1YR0A

Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
SVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
molecule keywords phosphinothricin acetyltransferase
total genus 44
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yr0A00
4IUSA 4QB9A 4ORFA 1FY7A 5DWNA 2PC1A 3TCVA 4H89A 2JLMA 2FL4A 1Y9KA 4CRYB 1I1DA 4NCZA 3TOBA 2ZW7A 4KOYA 4HNXB 2G3TA 4RI1A 1VHSA 3S6GA 1IYLA 1M4GA 3D2PA 2GANA 1KUVA 3DSBA 1YVOA 1P0HA 2FIWA 4JLYA 1M44A 4CAWA 4E2AA 2G3AA 2JDDA 3GYAA 1MJBA 2HV2A 4KLWA 4QBJA 4JXQA 2P6FA 3PGPA 2I79A 3S6KA 2B4DA 4XPKA 1Z4RA 2CNTA 3RYOA 3VWDA 1Z4EA 3LD2A 2PSWA 3TO6A 2ZW5A 1XEBA 3IGRA 1P4NA 3TO7A 2K5TA 4LX9A 2D4OA 3CXQA 1GHEA 4FD6A 2ZW6A 5KTCA 3FNCA 3R9FA 4XPDB 3T9YA 2A4NA 4E0AA 1VKCA 3N7ZA 2ZW4A 2B3VA 4KOWA 3ZZIA 4MHDA 2I00A 3F8KA 1IIDA 4AG7A 2ZXVA 1SQHA 3FBUA 1WK4A 4JJXA 4Y49C 4CS0B 3BLNA 2HQYA 2PR1A 1RXTA 4AVBA 3VWEA 5IB0A 3PP9A 2GIVA 3BJ7A 3CXSA 4KOSA 3TFYA 4YFJA 4NF1A 4PK2A 3EFAA 4XNHB 4KUAA 4QC6A 2FSRA 1YLEA 3NE7A 3QAHA 3SXNA 3V8IA 5KTDA 1KZFA 3H4QA 3OWCA 4KOTA 2JEVA 2FE7A 3BJ8A 1LRZA 2Q4VA 2PR8A 3D3SA 2FCKA 3S6HA 4MJ8A 1M4IA 1YX0A 3K9UA 2WPWA 5EC4A 1MJ9A 4L89A 1MJAA 2CNSA 4H6ZA 4HKFA 2EUIA 4KUBA 5JPHA 4PSXA 3F0AA 3MGDA 1OZPA 1QSNA 2VXKA 1R57A 2J8RA 4R9MA 2OB0A 2FXFA 3QB8A 2GE3A 4KOUA 3FIXA 3S6FA 1U6MA 5IX3A 4CAXA 2CY2A 3PZJA 4R87A 2JDCA 2Q7BA 4EVYA 2R1IA 3EC4A 2B4DB 1CM0A 2B3UA 2H5MA 3TE4A 1YR0A 1QSTA 2FT0A 1S7NA 5C82A 5F47A 1L0CA 5CNPA 3F5BA 1ON0A 2R7HA 4R3KA 4OAEA 4KZTA 4HNWB 3TOAA 3W91A 2OZUA 3P2FA 2BSWA 1Z9UA 4KVXA 4M3SA 1IICA 1CJWA 3E0KA 4R57A 2Q4YA 4LUAA 4MY0A 4Y49B 2KCWA 2FS5A 4R3LA 4I49A 5DWMA 1NSLA 4UWIA 2VI7A 4ZBGA 1TIQA 3W6SA 1M4DA 4XPDC 3R9EA 1KUXA 4AG9A 3LODA 2ZPAA 3KKWA 4II9A 2BUEA 1XMTA 2DXQA 4UBRA 1YREA 2REFA 5J8CA 1S7KA 3GKRA 1QSRA 2BL1A 4AB7A 3FB3A 4XPLA 3I9SA 1S7LA 4PK3A 2AJ6A 3DDDA 5HH1A 4F0YA 2OZGA 2Q0YA 5ISVA 1Q2YA 4F6AA 1S7FA 2PRBA 1Y9WA 1PU9A 2IL4A 1IYKA 4J3GA 2FIAA 5H86A 1YVKA 3WR7A 4AVAA 2QMLA 2Q44A 3T90A 2OU2A 2P6EA 4QUSA 4UA3A 4CAVA 5F46A 1Q2CA 2BEIA 2B5GB 4X5KA 1BO4A 2G0BA 4KOXA 4U9YA 2HUZA 2NMTA 2B4BA 2O28A 1WWZA 2Z10A 3FYNA 4H6UA 4MBUA 5IV0A 3FXTA 1Y7RA 2EVNA 2VZYA 4OADA 3ZJ0A 4B5OA 3C26A 2Z11A 2VQYA 2Y0MA 3DR6A 4JXRA 1YK3A 4RS2A 3CXPA 2PDOA 3D8PA 3P2HA 4PV6A 2VZZA 4NSQA 5I0CA 4FD7A 3D2MA 5EBVA 3R96A 4B5PA 1B87A 1NMTA 2AE6A 2R98A 1KUYA 1XIXA 3JUWA 3TO9A 1YGHA 4MY3A 2B5GA 2VBQA 1V0CA 1UFHA 1I21A 4L8AA 4BMHA 4FD5A 3R95A 2D4PA 4KVOE 3R1KA 5J8FA 5KTAA 4M85A 5HMNA 2F5IA 3DR8A 2REEA 2QECA 4MI4A 4JWPA 4KOVA 5H84A 2J8MA 2Q04A 1S5KA 2RC4A 3B8GA 4K30A 2J8NA 4QVTA 3EY5A 1IB1E 5GCNA 3R9GA 2OH1A 4XNHC 2X7BA 1RO5A 1XF8A 5FVJA 5E96A 3JVNA 3W6XA 3IWGA 4JD6A 4OLLA 1J4JA 3I3GA 1S3ZA 1I12A 2P0WA 4GS4A 1K4JA 1QSMA 2R8VA 2ARHA 1QSOA 1Q2DA 1M1DA 2Z0ZA 2CNMA 2P6GA 4ONUA 3G8WA 2QIRA 4YRHA 5F48A 3SHPA 1S60A 4YGOA 4IF5A 2OZHA 3FRMA 1PUAA 1BOBA 4NEXA 3TTHA 1XE4A 5F49A 4NXYA 4KORA 4KVME 3GY9A 2B58A 3SXOA 1NE9A 3EO4A 3UY5A 3TT2A 4E8OA 4U9ZA 2WPXA 4HNYB 2ATRA 5JQ4A 1B6BA 4U5YA 5C88A 4FD4A 1N71A 2PQ8A 3DNSA 4DNCA 2VEZA 4CRZB 2C27A 3G3SA 4PSWA 3EXNA 4KLVA 4B5PB 4AVCA 4UWJA 1MK4A
chains in the Genus database with same CATH superfamily
4ZGYB 2ZEPA 1DTDA 1BPNA 1YMEA 4IUSA 4QB9A 4ORFA 5A28A 2ZOFA 2GREA 1FY7A 5DWNA 4X8IA 4MCSA 3VARA 5I4MA 2QYVA 5J1QA 3HUVA 2PC1A 3TCVA 4H89A 2HB6A 2JLMA 3DLJA 4CPAA 4W9YA 4CYQA 4DNCA 2FL4A 1Y9KA 4DJLA 4CRYB 1ZLIA 1HEEA 1I1DA 3I1UA 4NCZA 3D7FA 4MMOA 3TOBA 2ZW7A 3FJUA 2AFSA 4KOYA 4NGNA 4PXEA 4DUKA 5G1ZA 2XEGA 4HNXB 3TX8A 4EMEA 2G3TA 5THWA 4RI1A 1VHSA 4TWEA 3S6GA 1IYLA 1M4GA 2PCUA 3D2PA 3RZAA 2GANA 1KUVA 4OP4A 4CYNA 1TKJA 1CX8A 3DSBA 1YVOA 2PVWA 3CT9A 1LAPA 2VL1A 4MFJA 1P0HA 2FIWA 4JLYA 1M44A 4CAWA 4E2AA 1AMPA 2G3AA 4B13A 3RNZA 2JDDA 4ZX9A 2PJ3A 2Z3MA 3GYAA 2WZNA 2Q43A 1MJBA 3KQXA 1Z5RA 4K3NA 2HV2A 4KLWA 4QBJA 1XRYA 4JXQA 3H8FA 2P6FA 3B3VA 1CPXA 3FF3A 3PGPA 3TC8A 2I79A 3B3TA 4MXUA 4UCMA 3B35A 2ZEHA 3S6KA 4PXCA 2B4DA 4XPKA 1Z4RA 2PJ4A 2CNTA 3RYOA 3VWDA 1RTQA 1LFWA 1Z4EA 2PSWA 3LD2A 3TO6A 2ZW5A 2PJ9A 4A2ZA 2DPSA 1XEBA 3IGRA 1P4NA 3JTKA 2PJ7A 1IOFA 1YW4A 4UFVA 3TO7A 2XEJA 5ELYA 4GXHA 2K5TA 4A31A 3LACA 4LX9A 4NGTA 2D4OA 1TF8A 3FECA 4AXVA 2F7VA 2GLJA 4CGOA 2ZEDA 3CXQA 1GHEA 3BI1A 2PJ5A 4FD6A 2ZW6A 5KTCA 4A37A 5IB9A 3FNCA 4C7IA 3R9FA 1Z8TA 5G20A 4GM5A 4XPDB 3T9YA 2A4NA 2YNEA 4E0AA 1VKCA 4R76A 3N7ZA 2ZW4A 2B3VA 1M4LA 3CPXA 3GB0A 4KOWA 4MHDA 3ZZIA 3KQZA 2I00A 3F8KA 3PBBA 1ARMA 1IIDA 4MFLA 4AG7A 2ZXVA 4C2YA 1SQHA 2V8DA 3FBUA 1WK4A 4JJXA 1A2ZA 3PFEA 3KGQA 4Y49C 4CS0B 3BLNA 4MRIA 2PR1A 1HDUA 2EBJA 1RXTA 2HQYA 1HDQA 2NYQA 4UCNA 3VWEA 4AVBA 4B11A 4CGLA 1BPMA 5IB0A 5AG7A 3KR5A 4X2TA 3PP9A 4ZY1A 3H8EA 1CP6A 3IC1A 4UCPA 2GIVA 3BJ7A 3FMCA 2V8VA 3CXSA 4KOSA 3TFYA 4CGPA 3KASA 2C6CA 3L2NA 4NF1A 4YFJA 4F8ZA 4PK2A 3RO0A 3EFAA 4O23A 4TNUA 1R43A 4BD9A 4XNHB 4KUAA 5LYDA 2EWBA 4QC6A 4UEZA 2Q7SA 2FSRA 1QQ9A 2YNCC 1YLEA 4LQ6A 1XMBA 2ZEEA 3NFZA 4YWYA 4NGQA 3NE7A 3QAHA 3SXNA 3V8IA 3SJFA 5JM6A 2OR4A 5KTDA 3B2YA 1F2PA 4WWVA 4IAVA 1KZFA 3H4QA 1Q7LA 3IO1A 3DGVA 3OWCA 4KOTA 4MHZA 4NJRA 2JEVA 1LOKA 3IFEA 4UIBA 2FE7A 1VHEA 3BJ8A 4MCRA 1UWYA 1LRZA 4CAEA 2EK9A 2F8HA 2Q4VA 2PR8A 3D3SA 2FCKA 1FNOA 1H8LA 4ZY0A 5HXDA 3S6HA 4MJ8A 1F57A 1M4IA 1YX0A 3K9UA 2WPWA 5EC4A 1MJ9A 4UEEA 4L89A 4Q38A 3QNVA 1MJAA 2CNSA 3BHXA 4P6YA 1IU8A 4H6ZA 3B7IA 4HKFA 1ZG8A 2EUIA 3B3WA 1Y7EA 4JZ0A 4KUBA 1ELLP 5JPHA 4PSXA 3F0AA 2ZEMA 3MGDA 4OIWA 4F0XA 1OZPA 1QSNA 2PRQA 2CF4A 1R57A 2J8RA 2VXKA 4R9MA 2OB0A 3CPAA 2DEAA 4C2XA 2FXFA 4PPZA 3QB8A 1FT7A 4B10A 3V38A 2GE3A 4P4EA 4KOUA 3D7GA 1Z2LA 3FIXA 1U6MA 3H8GA 3S6FA 4PXBA 5IX3A 4CAXA 2CY2A 4EFDA 1BAVA 4OKOA 3PZJA 1PCAA 4R87A 2JDCA 3IIBA 4FWUA 4IHMA 2EO8A 1F2OA 2ZEGA 3IEHA 4FBEA 2Q7BA 4EVYA 3QAYA 1ZLHA 4WJBA 1AYEA 2R1IA 3EC4A 2B4DB 4P4JA 3A9LA 4A94A 1CM0A 3S9NA 2B3UA 5CBMA 2H5MA 3GLJA 2CXAA 3PEIA 2CTCA 3TE4A 1YR0A 1QSTA 4MHPA 4ZY2A 4MCPA 2FT0A 2ZEFA 1IGBA 1S7NA 4IK2A 5C82A 5F47A 4NGSA 4C2ZA 4UFWA 1L0CA 4FUUA 3RAMA 5CNPA 4R6TA 1Y0YA 1ON0A 3F5BA 2R7HA 1LANA 4Q7AA 2OOTA 4KS9A 1TKHA 4OMEA 3LWUA 1AUGA 2CTBA 4OAEA 4R3KA 2IMOA 4NGPA 4KZTA 3ISZA 4HNWB 4P10A 3TOAA 3W91A 1VHOA 3D4UA 2C6GA 4M6HA 4BBHA 4MFPA 2OZUA 4LQGA 3P2FA 4UFXA 1ARLA 3MN8A 2BSWA 2PJ0A 1Z9UA 4KVXA 4M3SA 4UIAA 5JGFA 5D8NA 4A30A 1IICA 4A38A 1CJWA 2BO9A 3VH9A 3E0KA 2PIZA 5AG4A 4R57A 4EWTA 2Q4YA 1ZG9A 3CDXA 4LUAA 1R3NA 4PQAA 2GFQA 2YNDA 4MY0A 4OC3A 2KCWA 4Y49B 2FS5A 2PE3A 4R3LA 4I49A 5DWMA 1OBRA 3PB8X 1NSLA 4KSAA 4UWIA 2VI7A 4ZBGA 2QJ8A 1TIQA 2ODFA 3PB7X 3FX6A 3W6SA 1IOIA 1M4DA 4XPDC 3NH4A 4MFZA 3PB9X 3RBUA 2DF5A 2GU2A 3S9LA 3R9EA 4M6GA 3PBEA 2ZOGA 3KHZA 4KSFA 1KUXA 4AG9A 3LODA 3N5FA 2POKA 2ZPAA 4NGMA 3IWEA 3BI0A 2O4HA 3KKWA 4II9A 2PJBA 2Z3OA 2BUEA 4UEFA 1XMTA 2DXQA 4UBRA 4G1PA 4HPSA 1YREA 2REFA 4BINA 5J8CA 2O53A 2RB7A 3MRUA 2AFMA 1S7KA 3GIUA 2PJAA 4B12A 4X3RA 5A27A 3GKRA 1QSRA 2BL1A 5LRGA 3WC7A 3ISXA 3PB6X 4A39A 3FB3A 4XPLA 4A95A 4AB7A 2V77A 3I9SA 1S7LA 4PK3A 4NGRA 2AJ6A 2BCOA 1QMUA 5JH9A 3DDDA 1Y0RA 5HH1A 4F0YA 4F9UA 4OC5A 2OZGA 2Q0YA 5ISVA 1Q2YA 4F6AA 2Z3NA 4YU9A 1S7FA 2PRBA 1Y9WA 1PU9A 2IL4A 1IYKA 4J3GA 2FIAA 2PJ8A 1YVKA 3NE8A 4P4BA 5H86A 4UF4A 3WR7A 2QMLA 4AVAA 2Q44A 3T90A 5AG6A 2OU2A 1ZG7A 2P6EA 3LMSA 3SI2A 2PJCA 4M6IA 4QUSA 4UA3A 2AFOA 3T8WA 4CAVA 5F46A 3SJEA 1Q2CA 2BEIA 2B5GB 4X5KA 1ELMP 4B14A 1BO4A 2G0BA 4KOXA 2ABZA 4U9YA 4Z65A 5K8PA 2HUZA 5AGEA 2NMTA 1XBUA 2JBJA 2B4BA 2O28A 1WWZA 2Z10A 2WSAA 8CPAA 3FYNA 4H6UA 1EE3P 1TF9A 3IU2A 4MBUA 3BXMA 5IV0A 3FXTA 5BWAB 1Y7RA 2EVNA 2GLFA 2VZYA 4OADA 1Z8LA 3H5ZA 3ZJ0A 2PJ2A 4B5OA 4Q36A 3C26A 3VATA 2DPTA 2Z11A 2VQYA 2Y0MA 3DR6A 1TKFA 4JXRA 5LYFA 1YK3A 1BLLE 1DE4C 4RS2A 2AFWA 1CPSA 3CXPA 2PDOA 3D8PA 3P2HA 1Z8XA 4PV6A 5LYLA 5CPAA 2VZZA 4NSQA 6CPAA 5I0CA 1XOVA 3D2MA 4FD7A 5EBVA 3SI0A 3R96A 4ONWA 4B5PA 2V8HA 5EMIA 4P45A 1CG2A 4NJQA 4A32A 5F09A 1B87A 1NMTA 3K2KA 4R8FA 2AE6A 2R98A 1KUYA 1XIXA 3JUWA 3TO9A 4CGNA 1YGHA 5K8OA 1Z8WA 4MY3A 1X10A 2B5GA 2BOAA 3CZXA 2VBQA 1V0CA 2QVPA 1UFHA 1I21A 5AG5A 5LRJA 1CP7A 4KSIA 3IWWA 4JYWA 2V8GA 4P44A 4L8AA 2YNCA 4FD5A 4BMHA 2AFZA 4P4FA 4MHNA 3R95A 3NH8A 2D4PA 4KVOE 3R1KA 3V7ZA 5J8FA 5KTAA 2XEIA 4M85A 4A33A 5HMNA 2F5IA 3DR8A 7CPAA 2REEA 5D29A 2WUUA 3FEEA 2QECA 2Z3LA 4ZX8A 3SJXA 3WC6A 2XEFA 4MI4A 4JWPA 5HVHA 1LCPA 3KHXA 2AFUA 2IJZA 2Z3PA 4KOVA 1ZO0A 3D67A 5H84A 2J8MA 2Q04A 1S5KA 2RC4A 3B8GA 4K30A 2J8NA 4QVTA 2IQ6A 3EY5A 3B3CA 4B6ZA 1XJOA 1JQGA 5K8NA 2ANPA 1YQEA 1IB1E 5GCNA 3R9GA 3D7DA 4P4DA 2NSMA 2OH1A 4MHYA 4PXDA 4ZYQA 1IY7A 4XNHC 2X7BA 1KWMA 5G21A 1X12A 1RO5A 1TXRA 1XF8A 2PJ1A 2HC9A 5FVJA 4F9VA 3HLPA 3IJ3A 3D7HA 3WC5A 4MCQA 5E96A 3JVNA 4C7HA 2C1CA 3W6XA 3IWGA 5K8MA 4NFRA 1JWQA 4JD6A 1J4JA 4OLLA 4OC4A 3D68A 3I3GA 1YLOA 4P4IA 1S3ZA 3KR4A 1I12A 1CBXA 2P0WA 4CYPA 2ZEOA 4RUHA 2C6PA 1K4JA 1QSMA 4GS4A 1VGYA 2J9AA 2R8VA 2ARHA 1QSOA 1Q2DA 2PIYA 5HVFA 1M1DA 2Z0ZA 3KL9A 1PYTB 2CNMA 2P6GA 1YW6A 3G8WA 2QIRA 4ONUA 4YRHA 5F48A 3SHPA 4H2KA 1S60A 4YGOA 2PVVA 4IF5A 4CGMA 3KI9A 2AFXA 2OZHA 2CIJA 5G22A 3D66A 3FRMA 4DYOA 1PUAA 4C68A 1BOBA 4NEXA 3TTHA 2Q4ZA 4CAFA 1XE4A 5F49A 3WABA 4NXYA 2EK8A 4KORA 4OC2A 4OC1A 4MFQA 4KVME 3GY9A 2B58A 3JRUA 4R7MA 5HVGA 4RN7A 4MFKA 5LRKA 1YSJA 2ZELA 3SXOA 2WYRA 2Q51A 4OIDA 3SJGA 1NE9A 3WT4A 3FH4A 2ZENA 3EO4A 3UY5A 3SI1A 3TT2A 4E8OA 4U9ZA 2WPXA 2FVGA 2RFHA 2ATRA 3B3SA 4HNYB 3IU1A 4FAIA 5JQ4A 3PFOA 5LYIA 2JBKA 1B6BA 3K9TA 3KZWA 4U5YA 2I3CA 5C88A 4FD4A 1LAMA 1N71A 1GYTA 2PQ8A 3DNSA 2Z3KA 3PB4X 3PRTA 2PJ6A 1VIXA 2VEZA 3NH5A 3FVLA 4CRZB 4OC0A 3NA6A 2C27A 3G3SA 4PSWA 3EXNA 1NSAA 5DS0A 4KLVA 3S9MA 2G9DA 4B5PB 3GUXA 1XFOA 2YGWA 4CYOA 4ZI6A 3FEDA 4AVCA 4UWJA 2JEWA 1MK4A
chains in the Genus database with same CATH topology
4ZGYB 4IUSA 4QB9A 4ORFA 5A28A 1FY7A 5DWNA 2PC1A 3TCVA 4H89A 2JLMA 4CYQA 2FL4A 1Y9KA 4CRYB 1I1DA 4NCZA 3TOBA 2ZW7A 4KOYA 5G1ZA 4HNXB 2G3TA 4RI1A 1VHSA 3S6GA 1IYLA 1M4GA 3D2PA 2GANA 1KUVA 4CYNA 3DSBA 1YVOA 4MFJA 1P0HA 2FIWA 4JLYA 1M44A 4CAWA 4E2AA 2G3AA 4B13A 2JDDA 2Z3MA 3GYAA 1MJBA 2HV2A 4KLWA 4QBJA 4JXQA 2P6FA 3PGPA 2I79A 4UCMA 3S6KA 2B4DA 4XPKA 1Z4RA 2CNTA 3RYOA 3VWDA 1Z4EA 3LD2A 2PSWA 3TO6A 2ZW5A 4A2ZA 2DPSA 3IGRA 1XEBA 1P4NA 3JTKA 4UFVA 3TO7A 2K5TA 4A31A 4LX9A 2D4OA 4CGOA 3CXQA 1GHEA 4FD6A 2ZW6A 5KTCA 3FNCA 4C7IA 3R9FA 5G20A 4XPDB 3T9YA 2A4NA 2YNEA 4E0AA 1VKCA 3N7ZA 2ZW4A 2B3VA 4KOWA 3ZZIA 4MHDA 2I00A 3F8KA 1IIDA 4MFLA 4AG7A 2ZXVA 4C2YA 1SQHA 3FBUA 1WK4A 4JJXA 4Y49C 4CS0B 3BLNA 2HQYA 2PR1A 1RXTA 4B11A 4AVBA 4CGLA 4UCNA 3VWEA 5IB0A 5AG7A 3PP9A 4UCPA 2GIVA 3BJ7A 3CXSA 4KOSA 3TFYA 4CGPA 4YFJA 4NF1A 4PK2A 3EFAA 4XNHB 4KUAA 4QC6A 2FSRA 2YNCC 1YLEA 3NE7A 3QAHA 3SXNA 3V8IA 5KTDA 1KZFA 3H4QA 3OWCA 4KOTA 2JEVA 2FE7A 3BJ8A 1LRZA 4CAEA 2Q4VA 2PR8A 3D3SA 2FCKA 3S6HA 4MJ8A 1M4IA 1YX0A 3K9UA 2WPWA 5EC4A 1MJ9A 4L89A 4Q38A 1MJAA 2CNSA 4H6ZA 4HKFA 2EUIA 4KUBA 5JPHA 4PSXA 3F0AA 3MGDA 4F0XA 1OZPA 1QSNA 2VXKA 1R57A 2J8RA 4R9MA 2OB0A 4C2XA 2FXFA 3QB8A 4B10A 2GE3A 4KOUA 3FIXA 3S6FA 1U6MA 5IX3A 4CAXA 2CY2A 3PZJA 4R87A 2JDCA 2Q7BA 4EVYA 2R1IA 3EC4A 2B4DB 3A9LA 1CM0A 2B3UA 2H5MA 2CXAA 3TE4A 1YR0A 1QSTA 2FT0A 1S7NA 5C82A 5F47A 4C2ZA 4UFWA 1L0CA 5CNPA 3F5BA 1ON0A 2R7HA 4KS9A 4R3KA 4OAEA 4KZTA 4HNWB 3TOAA 3W91A 4BBHA 4MFPA 2OZUA 4UFXA 3P2FA 2BSWA 1Z9UA 4KVXA 4M3SA 4A30A 1IICA 1CJWA 3E0KA 5AG4A 4R57A 2Q4YA 4LUAA 2YNDA 4MY0A 4Y49B 2KCWA 2FS5A 4R3LA 4I49A 5DWMA 1NSLA 4KSAA 4UWIA 2VI7A 4ZBGA 1TIQA 3W6SA 1M4DA 4XPDC 4MFZA 3R9EA 4KSFA 1KUXA 4AG9A 3LODA 2ZPAA 3IWEA 3KKWA 4II9A 2Z3OA 2BUEA 1XMTA 2DXQA 4UBRA 1YREA 2REFA 5J8CA 1S7KA 4B12A 5A27A 3GKRA 1QSRA 2BL1A 4A95A 3FB3A 4XPLA 4AB7A 3I9SA 1S7LA 4PK3A 2AJ6A 3DDDA 5HH1A 4F0YA 2OZGA 2Q0YA 5ISVA 1Q2YA 4F6AA 2Z3NA 1S7FA 2PRBA 1Y9WA 1PU9A 2IL4A 1IYKA 4J3GA 2FIAA 5H86A 1YVKA 3WR7A 4AVAA 2QMLA 2Q44A 3T90A 5AG6A 2OU2A 2P6EA 4QUSA 4UA3A 4CAVA 5F46A 1Q2CA 2BEIA 2B5GB 4X5KA 4B14A 1BO4A 2G0BA 4KOXA 4U9YA 2HUZA 5AGEA 2NMTA 2B4BA 2O28A 1WWZA 2Z10A 2WSAA 4H6UA 3FYNA 3IU2A 4MBUA 5IV0A 3FXTA 5BWAB 1Y7RA 2EVNA 2VZYA 4OADA 3ZJ0A 3H5ZA 4B5OA 4Q36A 3C26A 2DPTA 2Z11A 2VQYA 2Y0MA 3DR6A 4JXRA 1YK3A 4RS2A 3CXPA 2PDOA 3D8PA 3P2HA 4PV6A 2VZZA 4NSQA 5I0CA 4FD7A 3D2MA 5EBVA 3R96A 4B5PA 4A32A 1B87A 1NMTA 2AE6A 2R98A 1KUYA 1XIXA 3JUWA 3TO9A 4CGNA 1YGHA 4MY3A 2B5GA 2VBQA 1V0CA 1UFHA 1I21A 5AG5A 4L8AA 2YNCA 4FD5A 4BMHA 3R95A 2D4PA 4KVOE 3R1KA 5J8FA 5KTAA 4M85A 4A33A 5HMNA 2F5IA 3DR8A 2REEA 2WUUA 2QECA 2Z3LA 4MI4A 4JWPA 2Z3PA 4KOVA 1ZO0A 5H84A 2J8MA 2Q04A 1S5KA 2RC4A 3B8GA 4K30A 2J8NA 4QVTA 3EY5A 1IB1E 5GCNA 3R9GA 2OH1A 4XNHC 2X7BA 5G21A 1RO5A 1XF8A 5FVJA 5E96A 3JVNA 4C7HA 3W6XA 3IWGA 4JD6A 4OLLA 1J4JA 3I3GA 1S3ZA 1I12A 2P0WA 4CYPA 4GS4A 1K4JA 1QSMA 2R8VA 2ARHA 1QSOA 1Q2DA 1M1DA 2Z0ZA 2CNMA 2P6GA 3G8WA 4ONUA 2QIRA 4YRHA 5F48A 3SHPA 1S60A 4YGOA 4CGMA 4IF5A 2OZHA 5G22A 3FRMA 1PUAA 4C68A 1BOBA 4NEXA 3TTHA 4CAFA 1XE4A 5F49A 4NXYA 4KORA 4MFQA 4KVME 3GY9A 2B58A 4MFKA 3SXOA 1NE9A 3EO4A 3UY5A 3TT2A 4E8OA 4U9ZA 2WPXA 4HNYB 2ATRA 3IU1A 5JQ4A 1B6BA 4U5YA 5C88A 4FD4A 1N71A 2PQ8A 3DNSA 4DNCA 2Z3KA 2VEZA 4CRZB 2C27A 3G3SA 4PSWA 3EXNA 4KLVA 4B5PB 2YGWA 4CYOA 4AVCA 4UWJA 1MK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUS A;  4QB9 A;  4ORF A;  1FY7 A;  5DWN A;  2PC1 A;  3TCV A;  4H89 A;  2JLM A;  2FL4 A;  1Y9K A;  4CRY B;  1I1D A;  4NCZ A;  3TOB A;  2ZW7 A;  4KOY A;  4HNX B;  2G3T A;  4RI1 A;  1VHS A;  3S6G A;  1IYL A;  1M4G A;  3D2P A;  2GAN A;  1KUV A;  3DSB A;  1YVO A;  1P0H A;  2FIW A;  4JLY A;  1M44 A;  4CAW A;  4E2A A;  2G3A A;  2JDD A;  3GYA A;  1MJB A;  2HV2 A;  4KLW A;  4QBJ A;  4JXQ A;  2P6F A;  3PGP A;  2I79 A;  3S6K A;  2B4D A;  4XPK A;  1Z4R A;  2CNT A;  3RYO A;  3VWD A;  1Z4E A;  3LD2 A;  2PSW A;  3TO6 A;  2ZW5 A;  1XEB A;  3IGR A;  1P4N A;  3TO7 A;  2K5T A;  4LX9 A;  2D4O A;  3CXQ A;  1GHE A;  4FD6 A;  2ZW6 A;  5KTC A;  3FNC A;  3R9F A;  4XPD B;  3T9Y A;  2A4N A;  4E0A A;  1VKC A;  3N7Z A;  2ZW4 A;  2B3V A;  4KOW A;  3ZZI A;  4MHD A;  2I00 A;  3F8K A;  1IID A;  4AG7 A;  2ZXV A;  1SQH A;  3FBU A;  1WK4 A;  4JJX A;  4Y49 C;  4CS0 B;  3BLN A;  2HQY A;  2PR1 A;  1RXT A;  4AVB A;  3VWE A;  5IB0 A;  3PP9 A;  2GIV A;  3BJ7 A;  3CXS A;  4KOS A;  3TFY A;  4YFJ A;  4NF1 A;  4PK2 A;  3EFA A;  4XNH B;  4KUA A;  4QC6 A;  2FSR A;  1YLE A;  3NE7 A;  3QAH A;  3SXN A;  3V8I A;  5KTD A;  1KZF A;  3H4Q A;  3OWC A;  4KOT A;  2JEV A;  2FE7 A;  3BJ8 A;  1LRZ A;  2Q4V A;  2PR8 A;  3D3S A;  2FCK A;  3S6H A;  4MJ8 A;  1M4I A;  1YX0 A;  3K9U A;  2WPW A;  5EC4 A;  1MJ9 A;  4L89 A;  1MJA A;  2CNS A;  4H6Z A;  4HKF A;  2EUI A;  4KUB A;  5JPH A;  4PSX A;  3F0A A;  3MGD A;  1OZP A;  1QSN A;  2VXK A;  1R57 A;  2J8R A;  4R9M A;  2OB0 A;  2FXF A;  3QB8 A;  2GE3 A;  4KOU A;  3FIX A;  3S6F A;  1U6M A;  5IX3 A;  4CAX A;  2CY2 A;  3PZJ A;  4R87 A;  2JDC A;  2Q7B A;  4EVY A;  2R1I A;  3EC4 A;  2B4D B;  1CM0 A;  2B3U A;  2H5M A;  3TE4 A;  1YR0 A;  1QST A;  2FT0 A;  1S7N A;  5C82 A;  5F47 A;  1L0C A;  5CNP A;  3F5B A;  1ON0 A;  2R7H A;  4R3K A;  4OAE A;  4KZT A;  4HNW B;  3TOA A;  3W91 A;  2OZU A;  3P2F A;  2BSW A;  1Z9U A;  4KVX A;  4M3S A;  1IIC A;  1CJW A;  3E0K A;  4R57 A;  2Q4Y A;  4LUA A;  4MY0 A;  4Y49 B;  2KCW A;  2FS5 A;  4R3L A;  4I49 A;  5DWM A;  1NSL A;  4UWI A;  2VI7 A;  4ZBG A;  1TIQ A;  3W6S A;  1M4D A;  4XPD C;  3R9E A;  1KUX A;  4AG9 A;  3LOD A;  2ZPA A;  3KKW A;  4II9 A;  2BUE A;  1XMT A;  2DXQ A;  4UBR A;  1YRE A;  2REF A;  5J8C A;  1S7K A;  3GKR A;  1QSR A;  2BL1 A;  4AB7 A;  3FB3 A;  4XPL A;  3I9S A;  1S7L A;  4PK3 A;  2AJ6 A;  3DDD A;  5HH1 A;  4F0Y A;  2OZG A;  2Q0Y A;  5ISV A;  1Q2Y A;  4F6A A;  1S7F A;  2PRB A;  1Y9W A;  1PU9 A;  2IL4 A;  1IYK A;  4J3G A;  2FIA A;  5H86 A;  1YVK A;  3WR7 A;  4AVA A;  2QML A;  2Q44 A;  3T90 A;  2OU2 A;  2P6E A;  4QUS A;  4UA3 A;  4CAV A;  5F46 A;  1Q2C A;  2BEI A;  2B5G B;  4X5K A;  1BO4 A;  2G0B A;  4KOX A;  4U9Y A;  2HUZ A;  2NMT A;  2B4B A;  2O28 A;  1WWZ A;  2Z10 A;  3FYN A;  4H6U A;  4MBU A;  5IV0 A;  3FXT A;  1Y7R A;  2EVN A;  2VZY A;  4OAD A;  3ZJ0 A;  4B5O A;  3C26 A;  2Z11 A;  2VQY A;  2Y0M A;  3DR6 A;  4JXR A;  1YK3 A;  4RS2 A;  3CXP A;  2PDO A;  3D8P A;  3P2H A;  4PV6 A;  2VZZ A;  4NSQ A;  5I0C A;  4FD7 A;  3D2M A;  5EBV A;  3R96 A;  4B5P A;  1B87 A;  1NMT A;  2AE6 A;  2R98 A;  1KUY A;  1XIX A;  3JUW A;  3TO9 A;  1YGH A;  4MY3 A;  2B5G A;  2VBQ A;  1V0C A;  1UFH A;  1I21 A;  4L8A A;  4BMH A;  4FD5 A;  3R95 A;  2D4P A;  4KVO E;  3R1K A;  5J8F A;  5KTA A;  4M85 A;  5HMN A;  2F5I A;  3DR8 A;  2REE A;  2QEC A;  4MI4 A;  4JWP A;  4KOV A;  5H84 A;  2J8M A;  2Q04 A;  1S5K A;  2RC4 A;  3B8G A;  4K30 A;  2J8N A;  4QVT A;  3EY5 A;  1IB1 E;  5GCN A;  3R9G A;  2OH1 A;  4XNH C;  2X7B A;  1RO5 A;  1XF8 A;  5FVJ A;  5E96 A;  3JVN A;  3W6X A;  3IWG A;  4JD6 A;  4OLL A;  1J4J A;  3I3G A;  1S3Z A;  1I12 A;  2P0W A;  4GS4 A;  1K4J A;  1QSM A;  2R8V A;  2ARH A;  1QSO A;  1Q2D A;  1M1D A;  2Z0Z A;  2CNM A;  2P6G A;  4ONU A;  3G8W A;  2QIR A;  4YRH A;  5F48 A;  3SHP A;  1S60 A;  4YGO A;  4IF5 A;  2OZH A;  3FRM A;  1PUA A;  1BOB A;  4NEX A;  3TTH A;  1XE4 A;  5F49 A;  4NXY A;  4KOR A;  4KVM E;  3GY9 A;  2B58 A;  3SXO A;  1NE9 A;  3EO4 A;  3UY5 A;  3TT2 A;  4E8O A;  4U9Z A;  2WPX A;  4HNY B;  2ATR A;  5JQ4 A;  1B6B A;  4U5Y A;  5C88 A;  4FD4 A;  1N71 A;  2PQ8 A;  3DNS A;  4DNC A;  2VEZ A;  4CRZ B;  2C27 A;  3G3S A;  4PSW A;  3EXN A;  4KLV A;  4B5P B;  4AVC A;  4UWJ A;  1MK4 A; 
#chains in the Genus database with same CATH topology
 4ZGY B;  2ZEP A;  1DTD A;  1BPN A;  1YME A;  4IUS A;  4QB9 A;  4ORF A;  5A28 A;  2ZOF A;  2GRE A;  1FY7 A;  5DWN A;  4X8I A;  4MCS A;  3VAR A;  5I4M A;  2QYV A;  5J1Q A;  3HUV A;  2PC1 A;  3TCV A;  4H89 A;  2HB6 A;  2JLM A;  3DLJ A;  4CPA A;  4W9Y A;  4CYQ A;  4DNC A;  2FL4 A;  1Y9K A;  4DJL A;  4CRY B;  1ZLI A;  1HEE A;  1I1D A;  3I1U A;  4NCZ A;  3D7F A;  4MMO A;  3TOB A;  2ZW7 A;  3FJU A;  2AFS A;  4KOY A;  4NGN A;  4PXE A;  4DUK A;  5G1Z A;  2XEG A;  4HNX B;  3TX8 A;  4EME A;  2G3T A;  5THW A;  4RI1 A;  1VHS A;  4TWE A;  3S6G A;  1IYL A;  1M4G A;  2PCU A;  3D2P A;  3RZA A;  2GAN A;  1KUV A;  4OP4 A;  4CYN A;  1TKJ A;  1CX8 A;  3DSB A;  1YVO A;  2PVW A;  3CT9 A;  1LAP A;  2VL1 A;  4MFJ A;  1P0H A;  2FIW A;  4JLY A;  1M44 A;  4CAW A;  4E2A A;  1AMP A;  2G3A A;  4B13 A;  3RNZ A;  2JDD A;  4ZX9 A;  2PJ3 A;  2Z3M A;  3GYA A;  2WZN A;  2Q43 A;  1MJB A;  3KQX A;  1Z5R A;  4K3N A;  2HV2 A;  4KLW A;  4QBJ A;  1XRY A;  4JXQ A;  3H8F A;  2P6F A;  3B3V A;  1CPX A;  3FF3 A;  3PGP A;  3TC8 A;  2I79 A;  3B3T A;  4MXU A;  4UCM A;  3B35 A;  2ZEH A;  3S6K A;  4PXC A;  2B4D A;  4XPK A;  1Z4R A;  2PJ4 A;  2CNT A;  3RYO A;  3VWD A;  1RTQ A;  1LFW A;  1Z4E A;  2PSW A;  3LD2 A;  3TO6 A;  2ZW5 A;  2PJ9 A;  4A2Z A;  2DPS A;  1XEB A;  3IGR A;  1P4N A;  3JTK A;  2PJ7 A;  1IOF A;  1YW4 A;  4UFV A;  3TO7 A;  2XEJ A;  5ELY A;  4GXH A;  2K5T A;  4A31 A;  3LAC A;  4LX9 A;  4NGT A;  2D4O A;  1TF8 A;  3FEC A;  4AXV A;  2F7V A;  2GLJ A;  4CGO A;  2ZED A;  3CXQ A;  1GHE A;  3BI1 A;  2PJ5 A;  4FD6 A;  2ZW6 A;  5KTC A;  4A37 A;  5IB9 A;  3FNC A;  4C7I A;  3R9F A;  1Z8T A;  5G20 A;  4GM5 A;  4XPD B;  3T9Y A;  2A4N A;  2YNE A;  4E0A A;  1VKC A;  4R76 A;  3N7Z A;  2ZW4 A;  2B3V A;  1M4L A;  3CPX A;  3GB0 A;  4KOW A;  4MHD A;  3ZZI A;  3KQZ A;  2I00 A;  3F8K A;  3PBB A;  1ARM A;  1IID A;  4MFL A;  4AG7 A;  2ZXV A;  4C2Y A;  1SQH A;  2V8D A;  3FBU A;  1WK4 A;  4JJX A;  1A2Z A;  3PFE A;  3KGQ A;  4Y49 C;  4CS0 B;  3BLN A;  4MRI A;  2PR1 A;  1HDU A;  2EBJ A;  1RXT A;  2HQY A;  1HDQ A;  2NYQ A;  4UCN A;  3VWE A;  4AVB A;  4B11 A;  4CGL A;  1BPM A;  5IB0 A;  5AG7 A;  3KR5 A;  4X2T A;  3PP9 A;  4ZY1 A;  3H8E A;  1CP6 A;  3IC1 A;  4UCP A;  2GIV A;  3BJ7 A;  3FMC A;  2V8V A;  3CXS A;  4KOS A;  3TFY A;  4CGP A;  3KAS A;  2C6C A;  3L2N A;  4NF1 A;  4YFJ A;  4F8Z A;  4PK2 A;  3RO0 A;  3EFA A;  4O23 A;  4TNU A;  1R43 A;  4BD9 A;  4XNH B;  4KUA A;  5LYD A;  2EWB A;  4QC6 A;  4UEZ A;  2Q7S A;  2FSR A;  1QQ9 A;  2YNC C;  1YLE A;  4LQ6 A;  1XMB A;  2ZEE A;  3NFZ A;  4YWY A;  4NGQ A;  3NE7 A;  3QAH A;  3SXN A;  3V8I A;  3SJF A;  5JM6 A;  2OR4 A;  5KTD A;  3B2Y A;  1F2P A;  4WWV A;  4IAV A;  1KZF A;  3H4Q A;  1Q7L A;  3IO1 A;  3DGV A;  3OWC A;  4KOT A;  4MHZ A;  4NJR A;  2JEV A;  1LOK A;  3IFE A;  4UIB A;  2FE7 A;  1VHE A;  3BJ8 A;  4MCR A;  1UWY A;  1LRZ A;  4CAE A;  2EK9 A;  2F8H A;  2Q4V A;  2PR8 A;  3D3S A;  2FCK A;  1FNO A;  1H8L A;  4ZY0 A;  5HXD A;  3S6H A;  4MJ8 A;  1F57 A;  1M4I A;  1YX0 A;  3K9U A;  2WPW A;  5EC4 A;  1MJ9 A;  4UEE A;  4L89 A;  4Q38 A;  3QNV A;  1MJA A;  2CNS A;  3BHX A;  4P6Y A;  1IU8 A;  4H6Z A;  3B7I A;  4HKF A;  1ZG8 A;  2EUI A;  3B3W A;  1Y7E A;  4JZ0 A;  4KUB A;  1ELL P;  5JPH A;  4PSX A;  3F0A A;  2ZEM A;  3MGD A;  4OIW A;  4F0X A;  1OZP A;  1QSN A;  2PRQ A;  2CF4 A;  1R57 A;  2J8R A;  2VXK A;  4R9M A;  2OB0 A;  3CPA A;  2DEA A;  4C2X A;  2FXF A;  4PPZ A;  3QB8 A;  1FT7 A;  4B10 A;  3V38 A;  2GE3 A;  4P4E A;  4KOU A;  3D7G A;  1Z2L A;  3FIX A;  1U6M A;  3H8G A;  3S6F A;  4PXB A;  5IX3 A;  4CAX A;  2CY2 A;  4EFD A;  1BAV A;  4OKO A;  3PZJ A;  1PCA A;  4R87 A;  2JDC A;  3IIB A;  4FWU A;  4IHM A;  2EO8 A;  1F2O A;  2ZEG A;  3IEH A;  4FBE A;  2Q7B A;  4EVY A;  3QAY A;  1ZLH A;  4WJB A;  1AYE A;  2R1I A;  3EC4 A;  2B4D B;  4P4J A;  3A9L A;  4A94 A;  1CM0 A;  3S9N A;  2B3U A;  5CBM A;  2H5M A;  3GLJ A;  2CXA A;  3PEI A;  2CTC A;  3TE4 A;  1YR0 A;  1QST A;  4MHP A;  4ZY2 A;  4MCP A;  2FT0 A;  2ZEF A;  1IGB A;  1S7N A;  4IK2 A;  5C82 A;  5F47 A;  4NGS A;  4C2Z A;  4UFW A;  1L0C A;  4FUU A;  3RAM A;  5CNP A;  4R6T A;  1Y0Y A;  1ON0 A;  3F5B A;  2R7H A;  1LAN A;  4Q7A A;  2OOT A;  4KS9 A;  1TKH A;  4OME A;  3LWU A;  1AUG A;  2CTB A;  4OAE A;  4R3K A;  2IMO A;  4NGP A;  4KZT A;  3ISZ A;  4HNW B;  4P10 A;  3TOA A;  3W91 A;  1VHO A;  3D4U A;  2C6G A;  4M6H A;  4BBH A;  4MFP A;  2OZU A;  4LQG A;  3P2F A;  4UFX A;  1ARL A;  3MN8 A;  2BSW A;  2PJ0 A;  1Z9U A;  4KVX A;  4M3S A;  4UIA A;  5JGF A;  5D8N A;  4A30 A;  1IIC A;  4A38 A;  1CJW A;  2BO9 A;  3VH9 A;  3E0K A;  2PIZ A;  5AG4 A;  4R57 A;  4EWT A;  2Q4Y A;  1ZG9 A;  3CDX A;  4LUA A;  1R3N A;  4PQA A;  2GFQ A;  2YND A;  4MY0 A;  4OC3 A;  2KCW A;  4Y49 B;  2FS5 A;  2PE3 A;  4R3L A;  4I49 A;  5DWM A;  1OBR A;  3PB8 X;  1NSL A;  4KSA A;  4UWI A;  2VI7 A;  4ZBG A;  2QJ8 A;  1TIQ A;  2ODF A;  3PB7 X;  3FX6 A;  3W6S A;  1IOI A;  1M4D A;  4XPD C;  3NH4 A;  4MFZ A;  3PB9 X;  3RBU A;  2DF5 A;  2GU2 A;  3S9L A;  3R9E A;  4M6G A;  3PBE A;  2ZOG A;  3KHZ A;  4KSF A;  1KUX A;  4AG9 A;  3LOD A;  3N5F A;  2POK A;  2ZPA A;  4NGM A;  3IWE A;  3BI0 A;  2O4H A;  3KKW A;  4II9 A;  2PJB A;  2Z3O A;  2BUE A;  4UEF A;  1XMT A;  2DXQ A;  4UBR A;  4G1P A;  4HPS A;  1YRE A;  2REF A;  4BIN A;  5J8C A;  2O53 A;  2RB7 A;  3MRU A;  2AFM A;  1S7K A;  3GIU A;  2PJA A;  4B12 A;  4X3R A;  5A27 A;  3GKR A;  1QSR A;  2BL1 A;  5LRG A;  3WC7 A;  3ISX A;  3PB6 X;  4A39 A;  3FB3 A;  4XPL A;  4A95 A;  4AB7 A;  2V77 A;  3I9S A;  1S7L A;  4PK3 A;  4NGR A;  2AJ6 A;  2BCO A;  1QMU A;  5JH9 A;  3DDD A;  1Y0R A;  5HH1 A;  4F0Y A;  4F9U A;  4OC5 A;  2OZG A;  2Q0Y A;  5ISV A;  1Q2Y A;  4F6A A;  2Z3N A;  4YU9 A;  1S7F A;  2PRB A;  1Y9W A;  1PU9 A;  2IL4 A;  1IYK A;  4J3G A;  2FIA A;  2PJ8 A;  1YVK A;  3NE8 A;  4P4B A;  5H86 A;  4UF4 A;  3WR7 A;  2QML A;  4AVA A;  2Q44 A;  3T90 A;  5AG6 A;  2OU2 A;  1ZG7 A;  2P6E A;  3LMS A;  3SI2 A;  2PJC A;  4M6I A;  4QUS A;  4UA3 A;  2AFO A;  3T8W A;  4CAV A;  5F46 A;  3SJE A;  1Q2C A;  2BEI A;  2B5G B;  4X5K A;  1ELM P;  4B14 A;  1BO4 A;  2G0B A;  4KOX A;  2ABZ A;  4U9Y A;  4Z65 A;  5K8P A;  2HUZ A;  5AGE A;  2NMT A;  1XBU A;  2JBJ A;  2B4B A;  2O28 A;  1WWZ A;  2Z10 A;  2WSA A;  8CPA A;  3FYN A;  4H6U A;  1EE3 P;  1TF9 A;  3IU2 A;  4MBU A;  3BXM A;  5IV0 A;  3FXT A;  5BWA B;  1Y7R A;  2EVN A;  2GLF A;  2VZY A;  4OAD A;  1Z8L A;  3H5Z A;  3ZJ0 A;  2PJ2 A;  4B5O A;  4Q36 A;  3C26 A;  3VAT A;  2DPT A;  2Z11 A;  2VQY A;  2Y0M A;  3DR6 A;  1TKF A;  4JXR A;  5LYF A;  1YK3 A;  1BLL E;  1DE4 C;  4RS2 A;  2AFW A;  1CPS A;  3CXP A;  2PDO A;  3D8P A;  3P2H A;  1Z8X A;  4PV6 A;  5LYL A;  5CPA A;  2VZZ A;  4NSQ A;  6CPA A;  5I0C A;  1XOV A;  3D2M A;  4FD7 A;  5EBV A;  3SI0 A;  3R96 A;  4ONW A;  4B5P A;  2V8H A;  5EMI A;  4P45 A;  1CG2 A;  4NJQ A;  4A32 A;  5F09 A;  1B87 A;  1NMT A;  3K2K A;  4R8F A;  2AE6 A;  2R98 A;  1KUY A;  1XIX A;  3JUW A;  3TO9 A;  4CGN A;  1YGH A;  5K8O A;  1Z8W A;  4MY3 A;  1X10 A;  2B5G A;  2BOA A;  3CZX A;  2VBQ A;  1V0C A;  2QVP A;  1UFH A;  1I21 A;  5AG5 A;  5LRJ A;  1CP7 A;  4KSI A;  3IWW A;  4JYW A;  2V8G A;  4P44 A;  4L8A A;  2YNC A;  4FD5 A;  4BMH A;  2AFZ A;  4P4F A;  4MHN A;  3R95 A;  3NH8 A;  2D4P A;  4KVO E;  3R1K A;  3V7Z A;  5J8F A;  5KTA A;  2XEI A;  4M85 A;  4A33 A;  5HMN A;  2F5I A;  3DR8 A;  7CPA A;  2REE A;  5D29 A;  2WUU A;  3FEE A;  2QEC A;  2Z3L A;  4ZX8 A;  3SJX A;  3WC6 A;  2XEF A;  4MI4 A;  4JWP A;  5HVH A;  1LCP A;  3KHX A;  2AFU A;  2IJZ A;  2Z3P A;  4KOV A;  1ZO0 A;  3D67 A;  5H84 A;  2J8M A;  2Q04 A;  1S5K A;  2RC4 A;  3B8G A;  4K30 A;  2J8N A;  4QVT A;  2IQ6 A;  3EY5 A;  3B3C A;  4B6Z A;  1XJO A;  1JQG A;  5K8N A;  2ANP A;  1YQE A;  1IB1 E;  5GCN A;  3R9G A;  3D7D A;  4P4D A;  2NSM A;  2OH1 A;  4MHY A;  4PXD A;  4ZYQ A;  1IY7 A;  4XNH C;  2X7B A;  1KWM A;  5G21 A;  1X12 A;  1RO5 A;  1TXR A;  1XF8 A;  2PJ1 A;  2HC9 A;  5FVJ A;  4F9V A;  3HLP A;  3IJ3 A;  3D7H A;  3WC5 A;  4MCQ A;  5E96 A;  3JVN A;  4C7H A;  2C1C A;  3W6X A;  3IWG A;  5K8M A;  4NFR A;  1JWQ A;  4JD6 A;  1J4J A;  4OLL A;  4OC4 A;  3D68 A;  3I3G A;  1YLO A;  4P4I A;  1S3Z A;  3KR4 A;  1I12 A;  1CBX A;  2P0W A;  4CYP A;  2ZEO A;  4RUH A;  2C6P A;  1K4J A;  1QSM A;  4GS4 A;  1VGY A;  2J9A A;  2R8V A;  2ARH A;  1QSO A;  1Q2D A;  2PIY A;  5HVF A;  1M1D A;  2Z0Z A;  3KL9 A;  1PYT B;  2CNM A;  2P6G A;  1YW6 A;  3G8W A;  2QIR A;  4ONU A;  4YRH A;  5F48 A;  3SHP A;  4H2K A;  1S60 A;  4YGO A;  2PVV A;  4IF5 A;  4CGM A;  3KI9 A;  2AFX A;  2OZH A;  2CIJ A;  5G22 A;  3D66 A;  3FRM A;  4DYO A;  1PUA A;  4C68 A;  1BOB A;  4NEX A;  3TTH A;  2Q4Z A;  4CAF A;  1XE4 A;  5F49 A;  3WAB A;  4NXY A;  2EK8 A;  4KOR A;  4OC2 A;  4OC1 A;  4MFQ A;  4KVM E;  3GY9 A;  2B58 A;  3JRU A;  4R7M A;  5HVG A;  4RN7 A;  4MFK A;  5LRK A;  1YSJ A;  2ZEL A;  3SXO A;  2WYR A;  2Q51 A;  4OID A;  3SJG A;  1NE9 A;  3WT4 A;  3FH4 A;  2ZEN A;  3EO4 A;  3UY5 A;  3SI1 A;  3TT2 A;  4E8O A;  4U9Z A;  2WPX A;  2FVG A;  2RFH A;  2ATR A;  3B3S A;  4HNY B;  3IU1 A;  4FAI A;  5JQ4 A;  3PFO A;  5LYI A;  2JBK A;  1B6B A;  3K9T A;  3KZW A;  4U5Y A;  2I3C A;  5C88 A;  4FD4 A;  1LAM A;  1N71 A;  1GYT A;  2PQ8 A;  3DNS A;  2Z3K A;  3PB4 X;  3PRT A;  2PJ6 A;  1VIX A;  2VEZ A;  3NH5 A;  3FVL A;  4CRZ B;  4OC0 A;  3NA6 A;  2C27 A;  3G3S A;  4PSW A;  3EXN A;  1NSA A;  5DS0 A;  4KLV A;  3S9M A;  2G9D A;  4B5P B;  3GUX A;  1XFO A;  2YGW A;  4CYO A;  4ZI6 A;  3FED A;  4AVC A;  4UWJ A;  2JEW A;  1MK4 A; 
#chains in the Genus database with same CATH homology
 4ZGY B;  4IUS A;  4QB9 A;  4ORF A;  5A28 A;  1FY7 A;  5DWN A;  2PC1 A;  3TCV A;  4H89 A;  2JLM A;  4CYQ A;  2FL4 A;  1Y9K A;  4CRY B;  1I1D A;  4NCZ A;  3TOB A;  2ZW7 A;  4KOY A;  5G1Z A;  4HNX B;  2G3T A;  4RI1 A;  1VHS A;  3S6G A;  1IYL A;  1M4G A;  3D2P A;  2GAN A;  1KUV A;  4CYN A;  3DSB A;  1YVO A;  4MFJ A;  1P0H A;  2FIW A;  4JLY A;  1M44 A;  4CAW A;  4E2A A;  2G3A A;  4B13 A;  2JDD A;  2Z3M A;  3GYA A;  1MJB A;  2HV2 A;  4KLW A;  4QBJ A;  4JXQ A;  2P6F A;  3PGP A;  2I79 A;  4UCM A;  3S6K A;  2B4D A;  4XPK A;  1Z4R A;  2CNT A;  3RYO A;  3VWD A;  1Z4E A;  3LD2 A;  2PSW A;  3TO6 A;  2ZW5 A;  4A2Z A;  2DPS A;  3IGR A;  1XEB A;  1P4N A;  3JTK A;  4UFV A;  3TO7 A;  2K5T A;  4A31 A;  4LX9 A;  2D4O A;  4CGO A;  3CXQ A;  1GHE A;  4FD6 A;  2ZW6 A;  5KTC A;  3FNC A;  4C7I A;  3R9F A;  5G20 A;  4XPD B;  3T9Y A;  2A4N A;  2YNE A;  4E0A A;  1VKC A;  3N7Z A;  2ZW4 A;  2B3V A;  4KOW A;  3ZZI A;  4MHD A;  2I00 A;  3F8K A;  1IID A;  4MFL A;  4AG7 A;  2ZXV A;  4C2Y A;  1SQH A;  3FBU A;  1WK4 A;  4JJX A;  4Y49 C;  4CS0 B;  3BLN A;  2HQY A;  2PR1 A;  1RXT A;  4B11 A;  4AVB A;  4CGL A;  4UCN A;  3VWE A;  5IB0 A;  5AG7 A;  3PP9 A;  4UCP A;  2GIV A;  3BJ7 A;  3CXS A;  4KOS A;  3TFY A;  4CGP A;  4YFJ A;  4NF1 A;  4PK2 A;  3EFA A;  4XNH B;  4KUA A;  4QC6 A;  2FSR A;  2YNC C;  1YLE A;  3NE7 A;  3QAH A;  3SXN A;  3V8I A;  5KTD A;  1KZF A;  3H4Q A;  3OWC A;  4KOT A;  2JEV A;  2FE7 A;  3BJ8 A;  1LRZ A;  4CAE A;  2Q4V A;  2PR8 A;  3D3S A;  2FCK A;  3S6H A;  4MJ8 A;  1M4I A;  1YX0 A;  3K9U A;  2WPW A;  5EC4 A;  1MJ9 A;  4L89 A;  4Q38 A;  1MJA A;  2CNS A;  4H6Z A;  4HKF A;  2EUI A;  4KUB A;  5JPH A;  4PSX A;  3F0A A;  3MGD A;  4F0X A;  1OZP A;  1QSN A;  2VXK A;  1R57 A;  2J8R A;  4R9M A;  2OB0 A;  4C2X A;  2FXF A;  3QB8 A;  4B10 A;  2GE3 A;  4KOU A;  3FIX A;  3S6F A;  1U6M A;  5IX3 A;  4CAX A;  2CY2 A;  3PZJ A;  4R87 A;  2JDC A;  2Q7B A;  4EVY A;  2R1I A;  3EC4 A;  2B4D B;  3A9L A;  1CM0 A;  2B3U A;  2H5M A;  2CXA A;  3TE4 A;  1YR0 A;  1QST A;  2FT0 A;  1S7N A;  5C82 A;  5F47 A;  4C2Z A;  4UFW A;  1L0C A;  5CNP A;  3F5B A;  1ON0 A;  2R7H A;  4KS9 A;  4R3K A;  4OAE A;  4KZT A;  4HNW B;  3TOA A;  3W91 A;  4BBH A;  4MFP A;  2OZU A;  4UFX A;  3P2F A;  2BSW A;  1Z9U A;  4KVX A;  4M3S A;  4A30 A;  1IIC A;  1CJW A;  3E0K A;  5AG4 A;  4R57 A;  2Q4Y A;  4LUA A;  2YND A;  4MY0 A;  4Y49 B;  2KCW A;  2FS5 A;  4R3L A;  4I49 A;  5DWM A;  1NSL A;  4KSA A;  4UWI A;  2VI7 A;  4ZBG A;  1TIQ A;  3W6S A;  1M4D A;  4XPD C;  4MFZ A;  3R9E A;  4KSF A;  1KUX A;  4AG9 A;  3LOD A;  2ZPA A;  3IWE A;  3KKW A;  4II9 A;  2Z3O A;  2BUE A;  1XMT A;  2DXQ A;  4UBR A;  1YRE A;  2REF A;  5J8C A;  1S7K A;  4B12 A;  5A27 A;  3GKR A;  1QSR A;  2BL1 A;  4A95 A;  3FB3 A;  4XPL A;  4AB7 A;  3I9S A;  1S7L A;  4PK3 A;  2AJ6 A;  3DDD A;  5HH1 A;  4F0Y A;  2OZG A;  2Q0Y A;  5ISV A;  1Q2Y A;  4F6A A;  2Z3N A;  1S7F A;  2PRB A;  1Y9W A;  1PU9 A;  2IL4 A;  1IYK A;  4J3G A;  2FIA A;  5H86 A;  1YVK A;  3WR7 A;  4AVA A;  2QML A;  2Q44 A;  3T90 A;  5AG6 A;  2OU2 A;  2P6E A;  4QUS A;  4UA3 A;  4CAV A;  5F46 A;  1Q2C A;  2BEI A;  2B5G B;  4X5K A;  4B14 A;  1BO4 A;  2G0B A;  4KOX A;  4U9Y A;  2HUZ A;  5AGE A;  2NMT A;  2B4B A;  2O28 A;  1WWZ A;  2Z10 A;  2WSA A;  4H6U A;  3FYN A;  3IU2 A;  4MBU A;  5IV0 A;  3FXT A;  5BWA B;  1Y7R A;  2EVN A;  2VZY A;  4OAD A;  3ZJ0 A;  3H5Z A;  4B5O A;  4Q36 A;  3C26 A;  2DPT A;  2Z11 A;  2VQY A;  2Y0M A;  3DR6 A;  4JXR A;  1YK3 A;  4RS2 A;  3CXP A;  2PDO A;  3D8P A;  3P2H A;  4PV6 A;  2VZZ A;  4NSQ A;  5I0C A;  4FD7 A;  3D2M A;  5EBV A;  3R96 A;  4B5P A;  4A32 A;  1B87 A;  1NMT A;  2AE6 A;  2R98 A;  1KUY A;  1XIX A;  3JUW A;  3TO9 A;  4CGN A;  1YGH A;  4MY3 A;  2B5G A;  2VBQ A;  1V0C A;  1UFH A;  1I21 A;  5AG5 A;  4L8A A;  2YNC A;  4FD5 A;  4BMH A;  3R95 A;  2D4P A;  4KVO E;  3R1K A;  5J8F A;  5KTA A;  4M85 A;  4A33 A;  5HMN A;  2F5I A;  3DR8 A;  2REE A;  2WUU A;  2QEC A;  2Z3L A;  4MI4 A;  4JWP A;  2Z3P A;  4KOV A;  1ZO0 A;  5H84 A;  2J8M A;  2Q04 A;  1S5K A;  2RC4 A;  3B8G A;  4K30 A;  2J8N A;  4QVT A;  3EY5 A;  1IB1 E;  5GCN A;  3R9G A;  2OH1 A;  4XNH C;  2X7B A;  5G21 A;  1RO5 A;  1XF8 A;  5FVJ A;  5E96 A;  3JVN A;  4C7H A;  3W6X A;  3IWG A;  4JD6 A;  4OLL A;  1J4J A;  3I3G A;  1S3Z A;  1I12 A;  2P0W A;  4CYP A;  4GS4 A;  1K4J A;  1QSM A;  2R8V A;  2ARH A;  1QSO A;  1Q2D A;  1M1D A;  2Z0Z A;  2CNM A;  2P6G A;  3G8W A;  4ONU A;  2QIR A;  4YRH A;  5F48 A;  3SHP A;  1S60 A;  4YGO A;  4CGM A;  4IF5 A;  2OZH A;  5G22 A;  3FRM A;  1PUA A;  4C68 A;  1BOB A;  4NEX A;  3TTH A;  4CAF A;  1XE4 A;  5F49 A;  4NXY A;  4KOR A;  4MFQ A;  4KVM E;  3GY9 A;  2B58 A;  4MFK A;  3SXO A;  1NE9 A;  3EO4 A;  3UY5 A;  3TT2 A;  4E8O A;  4U9Z A;  2WPX A;  4HNY B;  2ATR A;  3IU1 A;  5JQ4 A;  1B6B A;  4U5Y A;  5C88 A;  4FD4 A;  1N71 A;  2PQ8 A;  3DNS A;  4DNC A;  2Z3K A;  2VEZ A;  4CRZ B;  2C27 A;  3G3S A;  4PSW A;  3EXN A;  4KLV A;  4B5P B;  2YGW A;  4CYO A;  4AVC A;  4UWJ A;  1MK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...