4C68A

Plasmodium vivax n-myristoyltransferase in complex with a peptidomimetic inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
384
structure length
383
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 116
structure length 383
sequence length 384
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c68A00
4A33A 4CYPA 4UCPA 4B10A 3IU2A 4UFVA 5G21A 4C68A 2YNCC 4B13A 3JTKA 5AG6A 4C2ZA 5AGEA 2YNEA 2WUUA 4C2YA 4BBHA 5G1ZA 4C7IA 4CYQA 4A2ZA 4A30A 4CAEA 4C7HA 4CYOA 5A28A 4UFWA 4UCNA 4B12A 4CYNA 4A31A 5G22A 2WSAA 4A32A 4UCMA 2YNDA 3IU1A 4CGOA 2YNCA 4CGNA 4CGMA 5AG4A 4B14A 4B11A 3IWEA 3H5ZA 5A27A 5AG5A 5G20A 5AG7A 4C2XA 4CAFA 4CGPA 4UFXA 4A95A 4CGLA
chains in the Genus database with same CATH superfamily
4NGMA 4PXEA 1TKFA 4KSAA 1S3ZA 3K9TA 2V8HA 2Z3LA 3EFAA 3WC7A 4F0YA 3FIXA 2VZYA 3DNSA 4OMEA 2ZEMA 2JEWA 1Y7EA 4B5PA 1SQHA 4M6HA 2VI7A 3D66A 4A30A 5H84A 4C7HA 3PBBA 4KOXA 1FY7A 1Z2LA 3DDDA 3PB4X 1PU9A 5JQ4A 3T90A 2X7BA 4AVBA 4OKOA 2FVGA 1S5KA 1VGYA 3B3CA 2ZPAA 5KTDA 4W9YA 1XMBA 4MY0A 2AFSA 3S9MA 4KVME 4ONUA 3PB6X 2EVNA 1CPSA 3WR7A 3FJUA 3RYOA 4BINA 2O53A 4UEZA 2B4DB 4HNXB 2WPXA 4A95A 3KR5A 4AVAA 2PR8A 5C88A 2ZEHA 4PPZA 2Z3MA 2O4HA 1XJOA 2J8RA 5LYFA 3SJGA 4H2KA 3K9UA 4MJ8A 2XEGA 5EC4A 3KKWA 4XPDC 3B35A 1XE4A 4PXCA 4NF1A 4Y49C 1UWYA 4ZX8A 4IF5A 3V8IA 1I21A 3ISXA 3GB0A 2GLJA 3TCVA 2QECA 3D3SA 4KOYA 3HUVA 1IU8A 2D4PA 5C82A 2A4NA 3FVLA 4X3RA 1IYKA 5LYIA 3SXNA 4DYOA 3QB8A 2WPWA 4QUSA 4R7MA 4YFJA 3TC8A 2HUZA 2Q51A 4KOTA 5F48A 1KUYA 8CPAA 2FE7A 4UFXA 4FWUA 3R1KA 3NE7A 1IY7A 4QBJA 2Q04A 3V38A 1HDQA 5G21A 4EWTA 3MGDA 5HXDA 4CRZB 2PJ8A 5LRGA 1F57A 3KL9A 4MHZA 4II9A 2BSWA 2OOTA 3EO4A 2J9AA 2RB7A 1ZLHA 5F09A 1H8LA 4JYWA 4R8FA 2C6GA 1GHEA 1VHEA 2Z0ZA 4RI1A 4U9ZA 2PJ5A 3HLPA 3FNCA 1L0CA 1LOKA 3IC1A 2PRBA 2C1CA 4O23A 1IOIA 2RC4A 1ZG8A 3FX6A 2BL1A 4MFPA 1YLOA 1Z4EA 1XEBA 2EUIA 3PRTA 3LWUA 4PSXA 2Q7BA 3NH8A 1QSRA 1Y9KA 4TNUA 2C27A 2Q4YA 3H8EA 2OZUA 4U5YA 3TO7A 1ZO0A 1MJBA 3GLJA 2VL1A 3IJ3A 4IUSA 3PB9X 4MFJA 2B4DA 4M6IA 4OC0A 2I79A 4B5PB 4C68A 3PEIA 1IICA 3PBEA 1RTQA 4BBHA 4NGRA 4KOUA 4CAEA 3S6HA 3W6SA 4A39A 3MN8A 4R87A 1PCAA 2Q0YA 1M4IA 3B3WA 3I9SA 3KR4A 4KZTA 2AFOA 2Z3PA 4AG9A 2Q44A 3KHZA 1Z8XA 3C26A 3FRMA 2PJ1A 2Q4VA 4GXHA 2P6GA 4NFRA 4OLLA 4E8OA 4F8ZA 2CY2A 3PB7X 4KLVA 3IWEA 5HVFA 2G9DA 3S9LA 4ZGYB 3NH5A 4UWJA 4C2XA 1OZPA 2DEAA 2JBJA 5LYLA 2PVVA 3NA6A 3RO0A 4OC3A 4F9VA 3I1UA 4JLYA 3TT2A 1ELLP 4XNHB 3BJ7A 4AVCA 4B10A 1Z8LA 3FH4A 3SXOA 4HNWB 1X10A 4A94A 2YNCC 1BPMA 3MRUA 3S9NA 1Y7RA 3FEDA 4KOWA 3IWGA 2GU2A 4CYQA 4XPLA 4FD7A 4ZI6A 1CG2A 4PXDA 5A28A 4A31A 2PCUA 5G22A 1VKCA 3R9FA 1KZFA 5D8NA 3S6FA 2PR1A 1UFHA 2IMOA 4ZX9A 4CGNA 4EVYA 1QQ9A 1LCPA 4MCSA 4B6ZA 2BCOA 4MHPA 4CS0B 3A9LA 1M44A 2J8NA 2ZEOA 3TOBA 5THWA 1NMTA 3V7ZA 2VZZA 1ARMA 3TE4A 4CGLA 4CYPA 4Q38A 4UEEA 2OB0A 2ZXVA 1DE4C 2PJCA 3D7GA 4X5KA 1V0CA 2GFQA 4YRHA 4RUHA 3H8GA 4MXUA 5AG6A 4F9UA 4P4DA 4M6GA 2PDOA 2OH1A 4UIAA 4OC1A 1RO5A 2AJ6A 4UFWA 1VHSA 1WK4A 1YLEA 2CNMA 1QSNA 2WSAA 3DSBA 2BEIA 5I0CA 4J3GA 1ARLA 5BWAB 1KUVA 4K30A 3QAHA 4I49A 1YR0A 5A27A 2FT0A 4P44A 4QC6A 4FBEA 4ZY1A 5HMNA 2FL4A 3CT9A 2PVWA 4P6YA 4IAVA 1JWQA 1LANA 4UFVA 1F2OA 2DPTA 2F7VA 4KSIA 4NGSA 1RXTA 1MK4A 2YNEA 1IOFA 2PJBA 2ZW5A 4FD5A 4KVXA 4UWIA 2R8VA 3CXSA 2G3AA 2B4BA 4MCQA 2Q43A 2PSWA 2GLFA 2VXKA 4UCNA 3VATA 1LFWA 1YSJA 3KI9A 1YW4A 1KWMA 3G8WA 2D4OA 4NGTA 4R57A 1ZG9A 1LAPA 2OR4A 4IK2A 4PSWA 4PV6A 4MRIA 1AMPA 4DJLA 2BOAA 4Q7AA 4MY3A 2YGWA 2ZEDA 3I3GA 2B5GA 4KUAA 3D7FA 1U6MA 4OC4A 1VHOA 4P45A 1A2ZA 2Q4ZA 4UBRA 2OZGA 3IU2A 4KUBA 5HH1A 2I3CA 2AFZA 2PJ9A 4LQ6A 4ONWA 4B13A 3JTKA 1XMTA 2IJZA 5DWMA 3R95A 2HQYA 2FCKA 4OIWA 3SI1A 2REEA 2Z3KA 4MI4A 5KTAA 5K8MA 5F46A 4CRYB 1YMEA 1HEEA 3D2PA 3D7HA 3P2FA 4ORFA 2PJ3A 5DWNA 1ON0A 3SJFA 2XEFA 2EWBA 4OC2A 1I1DA 4Y49B 2VQYA 3GY9A 3ZJ0A 3SHPA 3P2HA 1Y0RA 3D67A 1Q7LA 3BXMA 1FT7A 4L8AA 3CDXA 2BUEA 2EBJA 4JXRA 3B3VA 2GREA 2ZEFA 5D29A 5K8PA 1CJWA 4OAEA 5H86A 3EXNA 4XPKA 5CPAA 4NXYA 3R9GA 2WYRA 4QB9A 2ZEEA 2IQ6A 3TX8A 3N5FA 2J8MA 1XF8A 2RFHA 1M4GA 2V8VA 6CPAA 4MBUA 1S60A 2ZEPA 1M1DA 3WC6A 4BD9A 5F47A 2AE6A 2JDCA 1S7FA 2EO8A 2O28A 2XEIA 4UCMA 5JM6A 1YX0A 2YNDA 5IB9A 2B58A 2F8HA 5LRJA 1PYTB 4XNHC 3LACA 3LMSA 5HVGA 3B3SA 3TO9A 4FD6A 4PK3A 1QSOA 3BHXA 1M4DA 2PJ6A 3KGQA 4FD4A 3CXPA 5EMIA 1B87A 3NH4A 4GM5A 4KS9A 3JRUA 4NEXA 2CF4A 4FUUA 1N71A 4MFLA 4CGPA 2ZW7A 4R76A 2JDDA 4UCPA 5I4MA 3S6GA 1CP6A 3JUWA 3PP9A 1Q2DA 2NMTA 3DLJA 3S6KA 1ZLIA 4NSQA 2CXAA 2PIZA 4JZ0A 5AGEA 3R9EA 3WABA 2C6CA 2PE3A 2V77A 3D7DA 3B8GA 3B2YA 3QAYA 4RS2A 4LQGA 1IGBA 1S7KA 2FIWA 2POKA 3G3SA 3IIBA 1R57A 3OWCA 4MHDA 2FS5A 2V8DA 2GANA 2K5TA 3FYNA 4PQAA 1OBRA 4B14A 1NSLA 4E2AA 1BPNA 2B5GB 3BI0A 5AG7A 2Q7SA 3TO6A 4LUAA 2PC1A 3D4UA 2ARHA 1JQGA 2Z3NA 3NE8A 3W6XA 2PJAA 4HPSA 4ZYQA 3CPAA 1NE9A 2PRQA 2QVPA 5K8OA 1HDUA 5LYDA 3BLNA 4X2TA 3PFEA 4OADA 5DS0A 2V8GA 4UIBA 4PXBA 4NGQA 1I12A 1BAVA 3IGRA 1XRYA 4MCRA 4KSFA 2GE3A 3KQZA 4CYNA 5J8FA 1Q2YA 4UEFA 4MCPA 4WJBA 3RAMA 2EK8A 2P0WA 4MFQA 7CPAA 5CNPA 2ODFA 2Z3OA 4A37A 3PB8X 2WZNA 3FECA 4H6ZA 2ZEGA 4MMOA 5G20A 5IB0A 2VBQA 1CX8A 3T9YA 1TIQA 3DGVA 1Z5RA 4K3NA 4CAWA 4PK2A 3H4QA 3FB3A 3JVNA 4A33A 2CTCA 4R3KA 5JPHA 1S7NA 1YW6A 1QSTA 2I00A 4QVTA 3QNVA 3F8KA 1CP7A 4EMEA 3WT4A 4KORA 4C2ZA 1AUGA 3W91A 2OU2A 4C2YA 1M4LA 4YU9A 4F6AA 3KASA 4NJQA 3IFEA 5G1ZA 1TKHA 3FF3A 3VARA 3TFYA 5ELYA 1GYTA 4JD6A 5IV0A 1Z8WA 2CNTA 2ABZA 4Q36A 2ZW4A 1TKJA 3PZJA 3IO1A 4R6TA 3IWWA 5AG4A 4B11A 1EE3P 3D2MA 4YGOA 2DXQA 1CBXA 3IEHA 3KHXA 5AG5A 4AG7A 3B7IA 1CM0A 2FXFA 1PUAA 4MHYA 3WC5A 2AFXA 2VEZA 4CPAA 2OZHA 1TXRA 3DR8A 1LAMA 2Z11A 3D68A 4IHMA 1YGHA 1WWZA 3L2NA 4MFZA 2FIAA 4G1PA 3RNZA 4NGNA 2QYVA 2CTBA 3CXQA 4UA3A 2WUUA 4MFKA 1IIDA 4C7IA 5HVHA 3CZXA 3B3TA 4F0XA 1P0HA 4CAVA 4JJXA 4NJRA 4R3LA 4U9YA 3LODA 4TWEA 2Z10A 1S7LA 3NFZA 3FMCA 4KOVA 4MHNA 2YNCA 4XPDB 1K4JA 5CBMA 1YVKA 1B6BA 2DPSA 1IB1E 3F5BA 2P6EA 5F49A 2PIYA 2PQ8A 5EBVA 1AYEA 2DF5A 4CAFA 2B3UA 4M3SA 4ZY0A 3D8PA 3E0KA 1Z8TA 4Z65A 3FXTA 2ZOGA 3TTHA 2EK9A 2PJ4A 3ISZA 2PJ7A 4JXQA 4UF4A 1CPXA 4FAIA 5J8CA 1R3NA 4H6UA 2B3VA 2ZELA 5FVJA 5JGFA 1YK3A 5KTCA 1X12A 4YWYA 3DR6A 3FEEA 2JEVA 4A2ZA 2XEJA 4GS4A 5E96A 3F0AA 1FNOA 2R98A 3ZZIA 1ZG7A 3SI0A 2QJ8A 4HKFA 2QMLA 4A32A 3GIUA 1QSMA 4OP4A 4P10A 4P4FA 3SI2A 3EY5A 4DUKA 3FBUA 3VWDA 4NCZA 3RZAA 2HV2A 1VIXA 2JLMA 4P4EA 2CNSA 1MJ9A 2IL4A 2NSMA 1KUXA 2AFMA 3BI1A 4KVOE 2ZW6A 1XIXA 3EC4A 2ZOFA 4RN7A 5ISVA 2KCWA 2F5IA 2P6FA 3VH9A 3VWEA 1BLLE 2R1IA 1Q2CA 3T8WA 1BO4A 2ZENA 2H5MA 4WWVA 3GKRA 3BJ8A 3TOAA 5JH9A 1XFOA 5IX3A 4H89A 4CYOA 2GIVA 4JWPA 4B12A 4BMHA 1ELMP 5K8NA 2PJ2A 2FSRA 2NYQA 4CGOA 2HB6A 1Z4RA 2PJ0A 5GCNA 2BO9A 3R96A 3KZWA 4CGMA 4R9MA 1XBUA 4NGPA 4OIDA 4ZBGA 4DNCA 5J1QA 3H5ZA 2C6PA 4KLWA 3UY5A 4L89A 3GYAA 4AB7A 2G0BA 4P4BA 3KQXA 1QMUA 2G3TA 4P4IA 1BOBA 2R7HA 4E0AA 1LRZA 2ATRA 1YQEA 1Z9UA 1MJAA 2HC9A 2REFA 3CPXA 3H8FA 2ANPA 3RBUA 3GUXA 4HNYB 1Y9WA 2Y0MA 3PGPA 5LRKA 1TF8A 4A38A 4CAXA 1P4NA 1TF9A 2AFWA 3SJEA 4LX9A 2AFUA 4AXVA 4EFDA 1J4JA 2CIJA 1YVOA 1F2PA 3IU1A 1NSAA 1Y0YA 2JBKA 1XOVA 3PFOA 4ZY2A 4X8IA 4M85A 1R43A 3SJXA 3K2KA 4B5OA 4OC5A 1YREA 1DTDA 4P4JA 3N7ZA 2QIRA 1IYLA 3LD2A 4KOSA
chains in the Genus database with same CATH topology
4KSAA 1S3ZA 2Z3LA 3EFAA 4F0YA 3FIXA 2VZYA 3DNSA 4B5PA 1SQHA 2VI7A 4A30A 5H84A 4C7HA 4KOXA 1FY7A 3DDDA 5JQ4A 1PU9A 3T90A 2X7BA 4AVBA 1S5KA 2ZPAA 4MY0A 4KVME 4ONUA 3WR7A 2EVNA 3RYOA 2B4DB 4HNXB 2WPXA 4A95A 4AVAA 2PR8A 5C88A 2Z3MA 2J8RA 3K9UA 4MJ8A 5EC4A 3KKWA 4XPDC 1XE4A 4NF1A 4Y49C 4IF5A 3V8IA 1I21A 3TCVA 2QECA 3D3SA 4KOYA 2D4PA 5C82A 2A4NA 1IYKA 3SXNA 3QB8A 2WPWA 4QUSA 4YFJA 2HUZA 4KOTA 5F48A 1KUYA 2FE7A 4UFXA 3R1KA 3NE7A 4QBJA 2Q04A 5G21A 3MGDA 4CRZB 4II9A 2BSWA 3EO4A 1GHEA 2Z0ZA 4U9ZA 4RI1A 3FNCA 1L0CA 2PRBA 2RC4A 2BL1A 4MFPA 1Z4EA 1XEBA 2EUIA 4PSXA 2Q7BA 1QSRA 1Y9KA 2C27A 2Q4YA 2OZUA 4U5YA 3TO7A 1ZO0A 1MJBA 4IUSA 4MFJA 4B5PB 2B4DA 4C68A 2I79A 1IICA 4BBHA 4KOUA 4CAEA 3S6HA 3W6SA 4R87A 2Q0YA 1M4IA 4KZTA 3I9SA 2Z3PA 4AG9A 2Q44A 3C26A 3FRMA 4OLLA 2Q4VA 4E8OA 2P6GA 2CY2A 4KLVA 3IWEA 4ZGYB 4UWJA 4C2XA 1OZPA 4JLYA 3TT2A 4XNHB 3BJ7A 4AVCA 4B10A 3SXOA 4HNWB 2YNCC 1Y7RA 4KOWA 3IWGA 4CYQA 4XPLA 4FD7A 5A28A 4A31A 5G22A 3R9FA 1VKCA 3S6FA 1KZFA 2PR1A 1UFHA 4CGNA 4EVYA 4CS0B 3A9LA 1M44A 2J8NA 3TOBA 1NMTA 2VZZA 3TE4A 4CGLA 4CYPA 4Q38A 2OB0A 2ZXVA 4X5KA 1V0CA 4YRHA 5AG6A 2PDOA 2OH1A 1RO5A 2AJ6A 4UFWA 1WK4A 1VHSA 1YLEA 2CNMA 1QSNA 2WSAA 3DSBA 2BEIA 5I0CA 4J3GA 5BWAB 1KUVA 4K30A 3QAHA 4I49A 1YR0A 5A27A 2FT0A 4QC6A 5HMNA 2FL4A 4UFVA 2DPTA 1RXTA 1MK4A 2YNEA 2ZW5A 4FD5A 4KVXA 4UWIA 2R8VA 3CXSA 2G3AA 2B4BA 2PSWA 2VXKA 4UCNA 3G8WA 2D4OA 4R57A 4PSWA 4PV6A 4MY3A 2YGWA 3I3GA 2B5GA 4KUAA 1U6MA 4UBRA 2OZGA 3IU2A 4KUBA 5HH1A 4B13A 3JTKA 1XMTA 5DWMA 3R95A 2HQYA 2FCKA 2REEA 2Z3KA 4MI4A 5KTAA 5F46A 4CRYB 3P2FA 3D2PA 4ORFA 5DWNA 1ON0A 1I1DA 4Y49B 2VQYA 3GY9A 3ZJ0A 3SHPA 3P2HA 4L8AA 4JXRA 2BUEA 1CJWA 4OAEA 5H86A 3EXNA 4XPKA 4NXYA 3R9GA 4QB9A 2J8MA 1XF8A 1M4GA 4MBUA 1S60A 1M1DA 5F47A 2AE6A 2JDCA 1S7FA 2O28A 4UCMA 1YX0A 2YNDA 2B58A 4XNHC 3TO9A 4FD6A 4PK3A 1QSOA 1M4DA 4FD4A 3CXPA 1B87A 4KS9A 4NEXA 1N71A 4MFLA 4CGPA 2ZW7A 2JDDA 4UCPA 3S6GA 3JUWA 3PP9A 1Q2DA 2NMTA 3S6KA 4NSQA 3R9EA 2CXAA 5AGEA 3B8GA 4RS2A 1S7KA 2FIWA 3G3SA 1R57A 3OWCA 4MHDA 2FS5A 2GANA 2K5TA 3FYNA 4B14A 1NSLA 4E2AA 2B5GB 3TO6A 5AG7A 4LUAA 2PC1A 2ARHA 2Z3NA 3W6XA 1NE9A 3BLNA 4OADA 1I12A 3IGRA 4KSFA 2GE3A 4CYNA 5J8FA 1Q2YA 2P0WA 4MFQA 5CNPA 2Z3OA 4H6ZA 5G20A 5IB0A 2VBQA 3T9YA 1TIQA 4CAWA 4PK2A 3H4QA 3FB3A 3JVNA 4A33A 4R3KA 5JPHA 1S7NA 2I00A 1QSTA 4QVTA 3F8KA 4KORA 4C2ZA 3W91A 2OU2A 4C2YA 4F6AA 5G1ZA 3TFYA 4JD6A 5IV0A 2CNTA 4Q36A 2ZW4A 3PZJA 5AG4A 4B11A 3D2MA 4YGOA 2DXQA 5AG5A 4AG7A 1CM0A 2FXFA 1PUAA 2VEZA 2OZHA 3DR8A 2Z11A 1YGHA 1WWZA 4MFZA 2FIAA 3CXQA 4UA3A 2WUUA 4MFKA 1IIDA 4C7IA 4F0XA 1P0HA 4CAVA 4JJXA 4R3LA 4U9YA 3LODA 2Z10A 1S7LA 4KOVA 2YNCA 4XPDB 1K4JA 1YVKA 1B6BA 2DPSA 1IB1E 3F5BA 2P6EA 5F49A 2PQ8A 5EBVA 4CAFA 2B3UA 4M3SA 3D8PA 3E0KA 3FXTA 5KTDA 3TTHA 4JXQA 5J8CA 4H6UA 2B3VA 5FVJA 1YK3A 5KTCA 3DR6A 2JEVA 4A2ZA 4GS4A 5E96A 3F0AA 2R98A 3ZZIA 4A32A 4HKFA 2QMLA 1QSMA 3EY5A 3FBUA 3VWDA 4NCZA 2HV2A 2JLMA 2CNSA 1MJ9A 2IL4A 1KUXA 4KVOE 2ZW6A 1XIXA 3EC4A 5ISVA 2KCWA 2F5IA 2P6FA 3VWEA 2R1IA 1Q2CA 1BO4A 2H5MA 3GKRA 3BJ8A 3TOAA 5IX3A 4H89A 4CYOA 2GIVA 4JWPA 4B12A 4BMHA 2FSRA 4CGOA 1Z4RA 4CGMA 5GCNA 3R96A 4R9MA 4ZBGA 4DNCA 3H5ZA 4KLWA 3UY5A 4L89A 3GYAA 4AB7A 2G0BA 2G3TA 1BOBA 2R7HA 4E0AA 1LRZA 2ATRA 1Z9UA 1MJAA 2REFA 4HNYB 1Y9WA 2Y0MA 3PGPA 4CAXA 1P4NA 4LX9A 1J4JA 1YVOA 3IU1A 4M85A 4B5OA 1YREA 3N7ZA 2QIRA 1IYLA 3LD2A 4KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A33 A;  4CYP A;  4UCP A;  4B10 A;  3IU2 A;  4UFV A;  5G21 A;  4C68 A;  2YNC C;  4B13 A;  3JTK A;  5AG6 A;  4C2Z A;  5AGE A;  2YNE A;  2WUU A;  4C2Y A;  4BBH A;  5G1Z A;  4C7I A;  4CYQ A;  4A2Z A;  4A30 A;  4CAE A;  4C7H A;  4CYO A;  5A28 A;  4UFW A;  4UCN A;  4B12 A;  4CYN A;  4A31 A;  5G22 A;  2WSA A;  4A32 A;  4UCM A;  2YND A;  3IU1 A;  4CGO A;  2YNC A;  4CGN A;  4CGM A;  5AG4 A;  4B14 A;  4B11 A;  3IWE A;  3H5Z A;  5A27 A;  5AG5 A;  5G20 A;  5AG7 A;  4C2X A;  4CAF A;  4CGP A;  4UFX A;  4A95 A;  4CGL A; 
#chains in the Genus database with same CATH topology
 4NGM A;  4PXE A;  1TKF A;  4KSA A;  1S3Z A;  3K9T A;  2V8H A;  2Z3L A;  3EFA A;  3WC7 A;  4F0Y A;  3FIX A;  2VZY A;  3DNS A;  4OME A;  2ZEM A;  2JEW A;  1Y7E A;  4B5P A;  1SQH A;  4M6H A;  2VI7 A;  3D66 A;  4A30 A;  5H84 A;  4C7H A;  3PBB A;  4KOX A;  1FY7 A;  1Z2L A;  3DDD A;  3PB4 X;  1PU9 A;  5JQ4 A;  3T90 A;  2X7B A;  4AVB A;  4OKO A;  2FVG A;  1S5K A;  1VGY A;  3B3C A;  2ZPA A;  5KTD A;  4W9Y A;  1XMB A;  4MY0 A;  2AFS A;  3S9M A;  4KVM E;  4ONU A;  3PB6 X;  2EVN A;  1CPS A;  3WR7 A;  3FJU A;  3RYO A;  4BIN A;  2O53 A;  4UEZ A;  2B4D B;  4HNX B;  2WPX A;  4A95 A;  3KR5 A;  4AVA A;  2PR8 A;  5C88 A;  2ZEH A;  4PPZ A;  2Z3M A;  2O4H A;  1XJO A;  2J8R A;  5LYF A;  3SJG A;  4H2K A;  3K9U A;  4MJ8 A;  2XEG A;  5EC4 A;  3KKW A;  4XPD C;  3B35 A;  1XE4 A;  4PXC A;  4NF1 A;  4Y49 C;  1UWY A;  4ZX8 A;  4IF5 A;  3V8I A;  1I21 A;  3ISX A;  3GB0 A;  2GLJ A;  3TCV A;  2QEC A;  3D3S A;  4KOY A;  3HUV A;  1IU8 A;  2D4P A;  5C82 A;  2A4N A;  3FVL A;  4X3R A;  1IYK A;  5LYI A;  3SXN A;  4DYO A;  3QB8 A;  2WPW A;  4QUS A;  4R7M A;  4YFJ A;  3TC8 A;  2HUZ A;  2Q51 A;  4KOT A;  5F48 A;  1KUY A;  8CPA A;  2FE7 A;  4UFX A;  4FWU A;  3R1K A;  3NE7 A;  1IY7 A;  4QBJ A;  2Q04 A;  3V38 A;  1HDQ A;  5G21 A;  4EWT A;  3MGD A;  5HXD A;  4CRZ B;  2PJ8 A;  5LRG A;  1F57 A;  3KL9 A;  4MHZ A;  4II9 A;  2BSW A;  2OOT A;  3EO4 A;  2J9A A;  2RB7 A;  1ZLH A;  5F09 A;  1H8L A;  4JYW A;  4R8F A;  2C6G A;  1GHE A;  1VHE A;  2Z0Z A;  4RI1 A;  4U9Z A;  2PJ5 A;  3HLP A;  3FNC A;  1L0C A;  1LOK A;  3IC1 A;  2PRB A;  2C1C A;  4O23 A;  1IOI A;  2RC4 A;  1ZG8 A;  3FX6 A;  2BL1 A;  4MFP A;  1YLO A;  1Z4E A;  1XEB A;  2EUI A;  3PRT A;  3LWU A;  4PSX A;  2Q7B A;  3NH8 A;  1QSR A;  1Y9K A;  4TNU A;  2C27 A;  2Q4Y A;  3H8E A;  2OZU A;  4U5Y A;  3TO7 A;  1ZO0 A;  1MJB A;  3GLJ A;  2VL1 A;  3IJ3 A;  4IUS A;  3PB9 X;  4MFJ A;  2B4D A;  4M6I A;  4OC0 A;  2I79 A;  4B5P B;  4C68 A;  3PEI A;  1IIC A;  3PBE A;  1RTQ A;  4BBH A;  4NGR A;  4KOU A;  4CAE A;  3S6H A;  3W6S A;  4A39 A;  3MN8 A;  4R87 A;  1PCA A;  2Q0Y A;  1M4I A;  3B3W A;  3I9S A;  3KR4 A;  4KZT A;  2AFO A;  2Z3P A;  4AG9 A;  2Q44 A;  3KHZ A;  1Z8X A;  3C26 A;  3FRM A;  2PJ1 A;  2Q4V A;  4GXH A;  2P6G A;  4NFR A;  4OLL A;  4E8O A;  4F8Z A;  2CY2 A;  3PB7 X;  4KLV A;  3IWE A;  5HVF A;  2G9D A;  3S9L A;  4ZGY B;  3NH5 A;  4UWJ A;  4C2X A;  1OZP A;  2DEA A;  2JBJ A;  5LYL A;  2PVV A;  3NA6 A;  3RO0 A;  4OC3 A;  4F9V A;  3I1U A;  4JLY A;  3TT2 A;  1ELL P;  4XNH B;  3BJ7 A;  4AVC A;  4B10 A;  1Z8L A;  3FH4 A;  3SXO A;  4HNW B;  1X10 A;  4A94 A;  2YNC C;  1BPM A;  3MRU A;  3S9N A;  1Y7R A;  3FED A;  4KOW A;  3IWG A;  2GU2 A;  4CYQ A;  4XPL A;  4FD7 A;  4ZI6 A;  1CG2 A;  4PXD A;  5A28 A;  4A31 A;  2PCU A;  5G22 A;  1VKC A;  3R9F A;  1KZF A;  5D8N A;  3S6F A;  2PR1 A;  1UFH A;  2IMO A;  4ZX9 A;  4CGN A;  4EVY A;  1QQ9 A;  1LCP A;  4MCS A;  4B6Z A;  2BCO A;  4MHP A;  4CS0 B;  3A9L A;  1M44 A;  2J8N A;  2ZEO A;  3TOB A;  5THW A;  1NMT A;  3V7Z A;  2VZZ A;  1ARM A;  3TE4 A;  4CGL A;  4CYP A;  4Q38 A;  4UEE A;  2OB0 A;  2ZXV A;  1DE4 C;  2PJC A;  3D7G A;  4X5K A;  1V0C A;  2GFQ A;  4YRH A;  4RUH A;  3H8G A;  4MXU A;  5AG6 A;  4F9U A;  4P4D A;  4M6G A;  2PDO A;  2OH1 A;  4UIA A;  4OC1 A;  1RO5 A;  2AJ6 A;  4UFW A;  1VHS A;  1WK4 A;  1YLE A;  2CNM A;  1QSN A;  2WSA A;  3DSB A;  2BEI A;  5I0C A;  4J3G A;  1ARL A;  5BWA B;  1KUV A;  4K30 A;  3QAH A;  4I49 A;  1YR0 A;  5A27 A;  2FT0 A;  4P44 A;  4QC6 A;  4FBE A;  4ZY1 A;  5HMN A;  2FL4 A;  3CT9 A;  2PVW A;  4P6Y A;  4IAV A;  1JWQ A;  1LAN A;  4UFV A;  1F2O A;  2DPT A;  2F7V A;  4KSI A;  4NGS A;  1RXT A;  1MK4 A;  2YNE A;  1IOF A;  2PJB A;  2ZW5 A;  4FD5 A;  4KVX A;  4UWI A;  2R8V A;  3CXS A;  2G3A A;  2B4B A;  4MCQ A;  2Q43 A;  2PSW A;  2GLF A;  2VXK A;  4UCN A;  3VAT A;  1LFW A;  1YSJ A;  3KI9 A;  1YW4 A;  1KWM A;  3G8W A;  2D4O A;  4NGT A;  4R57 A;  1ZG9 A;  1LAP A;  2OR4 A;  4IK2 A;  4PSW A;  4PV6 A;  4MRI A;  1AMP A;  4DJL A;  2BOA A;  4Q7A A;  4MY3 A;  2YGW A;  2ZED A;  3I3G A;  2B5G A;  4KUA A;  3D7F A;  1U6M A;  4OC4 A;  1VHO A;  4P45 A;  1A2Z A;  2Q4Z A;  4UBR A;  2OZG A;  3IU2 A;  4KUB A;  5HH1 A;  2I3C A;  2AFZ A;  2PJ9 A;  4LQ6 A;  4ONW A;  4B13 A;  3JTK A;  1XMT A;  2IJZ A;  5DWM A;  3R95 A;  2HQY A;  2FCK A;  4OIW A;  3SI1 A;  2REE A;  2Z3K A;  4MI4 A;  5KTA A;  5K8M A;  5F46 A;  4CRY B;  1YME A;  1HEE A;  3D2P A;  3D7H A;  3P2F A;  4ORF A;  2PJ3 A;  5DWN A;  1ON0 A;  3SJF A;  2XEF A;  2EWB A;  4OC2 A;  1I1D A;  4Y49 B;  2VQY A;  3GY9 A;  3ZJ0 A;  3SHP A;  3P2H A;  1Y0R A;  3D67 A;  1Q7L A;  3BXM A;  1FT7 A;  4L8A A;  3CDX A;  2BUE A;  2EBJ A;  4JXR A;  3B3V A;  2GRE A;  2ZEF A;  5D29 A;  5K8P A;  1CJW A;  4OAE A;  5H86 A;  3EXN A;  4XPK A;  5CPA A;  4NXY A;  3R9G A;  2WYR A;  4QB9 A;  2ZEE A;  2IQ6 A;  3TX8 A;  3N5F A;  2J8M A;  1XF8 A;  2RFH A;  1M4G A;  2V8V A;  6CPA A;  4MBU A;  1S60 A;  2ZEP A;  1M1D A;  3WC6 A;  4BD9 A;  5F47 A;  2AE6 A;  2JDC A;  1S7F A;  2EO8 A;  2O28 A;  2XEI A;  4UCM A;  5JM6 A;  1YX0 A;  2YND A;  5IB9 A;  2B58 A;  2F8H A;  5LRJ A;  1PYT B;  4XNH C;  3LAC A;  3LMS A;  5HVG A;  3B3S A;  3TO9 A;  4FD6 A;  4PK3 A;  1QSO A;  3BHX A;  1M4D A;  2PJ6 A;  3KGQ A;  4FD4 A;  3CXP A;  5EMI A;  1B87 A;  3NH4 A;  4GM5 A;  4KS9 A;  3JRU A;  4NEX A;  2CF4 A;  4FUU A;  1N71 A;  4MFL A;  4CGP A;  2ZW7 A;  4R76 A;  2JDD A;  4UCP A;  5I4M A;  3S6G A;  1CP6 A;  3JUW A;  3PP9 A;  1Q2D A;  2NMT A;  3DLJ A;  3S6K A;  1ZLI A;  4NSQ A;  2CXA A;  2PIZ A;  4JZ0 A;  5AGE A;  3R9E A;  3WAB A;  2C6C A;  2PE3 A;  2V77 A;  3D7D A;  3B8G A;  3B2Y A;  3QAY A;  4RS2 A;  4LQG A;  1IGB A;  1S7K A;  2FIW A;  2POK A;  3G3S A;  3IIB A;  1R57 A;  3OWC A;  4MHD A;  2FS5 A;  2V8D A;  2GAN A;  2K5T A;  3FYN A;  4PQA A;  1OBR A;  4B14 A;  1NSL A;  4E2A A;  1BPN A;  2B5G B;  3BI0 A;  5AG7 A;  2Q7S A;  3TO6 A;  4LUA A;  2PC1 A;  3D4U A;  2ARH A;  1JQG A;  2Z3N A;  3NE8 A;  3W6X A;  2PJA A;  4HPS A;  4ZYQ A;  3CPA A;  1NE9 A;  2PRQ A;  2QVP A;  5K8O A;  1HDU A;  5LYD A;  3BLN A;  4X2T A;  3PFE A;  4OAD A;  5DS0 A;  2V8G A;  4UIB A;  4PXB A;  4NGQ A;  1I12 A;  1BAV A;  3IGR A;  1XRY A;  4MCR A;  4KSF A;  2GE3 A;  3KQZ A;  4CYN A;  5J8F A;  1Q2Y A;  4UEF A;  4MCP A;  4WJB A;  3RAM A;  2EK8 A;  2P0W A;  4MFQ A;  7CPA A;  5CNP A;  2ODF A;  2Z3O A;  4A37 A;  3PB8 X;  2WZN A;  3FEC A;  4H6Z A;  2ZEG A;  4MMO A;  5G20 A;  5IB0 A;  2VBQ A;  1CX8 A;  3T9Y A;  1TIQ A;  3DGV A;  1Z5R A;  4K3N A;  4CAW A;  4PK2 A;  3H4Q A;  3FB3 A;  3JVN A;  4A33 A;  2CTC A;  4R3K A;  5JPH A;  1S7N A;  1YW6 A;  1QST A;  2I00 A;  4QVT A;  3QNV A;  3F8K A;  1CP7 A;  4EME A;  3WT4 A;  4KOR A;  4C2Z A;  1AUG A;  3W91 A;  2OU2 A;  4C2Y A;  1M4L A;  4YU9 A;  4F6A A;  3KAS A;  4NJQ A;  3IFE A;  5G1Z A;  1TKH A;  3FF3 A;  3VAR A;  3TFY A;  5ELY A;  1GYT A;  4JD6 A;  5IV0 A;  1Z8W A;  2CNT A;  2ABZ A;  4Q36 A;  2ZW4 A;  1TKJ A;  3PZJ A;  3IO1 A;  4R6T A;  3IWW A;  5AG4 A;  4B11 A;  1EE3 P;  3D2M A;  4YGO A;  2DXQ A;  1CBX A;  3IEH A;  3KHX A;  5AG5 A;  4AG7 A;  3B7I A;  1CM0 A;  2FXF A;  1PUA A;  4MHY A;  3WC5 A;  2AFX A;  2VEZ A;  4CPA A;  2OZH A;  1TXR A;  3DR8 A;  1LAM A;  2Z11 A;  3D68 A;  4IHM A;  1YGH A;  1WWZ A;  3L2N A;  4MFZ A;  2FIA A;  4G1P A;  3RNZ A;  4NGN A;  2QYV A;  2CTB A;  3CXQ A;  4UA3 A;  2WUU A;  4MFK A;  1IID A;  4C7I A;  5HVH A;  3CZX A;  3B3T A;  4F0X A;  1P0H A;  4CAV A;  4JJX A;  4NJR A;  4R3L A;  4U9Y A;  3LOD A;  4TWE A;  2Z10 A;  1S7L A;  3NFZ A;  3FMC A;  4KOV A;  4MHN A;  2YNC A;  4XPD B;  1K4J A;  5CBM A;  1YVK A;  1B6B A;  2DPS A;  1IB1 E;  3F5B A;  2P6E A;  5F49 A;  2PIY A;  2PQ8 A;  5EBV A;  1AYE A;  2DF5 A;  4CAF A;  2B3U A;  4M3S A;  4ZY0 A;  3D8P A;  3E0K A;  1Z8T A;  4Z65 A;  3FXT A;  2ZOG A;  3TTH A;  2EK9 A;  2PJ4 A;  3ISZ A;  2PJ7 A;  4JXQ A;  4UF4 A;  1CPX A;  4FAI A;  5J8C A;  1R3N A;  4H6U A;  2B3V A;  2ZEL A;  5FVJ A;  5JGF A;  1YK3 A;  5KTC A;  1X12 A;  4YWY A;  3DR6 A;  3FEE A;  2JEV A;  4A2Z A;  2XEJ A;  4GS4 A;  5E96 A;  3F0A A;  1FNO A;  2R98 A;  3ZZI A;  1ZG7 A;  3SI0 A;  2QJ8 A;  4HKF A;  2QML A;  4A32 A;  3GIU A;  1QSM A;  4OP4 A;  4P10 A;  4P4F A;  3SI2 A;  3EY5 A;  4DUK A;  3FBU A;  3VWD A;  4NCZ A;  3RZA A;  2HV2 A;  1VIX A;  2JLM A;  4P4E A;  2CNS A;  1MJ9 A;  2IL4 A;  2NSM A;  1KUX A;  2AFM A;  3BI1 A;  4KVO E;  2ZW6 A;  1XIX A;  3EC4 A;  2ZOF A;  4RN7 A;  5ISV A;  2KCW A;  2F5I A;  2P6F A;  3VH9 A;  3VWE A;  1BLL E;  2R1I A;  1Q2C A;  3T8W A;  1BO4 A;  2ZEN A;  2H5M A;  4WWV A;  3GKR A;  3BJ8 A;  3TOA A;  5JH9 A;  1XFO A;  5IX3 A;  4H89 A;  4CYO A;  2GIV A;  4JWP A;  4B12 A;  4BMH A;  1ELM P;  5K8N A;  2PJ2 A;  2FSR A;  2NYQ A;  4CGO A;  2HB6 A;  1Z4R A;  2PJ0 A;  5GCN A;  2BO9 A;  3R96 A;  3KZW A;  4CGM A;  4R9M A;  1XBU A;  4NGP A;  4OID A;  4ZBG A;  4DNC A;  5J1Q A;  3H5Z A;  2C6P A;  4KLW A;  3UY5 A;  4L89 A;  3GYA A;  4AB7 A;  2G0B A;  4P4B A;  3KQX A;  1QMU A;  2G3T A;  4P4I A;  1BOB A;  2R7H A;  4E0A A;  1LRZ A;  2ATR A;  1YQE A;  1Z9U A;  1MJA A;  2HC9 A;  2REF A;  3CPX A;  3H8F A;  2ANP A;  3RBU A;  3GUX A;  4HNY B;  1Y9W A;  2Y0M A;  3PGP A;  5LRK A;  1TF8 A;  4A38 A;  4CAX A;  1P4N A;  1TF9 A;  2AFW A;  3SJE A;  4LX9 A;  2AFU A;  4AXV A;  4EFD A;  1J4J A;  2CIJ A;  1YVO A;  1F2P A;  3IU1 A;  1NSA A;  1Y0Y A;  2JBK A;  1XOV A;  3PFO A;  4ZY2 A;  4X8I A;  4M85 A;  1R43 A;  3SJX A;  3K2K A;  4B5O A;  4OC5 A;  1YRE A;  1DTD A;  4P4J A;  3N7Z A;  2QIR A;  1IYL A;  3LD2 A;  4KOS A; 
#chains in the Genus database with same CATH homology
 4KSA A;  1S3Z A;  2Z3L A;  3EFA A;  4F0Y A;  3FIX A;  2VZY A;  3DNS A;  4B5P A;  1SQH A;  2VI7 A;  4A30 A;  5H84 A;  4C7H A;  4KOX A;  1FY7 A;  3DDD A;  5JQ4 A;  1PU9 A;  3T90 A;  2X7B A;  4AVB A;  1S5K A;  2ZPA A;  4MY0 A;  4KVM E;  4ONU A;  3WR7 A;  2EVN A;  3RYO A;  2B4D B;  4HNX B;  2WPX A;  4A95 A;  4AVA A;  2PR8 A;  5C88 A;  2Z3M A;  2J8R A;  3K9U A;  4MJ8 A;  5EC4 A;  3KKW A;  4XPD C;  1XE4 A;  4NF1 A;  4Y49 C;  4IF5 A;  3V8I A;  1I21 A;  3TCV A;  2QEC A;  3D3S A;  4KOY A;  2D4P A;  5C82 A;  2A4N A;  1IYK A;  3SXN A;  3QB8 A;  2WPW A;  4QUS A;  4YFJ A;  2HUZ A;  4KOT A;  5F48 A;  1KUY A;  2FE7 A;  4UFX A;  3R1K A;  3NE7 A;  4QBJ A;  2Q04 A;  5G21 A;  3MGD A;  4CRZ B;  4II9 A;  2BSW A;  3EO4 A;  1GHE A;  2Z0Z A;  4U9Z A;  4RI1 A;  3FNC A;  1L0C A;  2PRB A;  2RC4 A;  2BL1 A;  4MFP A;  1Z4E A;  1XEB A;  2EUI A;  4PSX A;  2Q7B A;  1QSR A;  1Y9K A;  2C27 A;  2Q4Y A;  2OZU A;  4U5Y A;  3TO7 A;  1ZO0 A;  1MJB A;  4IUS A;  4MFJ A;  4B5P B;  2B4D A;  4C68 A;  2I79 A;  1IIC A;  4BBH A;  4KOU A;  4CAE A;  3S6H A;  3W6S A;  4R87 A;  2Q0Y A;  1M4I A;  4KZT A;  3I9S A;  2Z3P A;  4AG9 A;  2Q44 A;  3C26 A;  3FRM A;  4OLL A;  2Q4V A;  4E8O A;  2P6G A;  2CY2 A;  4KLV A;  3IWE A;  4ZGY B;  4UWJ A;  4C2X A;  1OZP A;  4JLY A;  3TT2 A;  4XNH B;  3BJ7 A;  4AVC A;  4B10 A;  3SXO A;  4HNW B;  2YNC C;  1Y7R A;  4KOW A;  3IWG A;  4CYQ A;  4XPL A;  4FD7 A;  5A28 A;  4A31 A;  5G22 A;  3R9F A;  1VKC A;  3S6F A;  1KZF A;  2PR1 A;  1UFH A;  4CGN A;  4EVY A;  4CS0 B;  3A9L A;  1M44 A;  2J8N A;  3TOB A;  1NMT A;  2VZZ A;  3TE4 A;  4CGL A;  4CYP A;  4Q38 A;  2OB0 A;  2ZXV A;  4X5K A;  1V0C A;  4YRH A;  5AG6 A;  2PDO A;  2OH1 A;  1RO5 A;  2AJ6 A;  4UFW A;  1WK4 A;  1VHS A;  1YLE A;  2CNM A;  1QSN A;  2WSA A;  3DSB A;  2BEI A;  5I0C A;  4J3G A;  5BWA B;  1KUV A;  4K30 A;  3QAH A;  4I49 A;  1YR0 A;  5A27 A;  2FT0 A;  4QC6 A;  5HMN A;  2FL4 A;  4UFV A;  2DPT A;  1RXT A;  1MK4 A;  2YNE A;  2ZW5 A;  4FD5 A;  4KVX A;  4UWI A;  2R8V A;  3CXS A;  2G3A A;  2B4B A;  2PSW A;  2VXK A;  4UCN A;  3G8W A;  2D4O A;  4R57 A;  4PSW A;  4PV6 A;  4MY3 A;  2YGW A;  3I3G A;  2B5G A;  4KUA A;  1U6M A;  4UBR A;  2OZG A;  3IU2 A;  4KUB A;  5HH1 A;  4B13 A;  3JTK A;  1XMT A;  5DWM A;  3R95 A;  2HQY A;  2FCK A;  2REE A;  2Z3K A;  4MI4 A;  5KTA A;  5F46 A;  4CRY B;  3P2F A;  3D2P A;  4ORF A;  5DWN A;  1ON0 A;  1I1D A;  4Y49 B;  2VQY A;  3GY9 A;  3ZJ0 A;  3SHP A;  3P2H A;  4L8A A;  4JXR A;  2BUE A;  1CJW A;  4OAE A;  5H86 A;  3EXN A;  4XPK A;  4NXY A;  3R9G A;  4QB9 A;  2J8M A;  1XF8 A;  1M4G A;  4MBU A;  1S60 A;  1M1D A;  5F47 A;  2AE6 A;  2JDC A;  1S7F A;  2O28 A;  4UCM A;  1YX0 A;  2YND A;  2B58 A;  4XNH C;  3TO9 A;  4FD6 A;  4PK3 A;  1QSO A;  1M4D A;  4FD4 A;  3CXP A;  1B87 A;  4KS9 A;  4NEX A;  1N71 A;  4MFL A;  4CGP A;  2ZW7 A;  2JDD A;  4UCP A;  3S6G A;  3JUW A;  3PP9 A;  1Q2D A;  2NMT A;  3S6K A;  4NSQ A;  3R9E A;  2CXA A;  5AGE A;  3B8G A;  4RS2 A;  1S7K A;  2FIW A;  3G3S A;  1R57 A;  3OWC A;  4MHD A;  2FS5 A;  2GAN A;  2K5T A;  3FYN A;  4B14 A;  1NSL A;  4E2A A;  2B5G B;  3TO6 A;  5AG7 A;  4LUA A;  2PC1 A;  2ARH A;  2Z3N A;  3W6X A;  1NE9 A;  3BLN A;  4OAD A;  1I12 A;  3IGR A;  4KSF A;  2GE3 A;  4CYN A;  5J8F A;  1Q2Y A;  2P0W A;  4MFQ A;  5CNP A;  2Z3O A;  4H6Z A;  5G20 A;  5IB0 A;  2VBQ A;  3T9Y A;  1TIQ A;  4CAW A;  4PK2 A;  3H4Q A;  3FB3 A;  3JVN A;  4A33 A;  4R3K A;  5JPH A;  1S7N A;  2I00 A;  1QST A;  4QVT A;  3F8K A;  4KOR A;  4C2Z A;  3W91 A;  2OU2 A;  4C2Y A;  4F6A A;  5G1Z A;  3TFY A;  4JD6 A;  5IV0 A;  2CNT A;  4Q36 A;  2ZW4 A;  3PZJ A;  5AG4 A;  4B11 A;  3D2M A;  4YGO A;  2DXQ A;  5AG5 A;  4AG7 A;  1CM0 A;  2FXF A;  1PUA A;  2VEZ A;  2OZH A;  3DR8 A;  2Z11 A;  1YGH A;  1WWZ A;  4MFZ A;  2FIA A;  3CXQ A;  4UA3 A;  2WUU A;  4MFK A;  1IID A;  4C7I A;  4F0X A;  1P0H A;  4CAV A;  4JJX A;  4R3L A;  4U9Y A;  3LOD A;  2Z10 A;  1S7L A;  4KOV A;  2YNC A;  4XPD B;  1K4J A;  1YVK A;  1B6B A;  2DPS A;  1IB1 E;  3F5B A;  2P6E A;  5F49 A;  2PQ8 A;  5EBV A;  4CAF A;  2B3U A;  4M3S A;  3D8P A;  3E0K A;  3FXT A;  5KTD A;  3TTH A;  4JXQ A;  5J8C A;  4H6U A;  2B3V A;  5FVJ A;  1YK3 A;  5KTC A;  3DR6 A;  2JEV A;  4A2Z A;  4GS4 A;  5E96 A;  3F0A A;  2R98 A;  3ZZI A;  4A32 A;  4HKF A;  2QML A;  1QSM A;  3EY5 A;  3FBU A;  3VWD A;  4NCZ A;  2HV2 A;  2JLM A;  2CNS A;  1MJ9 A;  2IL4 A;  1KUX A;  4KVO E;  2ZW6 A;  1XIX A;  3EC4 A;  5ISV A;  2KCW A;  2F5I A;  2P6F A;  3VWE A;  2R1I A;  1Q2C A;  1BO4 A;  2H5M A;  3GKR A;  3BJ8 A;  3TOA A;  5IX3 A;  4H89 A;  4CYO A;  2GIV A;  4JWP A;  4B12 A;  4BMH A;  2FSR A;  4CGO A;  1Z4R A;  4CGM A;  5GCN A;  3R96 A;  4R9M A;  4ZBG A;  4DNC A;  3H5Z A;  4KLW A;  3UY5 A;  4L89 A;  3GYA A;  4AB7 A;  2G0B A;  2G3T A;  1BOB A;  2R7H A;  4E0A A;  1LRZ A;  2ATR A;  1Z9U A;  1MJA A;  2REF A;  4HNY B;  1Y9W A;  2Y0M A;  3PGP A;  4CAX A;  1P4N A;  4LX9 A;  1J4J A;  1YVO A;  3IU1 A;  4M85 A;  4B5O A;  1YRE A;  3N7Z A;  2QIR A;  1IYL A;  3LD2 A;  4KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...