A;  4X5K A;  1HDQ A;  2V77 A;  1P0H A;  3ZJ0 A;  2WYR A;  1LOK A;  2B5G A;  3GUX A;  5LRJ A;  2JLM A;  1YLO A;  2I79 A;  2ZOF A;  2C1C A;  2PSW A;  1M4G A;  4R7M A;  2X7B A;  3FVL A;  1XJO A;  2Z3N A;  1YR0 A;  3KQX A;  4NGQ A;  3KR4 A;  2R1I A;  1AYE A;  5KTD A;  4KOV A;  1Z2L A;  4PK3 A;  3FEE A;  3S6F A;  1Q2Y A;  1R3N A;  2Z3O A;  4IF5 A;  2Q04 A;  3BJ7 A;  4E0A A;  3R9G A;  2R7H A;  1S60 A;  1CPX A;  5JH9 A;  4AG7 A;  4CYN A;  4EVY A;  4R87 A;  4HKF A;  4C68 A;  2CF4 A;  1XBU A;  1Z4R A;  2F5I A;  4IHM A;  2ZEM A;  1IGB A;  5F48 A;  2J9A A;  4IUS A;  3QNV A;  2Q4Y A;  2PC1 A;  4A32 A;  4Z65 A;  2ZW7 A;  2F8H A;  1Y7R A;  2JBJ A;  5EMI A;  3UY5 A;  3VAT A;  3SJF A;  2BOA A;  3KKW A;  1ELL P;  4YWY A;  1Y9W A;  1OZP A;  3LD2 A;  3R95 A;  2Z3L A;  2PJ4 A;  2FT0 A;  1NMT A;  3WC6 A;  3BLN A;  4P6Y A;  1IYL A;  2J8M A;  2AJ6 A;  4YRH A;  2D4O A;  4MFL A;  1XOV A;  1H8L A;  4GM5 A;  2JBK A;  3LMS A;  1IU8 A;  4K30 A;  4MY3 A;  2ZEP A;  5EC4 A;  4CGP A;  4DYO A;  7CPA A;  4O23 A;  4ZX8 A;  3TFY A;  2ABZ A;  4LQG A;  4OAE A;  1NSL A;  1VIX A;  1WWZ A;  2B4B A;  4UFX A;  2WPW A;  4L8A A;  1RO5 A;  2EBJ A;  1ZLI A;  2PRB A;  2DF5 A;  1KUY A;  4NXY A;  4R9M A;  2IJZ A;  3F5B A;  3FXT A;  2PCU A;  3SJG A;  4UCP A;  1CM0 A;  3D67 A;  3PP9 A;  4UA3 A;  2VI7 A;  4RN7 A;  4ZI6 A;  1R43 A;  3PB6 X;  1LAM A;  1EE3 P;  2Q0Y A;  4U9Y A;  3B8G A;  4JJX A;  1KUX A;  2HUZ A;  2PJA A;  2QJ8 A;  2ZEN A;  3I1U A;  1QMU A;  4UEF A;  5F47 A;  4MHD A;  4BBH A;  1QSR A;  2VEZ A;  4NGR A;  4MRI A;  3SJX A;  3D7H A;  2Z0Z A;  1ZLH A;  5LRG A;  1QQ9 A;  2FCK A;  3R96 A;  4KSI A;  4KOW A;  2R98 A;  1HEE A;  4OP4 A;  4C2Z A;  1R57 A;  2FIW A;  3TO7 A;  3H5Z A;  4CPA A;  5I4M A;  4XNH B;  3SI0 A;  4NGM A;  3MN8 A;  2JDC A;  1ZG9 A;  2JEV A;  2ZOG A;  4NSQ A;  4OAD A;  4F9V A;  5F49 A;  2PQ8 A;  4PXC A;  4ONU A;  3RBU A;  3NE8 A;  1XE4 A;  5DS0 A;  4P44 A;  3BI0 A;  4CRZ B;  2CNS A;  1Q2D A;  3MRU A;  2OR4 A;  4UFV A;  1IOI A;  3CDX A;  3T8W A;  2V8G A;  4MHN A;  4CAE A;  5CNP A;  4JYW A;  3B3T A;  3SI1 A;  4MMO A;  4MCP A;  3VAR A;  1BAV A;  3I3G A;  8CPA A;  3BHX A;  4OC4 A;  3SHP A;  2I00 A;  5THW A;  3S9L A;  2ZEL A;  4UBR A;  2ZEH A;  4R76 A;  3RYO A;  2ZPA A;  2WPX A;  1YRE A;  4G1P A;  3FH4 A;  3HUV A;  4Y49 B;  3R1K A;  4JLY A;  1BPN A;  4QVT A;  4CAW A;  2R8V A;  4NGP A;  2OH1 A;  4H2K A;  2DXQ A;  3B3V A;  4ONW A;  4B5P B;  2QEC A;  1I1D A;  4FWU A;  4NGN A;  3KAS A;  3H8F A;  2ATR A;  2BUE A;  3BI1 A;  1M4I A;  1DE4 C;  2G3T A;  3PBE A;  1YME A;  2AFU A;  2OB0 A;  3PB4 X;  3TT2 A;  2H5M A;  4F0X A;  4F9U A;  5G21 A;  1LFW A;  2PJ6 A;  4TWE A;  5ELY A;  4E2A A;  5JPH A;  5I0C A;  2G9D A;  2D4P A;  1HDU A;  2Z3M A;  2ZEO A;  5LYI A;  2ZXV A;  3NFZ A;  4KVX A;  3GY9 A;  5AGE A;  3TCV A;  4QUS A;  1Q7L A;  4ZBG A;  4KVO E;  2HV2 A;  4PSW A;  1ZO0 A;  3V8I A;  5HH1 A;  2O28 A;  3CXQ A;  1I21 A;  1M1D A;  4NCZ A;  5AG4 A;  3WAB A;  3PFO A;  4TNU A;  3FEC A;  1N71 A;  4KOX A;  3JVN A;  1S7K A;  4AB7 A;  4JZ0 A;  3FMC A;  2PR8 A;  4ZYQ A;  3H8E A;  4EWT A;  4BD9 A;  3KHZ A;  1Y0Y A;  1QST A;  2OZU A;  3KQZ A;  2FE7 A;  4H6U A;  2PVV A;  1YW4 A;  2CTC A;  3IWG A;  2ODF A;  3TOB A;  1Q2C A;  3TE4 A;  3IO1 A;  4B5P A;  2YND A;  2CNM A;  2POK A;  3IC1 A;  3IWE A;  3OWC A;  5HVG A;  1L0C A;  1TF8 A;  2EK8 A;  2OZG A;  4OID A;  1BO4 A;  4UCM A;  1MJA A;  4MCQ A;  2WUU A;  4U5Y A;  2VBQ A;  1TKF A;  1PCA A;  5C82 A;  1SQH A;  5KTC A;  2P0W A;  3JTK A;  3PGP A;  5IB0 A;  4PSX A;  2FSR A;  3DDD A;  4KSF A;  3KHX A;  4PXD A;  3FRM A;  4JXQ A;  2C27 A;  3WT4 A;  5F09 A;  4XPD C;  1S7F A;  2EUI A;  3NE7 A;  1I12 A;  5HVF A;  4ZX9 A;  4F6A A;  1IIC A;  2FL4 A;  1S7L A;  4UWJ A;  4X3R A;  3F0A A;  1PUA A;  1B6B A;  1MK4 A;  3K9U A;  2PJ0 A;  3NH5 A;  1GYT A;  5F46 A;  1ZG8 A;  4P10 A;  2Q4Z A;  1JQG A;  1YVK A;  2EVN A;  5G1Z A;  3IU1 A;  1Z4E A;  5LYL A;  3PRT A;  2AFZ A;  2OOT A;  3RO0 A;  3D7G A;  4KOY A;  4PV6 A;  2VXK A;  3IJ3 A;  2VQY A;  4MFP A;  4MY0 A;  2C6C A;  1Y0R A;  4KUA A;  3D7F A;  1QSO A;  4HNY B;  2PRQ A;  5DWM A;  4KOT A;  2B3U A;  3JUW A;  3VWE A;  4B13 A;  4KSA A;  3R9E A;  4A95 A;  4CGL A;  2REE A;  3EY5 A;  1CP6 A;  2QIR A;  3V7Z A;  5K8P A;  4P4J A;  3G3S A;  2ZEG A;  2BCO A;  1CJW A;  3FYN A;  1J4J A;  2Z3P A;  2AFM A;  4MI4 A;  2AFO A;  2PJ2 A;  4B10 A;  3GKR A;  4OC0 A;  5H84 A;  4B12 A;  2FIA A;  3GYA A;  4AVC A;  1P4N A;  5GCN A;  3FB3 A;  1TXR A;  4UEZ A;  3DNS A;  3W6X A;  2V8D A;  3LWU A;  4MFQ A;  4LX9 A;  1FNO A;  2PVW A;  3GIU A;  4MHZ A;  2I3C A;  2J8R A;  1RTQ A;  3FX6 A;  4L89 A;  4FUU A;  4P4D A;  4B11 A;  4F8Z A;  4AVA A;  4R3L A;  4UCN A;  5K8O A;  5HVH A;  1AUG A;  4PPZ A;  1FY7 A;  3JRU A;  5J1Q A;  3EXN A;  2Z3K A;  2ZW5 A;  4RI1 A;  2DPS A;  1Y9K A;  2PJ5 A;  4OLL A;  4NEX A;  3SXN A;  2VZY A;  2XEG A;  3BJ8 A;  2G3A A;  4P4F A;  2KCW A;  4A2Z A;  4II9 A;  2YNC A;  3IU2 A;  4BIN A;  3ISZ A;  2J8N A;  5E96 A;  4RS2 A;  3KR5 A;  3PB8 X;  4ZY0 A;  2Q51 A;  5G20 A;  2BSW A;  3FBU A;  4P45 A;  4AVB A;  2Q4V A;  1TKJ A;  4UIB A;  4P4E A;  3D7D A;  3CT9 A;  4MBU A;  2HQY A;  4ORF A;  4U9Z A;  4AG9 A;  3A9L A;  4KZT A;  3B3C A;  2RB7 A;  4QC6 A;  4R8F A;  4CGM A;  1MJB A;  1YW6 A;  4P4I A;  3H4Q A;  2DEA A;  3D66 A;  4JWP A;  4MHY A;  3B2Y A;  4KVM E;  4KLV A;  1Z9U A;  1QSN A;  4J3G A;  1VHE A;  2VZZ A;  4FD7 A;  4MXU A;  4A38 A;  1PYT B;  4RUH A;  3S9M A;  4H89 A;  4C7H A;  4JXR A;  3RZA A;  2ZW6 A;  4OC3 A;  1TIQ A;  4MFK A;  2PJ7 A;  3S6H A;  3N5F A;  3F8K A;  4GXH A;  3D8P A;  5CPA A;  1XIX A;  4QBJ A;  1Z8L A;  1Z8W A;  1LAN A;  5AG6 A;  2WSA A;  3H8G A;  4MFZ A;  2C6P A;  3TTH A;  3V38 A;  2F7V A;  1DTD A;  2CY2 A;  3EFA A;  2BEI A;  3DR6 A;  1BPM A;  2QYV A;  5A28 A;  3PZJ A;  3IFE A;  4Q7A A;  1XFO A;  5C88 A;  4W9Y A;  1IB1 E;  2RC4 A;  4OKO A;  4LUA A;  4DJL A;  2PIY A;  2CIJ A;  3MGD A;  4XPL A;  3PB9 X;  4JD6 A;  4R57 A;  3RAM A;  1M4L A;  1K4J A;  2XEI A;  1CG2 A;  3NH8 A;  2ARH A;  2PR1 A;  5JQ4 A;  5K8M A;  4R3K A;  4DNC A;  3FF3 A;  4NJQ A;  4MCR A;  3K2K A;  5G22 A;  4FD4 A;  3GB0 A;  2GU2 A;  2Z10 A;  3FNC A;  3IWW A;  5BWA B;  4A37 A;  3QAH A;  2EO8 A;  4XNH C;  2P6F A;  2OU2 A;  4EME A;  2AFX A;  6CPA A;  3R9F A;  2GFQ A;  2O4H A;  3TO6 A;  2PDO A;  4H6Z A;  3TX8 A;  5LYF A;  3B3W A;  1NE9 A;  1UFH A;  3CPX A;  5HMN A;  1YK3 A;  1KWM A;  1ZG7 A;  3BXM A;  2PIZ A;  4KS9 A;  5HXD A;  5LRK A;  3B35 A;  1NSA A;  1YGH A;  1YVO A;  2ZEF A;  3FED A;  2VL1 A;  2CXA A;  4M6H A;  4CYQ A;  4KOS A;  5D29 A;  4A39 A;  5J8C A;  1VHO A;  2V8V A;  2YNE A;  4MFJ A;  4A94 A;  1OBR A;  2P6G A;  5IX3 A;  5JM6 A;  5J8F A;  3EO4 A;  1Z8X A;  3DR8 A;  4OME A;  3SXO A;  3WC5 A;  4CGN A;  5JGF A;  3S9N A;  2BO9 A;  1Z8T A;  1S5K A;  1JWQ A;  3D4U A;  3W6S A;  4Y49 C;  2O53 A;  3DSB A;  4B6Z A;  4CGO A;  4CAX A;  1RXT A;  3WR7 A;  1BLL E;  1XEB A;  1PU9 A;  4CS0 B;  4WWV A;  3T90 A;  3S6G A;  4NGT A;  5H86 A;  3FIX A;  5CBM A;  5EBV A;  1S3Z A;  3S6K A;  1FT7 A;  3NA6 A;  1X10 A;  3LAC A;  4OIW A;  3P2H A;  2GE3 A;  4NJR A;  5K8N A;  1CBX A;  4FAI A;  1LRZ A;  3B3S A;  3VH9 A;  4F0Y A;  2PJ9 A;  1B87 A;  2YGW A;  4UF4 A;  5AG5 A;  1F2P A;  1UWY A;  4ZY2 A;  2B4D B;  2RFH A;  4A33 A;  5KTA A;  3ZZI A;  3DGV A;  1TKH A;  4LQ6 A;  2HB6 A;  1M4D A;  5FVJ A;  3QAY A;  4CYP A;  3K9T A;  4IAV A;  4BMH A;  1XMT A;  4E8O A;  3NH4 A;  2IQ6 A;  2ZED A;  1AMP A;  2B3V A;  2G0B A;  4M85 A;  1F2O A;  3CPA A;  1BOB A;  2NMT A;  3TC8 A;  4CRY B;  1F57 A;  3TOA A;  3CZX A;  2AFW A;  3PEI A;  2QVP A;  3IEH A;  2XEJ A;  2PJC A;  5D8N A;  2GLF A;  2Q43 A;  1ON0 A;  3G8W A;  2OZH A;  2PJB A;  1M44 A;  3D2M A;  3N7Z A;  3PFE A;  4HPS A;  4UFW A;  4C2X A;  3IGR A;  4FD6 A;  4I49 A;  4EFD A;  2EK9 A;  1MJ9 A;  2PE3 A;  1YQE A;  3KGQ A;  4YU9 A;  1QSM A;  4PK2 A;  2C6G A;  2GRE A;  2IL4 A;  5A27 A;  1IID A;  4NGS A;  4HNW B;  2PJ1 A;  4M3S A;  2FVG A;  3QB8 A;  4CAV A;  2EWB A;  2FXF A;  2Y0M A;  3GLJ A;  2A4N A;  4NF1 A;  1XF8 A;  4KOU A;  4K3N A;  1Z5R A;  4KUB A;  3D2P A;  4OC1 A;  2Q7S A;  2JEW A;  3B7I A;  3CXS A;  1XMB A;  2CTB A;  2XEF A;  1XRY A;  2HC9 A;  2NYQ A;  2FS5 A;  3KL9 A;  1KUV A;  1LCP A;  1V0C A;  2GIV A;  2QML A;  1LAP A;  1VKC A;  3PB7 X;  2P6E A;  2B4D A;  4HNX B;  5ISV A;  1GHE A;  1KZF A;  5IV0 A;  4CYO A;  4Q36 A;  2CNT A;  4MJ8 A;  4A30 A;  2WZN A;  4PQA A;  3KZW A;  4MHP A;  2Q7B A;  3C26 A;  3IIB A;  3SJE A;  4X8I A;  2Q44 A;  2Z11 A;  3KI9 A;  4AXV A;  4B5O A;  2B5G B;  5DWN A;  4C7I A;  3PBB A;  4A31 A;  4UIA A;  1YX0 A;  2AE6 A;  3D3S A;  3ISX A;  2YNC C;  4YGO A;  3RNZ A;  1X12 A;  3L2N A;  2ZW4 A;  4P4B A;  4ZY1 A;  1YLE A;  3EC4 A;  1CX8 A;  3SI2 A;  5LYD A;  3T9Y A;  2PJ3 A;  2PJ8 A;  2REF A;  1S7N A;  2NSM A;  3CXP A;  4QB9 A;  4UEE A;  1ARL A;  1IY7 A;  4XPD B;  4OC5 A;  4M6G A;  2GAN A;  4X2T A;  1CPS A;  4B14 A;  2K5T A;  4FBE A;  1VHS A;  4GS4 A;  3FJU A;  1A2Z A;  2BL1 A;  4PXE A;  4R6T A;  3HLP A;  4PXB A;  1ELM P;  5IB9 A;  3D68 A;  1IYK A;  1TF9 A;  2ANP A;  5AG7 A;  1U6M A;  2V8H A;  3VWD A;  4NFR A;  1CP7 A;  1YSJ A;  4ZGY B;  4Q38 A;  4MCS A;  3TO9 A;  1ARM A;  2ZEE A; 
#chains in the Genus database with same CATH homology
 3I9S A;  4YFJ A;  3E0K A;  4KLW A;  4CAF A;  4FD5 A;  2B58 A;  2JDD A;  1WK4 A;  3LOD A;  4C2Y A;  3P2F A;  4XPK A;  4KOR A;  3W91 A;  4UWI A;  2DPT A;  4X5K A;  1P0H A;  3ZJ0 A;  2B5G A;  2JLM A;  2I79 A;  2PSW A;  1M4G A;  2X7B A;  2Z3N A;  1YR0 A;  2R1I A;  5KTD A;  4KOV A;  4PK3 A;  3S6F A;  1Q2Y A;  4IF5 A;  2Z3O A;  2Q04 A;  3BJ7 A;  4E0A A;  3R9G A;  2R7H A;  1S60 A;  4AG7 A;  4EVY A;  4R87 A;  4HKF A;  4C68 A;  1Z4R A;  2F5I A;  5F48 A;  4IUS A;  2Q4Y A;  2PC1 A;  4A32 A;  2ZW7 A;  1Y7R A;  3UY5 A;  3KKW A;  1Y9W A;  1OZP A;  3LD2 A;  3R95 A;  2Z3L A;  2FT0 A;  1NMT A;  3BLN A;  1IYL A;  2J8M A;  2AJ6 A;  4YRH A;  2D4O A;  4MFL A;  4K30 A;  4MY3 A;  5EC4 A;  4CGP A;  3TFY A;  4OAE A;  1NSL A;  1WWZ A;  2B4B A;  4UFX A;  2WPW A;  4L8A A;  1RO5 A;  2PRB A;  1KUY A;  4NXY A;  4R9M A;  3F5B A;  3FXT A;  4UCP A;  1CM0 A;  3PP9 A;  4UA3 A;  2VI7 A;  2Q0Y A;  4U9Y A;  3B8G A;  4JJX A;  1KUX A;  2HUZ A;  5F47 A;  4MHD A;  4BBH A;  1QSR A;  2VEZ A;  2Z0Z A;  2FCK A;  3R96 A;  4KOW A;  2R98 A;  4C2Z A;  1R57 A;  2FIW A;  3TO7 A;  3H5Z A;  4XNH B;  4OAD A;  2JDC A;  2JEV A;  4NSQ A;  5F49 A;  2PQ8 A;  4ONU A;  1XE4 A;  4CRZ B;  2CNS A;  1Q2D A;  4UFV A;  4CAE A;  5CNP A;  3I3G A;  3SHP A;  2I00 A;  4UBR A;  3RYO A;  2ZPA A;  2WPX A;  1YRE A;  4Y49 B;  3R1K A;  4JLY A;  4QVT A;  4CAW A;  2R8V A;  2OH1 A;  2DXQ A;  4B5P B;  2QEC A;  1I1D A;  2ATR A;  2BUE A;  1M4I A;  2G3T A;  2OB0 A;  3TT2 A;  2H5M A;  4F0X A;  5G21 A;  4E2A A;  5JPH A;  5I0C A;  2D4P A;  2Z3M A;  2ZXV A;  4KVX A;  3GY9 A;  5AGE A;  3TCV A;  4QUS A;  4ZBG A;  4KVO E;  2HV2 A;  4PSW A;  1ZO0 A;  3V8I A;  5HH1 A;  2O28 A;  3CXQ A;  1I21 A;  1M1D A;  4NCZ A;  5AG4 A;  1N71 A;  4KOX A;  3JVN A;  1S7K A;  4AB7 A;  2PR8 A;  1QST A;  2OZU A;  2FE7 A;  4H6U A;  3IWG A;  3TOB A;  1Q2C A;  3TE4 A;  4B5P A;  2YND A;  2CNM A;  3IWE A;  3OWC A;  1L0C A;  2OZG A;  1BO4 A;  4UCM A;  1MJA A;  2WUU A;  4U5Y A;  2VBQ A;  5C82 A;  1SQH A;  5KTC A;  2P0W A;  3JTK A;  3PGP A;  5IB0 A;  4PSX A;  2FSR A;  3DDD A;  4KSF A;  3FRM A;  4JXQ A;  2C27 A;  4XPD C;  1S7F A;  2EUI A;  3NE7 A;  1I12 A;  4F6A A;  1IIC A;  2FL4 A;  1S7L A;  4UWJ A;  3F0A A;  1PUA A;  1B6B A;  1MK4 A;  3K9U A;  5F46 A;  1YVK A;  2EVN A;  5G1Z A;  3IU1 A;  1Z4E A;  4KOY A;  4PV6 A;  2VXK A;  2VQY A;  4MY0 A;  4KUA A;  1QSO A;  4HNY B;  5DWM A;  4KOT A;  2B3U A;  3JUW A;  3VWE A;  4B13 A;  4KSA A;  3R9E A;  4A95 A;  4CGL A;  2REE A;  3EY5 A;  2QIR A;  3G3S A;  1CJW A;  3FYN A;  1J4J A;  2Z3P A;  4MI4 A;  4B10 A;  3GKR A;  5H84 A;  4B12 A;  2FIA A;  3GYA A;  4AVC A;  1P4N A;  5GCN A;  3FB3 A;  3W6X A;  3DNS A;  4MFQ A;  4LX9 A;  2J8R A;  4L89 A;  4B11 A;  4AVA A;  4R3L A;  4UCN A;  1FY7 A;  3EXN A;  2Z3K A;  2ZW5 A;  4RI1 A;  2DPS A;  1Y9K A;  4OLL A;  4NEX A;  3SXN A;  2VZY A;  3BJ8 A;  2G3A A;  2KCW A;  4A2Z A;  4II9 A;  2YNC A;  3IU2 A;  2J8N A;  5E96 A;  4RS2 A;  5G20 A;  2BSW A;  3FBU A;  4AVB A;  2Q4V A;  4MBU A;  4ORF A;  2HQY A;  4AG9 A;  4U9Z A;  3A9L A;  4KZT A;  4QC6 A;  4CGM A;  1MJB A;  3H4Q A;  4JWP A;  4KVM E;  4KLV A;  1Z9U A;  1QSN A;  4J3G A;  2VZZ A;  4FD7 A;  4C7H A;  4H89 A;  4JXR A;  2ZW6 A;  1TIQ A;  4MFK A;  3S6H A;  3F8K A;  3D8P A;  1XIX A;  4QBJ A;  5AG6 A;  2WSA A;  4MFZ A;  3TTH A;  2CY2 A;  3EFA A;  2BEI A;  3DR6 A;  5A28 A;  3PZJ A;  5C88 A;  1IB1 E;  2RC4 A;  4LUA A;  3MGD A;  4XPL A;  4JD6 A;  4R57 A;  1K4J A;  2ARH A;  2PR1 A;  5JQ4 A;  4R3K A;  4DNC A;  5G22 A;  4FD4 A;  2Z10 A;  3FNC A;  5BWA B;  3QAH A;  4XNH C;  2P6F A;  2OU2 A;  3R9F A;  3TO6 A;  2PDO A;  4H6Z A;  1NE9 A;  1UFH A;  5HMN A;  1YK3 A;  4KS9 A;  1YGH A;  1YVO A;  2CXA A;  4CYQ A;  4KOS A;  5J8C A;  2YNE A;  4MFJ A;  5IX3 A;  2P6G A;  5J8F A;  3EO4 A;  3DR8 A;  3SXO A;  4CGN A;  1S5K A;  3W6S A;  4Y49 C;  3DSB A;  4CGO A;  4CAX A;  1RXT A;  3WR7 A;  1XEB A;  1PU9 A;  4CS0 B;  3T90 A;  3S6G A;  3FIX A;  5EBV A;  1S3Z A;  3S6K A;  3P2H A;  2GE3 A;  1LRZ A;  4F0Y A;  5AG5 A;  1B87 A;  2YGW A;  2B4D B;  4A33 A;  5KTA A;  3ZZI A;  1M4D A;  5FVJ A;  4CYP A;  4BMH A;  1XMT A;  4E8O A;  2B3V A;  2G0B A;  4M85 A;  1BOB A;  2NMT A;  4CRY B;  3TOA A;  1ON0 A;  3G8W A;  2OZH A;  3D2M A;  1M44 A;  3N7Z A;  4UFW A;  4C2X A;  3IGR A;  4FD6 A;  4I49 A;  1MJ9 A;  1QSM A;  4PK2 A;  2IL4 A;  5A27 A;  1IID A;  4HNW B;  4M3S A;  3QB8 A;  4CAV A;  2FXF A;  2Y0M A;  2A4N A;  4NF1 A;  1XF8 A;  4KOU A;  4KUB A;  3D2P A;  3CXS A;  4MFP A;  5H86 A;  2FS5 A;  1KUV A;  1V0C A;  2GIV A;  2QML A;  1VKC A;  2P6E A;  2B4D A;  4HNX B;  5ISV A;  1GHE A;  1KZF A;  5IV0 A;  4CYO A;  4Q36 A;  2CNT A;  4MJ8 A;  4A30 A;  2Q7B A;  3C26 A;  4B5O A;  2Q44 A;  2Z11 A;  2B5G B;  5DWN A;  4C7I A;  4CYN A;  4A31 A;  1YX0 A;  2AE6 A;  3D3S A;  4YGO A;  2YNC C;  2ZW4 A;  1YLE A;  3EC4 A;  3T9Y A;  2REF A;  1S7N A;  3CXP A;  4QB9 A;  4XPD B;  2GAN A;  4B14 A;  2K5T A;  1VHS A;  4GS4 A;  2BL1 A;  1IYK A;  1U6M A;  3VWD A;  4ZGY B;  4Q38 A;  3TO9 A;  5AG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...