2GANA

Crystal structure of a putative acetyltransferase from pyrococcus horikoshii, northeast structural genomics target jr32.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
184
structure length
184
Chain Sequence
MEGVKKIKNPSTVKDELLELMFRIYRSTNGKYPALEWVKRKPNPNDFNGFREVYEPFLKFRLSQEFDELYTYQKDNRIIGTIALVYKRIKEKGIWWVPEELMNEKVGLIEFFVVDPEFQGKGIGSTLLEFAVKRLRSLGKDPYVVTFPNLEAYSYYYMKKGFREIMRYKEFVILKFNHKKFQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 182aa long hypothetical protein
publication title Crystal Structure of a Putative Acetyltransferase from Pyrococcus horikoshii, Northeast Structural Genomics Target JR32.
rcsb
source organism Pyrococcus horikoshii
total genus 47
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1990.20 Alpha Beta 2-Layer Sandwich CbiD-like CbiD-like 2ganA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ganA01
2QIRA 2RC4A 4UWJA 4XPLA 2OU2A 3PZJA 2IL4A 4LUAA 2P0WA 3LD2A 3TO6A 1VKCA 1XIXA 1SQHA 3TFYA 5GCNA 2H5MA 2CNTA 2B5GB 4XNHB 2ZW7A 2B3UA 3R1KA 1Q2DA 4PSWA 4KOTA 4R3KA 4KZTA 1YR0A 3GYAA 2Q44A 2PDOA 3FYNA 4EVYA 2VI7A 4L89A 4AG9A 3W91A 1M44A 5F49A 2A4NA 2B4BA 2HQYA 4XPKA 3SHPA 2HV2A 2EUIA 4Y49C 2R98A 4KLVA 2OZHA 2Q4YA 1S7NA 2Q7BA 5I0CA 1Z4EA 2B58A 1MJBA 2FL4A 2PQ8A 4QC6A 1BO4A 4NCZA 2EVNA 3T9YA 5IX3A 1P0HA 2BUEA 1P4NA 4GS4A 4CRZB 1RO5A 3TO9A 2P6EA 3FBUA 1KUVA 4RI1A 5IV0A 2PC1A 4HNWB 4KVOE 4CAVA 4KOWA 3S6GA 1XMTA 3FRMA 2HUZA 2B5GA 4DNCA 2OB0A 2I00A 3F5BA 4IUSA 4RS2A 3PGPA 5H86A 1IICA 4QB9A 1B87A 2R1IA 4FD7A 3DR8A 1J4JA 3D8PA 2VZZA 4KUBA 4JLYA 2ZW6A 4KOUA 2CNMA 1GHEA 2QECA 4HNYB 1PUAA 2PSWA 2PR8A 3TT2A 1CM0A 1WK4A 3TO7A 4JWPA 4M85A 4R3LA 2FIWA 1R57A 4AVCA 2O28A 4KORA 3GKRA 1TIQA 1MJ9A 2Z10A 4JJXA 3JUWA 3NE7A 2ZW5A 3TCVA 4M3SA 5KTAA 2VBQA 1QSRA 4AVBA 4Y49B 3MGDA 4IF5A 4E2AA 2REFA 4KOXA 4KVXA 1RXTA 4OLLA 3EO4A 3R9GA 3D2PA 2VZYA 4B5OA 1CJWA 1XE4A 2X7BA 1MJAA 3SXNA 3EY5A 4MHDA 2BEIA 2FE7A 3DDDA 2JLMA 1OZPA 5J8CA 5H84A 3PP9A 1NMTA 5C82A 4R9MA 2J8RA 4R87A 3K9UA 3N7ZA 5F47A 2Y0MA 3G3SA 3LODA 4B5PB 1BOBA 1YLEA 4OADA 3QAHA 2GIVA 4KOVA 4PK2A 4UA3A 4U5YA 3S6KA 3FXTA 3E0KA 3W6SA 5EC4A 1N71A 2AJ6A 4LX9A 1V0CA 4YRHA 3DR6A 1WWZA 3CXPA 2G3AA 2Q4VA 1YVOA 2VEZA 1YVKA 4NSQA 2NMTA 2Z11A 4E0AA 1Q2YA 2WPWA 1IB1E 3ZZIA 3EFAA 1NSLA 1Z9UA 4KOSA 3CXQA 1M4IA 3I9SA 2PR1A 2K5TA 3EC4A 4KUAA 4XPDB 4MJ8A 2AE6A 3CXSA 5ISVA 5E96A 1S7FA 3B8GA 2GE3A 4NEXA 4J3GA 4CRYB 4PV6A 4CAXA 2G3TA 1XEBA 3VWDA 1Q2CA 3D2MA 4B5PA 1KZFA 3H4QA 5JPHA 3DNSA 4F6AA 3FB3A 1U6MA 3W6XA 1I12A 5EBVA 2C27A 1YX0A 2D4OA 4MBUA 4K30A 4NF1A 2GANA 1I21A 3FIXA 1Y9WA 1XF8A 2ZXVA 3JVNA 2Q04A 4QUSA 3TTHA 2G0BA 1QSMA 1L0CA 3R9EA 4E8OA 4BMHA 1LRZA 1K4JA 5FVJA 1M1DA 4CAWA 4H89A 4XPDC 2P6FA 3TOAA 4UBRA 1S7LA 2FSRA 2ZPAA 3IWGA 4AG7A 3BJ7A 1YGHA 4YGOA 4ONUA 3OWCA 2I79A 4U9ZA 5DWNA 2ATRA 1M4GA 3BLNA 4MY3A 1I1DA 2D4PA 2Q0YA 5C88A 4JXRA 2B4DB 1B6BA 4QVTA 4PSXA 4R57A 5KTDA 2FIAA 5JQ4A 2BL1A 5F48A 3UY5A 3G8WA 4H6ZA 4ZBGA 1KUYA 4KVME 5CNPA 2OZGA 4FD4A 1S5KA 1PU9A 5KTCA 3SXOA 3VWEA 2B3VA 1IYKA 5IB0A 2VXKA 2KCWA 4F0YA 4UWIA 1NE9A 5DWMA 1IIDA 1KUXA 1IYLA 4I49A 1QSTA 3DSBA 5F46A 3EXNA 2FS5A 3TOBA 3WR7A 4KOYA 2R7HA 3P2FA 4OAEA 3ZJ0A 2JDCA 1ON0A 4YFJA 3R95A 1S7KA 4CS0B 3GY9A 3F8KA 4JD6A 2PRBA 1S3ZA 4FD5A 4KLWA 2REEA 3KKWA 4FD6A 2J8MA 5HMNA 2P6GA 2CNSA 3T90A 3QB8A 1UFHA 1QSNA 3FNCA 4HKFA 2B4DA 3RYOA 1MK4A 1Y9KA 4X5KA 2JEVA 3C26A 2VQYA 4II9A 2R8VA 4JXQA 5J8FA 4XNHC 3I3GA 4NXYA 4MY0A 1S60A 2OZUA 1YREA 4L8AA 1Y7RA 1M4DA 3P2HA 1Z4RA 2ARHA 2QMLA 4U9YA 3S6FA 4PK3A 2BSWA 4MI4A 1QSOA 2J8NA 3IGRA 4ORFA 3TE4A 3V8IA 3R9FA 3F0AA 3BJ8A 1FY7A 3S6HA 3R96A 4HNXB 2ZW4A 2JDDA 5HH1A 2OH1A 3D3SA 2F5IA 2Z0ZA 2CY2A 2DXQA 1YK3A 4QBJA 4AB7A 2FT0A 2FXFA 1VHSA 4H6UA 4AVAA 2WPXA 2FCKA
chains in the Genus database with same CATH superfamily
4MHNA 2O53A 4MFKA 4P10A 2QIRA 2RC4A 4UWJA 5CBMA 1Y0YA 3CPXA 4XPLA 5JGFA 2OU2A 1CPXA 3PZJA 4X3RA 2IL4A 2EK8A 1LCPA 4LUAA 2P0WA 3LD2A 3TO6A 1VKCA 1XIXA 1SQHA 2J9AA 4OC2A 4MFZA 5GCNA 3TFYA 3CDXA 4O23A 2H5MA 3FMCA 2CNTA 2PJBA 4M6GA 4GXHA 2B5GB 4XNHB 4RN7A 2ODFA 2ZW7A 2B3UA 3KI9A 3R1KA 1Q2DA 2Z3OA 2PJ0A 2YGWA 4PSWA 5HXDA 4KOTA 3PFOA 4R3KA 4H2KA 4KZTA 1YQEA 2EWBA 3RAMA 2PJ7A 1YR0A 4MMOA 2PRQA 3WT4A 4NJQA 4EWTA 3GYAA 4UIAA 4CPAA 2Q44A 2PDOA 3FYNA 4TWEA 4EVYA 3H8GA 3L2NA 4NJRA 1PYTB 2ZEDA 2VI7A 4L89A 2Q4ZA 3H8FA 2BCOA 4AG9A 1Z5RA 3W91A 1M44A 4UEZA 5F49A 4WWVA 4NGMA 2A4NA 1F57A 2PJ3A 3WC6A 4G1PA 4DUKA 2PJAA 2ZEMA 2O4HA 5A27A 2YNCA 2JEWA 2B4BA 4MFLA 4RUHA 2HQYA 4XPKA 3NH8A 4P4FA 3SHPA 3IJ3A 2HV2A 4NGRA 2EUIA 5LYIA 4Y49C 2R98A 1QQ9A 3PB6X 4KLVA 1OBRA 3SI1A 3D7HA 3NH4A 4A95A 2GLFA 2WSAA 3BHXA 5D8NA 5I4MA 2OZHA 1HDQA 2Q4YA 1S7NA 3K2KA 2Q7BA 5I0CA 4A33A 5LRKA 1Z4EA 2B58A 1MJBA 4C2ZA 2FL4A 2PQ8A 4QC6A 4NGTA 1BO4A 3ISXA 4PXEA 4NCZA 2EVNA 2QYVA 3T9YA 4OC5A 3SJFA 5IX3A 1P0HA 3FJUA 2CTBA 2BUEA 1P4NA 4GS4A 2HB6A 4P4DA 4CRZB 1RO5A 1DE4C 1Y0RA 2AFZA 4B13A 1IY7A 2P6EA 3TO9A 3FBUA 1KUVA 4RI1A 4CGPA 5IV0A 2PC1A 4OP4A 4HNWB 4EFDA 3V7ZA 4KVOE 1ELLP 4CAVA 1XMBA 3TC8A 2NSMA 4KOWA 3S6GA 3B3TA 1VGYA 1HEEA 1XMTA 1AUGA 3S9MA 2V77A 3FRMA 4PPZA 4PQAA 1YW6A 2HUZA 4R7MA 2EK9A 1F2PA 2B5GA 4Q7AA 4B6ZA 2OB0A 2I00A 3F5BA 3H5ZA 4IUSA 4RS2A 3PGPA 4UFWA 4EMEA 3H8EA 4MFPA 4UCMA 1IICA 2Z3KA 5H86A 4QB9A 1B87A 4OKOA 5G20A 2R1IA 4FD7A 5LYFA 3DR8A 1ARLA 2ZENA 3PB8X 4JYWA 1J4JA 4Q36A 4W9YA 4ZX8A 4DJLA 3D8PA 3TX8A 2VZZA 5JH9A 4OIDA 4KUBA 2IQ6A 2ZELA 2ZW6A 4JLYA 3BI1A 4KOUA 2CNMA 1GHEA 1ZG8A 1CPSA 2QECA 3LWUA 4UCPA 4HNYB 1PUAA 2ABZA 2PSWA 4HPSA 2PR8A 3TT2A 1CM0A 1WK4A 4OC4A 3FF3A 3TO7A 4JWPA 4MXUA 4PXBA 4M85A 4MRIA 4R3LA 2FIWA 1R57A 2GREA 3NFZA 4AVCA 3PB7X 2O28A 3PFEA 4KORA 3GKRA 1TIQA 2PIYA 3K9TA 1MJ9A 2BO9A 2XEGA 2Z10A 4JJXA 4ZY2A 4PXCA 1IOFA 3JUWA 4ZY0A 3NE7A 2YNEA 2ZW5A 3TCVA 4M3SA 2RB7A 2ZEPA 3MN8A 4A31A 3VH9A 4C7IA 4DNCA 2WYRA 5KTAA 2VBQA 1QSRA 4AVBA 2DPTA 4Y49B 3MGDA 4IF5A 1Y7EA 3IFEA 4KS9A 4E2AA 2REFA 4KOXA 4KVXA 1RXTA 2ZEFA 1LOKA 4OLLA 3HLPA 3EO4A 4Z65A 4B11A 2FVGA 3R9GA 1FNOA 4F9UA 2G9DA 2ZEGA 3D2PA 4A37A 2VZYA 4B5OA 3FX6A 1CJWA 1ZLHA 1XE4A 2X7BA 1MJAA 3SXNA 3EY5A 2OOTA 2EBJA 3D67A 4CYOA 3FVLA 1YLOA 4MHDA 3VARA 2BEIA 3SJEA 1YW4A 2FE7A 3DDDA 2JLMA 1X10A 1CP7A 2AFOA 1OZPA 3SI2A 2V8DA 2YNDA 5J8CA 3GLJA 1BPNA 5H84A 1TKFA 3PP9A 1NMTA 5G1ZA 4FWUA 2DPSA 5C82A 4R9MA 1YSJA 4A38A 2J8RA 4R87A 3K9UA 4YWYA 3WC5A 4Q38A 4ZI6A 2GLJA 3N7ZA 2QJ8A 4JZ0A 4P6YA 5K8NA 5F47A 8CPAA 2Y0MA 3G3SA 4TNUA 1GYTA 3LODA 4B5PB 5AG4A 1BOBA 1YLEA 2AFUA 4B14A 4OADA 3QAHA 4UEEA 4A2ZA 1TKHA 2GIVA 4M6IA 3V38A 3DGVA 4KOVA 4OC0A 4A32A 1R43A 2XEFA 4PK2A 4UA3A 4U5YA 3S6KA 1VIXA 5G22A 3FXTA 4A39A 1KWMA 3E0KA 3W6SA 3D4UA 5EC4A 1N71A 5AG6A 2AJ6A 4LX9A 3T8WA 1V0CA 3RBUA 2PJ6A 4YRHA 2C6GA 1XRYA 3DR6A 1WWZA 3CXPA 4NGQA 2G3AA 2Q4VA 1YVOA 2VEZA 3JTKA 1YVKA 3BXMA 1XFOA 4P4JA 4ZGYB 4DYOA 4NSQA 2NMTA 1LFWA 2Z11A 4E0AA 1Q2YA 1A2ZA 4CYNA 3KL9A 2WPWA 1IB1E 3ZZIA 3EFAA 1NSLA 1Z9UA 4KOSA 3PRTA 3CXQA 1M4IA 3WC7A 3I9SA 2PR1A 1TF8A 2K5TA 3EC4A 4BINA 4KUAA 3D7FA 4MHZA 1XBUA 1JWQA 3FH4A 4XPDB 3GB0A 4MJ8A 2AE6A 3CXSA 2JBJA 2POKA 3N5FA 2RFHA 4P4IA 4BD9A 4FAIA 5ISVA 2IMOA 5E96A 1Z8TA 1S7FA 3B8GA 2GE3A 4NEXA 4CGMA 4J3GA 2EO8A 5HVHA 4CRYB 4PV6A 3RO0A 4CAXA 1ELMP 5AG5A 4CYPA 2C1CA 3ISZA 1CP6A 2QVPA 1IU8A 4PXDA 2G3TA 1XEBA 3VWDA 4F8ZA 3CT9A 1Q2CA 3FECA 3D2MA 4B5PA 3FEEA 1KZFA 1RTQA 1FT7A 1Z8XA 3H4QA 1IGBA 5JPHA 3B2YA 3DNSA 2IJZA 4OC3A 1LAMA 2Z3LA 3KGQA 4F6AA 3FB3A 5K8MA 3CZXA 1U6MA 3B3WA 2GFQA 3W6XA 1I12A 5EBVA 1Z8WA 2C27A 3IWWA 4X8IA 1YX0A 5HVFA 2D4OA 4MCPA 4MBUA 4K30A 4NF1A 2GANA 1I21A 3NH5A 3FIXA 1Y9WA 1XF8A 2ZXVA 3JVNA 2Q04A 3B3CA 4QUSA 3TTHA 4B10A 2G0BA 3KQZA 5F09A 1QSMA 3WABA 4UFXA 3KQXA 4MCSA 3D68A 1L0CA 4LQ6A 2DF5A 4LQGA 3R9EA 4E8OA 7CPAA 4BMHA 3IC1A 1LRZA 3QNVA 1K4JA 4F0XA 5K8OA 5FVJA 1VHOA 1M1DA 1TXRA 1YMEA 4CAWA 4H89A 4XPDC 2P6FA 4UF4A 3TOAA 4UBRA 1S7LA 2FSRA 3PB9X 2ZPAA 4NFRA 3IWGA 4KSFA 2AFWA 3GUXA 5AG7A 2GU2A 2XEIA 2XEJA 2CTCA 2Z3MA 1ZLIA 3CPAA 4AG7A 3BJ7A 1YGHA 4MHPA 4B12A 4YGOA 2PVWA 4ONUA 3OWCA 2I79A 1JQGA 4U9ZA 2V8VA 1CBXA 2CF4A 2ATRA 2WPXA 1M4GA 3BLNA 4OMEA 3MRUA 5DWNA 4YU9A 4MY3A 1I1DA 2D4PA 2Q0YA 5C88A 4JXRA 2B4DB 4MCQA 1B6BA 4FBEA 5EMIA 4ZYQA 4QVTA 4R8FA 4WJBA 4PSXA 1R3NA 3A9LA 3IU1A 4R57A 2FIAA 5KTDA 5JQ4A 1BAVA 2BL1A 5F48A 5LYDA 3RNZA 2Z3PA 3UY5A 3G8WA 1BPMA 4H6ZA 1BLLE 1QMUA 2JBKA 2PJ1A 4ZBGA 5K8PA 1KUYA 4KVME 4R6TA 5CNPA 5CPAA 4C7HA 2OZGA 4KSIA 4CGNA 4FD4A 4CYQA 2OR4A 4P4EA 3HUVA 3D7GA 2CIJA 1S5KA 3PEIA 1PU9A 4IK2A 4BBHA 5KTCA 3PB4X 5LRJA 3SXOA 4ZX9A 3VWEA 2B3VA 1IYKA 1LAPA 2WUUA 5IB0A 2Z3NA 2VXKA 2KCWA 5ELYA 4F0YA 3QAYA 4UWIA 2ZEHA 1UWYA 3B7IA 4MFQA 1NE9A 4P45A 5DWMA 4UIBA 2I3CA 3SI0A 1IIDA 4M6HA 1KUXA 1IYLA 4I49A 1Z8LA 1QSTA 3DSBA 4ONWA 5F46A 1SR8A 3EXNA 4AXVA 5JM6A 1CX8A 2FS5A 3KASA 5HVGA 5DS0A 3KR4A 3SJGA 3TOBA 3WR7A 4KOYA 1H8LA 4NGNA 4KSAA 2R7HA 1Q7LA 1IOIA 3P2FA 2C6PA 4IHMA 3SJXA 4NGPA 1AMPA 2YNCC 1PCAA 4OAEA 2DEAA 3ZJ0A 2JDCA 1ON0A 4YFJA 3R95A 1S7KA 4CS0B 3GY9A 3F8KA 2Q7SA 3GIUA 4JD6A 2PRBA 2ZOFA 4GM5A 3PBEA 1S3ZA 5G21A 4UEFA 3DLJA 4FD5A 4KLWA 4MCRA 5AGEA 2AFMA 4CAFA 2V8HA 2REEA 4CGOA 3KKWA 2PVVA 4FD6A 2J8MA 2HC9A 5HMNA 2P6GA 3S9NA 2CNSA 3T90A 1EE3P 3QB8A 1UFHA 2AFSA 1QSNA 3IU2A 5BWAB 4P4BA 3B35A 3FNCA 3KZWA 4HKFA 4MFJA 5LYLA 1VHEA 2B4DA 3FEDA 2PJ4A 3BI0A 3IEHA 3S9LA 3RYOA 1MK4A 1Y9KA 2WZNA 4X5KA 2JEVA 3KHXA 3IIBA 3C26A 2VQYA 4II9A 3RZAA 1M4LA 4C2YA 4FUUA 2R8VA 4JXQA 2ANPA 5J8FA 2F7VA 1F2OA 4XNHC 2PJCA 3KR5A 3NA6A 2PJ9A 5THWA 5J1QA 2CXAA 2ZEEA 3I3GA 4UCNA 4NXYA 4MY0A 1S60A 2OZUA 3VATA 1X12A 3NE8A 5IB9A 1YREA 4A94A 4F9VA 1ZG9A 4C68A 2PIZA 4L8AA 1Y7RA 1M4DA 3P2HA 3LACA 1ARMA 1Z4RA 2V8GA 2ARHA 4MHYA 2QMLA 4U9YA 4X2TA 3KHZA 4UFVA 1TKJA 4OC1A 2AFXA 2ZOGA 3S6FA 4PK3A 2F8HA 3B3SA 2PJ2A 4CGLA 2BSWA 3JRUA 4MI4A 2PJ5A 5D29A 1QSOA 2J8NA 3IGRA 4ORFA 1ZO0A 4OIWA 3D66A 3V8IA 3TE4A 2PJ8A 3R9FA 3F0AA 3BJ8A 3IO1A 1FY7A 3S6HA 2BOAA 4ZY1A 4A30A 2NYQA 1DTDA 1NSAA 3R96A 4P44A 4HNXB 6CPAA 2ZW4A 1Z2LA 5LRGA 1XOVA 3IWEA 4K3NA 2JDDA 5HH1A 2OH1A 3D3SA 2F5IA 3B3VA 3LMSA 4R76A 1XJOA 1ZG7A 2CY2A 1HDUA 2DXQA 1CG2A 2VL1A 2Q51A 2Z0ZA 4IAVA 3D7DA 4NGSA 1YK3A 3I1UA 3PBBA 1AYEA 2C6CA 4QBJA 4AB7A 2FT0A 2FXFA 2Q43A 1VHSA 2ZEOA 4H6UA 4AVAA 4CAEA 1TF9A 2PCUA 4C2XA 1LANA 2FCKA 5A28A 2PE3A
chains in the Genus database with same CATH topology
4MFKA 2QIRA 2RC4A 4UWJA 4XPLA 2OU2A 3PZJA 2IL4A 4LUAA 2P0WA 3LD2A 3TO6A 1VKCA 1XIXA 1SQHA 4MFZA 5GCNA 3TFYA 2H5MA 2CNTA 2B5GB 4XNHB 2ZW7A 2B3UA 3R1KA 1Q2DA 2Z3OA 2YGWA 4PSWA 4KOTA 4R3KA 4KZTA 1YR0A 3GYAA 2Q44A 2PDOA 3FYNA 4EVYA 2VI7A 4L89A 4AG9A 3W91A 1M44A 5F49A 2A4NA 5A27A 2YNCA 4MFLA 2B4BA 2HQYA 4XPKA 3SHPA 2HV2A 2EUIA 4Y49C 2R98A 4KLVA 4A95A 2WSAA 2OZHA 2Q4YA 1S7NA 2Q7BA 5I0CA 4A33A 1Z4EA 2B58A 1MJBA 4C2ZA 2FL4A 2PQ8A 4QC6A 1BO4A 4NCZA 2EVNA 3T9YA 5IX3A 1P0HA 2BUEA 1P4NA 4GS4A 4CRZB 1RO5A 4B13A 3TO9A 2P6EA 3FBUA 1KUVA 4RI1A 4CGPA 5IV0A 2PC1A 4HNWB 4KVOE 4CAVA 4KOWA 3S6GA 1XMTA 3FRMA 2HUZA 2B5GA 4DNCA 2OB0A 2I00A 3F5BA 3H5ZA 4IUSA 4RS2A 3PGPA 4UFWA 4MFPA 4UCMA 1IICA 2Z3KA 5H86A 4QB9A 1B87A 5G20A 2R1IA 4FD7A 3DR8A 4Q36A 1J4JA 3D8PA 2VZZA 4KUBA 4JLYA 2ZW6A 4KOUA 2CNMA 1GHEA 2QECA 4UCPA 4HNYB 1PUAA 2PSWA 2PR8A 3TT2A 1CM0A 1WK4A 3TO7A 4JWPA 4M85A 4R3LA 2FIWA 1R57A 4AVCA 2O28A 4KORA 3GKRA 1TIQA 1MJ9A 2Z10A 4JJXA 3JUWA 3NE7A 2YNEA 2ZW5A 3TCVA 4M3SA 4A31A 4C7IA 5KTAA 2VBQA 1QSRA 4AVBA 2DPTA 4Y49B 3MGDA 4IF5A 4KS9A 4E2AA 2REFA 4KOXA 4KVXA 1RXTA 4OLLA 3EO4A 4B11A 3R9GA 3D2PA 2VZYA 4B5OA 1CJWA 1XE4A 2X7BA 1MJAA 3SXNA 3EY5A 4CYOA 4MHDA 2BEIA 2FE7A 3DDDA 2JLMA 1OZPA 5J8CA 2YNDA 5H84A 3PP9A 1NMTA 5G1ZA 2DPSA 5C82A 4R9MA 2J8RA 4R87A 3K9UA 4Q38A 3N7ZA 5F47A 2Y0MA 3G3SA 3LODA 4B5PB 5AG4A 1BOBA 1YLEA 4B14A 4OADA 3QAHA 4A2ZA 2GIVA 4KOVA 4A32A 4PK2A 4UA3A 4U5YA 3S6KA 5G22A 3FXTA 3E0KA 3W6SA 5EC4A 1N71A 5AG6A 2AJ6A 4LX9A 1V0CA 4YRHA 3DR6A 1WWZA 3CXPA 2G3AA 2Q4VA 1YVOA 2VEZA 3JTKA 1YVKA 4ZGYB 4NSQA 2NMTA 2Z11A 4E0AA 1Q2YA 4CYNA 2WPWA 1IB1E 3ZZIA 3EFAA 1NSLA 1Z9UA 4KOSA 3CXQA 1M4IA 3I9SA 2PR1A 2K5TA 3EC4A 4KUAA 4XPDB 4MJ8A 2AE6A 3CXSA 5ISVA 5E96A 1S7FA 3B8GA 2GE3A 4NEXA 4CGMA 4J3GA 4CRYB 4PV6A 4CAXA 5AG5A 4CYPA 2G3TA 1XEBA 3VWDA 1Q2CA 3D2MA 4B5PA 1KZFA 3H4QA 5JPHA 3DNSA 2Z3LA 4F6AA 3FB3A 1U6MA 3W6XA 1I12A 5EBVA 2C27A 1YX0A 2D4OA 4MBUA 4K30A 4NF1A 2GANA 1I21A 3FIXA 1Y9WA 1XF8A 2ZXVA 3JVNA 2Q04A 4QUSA 3TTHA 4B10A 2G0BA 1QSMA 4UFXA 1L0CA 3R9EA 4E8OA 4BMHA 1LRZA 1K4JA 4F0XA 5FVJA 1M1DA 4CAWA 4H89A 4XPDC 2P6FA 3TOAA 4UBRA 1S7LA 2FSRA 2ZPAA 3IWGA 4KSFA 5AG7A 2Z3MA 4AG7A 3BJ7A 1YGHA 4B12A 4YGOA 4ONUA 3OWCA 2I79A 4U9ZA 5DWNA 2ATRA 1M4GA 3BLNA 4MY3A 1I1DA 2D4PA 2Q0YA 5C88A 4JXRA 2B4DB 1B6BA 4QVTA 4PSXA 4R57A 3A9LA 3IU1A 5KTDA 2FIAA 5JQ4A 2BL1A 5F48A 2Z3PA 3UY5A 3G8WA 4H6ZA 4ZBGA 1KUYA 4KVME 5CNPA 4C7HA 2OZGA 4CGNA 4FD4A 4CYQA 1S5KA 1PU9A 5KTCA 4BBHA 3SXOA 3VWEA 2B3VA 1IYKA 2WUUA 5IB0A 2Z3NA 2VXKA 2KCWA 4F0YA 4UWIA 4MFQA 1NE9A 5DWMA 1IIDA 1KUXA 1IYLA 4I49A 1QSTA 3DSBA 5F46A 1SR8A 3EXNA 2FS5A 3TOBA 3WR7A 4KOYA 4KSAA 2R7HA 3P2FA 2YNCC 4OAEA 3ZJ0A 2JDCA 1ON0A 4YFJA 3R95A 1S7KA 4CS0B 3GY9A 3F8KA 4JD6A 2PRBA 1S3ZA 5G21A 4FD5A 4KLWA 5AGEA 4CAFA 2REEA 4CGOA 3KKWA 4FD6A 2J8MA 5HMNA 2P6GA 2CNSA 3T90A 3QB8A 1UFHA 5BWAB 1QSNA 3IU2A 3FNCA 4HKFA 4MFJA 2B4DA 3RYOA 1MK4A 1Y9KA 4X5KA 2JEVA 3C26A 2VQYA 4II9A 4C2YA 2R8VA 4JXQA 5J8FA 4XNHC 2CXAA 3I3GA 4UCNA 4NXYA 4MY0A 1S60A 2OZUA 1YREA 4C68A 4L8AA 1Y7RA 1M4DA 3P2HA 1Z4RA 2ARHA 2QMLA 4U9YA 4UFVA 3S6FA 4PK3A 4CGLA 2BSWA 4MI4A 1QSOA 2J8NA 3IGRA 4ORFA 1ZO0A 3TE4A 3V8IA 3R9FA 3F0AA 3BJ8A 1FY7A 3S6HA 4A30A 3R96A 4HNXB 2ZW4A 3IWEA 2JDDA 5HH1A 2OH1A 3D3SA 2F5IA 2Z0ZA 2CY2A 2DXQA 1YK3A 4QBJA 4AB7A 2FT0A 2FXFA 1VHSA 4H6UA 4AVAA 4CAEA 4C2XA 2WPXA 2FCKA 5A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIR A;  2RC4 A;  4UWJ A;  4XPL A;  2OU2 A;  3PZJ A;  2IL4 A;  4LUA A;  2P0W A;  3LD2 A;  3TO6 A;  1VKC A;  1XIX A;  1SQH A;  3TFY A;  5GCN A;  2H5M A;  2CNT A;  2B5G B;  4XNH B;  2ZW7 A;  2B3U A;  3R1K A;  1Q2D A;  4PSW A;  4KOT A;  4R3K A;  4KZT A;  1YR0 A;  3GYA A;  2Q44 A;  2PDO A;  3FYN A;  4EVY A;  2VI7 A;  4L89 A;  4AG9 A;  3W91 A;  1M44 A;  5F49 A;  2A4N A;  2B4B A;  2HQY A;  4XPK A;  3SHP A;  2HV2 A;  2EUI A;  4Y49 C;  2R98 A;  4KLV A;  2OZH A;  2Q4Y A;  1S7N A;  2Q7B A;  5I0C A;  1Z4E A;  2B58 A;  1MJB A;  2FL4 A;  2PQ8 A;  4QC6 A;  1BO4 A;  4NCZ A;  2EVN A;  3T9Y A;  5IX3 A;  1P0H A;  2BUE A;  1P4N A;  4GS4 A;  4CRZ B;  1RO5 A;  3TO9 A;  2P6E A;  3FBU A;  1KUV A;  4RI1 A;  5IV0 A;  2PC1 A;  4HNW B;  4KVO E;  4CAV A;  4KOW A;  3S6G A;  1XMT A;  3FRM A;  2HUZ A;  2B5G A;  4DNC A;  2OB0 A;  2I00 A;  3F5B A;  4IUS A;  4RS2 A;  3PGP A;  5H86 A;  1IIC A;  4QB9 A;  1B87 A;  2R1I A;  4FD7 A;  3DR8 A;  1J4J A;  3D8P A;  2VZZ A;  4KUB A;  4JLY A;  2ZW6 A;  4KOU A;  2CNM A;  1GHE A;  2QEC A;  4HNY B;  1PUA A;  2PSW A;  2PR8 A;  3TT2 A;  1CM0 A;  1WK4 A;  3TO7 A;  4JWP A;  4M85 A;  4R3L A;  2FIW A;  1R57 A;  4AVC A;  2O28 A;  4KOR A;  3GKR A;  1TIQ A;  1MJ9 A;  2Z10 A;  4JJX A;  3JUW A;  3NE7 A;  2ZW5 A;  3TCV A;  4M3S A;  5KTA A;  2VBQ A;  1QSR A;  4AVB A;  4Y49 B;  3MGD A;  4IF5 A;  4E2A A;  2REF A;  4KOX A;  4KVX A;  1RXT A;  4OLL A;  3EO4 A;  3R9G A;  3D2P A;  2VZY A;  4B5O A;  1CJW A;  1XE4 A;  2X7B A;  1MJA A;  3SXN A;  3EY5 A;  4MHD A;  2BEI A;  2FE7 A;  3DDD A;  2JLM A;  1OZP A;  5J8C A;  5H84 A;  3PP9 A;  1NMT A;  5C82 A;  4R9M A;  2J8R A;  4R87 A;  3K9U A;  3N7Z A;  5F47 A;  2Y0M A;  3G3S A;  3LOD A;  4B5P B;  1BOB A;  1YLE A;  4OAD A;  3QAH A;  2GIV A;  4KOV A;  4PK2 A;  4UA3 A;  4U5Y A;  3S6K A;  3FXT A;  3E0K A;  3W6S A;  5EC4 A;  1N71 A;  2AJ6 A;  4LX9 A;  1V0C A;  4YRH A;  3DR6 A;  1WWZ A;  3CXP A;  2G3A A;  2Q4V A;  1YVO A;  2VEZ A;  1YVK A;  4NSQ A;  2NMT A;  2Z11 A;  4E0A A;  1Q2Y A;  2WPW A;  1IB1 E;  3ZZI A;  3EFA A;  1NSL A;  1Z9U A;  4KOS A;  3CXQ A;  1M4I A;  3I9S A;  2PR1 A;  2K5T A;  3EC4 A;  4KUA A;  4XPD B;  4MJ8 A;  2AE6 A;  3CXS A;  5ISV A;  5E96 A;  1S7F A;  3B8G A;  2GE3 A;  4NEX A;  4J3G A;  4CRY B;  4PV6 A;  4CAX A;  2G3T A;  1XEB A;  3VWD A;  1Q2C A;  3D2M A;  4B5P A;  1KZF A;  3H4Q A;  5JPH A;  3DNS A;  4F6A A;  3FB3 A;  1U6M A;  3W6X A;  1I12 A;  5EBV A;  2C27 A;  1YX0 A;  2D4O A;  4MBU A;  4K30 A;  4NF1 A;  2GAN A;  1I21 A;  3FIX A;  1Y9W A;  1XF8 A;  2ZXV A;  3JVN A;  2Q04 A;  4QUS A;  3TTH A;  2G0B A;  1QSM A;  1L0C A;  3R9E A;  4E8O A;  4BMH A;  1LRZ A;  1K4J A;  5FVJ A;  1M1D A;  4CAW A;  4H89 A;  4XPD C;  2P6F A;  3TOA A;  4UBR A;  1S7L A;  2FSR A;  2ZPA A;  3IWG A;  4AG7 A;  3BJ7 A;  1YGH A;  4YGO A;  4ONU A;  3OWC A;  2I79 A;  4U9Z A;  5DWN A;  2ATR A;  1M4G A;  3BLN A;  4MY3 A;  1I1D A;  2D4P A;  2Q0Y A;  5C88 A;  4JXR A;  2B4D B;  1B6B A;  4QVT A;  4PSX A;  4R57 A;  5KTD A;  2FIA A;  5JQ4 A;  2BL1 A;  5F48 A;  3UY5 A;  3G8W A;  4H6Z A;  4ZBG A;  1KUY A;  4KVM E;  5CNP A;  2OZG A;  4FD4 A;  1S5K A;  1PU9 A;  5KTC A;  3SXO A;  3VWE A;  2B3V A;  1IYK A;  5IB0 A;  2VXK A;  2KCW A;  4F0Y A;  4UWI A;  1NE9 A;  5DWM A;  1IID A;  1KUX A;  1IYL A;  4I49 A;  1QST A;  3DSB A;  5F46 A;  3EXN A;  2FS5 A;  3TOB A;  3WR7 A;  4KOY A;  2R7H A;  3P2F A;  4OAE A;  3ZJ0 A;  2JDC A;  1ON0 A;  4YFJ A;  3R95 A;  1S7K A;  4CS0 B;  3GY9 A;  3F8K A;  4JD6 A;  2PRB A;  1S3Z A;  4FD5 A;  4KLW A;  2REE A;  3KKW A;  4FD6 A;  2J8M A;  5HMN A;  2P6G A;  2CNS A;  3T90 A;  3QB8 A;  1UFH A;  1QSN A;  3FNC A;  4HKF A;  2B4D A;  3RYO A;  1MK4 A;  1Y9K A;  4X5K A;  2JEV A;  3C26 A;  2VQY A;  4II9 A;  2R8V A;  4JXQ A;  5J8F A;  4XNH C;  3I3G A;  4NXY A;  4MY0 A;  1S60 A;  2OZU A;  1YRE A;  4L8A A;  1Y7R A;  1M4D A;  3P2H A;  1Z4R A;  2ARH A;  2QML A;  4U9Y A;  3S6F A;  4PK3 A;  2BSW A;  4MI4 A;  1QSO A;  2J8N A;  3IGR A;  4ORF A;  3TE4 A;  3V8I A;  3R9F A;  3F0A A;  3BJ8 A;  1FY7 A;  3S6H A;  3R96 A;  4HNX B;  2ZW4 A;  2JDD A;  5HH1 A;  2OH1 A;  3D3S A;  2F5I A;  2Z0Z A;  2CY2 A;  2DXQ A;  1YK3 A;  4QBJ A;  4AB7 A;  2FT0 A;  2FXF A;  1VHS A;  4H6U A;  4AVA A;  2WPX A;  2FCK A; 
#chains in the Genus database with same CATH topology
 4MHN A;  2O53 A;  4MFK A;  4P10 A;  2QIR A;  2RC4 A;  4UWJ A;  5CBM A;  1Y0Y A;  3CPX A;  4XPL A;  5JGF A;  2OU2 A;  1CPX A;  3PZJ A;  4X3R A;  2IL4 A;  2EK8 A;  1LCP A;  4LUA A;  2P0W A;  3LD2 A;  3TO6 A;  1VKC A;  1XIX A;  1SQH A;  2J9A A;  4OC2 A;  4MFZ A;  5GCN A;  3TFY A;  3CDX A;  4O23 A;  2H5M A;  3FMC A;  2CNT A;  2PJB A;  4M6G A;  4GXH A;  2B5G B;  4XNH B;  4RN7 A;  2ODF A;  2ZW7 A;  2B3U A;  3KI9 A;  3R1K A;  1Q2D A;  2Z3O A;  2PJ0 A;  2YGW A;  4PSW A;  5HXD A;  4KOT A;  3PFO A;  4R3K A;  4H2K A;  4KZT A;  1YQE A;  2EWB A;  3RAM A;  2PJ7 A;  1YR0 A;  4MMO A;  2PRQ A;  3WT4 A;  4NJQ A;  4EWT A;  3GYA A;  4UIA A;  4CPA A;  2Q44 A;  2PDO A;  3FYN A;  4TWE A;  4EVY A;  3H8G A;  3L2N A;  4NJR A;  1PYT B;  2ZED A;  2VI7 A;  4L89 A;  2Q4Z A;  3H8F A;  2BCO A;  4AG9 A;  1Z5R A;  3W91 A;  1M44 A;  4UEZ A;  5F49 A;  4WWV A;  4NGM A;  2A4N A;  1F57 A;  2PJ3 A;  3WC6 A;  4G1P A;  4DUK A;  2PJA A;  2ZEM A;  2O4H A;  5A27 A;  2YNC A;  2JEW A;  2B4B A;  4MFL A;  4RUH A;  2HQY A;  4XPK A;  3NH8 A;  4P4F A;  3SHP A;  3IJ3 A;  2HV2 A;  4NGR A;  2EUI A;  5LYI A;  4Y49 C;  2R98 A;  1QQ9 A;  3PB6 X;  4KLV A;  1OBR A;  3SI1 A;  3D7H A;  3NH4 A;  4A95 A;  2GLF A;  2WSA A;  3BHX A;  5D8N A;  5I4M A;  2OZH A;  1HDQ A;  2Q4Y A;  1S7N A;  3K2K A;  2Q7B A;  5I0C A;  4A33 A;  5LRK A;  1Z4E A;  2B58 A;  1MJB A;  4C2Z A;  2FL4 A;  2PQ8 A;  4QC6 A;  4NGT A;  1BO4 A;  3ISX A;  4PXE A;  4NCZ A;  2EVN A;  2QYV A;  3T9Y A;  4OC5 A;  3SJF A;  5IX3 A;  1P0H A;  3FJU A;  2CTB A;  2BUE A;  1P4N A;  4GS4 A;  2HB6 A;  4P4D A;  4CRZ B;  1RO5 A;  1DE4 C;  1Y0R A;  2AFZ A;  4B13 A;  1IY7 A;  2P6E A;  3TO9 A;  3FBU A;  1KUV A;  4RI1 A;  4CGP A;  5IV0 A;  2PC1 A;  4OP4 A;  4HNW B;  4EFD A;  3V7Z A;  4KVO E;  1ELL P;  4CAV A;  1XMB A;  3TC8 A;  2NSM A;  4KOW A;  3S6G A;  3B3T A;  1VGY A;  1HEE A;  1XMT A;  1AUG A;  3S9M A;  2V77 A;  3FRM A;  4PPZ A;  4PQA A;  1YW6 A;  2HUZ A;  4R7M A;  2EK9 A;  1F2P A;  2B5G A;  4Q7A A;  4B6Z A;  2OB0 A;  2I00 A;  3F5B A;  3H5Z A;  4IUS A;  4RS2 A;  3PGP A;  4UFW A;  4EME A;  3H8E A;  4MFP A;  4UCM A;  1IIC A;  2Z3K A;  5H86 A;  4QB9 A;  1B87 A;  4OKO A;  5G20 A;  2R1I A;  4FD7 A;  5LYF A;  3DR8 A;  1ARL A;  2ZEN A;  3PB8 X;  4JYW A;  1J4J A;  4Q36 A;  4W9Y A;  4ZX8 A;  4DJL A;  3D8P A;  3TX8 A;  2VZZ A;  5JH9 A;  4OID A;  4KUB A;  2IQ6 A;  2ZEL A;  2ZW6 A;  4JLY A;  3BI1 A;  4KOU A;  2CNM A;  1GHE A;  1ZG8 A;  1CPS A;  2QEC A;  3LWU A;  4UCP A;  4HNY B;  1PUA A;  2ABZ A;  2PSW A;  4HPS A;  2PR8 A;  3TT2 A;  1CM0 A;  1WK4 A;  4OC4 A;  3FF3 A;  3TO7 A;  4JWP A;  4MXU A;  4PXB A;  4M85 A;  4MRI A;  4R3L A;  2FIW A;  1R57 A;  2GRE A;  3NFZ A;  4AVC A;  3PB7 X;  2O28 A;  3PFE A;  4KOR A;  3GKR A;  1TIQ A;  2PIY A;  3K9T A;  1MJ9 A;  2BO9 A;  2XEG A;  2Z10 A;  4JJX A;  4ZY2 A;  4PXC A;  1IOF A;  3JUW A;  4ZY0 A;  3NE7 A;  2YNE A;  2ZW5 A;  3TCV A;  4M3S A;  2RB7 A;  2ZEP A;  3MN8 A;  4A31 A;  3VH9 A;  4C7I A;  4DNC A;  2WYR A;  5KTA A;  2VBQ A;  1QSR A;  4AVB A;  2DPT A;  4Y49 B;  3MGD A;  4IF5 A;  1Y7E A;  3IFE A;  4KS9 A;  4E2A A;  2REF A;  4KOX A;  4KVX A;  1RXT A;  2ZEF A;  1LOK A;  4OLL A;  3HLP A;  3EO4 A;  4Z65 A;  4B11 A;  2FVG A;  3R9G A;  1FNO A;  4F9U A;  2G9D A;  2ZEG A;  3D2P A;  4A37 A;  2VZY A;  4B5O A;  3FX6 A;  1CJW A;  1ZLH A;  1XE4 A;  2X7B A;  1MJA A;  3SXN A;  3EY5 A;  2OOT A;  2EBJ A;  3D67 A;  4CYO A;  3FVL A;  1YLO A;  4MHD A;  3VAR A;  2BEI A;  3SJE A;  1YW4 A;  2FE7 A;  3DDD A;  2JLM A;  1X10 A;  1CP7 A;  2AFO A;  1OZP A;  3SI2 A;  2V8D A;  2YND A;  5J8C A;  3GLJ A;  1BPN A;  5H84 A;  1TKF A;  3PP9 A;  1NMT A;  5G1Z A;  4FWU A;  2DPS A;  5C82 A;  4R9M A;  1YSJ A;  4A38 A;  2J8R A;  4R87 A;  3K9U A;  4YWY A;  3WC5 A;  4Q38 A;  4ZI6 A;  2GLJ A;  3N7Z A;  2QJ8 A;  4JZ0 A;  4P6Y A;  5K8N A;  5F47 A;  8CPA A;  2Y0M A;  3G3S A;  4TNU A;  1GYT A;  3LOD A;  4B5P B;  5AG4 A;  1BOB A;  1YLE A;  2AFU A;  4B14 A;  4OAD A;  3QAH A;  4UEE A;  4A2Z A;  1TKH A;  2GIV A;  4M6I A;  3V38 A;  3DGV A;  4KOV A;  4OC0 A;  4A32 A;  1R43 A;  2XEF A;  4PK2 A;  4UA3 A;  4U5Y A;  3S6K A;  1VIX A;  5G22 A;  3FXT A;  4A39 A;  1KWM A;  3E0K A;  3W6S A;  3D4U A;  5EC4 A;  1N71 A;  5AG6 A;  2AJ6 A;  4LX9 A;  3T8W A;  1V0C A;  3RBU A;  2PJ6 A;  4YRH A;  2C6G A;  1XRY A;  3DR6 A;  1WWZ A;  3CXP A;  4NGQ A;  2G3A A;  2Q4V A;  1YVO A;  2VEZ A;  3JTK A;  1YVK A;  3BXM A;  1XFO A;  4P4J A;  4ZGY B;  4DYO A;  4NSQ A;  2NMT A;  1LFW A;  2Z11 A;  4E0A A;  1Q2Y A;  1A2Z A;  4CYN A;  3KL9 A;  2WPW A;  1IB1 E;  3ZZI A;  3EFA A;  1NSL A;  1Z9U A;  4KOS A;  3PRT A;  3CXQ A;  1M4I A;  3WC7 A;  3I9S A;  2PR1 A;  1TF8 A;  2K5T A;  3EC4 A;  4BIN A;  4KUA A;  3D7F A;  4MHZ A;  1XBU A;  1JWQ A;  3FH4 A;  4XPD B;  3GB0 A;  4MJ8 A;  2AE6 A;  3CXS A;  2JBJ A;  2POK A;  3N5F A;  2RFH A;  4P4I A;  4BD9 A;  4FAI A;  5ISV A;  2IMO A;  5E96 A;  1Z8T A;  1S7F A;  3B8G A;  2GE3 A;  4NEX A;  4CGM A;  4J3G A;  2EO8 A;  5HVH A;  4CRY B;  4PV6 A;  3RO0 A;  4CAX A;  1ELM P;  5AG5 A;  4CYP A;  2C1C A;  3ISZ A;  1CP6 A;  2QVP A;  1IU8 A;  4PXD A;  2G3T A;  1XEB A;  3VWD A;  4F8Z A;  3CT9 A;  1Q2C A;  3FEC A;  3D2M A;  4B5P A;  3FEE A;  1KZF A;  1RTQ A;  1FT7 A;  1Z8X A;  3H4Q A;  1IGB A;  5JPH A;  3B2Y A;  3DNS A;  2IJZ A;  4OC3 A;  1LAM A;  2Z3L A;  3KGQ A;  4F6A A;  3FB3 A;  5K8M A;  3CZX A;  1U6M A;  3B3W A;  2GFQ A;  3W6X A;  1I12 A;  5EBV A;  1Z8W A;  2C27 A;  3IWW A;  4X8I A;  1YX0 A;  5HVF A;  2D4O A;  4MCP A;  4MBU A;  4K30 A;  4NF1 A;  2GAN A;  1I21 A;  3NH5 A;  3FIX A;  1Y9W A;  1XF8 A;  2ZXV A;  3JVN A;  2Q04 A;  3B3C A;  4QUS A;  3TTH A;  4B10 A;  2G0B A;  3KQZ A;  5F09 A;  1QSM A;  3WAB A;  4UFX A;  3KQX A;  4MCS A;  3D68 A;  1L0C A;  4LQ6 A;  2DF5 A;  4LQG A;  3R9E A;  4E8O A;  7CPA A;  4BMH A;  3IC1 A;  1LRZ A;  3QNV A;  1K4J A;  4F0X A;  5K8O A;  5FVJ A;  1VHO A;  1M1D A;  1TXR A;  1YME A;  4CAW A;  4H89 A;  4XPD C;  2P6F A;  4UF4 A;  3TOA A;  4UBR A;  1S7L A;  2FSR A;  3PB9 X;  2ZPA A;  4NFR A;  3IWG A;  4KSF A;  2AFW A;  3GUX A;  5AG7 A;  2GU2 A;  2XEI A;  2XEJ A;  2CTC A;  2Z3M A;  1ZLI A;  3CPA A;  4AG7 A;  3BJ7 A;  1YGH A;  4MHP A;  4B12 A;  4YGO A;  2PVW A;  4ONU A;  3OWC A;  2I79 A;  1JQG A;  4U9Z A;  2V8V A;  1CBX A;  2CF4 A;  2ATR A;  2WPX A;  1M4G A;  3BLN A;  4OME A;  3MRU A;  5DWN A;  4YU9 A;  4MY3 A;  1I1D A;  2D4P A;  2Q0Y A;  5C88 A;  4JXR A;  2B4D B;  4MCQ A;  1B6B A;  4FBE A;  5EMI A;  4ZYQ A;  4QVT A;  4R8F A;  4WJB A;  4PSX A;  1R3N A;  3A9L A;  3IU1 A;  4R57 A;  2FIA A;  5KTD A;  5JQ4 A;  1BAV A;  2BL1 A;  5F48 A;  5LYD A;  3RNZ A;  2Z3P A;  3UY5 A;  3G8W A;  1BPM A;  4H6Z A;  1BLL E;  1QMU A;  2JBK A;  2PJ1 A;  4ZBG A;  5K8P A;  1KUY A;  4KVM E;  4R6T A;  5CNP A;  5CPA A;  4C7H A;  2OZG A;  4KSI A;  4CGN A;  4FD4 A;  4CYQ A;  2OR4 A;  4P4E A;  3HUV A;  3D7G A;  2CIJ A;  1S5K A;  3PEI A;  1PU9 A;  4IK2 A;  4BBH A;  5KTC A;  3PB4 X;  5LRJ A;  3SXO A;  4ZX9 A;  3VWE A;  2B3V A;  1IYK A;  1LAP A;  2WUU A;  5IB0 A;  2Z3N A;  2VXK A;  2KCW A;  5ELY A;  4F0Y A;  3QAY A;  4UWI A;  2ZEH A;  1UWY A;  3B7I A;  4MFQ A;  1NE9 A;  4P45 A;  5DWM A;  4UIB A;  2I3C A;  3SI0 A;  1IID A;  4M6H A;  1KUX A;  1IYL A;  4I49 A;  1Z8L A;  1QST A;  3DSB A;  4ONW A;  5F46 A;  1SR8 A;  3EXN A;  4AXV A;  5JM6 A;  1CX8 A;  2FS5 A;  3KAS A;  5HVG A;  5DS0 A;  3KR4 A;  3SJG A;  3TOB A;  3WR7 A;  4KOY A;  1H8L A;  4NGN A;  4KSA A;  2R7H A;  1Q7L A;  1IOI A;  3P2F A;  2C6P A;  4IHM A;  3SJX A;  4NGP A;  1AMP A;  2YNC C;  1PCA A;  4OAE A;  2DEA A;  3ZJ0 A;  2JDC A;  1ON0 A;  4YFJ A;  3R95 A;  1S7K A;  4CS0 B;  3GY9 A;  3F8K A;  2Q7S A;  3GIU A;  4JD6 A;  2PRB A;  2ZOF A;  4GM5 A;  3PBE A;  1S3Z A;  5G21 A;  4UEF A;  3DLJ A;  4FD5 A;  4KLW A;  4MCR A;  5AGE A;  2AFM A;  4CAF A;  2V8H A;  2REE A;  4CGO A;  3KKW A;  2PVV A;  4FD6 A;  2J8M A;  2HC9 A;  5HMN A;  2P6G A;  3S9N A;  2CNS A;  3T90 A;  1EE3 P;  3QB8 A;  1UFH A;  2AFS A;  1QSN A;  3IU2 A;  5BWA B;  4P4B A;  3B35 A;  3FNC A;  3KZW A;  4HKF A;  4MFJ A;  5LYL A;  1VHE A;  2B4D A;  3FED A;  2PJ4 A;  3BI0 A;  3IEH A;  3S9L A;  3RYO A;  1MK4 A;  1Y9K A;  2WZN A;  4X5K A;  2JEV A;  3KHX A;  3IIB A;  3C26 A;  2VQY A;  4II9 A;  3RZA A;  1M4L A;  4C2Y A;  4FUU A;  2R8V A;  4JXQ A;  2ANP A;  5J8F A;  2F7V A;  1F2O A;  4XNH C;  2PJC A;  3KR5 A;  3NA6 A;  2PJ9 A;  5THW A;  5J1Q A;  2CXA A;  2ZEE A;  3I3G A;  4UCN A;  4NXY A;  4MY0 A;  1S60 A;  2OZU A;  3VAT A;  1X12 A;  3NE8 A;  5IB9 A;  1YRE A;  4A94 A;  4F9V A;  1ZG9 A;  4C68 A;  2PIZ A;  4L8A A;  1Y7R A;  1M4D A;  3P2H A;  3LAC A;  1ARM A;  1Z4R A;  2V8G A;  2ARH A;  4MHY A;  2QML A;  4U9Y A;  4X2T A;  3KHZ A;  4UFV A;  1TKJ A;  4OC1 A;  2AFX A;  2ZOG A;  3S6F A;  4PK3 A;  2F8H A;  3B3S A;  2PJ2 A;  4CGL A;  2BSW A;  3JRU A;  4MI4 A;  2PJ5 A;  5D29 A;  1QSO A;  2J8N A;  3IGR A;  4ORF A;  1ZO0 A;  4OIW A;  3D66 A;  3V8I A;  3TE4 A;  2PJ8 A;  3R9F A;  3F0A A;  3BJ8 A;  3IO1 A;  1FY7 A;  3S6H A;  2BOA A;  4ZY1 A;  4A30 A;  2NYQ A;  1DTD A;  1NSA A;  3R96 A;  4P44 A;  4HNX B;  6CPA A;  2ZW4 A;  1Z2L A;  5LRG A;  1XOV A;  3IWE A;  4K3N A;  2JDD A;  5HH1 A;  2OH1 A;  3D3S A;  2F5I A;  3B3V A;  3LMS A;  4R76 A;  1XJO A;  1ZG7 A;  2CY2 A;  1HDU A;  2DXQ A;  1CG2 A;  2VL1 A;  2Q51 A;  2Z0Z A;  4IAV A;  3D7D A;  4NGS A;  1YK3 A;  3I1U A;  3PBB A;  1AYE A;  2C6C A;  4QBJ A;  4AB7 A;  2FT0 A;  2FXF A;  2Q43 A;  1VHS A;  2ZEO A;  4H6U A;  4AVA A;  4CAE A;  1TF9 A;  2PCU A;  4C2X A;  1LAN A;  2FCK A;  5A28 A;  2PE3 A; 
#chains in the Genus database with same CATH homology
 4MFK A;  2QIR A;  2RC4 A;  4UWJ A;  4XPL A;  2OU2 A;  3PZJ A;  2IL4 A;  4LUA A;  2P0W A;  3LD2 A;  3TO6 A;  1VKC A;  1XIX A;  1SQH A;  4MFZ A;  5GCN A;  3TFY A;  2H5M A;  2CNT A;  2B5G B;  4XNH B;  2ZW7 A;  2B3U A;  3R1K A;  1Q2D A;  2Z3O A;  2YGW A;  4PSW A;  4KOT A;  4R3K A;  4KZT A;  1YR0 A;  3GYA A;  2Q44 A;  2PDO A;  3FYN A;  4EVY A;  2VI7 A;  4L89 A;  4AG9 A;  3W91 A;  1M44 A;  5F49 A;  2A4N A;  5A27 A;  2YNC A;  4MFL A;  2B4B A;  2HQY A;  4XPK A;  3SHP A;  2HV2 A;  2EUI A;  4Y49 C;  2R98 A;  4KLV A;  4A95 A;  2WSA A;  2OZH A;  2Q4Y A;  1S7N A;  2Q7B A;  5I0C A;  4A33 A;  1Z4E A;  2B58 A;  1MJB A;  4C2Z A;  2FL4 A;  2PQ8 A;  4QC6 A;  1BO4 A;  4NCZ A;  2EVN A;  3T9Y A;  5IX3 A;  1P0H A;  2BUE A;  1P4N A;  4GS4 A;  4CRZ B;  1RO5 A;  4B13 A;  3TO9 A;  2P6E A;  3FBU A;  1KUV A;  4RI1 A;  4CGP A;  5IV0 A;  2PC1 A;  4HNW B;  4KVO E;  4CAV A;  4KOW A;  3S6G A;  1XMT A;  3FRM A;  2HUZ A;  2B5G A;  4DNC A;  2OB0 A;  2I00 A;  3F5B A;  3H5Z A;  4IUS A;  4RS2 A;  3PGP A;  4UFW A;  4MFP A;  4UCM A;  1IIC A;  2Z3K A;  5H86 A;  4QB9 A;  1B87 A;  5G20 A;  2R1I A;  4FD7 A;  3DR8 A;  4Q36 A;  1J4J A;  3D8P A;  2VZZ A;  4KUB A;  4JLY A;  2ZW6 A;  4KOU A;  2CNM A;  1GHE A;  2QEC A;  4UCP A;  4HNY B;  1PUA A;  2PSW A;  2PR8 A;  3TT2 A;  1CM0 A;  1WK4 A;  3TO7 A;  4JWP A;  4M85 A;  4R3L A;  2FIW A;  1R57 A;  4AVC A;  2O28 A;  4KOR A;  3GKR A;  1TIQ A;  1MJ9 A;  2Z10 A;  4JJX A;  3JUW A;  3NE7 A;  2YNE A;  2ZW5 A;  3TCV A;  4M3S A;  4A31 A;  4C7I A;  5KTA A;  2VBQ A;  1QSR A;  4AVB A;  2DPT A;  4Y49 B;  3MGD A;  4IF5 A;  4KS9 A;  4E2A A;  2REF A;  4KOX A;  4KVX A;  1RXT A;  4OLL A;  3EO4 A;  4B11 A;  3R9G A;  3D2P A;  2VZY A;  4B5O A;  1CJW A;  1XE4 A;  2X7B A;  1MJA A;  3SXN A;  3EY5 A;  4CYO A;  4MHD A;  2BEI A;  2FE7 A;  3DDD A;  2JLM A;  1OZP A;  5J8C A;  2YND A;  5H84 A;  3PP9 A;  1NMT A;  5G1Z A;  2DPS A;  5C82 A;  4R9M A;  2J8R A;  4R87 A;  3K9U A;  4Q38 A;  3N7Z A;  5F47 A;  2Y0M A;  3G3S A;  3LOD A;  4B5P B;  5AG4 A;  1BOB A;  1YLE A;  4B14 A;  4OAD A;  3QAH A;  4A2Z A;  2GIV A;  4KOV A;  4A32 A;  4PK2 A;  4UA3 A;  4U5Y A;  3S6K A;  5G22 A;  3FXT A;  3E0K A;  3W6S A;  5EC4 A;  1N71 A;  5AG6 A;  2AJ6 A;  4LX9 A;  1V0C A;  4YRH A;  3DR6 A;  1WWZ A;  3CXP A;  2G3A A;  2Q4V A;  1YVO A;  2VEZ A;  3JTK A;  1YVK A;  4ZGY B;  4NSQ A;  2NMT A;  2Z11 A;  4E0A A;  1Q2Y A;  4CYN A;  2WPW A;  1IB1 E;  3ZZI A;  3EFA A;  1NSL A;  1Z9U A;  4KOS A;  3CXQ A;  1M4I A;  3I9S A;  2PR1 A;  2K5T A;  3EC4 A;  4KUA A;  4XPD B;  4MJ8 A;  2AE6 A;  3CXS A;  5ISV A;  5E96 A;  1S7F A;  3B8G A;  2GE3 A;  4NEX A;  4CGM A;  4J3G A;  4CRY B;  4PV6 A;  4CAX A;  5AG5 A;  4CYP A;  2G3T A;  1XEB A;  3VWD A;  1Q2C A;  3D2M A;  4B5P A;  1KZF A;  3H4Q A;  5JPH A;  3DNS A;  2Z3L A;  4F6A A;  3FB3 A;  1U6M A;  3W6X A;  1I12 A;  5EBV A;  2C27 A;  1YX0 A;  2D4O A;  4MBU A;  4K30 A;  4NF1 A;  2GAN A;  1I21 A;  3FIX A;  1Y9W A;  1XF8 A;  2ZXV A;  3JVN A;  2Q04 A;  4QUS A;  3TTH A;  4B10 A;  2G0B A;  1QSM A;  4UFX A;  1L0C A;  3R9E A;  4E8O A;  4BMH A;  1LRZ A;  1K4J A;  4F0X A;  5FVJ A;  1M1D A;  4CAW A;  4H89 A;  4XPD C;  2P6F A;  3TOA A;  4UBR A;  1S7L A;  2FSR A;  2ZPA A;  3IWG A;  4KSF A;  5AG7 A;  2Z3M A;  4AG7 A;  3BJ7 A;  1YGH A;  4B12 A;  4YGO A;  4ONU A;  3OWC A;  2I79 A;  4U9Z A;  5DWN A;  2ATR A;  1M4G A;  3BLN A;  4MY3 A;  1I1D A;  2D4P A;  2Q0Y A;  5C88 A;  4JXR A;  2B4D B;  1B6B A;  4QVT A;  4PSX A;  4R57 A;  3A9L A;  3IU1 A;  5KTD A;  2FIA A;  5JQ4 A;  2BL1 A;  5F48 A;  2Z3P A;  3UY5 A;  3G8W A;  4H6Z A;  4ZBG A;  1KUY A;  4KVM E;  5CNP A;  4C7H A;  2OZG A;  4CGN A;  4FD4 A;  4CYQ A;  1S5K A;  1PU9 A;  5KTC A;  4BBH A;  3SXO A;  3VWE A;  2B3V A;  1IYK A;  2WUU A;  5IB0 A;  2Z3N A;  2VXK A;  2KCW A;  4F0Y A;  4UWI A;  4MFQ A;  1NE9 A;  5DWM A;  1IID A;  1KUX A;  1IYL A;  4I49 A;  1QST A;  3DSB A;  5F46 A;  1SR8 A;  3EXN A;  2FS5 A;  3TOB A;  3WR7 A;  4KOY A;  4KSA A;  2R7H A;  3P2F A;  2YNC C;  4OAE A;  3ZJ0 A;  2JDC A;  1ON0 A;  4YFJ A;  3R95 A;  1S7K A;  4CS0 B;  3GY9 A;  3F8K A;  4JD6 A;  2PRB A;  1S3Z A;  5G21 A;  4FD5 A;  4KLW A;  5AGE A;  4CAF A;  2REE A;  4CGO A;  3KKW A;  4FD6 A;  2J8M A;  5HMN A;  2P6G A;  2CNS A;  3T90 A;  3QB8 A;  1UFH A;  5BWA B;  1QSN A;  3IU2 A;  3FNC A;  4HKF A;  4MFJ A;  2B4D A;  3RYO A;  1MK4 A;  1Y9K A;  4X5K A;  2JEV A;  3C26 A;  2VQY A;  4II9 A;  4C2Y A;  2R8V A;  4JXQ A;  5J8F A;  4XNH C;  2CXA A;  3I3G A;  4UCN A;  4NXY A;  4MY0 A;  1S60 A;  2OZU A;  1YRE A;  4C68 A;  4L8A A;  1Y7R A;  1M4D A;  3P2H A;  1Z4R A;  2ARH A;  2QML A;  4U9Y A;  4UFV A;  3S6F A;  4PK3 A;  4CGL A;  2BSW A;  4MI4 A;  1QSO A;  2J8N A;  3IGR A;  4ORF A;  1ZO0 A;  3TE4 A;  3V8I A;  3R9F A;  3F0A A;  3BJ8 A;  1FY7 A;  3S6H A;  4A30 A;  3R96 A;  4HNX B;  2ZW4 A;  3IWE A;  2JDD A;  5HH1 A;  2OH1 A;  3D3S A;  2F5I A;  2Z0Z A;  2CY2 A;  2DXQ A;  1YK3 A;  4QBJ A;  4AB7 A;  2FT0 A;  2FXF A;  1VHS A;  4H6U A;  4AVA A;  4CAE A;  4C2X A;  2WPX A;  2FCK A;  5A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...