2GANA

Crystal structure of a putative acetyltransferase from pyrococcus horikoshii, northeast structural genomics target jr32.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
MEGVKKIKNPSTVKDELLELMFRIYRSTNGKYPALEWVKRKPNPNDFNGFREVYEPFLKFRLSQEFDELYTYQKDNRIIGTIALVYKRIKEKGIWWVPEELMNEKVGLIEFFVVDPEFQGKGIGSTLLEFAVKRLRSLGKDPYVVTFPNLEAYSYYYMKKGFREIMRYKEFVILKFNHKKFQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 182aa long hypothetical protein
publication title Crystal Structure of a Putative Acetyltransferase from Pyrococcus horikoshii, Northeast Structural Genomics Target JR32.
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 47
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1990.20 Alpha Beta 2-Layer Sandwich CbiD-like CbiD-like 2ganA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ganA01
3LD2A 1XE4A 1Z4EA 3B8GA 3MGDA 3S6KA 1Y9WA 4HNXB 5HMNA 4AB7A 5C82A 4E0AA 2PRBA 3QAHA 1WWZA 1MK4A 1QSOA 3FRMA 1J4JA 2G3TA 2JEVA 1MJAA 5DWMA 2Z10A 4PSWA 4X5KA 2AJ6A 2PSWA 1KUXA 1V0CA 2PDOA 5IX3A 2PR8A 3NE7A 4IF5A 1TIQA 3G3SA 1NE9A 2A4NA 2JDDA 3W6SA 1YX0A 1WK4A 2FIWA 2OZGA 2EUIA 2OU2A 2R7HA 1M1DA 2ATRA 1IYLA 4UWIA 3SXOA 1P0HA 3TO9A 2ZW5A 1IICA 4KORA 5IV0A 2ARHA 3FBUA 2ZW4A 3D2PA 3R9GA 1N71A 1YVKA 3S6FA 4CRYB 4Y49B 1MJBA 5H86A 3P2HA 4MY3A 2QMLA 5J8FA 2QIRA 2X7BA 3VWEA 2RC4A 4EVYA 4F6AA 1S60A 2JLMA 5HH1A 4YFJA 1LRZA 4KVME 2G3AA 1IB1E 4PV6A 3FYNA 3EO4A 3GYAA 3DNSA 3R95A 4CRZB 1YVOA 3W91A 3F8KA 1Q2DA 4YGOA 3TT2A 4ORFA 1P4NA 2BUEA 2J8NA 4CAVA 4FD5A 3N7ZA 1RO5A 1S7FA 3JVNA 4JJXA 4NF1A 4R3LA 4I49A 4RS2A 2BL1A 3F0AA 2FT0A 1I1DA 2CNTA 2ZPAA 5CNPA 1XF8A 5EC4A 2Q04A 1XIXA 2B5GB 1MJ9A 2BSWA 3TTHA 2OZUA 3W6XA 1S7NA 1OZPA 3ZJ0A 3R1KA 1CJWA 4AG7A 4PSXA 2HV2A 4LUAA 1Q2YA 4AVAA 4L89A 2P6GA 3PP9A 1S5KA 1CM0A 4OAEA 3SHPA 2D4OA 2Z11A 4F0YA 5IB0A 4Y49C 3V8IA 3BJ7A 3D2MA 4AVCA 4KVXA 1QSRA 1PU9A 2C27A 4U9YA 3OWCA 4XPDC 2GANA 5JPHA 3DSBA 2B5GA 4BMHA 4JXRA 3QB8A 4FD7A 4II9A 4ONUA 3TCVA 4KOSA 3PZJA 3FNCA 3ZZIA 4R57A 4H6UA 3TOAA 3BLNA 3CXSA 1M44A 2WPXA 1L0CA 3LODA 3EFAA 2VZYA 1S7LA 3EY5A 4UWJA 5F48A 1Q2CA 2G0BA 1S3ZA 3EC4A 3DDDA 4U5YA 3C26A 1XMTA 1I21A 4XPDB 2VBQA 1B87A 4AVBA 4HNWB 1NMTA 4XNHC 1I12A 2Q7BA 1YLEA 4JLYA 3FXTA 4IUSA 4U9ZA 2PR1A 4MY0A 3TOBA 4AG9A 3SXNA 1XEBA 5F49A 4KOVA 1QSMA 2I00A 5KTDA 4QVTA 2B3VA 2HQYA 4KOYA 2O28A 3BJ8A 4L8AA 3I9SA 4KLVA 2VEZA 5ISVA 3H4QA 3FIXA 4MJ8A 2R98A 2I79A 2OB0A 2ZXVA 2P0WA 5DWNA 2F5IA 4KOXA 4OADA 2B4BA 2WPWA 4M3SA 4H89A 5H84A 4XNHB 3D8PA 2Q4VA 4M85A 4DNCA 4GS4A 4UBRA 4UA3A 2D4PA 2FIAA 2DXQA 3JUWA 1IIDA 4QB9A 4QC6A 2B4DB 1KUYA 2JDCA 1GHEA 2J8RA 4YRHA 2PC1A 3EXNA 4CAWA 2Q44A 2VI7A 3VWDA 1YREA 1M4GA 2FL4A 2J8MA 4ZBGA 1BO4A 1Y9KA 3K9UA 3R9FA 2NMTA 5JQ4A 1IYKA 3T9YA 4OLLA 4B5PB 2VZZA 4KUBA 3TE4A 5EBVA 1B6BA 2HUZA 3TO6A 2VXKA 5GCNA 5FVJA 4NXYA 2OZHA 3DR8A 4PK3A 2VQYA 3R9EA 4LX9A 4J3GA 3D3SA 3IWGA 1YK3A 1QSNA 3E0KA 1U6MA 2P6EA 4E8OA 2B4DA 1M4DA 3CXPA 2R8VA 3CXQA 3TO7A 2REFA 2ZW7A 3KKWA 1YGHA 4KZTA 2EVNA 3P2FA 4NCZA 1KZFA 3FB3A 5KTCA 1R57A 4MHDA 5C88A 3T90A 1VHSA 3WR7A 2Q0YA 4MI4A 4B5PA 1BOBA 1QSTA 3G8WA 1KUVA 4KVOE 3DR6A 1Z4RA 2CY2A 4E2AA 2K5TA 4QBJA 2PQ8A 4H6ZA 1UFHA 5F47A 3GKRA 4K30A 4HNYB 4NSQA 4RI1A 3S6HA 3F5BA 1SQHA 2KCWA 2H5MA 2FS5A 4KOWA 4FD4A 4PK2A 1ON0A 4KLWA 2AE6A 2B58A 5J8CA 2FXFA 2Z0ZA 4JXQA 1FY7A 1Z9UA 1YR0A 3S6GA 1VKCA 4HKFA 4NEXA 4KOUA 2BEIA 2Q4YA 2ZW6A 4XPKA 5I0CA 2IL4A 3PGPA 5F46A 2P6FA 2QECA 5E96A 2GIVA 1Y7RA 1RXTA 3GY9A 2R1IA 2REEA 1M4IA 2CNMA 2B3UA 4CAXA 2FCKA 2GE3A 5KTAA 2CNSA 3UY5A 4JWPA 4JD6A 4R9MA 3I3GA 2OH1A 4B5OA 3R96A 1K4JA 4KUAA 4FD6A 4R87A 3IGRA 4MBUA 2FSRA 2Y0MA 4QUSA 4R3KA 1S7KA 4XPLA 2FE7A 1PUAA 3RYOA 4KOTA 3TFYA 4CS0B 1NSLA
chains in the Genus database with same CATH superfamily
4MHPA 4JYWA 3LD2A 1XE4A 1ZG7A 4CGNA 1Z4EA 3B8GA 4MCSA 3MGDA 3S6KA 1Y9WA 4HNXB 5A27A 1XBUA 3KHZA 4OC1A 4AB7A 5HMNA 3KR5A 5C82A 4ZY1A 4E0AA 2IJZA 3KASA 2PRBA 4M6IA 3QAHA 1WWZA 1MK4A 4PXDA 1CP7A 1QSOA 3FRMA 1J4JA 2G3TA 2JEVA 2G9DA 2ZEOA 1MJAA 4MHNA 5DWMA 2Z10A 3IJ3A 3PRTA 2PJ9A 2ZELA 4PSWA 2ZEHA 4PXBA 4X5KA 1CP6A 1Y0YA 2AJ6A 2CIJA 3NH8A 2PSWA 1KUXA 1V0CA 2PDOA 3K9TA 4CGOA 3PBBA 5IX3A 2PR8A 3DLJA 3NE7A 4IF5A 3FJUA 2PJ8A 2O4HA 1TIQA 3G3SA 1NE9A 2A4NA 2JDDA 3W6SA 4FAIA 1YX0A 1WK4A 2FIWA 2OZGA 3JTKA 4MFKA 2GREA 2EUIA 2OU2A 2WUUA 2R7HA 3QNVA 4B13A 1M1DA 4CGLA 2BOAA 2ATRA 1IYLA 3MN8A 4UWIA 4F9UA 1Z8XA 1P0HA 3SXOA 1X10A 3TO9A 7CPAA 2ZW5A 1IICA 3IC1A 4KORA 5IV0A 1TKFA 2ARHA 3FBUA 5CBMA 5HVHA 2ZW4A 2C1CA 2F7VA 3D2PA 1N71A 1YVKA 3R9GA 1ARMA 2ZOGA 2DF5A 3S6FA 4CRYB 5HXDA 3KZWA 4MFLA 4DYOA 4Y49B 1MJBA 2PVWA 5H86A 3P2HA 1LANA 4MY3A 4CYOA 2ZEEA 2QMLA 5J8FA 2QIRA 2X7BA 3A9LA 1TKHA 5G22A 4GM5A 3TC8A 3VWEA 4F9VA 2RC4A 4ZX8A 4EVYA 4F6AA 1S60A 4OKOA 2JLMA 1AYEA 4A31A 4EMEA 5K8PA 3PB9X 5HH1A 4YFJA 2IQ6A 1LRZA 4KVME 2G3AA 4UEFA 3WC6A 4CAEA 4PXEA 4MFJA 5AG7A 1IB1E 1PYTB 4A94A 4PV6A 3B3TA 4NFRA 1TF8A 3FYNA 2C6GA 3EO4A 3GYAA 2AFMA 4R8FA 3DNSA 3R95A 4F0XA 3PB6X 3IFEA 2ZENA 3KGQA 4Q38A 4C2XA 5K8NA 3RZAA 1YVOA 3WC5A 4CRZB 2EO8A 3KI9A 3W91A 1XRYA 4NGRA 2I3CA 3F8KA 1Q2DA 4MFQA 4YGOA 3TT2A 5I4MA 2Q51A 4OP4A 4ORFA 1P4NA 1YSJA 2BUEA 1BLLE 3CPXA 1F2OA 2J8NA 4CAVA 4FD5A 3N7ZA 1RO5A 1S7FA 4KSIA 3CZXA 3JVNA 4JJXA 4NF1A 3IWEA 4O23A 5G1ZA 5JM6A 2PJ3A 1UWYA 3DGVA 3PEIA 4R3LA 4I49A 4ZI6A 4DJLA 4MCRA 3NH4A 1Z2LA 3KR4A 4RS2A 2BL1A 3F0AA 1CX8A 3FF3A 2FT0A 4WJBA 1I1DA 4UFXA 5CPAA 2WSAA 3IIBA 2YGWA 4BINA 1ELLP 2CNTA 2ZPAA 5CNPA 1AUGA 1XF8A 5EC4A 2Q04A 3KHXA 4B6ZA 1XIXA 2B5GB 4RUHA 4WWVA 2QJ8A 5LYDA 1IU8A 1NSAA 1MJ9A 2PIYA 2BSWA 3TTHA 3RNZA 2OZUA 3W6XA 1S7NA 1OZPA 2ZEDA 3ZJ0A 4MFPA 3R1KA 2CF4A 4LQ6A 1CJWA 5AG5A 4AG7A 4OC2A 4PSXA 3B3WA 2HV2A 4LUAA 1Q2YA 3H5ZA 1CPSA 4DUKA 4R76A 4AVAA 5DS0A 1TKJA 2XEFA 4L89A 2P6GA 3PP9A 1S5KA 3FH4A 1CM0A 3MRUA 2Z3KA 4OAEA 1A2ZA 5LRJA 2V8HA 3NH5A 3PB4X 4OC4A 2JBKA 4MRIA 3SHPA 2D4OA 1LCPA 3B7IA 1LFWA 2NYQA 4UIBA 2Z11A 4F0YA 5LYLA 4NGTA 5IB0A 4BD9A 4GXHA 4Y49C 3V8IA 3BJ7A 1X12A 3D2MA 4AVCA 2OR4A 4K3NA 4KVXA 1QSRA 1VHEA 4X3RA 1HDUA 1PU9A 2C27A 4KSFA 3GLJA 3KQXA 3KL9A 4U9YA 1ZO0A 3OWCA 4XPDC 2GANA 5LYFA 5JPHA 1CG2A 3DSBA 2B5GA 4Q36A 4W9YA 4JXRA 4BMHA 3QB8A 4FD7A 5D8NA 4II9A 4ONUA 4MHYA 3TCVA 4KOSA 3PZJA 3FNCA 3ZZIA 4R57A 3IU1A 4H6UA 4NGNA 3TOAA 3BLNA 3PB7X 2WYRA 3CXSA 4B10A 3SI1A 1M44A 2AFUA 3SI2A 2WPXA 4UEZA 1L0CA 3LODA 4PXCA 1Y0RA 3EFAA 2VZYA 4NJRA 5AG6A 1Z8WA 1S7LA 4CGMA 5JH9A 3EY5A 1YQEA 2ZEGA 4UWJA 5F48A 2ZOFA 1Q2CA 2AFWA 2PJAA 2RB7A 1XFOA 4MCPA 1IGBA 2V77A 4B12A 3FEDA 2G0BA 4CYNA 3CT9A 1S3ZA 1Z8TA 3D66A 3EC4A 4UCMA 4MCQA 3PFEA 1BPNA 2V8DA 1YW6A 4X8IA 3DDDA 4MXUA 4BBHA 3PBEA 5ELYA 4U5YA 3C26A 5F09A 2PJ0A 1XMTA 1R43A 1I21A 2AFXA 3GIUA 4FWUA 1Y7EA 2VBQA 4XPDB 1B87A 4AVBA 4P45A 2EK8A 2J9AA 1NMTA 3B3SA 4HNWB 4KSAA 4ONWA 4XNHC 5JGFA 1I12A 4A2ZA 5K8OA 4A95A 3K2KA 2Q7BA 4Q7AA 1YLEA 2XEGA 4JLYA 3FXTA 4IUSA 4U9ZA 2PR1A 2Q7SA 2V8VA 4MY0A 3TOBA 2JEWA 4AG9A 3SXNA 4A37A 1XEBA 5F49A 4C2YA 4KOVA 2EWBA 1QSMA 2I00A 4IK2A 4M6GA 5KTDA 3IWWA 4QVTA 3V7ZA 2B3VA 2PCUA 2HQYA 3PFOA 4KOYA 4P44A 3RO0A 5EMIA 1LAMA 2O28A 3BJ8A 4L8AA 3I9SA 4EWTA 4KLVA 2VEZA 4B11A 1JQGA 1TF9A 3H4QA 3FIXA 4X2TA 5ISVA 4NGQA 5D29A 2YNEA 2EBJA 2R98A 2I79A 2OB0A 2EK9A 2ZXVA 4MJ8A 3VARA 2PRQA 4JZ0A 2GFQA 3CDXA 2P0WA 5DWNA 1ZLIA 2F5IA 3CPAA 4KOXA 4OADA 2Z3NA 2B4BA 2WZNA 4A33A 1BPMA 2WPWA 2PJBA 4M3SA 2C6PA 4H89A 5H84A 3N5FA 4XNHB 3D8PA 3D7GA 2Z3MA 5BWAB 4R6TA 4CGPA 2Q4VA 4ZGYB 2CTBA 4OIDA 4M85A 4DNCA 1IOIA 4GS4A 4UBRA 4UA3A 3VH9A 3S9NA 2DPTA 3JRUA 3D7HA 2D4PA 4UF4A 2FIAA 2C6CA 2DXQA 2QVPA 2Z3PA 3JUWA 1IIDA 4OC5A 3HUVA 4ZX9A 2RFHA 1DE4C 4QB9A 4QC6A 4UIAA 2B4DB 4F8ZA 1KUYA 2JDCA 3D68A 1GHEA 2J8RA 1Z8LA 4ZY2A 4IAVA 2HB6A 3NA6A 4YRHA 3WC7A 4C2ZA 4CYQA 1DTDA 4FBEA 3S9LA 4C68A 3LACA 1RTQA 1JWQA 4ZY0A 3V38A 2PC1A 2XEJA 1ELMP 1Q7LA 3EXNA 3IO1A 4P10A 2CXAA 4YWYA 1IOFA 4CAWA 1HEEA 2Q44A 4P4IA 1ZG8A 2VI7A 3VWDA 1YREA 1M4GA 4UEEA 4Z65A 2FL4A 2J8MA 4ZBGA 1R3NA 3FVLA 3HLPA 5G21A 1BO4A 1Y9KA 3K9UA 2NSMA 3R9FA 2NMTA 1VIXA 1AMPA 2OOTA 1IYKA 3H8EA 5JQ4A 8CPAA 4CYPA 3T9YA 4MFZA 4OLLA 2DPSA 4B5PB 2VZZA 1VGYA 4KUBA 1KWMA 3TE4A 5EBVA 3IU2A 2JBJA 3FECA 4IHMA 1B6BA 2HUZA 3IEHA 1QMUA 2YNCC 3TO6A 3RAMA 3BI1A 2VXKA 3GB0A 5GCNA 4YU9A 5FVJA 4NXYA 2GLFA 2Q4ZA 4C7IA 2OZHA 3B3CA 3DR8A 4PK3A 2VQYA 4CAFA 1FT7A 3R9EA 2AFOA 1PCAA 4NGMA 3WABA 3QAYA 2PJ1A 1VHOA 3D3SA 3H8FA 3IWGA 4J3GA 4LX9A 1YK3A 1QSNA 3E0KA 1U6MA 2AFZA 2P6EA 2PIZA 4A30A 4RN7A 4E8OA 2B4DA 1M4DA 1F57A 4OMEA 4R7MA 1FNOA 2AFSA 3CXPA 2R8VA 3CXQA 4MMOA 3TO7A 1F2PA 1LAPA 2ZEPA 2REFA 3B3VA 4OC0A 2ZW7A 3NFZA 3I1UA 3BI0A 1XJOA 5LRKA 2DEAA 2BCOA 1IY7A 3KKWA 3L2NA 1YGHA 3LMSA 4KZTA 1QQ9A 2V8GA 5LRGA 1OBRA 1YW4A 4A39A 2HC9A 2EVNA 3P2FA 1M4LA 4NCZA 3FMCA 3RBUA 1KZFA 3BXMA 3VATA 3FB3A 2POKA 5KTCA 6CPAA 3B35A 1R57A 4MHDA 5C88A 3T90A 2QYVA 4PPZA 2PJ6A 1VHSA 4NGPA 1CPXA 3WR7A 2PJ7A 2Q0YA 4MI4A 4B5PA 4LQGA 1BOBA 1QSTA 3G8WA 4B14A 5AG4A 1KUVA 4UFVA 4KVOE 2PVVA 3T8WA 2ABZA 4FUUA 3DR6A 1ZG9A 1Z4RA 3BHXA 2CY2A 4M6HA 4E2AA 2K5TA 4QBJA 2PQ8A 3D7DA 4H6ZA 2Z3OA 1Z5RA 5AGEA 1XOVA 1UFHA 2VL1A 3NE8A 3B2YA 4NJQA 4NGSA 4P4FA 3GKRA 4K30A 5F47A 3SI0A 4HNYB 4NSQA 4C7HA 3FEEA 4RI1A 3ISXA 3S6HA 3F5BA 4P4DA 1ZLHA 5HVFA 1SQHA 2KCWA 2H5MA 2IMOA 5K8MA 3SJFA 5HVGA 2FS5A 4AXVA 2PJ4A 2ZEFA 4KOWA 4UCPA 4FD4A 4PK2A 3D67A 1ON0A 4OC3A 3KQZA 5J1QA 4KLWA 2AE6A 4PQAA 2B58A 5J8CA 2FXFA 2Z0ZA 1YLOA 4JXQA 4MHZA 1TXRA 3H8GA 5G20A 1FY7A 1Z9UA 3LWUA 1H8LA 1YR0A 3S6GA 1VKCA 4HKFA 3S9MA 4NEXA 4TWEA 1LOKA 4KOUA 4TNUA 2BEIA 4UFWA 4OIWA 1CBXA 1SR8A 1EE3P 3D7FA 2BO9A 2Q4YA 3SJGA 5IB9A 2YNCA 2ZW6A 4XPKA 3WT4A 5I0CA 2IL4A 3PGPA 5F46A 3SJEA 2P6FA 4ZYQA 3TX8A 2QECA 2PE3A 5E96A 2GIVA 1Y7RA 1RXTA 2YNDA 1XMBA 1HDQA 3GY9A 2R1IA 2O53A 5THWA 2REEA 1M4IA 4G1PA 2ANPA 1ARLA 2CNMA 2GLJA 2GU2A 3ISZA 2B3UA 2F8HA 2FVGA 3PB8X 4CAXA 1BAVA 2FCKA 2GE3A 5KTAA 2CNSA 4EFDA 3UY5A 2PJ2A 4JD6A 4JWPA 4P4EA 4HPSA 4R9MA 4P4BA 4A38A 3I3GA 4A32A 1GYTA 2OH1A 4H2KA 4B5OA 3R96A 1K4JA 2ODFA 4FD6A 3FX6A 4KUAA 4R87A 3IGRA 4MBUA 4CPAA 3GUXA 2FSRA 2Y0MA 4QUSA 3SJXA 4P4JA 2XEIA 2ZEMA 1S7KA 4R3KA 1YMEA 2Q43A 4XPLA 2PJ5A 2Z3LA 2CTCA 2FE7A 3D4UA 1PUAA 5LYIA 3RYOA 4KOTA 4KS9A 5A28A 3TFYA 4P6YA 4CS0B 1NSLA 4UCNA 2PJCA
chains in the Genus database with same CATH topology
3LD2A 1XE4A 4CGNA 1Z4EA 3B8GA 3MGDA 3S6KA 1Y9WA 4HNXB 5A27A 5HMNA 4AB7A 5C82A 4E0AA 2PRBA 3QAHA 1WWZA 1MK4A 1QSOA 3FRMA 1J4JA 2G3TA 2JEVA 1MJAA 5DWMA 2Z10A 4PSWA 4X5KA 2AJ6A 2PSWA 1KUXA 1V0CA 2PDOA 4CGOA 5IX3A 2PR8A 3NE7A 4IF5A 1TIQA 3G3SA 1NE9A 2A4NA 2JDDA 3W6SA 1YX0A 1WK4A 2FIWA 2OZGA 3JTKA 4MFKA 2EUIA 2OU2A 2WUUA 2R7HA 4B13A 1M1DA 4CGLA 2ATRA 1IYLA 4UWIA 3SXOA 1P0HA 3TO9A 2ZW5A 1IICA 4KORA 5IV0A 2ARHA 3FBUA 2ZW4A 3D2PA 3R9GA 1N71A 1YVKA 3S6FA 4CRYB 4MFLA 4Y49B 1MJBA 5H86A 3P2HA 4MY3A 4CYOA 2QMLA 5J8FA 2QIRA 2X7BA 3A9LA 3VWEA 5G22A 2RC4A 4EVYA 4F6AA 1S60A 2JLMA 4A31A 5HH1A 4YFJA 1LRZA 4KVME 2G3AA 4CAEA 4MFJA 5AG7A 1IB1E 4PV6A 3FYNA 3EO4A 3GYAA 3DNSA 3R95A 4F0XA 4Q38A 4C2XA 4CRZB 1YVOA 3W91A 3F8KA 1Q2DA 4MFQA 4YGOA 3TT2A 4ORFA 1P4NA 2BUEA 2J8NA 4CAVA 4FD5A 3N7ZA 1RO5A 1S7FA 5G1ZA 3JVNA 4JJXA 4NF1A 3IWEA 4R3LA 4I49A 4RS2A 2BL1A 3F0AA 2FT0A 1I1DA 4UFXA 2WSAA 2YGWA 2CNTA 2ZPAA 5CNPA 1XF8A 5EC4A 2Q04A 1XIXA 2B5GB 1MJ9A 2BSWA 3TTHA 2OZUA 3W6XA 1S7NA 1OZPA 3ZJ0A 4MFPA 3R1KA 1CJWA 5AG5A 4AG7A 4PSXA 2HV2A 4LUAA 1Q2YA 3H5ZA 4AVAA 4L89A 2P6GA 3PP9A 1S5KA 1CM0A 2Z3KA 4OAEA 3SHPA 2D4OA 2Z11A 4F0YA 5IB0A 4Y49C 3V8IA 3BJ7A 3D2MA 4AVCA 4KVXA 1QSRA 1PU9A 2C27A 4KSFA 4U9YA 1ZO0A 3OWCA 4XPDC 2GANA 5JPHA 3DSBA 2B5GA 4Q36A 4BMHA 4JXRA 3QB8A 4FD7A 4II9A 4ONUA 3TCVA 4KOSA 3PZJA 3FNCA 3ZZIA 4R57A 3IU1A 4H6UA 3TOAA 3BLNA 4B10A 3CXSA 1M44A 2WPXA 1L0CA 3LODA 3EFAA 5AG6A 2VZYA 4CGMA 1S7LA 3EY5A 4UWJA 5F48A 1Q2CA 4B12A 2G0BA 4CYNA 1S3ZA 3EC4A 4UCMA 3DDDA 4BBHA 4U5YA 3C26A 1XMTA 1I21A 4XPDB 2VBQA 1B87A 4AVBA 4HNWB 1NMTA 4KSAA 4XNHC 1I12A 4A2ZA 4A95A 2Q7BA 1YLEA 4JLYA 3FXTA 4IUSA 4U9ZA 2PR1A 4MY0A 3TOBA 4AG9A 3SXNA 1XEBA 5F49A 4C2YA 4KOVA 1QSMA 2I00A 5KTDA 4QVTA 2B3VA 2HQYA 4KOYA 2O28A 3BJ8A 4L8AA 3I9SA 4KLVA 2VEZA 4B11A 5ISVA 3H4QA 3FIXA 2YNEA 4MJ8A 2R98A 2I79A 2OB0A 2ZXVA 2P0WA 5DWNA 2F5IA 4KOXA 4OADA 2Z3NA 2B4BA 4A33A 2WPWA 4M3SA 4H89A 5H84A 4XNHB 3D8PA 2Z3MA 5BWAB 4CGPA 2Q4VA 4ZGYB 4M85A 4DNCA 4GS4A 4UBRA 4UA3A 2DPTA 2D4PA 2FIAA 2DXQA 2Z3PA 3JUWA 1IIDA 4QB9A 4QC6A 2B4DB 1KUYA 2JDCA 1GHEA 2J8RA 4YRHA 4C2ZA 4CYQA 4C68A 2PC1A 3EXNA 4CAWA 2CXAA 2Q44A 2VI7A 3VWDA 1YREA 1M4GA 2FL4A 2J8MA 4ZBGA 5G21A 1BO4A 1Y9KA 3K9UA 3R9FA 2NMTA 5JQ4A 1IYKA 4CYPA 3T9YA 4MFZA 4OLLA 2DPSA 4B5PB 2VZZA 4KUBA 3TE4A 5EBVA 3IU2A 1B6BA 2HUZA 2YNCC 3TO6A 2VXKA 5GCNA 5FVJA 4NXYA 4C7IA 2OZHA 3DR8A 4PK3A 2VQYA 4CAFA 3R9EA 4J3GA 3D3SA 3IWGA 4LX9A 1YK3A 1QSNA 3E0KA 1U6MA 2P6EA 4A30A 4E8OA 2B4DA 1M4DA 3CXPA 2R8VA 3CXQA 3TO7A 2REFA 2ZW7A 3KKWA 1YGHA 4KZTA 2EVNA 3P2FA 4NCZA 1KZFA 3FB3A 5KTCA 1R57A 4MHDA 5C88A 3T90A 1VHSA 3WR7A 2Q0YA 4MI4A 4B5PA 1BOBA 1QSTA 3G8WA 4B14A 5AG4A 1KUVA 4UFVA 4KVOE 3DR6A 1Z4RA 2CY2A 4E2AA 2K5TA 4QBJA 2PQ8A 4H6ZA 2Z3OA 5AGEA 1UFHA 5F47A 3GKRA 4K30A 4C7HA 4HNYB 4NSQA 4RI1A 3S6HA 3F5BA 1SQHA 2KCWA 2H5MA 2FS5A 4KOWA 4UCPA 4FD4A 4PK2A 1ON0A 4KLWA 2AE6A 2B58A 5J8CA 2FXFA 2Z0ZA 4JXQA 5G20A 1FY7A 1Z9UA 1YR0A 3S6GA 1VKCA 4HKFA 4NEXA 4KOUA 2BEIA 4UFWA 1SR8A 2Q4YA 2YNCA 2ZW6A 4XPKA 5I0CA 2IL4A 3PGPA 5F46A 2P6FA 2QECA 5E96A 2GIVA 1Y7RA 1RXTA 2YNDA 3GY9A 2R1IA 2REEA 1M4IA 2CNMA 2B3UA 4CAXA 2FCKA 2GE3A 5KTAA 2CNSA 3UY5A 4JWPA 4JD6A 4R9MA 3I3GA 4A32A 2OH1A 4B5OA 3R96A 1K4JA 4FD6A 4KUAA 4R87A 3IGRA 4MBUA 2FSRA 2Y0MA 4QUSA 4R3KA 1S7KA 4XPLA 2Z3LA 2FE7A 1PUAA 3RYOA 4KOTA 4KS9A 5A28A 3TFYA 4CS0B 1NSLA 4UCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LD2 A;  1XE4 A;  1Z4E A;  3B8G A;  3MGD A;  3S6K A;  1Y9W A;  4HNX B;  5HMN A;  4AB7 A;  5C82 A;  4E0A A;  2PRB A;  3QAH A;  1WWZ A;  1MK4 A;  1QSO A;  3FRM A;  1J4J A;  2G3T A;  2JEV A;  1MJA A;  5DWM A;  2Z10 A;  4PSW A;  4X5K A;  2AJ6 A;  2PSW A;  1KUX A;  1V0C A;  2PDO A;  5IX3 A;  2PR8 A;  3NE7 A;  4IF5 A;  1TIQ A;  3G3S A;  1NE9 A;  2A4N A;  2JDD A;  3W6S A;  1YX0 A;  1WK4 A;  2FIW A;  2OZG A;  2EUI A;  2OU2 A;  2R7H A;  1M1D A;  2ATR A;  1IYL A;  4UWI A;  3SXO A;  1P0H A;  3TO9 A;  2ZW5 A;  1IIC A;  4KOR A;  5IV0 A;  2ARH A;  3FBU A;  2ZW4 A;  3D2P A;  3R9G A;  1N71 A;  1YVK A;  3S6F A;  4CRY B;  4Y49 B;  1MJB A;  5H86 A;  3P2H A;  4MY3 A;  2QML A;  5J8F A;  2QIR A;  2X7B A;  3VWE A;  2RC4 A;  4EVY A;  4F6A A;  1S60 A;  2JLM A;  5HH1 A;  4YFJ A;  1LRZ A;  4KVM E;  2G3A A;  1IB1 E;  4PV6 A;  3FYN A;  3EO4 A;  3GYA A;  3DNS A;  3R95 A;  4CRZ B;  1YVO A;  3W91 A;  3F8K A;  1Q2D A;  4YGO A;  3TT2 A;  4ORF A;  1P4N A;  2BUE A;  2J8N A;  4CAV A;  4FD5 A;  3N7Z A;  1RO5 A;  1S7F A;  3JVN A;  4JJX A;  4NF1 A;  4R3L A;  4I49 A;  4RS2 A;  2BL1 A;  3F0A A;  2FT0 A;  1I1D A;  2CNT A;  2ZPA A;  5CNP A;  1XF8 A;  5EC4 A;  2Q04 A;  1XIX A;  2B5G B;  1MJ9 A;  2BSW A;  3TTH A;  2OZU A;  3W6X A;  1S7N A;  1OZP A;  3ZJ0 A;  3R1K A;  1CJW A;  4AG7 A;  4PSX A;  2HV2 A;  4LUA A;  1Q2Y A;  4AVA A;  4L89 A;  2P6G A;  3PP9 A;  1S5K A;  1CM0 A;  4OAE A;  3SHP A;  2D4O A;  2Z11 A;  4F0Y A;  5IB0 A;  4Y49 C;  3V8I A;  3BJ7 A;  3D2M A;  4AVC A;  4KVX A;  1QSR A;  1PU9 A;  2C27 A;  4U9Y A;  3OWC A;  4XPD C;  2GAN A;  5JPH A;  3DSB A;  2B5G A;  4BMH A;  4JXR A;  3QB8 A;  4FD7 A;  4II9 A;  4ONU A;  3TCV A;  4KOS A;  3PZJ A;  3FNC A;  3ZZI A;  4R57 A;  4H6U A;  3TOA A;  3BLN A;  3CXS A;  1M44 A;  2WPX A;  1L0C A;  3LOD A;  3EFA A;  2VZY A;  1S7L A;  3EY5 A;  4UWJ A;  5F48 A;  1Q2C A;  2G0B A;  1S3Z A;  3EC4 A;  3DDD A;  4U5Y A;  3C26 A;  1XMT A;  1I21 A;  4XPD B;  2VBQ A;  1B87 A;  4AVB A;  4HNW B;  1NMT A;  4XNH C;  1I12 A;  2Q7B A;  1YLE A;  4JLY A;  3FXT A;  4IUS A;  4U9Z A;  2PR1 A;  4MY0 A;  3TOB A;  4AG9 A;  3SXN A;  1XEB A;  5F49 A;  4KOV A;  1QSM A;  2I00 A;  5KTD A;  4QVT A;  2B3V A;  2HQY A;  4KOY A;  2O28 A;  3BJ8 A;  4L8A A;  3I9S A;  4KLV A;  2VEZ A;  5ISV A;  3H4Q A;  3FIX A;  4MJ8 A;  2R98 A;  2I79 A;  2OB0 A;  2ZXV A;  2P0W A;  5DWN A;  2F5I A;  4KOX A;  4OAD A;  2B4B A;  2WPW A;  4M3S A;  4H89 A;  5H84 A;  4XNH B;  3D8P A;  2Q4V A;  4M85 A;  4DNC A;  4GS4 A;  4UBR A;  4UA3 A;  2D4P A;  2FIA A;  2DXQ A;  3JUW A;  1IID A;  4QB9 A;  4QC6 A;  2B4D B;  1KUY A;  2JDC A;  1GHE A;  2J8R A;  4YRH A;  2PC1 A;  3EXN A;  4CAW A;  2Q44 A;  2VI7 A;  3VWD A;  1YRE A;  1M4G A;  2FL4 A;  2J8M A;  4ZBG A;  1BO4 A;  1Y9K A;  3K9U A;  3R9F A;  2NMT A;  5JQ4 A;  1IYK A;  3T9Y A;  4OLL A;  4B5P B;  2VZZ A;  4KUB A;  3TE4 A;  5EBV A;  1B6B A;  2HUZ A;  3TO6 A;  2VXK A;  5GCN A;  5FVJ A;  4NXY A;  2OZH A;  3DR8 A;  4PK3 A;  2VQY A;  3R9E A;  4LX9 A;  4J3G A;  3D3S A;  3IWG A;  1YK3 A;  1QSN A;  3E0K A;  1U6M A;  2P6E A;  4E8O A;  2B4D A;  1M4D A;  3CXP A;  2R8V A;  3CXQ A;  3TO7 A;  2REF A;  2ZW7 A;  3KKW A;  1YGH A;  4KZT A;  2EVN A;  3P2F A;  4NCZ A;  1KZF A;  3FB3 A;  5KTC A;  1R57 A;  4MHD A;  5C88 A;  3T90 A;  1VHS A;  3WR7 A;  2Q0Y A;  4MI4 A;  4B5P A;  1BOB A;  1QST A;  3G8W A;  1KUV A;  4KVO E;  3DR6 A;  1Z4R A;  2CY2 A;  4E2A A;  2K5T A;  4QBJ A;  2PQ8 A;  4H6Z A;  1UFH A;  5F47 A;  3GKR A;  4K30 A;  4HNY B;  4NSQ A;  4RI1 A;  3S6H A;  3F5B A;  1SQH A;  2KCW A;  2H5M A;  2FS5 A;  4KOW A;  4FD4 A;  4PK2 A;  1ON0 A;  4KLW A;  2AE6 A;  2B58 A;  5J8C A;  2FXF A;  2Z0Z A;  4JXQ A;  1FY7 A;  1Z9U A;  1YR0 A;  3S6G A;  1VKC A;  4HKF A;  4NEX A;  4KOU A;  2BEI A;  2Q4Y A;  2ZW6 A;  4XPK A;  5I0C A;  2IL4 A;  3PGP A;  5F46 A;  2P6F A;  2QEC A;  5E96 A;  2GIV A;  1Y7R A;  1RXT A;  3GY9 A;  2R1I A;  2REE A;  1M4I A;  2CNM A;  2B3U A;  4CAX A;  2FCK A;  2GE3 A;  5KTA A;  2CNS A;  3UY5 A;  4JWP A;  4JD6 A;  4R9M A;  3I3G A;  2OH1 A;  4B5O A;  3R96 A;  1K4J A;  4KUA A;  4FD6 A;  4R87 A;  3IGR A;  4MBU A;  2FSR A;  2Y0M A;  4QUS A;  4R3K A;  1S7K A;  4XPL A;  2FE7 A;  1PUA A;  3RYO A;  4KOT A;  3TFY A;  4CS0 B;  1NSL A; 
#chains in the Genus database with same CATH topology
 4MHP A;  4JYW A;  3LD2 A;  1XE4 A;  1ZG7 A;  4CGN A;  1Z4E A;  3B8G A;  4MCS A;  3MGD A;  3S6K A;  1Y9W A;  4HNX B;  5A27 A;  1XBU A;  3KHZ A;  4OC1 A;  4AB7 A;  5HMN A;  3KR5 A;  5C82 A;  4ZY1 A;  4E0A A;  2IJZ A;  3KAS A;  2PRB A;  4M6I A;  3QAH A;  1WWZ A;  1MK4 A;  4PXD A;  1CP7 A;  1QSO A;  3FRM A;  1J4J A;  2G3T A;  2JEV A;  2G9D A;  2ZEO A;  1MJA A;  4MHN A;  5DWM A;  2Z10 A;  3IJ3 A;  3PRT A;  2PJ9 A;  2ZEL A;  4PSW A;  2ZEH A;  4PXB A;  4X5K A;  1CP6 A;  1Y0Y A;  2AJ6 A;  2CIJ A;  3NH8 A;  2PSW A;  1KUX A;  1V0C A;  2PDO A;  3K9T A;  4CGO A;  3PBB A;  5IX3 A;  2PR8 A;  3DLJ A;  3NE7 A;  4IF5 A;  3FJU A;  2PJ8 A;  2O4H A;  1TIQ A;  3G3S A;  1NE9 A;  2A4N A;  2JDD A;  3W6S A;  4FAI A;  1YX0 A;  1WK4 A;  2FIW A;  2OZG A;  3JTK A;  4MFK A;  2GRE A;  2EUI A;  2OU2 A;  2WUU A;  2R7H A;  3QNV A;  4B13 A;  1M1D A;  4CGL A;  2BOA A;  2ATR A;  1IYL A;  3MN8 A;  4UWI A;  4F9U A;  1Z8X A;  1P0H A;  3SXO A;  1X10 A;  3TO9 A;  7CPA A;  2ZW5 A;  1IIC A;  3IC1 A;  4KOR A;  5IV0 A;  1TKF A;  2ARH A;  3FBU A;  5CBM A;  5HVH A;  2ZW4 A;  2C1C A;  2F7V A;  3D2P A;  1N71 A;  1YVK A;  3R9G A;  1ARM A;  2ZOG A;  2DF5 A;  3S6F A;  4CRY B;  5HXD A;  3KZW A;  4MFL A;  4DYO A;  4Y49 B;  1MJB A;  2PVW A;  5H86 A;  3P2H A;  1LAN A;  4MY3 A;  4CYO A;  2ZEE A;  2QML A;  5J8F A;  2QIR A;  2X7B A;  3A9L A;  1TKH A;  5G22 A;  4GM5 A;  3TC8 A;  3VWE A;  4F9V A;  2RC4 A;  4ZX8 A;  4EVY A;  4F6A A;  1S60 A;  4OKO A;  2JLM A;  1AYE A;  4A31 A;  4EME A;  5K8P A;  3PB9 X;  5HH1 A;  4YFJ A;  2IQ6 A;  1LRZ A;  4KVM E;  2G3A A;  4UEF A;  3WC6 A;  4CAE A;  4PXE A;  4MFJ A;  5AG7 A;  1IB1 E;  1PYT B;  4A94 A;  4PV6 A;  3B3T A;  4NFR A;  1TF8 A;  3FYN A;  2C6G A;  3EO4 A;  3GYA A;  2AFM A;  4R8F A;  3DNS A;  3R95 A;  4F0X A;  3PB6 X;  3IFE A;  2ZEN A;  3KGQ A;  4Q38 A;  4C2X A;  5K8N A;  3RZA A;  1YVO A;  3WC5 A;  4CRZ B;  2EO8 A;  3KI9 A;  3W91 A;  1XRY A;  4NGR A;  2I3C A;  3F8K A;  1Q2D A;  4MFQ A;  4YGO A;  3TT2 A;  5I4M A;  2Q51 A;  4OP4 A;  4ORF A;  1P4N A;  1YSJ A;  2BUE A;  1BLL E;  3CPX A;  1F2O A;  2J8N A;  4CAV A;  4FD5 A;  3N7Z A;  1RO5 A;  1S7F A;  4KSI A;  3CZX A;  3JVN A;  4JJX A;  4NF1 A;  3IWE A;  4O23 A;  5G1Z A;  5JM6 A;  2PJ3 A;  1UWY A;  3DGV A;  3PEI A;  4R3L A;  4I49 A;  4ZI6 A;  4DJL A;  4MCR A;  3NH4 A;  1Z2L A;  3KR4 A;  4RS2 A;  2BL1 A;  3F0A A;  1CX8 A;  3FF3 A;  2FT0 A;  4WJB A;  1I1D A;  4UFX A;  5CPA A;  2WSA A;  3IIB A;  2YGW A;  4BIN A;  1ELL P;  2CNT A;  2ZPA A;  5CNP A;  1AUG A;  1XF8 A;  5EC4 A;  2Q04 A;  3KHX A;  4B6Z A;  1XIX A;  2B5G B;  4RUH A;  4WWV A;  2QJ8 A;  5LYD A;  1IU8 A;  1NSA A;  1MJ9 A;  2PIY A;  2BSW A;  3TTH A;  3RNZ A;  2OZU A;  3W6X A;  1S7N A;  1OZP A;  2ZED A;  3ZJ0 A;  4MFP A;  3R1K A;  2CF4 A;  4LQ6 A;  1CJW A;  5AG5 A;  4AG7 A;  4OC2 A;  4PSX A;  3B3W A;  2HV2 A;  4LUA A;  1Q2Y A;  3H5Z A;  1CPS A;  4DUK A;  4R76 A;  4AVA A;  5DS0 A;  1TKJ A;  2XEF A;  4L89 A;  2P6G A;  3PP9 A;  1S5K A;  3FH4 A;  1CM0 A;  3MRU A;  2Z3K A;  4OAE A;  1A2Z A;  5LRJ A;  2V8H A;  3NH5 A;  3PB4 X;  4OC4 A;  2JBK A;  4MRI A;  3SHP A;  2D4O A;  1LCP A;  3B7I A;  1LFW A;  2NYQ A;  4UIB A;  2Z11 A;  4F0Y A;  5LYL A;  4NGT A;  5IB0 A;  4BD9 A;  4GXH A;  4Y49 C;  3V8I A;  3BJ7 A;  1X12 A;  3D2M A;  4AVC A;  2OR4 A;  4K3N A;  4KVX A;  1QSR A;  1VHE A;  4X3R A;  1HDU A;  1PU9 A;  2C27 A;  4KSF A;  3GLJ A;  3KQX A;  3KL9 A;  4U9Y A;  1ZO0 A;  3OWC A;  4XPD C;  2GAN A;  5LYF A;  5JPH A;  1CG2 A;  3DSB A;  2B5G A;  4Q36 A;  4W9Y A;  4JXR A;  4BMH A;  3QB8 A;  4FD7 A;  5D8N A;  4II9 A;  4ONU A;  4MHY A;  3TCV A;  4KOS A;  3PZJ A;  3FNC A;  3ZZI A;  4R57 A;  3IU1 A;  4H6U A;  4NGN A;  3TOA A;  3BLN A;  3PB7 X;  2WYR A;  3CXS A;  4B10 A;  3SI1 A;  1M44 A;  2AFU A;  3SI2 A;  2WPX A;  4UEZ A;  1L0C A;  3LOD A;  4PXC A;  1Y0R A;  3EFA A;  2VZY A;  4NJR A;  5AG6 A;  1Z8W A;  1S7L A;  4CGM A;  5JH9 A;  3EY5 A;  1YQE A;  2ZEG A;  4UWJ A;  5F48 A;  2ZOF A;  1Q2C A;  2AFW A;  2PJA A;  2RB7 A;  1XFO A;  4MCP A;  1IGB A;  2V77 A;  4B12 A;  3FED A;  2G0B A;  4CYN A;  3CT9 A;  1S3Z A;  1Z8T A;  3D66 A;  3EC4 A;  4UCM A;  4MCQ A;  3PFE A;  1BPN A;  2V8D A;  1YW6 A;  4X8I A;  3DDD A;  4MXU A;  4BBH A;  3PBE A;  5ELY A;  4U5Y A;  3C26 A;  5F09 A;  2PJ0 A;  1XMT A;  1R43 A;  1I21 A;  2AFX A;  3GIU A;  4FWU A;  1Y7E A;  2VBQ A;  4XPD B;  1B87 A;  4AVB A;  4P45 A;  2EK8 A;  2J9A A;  1NMT A;  3B3S A;  4HNW B;  4KSA A;  4ONW A;  4XNH C;  5JGF A;  1I12 A;  4A2Z A;  5K8O A;  4A95 A;  3K2K A;  2Q7B A;  4Q7A A;  1YLE A;  2XEG A;  4JLY A;  3FXT A;  4IUS A;  4U9Z A;  2PR1 A;  2Q7S A;  2V8V A;  4MY0 A;  3TOB A;  2JEW A;  4AG9 A;  3SXN A;  4A37 A;  1XEB A;  5F49 A;  4C2Y A;  4KOV A;  2EWB A;  1QSM A;  2I00 A;  4IK2 A;  4M6G A;  5KTD A;  3IWW A;  4QVT A;  3V7Z A;  2B3V A;  2PCU A;  2HQY A;  3PFO A;  4KOY A;  4P44 A;  3RO0 A;  5EMI A;  1LAM A;  2O28 A;  3BJ8 A;  4L8A A;  3I9S A;  4EWT A;  4KLV A;  2VEZ A;  4B11 A;  1JQG A;  1TF9 A;  3H4Q A;  3FIX A;  4X2T A;  5ISV A;  4NGQ A;  5D29 A;  2YNE A;  2EBJ A;  2R98 A;  2I79 A;  2OB0 A;  2EK9 A;  2ZXV A;  4MJ8 A;  3VAR A;  2PRQ A;  4JZ0 A;  2GFQ A;  3CDX A;  2P0W A;  5DWN A;  1ZLI A;  2F5I A;  3CPA A;  4KOX A;  4OAD A;  2Z3N A;  2B4B A;  2WZN A;  4A33 A;  1BPM A;  2WPW A;  2PJB A;  4M3S A;  2C6P A;  4H89 A;  5H84 A;  3N5F A;  4XNH B;  3D8P A;  3D7G A;  2Z3M A;  5BWA B;  4R6T A;  4CGP A;  2Q4V A;  4ZGY B;  2CTB A;  4OID A;  4M85 A;  4DNC A;  1IOI A;  4GS4 A;  4UBR A;  4UA3 A;  3VH9 A;  3S9N A;  2DPT A;  3JRU A;  3D7H A;  2D4P A;  4UF4 A;  2FIA A;  2C6C A;  2DXQ A;  2QVP A;  2Z3P A;  3JUW A;  1IID A;  4OC5 A;  3HUV A;  4ZX9 A;  2RFH A;  1DE4 C;  4QB9 A;  4QC6 A;  4UIA A;  2B4D B;  4F8Z A;  1KUY A;  2JDC A;  3D68 A;  1GHE A;  2J8R A;  1Z8L A;  4ZY2 A;  4IAV A;  2HB6 A;  3NA6 A;  4YRH A;  3WC7 A;  4C2Z A;  4CYQ A;  1DTD A;  4FBE A;  3S9L A;  4C68 A;  3LAC A;  1RTQ A;  1JWQ A;  4ZY0 A;  3V38 A;  2PC1 A;  2XEJ A;  1ELM P;  1Q7L A;  3EXN A;  3IO1 A;  4P10 A;  2CXA A;  4YWY A;  1IOF A;  4CAW A;  1HEE A;  2Q44 A;  4P4I A;  1ZG8 A;  2VI7 A;  3VWD A;  1YRE A;  1M4G A;  4UEE A;  4Z65 A;  2FL4 A;  2J8M A;  4ZBG A;  1R3N A;  3FVL A;  3HLP A;  5G21 A;  1BO4 A;  1Y9K A;  3K9U A;  2NSM A;  3R9F A;  2NMT A;  1VIX A;  1AMP A;  2OOT A;  1IYK A;  3H8E A;  5JQ4 A;  8CPA A;  4CYP A;  3T9Y A;  4MFZ A;  4OLL A;  2DPS A;  4B5P B;  2VZZ A;  1VGY A;  4KUB A;  1KWM A;  3TE4 A;  5EBV A;  3IU2 A;  2JBJ A;  3FEC A;  4IHM A;  1B6B A;  2HUZ A;  3IEH A;  1QMU A;  2YNC C;  3TO6 A;  3RAM A;  3BI1 A;  2VXK A;  3GB0 A;  5GCN A;  4YU9 A;  5FVJ A;  4NXY A;  2GLF A;  2Q4Z A;  4C7I A;  2OZH A;  3B3C A;  3DR8 A;  4PK3 A;  2VQY A;  4CAF A;  1FT7 A;  3R9E A;  2AFO A;  1PCA A;  4NGM A;  3WAB A;  3QAY A;  2PJ1 A;  1VHO A;  3D3S A;  3H8F A;  3IWG A;  4J3G A;  4LX9 A;  1YK3 A;  1QSN A;  3E0K A;  1U6M A;  2AFZ A;  2P6E A;  2PIZ A;  4A30 A;  4RN7 A;  4E8O A;  2B4D A;  1M4D A;  1F57 A;  4OME A;  4R7M A;  1FNO A;  2AFS A;  3CXP A;  2R8V A;  3CXQ A;  4MMO A;  3TO7 A;  1F2P A;  1LAP A;  2ZEP A;  2REF A;  3B3V A;  4OC0 A;  2ZW7 A;  3NFZ A;  3I1U A;  3BI0 A;  1XJO A;  5LRK A;  2DEA A;  2BCO A;  1IY7 A;  3KKW A;  3L2N A;  1YGH A;  3LMS A;  4KZT A;  1QQ9 A;  2V8G A;  5LRG A;  1OBR A;  1YW4 A;  4A39 A;  2HC9 A;  2EVN A;  3P2F A;  1M4L A;  4NCZ A;  3FMC A;  3RBU A;  1KZF A;  3BXM A;  3VAT A;  3FB3 A;  2POK A;  5KTC A;  6CPA A;  3B35 A;  1R57 A;  4MHD A;  5C88 A;  3T90 A;  2QYV A;  4PPZ A;  2PJ6 A;  1VHS A;  4NGP A;  1CPX A;  3WR7 A;  2PJ7 A;  2Q0Y A;  4MI4 A;  4B5P A;  4LQG A;  1BOB A;  1QST A;  3G8W A;  4B14 A;  5AG4 A;  1KUV A;  4UFV A;  4KVO E;  2PVV A;  3T8W A;  2ABZ A;  4FUU A;  3DR6 A;  1ZG9 A;  1Z4R A;  3BHX A;  2CY2 A;  4M6H A;  4E2A A;  2K5T A;  4QBJ A;  2PQ8 A;  3D7D A;  4H6Z A;  2Z3O A;  1Z5R A;  5AGE A;  1XOV A;  1UFH A;  2VL1 A;  3NE8 A;  3B2Y A;  4NJQ A;  4NGS A;  4P4F A;  3GKR A;  4K30 A;  5F47 A;  3SI0 A;  4HNY B;  4NSQ A;  4C7H A;  3FEE A;  4RI1 A;  3ISX A;  3S6H A;  3F5B A;  4P4D A;  1ZLH A;  5HVF A;  1SQH A;  2KCW A;  2H5M A;  2IMO A;  5K8M A;  3SJF A;  5HVG A;  2FS5 A;  4AXV A;  2PJ4 A;  2ZEF A;  4KOW A;  4UCP A;  4FD4 A;  4PK2 A;  3D67 A;  1ON0 A;  4OC3 A;  3KQZ A;  5J1Q A;  4KLW A;  2AE6 A;  4PQA A;  2B58 A;  5J8C A;  2FXF A;  2Z0Z A;  1YLO A;  4JXQ A;  4MHZ A;  1TXR A;  3H8G A;  5G20 A;  1FY7 A;  1Z9U A;  3LWU A;  1H8L A;  1YR0 A;  3S6G A;  1VKC A;  4HKF A;  3S9M A;  4NEX A;  4TWE A;  1LOK A;  4KOU A;  4TNU A;  2BEI A;  4UFW A;  4OIW A;  1CBX A;  1SR8 A;  1EE3 P;  3D7F A;  2BO9 A;  2Q4Y A;  3SJG A;  5IB9 A;  2YNC A;  2ZW6 A;  4XPK A;  3WT4 A;  5I0C A;  2IL4 A;  3PGP A;  5F46 A;  3SJE A;  2P6F A;  4ZYQ A;  3TX8 A;  2QEC A;  2PE3 A;  5E96 A;  2GIV A;  1Y7R A;  1RXT A;  2YND A;  1XMB A;  1HDQ A;  3GY9 A;  2R1I A;  2O53 A;  5THW A;  2REE A;  1M4I A;  4G1P A;  2ANP A;  1ARL A;  2CNM A;  2GLJ A;  2GU2 A;  3ISZ A;  2B3U A;  2F8H A;  2FVG A;  3PB8 X;  4CAX A;  1BAV A;  2FCK A;  2GE3 A;  5KTA A;  2CNS A;  4EFD A;  3UY5 A;  2PJ2 A;  4JD6 A;  4JWP A;  4P4E A;  4HPS A;  4R9M A;  4P4B A;  4A38 A;  3I3G A;  4A32 A;  1GYT A;  2OH1 A;  4H2K A;  4B5O A;  3R96 A;  1K4J A;  2ODF A;  4FD6 A;  3FX6 A;  4KUA A;  4R87 A;  3IGR A;  4MBU A;  4CPA A;  3GUX A;  2FSR A;  2Y0M A;  4QUS A;  3SJX A;  4P4J A;  2XEI A;  2ZEM A;  1S7K A;  4R3K A;  1YME A;  2Q43 A;  4XPL A;  2PJ5 A;  2Z3L A;  2CTC A;  2FE7 A;  3D4U A;  1PUA A;  5LYI A;  3RYO A;  4KOT A;  4KS9 A;  5A28 A;  3TFY A;  4P6Y A;  4CS0 B;  1NSL A;  4UCN A;  2PJC A; 
#chains in the Genus database with same CATH homology
 3LD2 A;  1XE4 A;  4CGN A;  1Z4E A;  3B8G A;  3MGD A;  3S6K A;  1Y9W A;  4HNX B;  5A27 A;  5HMN A;  4AB7 A;  5C82 A;  4E0A A;  2PRB A;  3QAH A;  1WWZ A;  1MK4 A;  1QSO A;  3FRM A;  1J4J A;  2G3T A;  2JEV A;  1MJA A;  5DWM A;  2Z10 A;  4PSW A;  4X5K A;  2AJ6 A;  2PSW A;  1KUX A;  1V0C A;  2PDO A;  4CGO A;  5IX3 A;  2PR8 A;  3NE7 A;  4IF5 A;  1TIQ A;  3G3S A;  1NE9 A;  2A4N A;  2JDD A;  3W6S A;  1YX0 A;  1WK4 A;  2FIW A;  2OZG A;  3JTK A;  4MFK A;  2EUI A;  2OU2 A;  2WUU A;  2R7H A;  4B13 A;  1M1D A;  4CGL A;  2ATR A;  1IYL A;  4UWI A;  3SXO A;  1P0H A;  3TO9 A;  2ZW5 A;  1IIC A;  4KOR A;  5IV0 A;  2ARH A;  3FBU A;  2ZW4 A;  3D2P A;  3R9G A;  1N71 A;  1YVK A;  3S6F A;  4CRY B;  4MFL A;  4Y49 B;  1MJB A;  5H86 A;  3P2H A;  4MY3 A;  4CYO A;  2QML A;  5J8F A;  2QIR A;  2X7B A;  3A9L A;  3VWE A;  5G22 A;  2RC4 A;  4EVY A;  4F6A A;  1S60 A;  2JLM A;  4A31 A;  5HH1 A;  4YFJ A;  1LRZ A;  4KVM E;  2G3A A;  4CAE A;  4MFJ A;  5AG7 A;  1IB1 E;  4PV6 A;  3FYN A;  3EO4 A;  3GYA A;  3DNS A;  3R95 A;  4F0X A;  4Q38 A;  4C2X A;  4CRZ B;  1YVO A;  3W91 A;  3F8K A;  1Q2D A;  4MFQ A;  4YGO A;  3TT2 A;  4ORF A;  1P4N A;  2BUE A;  2J8N A;  4CAV A;  4FD5 A;  3N7Z A;  1RO5 A;  1S7F A;  5G1Z A;  3JVN A;  4JJX A;  4NF1 A;  3IWE A;  4R3L A;  4I49 A;  4RS2 A;  2BL1 A;  3F0A A;  2FT0 A;  1I1D A;  4UFX A;  2WSA A;  2YGW A;  2CNT A;  2ZPA A;  5CNP A;  1XF8 A;  5EC4 A;  2Q04 A;  1XIX A;  2B5G B;  1MJ9 A;  2BSW A;  3TTH A;  2OZU A;  3W6X A;  1S7N A;  1OZP A;  3ZJ0 A;  4MFP A;  3R1K A;  1CJW A;  5AG5 A;  4AG7 A;  4PSX A;  2HV2 A;  4LUA A;  1Q2Y A;  3H5Z A;  4AVA A;  4L89 A;  2P6G A;  3PP9 A;  1S5K A;  1CM0 A;  2Z3K A;  4OAE A;  3SHP A;  2D4O A;  2Z11 A;  4F0Y A;  5IB0 A;  4Y49 C;  3V8I A;  3BJ7 A;  3D2M A;  4AVC A;  4KVX A;  1QSR A;  1PU9 A;  2C27 A;  4KSF A;  4U9Y A;  1ZO0 A;  3OWC A;  4XPD C;  2GAN A;  5JPH A;  3DSB A;  2B5G A;  4Q36 A;  4BMH A;  4JXR A;  3QB8 A;  4FD7 A;  4II9 A;  4ONU A;  3TCV A;  4KOS A;  3PZJ A;  3FNC A;  3ZZI A;  4R57 A;  3IU1 A;  4H6U A;  3TOA A;  3BLN A;  4B10 A;  3CXS A;  1M44 A;  2WPX A;  1L0C A;  3LOD A;  3EFA A;  5AG6 A;  2VZY A;  4CGM A;  1S7L A;  3EY5 A;  4UWJ A;  5F48 A;  1Q2C A;  4B12 A;  2G0B A;  4CYN A;  1S3Z A;  3EC4 A;  4UCM A;  3DDD A;  4BBH A;  4U5Y A;  3C26 A;  1XMT A;  1I21 A;  4XPD B;  2VBQ A;  1B87 A;  4AVB A;  4HNW B;  1NMT A;  4KSA A;  4XNH C;  1I12 A;  4A2Z A;  4A95 A;  2Q7B A;  1YLE A;  4JLY A;  3FXT A;  4IUS A;  4U9Z A;  2PR1 A;  4MY0 A;  3TOB A;  4AG9 A;  3SXN A;  1XEB A;  5F49 A;  4C2Y A;  4KOV A;  1QSM A;  2I00 A;  5KTD A;  4QVT A;  2B3V A;  2HQY A;  4KOY A;  2O28 A;  3BJ8 A;  4L8A A;  3I9S A;  4KLV A;  2VEZ A;  4B11 A;  5ISV A;  3H4Q A;  3FIX A;  2YNE A;  4MJ8 A;  2R98 A;  2I79 A;  2OB0 A;  2ZXV A;  2P0W A;  5DWN A;  2F5I A;  4KOX A;  4OAD A;  2Z3N A;  2B4B A;  4A33 A;  2WPW A;  4M3S A;  4H89 A;  5H84 A;  4XNH B;  3D8P A;  2Z3M A;  5BWA B;  4CGP A;  2Q4V A;  4ZGY B;  4M85 A;  4DNC A;  4GS4 A;  4UBR A;  4UA3 A;  2DPT A;  2D4P A;  2FIA A;  2DXQ A;  2Z3P A;  3JUW A;  1IID A;  4QB9 A;  4QC6 A;  2B4D B;  1KUY A;  2JDC A;  1GHE A;  2J8R A;  4YRH A;  4C2Z A;  4CYQ A;  4C68 A;  2PC1 A;  3EXN A;  4CAW A;  2CXA A;  2Q44 A;  2VI7 A;  3VWD A;  1YRE A;  1M4G A;  2FL4 A;  2J8M A;  4ZBG A;  5G21 A;  1BO4 A;  1Y9K A;  3K9U A;  3R9F A;  2NMT A;  5JQ4 A;  1IYK A;  4CYP A;  3T9Y A;  4MFZ A;  4OLL A;  2DPS A;  4B5P B;  2VZZ A;  4KUB A;  3TE4 A;  5EBV A;  3IU2 A;  1B6B A;  2HUZ A;  2YNC C;  3TO6 A;  2VXK A;  5GCN A;  5FVJ A;  4NXY A;  4C7I A;  2OZH A;  3DR8 A;  4PK3 A;  2VQY A;  4CAF A;  3R9E A;  4J3G A;  3D3S A;  3IWG A;  4LX9 A;  1YK3 A;  1QSN A;  3E0K A;  1U6M A;  2P6E A;  4A30 A;  4E8O A;  2B4D A;  1M4D A;  3CXP A;  2R8V A;  3CXQ A;  3TO7 A;  2REF A;  2ZW7 A;  3KKW A;  1YGH A;  4KZT A;  2EVN A;  3P2F A;  4NCZ A;  1KZF A;  3FB3 A;  5KTC A;  1R57 A;  4MHD A;  5C88 A;  3T90 A;  1VHS A;  3WR7 A;  2Q0Y A;  4MI4 A;  4B5P A;  1BOB A;  1QST A;  3G8W A;  4B14 A;  5AG4 A;  1KUV A;  4UFV A;  4KVO E;  3DR6 A;  1Z4R A;  2CY2 A;  4E2A A;  2K5T A;  4QBJ A;  2PQ8 A;  4H6Z A;  2Z3O A;  5AGE A;  1UFH A;  5F47 A;  3GKR A;  4K30 A;  4C7H A;  4HNY B;  4NSQ A;  4RI1 A;  3S6H A;  3F5B A;  1SQH A;  2KCW A;  2H5M A;  2FS5 A;  4KOW A;  4UCP A;  4FD4 A;  4PK2 A;  1ON0 A;  4KLW A;  2AE6 A;  2B58 A;  5J8C A;  2FXF A;  2Z0Z A;  4JXQ A;  5G20 A;  1FY7 A;  1Z9U A;  1YR0 A;  3S6G A;  1VKC A;  4HKF A;  4NEX A;  4KOU A;  2BEI A;  4UFW A;  1SR8 A;  2Q4Y A;  2YNC A;  2ZW6 A;  4XPK A;  5I0C A;  2IL4 A;  3PGP A;  5F46 A;  2P6F A;  2QEC A;  5E96 A;  2GIV A;  1Y7R A;  1RXT A;  2YND A;  3GY9 A;  2R1I A;  2REE A;  1M4I A;  2CNM A;  2B3U A;  4CAX A;  2FCK A;  2GE3 A;  5KTA A;  2CNS A;  3UY5 A;  4JWP A;  4JD6 A;  4R9M A;  3I3G A;  4A32 A;  2OH1 A;  4B5O A;  3R96 A;  1K4J A;  4FD6 A;  4KUA A;  4R87 A;  3IGR A;  4MBU A;  2FSR A;  2Y0M A;  4QUS A;  4R3K A;  1S7K A;  4XPL A;  2Z3L A;  2FE7 A;  1PUA A;  3RYO A;  4KOT A;  4KS9 A;  5A28 A;  3TFY A;  4CS0 B;  1NSL A;  4UCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...