1YR0A

Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
SVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transferase
molecule keywords phosphinothricin acetyltransferase
total genus 44
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yr0A00
1QSRA 4QUSA 2PDOA 3I9SA 1S7LA 2ZW4A 1XIXA 1S7KA 4B5PB 5F47A 5C82A 3FYNA 1S7NA 5IB0A 1UFHA 2X7BA 4U5YA 3RYOA 3ZJ0A 1YREA 2D4PA 2FS5A 1WWZA 2BUEA 3S6FA 4MI4A 3P2HA 3BLNA 3D8PA 3DNSA 4UA3A 2GIVA 4ONUA 4KLVA 1CM0A 2HUZA 1I1DA 4LUAA 1M4GA 2CY2A 4XPLA 4CAWA 4OLLA 5HH1A 2OB0A 2Q44A 4I49A 3FNCA 3SXNA 4DNCA 1Y7RA 3EXNA 4H6UA 4QC6A 3MGDA 3GY9A 1KUYA 2CNMA 4NXYA 4MJ8A 4UWIA 5GCNA 1P0HA 5F48A 2FIAA 4CAXA 2FCKA 3BJ7A 5E96A 5EBVA 4MY3A 1YVKA 2FT0A 2IL4A 3W6SA 2Q04A 1S3ZA 2OH1A 4U9YA 1I12A 4NCZA 2PC1A 1BO4A 4FD6A 3FBUA 4KVME 4R57A 2QMLA 5KTAA 2Q4YA 3R9FA 2G0BA 4KOTA 5CNPA 2OU2A 4JXQA 2JLMA 1B6BA 2R8VA 1TIQA 4H89A 1S60A 3N7ZA 3TO6A 2REFA 4F6AA 5IX3A 2B5GB 3B8GA 4NEXA 5JPHA 5H84A 4KLWA 1IICA 4XNHB 2ZPAA 2OZGA 3SHPA 2REEA 2I79A 4XPKA 4PV6A 5IV0A 4AVAA 3R95A 1P4NA 1QSMA 2R1IA 3EC4A 3F8KA 2VXKA 3NE7A 4Y49C 2G3TA 5FVJA 1MJBA 1BOBA 2VI7A 1FY7A 4MBUA 1KUXA 4U9ZA 4UWJA 4OAEA 3JVNA 1YX0A 1RXTA 3R1KA 3DR8A 4HKFA 2J8MA 3T9YA 3ZZIA 1LRZA 3G3SA 2FXFA 1Q2CA 4GS4A 4JWPA 2PR1A 4YFJA 3LODA 2I00A 1S7FA 2GANA 4AVBA 1U6MA 3TCVA 3S6GA 1WK4A 2ZW5A 3PZJA 1S5KA 1IYKA 2P6GA 2WPXA 5DWNA 2H5MA 2R7HA 2DXQA 4MY0A 1YGHA 3TO7A 5I0CA 3R96A 4KOSA 4J3GA 5F46A 4II9A 2P6EA 4PK2A 4JLYA 2A4NA 2C27A 4R3LA 2VBQA 1MJ9A 2KCWA 4L8AA 3IGRA 1RO5A 4FD5A 4XPDC 3FIXA 3QAHA 4AB7A 4H6ZA 4HNWB 4JJXA 2R98A 1Q2DA 4JXRA 4YGOA 3SXOA 4KOVA 5KTCA 3GKRA 4YRHA 4R9MA 4IF5A 2JDCA 1VKCA 3TFYA 1ON0A 4FD4A 1M44A 3FRMA 3CXQA 1MK4A 3P2FA 1M1DA 4QVTA 5KTDA 2G3AA 2ZW7A 2ARHA 2PRBA 4NF1A 5ISVA 1KUVA 2EVNA 2ZXVA 1K4JA 2J8RA 4HNXB 3E0KA 3S6HA 2J8NA 2FIWA 4KOWA 4NSQA 2VQYA 2HQYA 3DDDA 4KZTA 1YR0A 4PK3A 4QB9A 2O28A 3PGPA 4JD6A 5DWMA 2Y0MA 4XPDB 4R87A 3T90A 3DR6A 1Z4EA 4ZBGA 4E0AA 4KUAA 4F0YA 1QSOA 4IUSA 2Z0ZA 4PSWA 1M4DA 2K5TA 2PR8A 1IB1E 2QECA 3FXTA 2OZHA 3I3GA 2GE3A 4AVCA 3F5BA 3G8WA 2F5IA 2P6FA 4LX9A 1YLEA 3D2MA 1YK3A 2B4BA 3UY5A 1KZFA 1M4IA 2FSRA 1R57A 4RS2A 1OZPA 3K9UA 4MHDA 1XE4A 3GYAA 3CXPA 1J4JA 1QSNA 4OADA 3WR7A 2RC4A 1GHEA 4QBJA 3R9GA 3DSBA 5JQ4A 5H86A 4KVOE 3H4QA 4PSXA 4B5PA 2Q7BA 2VEZA 4L89A 2WPWA 3EFAA 4AG9A 4CRYB 3IWGA 4FD7A 5EC4A 4EVYA 3V8IA 2B58A 2QIRA 3PP9A 4KOUA 2JDDA 1Z9UA 4M3SA 3TO9A 1V0CA 2CNTA 4M85A 1YVOA 4RI1A 2B4DA 3QB8A 3BJ8A 3FB3A 2B3UA 2P0WA 3KKWA 1CJWA 1Y9KA 2B3VA 2B4DB 5HMNA 3TT2A 1XMTA 5F49A 1NMTA 4CRZB 4AG7A 1B87A 2EUIA 1XEBA 2ZW6A 1IIDA 4CS0B 2PSWA 2NMTA 1IYLA 3D2PA 3D3SA 2Q4VA 5C88A 1VHSA 1QSTA 2PQ8A 2OZUA 2Z10A 3VWEA 3OWCA 2ATRA 4KVXA 4KOYA 4HNYB 2B5GA 2JEVA 1Q2YA 1SQHA 3C26A 3EO4A 2BSWA 4XNHC 3VWDA 2FL4A 2CNSA 5J8FA 4ORFA 2AE6A 2FE7A 4B5OA 2VZZA 4K30A 4CAVA 1XF8A 1NE9A 2BEIA 4UBRA 3TTHA 1MJAA 2D4OA 3TOBA 4R3KA 2VZYA 1Y9WA 4KORA 4Y49B 2Q0YA 4X5KA 4E2AA 3CXSA 2BL1A 1L0CA 3LD2A 3TOAA 1N71A 3W6XA 4KUBA 4E8OA 1NSLA 2Z11A 3EY5A 2AJ6A 3F0AA 4BMHA 1PU9A 3R9EA 3S6KA 1I21A 3W91A 2HV2A 3JUWA 1PUAA 5J8CA 4KOXA 3TE4A 1Z4RA
chains in the Genus database with same CATH superfamily
1QSRA 4QUSA 1F57A 2GLFA 2PDOA 3CPXA 4UFWA 3I9SA 3KI9A 2OR4A 1YQEA 1S7LA 5G20A 1TKFA 4KSAA 2ZW4A 1XIXA 1S7KA 2PJ5A 4B5PB 5F47A 3BXMA 5C82A 3FYNA 1S7NA 4YWYA 5G1ZA 3GB0A 4R6TA 5J1QA 5IB0A 1UFHA 1FNOA 3FEEA 3ISXA 2X7BA 4U5YA 3RYOA 1IOFA 4MCPA 3D7GA 1YREA 1BLLE 5DS0A 2D4PA 2FS5A 1WWZA 2BUEA 3IJ3A 4CYPA 3S6FA 4MI4A 3DGVA 3P2HA 4MFZA 3BLNA 3SJGA 4CYNA 2DF5A 3D8PA 3DNSA 4UA3A 4CAEA 1PYTB 2GIVA 2QJ8A 4DJLA 4ONUA 2Q43A 4KLVA 4IHMA 1CM0A 4A33A 3IWEA 2DEAA 3H5ZA 2HUZA 1I1DA 4LUAA 4M6IA 1M4GA 2CY2A 1XFOA 4XPLA 4OC0A 5D29A 4CAWA 4OLLA 5HH1A 2OB0A 2Q44A 4I49A 1XRYA 2ANPA 3FNCA 1YSJA 3BHXA 3DLJA 4R7MA 2PVWA 4DNCA 5JH9A 1ARMA 2ZEGA 1Y7RA 3KZWA 4UEZA 5G21A 1IOIA 4H6UA 4QC6A 3MGDA 2Z3NA 1KWMA 3GY9A 4A38A 4WWVA 4ZGYB 2XEGA 2EO8A 4MHNA 2OOTA 2ZEPA 5AG4A 2NYQA 4PXBA 4B6ZA 2PJ1A 1KUYA 4X8IA 5J8CA 2CNMA 4NXYA 4MJ8A 4NGSA 1CP6A 2QYVA 4ONWA 3H8GA 1P0HA 4UWIA 5GCNA 3B3CA 2CF4A 5F48A 2FIAA 4CPAA 3S9NA 1ARLA 3HLPA 4MFQA 4CAXA 2FCKA 3BJ7A 5F09A 5E96A 3D67A 2YNEA 4P4BA 5AG5A 3PB9X 5EBVA 4ZY2A 4MY3A 1YVKA 1NSAA 2PIZA 2FT0A 3B7IA 5LYLA 3GLJA 2Z3MA 2I3CA 2IL4A 3W6SA 2Q04A 1S3ZA 2JBJA 2OH1A 4UF4A 4U9YA 1I12A 4NCZA 3KHXA 2PC1A 1QQ9A 3PBEA 4W9YA 1BO4A 4FD6A 2Z3LA 4TNUA 1YLOA 2Z3PA 3FBUA 4KVME 4R57A 4RN7A 3D7DA 2QMLA 5KTAA 2Q4YA 2V8GA 2HC9A 5JM6A 2PJ3A 3R9FA 2G0BA 4FBEA 2AFUA 4KOTA 5CNPA 5LRGA 3B3SA 4A39A 2OU2A 3D4UA 4JXQA 5A28A 2JLMA 1B6BA 2R8VA 5I4MA 1TIQA 5HVGA 1UWYA 1XJOA 4H89A 2HB6A 2DPSA 2PJBA 2RFHA 1S60A 1Y7EA 3N7ZA 4X2TA 3TO6A 4MCSA 2REFA 4F6AA 4F9VA 1JWQA 2C6CA 5IX3A 2B5GB 2CXAA 1TXRA 3B8GA 1BAVA 4NEXA 4NGNA 5JPHA 3B2YA 2CTBA 5H84A 2AFZA 3KQZA 2YNCA 4KLWA 1IICA 4XNHB 1XBUA 2ZPAA 3IO1A 2OZGA 3SHPA 5D8NA 2REEA 2I79A 5CBMA 2QVPA 2C1CA 4XPKA 2PJ8A 2V8HA 4R8FA 3NH4A 4PV6A 5IV0A 4AVAA 3CDXA 3R95A 3SXNA 3H8FA 1P4NA 4P4DA 1QSMA 2R1IA 4ZY1A 3EC4A 4OKOA 3F8KA 2VXKA 3NE7A 3V38A 4Y49C 4B11A 4CYOA 4BINA 2G3TA 4P4FA 2PCUA 2PJAA 4IK2A 5FVJA 3SJXA 4GM5A 1MJBA 1BOBA 1ELLP 1TKJA 2VI7A 1VHEA 1VGYA 3K2KA 5HVHA 1F2OA 3WABA 3V7ZA 1FY7A 2AFXA 4MBUA 4B12A 1KUXA 4PXCA 4U9ZA 4UWJA 4DYOA 4OAEA 3JVNA 1YX0A 1RXTA 2PJ4A 3LACA 5CPAA 3R1KA 3SJFA 3DR8A 4HKFA 2J8MA 3T9YA 1ZLIA 4PXDA 3ZZIA 1Z2LA 4MFJA 1LRZA 3G3SA 2GREA 4NGTA 2FXFA 2PIYA 2CTCA 1Q2CA 3LMSA 1ZG7A 4GS4A 4JWPA 2PR1A 4NGMA 4YFJA 4KSIA 4UFXA 5LRJA 4NJRA 2Q4ZA 3LODA 1HDUA 2I00A 2EBJA 1S7FA 2AFSA 1M4LA 2GANA 4P4IA 1Z8WA 1IY7A 3IU2A 4P4JA 4Q7AA 1U6MA 4AVBA 1DE4C 3WC6A 2IJZA 4X3RA 1XOVA 2NSMA 3TCVA 4JYWA 3RAMA 3S6GA 3IEHA 1WK4A 3KL9A 2WYRA 1CP7A 2ZW5A 1S5KA 3PZJA 1HEEA 4ZYQA 2PJ7A 2PE3A 2C6PA 2ZEMA 1LCPA 1IYKA 4MMOA 2P6GA 4UIBA 2AFMA 4O23A 2WPXA 1Y0RA 4HPSA 5DWNA 4PPZA 3CZXA 2PVVA 1H8LA 3GIUA 2H5MA 1R3NA 2DXQA 2R7HA 4MY0A 1YGHA 3TO7A 5I0CA 2PJ6A 3R96A 2O4HA 4KOSA 4J3GA 5F46A 4II9A 4UEEA 4MHZA 2P6EA 1LANA 3IIBA 4PK2A 4JLYA 4EWTA 2F8HA 4A94A 2A4NA 2RB7A 1ZG8A 2C27A 4R3LA 4CGLA 2PRQA 1LAPA 2VBQA 1MJ9A 2KCWA 4L8AA 3IGRA 1RO5A 4CGMA 3N5FA 4FD5A 2XEJA 4R76A 4DUKA 4MHPA 1VIXA 4OC5A 4XPDC 3SI0A 4NGPA 4UFVA 4UIAA 3FIXA 3QAHA 3T8WA 4AB7A 3KQXA 2ODFA 5EMIA 2PJ9A 3IFEA 4H6ZA 2ZEDA 4HNWB 3PB6X 4P4EA 1AYEA 2V8VA 3IC1A 4JJXA 3WC7A 2R98A 2BOAA 3I1UA 4NGRA 1Q2DA 4JXRA 4YGOA 1DTDA 2PJCA 3SXOA 1TF8A 4KOVA 5KTCA 3KGQA 3GKRA 3WC5A 1YMEA 1R43A 4YRHA 4R9MA 4IF5A 2JDCA 1VKCA 3TFYA 1ON0A 3FF3A 4FD4A 2ABZA 1M44A 3HUVA 3SI2A 2ZEHA 3FRMA 4KS9A 3CXQA 1LAMA 4M6GA 1MK4A 3P2FA 1M1DA 4QVTA 5KTDA 2G3AA 2ZW7A 2ZEOA 4EMEA 4JZ0A 1Z8TA 1GYTA 2ARHA 1YW6A 3IU1A 2PRBA 3K9TA 4NF1A 2IQ6A 4B10A 2EWBA 5ISVA 1KUVA 2EVNA 7CPAA 2ZXVA 1HDQA 1K4JA 1LOKA 2J8RA 3GUXA 4HNXB 3E0KA 4UCPA 4UCNA 4NGQA 3S6HA 2J8NA 4MCRA 2FIWA 4PQAA 4KOWA 4NSQA 2VQYA 2HQYA 3DDDA 4KZTA 3CPAA 1YR0A 4PK3A 4QB9A 2O28A 3PGPA 2C6GA 2PJ2A 4JD6A 3ZJ0A 2CIJA 5DWMA 2Y0MA 4MCQA 4XPDB 1QMUA 3FECA 5K8NA 4R87A 3T90A 2ZOFA 3DR6A 4P6YA 1Z4EA 4ZBGA 4ZX8A 4KUAA 4E0AA 4CGNA 1QSOA 4F0YA 4CAFA 2O53A 3RBUA 5LYIA 4IUSA 4C7IA 2Z0ZA 4PSWA 1M4DA 2K5TA 2PR8A 1IB1E 2QECA 3FXTA 2OZHA 4ZY0A 3I3GA 2GE3A 4AVCA 2WZNA 3F5BA 3G8WA 4FAIA 4A37A 1XMBA 2F5IA 2P6FA 4LX9A 4IAVA 4A2ZA 1YLEA 3D2MA 3PBBA 1VHOA 3S9MA 1YK3A 8CPAA 2B4BA 3UY5A 4LQGA 1KZFA 1M4IA 2FSRA 3QAYA 1R57A 4RS2A 4CYQA 4F0XA 1OZPA 3K9UA 4MHDA 1XE4A 2IMOA 3CT9A 3GYAA 3RZAA 3CXPA 1J4JA 1QSNA 2BCOA 4OADA 3WR7A 3L2NA 3H8EA 4H2KA 2JEWA 2RC4A 1GHEA 4C7HA 4UEFA 2WUUA 1TKHA 4NJQA 5LRKA 2BO9A 4MFPA 4QBJA 3B3VA 4TWEA 3R9GA 1JQGA 3DSBA 3A9LA 1Z8XA 5THWA 5JQ4A 4RUHA 2WSAA 4ZX9A 5H86A 4KVOE 3H4QA 4PSXA 4K3NA 1ZLHA 2AFWA 2V77A 4B5PA 1FT7A 4C2XA 2F7VA 1BPMA 3KR4A 5AGEA 2Q7BA 2VEZA 2Z3OA 3PRTA 4L89A 4MXUA 2WPWA 4UCMA 3BI1A 3EFAA 4AG9A 2ZELA 4CRYB 4F9UA 3FJUA 3IWGA 4FD7A 5EC4A 5LYDA 1Z5RA 4AXVA 4EVYA 3V8IA 2B58A 2QIRA 3D7FA 1ELMP 3NE8A 3PP9A 1CPSA 1X10A 4KOUA 3S9LA 2JDDA 1Z9UA 4M3SA 4A30A 3RNZA 4OC3A 3TO9A 1V0CA 2CNTA 4M85A 1YVOA 2EK9A 2B4DA 4RI1A 3VARA 2PJ0A 3QB8A 4ZI6A 2JBKA 3BJ8A 3FB3A 2B3UA 4OIWA 2P0WA 3KKWA 1CJWA 1Y9KA 2B3VA 2B4DB 5IB9A 3NA6A 5K8OA 1CX8A 5HMNA 3TT2A 1XMTA 5F49A 1AUGA 1NMTA 1F2PA 4B13A 4CRZB 5HXDA 4AG7A 1A2ZA 4A32A 1YW4A 2FVGA 4OC2A 1B87A 2Z3KA 2EUIA 2VL1A 1XEBA 2ZW6A 1IIDA 4MHYA 4CS0B 1Q7LA 1AMPA 2NMTA 2PSWA 1IYLA 2V8DA 3JTKA 3PEIA 5JGFA 3D2PA 5BWAB 4OP4A 3D3SA 3VH9A 3B35A 2Q4VA 2G9DA 1ZO0A 3SJEA 3TC8A 1IU8A 1Y0YA 1VHSA 1QSTA 5C88A 2PQ8A 4Q38A 4Z65A 2OZUA 2Z10A 3BI0A 5ELYA 3VWEA 1X12A 5K8PA 3OWCA 2ATRA 3MRUA 4EFDA 4KVXA 4KOYA 4NFRA 4HNYB 2B5GA 1OBRA 2JEVA 5A27A 1LFWA 2GLJA 1Q2YA 3KR5A 1SQHA 3PB4X 3C26A 3EO4A 2BSWA 4XNHC 4FWUA 3SI1A 3VWDA 2FL4A 2CNSA 2YGWA 3LWUA 5J8FA 4F8ZA 3JRUA 4ORFA 3ISZA 2AE6A 2Q51A 2FE7A 3RO0A 3NH8A 4B5OA 3PB8X 3B3TA 2AFOA 3IWWA 2VZZA 2XEFA 4LQ6A 1PCAA 4K30A 2ZEFA 4CAVA 4Q36A 1XF8A 1CPXA 2ZEEA 2EK8A 1NE9A 1EE3P 2BEIA 4YU9A 3FVLA 4UBRA 4M6HA 4P45A 4OIDA 4OMEA 1Z8LA 3TTHA 4C68A 1MJAA 2D4OA 3TOBA 4B14A 4R3KA 3B3WA 2VZYA 4C2ZA 1Y9WA 3WT4A 3D68A 3FMCA 5AG7A 2ZOGA 2DPTA 4KORA 2POKA 5AG6A 3FX6A 4Y49B 4KOXA 2Q0YA 4P10A 4CGPA 3MN8A 4X5KA 3FEDA 4E2AA 1IGBA 1TF9A 3CXSA 1CBXA 2BL1A 1L0CA 6CPAA 4BBHA 1CG2A 3LD2A 3VATA 3TOAA 5HVFA 3D66A 2YNCC 3PB7X 4MFLA 1N71A 4CGOA 5LYFA 4MFKA 3FH4A 3TX8A 4KUBA 3W6XA 4E8OA 3KASA 1NSLA 2Z11A 3EY5A 2Q7SA 4WJBA 2AJ6A 4BD9A 2J9AA 3F0AA 1BPNA 3PFOA 2YNDA 4A31A 4G1PA 4BMHA 1PU9A 4GXHA 3R9EA 3S6KA 3QNVA 4P44A 1RTQA 4KSFA 4OC1A 3KHZA 5K8MA 4FUUA 1I21A 3PFEA 5G22A 3NH5A 4MRIA 4OC4A 4PXEA 3W91A 3D7HA 2GFQA 2HV2A 2ZENA 4A95A 1ZG9A 2XEIA 3JUWA 3NFZA 1PUAA 4C2YA 3EXNA 3TE4A 1Z4RA 2GU2A
chains in the Genus database with same CATH topology
1QSRA 4QUSA 2PDOA 4UFWA 3I9SA 1S7LA 5G20A 4KSAA 2ZW4A 1XIXA 1S7KA 4B5PB 5F47A 5C82A 3FYNA 1S7NA 5G1ZA 5IB0A 1UFHA 2X7BA 4U5YA 3RYOA 3ZJ0A 1YREA 2D4PA 2FS5A 1WWZA 2BUEA 4CYPA 3S6FA 4MI4A 3P2HA 4MFZA 3BLNA 4CYNA 3D8PA 3DNSA 4UA3A 4CAEA 2GIVA 4ONUA 4KLVA 1CM0A 4A33A 3IWEA 3H5ZA 2HUZA 1I1DA 4LUAA 1M4GA 2CY2A 4XPLA 4CAWA 4OLLA 5HH1A 2OB0A 4I49A 2Q44A 3FNCA 3SXNA 4DNCA 1Y7RA 3EXNA 5G21A 4H6UA 4QC6A 3MGDA 2Z3NA 3GY9A 4ZGYB 5AG4A 1KUYA 5J8CA 2CNMA 4NXYA 4MJ8A 4UWIA 5GCNA 1P0HA 5F48A 2FIAA 4MFQA 4CAXA 2FCKA 3BJ7A 5E96A 2YNEA 5AG5A 5EBVA 4MY3A 1YVKA 2FT0A 2Z3MA 2IL4A 3W6SA 2Q04A 1S3ZA 2OH1A 4U9YA 1I12A 4NCZA 2PC1A 1BO4A 4FD6A 2Z3LA 2Z3PA 3FBUA 4KVME 4R57A 2QMLA 5KTAA 2Q4YA 3R9FA 2G0BA 4KOTA 5CNPA 2OU2A 4JXQA 5A28A 2JLMA 1B6BA 2R8VA 1TIQA 4H89A 2DPSA 1S60A 3N7ZA 3TO6A 2REFA 4F6AA 5IX3A 2B5GB 2CXAA 3B8GA 4NEXA 5JPHA 5H84A 2YNCA 4KLWA 1IICA 4XNHB 2ZPAA 2OZGA 3SHPA 2REEA 2I79A 4XPKA 4PV6A 5IV0A 4AVAA 3R95A 1P4NA 1QSMA 2R1IA 3EC4A 3F8KA 2VXKA 3NE7A 4Y49C 4B11A 4CYOA 2G3TA 5FVJA 1MJBA 1BOBA 2VI7A 1FY7A 4MBUA 4B12A 1KUXA 4U9ZA 4UWJA 4OAEA 3JVNA 1YX0A 1RXTA 3R1KA 3DR8A 4HKFA 2J8MA 3T9YA 3ZZIA 4MFJA 1LRZA 3G3SA 2FXFA 1Q2CA 4GS4A 4JWPA 2PR1A 4YFJA 4UFXA 3LODA 2I00A 1S7FA 2GANA 3IU2A 4AVBA 1U6MA 3TCVA 3S6GA 1WK4A 2ZW5A 3PZJA 1S5KA 1IYKA 2P6GA 2WPXA 5DWNA 2H5MA 2R7HA 2DXQA 4MY0A 1YGHA 3TO7A 5I0CA 3R96A 4KOSA 4J3GA 5F46A 4II9A 2P6EA 4PK2A 4JLYA 2A4NA 2C27A 4R3LA 4CGLA 2VBQA 1MJ9A 2KCWA 4L8AA 3IGRA 1RO5A 4CGMA 4FD5A 4XPDC 4UFVA 3FIXA 3QAHA 4AB7A 4H6ZA 4HNWB 4JJXA 2R98A 1Q2DA 4JXRA 4YGOA 3SXOA 4KOVA 5KTCA 3GKRA 4YRHA 4R9MA 4IF5A 2JDCA 1VKCA 3TFYA 1ON0A 4FD4A 1M44A 4KS9A 3FRMA 3CXQA 1MK4A 3P2FA 1M1DA 4QVTA 5KTDA 2G3AA 2ZW7A 3IU1A 2ARHA 2PRBA 4NF1A 4B10A 5ISVA 1KUVA 2EVNA 2ZXVA 1K4JA 2J8RA 4UCPA 4UCNA 4HNXB 3E0KA 3S6HA 2J8NA 2FIWA 4KOWA 4NSQA 2VQYA 2HQYA 3DDDA 4KZTA 1YR0A 4PK3A 4QB9A 2O28A 3PGPA 4JD6A 5DWMA 2Y0MA 4XPDB 4R87A 3T90A 3DR6A 1Z4EA 4ZBGA 4E0AA 4KUAA 4F0YA 4CGNA 1QSOA 4CAFA 4IUSA 4C7IA 2Z0ZA 4PSWA 1M4DA 2K5TA 2PR8A 1IB1E 2QECA 3FXTA 2OZHA 3I3GA 2GE3A 4AVCA 3F5BA 3G8WA 2F5IA 2P6FA 4LX9A 4A2ZA 1YLEA 3D2MA 1YK3A 2B4BA 3UY5A 1KZFA 1M4IA 2FSRA 1R57A 4RS2A 4CYQA 4F0XA 1OZPA 3K9UA 4MHDA 1XE4A 3GYAA 3CXPA 1J4JA 1QSNA 4OADA 3WR7A 2RC4A 1GHEA 4C7HA 2WUUA 4MFPA 4QBJA 3R9GA 3DSBA 3A9LA 5JQ4A 2WSAA 5H86A 4KVOE 3H4QA 4PSXA 4B5PA 4C2XA 5AGEA 2Q7BA 2VEZA 2Z3OA 4L89A 4UCMA 2WPWA 3EFAA 4AG9A 4CRYB 3IWGA 4FD7A 5EC4A 4EVYA 3V8IA 2B58A 2QIRA 3PP9A 4KOUA 2JDDA 1Z9UA 4M3SA 4A30A 3TO9A 1V0CA 2CNTA 4M85A 1YVOA 4RI1A 2B4DA 3QB8A 3BJ8A 3FB3A 2B3UA 2P0WA 3KKWA 1CJWA 1Y9KA 2B3VA 2B4DB 5HMNA 3TT2A 1XMTA 5F49A 1NMTA 4B13A 4CRZB 4AG7A 4A32A 1B87A 2Z3KA 2EUIA 1XEBA 2ZW6A 1IIDA 4CS0B 2PSWA 2NMTA 1IYLA 3JTKA 3D2PA 5BWAB 3D3SA 2Q4VA 1ZO0A 5C88A 1VHSA 1QSTA 2PQ8A 4Q38A 2OZUA 2Z10A 3VWEA 3OWCA 2ATRA 4KVXA 4KOYA 4HNYB 2B5GA 5A27A 2JEVA 1Q2YA 1SQHA 3C26A 3EO4A 2BSWA 4XNHC 3VWDA 2FL4A 2CNSA 2YGWA 5J8FA 4ORFA 2AE6A 2FE7A 4B5OA 2VZZA 4K30A 4CAVA 4Q36A 1XF8A 1NE9A 2BEIA 4UBRA 3TTHA 4C68A 1MJAA 2D4OA 3TOBA 4B14A 4R3KA 2VZYA 4C2ZA 1Y9WA 5AG7A 2DPTA 4KORA 5AG6A 4Y49B 2Q0YA 4CGPA 4X5KA 4E2AA 3CXSA 2BL1A 1L0CA 4BBHA 3LD2A 3TOAA 2YNCC 4MFLA 1N71A 4CGOA 4MFKA 3W6XA 4KUBA 4E8OA 1NSLA 2Z11A 3EY5A 2AJ6A 3F0AA 2YNDA 4A31A 4BMHA 1PU9A 3R9EA 3S6KA 4KSFA 1I21A 5G22A 3W91A 2HV2A 4A95A 3JUWA 1PUAA 4C2YA 4KOXA 3TE4A 1Z4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSR A;  4QUS A;  2PDO A;  3I9S A;  1S7L A;  2ZW4 A;  1XIX A;  1S7K A;  4B5P B;  5F47 A;  5C82 A;  3FYN A;  1S7N A;  5IB0 A;  1UFH A;  2X7B A;  4U5Y A;  3RYO A;  3ZJ0 A;  1YRE A;  2D4P A;  2FS5 A;  1WWZ A;  2BUE A;  3S6F A;  4MI4 A;  3P2H A;  3BLN A;  3D8P A;  3DNS A;  4UA3 A;  2GIV A;  4ONU A;  4KLV A;  1CM0 A;  2HUZ A;  1I1D A;  4LUA A;  1M4G A;  2CY2 A;  4XPL A;  4CAW A;  4OLL A;  5HH1 A;  2OB0 A;  2Q44 A;  4I49 A;  3FNC A;  3SXN A;  4DNC A;  1Y7R A;  3EXN A;  4H6U A;  4QC6 A;  3MGD A;  3GY9 A;  1KUY A;  2CNM A;  4NXY A;  4MJ8 A;  4UWI A;  5GCN A;  1P0H A;  5F48 A;  2FIA A;  4CAX A;  2FCK A;  3BJ7 A;  5E96 A;  5EBV A;  4MY3 A;  1YVK A;  2FT0 A;  2IL4 A;  3W6S A;  2Q04 A;  1S3Z A;  2OH1 A;  4U9Y A;  1I12 A;  4NCZ A;  2PC1 A;  1BO4 A;  4FD6 A;  3FBU A;  4KVM E;  4R57 A;  2QML A;  5KTA A;  2Q4Y A;  3R9F A;  2G0B A;  4KOT A;  5CNP A;  2OU2 A;  4JXQ A;  2JLM A;  1B6B A;  2R8V A;  1TIQ A;  4H89 A;  1S60 A;  3N7Z A;  3TO6 A;  2REF A;  4F6A A;  5IX3 A;  2B5G B;  3B8G A;  4NEX A;  5JPH A;  5H84 A;  4KLW A;  1IIC A;  4XNH B;  2ZPA A;  2OZG A;  3SHP A;  2REE A;  2I79 A;  4XPK A;  4PV6 A;  5IV0 A;  4AVA A;  3R95 A;  1P4N A;  1QSM A;  2R1I A;  3EC4 A;  3F8K A;  2VXK A;  3NE7 A;  4Y49 C;  2G3T A;  5FVJ A;  1MJB A;  1BOB A;  2VI7 A;  1FY7 A;  4MBU A;  1KUX A;  4U9Z A;  4UWJ A;  4OAE A;  3JVN A;  1YX0 A;  1RXT A;  3R1K A;  3DR8 A;  4HKF A;  2J8M A;  3T9Y A;  3ZZI A;  1LRZ A;  3G3S A;  2FXF A;  1Q2C A;  4GS4 A;  4JWP A;  2PR1 A;  4YFJ A;  3LOD A;  2I00 A;  1S7F A;  2GAN A;  4AVB A;  1U6M A;  3TCV A;  3S6G A;  1WK4 A;  2ZW5 A;  3PZJ A;  1S5K A;  1IYK A;  2P6G A;  2WPX A;  5DWN A;  2H5M A;  2R7H A;  2DXQ A;  4MY0 A;  1YGH A;  3TO7 A;  5I0C A;  3R96 A;  4KOS A;  4J3G A;  5F46 A;  4II9 A;  2P6E A;  4PK2 A;  4JLY A;  2A4N A;  2C27 A;  4R3L A;  2VBQ A;  1MJ9 A;  2KCW A;  4L8A A;  3IGR A;  1RO5 A;  4FD5 A;  4XPD C;  3FIX A;  3QAH A;  4AB7 A;  4H6Z A;  4HNW B;  4JJX A;  2R98 A;  1Q2D A;  4JXR A;  4YGO A;  3SXO A;  4KOV A;  5KTC A;  3GKR A;  4YRH A;  4R9M A;  4IF5 A;  2JDC A;  1VKC A;  3TFY A;  1ON0 A;  4FD4 A;  1M44 A;  3FRM A;  3CXQ A;  1MK4 A;  3P2F A;  1M1D A;  4QVT A;  5KTD A;  2G3A A;  2ZW7 A;  2ARH A;  2PRB A;  4NF1 A;  5ISV A;  1KUV A;  2EVN A;  2ZXV A;  1K4J A;  2J8R A;  4HNX B;  3E0K A;  3S6H A;  2J8N A;  2FIW A;  4KOW A;  4NSQ A;  2VQY A;  2HQY A;  3DDD A;  4KZT A;  1YR0 A;  4PK3 A;  4QB9 A;  2O28 A;  3PGP A;  4JD6 A;  5DWM A;  2Y0M A;  4XPD B;  4R87 A;  3T90 A;  3DR6 A;  1Z4E A;  4ZBG A;  4E0A A;  4KUA A;  4F0Y A;  1QSO A;  4IUS A;  2Z0Z A;  4PSW A;  1M4D A;  2K5T A;  2PR8 A;  1IB1 E;  2QEC A;  3FXT A;  2OZH A;  3I3G A;  2GE3 A;  4AVC A;  3F5B A;  3G8W A;  2F5I A;  2P6F A;  4LX9 A;  1YLE A;  3D2M A;  1YK3 A;  2B4B A;  3UY5 A;  1KZF A;  1M4I A;  2FSR A;  1R57 A;  4RS2 A;  1OZP A;  3K9U A;  4MHD A;  1XE4 A;  3GYA A;  3CXP A;  1J4J A;  1QSN A;  4OAD A;  3WR7 A;  2RC4 A;  1GHE A;  4QBJ A;  3R9G A;  3DSB A;  5JQ4 A;  5H86 A;  4KVO E;  3H4Q A;  4PSX A;  4B5P A;  2Q7B A;  2VEZ A;  4L89 A;  2WPW A;  3EFA A;  4AG9 A;  4CRY B;  3IWG A;  4FD7 A;  5EC4 A;  4EVY A;  3V8I A;  2B58 A;  2QIR A;  3PP9 A;  4KOU A;  2JDD A;  1Z9U A;  4M3S A;  3TO9 A;  1V0C A;  2CNT A;  4M85 A;  1YVO A;  4RI1 A;  2B4D A;  3QB8 A;  3BJ8 A;  3FB3 A;  2B3U A;  2P0W A;  3KKW A;  1CJW A;  1Y9K A;  2B3V A;  2B4D B;  5HMN A;  3TT2 A;  1XMT A;  5F49 A;  1NMT A;  4CRZ B;  4AG7 A;  1B87 A;  2EUI A;  1XEB A;  2ZW6 A;  1IID A;  4CS0 B;  2PSW A;  2NMT A;  1IYL A;  3D2P A;  3D3S A;  2Q4V A;  5C88 A;  1VHS A;  1QST A;  2PQ8 A;  2OZU A;  2Z10 A;  3VWE A;  3OWC A;  2ATR A;  4KVX A;  4KOY A;  4HNY B;  2B5G A;  2JEV A;  1Q2Y A;  1SQH A;  3C26 A;  3EO4 A;  2BSW A;  4XNH C;  3VWD A;  2FL4 A;  2CNS A;  5J8F A;  4ORF A;  2AE6 A;  2FE7 A;  4B5O A;  2VZZ A;  4K30 A;  4CAV A;  1XF8 A;  1NE9 A;  2BEI A;  4UBR A;  3TTH A;  1MJA A;  2D4O A;  3TOB A;  4R3K A;  2VZY A;  1Y9W A;  4KOR A;  4Y49 B;  2Q0Y A;  4X5K A;  4E2A A;  3CXS A;  2BL1 A;  1L0C A;  3LD2 A;  3TOA A;  1N71 A;  3W6X A;  4KUB A;  4E8O A;  1NSL A;  2Z11 A;  3EY5 A;  2AJ6 A;  3F0A A;  4BMH A;  1PU9 A;  3R9E A;  3S6K A;  1I21 A;  3W91 A;  2HV2 A;  3JUW A;  1PUA A;  5J8C A;  4KOX A;  3TE4 A;  1Z4R A; 
#chains in the Genus database with same CATH topology
 1QSR A;  4QUS A;  1F57 A;  2GLF A;  2PDO A;  3CPX A;  4UFW A;  3I9S A;  3KI9 A;  2OR4 A;  1YQE A;  1S7L A;  5G20 A;  1TKF A;  4KSA A;  2ZW4 A;  1XIX A;  1S7K A;  2PJ5 A;  4B5P B;  5F47 A;  3BXM A;  5C82 A;  3FYN A;  1S7N A;  4YWY A;  5G1Z A;  3GB0 A;  4R6T A;  5J1Q A;  5IB0 A;  1UFH A;  1FNO A;  3FEE A;  3ISX A;  2X7B A;  4U5Y A;  3RYO A;  1IOF A;  4MCP A;  3D7G A;  1YRE A;  1BLL E;  5DS0 A;  2D4P A;  2FS5 A;  1WWZ A;  2BUE A;  3IJ3 A;  4CYP A;  3S6F A;  4MI4 A;  3DGV A;  3P2H A;  4MFZ A;  3BLN A;  3SJG A;  4CYN A;  2DF5 A;  3D8P A;  3DNS A;  4UA3 A;  4CAE A;  1PYT B;  2GIV A;  2QJ8 A;  4DJL A;  4ONU A;  2Q43 A;  4KLV A;  4IHM A;  1CM0 A;  4A33 A;  3IWE A;  2DEA A;  3H5Z A;  2HUZ A;  1I1D A;  4LUA A;  4M6I A;  1M4G A;  2CY2 A;  1XFO A;  4XPL A;  4OC0 A;  5D29 A;  4CAW A;  4OLL A;  5HH1 A;  2OB0 A;  2Q44 A;  4I49 A;  1XRY A;  2ANP A;  3FNC A;  1YSJ A;  3BHX A;  3DLJ A;  4R7M A;  2PVW A;  4DNC A;  5JH9 A;  1ARM A;  2ZEG A;  1Y7R A;  3KZW A;  4UEZ A;  5G21 A;  1IOI A;  4H6U A;  4QC6 A;  3MGD A;  2Z3N A;  1KWM A;  3GY9 A;  4A38 A;  4WWV A;  4ZGY B;  2XEG A;  2EO8 A;  4MHN A;  2OOT A;  2ZEP A;  5AG4 A;  2NYQ A;  4PXB A;  4B6Z A;  2PJ1 A;  1KUY A;  4X8I A;  5J8C A;  2CNM A;  4NXY A;  4MJ8 A;  4NGS A;  1CP6 A;  2QYV A;  4ONW A;  3H8G A;  1P0H A;  4UWI A;  5GCN A;  3B3C A;  2CF4 A;  5F48 A;  2FIA A;  4CPA A;  3S9N A;  1ARL A;  3HLP A;  4MFQ A;  4CAX A;  2FCK A;  3BJ7 A;  5F09 A;  5E96 A;  3D67 A;  2YNE A;  4P4B A;  5AG5 A;  3PB9 X;  5EBV A;  4ZY2 A;  4MY3 A;  1YVK A;  1NSA A;  2PIZ A;  2FT0 A;  3B7I A;  5LYL A;  3GLJ A;  2Z3M A;  2I3C A;  2IL4 A;  3W6S A;  2Q04 A;  1S3Z A;  2JBJ A;  2OH1 A;  4UF4 A;  4U9Y A;  1I12 A;  4NCZ A;  3KHX A;  2PC1 A;  1QQ9 A;  3PBE A;  4W9Y A;  1BO4 A;  4FD6 A;  2Z3L A;  4TNU A;  1YLO A;  2Z3P A;  3FBU A;  4KVM E;  4R57 A;  4RN7 A;  3D7D A;  2QML A;  5KTA A;  2Q4Y A;  2V8G A;  2HC9 A;  5JM6 A;  2PJ3 A;  3R9F A;  2G0B A;  4FBE A;  2AFU A;  4KOT A;  5CNP A;  5LRG A;  3B3S A;  4A39 A;  2OU2 A;  3D4U A;  4JXQ A;  5A28 A;  2JLM A;  1B6B A;  2R8V A;  5I4M A;  1TIQ A;  5HVG A;  1UWY A;  1XJO A;  4H89 A;  2HB6 A;  2DPS A;  2PJB A;  2RFH A;  1S60 A;  1Y7E A;  3N7Z A;  4X2T A;  3TO6 A;  4MCS A;  2REF A;  4F6A A;  4F9V A;  1JWQ A;  2C6C A;  5IX3 A;  2B5G B;  2CXA A;  1TXR A;  3B8G A;  1BAV A;  4NEX A;  4NGN A;  5JPH A;  3B2Y A;  2CTB A;  5H84 A;  2AFZ A;  3KQZ A;  2YNC A;  4KLW A;  1IIC A;  4XNH B;  1XBU A;  2ZPA A;  3IO1 A;  2OZG A;  3SHP A;  5D8N A;  2REE A;  2I79 A;  5CBM A;  2QVP A;  2C1C A;  4XPK A;  2PJ8 A;  2V8H A;  4R8F A;  3NH4 A;  4PV6 A;  5IV0 A;  4AVA A;  3CDX A;  3R95 A;  3SXN A;  3H8F A;  1P4N A;  4P4D A;  1QSM A;  2R1I A;  4ZY1 A;  3EC4 A;  4OKO A;  3F8K A;  2VXK A;  3NE7 A;  3V38 A;  4Y49 C;  4B11 A;  4CYO A;  4BIN A;  2G3T A;  4P4F A;  2PCU A;  2PJA A;  4IK2 A;  5FVJ A;  3SJX A;  4GM5 A;  1MJB A;  1BOB A;  1ELL P;  1TKJ A;  2VI7 A;  1VHE A;  1VGY A;  3K2K A;  5HVH A;  1F2O A;  3WAB A;  3V7Z A;  1FY7 A;  2AFX A;  4MBU A;  4B12 A;  1KUX A;  4PXC A;  4U9Z A;  4UWJ A;  4DYO A;  4OAE A;  3JVN A;  1YX0 A;  1RXT A;  2PJ4 A;  3LAC A;  5CPA A;  3R1K A;  3SJF A;  3DR8 A;  4HKF A;  2J8M A;  3T9Y A;  1ZLI A;  4PXD A;  3ZZI A;  1Z2L A;  4MFJ A;  1LRZ A;  3G3S A;  2GRE A;  4NGT A;  2FXF A;  2PIY A;  2CTC A;  1Q2C A;  3LMS A;  1ZG7 A;  4GS4 A;  4JWP A;  2PR1 A;  4NGM A;  4YFJ A;  4KSI A;  4UFX A;  5LRJ A;  4NJR A;  2Q4Z A;  3LOD A;  1HDU A;  2I00 A;  2EBJ A;  1S7F A;  2AFS A;  1M4L A;  2GAN A;  4P4I A;  1Z8W A;  1IY7 A;  3IU2 A;  4P4J A;  4Q7A A;  1U6M A;  4AVB A;  1DE4 C;  3WC6 A;  2IJZ A;  4X3R A;  1XOV A;  2NSM A;  3TCV A;  4JYW A;  3RAM A;  3S6G A;  3IEH A;  1WK4 A;  3KL9 A;  2WYR A;  1CP7 A;  2ZW5 A;  1S5K A;  3PZJ A;  1HEE A;  4ZYQ A;  2PJ7 A;  2PE3 A;  2C6P A;  2ZEM A;  1LCP A;  1IYK A;  4MMO A;  2P6G A;  4UIB A;  2AFM A;  4O23 A;  2WPX A;  1Y0R A;  4HPS A;  5DWN A;  4PPZ A;  3CZX A;  2PVV A;  1H8L A;  3GIU A;  2H5M A;  1R3N A;  2DXQ A;  2R7H A;  4MY0 A;  1YGH A;  3TO7 A;  5I0C A;  2PJ6 A;  3R96 A;  2O4H A;  4KOS A;  4J3G A;  5F46 A;  4II9 A;  4UEE A;  4MHZ A;  2P6E A;  1LAN A;  3IIB A;  4PK2 A;  4JLY A;  4EWT A;  2F8H A;  4A94 A;  2A4N A;  2RB7 A;  1ZG8 A;  2C27 A;  4R3L A;  4CGL A;  2PRQ A;  1LAP A;  2VBQ A;  1MJ9 A;  2KCW A;  4L8A A;  3IGR A;  1RO5 A;  4CGM A;  3N5F A;  4FD5 A;  2XEJ A;  4R76 A;  4DUK A;  4MHP A;  1VIX A;  4OC5 A;  4XPD C;  3SI0 A;  4NGP A;  4UFV A;  4UIA A;  3FIX A;  3QAH A;  3T8W A;  4AB7 A;  3KQX A;  2ODF A;  5EMI A;  2PJ9 A;  3IFE A;  4H6Z A;  2ZED A;  4HNW B;  3PB6 X;  4P4E A;  1AYE A;  2V8V A;  3IC1 A;  4JJX A;  3WC7 A;  2R98 A;  2BOA A;  3I1U A;  4NGR A;  1Q2D A;  4JXR A;  4YGO A;  1DTD A;  2PJC A;  3SXO A;  1TF8 A;  4KOV A;  5KTC A;  3KGQ A;  3GKR A;  3WC5 A;  1YME A;  1R43 A;  4YRH A;  4R9M A;  4IF5 A;  2JDC A;  1VKC A;  3TFY A;  1ON0 A;  3FF3 A;  4FD4 A;  2ABZ A;  1M44 A;  3HUV A;  3SI2 A;  2ZEH A;  3FRM A;  4KS9 A;  3CXQ A;  1LAM A;  4M6G A;  1MK4 A;  3P2F A;  1M1D A;  4QVT A;  5KTD A;  2G3A A;  2ZW7 A;  2ZEO A;  4EME A;  4JZ0 A;  1Z8T A;  1GYT A;  2ARH A;  1YW6 A;  3IU1 A;  2PRB A;  3K9T A;  4NF1 A;  2IQ6 A;  4B10 A;  2EWB A;  5ISV A;  1KUV A;  2EVN A;  7CPA A;  2ZXV A;  1HDQ A;  1K4J A;  1LOK A;  2J8R A;  3GUX A;  4HNX B;  3E0K A;  4UCP A;  4UCN A;  4NGQ A;  3S6H A;  2J8N A;  4MCR A;  2FIW A;  4PQA A;  4KOW A;  4NSQ A;  2VQY A;  2HQY A;  3DDD A;  4KZT A;  3CPA A;  1YR0 A;  4PK3 A;  4QB9 A;  2O28 A;  3PGP A;  2C6G A;  2PJ2 A;  4JD6 A;  3ZJ0 A;  2CIJ A;  5DWM A;  2Y0M A;  4MCQ A;  4XPD B;  1QMU A;  3FEC A;  5K8N A;  4R87 A;  3T90 A;  2ZOF A;  3DR6 A;  4P6Y A;  1Z4E A;  4ZBG A;  4ZX8 A;  4KUA A;  4E0A A;  4CGN A;  1QSO A;  4F0Y A;  4CAF A;  2O53 A;  3RBU A;  5LYI A;  4IUS A;  4C7I A;  2Z0Z A;  4PSW A;  1M4D A;  2K5T A;  2PR8 A;  1IB1 E;  2QEC A;  3FXT A;  2OZH A;  4ZY0 A;  3I3G A;  2GE3 A;  4AVC A;  2WZN A;  3F5B A;  3G8W A;  4FAI A;  4A37 A;  1XMB A;  2F5I A;  2P6F A;  4LX9 A;  4IAV A;  4A2Z A;  1YLE A;  3D2M A;  3PBB A;  1VHO A;  3S9M A;  1YK3 A;  8CPA A;  2B4B A;  3UY5 A;  4LQG A;  1KZF A;  1M4I A;  2FSR A;  3QAY A;  1R57 A;  4RS2 A;  4CYQ A;  4F0X A;  1OZP A;  3K9U A;  4MHD A;  1XE4 A;  2IMO A;  3CT9 A;  3GYA A;  3RZA A;  3CXP A;  1J4J A;  1QSN A;  2BCO A;  4OAD A;  3WR7 A;  3L2N A;  3H8E A;  4H2K A;  2JEW A;  2RC4 A;  1GHE A;  4C7H A;  4UEF A;  2WUU A;  1TKH A;  4NJQ A;  5LRK A;  2BO9 A;  4MFP A;  4QBJ A;  3B3V A;  4TWE A;  3R9G A;  1JQG A;  3DSB A;  3A9L A;  1Z8X A;  5THW A;  5JQ4 A;  4RUH A;  2WSA A;  4ZX9 A;  5H86 A;  4KVO E;  3H4Q A;  4PSX A;  4K3N A;  1ZLH A;  2AFW A;  2V77 A;  4B5P A;  1FT7 A;  4C2X A;  2F7V A;  1BPM A;  3KR4 A;  5AGE A;  2Q7B A;  2VEZ A;  2Z3O A;  3PRT A;  4L89 A;  4MXU A;  2WPW A;  4UCM A;  3BI1 A;  3EFA A;  4AG9 A;  2ZEL A;  4CRY B;  4F9U A;  3FJU A;  3IWG A;  4FD7 A;  5EC4 A;  5LYD A;  1Z5R A;  4AXV A;  4EVY A;  3V8I A;  2B58 A;  2QIR A;  3D7F A;  1ELM P;  3NE8 A;  3PP9 A;  1CPS A;  1X10 A;  4KOU A;  3S9L A;  2JDD A;  1Z9U A;  4M3S A;  4A30 A;  3RNZ A;  4OC3 A;  3TO9 A;  1V0C A;  2CNT A;  4M85 A;  1YVO A;  2EK9 A;  2B4D A;  4RI1 A;  3VAR A;  2PJ0 A;  3QB8 A;  4ZI6 A;  2JBK A;  3BJ8 A;  3FB3 A;  2B3U A;  4OIW A;  2P0W A;  3KKW A;  1CJW A;  1Y9K A;  2B3V A;  2B4D B;  5IB9 A;  3NA6 A;  5K8O A;  1CX8 A;  5HMN A;  3TT2 A;  1XMT A;  5F49 A;  1AUG A;  1NMT A;  1F2P A;  4B13 A;  4CRZ B;  5HXD A;  4AG7 A;  1A2Z A;  4A32 A;  1YW4 A;  2FVG A;  4OC2 A;  1B87 A;  2Z3K A;  2EUI A;  2VL1 A;  1XEB A;  2ZW6 A;  1IID A;  4MHY A;  4CS0 B;  1Q7L A;  1AMP A;  2NMT A;  2PSW A;  1IYL A;  2V8D A;  3JTK A;  3PEI A;  5JGF A;  3D2P A;  5BWA B;  4OP4 A;  3D3S A;  3VH9 A;  3B35 A;  2Q4V A;  2G9D A;  1ZO0 A;  3SJE A;  3TC8 A;  1IU8 A;  1Y0Y A;  1VHS A;  1QST A;  5C88 A;  2PQ8 A;  4Q38 A;  4Z65 A;  2OZU A;  2Z10 A;  3BI0 A;  5ELY A;  3VWE A;  1X12 A;  5K8P A;  3OWC A;  2ATR A;  3MRU A;  4EFD A;  4KVX A;  4KOY A;  4NFR A;  4HNY B;  2B5G A;  1OBR A;  2JEV A;  5A27 A;  1LFW A;  2GLJ A;  1Q2Y A;  3KR5 A;  1SQH A;  3PB4 X;  3C26 A;  3EO4 A;  2BSW A;  4XNH C;  4FWU A;  3SI1 A;  3VWD A;  2FL4 A;  2CNS A;  2YGW A;  3LWU A;  5J8F A;  4F8Z A;  3JRU A;  4ORF A;  3ISZ A;  2AE6 A;  2Q51 A;  2FE7 A;  3RO0 A;  3NH8 A;  4B5O A;  3PB8 X;  3B3T A;  2AFO A;  3IWW A;  2VZZ A;  2XEF A;  4LQ6 A;  1PCA A;  4K30 A;  2ZEF A;  4CAV A;  4Q36 A;  1XF8 A;  1CPX A;  2ZEE A;  2EK8 A;  1NE9 A;  1EE3 P;  2BEI A;  4YU9 A;  3FVL A;  4UBR A;  4M6H A;  4P45 A;  4OID A;  4OME A;  1Z8L A;  3TTH A;  4C68 A;  1MJA A;  2D4O A;  3TOB A;  4B14 A;  4R3K A;  3B3W A;  2VZY A;  4C2Z A;  1Y9W A;  3WT4 A;  3D68 A;  3FMC A;  5AG7 A;  2ZOG A;  2DPT A;  4KOR A;  2POK A;  5AG6 A;  3FX6 A;  4Y49 B;  4KOX A;  2Q0Y A;  4P10 A;  4CGP A;  3MN8 A;  4X5K A;  3FED A;  4E2A A;  1IGB A;  1TF9 A;  3CXS A;  1CBX A;  2BL1 A;  1L0C A;  6CPA A;  4BBH A;  1CG2 A;  3LD2 A;  3VAT A;  3TOA A;  5HVF A;  3D66 A;  2YNC C;  3PB7 X;  4MFL A;  1N71 A;  4CGO A;  5LYF A;  4MFK A;  3FH4 A;  3TX8 A;  4KUB A;  3W6X A;  4E8O A;  3KAS A;  1NSL A;  2Z11 A;  3EY5 A;  2Q7S A;  4WJB A;  2AJ6 A;  4BD9 A;  2J9A A;  3F0A A;  1BPN A;  3PFO A;  2YND A;  4A31 A;  4G1P A;  4BMH A;  1PU9 A;  4GXH A;  3R9E A;  3S6K A;  3QNV A;  4P44 A;  1RTQ A;  4KSF A;  4OC1 A;  3KHZ A;  5K8M A;  4FUU A;  1I21 A;  3PFE A;  5G22 A;  3NH5 A;  4MRI A;  4OC4 A;  4PXE A;  3W91 A;  3D7H A;  2GFQ A;  2HV2 A;  2ZEN A;  4A95 A;  1ZG9 A;  2XEI A;  3JUW A;  3NFZ A;  1PUA A;  4C2Y A;  3EXN A;  3TE4 A;  1Z4R A;  2GU2 A; 
#chains in the Genus database with same CATH homology
 1QSR A;  4QUS A;  2PDO A;  4UFW A;  3I9S A;  1S7L A;  5G20 A;  4KSA A;  2ZW4 A;  1XIX A;  1S7K A;  4B5P B;  5F47 A;  5C82 A;  3FYN A;  1S7N A;  5G1Z A;  5IB0 A;  1UFH A;  2X7B A;  4U5Y A;  3RYO A;  3ZJ0 A;  1YRE A;  2D4P A;  2FS5 A;  1WWZ A;  2BUE A;  4CYP A;  3S6F A;  4MI4 A;  3P2H A;  4MFZ A;  3BLN A;  4CYN A;  3D8P A;  3DNS A;  4UA3 A;  4CAE A;  2GIV A;  4ONU A;  4KLV A;  1CM0 A;  4A33 A;  3IWE A;  3H5Z A;  2HUZ A;  1I1D A;  4LUA A;  1M4G A;  2CY2 A;  4XPL A;  4CAW A;  4OLL A;  5HH1 A;  2OB0 A;  4I49 A;  2Q44 A;  3FNC A;  3SXN A;  4DNC A;  1Y7R A;  3EXN A;  5G21 A;  4H6U A;  4QC6 A;  3MGD A;  2Z3N A;  3GY9 A;  4ZGY B;  5AG4 A;  1KUY A;  5J8C A;  2CNM A;  4NXY A;  4MJ8 A;  4UWI A;  5GCN A;  1P0H A;  5F48 A;  2FIA A;  4MFQ A;  4CAX A;  2FCK A;  3BJ7 A;  5E96 A;  2YNE A;  5AG5 A;  5EBV A;  4MY3 A;  1YVK A;  2FT0 A;  2Z3M A;  2IL4 A;  3W6S A;  2Q04 A;  1S3Z A;  2OH1 A;  4U9Y A;  1I12 A;  4NCZ A;  2PC1 A;  1BO4 A;  4FD6 A;  2Z3L A;  2Z3P A;  3FBU A;  4KVM E;  4R57 A;  2QML A;  5KTA A;  2Q4Y A;  3R9F A;  2G0B A;  4KOT A;  5CNP A;  2OU2 A;  4JXQ A;  5A28 A;  2JLM A;  1B6B A;  2R8V A;  1TIQ A;  4H89 A;  2DPS A;  1S60 A;  3N7Z A;  3TO6 A;  2REF A;  4F6A A;  5IX3 A;  2B5G B;  2CXA A;  3B8G A;  4NEX A;  5JPH A;  5H84 A;  2YNC A;  4KLW A;  1IIC A;  4XNH B;  2ZPA A;  2OZG A;  3SHP A;  2REE A;  2I79 A;  4XPK A;  4PV6 A;  5IV0 A;  4AVA A;  3R95 A;  1P4N A;  1QSM A;  2R1I A;  3EC4 A;  3F8K A;  2VXK A;  3NE7 A;  4Y49 C;  4B11 A;  4CYO A;  2G3T A;  5FVJ A;  1MJB A;  1BOB A;  2VI7 A;  1FY7 A;  4MBU A;  4B12 A;  1KUX A;  4U9Z A;  4UWJ A;  4OAE A;  3JVN A;  1YX0 A;  1RXT A;  3R1K A;  3DR8 A;  4HKF A;  2J8M A;  3T9Y A;  3ZZI A;  4MFJ A;  1LRZ A;  3G3S A;  2FXF A;  1Q2C A;  4GS4 A;  4JWP A;  2PR1 A;  4YFJ A;  4UFX A;  3LOD A;  2I00 A;  1S7F A;  2GAN A;  3IU2 A;  4AVB A;  1U6M A;  3TCV A;  3S6G A;  1WK4 A;  2ZW5 A;  3PZJ A;  1S5K A;  1IYK A;  2P6G A;  2WPX A;  5DWN A;  2H5M A;  2R7H A;  2DXQ A;  4MY0 A;  1YGH A;  3TO7 A;  5I0C A;  3R96 A;  4KOS A;  4J3G A;  5F46 A;  4II9 A;  2P6E A;  4PK2 A;  4JLY A;  2A4N A;  2C27 A;  4R3L A;  4CGL A;  2VBQ A;  1MJ9 A;  2KCW A;  4L8A A;  3IGR A;  1RO5 A;  4CGM A;  4FD5 A;  4XPD C;  4UFV A;  3FIX A;  3QAH A;  4AB7 A;  4H6Z A;  4HNW B;  4JJX A;  2R98 A;  1Q2D A;  4JXR A;  4YGO A;  3SXO A;  4KOV A;  5KTC A;  3GKR A;  4YRH A;  4R9M A;  4IF5 A;  2JDC A;  1VKC A;  3TFY A;  1ON0 A;  4FD4 A;  1M44 A;  4KS9 A;  3FRM A;  3CXQ A;  1MK4 A;  3P2F A;  1M1D A;  4QVT A;  5KTD A;  2G3A A;  2ZW7 A;  3IU1 A;  2ARH A;  2PRB A;  4NF1 A;  4B10 A;  5ISV A;  1KUV A;  2EVN A;  2ZXV A;  1K4J A;  2J8R A;  4UCP A;  4UCN A;  4HNX B;  3E0K A;  3S6H A;  2J8N A;  2FIW A;  4KOW A;  4NSQ A;  2VQY A;  2HQY A;  3DDD A;  4KZT A;  1YR0 A;  4PK3 A;  4QB9 A;  2O28 A;  3PGP A;  4JD6 A;  5DWM A;  2Y0M A;  4XPD B;  4R87 A;  3T90 A;  3DR6 A;  1Z4E A;  4ZBG A;  4E0A A;  4KUA A;  4F0Y A;  4CGN A;  1QSO A;  4CAF A;  4IUS A;  4C7I A;  2Z0Z A;  4PSW A;  1M4D A;  2K5T A;  2PR8 A;  1IB1 E;  2QEC A;  3FXT A;  2OZH A;  3I3G A;  2GE3 A;  4AVC A;  3F5B A;  3G8W A;  2F5I A;  2P6F A;  4LX9 A;  4A2Z A;  1YLE A;  3D2M A;  1YK3 A;  2B4B A;  3UY5 A;  1KZF A;  1M4I A;  2FSR A;  1R57 A;  4RS2 A;  4CYQ A;  4F0X A;  1OZP A;  3K9U A;  4MHD A;  1XE4 A;  3GYA A;  3CXP A;  1J4J A;  1QSN A;  4OAD A;  3WR7 A;  2RC4 A;  1GHE A;  4C7H A;  2WUU A;  4MFP A;  4QBJ A;  3R9G A;  3DSB A;  3A9L A;  5JQ4 A;  2WSA A;  5H86 A;  4KVO E;  3H4Q A;  4PSX A;  4B5P A;  4C2X A;  5AGE A;  2Q7B A;  2VEZ A;  2Z3O A;  4L89 A;  4UCM A;  2WPW A;  3EFA A;  4AG9 A;  4CRY B;  3IWG A;  4FD7 A;  5EC4 A;  4EVY A;  3V8I A;  2B58 A;  2QIR A;  3PP9 A;  4KOU A;  2JDD A;  1Z9U A;  4M3S A;  4A30 A;  3TO9 A;  1V0C A;  2CNT A;  4M85 A;  1YVO A;  4RI1 A;  2B4D A;  3QB8 A;  3BJ8 A;  3FB3 A;  2B3U A;  2P0W A;  3KKW A;  1CJW A;  1Y9K A;  2B3V A;  2B4D B;  5HMN A;  3TT2 A;  1XMT A;  5F49 A;  1NMT A;  4B13 A;  4CRZ B;  4AG7 A;  4A32 A;  1B87 A;  2Z3K A;  2EUI A;  1XEB A;  2ZW6 A;  1IID A;  4CS0 B;  2PSW A;  2NMT A;  1IYL A;  3JTK A;  3D2P A;  5BWA B;  3D3S A;  2Q4V A;  1ZO0 A;  5C88 A;  1VHS A;  1QST A;  2PQ8 A;  4Q38 A;  2OZU A;  2Z10 A;  3VWE A;  3OWC A;  2ATR A;  4KVX A;  4KOY A;  4HNY B;  2B5G A;  5A27 A;  2JEV A;  1Q2Y A;  1SQH A;  3C26 A;  3EO4 A;  2BSW A;  4XNH C;  3VWD A;  2FL4 A;  2CNS A;  2YGW A;  5J8F A;  4ORF A;  2AE6 A;  2FE7 A;  4B5O A;  2VZZ A;  4K30 A;  4CAV A;  4Q36 A;  1XF8 A;  1NE9 A;  2BEI A;  4UBR A;  3TTH A;  4C68 A;  1MJA A;  2D4O A;  3TOB A;  4B14 A;  4R3K A;  2VZY A;  4C2Z A;  1Y9W A;  5AG7 A;  2DPT A;  4KOR A;  5AG6 A;  4Y49 B;  2Q0Y A;  4CGP A;  4X5K A;  4E2A A;  3CXS A;  2BL1 A;  1L0C A;  4BBH A;  3LD2 A;  3TOA A;  2YNC C;  4MFL A;  1N71 A;  4CGO A;  4MFK A;  3W6X A;  4KUB A;  4E8O A;  1NSL A;  2Z11 A;  3EY5 A;  2AJ6 A;  3F0A A;  2YND A;  4A31 A;  4BMH A;  1PU9 A;  3R9E A;  3S6K A;  4KSF A;  1I21 A;  5G22 A;  3W91 A;  2HV2 A;  4A95 A;  3JUW A;  1PUA A;  4C2Y A;  4KOX A;  3TE4 A;  1Z4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...