1YR0A

Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
SVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphinothricin acetyltransferase
publication title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
total genus 44
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yr0A00
2GE3A 4UA3A 3G8WA 2BEIA 4AG9A 4KVOE 1YK3A 3BLNA 2P6EA 1J4JA 5FVJA 1IIDA 3GYAA 4H89A 2BUEA 3FXTA 1B6BA 1YVOA 3N7ZA 4U5YA 1NE9A 2R98A 3FNCA 4QVTA 4FD4A 1NMTA 1I21A 2VI7A 2QECA 2Z11A 4XPDB 1M4IA 4HNYB 1FY7A 1KUXA 3GKRA 2VXKA 3V8IA 1NSLA 1WK4A 1YX0A 2J8MA 1KUYA 4AG7A 4MY3A 1BO4A 2HQYA 1QSOA 5DWMA 4XPLA 4CAXA 3VWEA 2CY2A 2VZYA 4F0YA 4H6UA 2REFA 3F5BA 4JXQA 1KUVA 2FS5A 1XEBA 1R57A 1YLEA 4CRZB 4UWJA 5IB0A 2EUIA 4R87A 3F8KA 4KOTA 2Q0YA 2NMTA 2F5IA 1RO5A 2Q44A 4GS4A 4ORFA 4AVBA 4KOWA 1YR0A 4R9MA 3EXNA 4QUSA 3CXSA 3P2FA 1M4GA 4XNHB 4Y49B 3S6FA 2Z0ZA 2FIWA 1MK4A 1IICA 5JQ4A 1IYKA 3G3SA 4KZTA 3R9FA 3TOAA 1PU9A 1Q2DA 4PK2A 4X5KA 3CXPA 3S6KA 2Q04A 3QB8A 2JDDA 1V0CA 4U9ZA 2R7HA 4E8OA 1QSNA 1QSRA 2WPXA 4CAVA 1I1DA 2O28A 4KOUA 3TOBA 2OZHA 2I79A 2VZZA 3EC4A 3LD2A 5J8CA 4E2AA 3D2PA 3SXOA 3BJ8A 4PK3A 3FBUA 1P0HA 4I49A 4YRHA 2OB0A 3S6HA 3TE4A 4II9A 2ATRA 3R96A 2ZW4A 3E0KA 3PGPA 2PSWA 5CNPA 5H86A 2P6FA 5EBVA 2I00A 1S7KA 4MI4A 5F49A 4HNXB 3D3SA 4XPKA 1S60A 2PRBA 2PDOA 2J8NA 4NF1A 4B5PA 1YGHA 3SXNA 5KTAA 2VBQA 3B8GA 3H4QA 1GHEA 3R95A 4ZBGA 4OLLA 5EC4A 4FD7A 4YGOA 3DR8A 4B5PB 3LODA 2PR8A 4AVAA 2PC1A 1LRZA 4KOVA 3DNSA 5F47A 1CJWA 2OZUA 4NEXA 1Z4EA 3TFYA 4MJ8A 4OADA 4R3LA 3D2MA 1S5KA 2QIRA 4MY0A 5F46A 1CM0A 1Z9UA 3I9SA 1ON0A 2KCWA 3W91A 3NE7A 3IWGA 1XIXA 1XF8A 4K30A 3R1KA 1Y9KA 2B3UA 2DXQA 1BOBA 4HNWB 4JJXA 4B5OA 3FB3A 4J3GA 4LX9A 5C88A 3IGRA 4RS2A 4XPDC 4H6ZA 4YFJA 1TIQA 4HKFA 3T9YA 2PR1A 1MJAA 3QAHA 1XMTA 2FSRA 4KLVA 2JDCA 2OZGA 3F0AA 4RI1A 2VEZA 1VKCA 4R3KA 5HH1A 2B3VA 3D8PA 3VWDA 2B4DA 3TTHA 4M85A 2C27A 4F6AA 2G3TA 2D4OA 1M44A 1I12A 4LUAA 1U6MA 3EFAA 4MHDA 2JLMA 3P2HA 3FIXA 3R9GA 2D4PA 4KORA 5GCNA 1S7FA 2Q4YA 3RYOA 2B4DB 2IL4A 4M3SA 1M4DA 2VQYA 4AVCA 4KLWA 3TT2A 4KVME 2P6GA 4IUSA 5KTDA 2WPWA 3EY5A 3WR7A 3EO4A 2G3AA 2HV2A 1B87A 1Q2YA 5JPHA 3MGDA 4NSQA 1YVKA 4PV6A 1VHSA 2Q7BA 4XNHC 4Y49C 2K5TA 1Y7RA 1YREA 2OH1A 2R8VA 4KOXA 2AE6A 4ONUA 1RXTA 3TO7A 2FIAA 2FT0A 4QBJA 2Y0MA 2B58A 3KKWA 1S7NA 4AB7A 2ZPAA 3BJ7A 1MJBA 3FRMA 2Z10A 4QC6A 1Y9WA 2PQ8A 2X7BA 3JVNA 2CNTA 2FL4A 2JEVA 2FE7A 2OU2A 2ZW5A 4BMHA 2CNSA 2R1IA 2J8RA 2BSWA 4FD6A 3R9EA 1P4NA 3CXQA 3S6GA 3GY9A 3W6SA 3TO9A 1S7LA 1UFHA 2GANA 3K9UA 5IX3A 1Q2CA 2A4NA 4R57A 3FYNA 1IB1E 4KVXA 3DSBA 2RC4A 4UWIA 2P0WA 3SHPA 2ZXVA 4OAEA 2B5GA 3DDDA 1QSMA 3ZJ0A 2REEA 3TCVA 4NCZA 5H84A 4CAWA 2QMLA 4L8AA 2BL1A 4JLYA 2ARHA 5DWNA 3PP9A 2HUZA 3PZJA 4JWPA 3UY5A 4IF5A 3TO6A 3C26A 1PUAA 2B5GB 3JUWA 2Q4VA 5E96A 1WWZA 3T90A 5KTCA 2CNMA 4UBRA 1OZPA 1M1DA 2FCKA 1SQHA 4PSWA 1Z4RA 5J8FA 1XE4A 4QB9A 1S3ZA 4KOSA 4L89A 3I3GA 3W6XA 2ZW6A 1MJ9A 3DR6A 4JXRA 4JD6A 4PSXA 1K4JA 4CS0B 5ISVA 2B4BA 4KOYA 1IYLA 4KUBA 4DNCA 5I0CA 1L0CA 3ZZIA 4E0AA 5F48A 2EVNA 4MBUA 3OWCA 4CRYB 5IV0A 1QSTA 2FXFA 4EVYA 2G0BA 4KUAA 2H5MA 4NXYA 5C82A 2GIVA 1KZFA 1N71A 4FD5A 5HMNA 2ZW7A 4U9YA 2AJ6A
chains in the Genus database with same CATH superfamily
4O23A 2GE3A 2V8GA 4UA3A 3G8WA 2PRQA 4EMEA 4OIWA 4ONWA 2BEIA 3CT9A 1ZG9A 4IK2A 4AG9A 3ISXA 4F9VA 4CGPA 4KVOE 5CBMA 1YK3A 2V77A 3B3VA 3BLNA 2GREA 1IU8A 2P6EA 4P45A 5JGFA 1J4JA 5FVJA 1IIDA 1ELLP 3GYAA 4MCSA 4H89A 1XJOA 2CXAA 2BUEA 2YNCC 3FXTA 5LRKA 1B6BA 1BPMA 1YVOA 3FX6A 3N7ZA 4U5YA 1NE9A 2C1CA 2R98A 1VIXA 2CF4A 3FNCA 4FD4A 4QVTA 4NGNA 1NMTA 5K8MA 1I21A 2VI7A 2QECA 4C2XA 2Z11A 5I4MA 1Z8TA 4XPDB 1M4IA 5G22A 1TKHA 4HNYB 3KGQA 4MFQA 1AMPA 1Y0YA 1FY7A 1TF9A 1KUXA 3GKRA 2Z3OA 2VXKA 2AFXA 3V8IA 5JM6A 1NSLA 1WK4A 1YX0A 2J8MA 1KUYA 3D7HA 3RAMA 4AG7A 4MY3A 1BO4A 2HQYA 5HVFA 1QSOA 3PBEA 2AFMA 5DWMA 4XPLA 4CAXA 3VWEA 2CY2A 1Y0RA 2VZYA 4OC3A 4F0YA 4H6UA 2REFA 3F5BA 1EE3P 4ZX9A 4BINA 2NYQA 3FMCA 4M6GA 2I3CA 4JXQA 1KUVA 2FS5A 4A39A 2AFSA 1XEBA 1R57A 1YLEA 4C7IA 4CRZB 3B3SA 4UCPA 4G1PA 1IGBA 4X8IA 1PCAA 4UWJA 5IB0A 4KSAA 2EUIA 2WUUA 3H8GA 1H8LA 4R87A 3JRUA 4B14A 3F8KA 4KOTA 4UIBA 4OP4A 3T8WA 1TKFA 2Q0YA 3B35A 4PXEA 2CIJA 2NMTA 2CTCA 2F5IA 4IAVA 1RO5A 2Q44A 4MRIA 4WWVA 4NGSA 3IEHA 4GS4A 3MRUA 4ORFA 1X12A 4DUKA 1VHOA 4AVBA 3MN8A 1LFWA 4YU9A 4KOWA 1YR0A 4R9MA 1ZO0A 5F09A 3EXNA 2Z3PA 4QUSA 3D7GA 3CXSA 3P2FA 3A9LA 4FUUA 1M4GA 4XNHB 4MCRA 4Y49B 2RB7A 2CTBA 3S6FA 4B12A 2VL1A 2Z0ZA 4Q36A 2FIWA 1ZLIA 2G9DA 1MK4A 1IICA 5HVHA 5LYLA 1XRYA 1VGYA 5A28A 5JQ4A 1IYKA 3QAYA 5A27A 3K2KA 3G3SA 4PPZA 4UFVA 1GYTA 4C7HA 4KZTA 1R43A 2HC9A 2DPSA 3KI9A 2PJ2A 4NFRA 3R9FA 3KR4A 4PXCA 3TOAA 1PU9A 1Q2DA 4PK2A 3WT4A 4ZGYB 3S9NA 4X2TA 7CPAA 5JH9A 1LANA 2F8HA 5K8NA 3KZWA 3CXPA 4X5KA 2DF5A 3S6KA 2PJ1A 2Q04A 4B6ZA 3QB8A 2J9AA 3FEDA 2JDDA 4RN7A 2QJ8A 1V0CA 1IY7A 3KR5A 4U9ZA 3IFEA 3JTKA 1HEEA 5G21A 3TX8A 2R7HA 1HDQA 4E8OA 3IWEA 4WJBA 1QSNA 3WABA 1QSRA 2WPXA 4CAVA 2PJCA 4P4IA 1CX8A 1I1DA 3S9MA 2ZOFA 2O28A 4KOUA 3SJEA 3TOBA 2OZHA 5AG4A 4CAEA 2I79A 2VZZA 1XFOA 3EC4A 1FNOA 1UWYA 3LD2A 4E2AA 5J8CA 3D2PA 4NGMA 3VATA 3H8FA 3IU2A 3SXOA 3BJ8A 4PK3A 3FBUA 1P0HA 4I49A 1Q7LA 2OB0A 3FH4A 4NGQA 4YRHA 5THWA 3S6HA 3TE4A 4II9A 1ZLHA 2ATRA 4RUHA 3R96A 2ZW4A 3D67A 1Z8WA 1Z2LA 3E0KA 3PGPA 2AFWA 2PSWA 2YNEA 4BD9A 5K8OA 1OBRA 5CNPA 1ARMA 2P6FA 2O4HA 5EBVA 5H86A 3VH9A 8CPAA 2I00A 1S7KA 3IIBA 3PB9X 3FVLA 4MI4A 4NGRA 5F49A 2Q7SA 3KASA 4HNXB 2QVPA 3D3SA 1YW6A 4XPKA 2Z3MA 4F8ZA 1S60A 1KWMA 2HB6A 2PRBA 4CYPA 3B3CA 5HVGA 3TC8A 4DJLA 2PDOA 3B2YA 2J8NA 1X10A 4NF1A 5ELYA 4B5PA 4CYQA 1QQ9A 3NH4A 2WZNA 3NE8A 3PFOA 2DEAA 2XEFA 2ZOGA 4R6TA 4CPAA 4MXUA 1YGHA 3SXNA 5KTAA 1Y7EA 2ZELA 2VBQA 3B8GA 2ZEGA 3BHXA 2RFHA 3H4QA 2ODFA 3RZAA 3GUXA 2IJZA 3KL9A 3BI0A 2V8DA 1GHEA 2PIZA 4M6IA 5G1ZA 1NSAA 3R95A 4B10A 3IC1A 4MMOA 4P4JA 4OLLA 5EC4A 4FD7A 4ZBGA 4YGOA 2C6GA 3DR8A 4UIAA 4CYOA 4B5PB 3LODA 2PR8A 4AVAA 2PC1A 4MCQA 3PB6X 1LRZA 3PBBA 4NJRA 4KOVA 3DNSA 5F47A 4P4DA 1CJWA 1ZG7A 5K8PA 2OZUA 4NEXA 1Z4EA 3TFYA 2V8VA 4MJ8A 5CPAA 4K3NA 4OADA 4R3LA 3WC6A 1LOKA 1S5KA 3D2MA 4A33A 1IOIA 4CAFA 4A38A 3CZXA 4P4BA 2QIRA 4MY0A 5F46A 1CM0A 1Z9UA 3I9SA 4LQ6A 4UCMA 1ON0A 2KCWA 1TF8A 3W91A 3NE7A 3IWGA 3FJUA 3SI2A 5BWAB 3K9TA 1XIXA 1HDUA 3L2NA 3PFEA 1XF8A 4TWEA 1ARLA 3R1KA 4K30A 4CGOA 3CPXA 3IO1A 1Y9KA 2B3UA 2DXQA 2PJAA 2ZEOA 1BOBA 4HNWB 4JJXA 4B5OA 3FB3A 4J3GA 2PVWA 1ELMP 4A31A 4JZ0A 4LX9A 5C88A 4UEEA 3IGRA 4RS2A 4XPDC 4H6ZA 4MHYA 4YFJA 1TIQA 2YNCA 4HKFA 3T9YA 4A37A 4A94A 1AUGA 2PR1A 1MJAA 3QAHA 1XMTA 2FSRA 4KLVA 4UF4A 4CGMA 4A2ZA 1TKJA 2JDCA 2OZGA 3F0AA 4RI1A 2EK8A 3KQZA 4MFJA 2VEZA 1VKCA 4BBHA 2IQ6A 4R3KA 4KS9A 4IHMA 5HH1A 3D66A 3SJXA 4C2ZA 2B3VA 3D8PA 2ZEDA 3VWDA 2B4DA 1QMUA 3TTHA 2O53A 5D29A 4M85A 2C27A 4F6AA 1BAVA 3GLJA 2G3TA 3V7ZA 2D4OA 1M44A 2AFZA 1I12A 2PJ4A 1Z8LA 1U6MA 4LUAA 3LACA 3GIUA 2XEIA 1YW4A 3EFAA 4MHDA 4Q7AA 3I1UA 4OMEA 2JLMA 3P2HA 4C2YA 1YLOA 2BCOA 3FIXA 3R9GA 4A30A 2D4PA 4KORA 1M4LA 1S7FA 5GCNA 2Q4YA 1F2OA 1XBUA 2PJ8A 3PB8X 2PJ9A 1CPXA 3RYOA 2ZENA 4ZYQA 4P4FA 2BOAA 2FVGA 1LAMA 2B4DB 2IL4A 2EBJA 3GB0A 1M4DA 4M3SA 2VQYA 2Q43A 3KHXA 3RBUA 4AVCA 4KLWA 3TT2A 1CP6A 3N5FA 4F0XA 4KVME 2OR4A 2NSMA 2BO9A 2P6GA 2WPWA 3EY5A 4IUSA 4OC1A 5KTDA 3WR7A 4P6YA 3EO4A 2G3AA 2HV2A 2GLFA 2Z3NA 4YWYA 2ZEFA 1B87A 2PJ7A 4ZY0A 1Q2YA 5JPHA 3MGDA 2ANPA 4NSQA 1YVKA 2PJBA 4PV6A 5DS0A 2JBJA 1VHSA 2Q7BA 4Q38A 4MHPA 4XNHC 4Y49C 4HPSA 2K5TA 4KSIA 2PJ3A 1Y7RA 1YREA 1Z8XA 2AFUA 2OH1A 2R8VA 4MHZA 4KOXA 3BXMA 2AE6A 4UEFA 4A32A 1YQEA 2DPTA 2PE3A 4LQGA 2JEWA 3B7IA 4ONUA 4MHNA 1RXTA 2PCUA 4ZY2A 3LMSA 3TO7A 2V8HA 2FIAA 2FT0A 2PVVA 1XMBA 4DYOA 4QBJA 3CPAA 3CDXA 5AG6A 4FBEA 3RO0A 2Y0MA 2B58A 3KKWA 1S7NA 4AB7A 2Z3KA 1VHEA 2ZPAA 3BJ7A 4R76A 1MJBA 2EO8A 2Z10A 3FRMA 4QC6A 1Y9WA 2EWBA 1R3NA 2PQ8A 2X7BA 4B13A 3D7FA 2GLJA 3JVNA 4OC5A 3SI1A 3PB4X 4FWUA 2CNTA 1CPSA 1PYTB 2FL4A 2JEVA 2GFQA 2FE7A 1IOFA 1TXRA 4EWTA 2OU2A 1XOVA 1YSJA 4TNUA 1CBXA 2ZW5A 4P4EA 5LYIA 4BMHA 2ZEPA 3PEIA 4MCPA 2C6CA 2CNSA 2Q4ZA 2R1IA 3D7DA 2J8RA 2BSWA 3HUVA 4CYNA 4FD6A 3R9EA 1P4NA 3VARA 3CXQA 3NH5A 3D4UA 2ZEEA 3B3TA 2WSAA 5EMIA 5LRJA 3S6GA 3GY9A 3W6SA 4A95A 3TO9A 2QYVA 1S7LA 1UFHA 2GANA 5AGEA 3K9UA 5IX3A 2XEGA 1Q2CA 3NFZA 2A4NA 4R57A 3FYNA 1IB1E 3BI1A 4KVXA 3LWUA 2AFOA 3DSBA 2C6PA 2Q51A 3KQXA 2RC4A 4UWIA 4OC2A 4H2KA 2P0WA 3SHPA 3RNZA 4NJQA 2Z3LA 2ZXVA 4OAEA 3WC5A 2B5GA 3DDDA 4R8FA 1QSMA 1CP7A 3KHZA 2REEA 3ZJ0A 2F7VA 4PXBA 4ZI6A 3TCVA 2EK9A 3NA6A 3QNVA 4NCZA 5H84A 4CAWA 5AG5A 3H8EA 2QMLA 4PQAA 3IJ3A 4L8AA 2BL1A 4JLYA 1Z5RA 4X3RA 3FECA 2ARHA 1YMEA 4GM5A 2POKA 5DWNA 5LYFA 4UCNA 5G20A 4KSFA 3PP9A 2HUZA 4MFPA 3PZJA 4JWPA 4NGTA 4OC0A 3UY5A 4OKOA 6CPAA 4IF5A 3TO6A 5HXDA 2PIYA 3NH8A 3C26A 4AXVA 3SJFA 1PUAA 2B5GB 3JUWA 2Q4VA 2WYRA 4MFKA 2PJ6A 1JWQA 3IU1A 1DE4C 4OIDA 1JQGA 5E96A 4CGNA 4GXHA 2PJ5A 3S9LA 4EFDA 1LCPA 1WWZA 3D68A 3ISZA 3T90A 5KTCA 2PJ0A 4B11A 2JBKA 2ZEHA 2CNMA 4UBRA 4UEZA 5IB9A 1OZPA 1M1DA 2FCKA 4JYWA 1SQHA 4FAIA 5AG7A 3V38A 4ZY1A 5J1QA 4M6HA 3FF3A 4PSWA 1Z4RA 3B3WA 5J8FA 1XE4A 4QB9A 3DGVA 1S3ZA 4KOSA 1CG2A 2GU2A 4CGLA 4L89A 3I3GA 3W6XA 1F57A 1RTQA 2YGWA 4ZX8A 1A2ZA 2ZW6A 1MJ9A 3DR6A 4P44A 4PXDA 4W9YA 1BPNA 4JXRA 5D8NA 4JD6A 4PSXA 4F9UA 3DLJA 2IMOA 3SI0A 1K4JA 3HLPA 4CS0B 1ZG8A 5ISVA 2B4BA 5LRGA 4KOYA 1IYLA 2YNDA 2XEJA 4KUBA 1L0CA 4MFZA 4DNCA 4C68A 3ZZIA 4E0AA 5I0CA 5F48A 4NGPA 3PB7X 2EVNA 4UFWA 4MBUA 3OWCA 3PRTA 3H5ZA 3WC7A 4R7MA 4CRYB 5IV0A 2ZEMA 1QSTA 2FXFA 4EVYA 2OOTA 4UFXA 4OC4A 4MFLA 1BLLE 2G0BA 2H5MA 4KUAA 4NXYA 5C82A 2GIVA 1F2PA 1KZFA 3FEEA 4P10A 1LAPA 5LYDA 3SJGA 1N71A 4FD5A 5HMNA 2ZW7A 4U9YA 3IWWA 1AYEA 2AJ6A 1FT7A 4Z65A 1DTDA 2ABZA
chains in the Genus database with same CATH topology
2GE3A 4UA3A 3G8WA 2BEIA 4AG9A 4CGPA 4KVOE 1YK3A 3BLNA 2P6EA 1J4JA 5FVJA 1IIDA 3GYAA 4H89A 2CXAA 2BUEA 2YNCC 3FXTA 1B6BA 1YVOA 3N7ZA 4U5YA 1NE9A 2R98A 3FNCA 4QVTA 4FD4A 1NMTA 1I21A 2VI7A 2QECA 4C2XA 2Z11A 4XPDB 1M4IA 5G22A 4HNYB 4MFQA 1FY7A 1KUXA 3GKRA 2Z3OA 2VXKA 3V8IA 1NSLA 1WK4A 1YX0A 2J8MA 1KUYA 4AG7A 4MY3A 1BO4A 2HQYA 1QSOA 5DWMA 4XPLA 4CAXA 3VWEA 2CY2A 2VZYA 4F0YA 4H6UA 2REFA 3F5BA 4JXQA 1KUVA 2FS5A 1XEBA 1R57A 1YLEA 4C7IA 4CRZB 4UCPA 4UWJA 5IB0A 4KSAA 2EUIA 2WUUA 4R87A 4B14A 3F8KA 4KOTA 2Q0YA 2NMTA 2F5IA 1RO5A 2Q44A 4GS4A 4ORFA 4AVBA 4KOWA 1YR0A 4R9MA 1ZO0A 3EXNA 2Z3PA 4QUSA 3CXSA 3P2FA 3A9LA 1M4GA 4XNHB 4Y49B 3S6FA 4B12A 2Z0ZA 4Q36A 2FIWA 1MK4A 1IICA 5A28A 5JQ4A 1IYKA 5A27A 3G3SA 4UFVA 4C7HA 4KZTA 2DPSA 3R9FA 3TOAA 1PU9A 1Q2DA 4PK2A 4ZGYB 4X5KA 3CXPA 3S6KA 2Q04A 3QB8A 2JDDA 1V0CA 4U9ZA 3JTKA 5G21A 2R7HA 4E8OA 3IWEA 1QSNA 1QSRA 2WPXA 4CAVA 1I1DA 2O28A 4KOUA 3TOBA 2OZHA 5AG4A 4CAEA 2I79A 2VZZA 3EC4A 3LD2A 5J8CA 4E2AA 3D2PA 3IU2A 3SXOA 3BJ8A 4PK3A 3FBUA 1P0HA 4I49A 4YRHA 2OB0A 3S6HA 3TE4A 4II9A 2ATRA 3R96A 2ZW4A 3E0KA 3PGPA 2PSWA 2YNEA 5CNPA 5H86A 2P6FA 5EBVA 2I00A 1S7KA 4MI4A 5F49A 4HNXB 3D3SA 4XPKA 2Z3MA 1S60A 2PRBA 4CYPA 2PDOA 2J8NA 4NF1A 4B5PA 4CYQA 1YGHA 3SXNA 5KTAA 2VBQA 3B8GA 3H4QA 1GHEA 5G1ZA 3R95A 4B10A 4B13A 4ZBGA 4OLLA 5EC4A 4FD7A 4YGOA 4CYOA 3DR8A 4B5PB 3LODA 2PR8A 4AVAA 2PC1A 1LRZA 4KOVA 3DNSA 5F47A 1CJWA 2OZUA 4NEXA 1Z4EA 3TFYA 4MJ8A 4OADA 4R3LA 4A33A 3D2MA 1S5KA 4CAFA 2QIRA 4MY0A 5F46A 1CM0A 1Z9UA 3I9SA 4UCMA 1ON0A 2KCWA 3W91A 3NE7A 3IWGA 5BWAB 1XIXA 1XF8A 4CGOA 4K30A 3R1KA 1Y9KA 2B3UA 2DXQA 1BOBA 4HNWB 4JJXA 4B5OA 3FB3A 4J3GA 4A31A 4LX9A 5C88A 3IGRA 4RS2A 4XPDC 4H6ZA 4YFJA 1TIQA 2YNCA 4HKFA 3T9YA 2PR1A 1MJAA 3QAHA 1XMTA 2FSRA 4KLVA 4CGMA 4A2ZA 2JDCA 2OZGA 3F0AA 4RI1A 4MFJA 2VEZA 1VKCA 4BBHA 4R3KA 4KS9A 5HH1A 4C2ZA 2B3VA 3D8PA 3VWDA 2B4DA 3TTHA 4M85A 2C27A 4F6AA 2G3TA 2D4OA 1M44A 1I12A 4LUAA 1U6MA 3EFAA 4MHDA 2JLMA 3P2HA 4C2YA 4A30A 3FIXA 3R9GA 2D4PA 4KORA 5GCNA 1S7FA 2Q4YA 3RYOA 2B4DB 2IL4A 4M3SA 4CYNA 1M4DA 2VQYA 4AVCA 4KLWA 3TT2A 4F0XA 4KVME 2P6GA 4IUSA 5KTDA 2WPWA 3EY5A 3WR7A 3EO4A 2G3AA 2HV2A 2Z3NA 1B87A 1Q2YA 5JPHA 3MGDA 4NSQA 1YVKA 4PV6A 1VHSA 2Q7BA 4Q38A 4XNHC 4Y49C 2K5TA 1Y7RA 1YREA 2OH1A 2R8VA 4KOXA 2AE6A 4A32A 2DPTA 4ONUA 1RXTA 3TO7A 2FIAA 2FT0A 4QBJA 5AG6A 2Y0MA 2B58A 3KKWA 1S7NA 4AB7A 2Z3KA 2ZPAA 3BJ7A 1MJBA 3FRMA 2Z10A 4QC6A 1Y9WA 2PQ8A 2X7BA 3JVNA 2CNTA 2FL4A 2JEVA 2FE7A 2OU2A 2ZW5A 4BMHA 2CNSA 2R1IA 2J8RA 2BSWA 4FD6A 3R9EA 1P4NA 3CXQA 3S6GA 2WSAA 3GY9A 3W6SA 4A95A 3TO9A 1S7LA 1UFHA 2GANA 5AGEA 3K9UA 5IX3A 1Q2CA 2A4NA 4R57A 3FYNA 1IB1E 4KVXA 3DSBA 2RC4A 4UWIA 2P0WA 3SHPA 2Z3LA 2ZXVA 4OAEA 2B5GA 3DDDA 1QSMA 3ZJ0A 2REEA 3TCVA 4NCZA 5H84A 4CAWA 5AG5A 2QMLA 4L8AA 2BL1A 4JLYA 2ARHA 5DWNA 4UCNA 5G20A 4KSFA 3PP9A 2HUZA 4MFPA 3PZJA 4JWPA 3UY5A 4IF5A 3TO6A 3C26A 1PUAA 2B5GB 3JUWA 2Q4VA 4MFKA 3IU1A 5E96A 4CGNA 1WWZA 3T90A 5KTCA 4B11A 2CNMA 4UBRA 1OZPA 1M1DA 2FCKA 1SQHA 5AG7A 4PSWA 1Z4RA 5J8FA 1XE4A 4QB9A 1S3ZA 4KOSA 4CGLA 4L89A 3I3GA 3W6XA 2YGWA 2ZW6A 1MJ9A 3DR6A 4JXRA 4JD6A 4PSXA 1K4JA 4CS0B 5ISVA 2B4BA 4KOYA 1IYLA 2YNDA 4KUBA 4MFZA 1L0CA 4DNCA 5I0CA 4C68A 3ZZIA 4E0AA 5F48A 2EVNA 4UFWA 4MBUA 3OWCA 3H5ZA 4CRYB 5IV0A 1QSTA 2FXFA 4EVYA 4UFXA 4MFLA 2G0BA 4KUAA 2H5MA 4NXYA 5C82A 2GIVA 1KZFA 1N71A 4FD5A 5HMNA 2ZW7A 4U9YA 2AJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE3 A;  4UA3 A;  3G8W A;  2BEI A;  4AG9 A;  4KVO E;  1YK3 A;  3BLN A;  2P6E A;  1J4J A;  5FVJ A;  1IID A;  3GYA A;  4H89 A;  2BUE A;  3FXT A;  1B6B A;  1YVO A;  3N7Z A;  4U5Y A;  1NE9 A;  2R98 A;  3FNC A;  4QVT A;  4FD4 A;  1NMT A;  1I21 A;  2VI7 A;  2QEC A;  2Z11 A;  4XPD B;  1M4I A;  4HNY B;  1FY7 A;  1KUX A;  3GKR A;  2VXK A;  3V8I A;  1NSL A;  1WK4 A;  1YX0 A;  2J8M A;  1KUY A;  4AG7 A;  4MY3 A;  1BO4 A;  2HQY A;  1QSO A;  5DWM A;  4XPL A;  4CAX A;  3VWE A;  2CY2 A;  2VZY A;  4F0Y A;  4H6U A;  2REF A;  3F5B A;  4JXQ A;  1KUV A;  2FS5 A;  1XEB A;  1R57 A;  1YLE A;  4CRZ B;  4UWJ A;  5IB0 A;  2EUI A;  4R87 A;  3F8K A;  4KOT A;  2Q0Y A;  2NMT A;  2F5I A;  1RO5 A;  2Q44 A;  4GS4 A;  4ORF A;  4AVB A;  4KOW A;  1YR0 A;  4R9M A;  3EXN A;  4QUS A;  3CXS A;  3P2F A;  1M4G A;  4XNH B;  4Y49 B;  3S6F A;  2Z0Z A;  2FIW A;  1MK4 A;  1IIC A;  5JQ4 A;  1IYK A;  3G3S A;  4KZT A;  3R9F A;  3TOA A;  1PU9 A;  1Q2D A;  4PK2 A;  4X5K A;  3CXP A;  3S6K A;  2Q04 A;  3QB8 A;  2JDD A;  1V0C A;  4U9Z A;  2R7H A;  4E8O A;  1QSN A;  1QSR A;  2WPX A;  4CAV A;  1I1D A;  2O28 A;  4KOU A;  3TOB A;  2OZH A;  2I79 A;  2VZZ A;  3EC4 A;  3LD2 A;  5J8C A;  4E2A A;  3D2P A;  3SXO A;  3BJ8 A;  4PK3 A;  3FBU A;  1P0H A;  4I49 A;  4YRH A;  2OB0 A;  3S6H A;  3TE4 A;  4II9 A;  2ATR A;  3R96 A;  2ZW4 A;  3E0K A;  3PGP A;  2PSW A;  5CNP A;  5H86 A;  2P6F A;  5EBV A;  2I00 A;  1S7K A;  4MI4 A;  5F49 A;  4HNX B;  3D3S A;  4XPK A;  1S60 A;  2PRB A;  2PDO A;  2J8N A;  4NF1 A;  4B5P A;  1YGH A;  3SXN A;  5KTA A;  2VBQ A;  3B8G A;  3H4Q A;  1GHE A;  3R95 A;  4ZBG A;  4OLL A;  5EC4 A;  4FD7 A;  4YGO A;  3DR8 A;  4B5P B;  3LOD A;  2PR8 A;  4AVA A;  2PC1 A;  1LRZ A;  4KOV A;  3DNS A;  5F47 A;  1CJW A;  2OZU A;  4NEX A;  1Z4E A;  3TFY A;  4MJ8 A;  4OAD A;  4R3L A;  3D2M A;  1S5K A;  2QIR A;  4MY0 A;  5F46 A;  1CM0 A;  1Z9U A;  3I9S A;  1ON0 A;  2KCW A;  3W91 A;  3NE7 A;  3IWG A;  1XIX A;  1XF8 A;  4K30 A;  3R1K A;  1Y9K A;  2B3U A;  2DXQ A;  1BOB A;  4HNW B;  4JJX A;  4B5O A;  3FB3 A;  4J3G A;  4LX9 A;  5C88 A;  3IGR A;  4RS2 A;  4XPD C;  4H6Z A;  4YFJ A;  1TIQ A;  4HKF A;  3T9Y A;  2PR1 A;  1MJA A;  3QAH A;  1XMT A;  2FSR A;  4KLV A;  2JDC A;  2OZG A;  3F0A A;  4RI1 A;  2VEZ A;  1VKC A;  4R3K A;  5HH1 A;  2B3V A;  3D8P A;  3VWD A;  2B4D A;  3TTH A;  4M85 A;  2C27 A;  4F6A A;  2G3T A;  2D4O A;  1M44 A;  1I12 A;  4LUA A;  1U6M A;  3EFA A;  4MHD A;  2JLM A;  3P2H A;  3FIX A;  3R9G A;  2D4P A;  4KOR A;  5GCN A;  1S7F A;  2Q4Y A;  3RYO A;  2B4D B;  2IL4 A;  4M3S A;  1M4D A;  2VQY A;  4AVC A;  4KLW A;  3TT2 A;  4KVM E;  2P6G A;  4IUS A;  5KTD A;  2WPW A;  3EY5 A;  3WR7 A;  3EO4 A;  2G3A A;  2HV2 A;  1B87 A;  1Q2Y A;  5JPH A;  3MGD A;  4NSQ A;  1YVK A;  4PV6 A;  1VHS A;  2Q7B A;  4XNH C;  4Y49 C;  2K5T A;  1Y7R A;  1YRE A;  2OH1 A;  2R8V A;  4KOX A;  2AE6 A;  4ONU A;  1RXT A;  3TO7 A;  2FIA A;  2FT0 A;  4QBJ A;  2Y0M A;  2B58 A;  3KKW A;  1S7N A;  4AB7 A;  2ZPA A;  3BJ7 A;  1MJB A;  3FRM A;  2Z10 A;  4QC6 A;  1Y9W A;  2PQ8 A;  2X7B A;  3JVN A;  2CNT A;  2FL4 A;  2JEV A;  2FE7 A;  2OU2 A;  2ZW5 A;  4BMH A;  2CNS A;  2R1I A;  2J8R A;  2BSW A;  4FD6 A;  3R9E A;  1P4N A;  3CXQ A;  3S6G A;  3GY9 A;  3W6S A;  3TO9 A;  1S7L A;  1UFH A;  2GAN A;  3K9U A;  5IX3 A;  1Q2C A;  2A4N A;  4R57 A;  3FYN A;  1IB1 E;  4KVX A;  3DSB A;  2RC4 A;  4UWI A;  2P0W A;  3SHP A;  2ZXV A;  4OAE A;  2B5G A;  3DDD A;  1QSM A;  3ZJ0 A;  2REE A;  3TCV A;  4NCZ A;  5H84 A;  4CAW A;  2QML A;  4L8A A;  2BL1 A;  4JLY A;  2ARH A;  5DWN A;  3PP9 A;  2HUZ A;  3PZJ A;  4JWP A;  3UY5 A;  4IF5 A;  3TO6 A;  3C26 A;  1PUA A;  2B5G B;  3JUW A;  2Q4V A;  5E96 A;  1WWZ A;  3T90 A;  5KTC A;  2CNM A;  4UBR A;  1OZP A;  1M1D A;  2FCK A;  1SQH A;  4PSW A;  1Z4R A;  5J8F A;  1XE4 A;  4QB9 A;  1S3Z A;  4KOS A;  4L89 A;  3I3G A;  3W6X A;  2ZW6 A;  1MJ9 A;  3DR6 A;  4JXR A;  4JD6 A;  4PSX A;  1K4J A;  4CS0 B;  5ISV A;  2B4B A;  4KOY A;  1IYL A;  4KUB A;  4DNC A;  5I0C A;  1L0C A;  3ZZI A;  4E0A A;  5F48 A;  2EVN A;  4MBU A;  3OWC A;  4CRY B;  5IV0 A;  1QST A;  2FXF A;  4EVY A;  2G0B A;  4KUA A;  2H5M A;  4NXY A;  5C82 A;  2GIV A;  1KZF A;  1N71 A;  4FD5 A;  5HMN A;  2ZW7 A;  4U9Y A;  2AJ6 A; 
#chains in the Genus database with same CATH topology
 4O23 A;  2GE3 A;  2V8G A;  4UA3 A;  3G8W A;  2PRQ A;  4EME A;  4OIW A;  4ONW A;  2BEI A;  3CT9 A;  1ZG9 A;  4IK2 A;  4AG9 A;  3ISX A;  4F9V A;  4CGP A;  4KVO E;  5CBM A;  1YK3 A;  2V77 A;  3B3V A;  3BLN A;  2GRE A;  1IU8 A;  2P6E A;  4P45 A;  5JGF A;  1J4J A;  5FVJ A;  1IID A;  1ELL P;  3GYA A;  4MCS A;  4H89 A;  1XJO A;  2CXA A;  2BUE A;  2YNC C;  3FXT A;  5LRK A;  1B6B A;  1BPM A;  1YVO A;  3FX6 A;  3N7Z A;  4U5Y A;  1NE9 A;  2C1C A;  2R98 A;  1VIX A;  2CF4 A;  3FNC A;  4FD4 A;  4QVT A;  4NGN A;  1NMT A;  5K8M A;  1I21 A;  2VI7 A;  2QEC A;  4C2X A;  2Z11 A;  5I4M A;  1Z8T A;  4XPD B;  1M4I A;  5G22 A;  1TKH A;  4HNY B;  3KGQ A;  4MFQ A;  1AMP A;  1Y0Y A;  1FY7 A;  1TF9 A;  1KUX A;  3GKR A;  2Z3O A;  2VXK A;  2AFX A;  3V8I A;  5JM6 A;  1NSL A;  1WK4 A;  1YX0 A;  2J8M A;  1KUY A;  3D7H A;  3RAM A;  4AG7 A;  4MY3 A;  1BO4 A;  2HQY A;  5HVF A;  1QSO A;  3PBE A;  2AFM A;  5DWM A;  4XPL A;  4CAX A;  3VWE A;  2CY2 A;  1Y0R A;  2VZY A;  4OC3 A;  4F0Y A;  4H6U A;  2REF A;  3F5B A;  1EE3 P;  4ZX9 A;  4BIN A;  2NYQ A;  3FMC A;  4M6G A;  2I3C A;  4JXQ A;  1KUV A;  2FS5 A;  4A39 A;  2AFS A;  1XEB A;  1R57 A;  1YLE A;  4C7I A;  4CRZ B;  3B3S A;  4UCP A;  4G1P A;  1IGB A;  4X8I A;  1PCA A;  4UWJ A;  5IB0 A;  4KSA A;  2EUI A;  2WUU A;  3H8G A;  1H8L A;  4R87 A;  3JRU A;  4B14 A;  3F8K A;  4KOT A;  4UIB A;  4OP4 A;  3T8W A;  1TKF A;  2Q0Y A;  3B35 A;  4PXE A;  2CIJ A;  2NMT A;  2CTC A;  2F5I A;  4IAV A;  1RO5 A;  2Q44 A;  4MRI A;  4WWV A;  4NGS A;  3IEH A;  4GS4 A;  3MRU A;  4ORF A;  1X12 A;  4DUK A;  1VHO A;  4AVB A;  3MN8 A;  1LFW A;  4YU9 A;  4KOW A;  1YR0 A;  4R9M A;  1ZO0 A;  5F09 A;  3EXN A;  2Z3P A;  4QUS A;  3D7G A;  3CXS A;  3P2F A;  3A9L A;  4FUU A;  1M4G A;  4XNH B;  4MCR A;  4Y49 B;  2RB7 A;  2CTB A;  3S6F A;  4B12 A;  2VL1 A;  2Z0Z A;  4Q36 A;  2FIW A;  1ZLI A;  2G9D A;  1MK4 A;  1IIC A;  5HVH A;  5LYL A;  1XRY A;  1VGY A;  5A28 A;  5JQ4 A;  1IYK A;  3QAY A;  5A27 A;  3K2K A;  3G3S A;  4PPZ A;  4UFV A;  1GYT A;  4C7H A;  4KZT A;  1R43 A;  2HC9 A;  2DPS A;  3KI9 A;  2PJ2 A;  4NFR A;  3R9F A;  3KR4 A;  4PXC A;  3TOA A;  1PU9 A;  1Q2D A;  4PK2 A;  3WT4 A;  4ZGY B;  3S9N A;  4X2T A;  7CPA A;  5JH9 A;  1LAN A;  2F8H A;  5K8N A;  3KZW A;  3CXP A;  4X5K A;  2DF5 A;  3S6K A;  2PJ1 A;  2Q04 A;  4B6Z A;  3QB8 A;  2J9A A;  3FED A;  2JDD A;  4RN7 A;  2QJ8 A;  1V0C A;  1IY7 A;  3KR5 A;  4U9Z A;  3IFE A;  3JTK A;  1HEE A;  5G21 A;  3TX8 A;  2R7H A;  1HDQ A;  4E8O A;  3IWE A;  4WJB A;  1QSN A;  3WAB A;  1QSR A;  2WPX A;  4CAV A;  2PJC A;  4P4I A;  1CX8 A;  1I1D A;  3S9M A;  2ZOF A;  2O28 A;  4KOU A;  3SJE A;  3TOB A;  2OZH A;  5AG4 A;  4CAE A;  2I79 A;  2VZZ A;  1XFO A;  3EC4 A;  1FNO A;  1UWY A;  3LD2 A;  4E2A A;  5J8C A;  3D2P A;  4NGM A;  3VAT A;  3H8F A;  3IU2 A;  3SXO A;  3BJ8 A;  4PK3 A;  3FBU A;  1P0H A;  4I49 A;  1Q7L A;  2OB0 A;  3FH4 A;  4NGQ A;  4YRH A;  5THW A;  3S6H A;  3TE4 A;  4II9 A;  1ZLH A;  2ATR A;  4RUH A;  3R96 A;  2ZW4 A;  3D67 A;  1Z8W A;  1Z2L A;  3E0K A;  3PGP A;  2AFW A;  2PSW A;  2YNE A;  4BD9 A;  5K8O A;  1OBR A;  5CNP A;  1ARM A;  2P6F A;  2O4H A;  5EBV A;  5H86 A;  3VH9 A;  8CPA A;  2I00 A;  1S7K A;  3IIB A;  3PB9 X;  3FVL A;  4MI4 A;  4NGR A;  5F49 A;  2Q7S A;  3KAS A;  4HNX B;  2QVP A;  3D3S A;  1YW6 A;  4XPK A;  2Z3M A;  4F8Z A;  1S60 A;  1KWM A;  2HB6 A;  2PRB A;  4CYP A;  3B3C A;  5HVG A;  3TC8 A;  4DJL A;  2PDO A;  3B2Y A;  2J8N A;  1X10 A;  4NF1 A;  5ELY A;  4B5P A;  4CYQ A;  1QQ9 A;  3NH4 A;  2WZN A;  3NE8 A;  3PFO A;  2DEA A;  2XEF A;  2ZOG A;  4R6T A;  4CPA A;  4MXU A;  1YGH A;  3SXN A;  5KTA A;  1Y7E A;  2ZEL A;  2VBQ A;  3B8G A;  2ZEG A;  3BHX A;  2RFH A;  3H4Q A;  2ODF A;  3RZA A;  3GUX A;  2IJZ A;  3KL9 A;  3BI0 A;  2V8D A;  1GHE A;  2PIZ A;  4M6I A;  5G1Z A;  1NSA A;  3R95 A;  4B10 A;  3IC1 A;  4MMO A;  4P4J A;  4OLL A;  5EC4 A;  4FD7 A;  4ZBG A;  4YGO A;  2C6G A;  3DR8 A;  4UIA A;  4CYO A;  4B5P B;  3LOD A;  2PR8 A;  4AVA A;  2PC1 A;  4MCQ A;  3PB6 X;  1LRZ A;  3PBB A;  4NJR A;  4KOV A;  3DNS A;  5F47 A;  4P4D A;  1CJW A;  1ZG7 A;  5K8P A;  2OZU A;  4NEX A;  1Z4E A;  3TFY A;  2V8V A;  4MJ8 A;  5CPA A;  4K3N A;  4OAD A;  4R3L A;  3WC6 A;  1LOK A;  1S5K A;  3D2M A;  4A33 A;  1IOI A;  4CAF A;  4A38 A;  3CZX A;  4P4B A;  2QIR A;  4MY0 A;  5F46 A;  1CM0 A;  1Z9U A;  3I9S A;  4LQ6 A;  4UCM A;  1ON0 A;  2KCW A;  1TF8 A;  3W91 A;  3NE7 A;  3IWG A;  3FJU A;  3SI2 A;  5BWA B;  3K9T A;  1XIX A;  1HDU A;  3L2N A;  3PFE A;  1XF8 A;  4TWE A;  1ARL A;  3R1K A;  4K30 A;  4CGO A;  3CPX A;  3IO1 A;  1Y9K A;  2B3U A;  2DXQ A;  2PJA A;  2ZEO A;  1BOB A;  4HNW B;  4JJX A;  4B5O A;  3FB3 A;  4J3G A;  2PVW A;  1ELM P;  4A31 A;  4JZ0 A;  4LX9 A;  5C88 A;  4UEE A;  3IGR A;  4RS2 A;  4XPD C;  4H6Z A;  4MHY A;  4YFJ A;  1TIQ A;  2YNC A;  4HKF A;  3T9Y A;  4A37 A;  4A94 A;  1AUG A;  2PR1 A;  1MJA A;  3QAH A;  1XMT A;  2FSR A;  4KLV A;  4UF4 A;  4CGM A;  4A2Z A;  1TKJ A;  2JDC A;  2OZG A;  3F0A A;  4RI1 A;  2EK8 A;  3KQZ A;  4MFJ A;  2VEZ A;  1VKC A;  4BBH A;  2IQ6 A;  4R3K A;  4KS9 A;  4IHM A;  5HH1 A;  3D66 A;  3SJX A;  4C2Z A;  2B3V A;  3D8P A;  2ZED A;  3VWD A;  2B4D A;  1QMU A;  3TTH A;  2O53 A;  5D29 A;  4M85 A;  2C27 A;  4F6A A;  1BAV A;  3GLJ A;  2G3T A;  3V7Z A;  2D4O A;  1M44 A;  2AFZ A;  1I12 A;  2PJ4 A;  1Z8L A;  1U6M A;  4LUA A;  3LAC A;  3GIU A;  2XEI A;  1YW4 A;  3EFA A;  4MHD A;  4Q7A A;  3I1U A;  4OME A;  2JLM A;  3P2H A;  4C2Y A;  1YLO A;  2BCO A;  3FIX A;  3R9G A;  4A30 A;  2D4P A;  4KOR A;  1M4L A;  1S7F A;  5GCN A;  2Q4Y A;  1F2O A;  1XBU A;  2PJ8 A;  3PB8 X;  2PJ9 A;  1CPX A;  3RYO A;  2ZEN A;  4ZYQ A;  4P4F A;  2BOA A;  2FVG A;  1LAM A;  2B4D B;  2IL4 A;  2EBJ A;  3GB0 A;  1M4D A;  4M3S A;  2VQY A;  2Q43 A;  3KHX A;  3RBU A;  4AVC A;  4KLW A;  3TT2 A;  1CP6 A;  3N5F A;  4F0X A;  4KVM E;  2OR4 A;  2NSM A;  2BO9 A;  2P6G A;  2WPW A;  3EY5 A;  4IUS A;  4OC1 A;  5KTD A;  3WR7 A;  4P6Y A;  3EO4 A;  2G3A A;  2HV2 A;  2GLF A;  2Z3N A;  4YWY A;  2ZEF A;  1B87 A;  2PJ7 A;  4ZY0 A;  1Q2Y A;  5JPH A;  3MGD A;  2ANP A;  4NSQ A;  1YVK A;  2PJB A;  4PV6 A;  5DS0 A;  2JBJ A;  1VHS A;  2Q7B A;  4Q38 A;  4MHP A;  4XNH C;  4Y49 C;  4HPS A;  2K5T A;  4KSI A;  2PJ3 A;  1Y7R A;  1YRE A;  1Z8X A;  2AFU A;  2OH1 A;  2R8V A;  4MHZ A;  4KOX A;  3BXM A;  2AE6 A;  4UEF A;  4A32 A;  1YQE A;  2DPT A;  2PE3 A;  4LQG A;  2JEW A;  3B7I A;  4ONU A;  4MHN A;  1RXT A;  2PCU A;  4ZY2 A;  3LMS A;  3TO7 A;  2V8H A;  2FIA A;  2FT0 A;  2PVV A;  1XMB A;  4DYO A;  4QBJ A;  3CPA A;  3CDX A;  5AG6 A;  4FBE A;  3RO0 A;  2Y0M A;  2B58 A;  3KKW A;  1S7N A;  4AB7 A;  2Z3K A;  1VHE A;  2ZPA A;  3BJ7 A;  4R76 A;  1MJB A;  2EO8 A;  2Z10 A;  3FRM A;  4QC6 A;  1Y9W A;  2EWB A;  1R3N A;  2PQ8 A;  2X7B A;  4B13 A;  3D7F A;  2GLJ A;  3JVN A;  4OC5 A;  3SI1 A;  3PB4 X;  4FWU A;  2CNT A;  1CPS A;  1PYT B;  2FL4 A;  2JEV A;  2GFQ A;  2FE7 A;  1IOF A;  1TXR A;  4EWT A;  2OU2 A;  1XOV A;  1YSJ A;  4TNU A;  1CBX A;  2ZW5 A;  4P4E A;  5LYI A;  4BMH A;  2ZEP A;  3PEI A;  4MCP A;  2C6C A;  2CNS A;  2Q4Z A;  2R1I A;  3D7D A;  2J8R A;  2BSW A;  3HUV A;  4CYN A;  4FD6 A;  3R9E A;  1P4N A;  3VAR A;  3CXQ A;  3NH5 A;  3D4U A;  2ZEE A;  3B3T A;  2WSA A;  5EMI A;  5LRJ A;  3S6G A;  3GY9 A;  3W6S A;  4A95 A;  3TO9 A;  2QYV A;  1S7L A;  1UFH A;  2GAN A;  5AGE A;  3K9U A;  5IX3 A;  2XEG A;  1Q2C A;  3NFZ A;  2A4N A;  4R57 A;  3FYN A;  1IB1 E;  3BI1 A;  4KVX A;  3LWU A;  2AFO A;  3DSB A;  2C6P A;  2Q51 A;  3KQX A;  2RC4 A;  4UWI A;  4OC2 A;  4H2K A;  2P0W A;  3SHP A;  3RNZ A;  4NJQ A;  2Z3L A;  2ZXV A;  4OAE A;  3WC5 A;  2B5G A;  3DDD A;  4R8F A;  1QSM A;  1CP7 A;  3KHZ A;  2REE A;  3ZJ0 A;  2F7V A;  4PXB A;  4ZI6 A;  3TCV A;  2EK9 A;  3NA6 A;  3QNV A;  4NCZ A;  5H84 A;  4CAW A;  5AG5 A;  3H8E A;  2QML A;  4PQA A;  3IJ3 A;  4L8A A;  2BL1 A;  4JLY A;  1Z5R A;  4X3R A;  3FEC A;  2ARH A;  1YME A;  4GM5 A;  2POK A;  5DWN A;  5LYF A;  4UCN A;  5G20 A;  4KSF A;  3PP9 A;  2HUZ A;  4MFP A;  3PZJ A;  4JWP A;  4NGT A;  4OC0 A;  3UY5 A;  4OKO A;  6CPA A;  4IF5 A;  3TO6 A;  5HXD A;  2PIY A;  3NH8 A;  3C26 A;  4AXV A;  3SJF A;  1PUA A;  2B5G B;  3JUW A;  2Q4V A;  2WYR A;  4MFK A;  2PJ6 A;  1JWQ A;  3IU1 A;  1DE4 C;  4OID A;  1JQG A;  5E96 A;  4CGN A;  4GXH A;  2PJ5 A;  3S9L A;  4EFD A;  1LCP A;  1WWZ A;  3D68 A;  3ISZ A;  3T90 A;  5KTC A;  2PJ0 A;  4B11 A;  2JBK A;  2ZEH A;  2CNM A;  4UBR A;  4UEZ A;  5IB9 A;  1OZP A;  1M1D A;  2FCK A;  4JYW A;  1SQH A;  4FAI A;  5AG7 A;  3V38 A;  4ZY1 A;  5J1Q A;  4M6H A;  3FF3 A;  4PSW A;  1Z4R A;  3B3W A;  5J8F A;  1XE4 A;  4QB9 A;  3DGV A;  1S3Z A;  4KOS A;  1CG2 A;  2GU2 A;  4CGL A;  4L89 A;  3I3G A;  3W6X A;  1F57 A;  1RTQ A;  2YGW A;  4ZX8 A;  1A2Z A;  2ZW6 A;  1MJ9 A;  3DR6 A;  4P44 A;  4PXD A;  4W9Y A;  1BPN A;  4JXR A;  5D8N A;  4JD6 A;  4PSX A;  4F9U A;  3DLJ A;  2IMO A;  3SI0 A;  1K4J A;  3HLP A;  4CS0 B;  1ZG8 A;  5ISV A;  2B4B A;  5LRG A;  4KOY A;  1IYL A;  2YND A;  2XEJ A;  4KUB A;  1L0C A;  4MFZ A;  4DNC A;  4C68 A;  3ZZI A;  4E0A A;  5I0C A;  5F48 A;  4NGP A;  3PB7 X;  2EVN A;  4UFW A;  4MBU A;  3OWC A;  3PRT A;  3H5Z A;  3WC7 A;  4R7M A;  4CRY B;  5IV0 A;  2ZEM A;  1QST A;  2FXF A;  4EVY A;  2OOT A;  4UFX A;  4OC4 A;  4MFL A;  1BLL E;  2G0B A;  2H5M A;  4KUA A;  4NXY A;  5C82 A;  2GIV A;  1F2P A;  1KZF A;  3FEE A;  4P10 A;  1LAP A;  5LYD A;  3SJG A;  1N71 A;  4FD5 A;  5HMN A;  2ZW7 A;  4U9Y A;  3IWW A;  1AYE A;  2AJ6 A;  1FT7 A;  4Z65 A;  1DTD A;  2ABZ A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  4UA3 A;  3G8W A;  2BEI A;  4AG9 A;  4CGP A;  4KVO E;  1YK3 A;  3BLN A;  2P6E A;  1J4J A;  5FVJ A;  1IID A;  3GYA A;  4H89 A;  2CXA A;  2BUE A;  2YNC C;  3FXT A;  1B6B A;  1YVO A;  3N7Z A;  4U5Y A;  1NE9 A;  2R98 A;  3FNC A;  4QVT A;  4FD4 A;  1NMT A;  1I21 A;  2VI7 A;  2QEC A;  4C2X A;  2Z11 A;  4XPD B;  1M4I A;  5G22 A;  4HNY B;  4MFQ A;  1FY7 A;  1KUX A;  3GKR A;  2Z3O A;  2VXK A;  3V8I A;  1NSL A;  1WK4 A;  1YX0 A;  2J8M A;  1KUY A;  4AG7 A;  4MY3 A;  1BO4 A;  2HQY A;  1QSO A;  5DWM A;  4XPL A;  4CAX A;  3VWE A;  2CY2 A;  2VZY A;  4F0Y A;  4H6U A;  2REF A;  3F5B A;  4JXQ A;  1KUV A;  2FS5 A;  1XEB A;  1R57 A;  1YLE A;  4C7I A;  4CRZ B;  4UCP A;  4UWJ A;  5IB0 A;  4KSA A;  2EUI A;  2WUU A;  4R87 A;  4B14 A;  3F8K A;  4KOT A;  2Q0Y A;  2NMT A;  2F5I A;  1RO5 A;  2Q44 A;  4GS4 A;  4ORF A;  4AVB A;  4KOW A;  1YR0 A;  4R9M A;  1ZO0 A;  3EXN A;  2Z3P A;  4QUS A;  3CXS A;  3P2F A;  3A9L A;  1M4G A;  4XNH B;  4Y49 B;  3S6F A;  4B12 A;  2Z0Z A;  4Q36 A;  2FIW A;  1MK4 A;  1IIC A;  5A28 A;  5JQ4 A;  1IYK A;  5A27 A;  3G3S A;  4UFV A;  4C7H A;  4KZT A;  2DPS A;  3R9F A;  3TOA A;  1PU9 A;  1Q2D A;  4PK2 A;  4ZGY B;  4X5K A;  3CXP A;  3S6K A;  2Q04 A;  3QB8 A;  2JDD A;  1V0C A;  4U9Z A;  3JTK A;  5G21 A;  2R7H A;  4E8O A;  3IWE A;  1QSN A;  1QSR A;  2WPX A;  4CAV A;  1I1D A;  2O28 A;  4KOU A;  3TOB A;  2OZH A;  5AG4 A;  4CAE A;  2I79 A;  2VZZ A;  3EC4 A;  3LD2 A;  5J8C A;  4E2A A;  3D2P A;  3IU2 A;  3SXO A;  3BJ8 A;  4PK3 A;  3FBU A;  1P0H A;  4I49 A;  4YRH A;  2OB0 A;  3S6H A;  3TE4 A;  4II9 A;  2ATR A;  3R96 A;  2ZW4 A;  3E0K A;  3PGP A;  2PSW A;  2YNE A;  5CNP A;  5H86 A;  2P6F A;  5EBV A;  2I00 A;  1S7K A;  4MI4 A;  5F49 A;  4HNX B;  3D3S A;  4XPK A;  2Z3M A;  1S60 A;  2PRB A;  4CYP A;  2PDO A;  2J8N A;  4NF1 A;  4B5P A;  4CYQ A;  1YGH A;  3SXN A;  5KTA A;  2VBQ A;  3B8G A;  3H4Q A;  1GHE A;  5G1Z A;  3R95 A;  4B10 A;  4B13 A;  4ZBG A;  4OLL A;  5EC4 A;  4FD7 A;  4YGO A;  4CYO A;  3DR8 A;  4B5P B;  3LOD A;  2PR8 A;  4AVA A;  2PC1 A;  1LRZ A;  4KOV A;  3DNS A;  5F47 A;  1CJW A;  2OZU A;  4NEX A;  1Z4E A;  3TFY A;  4MJ8 A;  4OAD A;  4R3L A;  4A33 A;  3D2M A;  1S5K A;  4CAF A;  2QIR A;  4MY0 A;  5F46 A;  1CM0 A;  1Z9U A;  3I9S A;  4UCM A;  1ON0 A;  2KCW A;  3W91 A;  3NE7 A;  3IWG A;  5BWA B;  1XIX A;  1XF8 A;  4CGO A;  4K30 A;  3R1K A;  1Y9K A;  2B3U A;  2DXQ A;  1BOB A;  4HNW B;  4JJX A;  4B5O A;  3FB3 A;  4J3G A;  4A31 A;  4LX9 A;  5C88 A;  3IGR A;  4RS2 A;  4XPD C;  4H6Z A;  4YFJ A;  1TIQ A;  2YNC A;  4HKF A;  3T9Y A;  2PR1 A;  1MJA A;  3QAH A;  1XMT A;  2FSR A;  4KLV A;  4CGM A;  4A2Z A;  2JDC A;  2OZG A;  3F0A A;  4RI1 A;  4MFJ A;  2VEZ A;  1VKC A;  4BBH A;  4R3K A;  4KS9 A;  5HH1 A;  4C2Z A;  2B3V A;  3D8P A;  3VWD A;  2B4D A;  3TTH A;  4M85 A;  2C27 A;  4F6A A;  2G3T A;  2D4O A;  1M44 A;  1I12 A;  4LUA A;  1U6M A;  3EFA A;  4MHD A;  2JLM A;  3P2H A;  4C2Y A;  4A30 A;  3FIX A;  3R9G A;  2D4P A;  4KOR A;  5GCN A;  1S7F A;  2Q4Y A;  3RYO A;  2B4D B;  2IL4 A;  4M3S A;  4CYN A;  1M4D A;  2VQY A;  4AVC A;  4KLW A;  3TT2 A;  4F0X A;  4KVM E;  2P6G A;  4IUS A;  5KTD A;  2WPW A;  3EY5 A;  3WR7 A;  3EO4 A;  2G3A A;  2HV2 A;  2Z3N A;  1B87 A;  1Q2Y A;  5JPH A;  3MGD A;  4NSQ A;  1YVK A;  4PV6 A;  1VHS A;  2Q7B A;  4Q38 A;  4XNH C;  4Y49 C;  2K5T A;  1Y7R A;  1YRE A;  2OH1 A;  2R8V A;  4KOX A;  2AE6 A;  4A32 A;  2DPT A;  4ONU A;  1RXT A;  3TO7 A;  2FIA A;  2FT0 A;  4QBJ A;  5AG6 A;  2Y0M A;  2B58 A;  3KKW A;  1S7N A;  4AB7 A;  2Z3K A;  2ZPA A;  3BJ7 A;  1MJB A;  3FRM A;  2Z10 A;  4QC6 A;  1Y9W A;  2PQ8 A;  2X7B A;  3JVN A;  2CNT A;  2FL4 A;  2JEV A;  2FE7 A;  2OU2 A;  2ZW5 A;  4BMH A;  2CNS A;  2R1I A;  2J8R A;  2BSW A;  4FD6 A;  3R9E A;  1P4N A;  3CXQ A;  3S6G A;  2WSA A;  3GY9 A;  3W6S A;  4A95 A;  3TO9 A;  1S7L A;  1UFH A;  2GAN A;  5AGE A;  3K9U A;  5IX3 A;  1Q2C A;  2A4N A;  4R57 A;  3FYN A;  1IB1 E;  4KVX A;  3DSB A;  2RC4 A;  4UWI A;  2P0W A;  3SHP A;  2Z3L A;  2ZXV A;  4OAE A;  2B5G A;  3DDD A;  1QSM A;  3ZJ0 A;  2REE A;  3TCV A;  4NCZ A;  5H84 A;  4CAW A;  5AG5 A;  2QML A;  4L8A A;  2BL1 A;  4JLY A;  2ARH A;  5DWN A;  4UCN A;  5G20 A;  4KSF A;  3PP9 A;  2HUZ A;  4MFP A;  3PZJ A;  4JWP A;  3UY5 A;  4IF5 A;  3TO6 A;  3C26 A;  1PUA A;  2B5G B;  3JUW A;  2Q4V A;  4MFK A;  3IU1 A;  5E96 A;  4CGN A;  1WWZ A;  3T90 A;  5KTC A;  4B11 A;  2CNM A;  4UBR A;  1OZP A;  1M1D A;  2FCK A;  1SQH A;  5AG7 A;  4PSW A;  1Z4R A;  5J8F A;  1XE4 A;  4QB9 A;  1S3Z A;  4KOS A;  4CGL A;  4L89 A;  3I3G A;  3W6X A;  2YGW A;  2ZW6 A;  1MJ9 A;  3DR6 A;  4JXR A;  4JD6 A;  4PSX A;  1K4J A;  4CS0 B;  5ISV A;  2B4B A;  4KOY A;  1IYL A;  2YND A;  4KUB A;  4MFZ A;  1L0C A;  4DNC A;  5I0C A;  4C68 A;  3ZZI A;  4E0A A;  5F48 A;  2EVN A;  4UFW A;  4MBU A;  3OWC A;  3H5Z A;  4CRY B;  5IV0 A;  1QST A;  2FXF A;  4EVY A;  4UFX A;  4MFL A;  2G0B A;  4KUA A;  2H5M A;  4NXY A;  5C82 A;  2GIV A;  1KZF A;  1N71 A;  4FD5 A;  5HMN A;  2ZW7 A;  4U9Y A;  2AJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...