1YR0A

Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
SVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords phosphinothricin acetyltransferase
publication title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
total genus 44
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yr0A00
5I0CA 3BLNA 3LD2A 2J8RA 4GS4A 2BL1A 2B4DA 4KVOE 3GY9A 3FNCA 5H86A 5HMNA 5EBVA 3R9FA 1QSOA 3D2PA 1S7NA 3I9SA 1U6MA 2ZW5A 4AVAA 3EXNA 2I79A 5IB0A 1GHEA 3N7ZA 1MK4A 3I3GA 4YFJA 2FS5A 3GKRA 3ZJ0A 4DNCA 4KOXA 3SXNA 1XEBA 5J8CA 4M85A 2VI7A 1CM0A 2Q44A 4MBUA 1V0CA 4KLWA 3D3SA 3T90A 2QECA 4R9MA 2QIRA 2B3UA 4ORFA 2F5IA 3K9UA 2A4NA 1S3ZA 2QMLA 3W6XA 3QB8A 3TO9A 3S6GA 2IL4A 1Y7RA 4OAEA 5KTDA 4UWIA 4U9YA 2BEIA 4NF1A 4NSQA 5EC4A 4JXRA 1OZPA 1Y9KA 1S7FA 2B3VA 4CRYB 3DDDA 5KTAA 4F0YA 4AVBA 4B5PA 1Y9WA 2P0WA 4H89A 2JDCA 5C82A 4AG7A 1IB1E 2R1IA 2R8VA 2VEZA 4JLYA 3CXPA 2H5MA 3F0AA 3D2MA 2J8MA 1QSMA 3P2HA 4I49A 4KUBA 1NSLA 2VZZA 3VWDA 1BO4A 2ZXVA 1WK4A 4KLVA 3T9YA 4QUSA 1K4JA 2GIVA 3EC4A 4JXQA 1M44A 3FIXA 4E0AA 5DWMA 4UA3A 2G3TA 4CAXA 2FIAA 3TFYA 1M4IA 3R96A 3DR6A 4F6AA 4R3LA 4KORA 4J3GA 3IGRA 2OB0A 1XMTA 1ON0A 2REFA 5IX3A 4PSXA 4CAVA 3G8WA 3DNSA 4LUAA 4XNHC 3NE7A 3P2FA 1YLEA 4NEXA 2WPWA 2Z11A 4LX9A 1Z4EA 1RXTA 4JWPA 4QBJA 1P4NA 4CAWA 3FXTA 3FB3A 3F8KA 1XF8A 4H6UA 1YK3A 5CNPA 2BUEA 4MY0A 2Z0ZA 2B5GA 3LODA 1UFHA 4KOUA 4R87A 3RYOA 5F46A 1WWZA 3TCVA 2Q4YA 4Y49C 2R98A 3F5BA 3VWEA 2PSWA 4II9A 3WR7A 4ONUA 5J8FA 2ATRA 4FD6A 4HNXB 4AVCA 2CNTA 1P0HA 4KZTA 3TO7A 2OZUA 4KOSA 4CRZB 1PU9A 4XPDB 5F47A 2B5GB 1J4JA 3TTHA 2OH1A 2PRBA 3TO6A 2HUZA 1Z4RA 4NXYA 1Z9UA 1KZFA 1SQHA 4ZBGA 3R95A 1YGHA 2AE6A 3TT2A 2FL4A 2OU2A 1S7LA 2J8NA 4U5YA 5IV0A 3ZZIA 3MGDA 1I1DA 5FVJA 4PV6A 5GCNA 1I12A 2KCWA 2ZW4A 2PC1A 1L0CA 4BMHA 3B8GA 1M4GA 4E8OA 5HH1A 1CJWA 1NMTA 2CY2A 3TE4A 2RC4A 5F48A 5F49A 4U9ZA 4FD5A 3C26A 3H4QA 4L8AA 3V8IA 2JDDA 3GYAA 4MI4A 3S6HA 2R7HA 1VKCA 2FCKA 4B5OA 2P6EA 1YVKA 3EY5A 1RO5A 2DXQA 1KUVA 2GE3A 3QAHA 1Q2CA 1YREA 1S7KA 1MJ9A 3JUWA 4KOYA 3TOAA 4AB7A 2VZYA 4MHDA 4PK3A 5ISVA 1S5KA 4QB9A 4XPLA 2G3AA 2Q0YA 4PSWA 4MY3A 5C88A 1MJAA 2C27A 2I00A 3EO4A 2P6FA 4FD4A 2OZHA 4L89A 4CS0B 2FSRA 2FXFA 2FE7A 2VBQA 2VXKA 4KOTA 1Q2DA 4K30A 4YRHA 4XPKA 3DSBA 3W91A 1XE4A 2Y0MA 4M3SA 1I21A 2HQYA 3E0KA 1QSTA 4EVYA 1M1DA 4HNYB 3UY5A 4RS2A 1B6BA 2ZPAA 3CXSA 1LRZA 2HV2A 1QSNA 4FD7A 4HKFA 1QSRA 3G3SA 3OWCA 3R9EA 2K5TA 2WPXA 4PK2A 2JEVA 4RI1A 5DWNA 2X7BA 1MJBA 4UBRA 4UWJA 3SXOA 2NMTA 2ARHA 4QC6A 3PP9A 3D8PA 3FRMA 2PR8A 1N71A 4KVME 3DR8A 1IYLA 1S60A 1YR0A 2B4DB 3EFAA 2D4OA 2EVNA 3W6SA 3BJ7A 2PQ8A 2B58A 2B4BA 4R57A 2EUIA 1YX0A 3FBUA 1Q2YA 1KUXA 4OADA 1TIQA 2CNSA 2VQYA 4E2AA 3JVNA 4IF5A 3PZJA 3PGPA 2BSWA 3TOBA 4HNWB 2Q4VA 1IICA 3S6KA 2AJ6A 2ZW6A 4JJXA 1M4DA 4KUAA 4QVTA 1YVOA 2PDOA 2O28A 4MJ8A 2FT0A 2REEA 4XNHB 2OZGA 1NE9A 4KOWA 3SHPA 4XPDC 2FIWA 1PUAA 2GANA 2D4PA 4R3KA 3CXQA 3R9GA 2G0BA 2P6GA 5JPHA 4YGOA 5KTCA 4JD6A 3R1KA 4OLLA 1R57A 3BJ8A 1VHSA 4KVXA 3S6FA 4Y49B 4NCZA 1B87A 4H6ZA 4KOVA 5JQ4A 4AG9A 2ZW7A 5H84A 4IUSA 1FY7A 3KKWA 5E96A 3IWGA 4X5KA 4B5PB 2Z10A 1IIDA 2CNMA 2PR1A 2Q04A 2JLMA 3FYNA 2Q7BA 1IYKA 1KUYA 1XIXA 1BOBA
chains in the Genus database with same CATH superfamily
4Q38A 5I0CA 2NYQA 4NFRA 3BLNA 3LD2A 2J8RA 4GS4A 2BL1A 4B13A 2ZEOA 4MHNA 2B4DA 1PYTB 4KVOE 4A30A 2HB6A 4CGPA 3GY9A 3FNCA 5H86A 2BO9A 4F9UA 5HMNA 2CIJA 3FX6A 2YNDA 5G22A 2YGWA 3H8GA 5EBVA 3R9FA 1QSOA 3D2PA 3KR4A 3FVLA 1S7NA 4G1PA 2DF5A 4ZY1A 5JM6A 3I9SA 5A28A 1U6MA 2ZW5A 3WC5A 2FVGA 4AVAA 3EXNA 5LRKA 2I79A 4ZI6A 5IB0A 1GHEA 1IOFA 2WYRA 3KZWA 3N7ZA 1MK4A 1CX8A 3I3GA 4YFJA 3GUXA 2FS5A 3PBEA 2YNCC 3TC8A 2ZOFA 1BAVA 3PB8X 3RO0A 3GKRA 2AFMA 4MFPA 1XJOA 4FUUA 2O4HA 2ZENA 3PEIA 3ZJ0A 1ZG7A 4GXHA 1Z8XA 2PJ9A 4B10A 4DNCA 2EK8A 4CGLA 2Q43A 3NFZA 4KOXA 2F7VA 3SXNA 1UWYA 4BBHA 1NSAA 1X12A 1PCAA 1XEBA 1CP7A 5J8CA 2ZELA 2Q7SA 4M85A 4CGNA 1OBRA 2VI7A 4B6ZA 1CM0A 1M4LA 3IWWA 2Q44A 4MBUA 1V0CA 2EO8A 3D3SA 4KLWA 5CBMA 3GB0A 3T90A 2QECA 4UCPA 4A38A 3WC7A 4R9MA 2QIRA 5K8OA 4FWUA 4BINA 3RZAA 2DEAA 2B3UA 4X2TA 5F09A 4B11A 4ORFA 2F5IA 3IJ3A 2CTCA 1CPXA 3K9UA 3H8FA 2DPSA 3H5ZA 2A4NA 1S3ZA 2JBJA 2QMLA 4TWEA 4OIWA 3W6XA 3IC1A 4MFJA 4FAIA 2YNEA 4KSIA 3PB7X 3QB8A 3TO9A 3S6GA 4NGQA 1Y0YA 2F8HA 2IL4A 3VARA 3S9LA 2ZEMA 1Y7RA 4OAEA 2C6PA 3NH4A 5KTDA 2YNCA 4UWIA 4U9YA 2BEIA 4P4JA 4NF1A 1FNOA 1IGBA 4NSQA 5EC4A 2BCOA 4JXRA 1OZPA 1Y9KA 5AG4A 5HXDA 1JQGA 1S7FA 3B7IA 2B3VA 2NSMA 1TF8A 4CRYB 1JWQA 3DDDA 4IAVA 4F0YA 4AVBA 5KTAA 4B5PA 1Y9WA 2QVPA 1XRYA 1Y0RA 2P0WA 4H89A 2JDCA 4A33A 3D68A 3LWUA 4ZX8A 5C82A 4AG7A 1IB1E 2R1IA 2R8VA 4MCSA 2VEZA 4JLYA 3CXPA 1ZLHA 3LACA 1CPSA 2OR4A 2H5MA 3BI1A 3F0AA 4GM5A 2J8MA 3D2MA 1QSMA 3P2HA 5THWA 1GYTA 4I49A 4KUBA 2Z3NA 2IQ6A 4PQAA 2HC9A 4UF4A 3HUVA 1NSLA 4NJRA 4CAEA 2VZZA 3BI0A 4PXDA 3VWDA 1BO4A 1IU8A 1WK4A 2ZXVA 2C1CA 4B14A 2ZEPA 4EMEA 2PCUA 3FEEA 4KLVA 2PJ0A 4MFLA 3T9YA 4QUSA 1K4JA 3SJEA 2GIVA 5K8PA 4P45A 5HVGA 3IU1A 3EC4A 1R43A 1ELMP 4JXQA 2PJAA 1M44A 3FIXA 4HPSA 4UIAA 1XBUA 4E0AA 5DWMA 2Z3KA 3PB6X 1AYEA 4UA3A 2G3TA 4CAXA 2FIAA 3TFYA 2PJ7A 1M4IA 2OOTA 4P4EA 2I3CA 3KHZA 2Z3MA 3DR6A 4NGPA 3R96A 4R3LA 3WABA 4F6AA 4KORA 4F0XA 1TXRA 3KHXA 4C68A 2CXAA 4J3GA 3IGRA 3CDXA 2OB0A 1XMTA 1ON0A 1TKFA 4WWVA 3SI0A 5JGFA 2REFA 5IX3A 1ARMA 4PSXA 4R7MA 1ARLA 3G8WA 2V8DA 4UFWA 4CAVA 3DNSA 3IFEA 4LUAA 4MMOA 4XNHC 1VHEA 2EWBA 2PJBA 3NE7A 1YLEA 3P2FA 1R3NA 4NEXA 2WPWA 6CPAA 3S9NA 4R8FA 4B12A 2Z11A 4LX9A 1Z4EA 1RXTA 2RB7A 4JWPA 4QBJA 3PB4X 2AFUA 1P4NA 1AMPA 4CGMA 4CAWA 3FXTA 3FB3A 3F8KA 2ZEGA 1XF8A 1ZO0A 1YK3A 4H6UA 2BUEA 3FMCA 2Q4ZA 2Z0ZA 2B5GA 2PJ3A 4MY0A 3B35A 5CNPA 3RAMA 3S9MA 4KS9A 3LODA 1TKHA 1UFHA 2JEWA 4OC3A 5EMIA 3D67A 4KOUA 4R87A 3RYOA 3FH4A 1WWZA 3JTKA 3TCVA 4RUHA 2Q4YA 5F46A 4Y49C 2R98A 3F5BA 4KSAA 3VWEA 4C7HA 1YW4A 2PSWA 4II9A 3WR7A 4A32A 4ONUA 2WUUA 2GFQA 4NGTA 5J8FA 2ATRA 4P44A 4A2ZA 2PJCA 4FD6A 7CPAA 2AFZA 4HNXB 4AVCA 1CG2A 1P0HA 2CNTA 2PJ4A 4KZTA 4BD9A 3TO7A 2OZUA 1DE4C 2ODFA 4KOSA 3KGQA 2PJ2A 1LFWA 1PU9A 1X10A 1Z2LA 4XPDB 5F47A 2B5GB 4CRZB 1J4JA 5LRGA 3TTHA 3PRTA 2OH1A 2PRBA 3JRUA 4M6GA 2ZEDA 2HUZA 1Z4RA 3KR5A 3TO6A 3WC6A 2V8VA 4NXYA 2Z3LA 4MCQA 4MHYA 4MXUA 1Z9UA 5HVHA 2PVVA 5LRJA 1KZFA 4CYNA 3KQXA 1SQHA 3PFOA 5D8NA 3DLJA 4ZBGA 4P10A 3R95A 1YMEA 4MHZA 4W9YA 3NH8A 5G20A 3VATA 1HEEA 1YGHA 2AE6A 3TT2A 1XOVA 4NGNA 2FL4A 2OU2A 1F2OA 3FECA 3SJFA 1S7LA 3PFEA 3B3SA 2J9AA 4OKOA 2CF4A 1LANA 1BPNA 4ZX9A 1Q7LA 4O23A 5AG6A 2J8NA 2EK9A 4U5YA 5IV0A 2V8HA 3ZZIA 3MGDA 1EE3P 1I1DA 5FVJA 5A27A 1IY7A 4ZY2A 4PV6A 5GCNA 3SI2A 2RFHA 1I12A 2KCWA 2ZW4A 3BHXA 4MFKA 2PC1A 3B3CA 4YU9A 4F9VA 1L0CA 5HVFA 4BMHA 3B8GA 1M4GA 4E8OA 4A94A 5G1ZA 5HH1A 1CJWA 1NMTA 2V77A 1YW6A 2CY2A 4P4FA 3TE4A 2GLFA 2RC4A 2XEFA 4NJQA 4MFZA 1CBXA 1LAPA 4FD5A 4U9ZA 3C26A 3H4QA 5F49A 4L8AA 3V8IA 2JDDA 3GYAA 4MI4A 1ELLP 1F57A 3S6HA 2R7HA 1VKCA 2FCKA 4B5OA 4CPAA 4M6IA 4P4DA 2P6EA 1YVKA 2ABZA 4A39A 3EY5A 1RO5A 2DXQA 1KUVA 2GE3A 3QAHA 1Q2CA 1YREA 4NGRA 1S7KA 4F8ZA 1MJ9A 3HLPA 1VGYA 2ZEEA 3JUWA 4KOYA 4OC1A 4K3NA 3TOAA 4AB7A 2VZYA 3CT9A 4MHDA 4X3RA 1FT7A 4PK3A 2G9DA 3KL9A 1S5KA 5ISVA 1TKJA 4QB9A 4UFVA 4CYQA 4OIDA 5ELYA 4XPLA 3QAYA 5IB9A 3I1UA 2G3AA 2Q0YA 3CZXA 3IU2A 4PSWA 4FBEA 4MY3A 2QYVA 3B3WA 5C88A 4C2YA 1MJAA 4Q7AA 4IK2A 2C27A 2I00A 3EO4A 4RN7A 4DUKA 2P6FA 1F2PA 4FD4A 2OZHA 4L89A 4CS0B 2FSRA 3D7DA 2FXFA 2FE7A 2VBQA 2VXKA 4KOTA 4NGMA 1Q2DA 2BOAA 4K30A 4A31A 4YRHA 3D7FA 1ZG9A 4PPZA 2XEJA 4OC4A 2IJZA 4XPKA 3DSBA 3W91A 1XE4A 2Y0MA 4M3SA 3SI1A 5J1QA 1AUGA 1I21A 2HQYA 3E0KA 3RNZA 2EBJA 1QSTA 3QNVA 4OC5A 4AXVA 4EVYA 2Q51A 1M1DA 4HNYB 2PJ1A 3NH5A 3UY5A 4RS2A 1B6BA 1LCPA 2ZPAA 3CXSA 3FJUA 4C2ZA 1LRZA 2HV2A 1HDQA 1QSNA 2PJ5A 4FD7A 4HKFA 1QSRA 3D7GA 3G3SA 3OWCA 3R9EA 2PRQA 2PE3A 2PJ8A 2K5TA 3CPAA 2WPXA 3L2NA 4KSFA 2IMOA 4PK2A 3NA6A 2JEVA 3IIBA 1Y7EA 4RI1A 4CYOA 5DS0A 3KASA 5DWNA 1H8LA 5BWAB 2X7BA 3WT4A 4R76A 2C6GA 2GLJA 2ZEHA 1MJBA 4UBRA 4UWJA 3SXOA 2XEIA 2NMTA 2ARHA 4DYOA 4MHPA 4QC6A 5K8NA 3PP9A 3T8WA 3B2YA 3D8PA 3FRMA 4DJLA 1Z5RA 2PR8A 1N71A 3K2KA 1RTQA 4KVME 3DR8A 4MFQA 1IYLA 1S60A 3FF3A 2CTBA 1YR0A 1Z8TA 2B4DB 5D29A 3V7ZA 3EFAA 5I4MA 2D4OA 2EVNA 3W6SA 3BJ7A 2PQ8A 2B58A 2B4BA 4R57A 4JZ0A 2EUIA 4UCNA 4OC0A 4CGOA 4LQGA 2V8GA 1YX0A 2Z3PA 4C2XA 4CYPA 1YLOA 3TX8A 4H2KA 1LOKA 3NE8A 4OMEA 4P4IA 3FBUA 4OP4A 3BXMA 1VHOA 1Q2YA 4JYWA 1KUXA 4UCMA 1LAMA 4OADA 1TIQA 2CNSA 5LYIA 3DGVA 3GLJA 3ISXA 4MCPA 1HDUA 2AFOA 2VQYA 3JVNA 4UFXA 4IF5A 1YQEA 4E2AA 3PZJA 3PGPA 4P6YA 4CAFA 2BSWA 3TOBA 4EFDA 5K8MA 3MN8A 2ZOGA 2PIZA 1XFOA 4OC2A 2Z3OA 4HNWB 2Q4VA 4M6HA 3D4UA 1Z8WA 1IICA 1QQ9A 2GREA 3IEHA 3S6KA 2AJ6A 2ZW6A 1DTDA 3MRUA 4JJXA 4A95A 3KI9A 1M4DA 4KUAA 3IWEA 3A9LA 4QVTA 2AFWA 1TF9A 1YVOA 2PDOA 2QJ8A 2DPTA 2VL1A 2WZNA 1A2ZA 3CPXA 3D7HA 3PB9X 2O28A 1Z8LA 4MJ8A 2C6CA 3PBBA 2FT0A 3B3TA 2REEA 1CP6A 4ZGYB 4LQ6A 3ISZA 4PXEA 2PVWA 4UEFA 3D66A 5LYLA 4XNHB 4UEZA 1KWMA 2OZGA 1BLLE 1ZG8A 1NE9A 4KOWA 2ANPA 3SJGA 2AFSA 3SHPA 1IOIA 4XPDC 4Z65A 2FIWA 5G21A 4Q36A 4ZY0A 1PUAA 2GANA 2D4PA 2PJ6A 3CXQA 4R3KA 2POKA 3R9GA 4ZYQA 5JH9A 1YSJA 2JBKA 4UEEA 2G0BA 2P6GA 5CPAA 4YWYA 5JPHA 5LYFA 4YGOA 4EWTA 1ZLIA 2GU2A 5KTCA 5AGEA 2XEGA 4JD6A 3SJXA 3R1KA 4OLLA 1R57A 3KQZA 1BPMA 3BJ8A 4X8IA 1VHSA 5AG5A 5LYDA 3N5FA 8CPAA 4IHMA 3B3VA 4PXCA 2PIYA 4NGSA 4KVXA 2ZEFA 3RBUA 3S6FA 4P4BA 4Y49B 4NCZA 4ONWA 5F48A 1B87A 4H6ZA 4KOVA 4A37A 4AG9A 5JQ4A 2ZW7A 2AFXA 5AG7A 2O53A 3LMSA 5H84A 4IUSA 1QMUA 1FY7A 3GIUA 3VH9A 3KKWA 5E96A 3IWGA 4X5KA 4UIBA 4B5PB 2Z10A 4R6TA 1IIDA 3IO1A 4TNUA 2CNMA 4MRIA 2WSAA 2PR1A 2Q04A 4WJBA 3H8EA 1VIXA 2JLMA 3K9TA 3FYNA 3V38A 3FEDA 2Q7BA 1XMBA 1IYKA 1KUYA 1XIXA 4C7IA 4PXBA 1BOBA 4MCRA
chains in the Genus database with same CATH topology
4Q38A 5I0CA 3BLNA 3LD2A 2J8RA 4GS4A 2BL1A 4B13A 2B4DA 4KVOE 4A30A 4CGPA 3GY9A 3FNCA 5H86A 5HMNA 2YNDA 5G22A 2YGWA 5EBVA 3R9FA 1QSOA 3D2PA 1S7NA 3I9SA 5A28A 1U6MA 2ZW5A 4AVAA 3EXNA 2I79A 5IB0A 1GHEA 3N7ZA 1MK4A 3I3GA 4YFJA 2FS5A 2YNCC 3GKRA 4MFPA 3ZJ0A 4B10A 4DNCA 4CGLA 4KOXA 3SXNA 4BBHA 1XEBA 5J8CA 4M85A 4CGNA 2VI7A 1CM0A 2Q44A 4MBUA 1V0CA 4KLWA 3D3SA 3T90A 2QECA 4UCPA 4R9MA 2QIRA 2B3UA 4B11A 4ORFA 2F5IA 3K9UA 2DPSA 3H5ZA 2A4NA 1S3ZA 2QMLA 3W6XA 4MFJA 2YNEA 3QB8A 3TO9A 3S6GA 2IL4A 1Y7RA 4OAEA 5KTDA 2YNCA 4UWIA 4U9YA 2BEIA 4NF1A 4NSQA 5EC4A 4JXRA 1OZPA 1Y9KA 1S7FA 2B3VA 4CRYB 3DDDA 5KTAA 4F0YA 4AVBA 4B5PA 1Y9WA 2P0WA 4A33A 4H89A 2JDCA 5C82A 4AG7A 1IB1E 2R1IA 2R8VA 2VEZA 4JLYA 3CXPA 2H5MA 3F0AA 3D2MA 2J8MA 1QSMA 3P2HA 4I49A 4KUBA 2Z3NA 1NSLA 4CAEA 2VZZA 3VWDA 1BO4A 2ZXVA 1WK4A 4B14A 4KLVA 4MFLA 3T9YA 4QUSA 1K4JA 2GIVA 3IU1A 3EC4A 4JXQA 1M44A 3FIXA 4E0AA 5DWMA 2Z3KA 4UA3A 2G3TA 4CAXA 2FIAA 3TFYA 1M4IA 2Z3MA 3DR6A 3R96A 4F6AA 4R3LA 4F0XA 4KORA 4C68A 2CXAA 4J3GA 3IGRA 2OB0A 1XMTA 1ON0A 2REFA 5IX3A 4PSXA 4CAVA 3G8WA 4UFWA 3DNSA 4LUAA 4XNHC 3NE7A 3P2FA 1YLEA 4NEXA 2WPWA 4B12A 2Z11A 4LX9A 1Z4EA 1RXTA 4JWPA 4QBJA 1P4NA 4CGMA 4CAWA 3FXTA 3FB3A 3F8KA 1XF8A 1ZO0A 1YK3A 4H6UA 2BUEA 4MY0A 2Z0ZA 5CNPA 2B5GA 4KS9A 3LODA 1UFHA 4KOUA 4R87A 3RYOA 3JTKA 1WWZA 3TCVA 5F46A 2Q4YA 4Y49C 2R98A 3F5BA 4KSAA 3VWEA 4C7HA 2PSWA 4II9A 3WR7A 4A32A 4ONUA 2WUUA 5J8FA 2ATRA 4A2ZA 4FD6A 4HNXB 4AVCA 2CNTA 1P0HA 4KZTA 3TO7A 2OZUA 4KOSA 4CRZB 5AG4A 1PU9A 4XPDB 5F47A 2B5GB 1J4JA 3TTHA 2OH1A 2PRBA 3TO6A 2HUZA 1Z4RA 4NXYA 2Z3LA 1Z9UA 1KZFA 4CYNA 1SQHA 4ZBGA 3R95A 5G20A 1YGHA 2AE6A 3TT2A 2FL4A 2OU2A 1S7LA 5AG6A 2J8NA 4U5YA 5IV0A 3ZZIA 3MGDA 1I1DA 5FVJA 5A27A 4PV6A 5GCNA 1I12A 2KCWA 2ZW4A 4MFKA 2PC1A 1L0CA 4BMHA 3B8GA 1M4GA 4E8OA 5G1ZA 5HH1A 1CJWA 1NMTA 2CY2A 3TE4A 2RC4A 5F48A 5F49A 4MFZA 4U9ZA 4FD5A 3C26A 3H4QA 4L8AA 3V8IA 2JDDA 3GYAA 4MI4A 3S6HA 2R7HA 1VKCA 2FCKA 4B5OA 2P6EA 1YVKA 3EY5A 1RO5A 2DXQA 1KUVA 2GE3A 3QAHA 1Q2CA 1YREA 1S7KA 1MJ9A 3JUWA 4KOYA 3TOAA 4AB7A 2VZYA 4MHDA 4PK3A 5ISVA 1S5KA 4CYQA 4QB9A 4UFVA 4XPLA 2G3AA 2Q0YA 4PSWA 3IU2A 4MY3A 5C88A 4C2YA 1MJAA 2C27A 2I00A 3EO4A 2P6FA 4FD4A 2OZHA 4L89A 4CS0B 2FSRA 2FXFA 2FE7A 2VBQA 2VXKA 4KOTA 1Q2DA 4K30A 4A31A 4YRHA 4XPKA 3DSBA 3W91A 1XE4A 2Y0MA 4M3SA 1I21A 2HQYA 3E0KA 1QSTA 4EVYA 1M1DA 4HNYB 3UY5A 4RS2A 1B6BA 2ZPAA 3CXSA 4C2ZA 1LRZA 2HV2A 1QSNA 4FD7A 4HKFA 1QSRA 3G3SA 3OWCA 3R9EA 4KSFA 2K5TA 2WPXA 4PK2A 2JEVA 4RI1A 4CYOA 5DWNA 5BWAB 2X7BA 1MJBA 4UBRA 4UWJA 3SXOA 2NMTA 2ARHA 4QC6A 3PP9A 3D8PA 3FRMA 2PR8A 1N71A 4KVME 3DR8A 4MFQA 1IYLA 1S60A 1YR0A 2B4DB 3EFAA 2D4OA 2EVNA 3W6SA 3BJ7A 2PQ8A 2B58A 2B4BA 4R57A 2EUIA 4UCNA 4CGOA 1YX0A 2Z3PA 4C2XA 4CYPA 3FBUA 1Q2YA 1KUXA 4UCMA 4OADA 1TIQA 2CNSA 4UFXA 2VQYA 4E2AA 3JVNA 4IF5A 3PZJA 3PGPA 4CAFA 2BSWA 3TOBA 2Z3OA 4HNWB 2Q4VA 1IICA 3S6KA 2AJ6A 2ZW6A 4JJXA 4A95A 1M4DA 4KUAA 3IWEA 3A9LA 4QVTA 1YVOA 2PDOA 2DPTA 2O28A 4MJ8A 2FT0A 2REEA 4ZGYB 4XNHB 2OZGA 1NE9A 4KOWA 3SHPA 4XPDC 2FIWA 5G21A 4Q36A 1PUAA 2GANA 2D4PA 4R3KA 3CXQA 3R9GA 2G0BA 2P6GA 5JPHA 4YGOA 5KTCA 5AGEA 4JD6A 3R1KA 4OLLA 1R57A 3BJ8A 5AG5A 1VHSA 4KVXA 3S6FA 4Y49B 4NCZA 1B87A 4H6ZA 4KOVA 5JQ4A 4AG9A 2ZW7A 5AG7A 5H84A 4IUSA 1FY7A 3KKWA 5E96A 3IWGA 4X5KA 4B5PB 2Z10A 1IIDA 2CNMA 2WSAA 2PR1A 2Q04A 2JLMA 3FYNA 2Q7BA 4C7IA 1IYKA 1KUYA 1XIXA 1BOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0C A;  3BLN A;  3LD2 A;  2J8R A;  4GS4 A;  2BL1 A;  2B4D A;  4KVO E;  3GY9 A;  3FNC A;  5H86 A;  5HMN A;  5EBV A;  3R9F A;  1QSO A;  3D2P A;  1S7N A;  3I9S A;  1U6M A;  2ZW5 A;  4AVA A;  3EXN A;  2I79 A;  5IB0 A;  1GHE A;  3N7Z A;  1MK4 A;  3I3G A;  4YFJ A;  2FS5 A;  3GKR A;  3ZJ0 A;  4DNC A;  4KOX A;  3SXN A;  1XEB A;  5J8C A;  4M85 A;  2VI7 A;  1CM0 A;  2Q44 A;  4MBU A;  1V0C A;  4KLW A;  3D3S A;  3T90 A;  2QEC A;  4R9M A;  2QIR A;  2B3U A;  4ORF A;  2F5I A;  3K9U A;  2A4N A;  1S3Z A;  2QML A;  3W6X A;  3QB8 A;  3TO9 A;  3S6G A;  2IL4 A;  1Y7R A;  4OAE A;  5KTD A;  4UWI A;  4U9Y A;  2BEI A;  4NF1 A;  4NSQ A;  5EC4 A;  4JXR A;  1OZP A;  1Y9K A;  1S7F A;  2B3V A;  4CRY B;  3DDD A;  5KTA A;  4F0Y A;  4AVB A;  4B5P A;  1Y9W A;  2P0W A;  4H89 A;  2JDC A;  5C82 A;  4AG7 A;  1IB1 E;  2R1I A;  2R8V A;  2VEZ A;  4JLY A;  3CXP A;  2H5M A;  3F0A A;  3D2M A;  2J8M A;  1QSM A;  3P2H A;  4I49 A;  4KUB A;  1NSL A;  2VZZ A;  3VWD A;  1BO4 A;  2ZXV A;  1WK4 A;  4KLV A;  3T9Y A;  4QUS A;  1K4J A;  2GIV A;  3EC4 A;  4JXQ A;  1M44 A;  3FIX A;  4E0A A;  5DWM A;  4UA3 A;  2G3T A;  4CAX A;  2FIA A;  3TFY A;  1M4I A;  3R96 A;  3DR6 A;  4F6A A;  4R3L A;  4KOR A;  4J3G A;  3IGR A;  2OB0 A;  1XMT A;  1ON0 A;  2REF A;  5IX3 A;  4PSX A;  4CAV A;  3G8W A;  3DNS A;  4LUA A;  4XNH C;  3NE7 A;  3P2F A;  1YLE A;  4NEX A;  2WPW A;  2Z11 A;  4LX9 A;  1Z4E A;  1RXT A;  4JWP A;  4QBJ A;  1P4N A;  4CAW A;  3FXT A;  3FB3 A;  3F8K A;  1XF8 A;  4H6U A;  1YK3 A;  5CNP A;  2BUE A;  4MY0 A;  2Z0Z A;  2B5G A;  3LOD A;  1UFH A;  4KOU A;  4R87 A;  3RYO A;  5F46 A;  1WWZ A;  3TCV A;  2Q4Y A;  4Y49 C;  2R98 A;  3F5B A;  3VWE A;  2PSW A;  4II9 A;  3WR7 A;  4ONU A;  5J8F A;  2ATR A;  4FD6 A;  4HNX B;  4AVC A;  2CNT A;  1P0H A;  4KZT A;  3TO7 A;  2OZU A;  4KOS A;  4CRZ B;  1PU9 A;  4XPD B;  5F47 A;  2B5G B;  1J4J A;  3TTH A;  2OH1 A;  2PRB A;  3TO6 A;  2HUZ A;  1Z4R A;  4NXY A;  1Z9U A;  1KZF A;  1SQH A;  4ZBG A;  3R95 A;  1YGH A;  2AE6 A;  3TT2 A;  2FL4 A;  2OU2 A;  1S7L A;  2J8N A;  4U5Y A;  5IV0 A;  3ZZI A;  3MGD A;  1I1D A;  5FVJ A;  4PV6 A;  5GCN A;  1I12 A;  2KCW A;  2ZW4 A;  2PC1 A;  1L0C A;  4BMH A;  3B8G A;  1M4G A;  4E8O A;  5HH1 A;  1CJW A;  1NMT A;  2CY2 A;  3TE4 A;  2RC4 A;  5F48 A;  5F49 A;  4U9Z A;  4FD5 A;  3C26 A;  3H4Q A;  4L8A A;  3V8I A;  2JDD A;  3GYA A;  4MI4 A;  3S6H A;  2R7H A;  1VKC A;  2FCK A;  4B5O A;  2P6E A;  1YVK A;  3EY5 A;  1RO5 A;  2DXQ A;  1KUV A;  2GE3 A;  3QAH A;  1Q2C A;  1YRE A;  1S7K A;  1MJ9 A;  3JUW A;  4KOY A;  3TOA A;  4AB7 A;  2VZY A;  4MHD A;  4PK3 A;  5ISV A;  1S5K A;  4QB9 A;  4XPL A;  2G3A A;  2Q0Y A;  4PSW A;  4MY3 A;  5C88 A;  1MJA A;  2C27 A;  2I00 A;  3EO4 A;  2P6F A;  4FD4 A;  2OZH A;  4L89 A;  4CS0 B;  2FSR A;  2FXF A;  2FE7 A;  2VBQ A;  2VXK A;  4KOT A;  1Q2D A;  4K30 A;  4YRH A;  4XPK A;  3DSB A;  3W91 A;  1XE4 A;  2Y0M A;  4M3S A;  1I21 A;  2HQY A;  3E0K A;  1QST A;  4EVY A;  1M1D A;  4HNY B;  3UY5 A;  4RS2 A;  1B6B A;  2ZPA A;  3CXS A;  1LRZ A;  2HV2 A;  1QSN A;  4FD7 A;  4HKF A;  1QSR A;  3G3S A;  3OWC A;  3R9E A;  2K5T A;  2WPX A;  4PK2 A;  2JEV A;  4RI1 A;  5DWN A;  2X7B A;  1MJB A;  4UBR A;  4UWJ A;  3SXO A;  2NMT A;  2ARH A;  4QC6 A;  3PP9 A;  3D8P A;  3FRM A;  2PR8 A;  1N71 A;  4KVM E;  3DR8 A;  1IYL A;  1S60 A;  1YR0 A;  2B4D B;  3EFA A;  2D4O A;  2EVN A;  3W6S A;  3BJ7 A;  2PQ8 A;  2B58 A;  2B4B A;  4R57 A;  2EUI A;  1YX0 A;  3FBU A;  1Q2Y A;  1KUX A;  4OAD A;  1TIQ A;  2CNS A;  2VQY A;  4E2A A;  3JVN A;  4IF5 A;  3PZJ A;  3PGP A;  2BSW A;  3TOB A;  4HNW B;  2Q4V A;  1IIC A;  3S6K A;  2AJ6 A;  2ZW6 A;  4JJX A;  1M4D A;  4KUA A;  4QVT A;  1YVO A;  2PDO A;  2O28 A;  4MJ8 A;  2FT0 A;  2REE A;  4XNH B;  2OZG A;  1NE9 A;  4KOW A;  3SHP A;  4XPD C;  2FIW A;  1PUA A;  2GAN A;  2D4P A;  4R3K A;  3CXQ A;  3R9G A;  2G0B A;  2P6G A;  5JPH A;  4YGO A;  5KTC A;  4JD6 A;  3R1K A;  4OLL A;  1R57 A;  3BJ8 A;  1VHS A;  4KVX A;  3S6F A;  4Y49 B;  4NCZ A;  1B87 A;  4H6Z A;  4KOV A;  5JQ4 A;  4AG9 A;  2ZW7 A;  5H84 A;  4IUS A;  1FY7 A;  3KKW A;  5E96 A;  3IWG A;  4X5K A;  4B5P B;  2Z10 A;  1IID A;  2CNM A;  2PR1 A;  2Q04 A;  2JLM A;  3FYN A;  2Q7B A;  1IYK A;  1KUY A;  1XIX A;  1BOB A; 
#chains in the Genus database with same CATH topology
 4Q38 A;  5I0C A;  2NYQ A;  4NFR A;  3BLN A;  3LD2 A;  2J8R A;  4GS4 A;  2BL1 A;  4B13 A;  2ZEO A;  4MHN A;  2B4D A;  1PYT B;  4KVO E;  4A30 A;  2HB6 A;  4CGP A;  3GY9 A;  3FNC A;  5H86 A;  2BO9 A;  4F9U A;  5HMN A;  2CIJ A;  3FX6 A;  2YND A;  5G22 A;  2YGW A;  3H8G A;  5EBV A;  3R9F A;  1QSO A;  3D2P A;  3KR4 A;  3FVL A;  1S7N A;  4G1P A;  2DF5 A;  4ZY1 A;  5JM6 A;  3I9S A;  5A28 A;  1U6M A;  2ZW5 A;  3WC5 A;  2FVG A;  4AVA A;  3EXN A;  5LRK A;  2I79 A;  4ZI6 A;  5IB0 A;  1GHE A;  1IOF A;  2WYR A;  3KZW A;  3N7Z A;  1MK4 A;  1CX8 A;  3I3G A;  4YFJ A;  3GUX A;  2FS5 A;  3PBE A;  2YNC C;  3TC8 A;  2ZOF A;  1BAV A;  3PB8 X;  3RO0 A;  3GKR A;  2AFM A;  4MFP A;  1XJO A;  4FUU A;  2O4H A;  2ZEN A;  3PEI A;  3ZJ0 A;  1ZG7 A;  4GXH A;  1Z8X A;  2PJ9 A;  4B10 A;  4DNC A;  2EK8 A;  4CGL A;  2Q43 A;  3NFZ A;  4KOX A;  2F7V A;  3SXN A;  1UWY A;  4BBH A;  1NSA A;  1X12 A;  1PCA A;  1XEB A;  1CP7 A;  5J8C A;  2ZEL A;  2Q7S A;  4M85 A;  4CGN A;  1OBR A;  2VI7 A;  4B6Z A;  1CM0 A;  1M4L A;  3IWW A;  2Q44 A;  4MBU A;  1V0C A;  2EO8 A;  3D3S A;  4KLW A;  5CBM A;  3GB0 A;  3T90 A;  2QEC A;  4UCP A;  4A38 A;  3WC7 A;  4R9M A;  2QIR A;  5K8O A;  4FWU A;  4BIN A;  3RZA A;  2DEA A;  2B3U A;  4X2T A;  5F09 A;  4B11 A;  4ORF A;  2F5I A;  3IJ3 A;  2CTC A;  1CPX A;  3K9U A;  3H8F A;  2DPS A;  3H5Z A;  2A4N A;  1S3Z A;  2JBJ A;  2QML A;  4TWE A;  4OIW A;  3W6X A;  3IC1 A;  4MFJ A;  4FAI A;  2YNE A;  4KSI A;  3PB7 X;  3QB8 A;  3TO9 A;  3S6G A;  4NGQ A;  1Y0Y A;  2F8H A;  2IL4 A;  3VAR A;  3S9L A;  2ZEM A;  1Y7R A;  4OAE A;  2C6P A;  3NH4 A;  5KTD A;  2YNC A;  4UWI A;  4U9Y A;  2BEI A;  4P4J A;  4NF1 A;  1FNO A;  1IGB A;  4NSQ A;  5EC4 A;  2BCO A;  4JXR A;  1OZP A;  1Y9K A;  5AG4 A;  5HXD A;  1JQG A;  1S7F A;  3B7I A;  2B3V A;  2NSM A;  1TF8 A;  4CRY B;  1JWQ A;  3DDD A;  4IAV A;  4F0Y A;  4AVB A;  5KTA A;  4B5P A;  1Y9W A;  2QVP A;  1XRY A;  1Y0R A;  2P0W A;  4H89 A;  2JDC A;  4A33 A;  3D68 A;  3LWU A;  4ZX8 A;  5C82 A;  4AG7 A;  1IB1 E;  2R1I A;  2R8V A;  4MCS A;  2VEZ A;  4JLY A;  3CXP A;  1ZLH A;  3LAC A;  1CPS A;  2OR4 A;  2H5M A;  3BI1 A;  3F0A A;  4GM5 A;  2J8M A;  3D2M A;  1QSM A;  3P2H A;  5THW A;  1GYT A;  4I49 A;  4KUB A;  2Z3N A;  2IQ6 A;  4PQA A;  2HC9 A;  4UF4 A;  3HUV A;  1NSL A;  4NJR A;  4CAE A;  2VZZ A;  3BI0 A;  4PXD A;  3VWD A;  1BO4 A;  1IU8 A;  1WK4 A;  2ZXV A;  2C1C A;  4B14 A;  2ZEP A;  4EME A;  2PCU A;  3FEE A;  4KLV A;  2PJ0 A;  4MFL A;  3T9Y A;  4QUS A;  1K4J A;  3SJE A;  2GIV A;  5K8P A;  4P45 A;  5HVG A;  3IU1 A;  3EC4 A;  1R43 A;  1ELM P;  4JXQ A;  2PJA A;  1M44 A;  3FIX A;  4HPS A;  4UIA A;  1XBU A;  4E0A A;  5DWM A;  2Z3K A;  3PB6 X;  1AYE A;  4UA3 A;  2G3T A;  4CAX A;  2FIA A;  3TFY A;  2PJ7 A;  1M4I A;  2OOT A;  4P4E A;  2I3C A;  3KHZ A;  2Z3M A;  3DR6 A;  4NGP A;  3R96 A;  4R3L A;  3WAB A;  4F6A A;  4KOR A;  4F0X A;  1TXR A;  3KHX A;  4C68 A;  2CXA A;  4J3G A;  3IGR A;  3CDX A;  2OB0 A;  1XMT A;  1ON0 A;  1TKF A;  4WWV A;  3SI0 A;  5JGF A;  2REF A;  5IX3 A;  1ARM A;  4PSX A;  4R7M A;  1ARL A;  3G8W A;  2V8D A;  4UFW A;  4CAV A;  3DNS A;  3IFE A;  4LUA A;  4MMO A;  4XNH C;  1VHE A;  2EWB A;  2PJB A;  3NE7 A;  1YLE A;  3P2F A;  1R3N A;  4NEX A;  2WPW A;  6CPA A;  3S9N A;  4R8F A;  4B12 A;  2Z11 A;  4LX9 A;  1Z4E A;  1RXT A;  2RB7 A;  4JWP A;  4QBJ A;  3PB4 X;  2AFU A;  1P4N A;  1AMP A;  4CGM A;  4CAW A;  3FXT A;  3FB3 A;  3F8K A;  2ZEG A;  1XF8 A;  1ZO0 A;  1YK3 A;  4H6U A;  2BUE A;  3FMC A;  2Q4Z A;  2Z0Z A;  2B5G A;  2PJ3 A;  4MY0 A;  3B35 A;  5CNP A;  3RAM A;  3S9M A;  4KS9 A;  3LOD A;  1TKH A;  1UFH A;  2JEW A;  4OC3 A;  5EMI A;  3D67 A;  4KOU A;  4R87 A;  3RYO A;  3FH4 A;  1WWZ A;  3JTK A;  3TCV A;  4RUH A;  2Q4Y A;  5F46 A;  4Y49 C;  2R98 A;  3F5B A;  4KSA A;  3VWE A;  4C7H A;  1YW4 A;  2PSW A;  4II9 A;  3WR7 A;  4A32 A;  4ONU A;  2WUU A;  2GFQ A;  4NGT A;  5J8F A;  2ATR A;  4P44 A;  4A2Z A;  2PJC A;  4FD6 A;  7CPA A;  2AFZ A;  4HNX B;  4AVC A;  1CG2 A;  1P0H A;  2CNT A;  2PJ4 A;  4KZT A;  4BD9 A;  3TO7 A;  2OZU A;  1DE4 C;  2ODF A;  4KOS A;  3KGQ A;  2PJ2 A;  1LFW A;  1PU9 A;  1X10 A;  1Z2L A;  4XPD B;  5F47 A;  2B5G B;  4CRZ B;  1J4J A;  5LRG A;  3TTH A;  3PRT A;  2OH1 A;  2PRB A;  3JRU A;  4M6G A;  2ZED A;  2HUZ A;  1Z4R A;  3KR5 A;  3TO6 A;  3WC6 A;  2V8V A;  4NXY A;  2Z3L A;  4MCQ A;  4MHY A;  4MXU A;  1Z9U A;  5HVH A;  2PVV A;  5LRJ A;  1KZF A;  4CYN A;  3KQX A;  1SQH A;  3PFO A;  5D8N A;  3DLJ A;  4ZBG A;  4P10 A;  3R95 A;  1YME A;  4MHZ A;  4W9Y A;  3NH8 A;  5G20 A;  3VAT A;  1HEE A;  1YGH A;  2AE6 A;  3TT2 A;  1XOV A;  4NGN A;  2FL4 A;  2OU2 A;  1F2O A;  3FEC A;  3SJF A;  1S7L A;  3PFE A;  3B3S A;  2J9A A;  4OKO A;  2CF4 A;  1LAN A;  1BPN A;  4ZX9 A;  1Q7L A;  4O23 A;  5AG6 A;  2J8N A;  2EK9 A;  4U5Y A;  5IV0 A;  2V8H A;  3ZZI A;  3MGD A;  1EE3 P;  1I1D A;  5FVJ A;  5A27 A;  1IY7 A;  4ZY2 A;  4PV6 A;  5GCN A;  3SI2 A;  2RFH A;  1I12 A;  2KCW A;  2ZW4 A;  3BHX A;  4MFK A;  2PC1 A;  3B3C A;  4YU9 A;  4F9V A;  1L0C A;  5HVF A;  4BMH A;  3B8G A;  1M4G A;  4E8O A;  4A94 A;  5G1Z A;  5HH1 A;  1CJW A;  1NMT A;  2V77 A;  1YW6 A;  2CY2 A;  4P4F A;  3TE4 A;  2GLF A;  2RC4 A;  2XEF A;  4NJQ A;  4MFZ A;  1CBX A;  1LAP A;  4FD5 A;  4U9Z A;  3C26 A;  3H4Q A;  5F49 A;  4L8A A;  3V8I A;  2JDD A;  3GYA A;  4MI4 A;  1ELL P;  1F57 A;  3S6H A;  2R7H A;  1VKC A;  2FCK A;  4B5O A;  4CPA A;  4M6I A;  4P4D A;  2P6E A;  1YVK A;  2ABZ A;  4A39 A;  3EY5 A;  1RO5 A;  2DXQ A;  1KUV A;  2GE3 A;  3QAH A;  1Q2C A;  1YRE A;  4NGR A;  1S7K A;  4F8Z A;  1MJ9 A;  3HLP A;  1VGY A;  2ZEE A;  3JUW A;  4KOY A;  4OC1 A;  4K3N A;  3TOA A;  4AB7 A;  2VZY A;  3CT9 A;  4MHD A;  4X3R A;  1FT7 A;  4PK3 A;  2G9D A;  3KL9 A;  1S5K A;  5ISV A;  1TKJ A;  4QB9 A;  4UFV A;  4CYQ A;  4OID A;  5ELY A;  4XPL A;  3QAY A;  5IB9 A;  3I1U A;  2G3A A;  2Q0Y A;  3CZX A;  3IU2 A;  4PSW A;  4FBE A;  4MY3 A;  2QYV A;  3B3W A;  5C88 A;  4C2Y A;  1MJA A;  4Q7A A;  4IK2 A;  2C27 A;  2I00 A;  3EO4 A;  4RN7 A;  4DUK A;  2P6F A;  1F2P A;  4FD4 A;  2OZH A;  4L89 A;  4CS0 B;  2FSR A;  3D7D A;  2FXF A;  2FE7 A;  2VBQ A;  2VXK A;  4KOT A;  4NGM A;  1Q2D A;  2BOA A;  4K30 A;  4A31 A;  4YRH A;  3D7F A;  1ZG9 A;  4PPZ A;  2XEJ A;  4OC4 A;  2IJZ A;  4XPK A;  3DSB A;  3W91 A;  1XE4 A;  2Y0M A;  4M3S A;  3SI1 A;  5J1Q A;  1AUG A;  1I21 A;  2HQY A;  3E0K A;  3RNZ A;  2EBJ A;  1QST A;  3QNV A;  4OC5 A;  4AXV A;  4EVY A;  2Q51 A;  1M1D A;  4HNY B;  2PJ1 A;  3NH5 A;  3UY5 A;  4RS2 A;  1B6B A;  1LCP A;  2ZPA A;  3CXS A;  3FJU A;  4C2Z A;  1LRZ A;  2HV2 A;  1HDQ A;  1QSN A;  2PJ5 A;  4FD7 A;  4HKF A;  1QSR A;  3D7G A;  3G3S A;  3OWC A;  3R9E A;  2PRQ A;  2PE3 A;  2PJ8 A;  2K5T A;  3CPA A;  2WPX A;  3L2N A;  4KSF A;  2IMO A;  4PK2 A;  3NA6 A;  2JEV A;  3IIB A;  1Y7E A;  4RI1 A;  4CYO A;  5DS0 A;  3KAS A;  5DWN A;  1H8L A;  5BWA B;  2X7B A;  3WT4 A;  4R76 A;  2C6G A;  2GLJ A;  2ZEH A;  1MJB A;  4UBR A;  4UWJ A;  3SXO A;  2XEI A;  2NMT A;  2ARH A;  4DYO A;  4MHP A;  4QC6 A;  5K8N A;  3PP9 A;  3T8W A;  3B2Y A;  3D8P A;  3FRM A;  4DJL A;  1Z5R A;  2PR8 A;  1N71 A;  3K2K A;  1RTQ A;  4KVM E;  3DR8 A;  4MFQ A;  1IYL A;  1S60 A;  3FF3 A;  2CTB A;  1YR0 A;  1Z8T A;  2B4D B;  5D29 A;  3V7Z A;  3EFA A;  5I4M A;  2D4O A;  2EVN A;  3W6S A;  3BJ7 A;  2PQ8 A;  2B58 A;  2B4B A;  4R57 A;  4JZ0 A;  2EUI A;  4UCN A;  4OC0 A;  4CGO A;  4LQG A;  2V8G A;  1YX0 A;  2Z3P A;  4C2X A;  4CYP A;  1YLO A;  3TX8 A;  4H2K A;  1LOK A;  3NE8 A;  4OME A;  4P4I A;  3FBU A;  4OP4 A;  3BXM A;  1VHO A;  1Q2Y A;  4JYW A;  1KUX A;  4UCM A;  1LAM A;  4OAD A;  1TIQ A;  2CNS A;  5LYI A;  3DGV A;  3GLJ A;  3ISX A;  4MCP A;  1HDU A;  2AFO A;  2VQY A;  3JVN A;  4UFX A;  4IF5 A;  1YQE A;  4E2A A;  3PZJ A;  3PGP A;  4P6Y A;  4CAF A;  2BSW A;  3TOB A;  4EFD A;  5K8M A;  3MN8 A;  2ZOG A;  2PIZ A;  1XFO A;  4OC2 A;  2Z3O A;  4HNW B;  2Q4V A;  4M6H A;  3D4U A;  1Z8W A;  1IIC A;  1QQ9 A;  2GRE A;  3IEH A;  3S6K A;  2AJ6 A;  2ZW6 A;  1DTD A;  3MRU A;  4JJX A;  4A95 A;  3KI9 A;  1M4D A;  4KUA A;  3IWE A;  3A9L A;  4QVT A;  2AFW A;  1TF9 A;  1YVO A;  2PDO A;  2QJ8 A;  2DPT A;  2VL1 A;  2WZN A;  1A2Z A;  3CPX A;  3D7H A;  3PB9 X;  2O28 A;  1Z8L A;  4MJ8 A;  2C6C A;  3PBB A;  2FT0 A;  3B3T A;  2REE A;  1CP6 A;  4ZGY B;  4LQ6 A;  3ISZ A;  4PXE A;  2PVW A;  4UEF A;  3D66 A;  5LYL A;  4XNH B;  4UEZ A;  1KWM A;  2OZG A;  1BLL E;  1ZG8 A;  1NE9 A;  4KOW A;  2ANP A;  3SJG A;  2AFS A;  3SHP A;  1IOI A;  4XPD C;  4Z65 A;  2FIW A;  5G21 A;  4Q36 A;  4ZY0 A;  1PUA A;  2GAN A;  2D4P A;  2PJ6 A;  3CXQ A;  4R3K A;  2POK A;  3R9G A;  4ZYQ A;  5JH9 A;  1YSJ A;  2JBK A;  4UEE A;  2G0B A;  2P6G A;  5CPA A;  4YWY A;  5JPH A;  5LYF A;  4YGO A;  4EWT A;  1ZLI A;  2GU2 A;  5KTC A;  5AGE A;  2XEG A;  4JD6 A;  3SJX A;  3R1K A;  4OLL A;  1R57 A;  3KQZ A;  1BPM A;  3BJ8 A;  4X8I A;  1VHS A;  5AG5 A;  5LYD A;  3N5F A;  8CPA A;  4IHM A;  3B3V A;  4PXC A;  2PIY A;  4NGS A;  4KVX A;  2ZEF A;  3RBU A;  3S6F A;  4P4B A;  4Y49 B;  4NCZ A;  4ONW A;  5F48 A;  1B87 A;  4H6Z A;  4KOV A;  4A37 A;  4AG9 A;  5JQ4 A;  2ZW7 A;  2AFX A;  5AG7 A;  2O53 A;  3LMS A;  5H84 A;  4IUS A;  1QMU A;  1FY7 A;  3GIU A;  3VH9 A;  3KKW A;  5E96 A;  3IWG A;  4X5K A;  4UIB A;  4B5P B;  2Z10 A;  4R6T A;  1IID A;  3IO1 A;  4TNU A;  2CNM A;  4MRI A;  2WSA A;  2PR1 A;  2Q04 A;  4WJB A;  3H8E A;  1VIX A;  2JLM A;  3K9T A;  3FYN A;  3V38 A;  3FED A;  2Q7B A;  1XMB A;  1IYK A;  1KUY A;  1XIX A;  4C7I A;  4PXB A;  1BOB A;  4MCR A; 
#chains in the Genus database with same CATH homology
 4Q38 A;  5I0C A;  3BLN A;  3LD2 A;  2J8R A;  4GS4 A;  2BL1 A;  4B13 A;  2B4D A;  4KVO E;  4A30 A;  4CGP A;  3GY9 A;  3FNC A;  5H86 A;  5HMN A;  2YND A;  5G22 A;  2YGW A;  5EBV A;  3R9F A;  1QSO A;  3D2P A;  1S7N A;  3I9S A;  5A28 A;  1U6M A;  2ZW5 A;  4AVA A;  3EXN A;  2I79 A;  5IB0 A;  1GHE A;  3N7Z A;  1MK4 A;  3I3G A;  4YFJ A;  2FS5 A;  2YNC C;  3GKR A;  4MFP A;  3ZJ0 A;  4B10 A;  4DNC A;  4CGL A;  4KOX A;  3SXN A;  4BBH A;  1XEB A;  5J8C A;  4M85 A;  4CGN A;  2VI7 A;  1CM0 A;  2Q44 A;  4MBU A;  1V0C A;  4KLW A;  3D3S A;  3T90 A;  2QEC A;  4UCP A;  4R9M A;  2QIR A;  2B3U A;  4B11 A;  4ORF A;  2F5I A;  3K9U A;  2DPS A;  3H5Z A;  2A4N A;  1S3Z A;  2QML A;  3W6X A;  4MFJ A;  2YNE A;  3QB8 A;  3TO9 A;  3S6G A;  2IL4 A;  1Y7R A;  4OAE A;  5KTD A;  2YNC A;  4UWI A;  4U9Y A;  2BEI A;  4NF1 A;  4NSQ A;  5EC4 A;  4JXR A;  1OZP A;  1Y9K A;  1S7F A;  2B3V A;  4CRY B;  3DDD A;  5KTA A;  4F0Y A;  4AVB A;  4B5P A;  1Y9W A;  2P0W A;  4A33 A;  4H89 A;  2JDC A;  5C82 A;  4AG7 A;  1IB1 E;  2R1I A;  2R8V A;  2VEZ A;  4JLY A;  3CXP A;  2H5M A;  3F0A A;  3D2M A;  2J8M A;  1QSM A;  3P2H A;  4I49 A;  4KUB A;  2Z3N A;  1NSL A;  4CAE A;  2VZZ A;  3VWD A;  1BO4 A;  2ZXV A;  1WK4 A;  4B14 A;  4KLV A;  4MFL A;  3T9Y A;  4QUS A;  1K4J A;  2GIV A;  3IU1 A;  3EC4 A;  4JXQ A;  1M44 A;  3FIX A;  4E0A A;  5DWM A;  2Z3K A;  4UA3 A;  2G3T A;  4CAX A;  2FIA A;  3TFY A;  1M4I A;  2Z3M A;  3DR6 A;  3R96 A;  4F6A A;  4R3L A;  4F0X A;  4KOR A;  4C68 A;  2CXA A;  4J3G A;  3IGR A;  2OB0 A;  1XMT A;  1ON0 A;  2REF A;  5IX3 A;  4PSX A;  4CAV A;  3G8W A;  4UFW A;  3DNS A;  4LUA A;  4XNH C;  3NE7 A;  3P2F A;  1YLE A;  4NEX A;  2WPW A;  4B12 A;  2Z11 A;  4LX9 A;  1Z4E A;  1RXT A;  4JWP A;  4QBJ A;  1P4N A;  4CGM A;  4CAW A;  3FXT A;  3FB3 A;  3F8K A;  1XF8 A;  1ZO0 A;  1YK3 A;  4H6U A;  2BUE A;  4MY0 A;  2Z0Z A;  5CNP A;  2B5G A;  4KS9 A;  3LOD A;  1UFH A;  4KOU A;  4R87 A;  3RYO A;  3JTK A;  1WWZ A;  3TCV A;  5F46 A;  2Q4Y A;  4Y49 C;  2R98 A;  3F5B A;  4KSA A;  3VWE A;  4C7H A;  2PSW A;  4II9 A;  3WR7 A;  4A32 A;  4ONU A;  2WUU A;  5J8F A;  2ATR A;  4A2Z A;  4FD6 A;  4HNX B;  4AVC A;  2CNT A;  1P0H A;  4KZT A;  3TO7 A;  2OZU A;  4KOS A;  4CRZ B;  5AG4 A;  1PU9 A;  4XPD B;  5F47 A;  2B5G B;  1J4J A;  3TTH A;  2OH1 A;  2PRB A;  3TO6 A;  2HUZ A;  1Z4R A;  4NXY A;  2Z3L A;  1Z9U A;  1KZF A;  4CYN A;  1SQH A;  4ZBG A;  3R95 A;  5G20 A;  1YGH A;  2AE6 A;  3TT2 A;  2FL4 A;  2OU2 A;  1S7L A;  5AG6 A;  2J8N A;  4U5Y A;  5IV0 A;  3ZZI A;  3MGD A;  1I1D A;  5FVJ A;  5A27 A;  4PV6 A;  5GCN A;  1I12 A;  2KCW A;  2ZW4 A;  4MFK A;  2PC1 A;  1L0C A;  4BMH A;  3B8G A;  1M4G A;  4E8O A;  5G1Z A;  5HH1 A;  1CJW A;  1NMT A;  2CY2 A;  3TE4 A;  2RC4 A;  5F48 A;  5F49 A;  4MFZ A;  4U9Z A;  4FD5 A;  3C26 A;  3H4Q A;  4L8A A;  3V8I A;  2JDD A;  3GYA A;  4MI4 A;  3S6H A;  2R7H A;  1VKC A;  2FCK A;  4B5O A;  2P6E A;  1YVK A;  3EY5 A;  1RO5 A;  2DXQ A;  1KUV A;  2GE3 A;  3QAH A;  1Q2C A;  1YRE A;  1S7K A;  1MJ9 A;  3JUW A;  4KOY A;  3TOA A;  4AB7 A;  2VZY A;  4MHD A;  4PK3 A;  5ISV A;  1S5K A;  4CYQ A;  4QB9 A;  4UFV A;  4XPL A;  2G3A A;  2Q0Y A;  4PSW A;  3IU2 A;  4MY3 A;  5C88 A;  4C2Y A;  1MJA A;  2C27 A;  2I00 A;  3EO4 A;  2P6F A;  4FD4 A;  2OZH A;  4L89 A;  4CS0 B;  2FSR A;  2FXF A;  2FE7 A;  2VBQ A;  2VXK A;  4KOT A;  1Q2D A;  4K30 A;  4A31 A;  4YRH A;  4XPK A;  3DSB A;  3W91 A;  1XE4 A;  2Y0M A;  4M3S A;  1I21 A;  2HQY A;  3E0K A;  1QST A;  4EVY A;  1M1D A;  4HNY B;  3UY5 A;  4RS2 A;  1B6B A;  2ZPA A;  3CXS A;  4C2Z A;  1LRZ A;  2HV2 A;  1QSN A;  4FD7 A;  4HKF A;  1QSR A;  3G3S A;  3OWC A;  3R9E A;  4KSF A;  2K5T A;  2WPX A;  4PK2 A;  2JEV A;  4RI1 A;  4CYO A;  5DWN A;  5BWA B;  2X7B A;  1MJB A;  4UBR A;  4UWJ A;  3SXO A;  2NMT A;  2ARH A;  4QC6 A;  3PP9 A;  3D8P A;  3FRM A;  2PR8 A;  1N71 A;  4KVM E;  3DR8 A;  4MFQ A;  1IYL A;  1S60 A;  1YR0 A;  2B4D B;  3EFA A;  2D4O A;  2EVN A;  3W6S A;  3BJ7 A;  2PQ8 A;  2B58 A;  2B4B A;  4R57 A;  2EUI A;  4UCN A;  4CGO A;  1YX0 A;  2Z3P A;  4C2X A;  4CYP A;  3FBU A;  1Q2Y A;  1KUX A;  4UCM A;  4OAD A;  1TIQ A;  2CNS A;  4UFX A;  2VQY A;  4E2A A;  3JVN A;  4IF5 A;  3PZJ A;  3PGP A;  4CAF A;  2BSW A;  3TOB A;  2Z3O A;  4HNW B;  2Q4V A;  1IIC A;  3S6K A;  2AJ6 A;  2ZW6 A;  4JJX A;  4A95 A;  1M4D A;  4KUA A;  3IWE A;  3A9L A;  4QVT A;  1YVO A;  2PDO A;  2DPT A;  2O28 A;  4MJ8 A;  2FT0 A;  2REE A;  4ZGY B;  4XNH B;  2OZG A;  1NE9 A;  4KOW A;  3SHP A;  4XPD C;  2FIW A;  5G21 A;  4Q36 A;  1PUA A;  2GAN A;  2D4P A;  4R3K A;  3CXQ A;  3R9G A;  2G0B A;  2P6G A;  5JPH A;  4YGO A;  5KTC A;  5AGE A;  4JD6 A;  3R1K A;  4OLL A;  1R57 A;  3BJ8 A;  5AG5 A;  1VHS A;  4KVX A;  3S6F A;  4Y49 B;  4NCZ A;  1B87 A;  4H6Z A;  4KOV A;  5JQ4 A;  4AG9 A;  2ZW7 A;  5AG7 A;  5H84 A;  4IUS A;  1FY7 A;  3KKW A;  5E96 A;  3IWG A;  4X5K A;  4B5P B;  2Z10 A;  1IID A;  2CNM A;  2WSA A;  2PR1 A;  2Q04 A;  2JLM A;  3FYN A;  2Q7B A;  4C7I A;  1IYK A;  1KUY A;  1XIX A;  1BOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...