1YR0A

Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
163
structure length
163
Chain Sequence
b'SVELRDATVDDLSGIMEIYNDAVVNTTAIWNEVVVDLENRKDWFAARTSRGFPVIVAILDGKVAGYASYGDWRAFDGYRHTREHSVYVHKDARGHGIGKRLMQALIDHAGGNDVHVLIAAIEAENTASIRLHESLGFRVVGRFSEVGTKFGRWLDLTCMELKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphinothricin acetyltransferase
molecule tags Transferase
source organism Agrobacterium tumefaciens str.
publication title Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
rcsb
total genus 44
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yr0A00
3TT2A 2Q0YA 2HQYA 3S6GA 4YFJA 2ZW4A 4R9MA 3IWGA 4QB9A 3E0KA 3B8GA 2EVNA 4PSWA 3P2HA 3I9SA 4KOWA 1S7LA 3LD2A 1PUAA 5I0CA 3UY5A 4XPLA 4AVAA 1J4JA 4R57A 1VKCA 1YR0A 4KUAA 5EC4A 2CNMA 3PP9A 2ZPAA 4JLYA 4R3LA 4KORA 3FIXA 4NCZA 1KUXA 2X7BA 3C26A 1N71A 2B3UA 3FRMA 2B5GB 3PGPA 4L89A 1YREA 3FYNA 4FD7A 4UWJA 2B4DB 4RI1A 4B5PB 4HNWB 2R98A 2PC1A 5JPHA 2Q7BA 5J8FA 1BO4A 5F49A 3I3GA 4HKFA 2O28A 4X5KA 3EO4A 1U6MA 2JDDA 3RYOA 1Z4RA 2I79A 4HNXB 2VZZA 4XPDC 3QB8A 4H6UA 2REEA 4KOUA 2VXKA 1FY7A 1M4GA 2G0BA 4KVXA 3WR7A 4DNCA 1QSNA 2BUEA 4XPKA 3VWEA 4Y49C 2ZW7A 2EUIA 4U5YA 4MY3A 1RXTA 1TIQA 4AG9A 3GY9A 4R3KA 2CY2A 1YGHA 2FIWA 1OZPA 3K9UA 3QAHA 2JLMA 3V8IA 2CNTA 4PK3A 2VBQA 3D8PA 3OWCA 1S5KA 3H4QA 3CXQA 5F46A 3S6KA 1SQHA 1UFHA 1NSLA 3GYAA 3GKRA 4KLWA 1YVOA 4K30A 5IB0A 3TCVA 1MJAA 3DDDA 5CNPA 1KUVA 2Q4YA 3DR6A 3TO7A 3MGDA 4B5PA 1BOBA 1L0CA 4YGOA 4KUBA 4QBJA 1QSTA 2JDCA 1VHSA 3BLNA 2D4PA 2OB0A 1S7FA 4XNHB 4II9A 2A4NA 4KOXA 4NEXA 2B5GA 1S3ZA 2P6FA 1M1DA 3TFYA 3FB3A 3CXPA 4AVBA 3ZZIA 2F5IA 2ATRA 2ZW5A 5JQ4A 4U9YA 5ISVA 3NE7A 1S60A 1R57A 2Q4VA 1YX0A 1MJ9A 5F48A 1QSOA 4KVOE 5GCNA 4YRHA 2FE7A 3JUWA 5H84A 5IX3A 2OZUA 1WWZA 4E8OA 1PU9A 3D2PA 2HV2A 4PV6A 2REFA 2PQ8A 1YVKA 4NSQA 4CRYB 2G3AA 4OLLA 4KVME 5J8CA 5EBVA 2VQYA 2Q44A 4MJ8A 2WPWA 2PRBA 4QUSA 1RO5A 4R87A 1NE9A 1MJBA 4UBRA 4QC6A 4AB7A 1QSMA 4FD4A 2D4OA 2J8RA 2ARHA 2FIAA 1B6BA 1P0HA 3SXNA 5E96A 2GE3A 1IIDA 1Y7RA 2P0WA 1Z9UA 1Q2CA 1S7KA 3IGRA 4KLVA 3R9GA 4OAEA 1Z4EA 1Q2DA 1KUYA 1IYLA 2FCKA 4QVTA 4MBUA 3P2FA 4B5OA 4LX9A 1LRZA 1I21A 4KOSA 4AVCA 2ZXVA 3S6HA 4XNHC 2PR8A 1Y9KA 3R9FA 2QECA 2FS5A 1XF8A 3S6FA 2FSRA 4LUAA 4JXQA 4IF5A 2PSWA 5KTCA 1M44A 4AG7A 2AJ6A 4CAWA 1Y9WA 4JXRA 1CJWA 4E0AA 4MHDA 4FD6A 1Q2YA 2B4DA 2CNSA 4CAVA 2J8MA 2QMLA 4JD6A 4M85A 4UWIA 1NMTA 3TO6A 3PZJA 5DWNA 4MI4A 2Y0MA 4ZBGA 2VI7A 4RS2A 3TOAA 2K5TA 4EVYA 4F0YA 3EC4A 3G8WA 1QSRA 4J3GA 2R7HA 4CRZB 3N7ZA 2GIVA 4Y49B 2OH1A 3DR8A 5KTAA 1XEBA 2ZW6A 4NXYA 1XMTA 3W91A 3TE4A 2IL4A 4XPDB 1IYKA 2FL4A 3EXNA 3FBUA 2OZGA 2P6EA 2BSWA 4UA3A 2R8VA 3R1KA 3TOBA 3T9YA 2JEVA 4HNYB 3CXSA 3DNSA 2AE6A 5C88A 3SHPA 1I12A 2FT0A 2RC4A 3D2MA 4H89A 1KZFA 4NF1A 5HH1A 3F8KA 2GANA 1GHEA 2NMTA 4M3SA 3ZJ0A 3BJ8A 5IV0A 4H6ZA 1IICA 1M4DA 3EFAA 4CAXA 4U9ZA 3F0AA 3W6XA 5KTDA 4CS0B 1K4JA 1P4NA 5FVJA 3R95A 1WK4A 1YK3A 3TO9A 3BJ7A 3FNCA 2B3VA 2OZHA 5DWMA 2I00A 3F5BA 3VWDA 3G3SA 2WPXA 3R9EA 4KZTA 3LODA 3T90A 2KCWA 4ONUA 5H86A 5C82A 4L8AA 4ORFA 2VZYA 2QIRA 2BL1A 2Q04A 4IUSA 5F47A 4E2AA 2J8NA 4BMHA 4JWPA 2DXQA 2FXFA 2G3TA 2Z11A 3W6SA 4OADA 2VEZA 4I49A 1XIXA 1B87A 4FD5A 2PDOA 4PSXA 1V0CA 1M4IA 3TTHA 2B4BA 4MY0A 1S7NA 1XE4A 1CM0A 4KOTA 2OU2A 2Z0ZA 2B58A 3D3SA 4GS4A 4PK2A 3EY5A 3SXOA 1MK4A 1IB1E 1YLEA 2BEIA 1ON0A 2H5MA 4KOVA 3JVNA 5HMNA 3KKWA 2P6GA 4F6AA 3DSBA 2PR1A 2R1IA 1I1DA 3R96A 2HUZA 4KOYA 2Z10A 2C27A 4JJXA 3FXTA
chains in the Genus database with same CATH superfamily
5HXDA 3FH4A 1Z2LA 4UIBA 5A28A 2DPSA 4H2KA 2QVPA 2OR4A 4K3NA 3TT2A 1XBUA 3DGVA 4ZGYB 5F09A 2Q0YA 4GM5A 2HQYA 3S6GA 4BBHA 3IU1A 4MHYA 4YFJA 2ZW4A 4M6IA 4R9MA 3PFOA 4AXVA 3IWGA 4QB9A 1IU8A 3A9LA 3E0KA 3B8GA 1IGBA 2EVNA 4PSWA 3CDXA 3P2HA 3I9SA 4KOWA 2PJ3A 1S7LA 3LD2A 4EWTA 1PUAA 3HUVA 3CPXA 4KSFA 5G20A 3UY5A 3I1UA 5I0CA 2BCOA 3IEHA 4A31A 4XPLA 4B14A 4B11A 4MXUA 1J4JA 4AVAA 1CBXA 1VKCA 2YGWA 4R57A 2Q4ZA 3NH4A 4OIWA 1YR0A 4OC3A 4KUAA 5EC4A 2CNMA 1AMPA 3PP9A 2ZPAA 4MMOA 3D7GA 4JLYA 4R3LA 4A94A 4KORA 1YW4A 3FIXA 4NCZA 3SJXA 2VL1A 4IHMA 3IC1A 1KUXA 3TX8A 2X7BA 5K8MA 3C26A 1N71A 3D68A 4CYQA 2B3UA 3FRMA 3PB9X 2EK8A 4Q7AA 2B5GB 1XRYA 3PGPA 3PRTA 1Z5RA 2Z3MA 2PJ1A 2ZEMA 4L89A 2Q7SA 1YREA 2HC9A 5D8NA 3RNZA 1Y0RA 4R8FA 1Y0YA 4UFWA 3FYNA 4FD7A 3FEEA 2B4DB 4UWJA 4ZY1A 4P4IA 3FECA 4NGNA 4FUUA 4UIAA 2PE3A 3KGQA 4P45A 4RI1A 4B5PB 4C2XA 4HNWB 2R98A 2PC1A 4Q36A 3SJFA 4BD9A 5JPHA 2Q7BA 4CGMA 5J8FA 2ZEDA 1BO4A 5F49A 4P4DA 3I3GA 4HKFA 1TKHA 2RFHA 2O28A 4X5KA 3EO4A 1F2OA 5JGFA 1CPSA 1U6MA 2JDDA 3RYOA 1CX8A 4OKOA 1Z4RA 2I79A 4HNXB 4OC1A 2VZZA 4XPDC 5G1ZA 4ZX9A 3QB8A 4H6UA 4RN7A 2REEA 4KOUA 1FY7A 1M4GA 2VXKA 2G0BA 4KVXA 3WR7A 4NGSA 1QSNA 2BUEA 4XPKA 4DNCA 3QAYA 4CGOA 3VWEA 4Y49C 4EFDA 5LRKA 2ZW7A 2EUIA 5CBMA 4U5YA 3FMCA 4MY3A 2IMOA 1RXTA 2V8DA 1TIQA 3FF3A 4AG9A 3GY9A 4R3KA 3SI0A 1ZLHA 2CY2A 3CPAA 1YGHA 3D66A 4A2ZA 1X10A 2FIWA 1OZPA 3K9UA 3QAHA 2JLMA 3IIBA 2Z3PA 4B12A 2POKA 3V8IA 2CNTA 1CP6A 4PK3A 1ZG8A 2J9AA 3PB4X 5HVFA 2VBQA 3D8PA 2IJZA 1S5KA 3H4QA 3OWCA 3CXQA 2PJ0A 5F46A 2BO9A 5LYLA 3WC5A 3WC6A 3S6KA 1SQHA 1UFHA 4MFZA 1NSLA 3GYAA 4UCMA 3GKRA 3PB7X 4KLWA 1YVOA 3GUXA 4K30A 1DTDA 1R3NA 4HPSA 5ELYA 3TCVA 5I4MA 5IB0A 1MJAA 3DDDA 5DS0A 2AFMA 5CNPA 1X12A 5AG6A 1KUVA 2Q4YA 3V38A 1LOKA 2WYRA 3CZXA 3DR6A 3RO0A 3TO7A 3MGDA 3N5FA 4B5PA 1H8LA 4CYPA 4R6TA 1BOBA 3QNVA 5HVGA 2DF5A 4OP4A 3KR4A 1L0CA 4YGOA 4Z65A 4KUBA 4DJLA 4QBJA 1QQ9A 1QSTA 2JDCA 2Z3NA 1ZG7A 1VHSA 3NA6A 3BLNA 4YU9A 2AFZA 5A27A 2D4PA 4MFLA 2OB0A 1S7FA 4P4JA 4XNHB 4B6ZA 4II9A 4MFJA 1Z8WA 2A4NA 2ZEEA 4KOXA 1TKJA 4NEXA 2B5GA 1Q7LA 1EE3P 1S3ZA 2GFQA 4P4EA 3KHXA 5EMIA 4OIDA 2P6FA 1M1DA 3TFYA 2HB6A 1TF9A 4UCPA 3FB3A 3H8EA 4P10A 3CXPA 2PIZA 4AVBA 3ZZIA 2F5IA 1NSAA 2ATRA 2CXAA 2ZENA 2ZW5A 5JQ4A 3H8FA 4U9YA 5ISVA 3NE7A 4MFPA 2YNDA 1S60A 1R57A 2Q4VA 1YX0A 1MJ9A 2PVVA 4NGRA 5F48A 5G21A 1QSOA 4A33A 2PJCA 4PXDA 3BHXA 4DUKA 4A95A 1XFOA 2NSMA 1VHEA 4KVOE 5GCNA 1LCPA 3IO1A 1Y7EA 4YRHA 2FE7A 3JUWA 1IY7A 5H84A 2OOTA 5IX3A 2OZUA 1WWZA 4IK2A 5LYIA 4E8OA 1PU9A 5HVHA 3D2PA 4PPZA 2HV2A 4PV6A 2REFA 2PQ8A 2CIJA 2EWBA 3MRUA 1YVKA 3FVLA 4NSQA 2PJ2A 4MCQA 4CRYB 1BLLE 4LQGA 4O23A 1IOFA 2G3AA 4OLLA 1CG2A 4OC4A 3D7FA 2PCUA 4KVME 5J8CA 1YMEA 3WT4A 5EBVA 3LACA 2Z3KA 2VQYA 1A2ZA 2Q44A 2I3CA 4CAEA 2O4HA 2GLJA 2JBJA 2XEIA 1FT7A 4MJ8A 2WPWA 2Z3OA 4UEFA 4MHNA 2WSAA 2PRBA 1RO5A 4QUSA 4R87A 3FJUA 4C7IA 1NE9A 1MJBA 2ZEGA 3KI9A 4UBRA 4MCRA 1ARMA 4NFRA 2ZEPA 3V7ZA 4ZYQA 4QC6A 4AB7A 1QSMA 4FD4A 2D4OA 2J8RA 2ARHA 2FIAA 3RAMA 1YLOA 3KR5A 1B6BA 3SI2A 1TXRA 3GB0A 3KL9A 1P0HA 3LWUA 3VH9A 5JH9A 2PJBA 2PJAA 3B3VA 1YQEA 3HLPA 3SXNA 5E96A 2GE3A 3T8WA 3B3SA 5JM6A 1IIDA 2O53A 5K8PA 1Y7RA 4A30A 2P0WA 2ZELA 4NGPA 4BINA 1Z9UA 1Q2CA 1S7KA 3H5ZA 3IGRA 5G22A 4UFVA 3S9MA 1CP7A 2QYVA 3K9TA 4KLVA 4ZX8A 4EMEA 3B7IA 4X3RA 4PQAA 3R9GA 4OAEA 1Z8TA 1Z4EA 2EK9A 4A38A 1Q2DA 1KUYA 2XEFA 4RUHA 1IYLA 2FCKA 3PEIA 2AFUA 4QVTA 1XJOA 4MBUA 2C6CA 3P2FA 2PJ9A 4B5OA 1XMBA 4TNUA 5AGEA 4LX9A 1LRZA 2CTCA 1AYEA 1I21A 3D7HA 4KOSA 4A37A 4KSAA 4P44A 5LYDA 2ZXVA 4AVCA 6CPAA 3S6HA 4MHZA 1LAPA 4A39A 1CPXA 4XNHC 2PR8A 2Z3LA 5K8OA 1Y9KA 3R9FA 2QECA 2ZEOA 2FS5A 1XF8A 4C7HA 3S6FA 1XOVA 2ZOGA 2FSRA 3KQXA 4LUAA 4MRIA 4JXQA 3FX6A 3DLJA 2AFSA 5IB9A 1JQGA 3IWEA 4JZ0A 1VHOA 2AFXA 4IF5A 4NJRA 2PSWA 2F8HA 1AUGA 5LYFA 2GREA 5KTCA 1M44A 4AG7A 2XEGA 1ZG9A 4R76A 2AJ6A 5D29A 4CAWA 1LFWA 1Y9WA 2V77A 4UCNA 4NGQA 4JXRA 4CGNA 3B35A 1CJWA 3NH8A 4E0AA 1VIXA 3KHZA 4TWEA 4MHDA 4FD6A 1Q2YA 2B4DA 2CNSA 4CAVA 3JRUA 2J8MA 2QMLA 2Q51A 2AFWA 4JD6A 4M85A 4UWIA 4F8ZA 1NMTA 4MHPA 1JWQA 3TO6A 3PZJA 5DWNA 4MI4A 1ELLP 2Y0MA 2ZEFA 4ZBGA 2VI7A 1IOIA 4MFKA 1RTQA 1YSJA 2NYQA 1ZO0A 4RS2A 2WZNA 2K5TA 3PBEA 3PB8X 4X8IA 3TOAA 4DYOA 1ZLIA 2DEAA 2RB7A 1F57A 3EC4A 3G8WA 4Q38A 4F0YA 3PB6X 3SJGA 7CPAA 1QSRA 2ODFA 4J3GA 2R7HA 5BWAB 1UWYA 4CRZB 3N7ZA 2GIVA 4NJQA 4Y49B 2OH1A 3DR8A 2C1CA 2YNEA 5KTAA 4F0XA 3D4UA 1XEBA 2WUUA 2ZW6A 4P4FA 3WC7A 4NXYA 1XMTA 3W91A 3D67A 2IL4A 3TE4A 4XPDB 5LRGA 1IYKA 2FL4A 2ANPA 3EXNA 2YNCC 2OZGA 1ELMP 3FBUA 4KSIA 2P6EA 2BSWA 4UA3A 2R8VA 3R1KA 1ARLA 3B3CA 3TOBA 3T9YA 1PYTB 2JEVA 4P4BA 4HNYB 3CXSA 4P6YA 3DNSA 4B13A 4C2YA 4F9VA 2CTBA 2AE6A 3VATA 3S9NA 5C88A 3SHPA 1I12A 2FT0A 4ZY0A 2RC4A 3D2MA 4OC5A 2V8HA 4H89A 1KZFA 4NF1A 5HH1A 3F8KA 2GANA 2CF4A 1GHEA 3ISZA 4ZI6A 5AG7A 2NMTA 5AG4A 1VGYA 2PVWA 4M3SA 4A32A 2DPTA 4CYNA 8CPAA 3ZJ0A 3BJ8A 1FNOA 5IV0A 1HEEA 3SJEA 4H6ZA 1IICA 1M4DA 3EFAA 2ZEHA 4MCSA 5K8NA 1Z8XA 3GIUA 4CAXA 4CPAA 1R43A 4U9ZA 4C2ZA 3F0AA 3KZWA 3W6XA 4ONWA 1DE4C 5KTDA 4PXEA 4F9UA 4M6HA 2PJ8A 4CS0B 2PJ4A 3B3WA 1K4JA 1P4NA 3IFEA 5FVJA 3R95A 4X2TA 4CGPA 1WK4A 1YK3A 3TO9A 2C6GA 3BJ7A 3FNCA 4UF4A 3JTKA 3NE8A 2B3VA 2OZHA 5DWMA 2IQ6A 2FVGA 2I00A 4PXCA 3F5BA 3VWDA 3G3SA 3BXMA 2V8GA 4R7MA 2WPXA 4JYWA 3FEDA 5AG5A 2PJ7A 3TC8A 1M4LA 2V8VA 3R9EA 4KZTA 3BI1A 3GLJA 4NGTA 3LODA 4UEEA 3T90A 3ISXA 1KWMA 2KCWA 4ONUA 3PFEA 5H86A 5C82A 4L8AA 2YNCA 3LMSA 4ORFA 2VZYA 2QIRA 4W9YA 2BL1A 3IU2A 2Q04A 1Z8LA 2EO8A 2ZOFA 4IUSA 3B2YA 1F2PA 3D7DA 5F47A 2PJ6A 2C6PA 4E2AA 2EBJA 2J8NA 5THWA 2GU2A 4FWUA 4YWYA 4BMHA 4FBEA 5J1QA 1YW6A 4JWPA 2DXQA 2FXFA 3MN8A 2G3TA 2Z11A 1HDUA 3W6SA 4OADA 1TF8A 4KS9A 4OC2A 2PJ5A 2VEZA 4ZY2A 4M6GA 3NH5A 3KASA 4I49A 1XIXA 1B87A 3VARA 2JBKA 2F7VA 4FD5A 2PDOA 2PRQA 4PSXA 3L2NA 4LQ6A 1BAVA 1V0CA 1M4IA 3TTHA 5LRJA 2B4BA 3RZAA 4MY0A 1S7NA 1HDQA 4NGMA 1XE4A 1CM0A 4KOTA 1TKFA 2OU2A 2Z0ZA 2B58A 3RBUA 3D3SA 4UEZA 4GS4A 4PK2A 3EY5A 4OMEA 2PIYA 3SXOA 1MK4A 1LAMA 1OBRA 1IB1E 3CT9A 1GYTA 1YLEA 2BEIA 3KQZA 4MFQA 1ON0A 4CYOA 2H5MA 4B10A 2Q43A 4KOVA 4WJBA 2GLFA 2BOAA 3JVNA 5HMNA 1QMUA 3PBBA 4GXHA 3NFZA 4CAFA 3KKWA 4EVYA 4UFXA 3H8GA 4WWVA 2P6GA 4G1PA 4F6AA 4IAVA 3DSBA 4C68A 3WABA 3BI0A 5CPAA 2JEWA 2PR1A 2R1IA 3S9LA 4CGLA 1BPNA 1I1DA 3R96A 1BPMA 2HUZA 4FAIA 4KOYA 2QJ8A 3B3TA 4PXBA 2AFOA 2Z10A 2XEJA 2C27A 3SI1A 2G9DA 4OC0A 3IJ3A 1PCAA 4JJXA 1LANA 2ABZA 3IWWA 3K2KA 3FXTA 4MCPA
chains in the Genus database with same CATH topology
5A28A 2DPSA 3TT2A 4ZGYB 2Q0YA 2HQYA 3S6GA 4BBHA 3IU1A 4YFJA 2ZW4A 4R9MA 3IWGA 4QB9A 3A9LA 3E0KA 3B8GA 2EVNA 4PSWA 3P2HA 3I9SA 4KOWA 1S7LA 3LD2A 1PUAA 4KSFA 5I0CA 5G20A 3UY5A 4A31A 4XPLA 4B14A 4B11A 4AVAA 1J4JA 4R57A 1VKCA 2YGWA 1YR0A 4KUAA 5EC4A 2CNMA 3PP9A 2ZPAA 4JLYA 4R3LA 4KORA 3FIXA 4NCZA 1KUXA 2X7BA 3C26A 1N71A 4CYQA 2B3UA 3FRMA 2B5GB 3PGPA 2Z3MA 4L89A 1YREA 4UFWA 3FYNA 4FD7A 4UWJA 2B4DB 4C2XA 4RI1A 4B5PB 4HNWB 2R98A 2PC1A 5JPHA 2Q7BA 4CGMA 5J8FA 1BO4A 5F49A 3I3GA 4HKFA 2O28A 4X5KA 3EO4A 1U6MA 2JDDA 3RYOA 1Z4RA 2I79A 4HNXB 2VZZA 4XPDC 5G1ZA 3QB8A 4H6UA 2REEA 4KOUA 2VXKA 1FY7A 1M4GA 2G0BA 4KVXA 3WR7A 4DNCA 1QSNA 2BUEA 4XPKA 4CGOA 3VWEA 4Y49C 2ZW7A 2EUIA 4U5YA 4MY3A 1RXTA 1TIQA 4AG9A 3GY9A 4R3KA 2CY2A 1YGHA 4A2ZA 2FIWA 1OZPA 3K9UA 3QAHA 2JLMA 2Z3PA 4B12A 3V8IA 2CNTA 4PK3A 2VBQA 3D8PA 3OWCA 1S5KA 3H4QA 3CXQA 5F46A 3S6KA 1SQHA 1UFHA 4MFZA 1NSLA 3GYAA 4UCMA 3GKRA 4KLWA 1YVOA 4K30A 5IB0A 3TCVA 1MJAA 3DDDA 5CNPA 5AG6A 1KUVA 2Q4YA 3DR6A 3TO7A 3MGDA 4B5PA 4CYPA 1BOBA 1L0CA 4YGOA 4KUBA 4QBJA 1QSTA 2JDCA 2Z3NA 1VHSA 3BLNA 5A27A 2D4PA 4MFLA 2OB0A 1S7FA 4XNHB 4II9A 4MFJA 2A4NA 4KOXA 4NEXA 2B5GA 1S3ZA 2P6FA 1M1DA 3TFYA 4UCPA 3FB3A 3CXPA 4AVBA 3ZZIA 2F5IA 2ATRA 2CXAA 2ZW5A 5JQ4A 4U9YA 5ISVA 3NE7A 4MFPA 2YNDA 1S60A 1R57A 2Q4VA 1YX0A 1MJ9A 5F48A 5G21A 4A33A 1QSOA 4A95A 4KVOE 5GCNA 4YRHA 2FE7A 3JUWA 5H84A 5IX3A 2OZUA 1WWZA 4E8OA 1PU9A 3D2PA 2HV2A 4PV6A 2REFA 2PQ8A 1YVKA 4NSQA 4CRYB 2G3AA 4OLLA 4KVME 5J8CA 5EBVA 2Z3KA 2VQYA 2Q44A 4CAEA 4MJ8A 2WPWA 2Z3OA 2WSAA 2PRBA 1RO5A 4QUSA 4R87A 4C7IA 1NE9A 1MJBA 4UBRA 4QC6A 4AB7A 1QSMA 4FD4A 2D4OA 2J8RA 2ARHA 2FIAA 1B6BA 1P0HA 3SXNA 5E96A 2GE3A 1IIDA 1Y7RA 4A30A 2P0WA 1Z9UA 1Q2CA 3H5ZA 3IGRA 1S7KA 5G22A 4UFVA 4KLVA 3R9GA 4OAEA 1Z4EA 1Q2DA 1KUYA 1IYLA 2FCKA 4QVTA 4MBUA 3P2FA 4B5OA 5AGEA 4LX9A 1LRZA 1I21A 4KOSA 4KSAA 4AVCA 2ZXVA 3S6HA 4XNHC 2PR8A 2Z3LA 1Y9KA 3R9FA 2QECA 4C7HA 2FS5A 1XF8A 3S6FA 2FSRA 4LUAA 4JXQA 3IWEA 4IF5A 2PSWA 5KTCA 1M44A 4AG7A 2AJ6A 4CAWA 1Y9WA 4UCNA 4JXRA 4CGNA 1CJWA 4E0AA 4MHDA 4FD6A 1Q2YA 2B4DA 2CNSA 4CAVA 2J8MA 2QMLA 4JD6A 4M85A 4UWIA 1NMTA 3TO6A 3PZJA 5DWNA 4MI4A 2Y0MA 4ZBGA 2VI7A 4MFKA 4RS2A 3TOAA 1ZO0A 2K5TA 4EVYA 4F0YA 3EC4A 3G8WA 4Q38A 1QSRA 4J3GA 2R7HA 5BWAB 4CRZB 3N7ZA 2GIVA 4Y49B 2OH1A 3DR8A 2YNEA 5KTAA 4F0XA 1XEBA 2WUUA 2ZW6A 4NXYA 1XMTA 3W91A 3TE4A 2IL4A 4XPDB 1IYKA 2FL4A 3EXNA 2YNCC 2OZGA 3FBUA 2P6EA 2BSWA 4UA3A 2R8VA 3R1KA 3TOBA 3T9YA 2JEVA 4HNYB 3CXSA 3DNSA 4B13A 4C2YA 2AE6A 5C88A 3SHPA 1I12A 2FT0A 2RC4A 3D2MA 4H89A 1KZFA 4NF1A 5HH1A 3F8KA 2GANA 1GHEA 5AG7A 2NMTA 5AG4A 4A32A 4M3SA 2DPTA 4CYNA 3ZJ0A 3BJ8A 5IV0A 4H6ZA 1IICA 1M4DA 3EFAA 4CAXA 4U9ZA 4C2ZA 3F0AA 3W6XA 5KTDA 4CS0B 1K4JA 1P4NA 5FVJA 3R95A 4CGPA 1WK4A 1YK3A 3TO9A 3BJ7A 3FNCA 3JTKA 2B3VA 2OZHA 5DWMA 2I00A 3F5BA 3VWDA 3G3SA 2WPXA 5AG5A 3R9EA 4KZTA 3LODA 3T90A 2KCWA 4ONUA 5H86A 5C82A 4L8AA 2YNCA 4ORFA 2VZYA 2QIRA 2BL1A 3IU2A 2Q04A 4IUSA 5F47A 4E2AA 2J8NA 4BMHA 4JWPA 2DXQA 2FXFA 2G3TA 2Z11A 3W6SA 4OADA 4KS9A 2VEZA 4I49A 1XIXA 1B87A 4FD5A 2PDOA 4PSXA 1V0CA 1M4IA 3TTHA 2B4BA 4MY0A 1S7NA 1XE4A 1CM0A 4KOTA 2OU2A 2Z0ZA 2B58A 3D3SA 4GS4A 4PK2A 3EY5A 3SXOA 1MK4A 4Q36A 1IB1E 4MFQA 1YLEA 2BEIA 1ON0A 4CYOA 2H5MA 4B10A 4KOVA 3JVNA 5HMNA 4CAFA 3KKWA 4UFXA 2P6GA 4F6AA 3DSBA 4C68A 2PR1A 2R1IA 4CGLA 1I1DA 3R96A 2HUZA 4KOYA 2Z10A 2C27A 4JJXA 3FXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TT2 A;  2Q0Y A;  2HQY A;  3S6G A;  4YFJ A;  2ZW4 A;  4R9M A;  3IWG A;  4QB9 A;  3E0K A;  3B8G A;  2EVN A;  4PSW A;  3P2H A;  3I9S A;  4KOW A;  1S7L A;  3LD2 A;  1PUA A;  5I0C A;  3UY5 A;  4XPL A;  4AVA A;  1J4J A;  4R57 A;  1VKC A;  1YR0 A;  4KUA A;  5EC4 A;  2CNM A;  3PP9 A;  2ZPA A;  4JLY A;  4R3L A;  4KOR A;  3FIX A;  4NCZ A;  1KUX A;  2X7B A;  3C26 A;  1N71 A;  2B3U A;  3FRM A;  2B5G B;  3PGP A;  4L89 A;  1YRE A;  3FYN A;  4FD7 A;  4UWJ A;  2B4D B;  4RI1 A;  4B5P B;  4HNW B;  2R98 A;  2PC1 A;  5JPH A;  2Q7B A;  5J8F A;  1BO4 A;  5F49 A;  3I3G A;  4HKF A;  2O28 A;  4X5K A;  3EO4 A;  1U6M A;  2JDD A;  3RYO A;  1Z4R A;  2I79 A;  4HNX B;  2VZZ A;  4XPD C;  3QB8 A;  4H6U A;  2REE A;  4KOU A;  2VXK A;  1FY7 A;  1M4G A;  2G0B A;  4KVX A;  3WR7 A;  4DNC A;  1QSN A;  2BUE A;  4XPK A;  3VWE A;  4Y49 C;  2ZW7 A;  2EUI A;  4U5Y A;  4MY3 A;  1RXT A;  1TIQ A;  4AG9 A;  3GY9 A;  4R3K A;  2CY2 A;  1YGH A;  2FIW A;  1OZP A;  3K9U A;  3QAH A;  2JLM A;  3V8I A;  2CNT A;  4PK3 A;  2VBQ A;  3D8P A;  3OWC A;  1S5K A;  3H4Q A;  3CXQ A;  5F46 A;  3S6K A;  1SQH A;  1UFH A;  1NSL A;  3GYA A;  3GKR A;  4KLW A;  1YVO A;  4K30 A;  5IB0 A;  3TCV A;  1MJA A;  3DDD A;  5CNP A;  1KUV A;  2Q4Y A;  3DR6 A;  3TO7 A;  3MGD A;  4B5P A;  1BOB A;  1L0C A;  4YGO A;  4KUB A;  4QBJ A;  1QST A;  2JDC A;  1VHS A;  3BLN A;  2D4P A;  2OB0 A;  1S7F A;  4XNH B;  4II9 A;  2A4N A;  4KOX A;  4NEX A;  2B5G A;  1S3Z A;  2P6F A;  1M1D A;  3TFY A;  3FB3 A;  3CXP A;  4AVB A;  3ZZI A;  2F5I A;  2ATR A;  2ZW5 A;  5JQ4 A;  4U9Y A;  5ISV A;  3NE7 A;  1S60 A;  1R57 A;  2Q4V A;  1YX0 A;  1MJ9 A;  5F48 A;  1QSO A;  4KVO E;  5GCN A;  4YRH A;  2FE7 A;  3JUW A;  5H84 A;  5IX3 A;  2OZU A;  1WWZ A;  4E8O A;  1PU9 A;  3D2P A;  2HV2 A;  4PV6 A;  2REF A;  2PQ8 A;  1YVK A;  4NSQ A;  4CRY B;  2G3A A;  4OLL A;  4KVM E;  5J8C A;  5EBV A;  2VQY A;  2Q44 A;  4MJ8 A;  2WPW A;  2PRB A;  4QUS A;  1RO5 A;  4R87 A;  1NE9 A;  1MJB A;  4UBR A;  4QC6 A;  4AB7 A;  1QSM A;  4FD4 A;  2D4O A;  2J8R A;  2ARH A;  2FIA A;  1B6B A;  1P0H A;  3SXN A;  5E96 A;  2GE3 A;  1IID A;  1Y7R A;  2P0W A;  1Z9U A;  1Q2C A;  1S7K A;  3IGR A;  4KLV A;  3R9G A;  4OAE A;  1Z4E A;  1Q2D A;  1KUY A;  1IYL A;  2FCK A;  4QVT A;  4MBU A;  3P2F A;  4B5O A;  4LX9 A;  1LRZ A;  1I21 A;  4KOS A;  4AVC A;  2ZXV A;  3S6H A;  4XNH C;  2PR8 A;  1Y9K A;  3R9F A;  2QEC A;  2FS5 A;  1XF8 A;  3S6F A;  2FSR A;  4LUA A;  4JXQ A;  4IF5 A;  2PSW A;  5KTC A;  1M44 A;  4AG7 A;  2AJ6 A;  4CAW A;  1Y9W A;  4JXR A;  1CJW A;  4E0A A;  4MHD A;  4FD6 A;  1Q2Y A;  2B4D A;  2CNS A;  4CAV A;  2J8M A;  2QML A;  4JD6 A;  4M85 A;  4UWI A;  1NMT A;  3TO6 A;  3PZJ A;  5DWN A;  4MI4 A;  2Y0M A;  4ZBG A;  2VI7 A;  4RS2 A;  3TOA A;  2K5T A;  4EVY A;  4F0Y A;  3EC4 A;  3G8W A;  1QSR A;  4J3G A;  2R7H A;  4CRZ B;  3N7Z A;  2GIV A;  4Y49 B;  2OH1 A;  3DR8 A;  5KTA A;  1XEB A;  2ZW6 A;  4NXY A;  1XMT A;  3W91 A;  3TE4 A;  2IL4 A;  4XPD B;  1IYK A;  2FL4 A;  3EXN A;  3FBU A;  2OZG A;  2P6E A;  2BSW A;  4UA3 A;  2R8V A;  3R1K A;  3TOB A;  3T9Y A;  2JEV A;  4HNY B;  3CXS A;  3DNS A;  2AE6 A;  5C88 A;  3SHP A;  1I12 A;  2FT0 A;  2RC4 A;  3D2M A;  4H89 A;  1KZF A;  4NF1 A;  5HH1 A;  3F8K A;  2GAN A;  1GHE A;  2NMT A;  4M3S A;  3ZJ0 A;  3BJ8 A;  5IV0 A;  4H6Z A;  1IIC A;  1M4D A;  3EFA A;  4CAX A;  4U9Z A;  3F0A A;  3W6X A;  5KTD A;  4CS0 B;  1K4J A;  1P4N A;  5FVJ A;  3R95 A;  1WK4 A;  1YK3 A;  3TO9 A;  3BJ7 A;  3FNC A;  2B3V A;  2OZH A;  5DWM A;  2I00 A;  3F5B A;  3VWD A;  3G3S A;  2WPX A;  3R9E A;  4KZT A;  3LOD A;  3T90 A;  2KCW A;  4ONU A;  5H86 A;  5C82 A;  4L8A A;  4ORF A;  2VZY A;  2QIR A;  2BL1 A;  2Q04 A;  4IUS A;  5F47 A;  4E2A A;  2J8N A;  4BMH A;  4JWP A;  2DXQ A;  2FXF A;  2G3T A;  2Z11 A;  3W6S A;  4OAD A;  2VEZ A;  4I49 A;  1XIX A;  1B87 A;  4FD5 A;  2PDO A;  4PSX A;  1V0C A;  1M4I A;  3TTH A;  2B4B A;  4MY0 A;  1S7N A;  1XE4 A;  1CM0 A;  4KOT A;  2OU2 A;  2Z0Z A;  2B58 A;  3D3S A;  4GS4 A;  4PK2 A;  3EY5 A;  3SXO A;  1MK4 A;  1IB1 E;  1YLE A;  2BEI A;  1ON0 A;  2H5M A;  4KOV A;  3JVN A;  5HMN A;  3KKW A;  2P6G A;  4F6A A;  3DSB A;  2PR1 A;  2R1I A;  1I1D A;  3R96 A;  2HUZ A;  4KOY A;  2Z10 A;  2C27 A;  4JJX A;  3FXT A; 
#chains in the Genus database with same CATH topology
 5HXD A;  3FH4 A;  1Z2L A;  4UIB A;  5A28 A;  2DPS A;  4H2K A;  2QVP A;  2OR4 A;  4K3N A;  3TT2 A;  1XBU A;  3DGV A;  4ZGY B;  5F09 A;  2Q0Y A;  4GM5 A;  2HQY A;  3S6G A;  4BBH A;  3IU1 A;  4MHY A;  4YFJ A;  2ZW4 A;  4M6I A;  4R9M A;  3PFO A;  4AXV A;  3IWG A;  4QB9 A;  1IU8 A;  3A9L A;  3E0K A;  3B8G A;  1IGB A;  2EVN A;  4PSW A;  3CDX A;  3P2H A;  3I9S A;  4KOW A;  2PJ3 A;  1S7L A;  3LD2 A;  4EWT A;  1PUA A;  3HUV A;  3CPX A;  4KSF A;  5G20 A;  3UY5 A;  3I1U A;  5I0C A;  2BCO A;  3IEH A;  4A31 A;  4XPL A;  4B14 A;  4B11 A;  4MXU A;  1J4J A;  4AVA A;  1CBX A;  1VKC A;  2YGW A;  4R57 A;  2Q4Z A;  3NH4 A;  4OIW A;  1YR0 A;  4OC3 A;  4KUA A;  5EC4 A;  2CNM A;  1AMP A;  3PP9 A;  2ZPA A;  4MMO A;  3D7G A;  4JLY A;  4R3L A;  4A94 A;  4KOR A;  1YW4 A;  3FIX A;  4NCZ A;  3SJX A;  2VL1 A;  4IHM A;  3IC1 A;  1KUX A;  3TX8 A;  2X7B A;  5K8M A;  3C26 A;  1N71 A;  3D68 A;  4CYQ A;  2B3U A;  3FRM A;  3PB9 X;  2EK8 A;  4Q7A A;  2B5G B;  1XRY A;  3PGP A;  3PRT A;  1Z5R A;  2Z3M A;  2PJ1 A;  2ZEM A;  4L89 A;  2Q7S A;  1YRE A;  2HC9 A;  5D8N A;  3RNZ A;  1Y0R A;  4R8F A;  1Y0Y A;  4UFW A;  3FYN A;  4FD7 A;  3FEE A;  2B4D B;  4UWJ A;  4ZY1 A;  4P4I A;  3FEC A;  4NGN A;  4FUU A;  4UIA A;  2PE3 A;  3KGQ A;  4P45 A;  4RI1 A;  4B5P B;  4C2X A;  4HNW B;  2R98 A;  2PC1 A;  4Q36 A;  3SJF A;  4BD9 A;  5JPH A;  2Q7B A;  4CGM A;  5J8F A;  2ZED A;  1BO4 A;  5F49 A;  4P4D A;  3I3G A;  4HKF A;  1TKH A;  2RFH A;  2O28 A;  4X5K A;  3EO4 A;  1F2O A;  5JGF A;  1CPS A;  1U6M A;  2JDD A;  3RYO A;  1CX8 A;  4OKO A;  1Z4R A;  2I79 A;  4HNX B;  4OC1 A;  2VZZ A;  4XPD C;  5G1Z A;  4ZX9 A;  3QB8 A;  4H6U A;  4RN7 A;  2REE A;  4KOU A;  1FY7 A;  1M4G A;  2VXK A;  2G0B A;  4KVX A;  3WR7 A;  4NGS A;  1QSN A;  2BUE A;  4XPK A;  4DNC A;  3QAY A;  4CGO A;  3VWE A;  4Y49 C;  4EFD A;  5LRK A;  2ZW7 A;  2EUI A;  5CBM A;  4U5Y A;  3FMC A;  4MY3 A;  2IMO A;  1RXT A;  2V8D A;  1TIQ A;  3FF3 A;  4AG9 A;  3GY9 A;  4R3K A;  3SI0 A;  1ZLH A;  2CY2 A;  3CPA A;  1YGH A;  3D66 A;  4A2Z A;  1X10 A;  2FIW A;  1OZP A;  3K9U A;  3QAH A;  2JLM A;  3IIB A;  2Z3P A;  4B12 A;  2POK A;  3V8I A;  2CNT A;  1CP6 A;  4PK3 A;  1ZG8 A;  2J9A A;  3PB4 X;  5HVF A;  2VBQ A;  3D8P A;  2IJZ A;  1S5K A;  3H4Q A;  3OWC A;  3CXQ A;  2PJ0 A;  5F46 A;  2BO9 A;  5LYL A;  3WC5 A;  3WC6 A;  3S6K A;  1SQH A;  1UFH A;  4MFZ A;  1NSL A;  3GYA A;  4UCM A;  3GKR A;  3PB7 X;  4KLW A;  1YVO A;  3GUX A;  4K30 A;  1DTD A;  1R3N A;  4HPS A;  5ELY A;  3TCV A;  5I4M A;  5IB0 A;  1MJA A;  3DDD A;  5DS0 A;  2AFM A;  5CNP A;  1X12 A;  5AG6 A;  1KUV A;  2Q4Y A;  3V38 A;  1LOK A;  2WYR A;  3CZX A;  3DR6 A;  3RO0 A;  3TO7 A;  3MGD A;  3N5F A;  4B5P A;  1H8L A;  4CYP A;  4R6T A;  1BOB A;  3QNV A;  5HVG A;  2DF5 A;  4OP4 A;  3KR4 A;  1L0C A;  4YGO A;  4Z65 A;  4KUB A;  4DJL A;  4QBJ A;  1QQ9 A;  1QST A;  2JDC A;  2Z3N A;  1ZG7 A;  1VHS A;  3NA6 A;  3BLN A;  4YU9 A;  2AFZ A;  5A27 A;  2D4P A;  4MFL A;  2OB0 A;  1S7F A;  4P4J A;  4XNH B;  4B6Z A;  4II9 A;  4MFJ A;  1Z8W A;  2A4N A;  2ZEE A;  4KOX A;  1TKJ A;  4NEX A;  2B5G A;  1Q7L A;  1EE3 P;  1S3Z A;  2GFQ A;  4P4E A;  3KHX A;  5EMI A;  4OID A;  2P6F A;  1M1D A;  3TFY A;  2HB6 A;  1TF9 A;  4UCP A;  3FB3 A;  3H8E A;  4P10 A;  3CXP A;  2PIZ A;  4AVB A;  3ZZI A;  2F5I A;  1NSA A;  2ATR A;  2CXA A;  2ZEN A;  2ZW5 A;  5JQ4 A;  3H8F A;  4U9Y A;  5ISV A;  3NE7 A;  4MFP A;  2YND A;  1S60 A;  1R57 A;  2Q4V A;  1YX0 A;  1MJ9 A;  2PVV A;  4NGR A;  5F48 A;  5G21 A;  1QSO A;  4A33 A;  2PJC A;  4PXD A;  3BHX A;  4DUK A;  4A95 A;  1XFO A;  2NSM A;  1VHE A;  4KVO E;  5GCN A;  1LCP A;  3IO1 A;  1Y7E A;  4YRH A;  2FE7 A;  3JUW A;  1IY7 A;  5H84 A;  2OOT A;  5IX3 A;  2OZU A;  1WWZ A;  4IK2 A;  5LYI A;  4E8O A;  1PU9 A;  5HVH A;  3D2P A;  4PPZ A;  2HV2 A;  4PV6 A;  2REF A;  2PQ8 A;  2CIJ A;  2EWB A;  3MRU A;  1YVK A;  3FVL A;  4NSQ A;  2PJ2 A;  4MCQ A;  4CRY B;  1BLL E;  4LQG A;  4O23 A;  1IOF A;  2G3A A;  4OLL A;  1CG2 A;  4OC4 A;  3D7F A;  2PCU A;  4KVM E;  5J8C A;  1YME A;  3WT4 A;  5EBV A;  3LAC A;  2Z3K A;  2VQY A;  1A2Z A;  2Q44 A;  2I3C A;  4CAE A;  2O4H A;  2GLJ A;  2JBJ A;  2XEI A;  1FT7 A;  4MJ8 A;  2WPW A;  2Z3O A;  4UEF A;  4MHN A;  2WSA A;  2PRB A;  1RO5 A;  4QUS A;  4R87 A;  3FJU A;  4C7I A;  1NE9 A;  1MJB A;  2ZEG A;  3KI9 A;  4UBR A;  4MCR A;  1ARM A;  4NFR A;  2ZEP A;  3V7Z A;  4ZYQ A;  4QC6 A;  4AB7 A;  1QSM A;  4FD4 A;  2D4O A;  2J8R A;  2ARH A;  2FIA A;  3RAM A;  1YLO A;  3KR5 A;  1B6B A;  3SI2 A;  1TXR A;  3GB0 A;  3KL9 A;  1P0H A;  3LWU A;  3VH9 A;  5JH9 A;  2PJB A;  2PJA A;  3B3V A;  1YQE A;  3HLP A;  3SXN A;  5E96 A;  2GE3 A;  3T8W A;  3B3S A;  5JM6 A;  1IID A;  2O53 A;  5K8P A;  1Y7R A;  4A30 A;  2P0W A;  2ZEL A;  4NGP A;  4BIN A;  1Z9U A;  1Q2C A;  1S7K A;  3H5Z A;  3IGR A;  5G22 A;  4UFV A;  3S9M A;  1CP7 A;  2QYV A;  3K9T A;  4KLV A;  4ZX8 A;  4EME A;  3B7I A;  4X3R A;  4PQA A;  3R9G A;  4OAE A;  1Z8T A;  1Z4E A;  2EK9 A;  4A38 A;  1Q2D A;  1KUY A;  2XEF A;  4RUH A;  1IYL A;  2FCK A;  3PEI A;  2AFU A;  4QVT A;  1XJO A;  4MBU A;  2C6C A;  3P2F A;  2PJ9 A;  4B5O A;  1XMB A;  4TNU A;  5AGE A;  4LX9 A;  1LRZ A;  2CTC A;  1AYE A;  1I21 A;  3D7H A;  4KOS A;  4A37 A;  4KSA A;  4P44 A;  5LYD A;  2ZXV A;  4AVC A;  6CPA A;  3S6H A;  4MHZ A;  1LAP A;  4A39 A;  1CPX A;  4XNH C;  2PR8 A;  2Z3L A;  5K8O A;  1Y9K A;  3R9F A;  2QEC A;  2ZEO A;  2FS5 A;  1XF8 A;  4C7H A;  3S6F A;  1XOV A;  2ZOG A;  2FSR A;  3KQX A;  4LUA A;  4MRI A;  4JXQ A;  3FX6 A;  3DLJ A;  2AFS A;  5IB9 A;  1JQG A;  3IWE A;  4JZ0 A;  1VHO A;  2AFX A;  4IF5 A;  4NJR A;  2PSW A;  2F8H A;  1AUG A;  5LYF A;  2GRE A;  5KTC A;  1M44 A;  4AG7 A;  2XEG A;  1ZG9 A;  4R76 A;  2AJ6 A;  5D29 A;  4CAW A;  1LFW A;  1Y9W A;  2V77 A;  4UCN A;  4NGQ A;  4JXR A;  4CGN A;  3B35 A;  1CJW A;  3NH8 A;  4E0A A;  1VIX A;  3KHZ A;  4TWE A;  4MHD A;  4FD6 A;  1Q2Y A;  2B4D A;  2CNS A;  4CAV A;  3JRU A;  2J8M A;  2QML A;  2Q51 A;  2AFW A;  4JD6 A;  4M85 A;  4UWI A;  4F8Z A;  1NMT A;  4MHP A;  1JWQ A;  3TO6 A;  3PZJ A;  5DWN A;  4MI4 A;  1ELL P;  2Y0M A;  2ZEF A;  4ZBG A;  2VI7 A;  1IOI A;  4MFK A;  1RTQ A;  1YSJ A;  2NYQ A;  1ZO0 A;  4RS2 A;  2WZN A;  2K5T A;  3PBE A;  3PB8 X;  4X8I A;  3TOA A;  4DYO A;  1ZLI A;  2DEA A;  2RB7 A;  1F57 A;  3EC4 A;  3G8W A;  4Q38 A;  4F0Y A;  3PB6 X;  3SJG A;  7CPA A;  1QSR A;  2ODF A;  4J3G A;  2R7H A;  5BWA B;  1UWY A;  4CRZ B;  3N7Z A;  2GIV A;  4NJQ A;  4Y49 B;  2OH1 A;  3DR8 A;  2C1C A;  2YNE A;  5KTA A;  4F0X A;  3D4U A;  1XEB A;  2WUU A;  2ZW6 A;  4P4F A;  3WC7 A;  4NXY A;  1XMT A;  3W91 A;  3D67 A;  2IL4 A;  3TE4 A;  4XPD B;  5LRG A;  1IYK A;  2FL4 A;  2ANP A;  3EXN A;  2YNC C;  2OZG A;  1ELM P;  3FBU A;  4KSI A;  2P6E A;  2BSW A;  4UA3 A;  2R8V A;  3R1K A;  1ARL A;  3B3C A;  3TOB A;  3T9Y A;  1PYT B;  2JEV A;  4P4B A;  4HNY B;  3CXS A;  4P6Y A;  3DNS A;  4B13 A;  4C2Y A;  4F9V A;  2CTB A;  2AE6 A;  3VAT A;  3S9N A;  5C88 A;  3SHP A;  1I12 A;  2FT0 A;  4ZY0 A;  2RC4 A;  3D2M A;  4OC5 A;  2V8H A;  4H89 A;  1KZF A;  4NF1 A;  5HH1 A;  3F8K A;  2GAN A;  2CF4 A;  1GHE A;  3ISZ A;  4ZI6 A;  5AG7 A;  2NMT A;  5AG4 A;  1VGY A;  2PVW A;  4M3S A;  4A32 A;  2DPT A;  4CYN A;  8CPA A;  3ZJ0 A;  3BJ8 A;  1FNO A;  5IV0 A;  1HEE A;  3SJE A;  4H6Z A;  1IIC A;  1M4D A;  3EFA A;  2ZEH A;  4MCS A;  5K8N A;  1Z8X A;  3GIU A;  4CAX A;  4CPA A;  1R43 A;  4U9Z A;  4C2Z A;  3F0A A;  3KZW A;  3W6X A;  4ONW A;  1DE4 C;  5KTD A;  4PXE A;  4F9U A;  4M6H A;  2PJ8 A;  4CS0 B;  2PJ4 A;  3B3W A;  1K4J A;  1P4N A;  3IFE A;  5FVJ A;  3R95 A;  4X2T A;  4CGP A;  1WK4 A;  1YK3 A;  3TO9 A;  2C6G A;  3BJ7 A;  3FNC A;  4UF4 A;  3JTK A;  3NE8 A;  2B3V A;  2OZH A;  5DWM A;  2IQ6 A;  2FVG A;  2I00 A;  4PXC A;  3F5B A;  3VWD A;  3G3S A;  3BXM A;  2V8G A;  4R7M A;  2WPX A;  4JYW A;  3FED A;  5AG5 A;  2PJ7 A;  3TC8 A;  1M4L A;  2V8V A;  3R9E A;  4KZT A;  3BI1 A;  3GLJ A;  4NGT A;  3LOD A;  4UEE A;  3T90 A;  3ISX A;  1KWM A;  2KCW A;  4ONU A;  3PFE A;  5H86 A;  5C82 A;  4L8A A;  2YNC A;  3LMS A;  4ORF A;  2VZY A;  2QIR A;  4W9Y A;  2BL1 A;  3IU2 A;  2Q04 A;  1Z8L A;  2EO8 A;  2ZOF A;  4IUS A;  3B2Y A;  1F2P A;  3D7D A;  5F47 A;  2PJ6 A;  2C6P A;  4E2A A;  2EBJ A;  2J8N A;  5THW A;  2GU2 A;  4FWU A;  4YWY A;  4BMH A;  4FBE A;  5J1Q A;  1YW6 A;  4JWP A;  2DXQ A;  2FXF A;  3MN8 A;  2G3T A;  2Z11 A;  1HDU A;  3W6S A;  4OAD A;  1TF8 A;  4KS9 A;  4OC2 A;  2PJ5 A;  2VEZ A;  4ZY2 A;  4M6G A;  3NH5 A;  3KAS A;  4I49 A;  1XIX A;  1B87 A;  3VAR A;  2JBK A;  2F7V A;  4FD5 A;  2PDO A;  2PRQ A;  4PSX A;  3L2N A;  4LQ6 A;  1BAV A;  1V0C A;  1M4I A;  3TTH A;  5LRJ A;  2B4B A;  3RZA A;  4MY0 A;  1S7N A;  1HDQ A;  4NGM A;  1XE4 A;  1CM0 A;  4KOT A;  1TKF A;  2OU2 A;  2Z0Z A;  2B58 A;  3RBU A;  3D3S A;  4UEZ A;  4GS4 A;  4PK2 A;  3EY5 A;  4OME A;  2PIY A;  3SXO A;  1MK4 A;  1LAM A;  1OBR A;  1IB1 E;  3CT9 A;  1GYT A;  1YLE A;  2BEI A;  3KQZ A;  4MFQ A;  1ON0 A;  4CYO A;  2H5M A;  4B10 A;  2Q43 A;  4KOV A;  4WJB A;  2GLF A;  2BOA A;  3JVN A;  5HMN A;  1QMU A;  3PBB A;  4GXH A;  3NFZ A;  4CAF A;  3KKW A;  4EVY A;  4UFX A;  3H8G A;  4WWV A;  2P6G A;  4G1P A;  4F6A A;  4IAV A;  3DSB A;  4C68 A;  3WAB A;  3BI0 A;  5CPA A;  2JEW A;  2PR1 A;  2R1I A;  3S9L A;  4CGL A;  1BPN A;  1I1D A;  3R96 A;  1BPM A;  2HUZ A;  4FAI A;  4KOY A;  2QJ8 A;  3B3T A;  4PXB A;  2AFO A;  2Z10 A;  2XEJ A;  2C27 A;  3SI1 A;  2G9D A;  4OC0 A;  3IJ3 A;  1PCA A;  4JJX A;  1LAN A;  2ABZ A;  3IWW A;  3K2K A;  3FXT A;  4MCP A; 
#chains in the Genus database with same CATH homology
 5A28 A;  2DPS A;  3TT2 A;  4ZGY B;  2Q0Y A;  2HQY A;  3S6G A;  4BBH A;  3IU1 A;  4YFJ A;  2ZW4 A;  4R9M A;  3IWG A;  4QB9 A;  3A9L A;  3E0K A;  3B8G A;  2EVN A;  4PSW A;  3P2H A;  3I9S A;  4KOW A;  1S7L A;  3LD2 A;  1PUA A;  4KSF A;  5I0C A;  5G20 A;  3UY5 A;  4A31 A;  4XPL A;  4B14 A;  4B11 A;  4AVA A;  1J4J A;  4R57 A;  1VKC A;  2YGW A;  1YR0 A;  4KUA A;  5EC4 A;  2CNM A;  3PP9 A;  2ZPA A;  4JLY A;  4R3L A;  4KOR A;  3FIX A;  4NCZ A;  1KUX A;  2X7B A;  3C26 A;  1N71 A;  4CYQ A;  2B3U A;  3FRM A;  2B5G B;  3PGP A;  2Z3M A;  4L89 A;  1YRE A;  4UFW A;  3FYN A;  4FD7 A;  4UWJ A;  2B4D B;  4C2X A;  4RI1 A;  4B5P B;  4HNW B;  2R98 A;  2PC1 A;  5JPH A;  2Q7B A;  4CGM A;  5J8F A;  1BO4 A;  5F49 A;  3I3G A;  4HKF A;  2O28 A;  4X5K A;  3EO4 A;  1U6M A;  2JDD A;  3RYO A;  1Z4R A;  2I79 A;  4HNX B;  2VZZ A;  4XPD C;  5G1Z A;  3QB8 A;  4H6U A;  2REE A;  4KOU A;  2VXK A;  1FY7 A;  1M4G A;  2G0B A;  4KVX A;  3WR7 A;  4DNC A;  1QSN A;  2BUE A;  4XPK A;  4CGO A;  3VWE A;  4Y49 C;  2ZW7 A;  2EUI A;  4U5Y A;  4MY3 A;  1RXT A;  1TIQ A;  4AG9 A;  3GY9 A;  4R3K A;  2CY2 A;  1YGH A;  4A2Z A;  2FIW A;  1OZP A;  3K9U A;  3QAH A;  2JLM A;  2Z3P A;  4B12 A;  3V8I A;  2CNT A;  4PK3 A;  2VBQ A;  3D8P A;  3OWC A;  1S5K A;  3H4Q A;  3CXQ A;  5F46 A;  3S6K A;  1SQH A;  1UFH A;  4MFZ A;  1NSL A;  3GYA A;  4UCM A;  3GKR A;  4KLW A;  1YVO A;  4K30 A;  5IB0 A;  3TCV A;  1MJA A;  3DDD A;  5CNP A;  5AG6 A;  1KUV A;  2Q4Y A;  3DR6 A;  3TO7 A;  3MGD A;  4B5P A;  4CYP A;  1BOB A;  1L0C A;  4YGO A;  4KUB A;  4QBJ A;  1QST A;  2JDC A;  2Z3N A;  1VHS A;  3BLN A;  5A27 A;  2D4P A;  4MFL A;  2OB0 A;  1S7F A;  4XNH B;  4II9 A;  4MFJ A;  2A4N A;  4KOX A;  4NEX A;  2B5G A;  1S3Z A;  2P6F A;  1M1D A;  3TFY A;  4UCP A;  3FB3 A;  3CXP A;  4AVB A;  3ZZI A;  2F5I A;  2ATR A;  2CXA A;  2ZW5 A;  5JQ4 A;  4U9Y A;  5ISV A;  3NE7 A;  4MFP A;  2YND A;  1S60 A;  1R57 A;  2Q4V A;  1YX0 A;  1MJ9 A;  5F48 A;  5G21 A;  4A33 A;  1QSO A;  4A95 A;  4KVO E;  5GCN A;  4YRH A;  2FE7 A;  3JUW A;  5H84 A;  5IX3 A;  2OZU A;  1WWZ A;  4E8O A;  1PU9 A;  3D2P A;  2HV2 A;  4PV6 A;  2REF A;  2PQ8 A;  1YVK A;  4NSQ A;  4CRY B;  2G3A A;  4OLL A;  4KVM E;  5J8C A;  5EBV A;  2Z3K A;  2VQY A;  2Q44 A;  4CAE A;  4MJ8 A;  2WPW A;  2Z3O A;  2WSA A;  2PRB A;  1RO5 A;  4QUS A;  4R87 A;  4C7I A;  1NE9 A;  1MJB A;  4UBR A;  4QC6 A;  4AB7 A;  1QSM A;  4FD4 A;  2D4O A;  2J8R A;  2ARH A;  2FIA A;  1B6B A;  1P0H A;  3SXN A;  5E96 A;  2GE3 A;  1IID A;  1Y7R A;  4A30 A;  2P0W A;  1Z9U A;  1Q2C A;  3H5Z A;  3IGR A;  1S7K A;  5G22 A;  4UFV A;  4KLV A;  3R9G A;  4OAE A;  1Z4E A;  1Q2D A;  1KUY A;  1IYL A;  2FCK A;  4QVT A;  4MBU A;  3P2F A;  4B5O A;  5AGE A;  4LX9 A;  1LRZ A;  1I21 A;  4KOS A;  4KSA A;  4AVC A;  2ZXV A;  3S6H A;  4XNH C;  2PR8 A;  2Z3L A;  1Y9K A;  3R9F A;  2QEC A;  4C7H A;  2FS5 A;  1XF8 A;  3S6F A;  2FSR A;  4LUA A;  4JXQ A;  3IWE A;  4IF5 A;  2PSW A;  5KTC A;  1M44 A;  4AG7 A;  2AJ6 A;  4CAW A;  1Y9W A;  4UCN A;  4JXR A;  4CGN A;  1CJW A;  4E0A A;  4MHD A;  4FD6 A;  1Q2Y A;  2B4D A;  2CNS A;  4CAV A;  2J8M A;  2QML A;  4JD6 A;  4M85 A;  4UWI A;  1NMT A;  3TO6 A;  3PZJ A;  5DWN A;  4MI4 A;  2Y0M A;  4ZBG A;  2VI7 A;  4MFK A;  4RS2 A;  3TOA A;  1ZO0 A;  2K5T A;  4EVY A;  4F0Y A;  3EC4 A;  3G8W A;  4Q38 A;  1QSR A;  4J3G A;  2R7H A;  5BWA B;  4CRZ B;  3N7Z A;  2GIV A;  4Y49 B;  2OH1 A;  3DR8 A;  2YNE A;  5KTA A;  4F0X A;  1XEB A;  2WUU A;  2ZW6 A;  4NXY A;  1XMT A;  3W91 A;  3TE4 A;  2IL4 A;  4XPD B;  1IYK A;  2FL4 A;  3EXN A;  2YNC C;  2OZG A;  3FBU A;  2P6E A;  2BSW A;  4UA3 A;  2R8V A;  3R1K A;  3TOB A;  3T9Y A;  2JEV A;  4HNY B;  3CXS A;  3DNS A;  4B13 A;  4C2Y A;  2AE6 A;  5C88 A;  3SHP A;  1I12 A;  2FT0 A;  2RC4 A;  3D2M A;  4H89 A;  1KZF A;  4NF1 A;  5HH1 A;  3F8K A;  2GAN A;  1GHE A;  5AG7 A;  2NMT A;  5AG4 A;  4A32 A;  4M3S A;  2DPT A;  4CYN A;  3ZJ0 A;  3BJ8 A;  5IV0 A;  4H6Z A;  1IIC A;  1M4D A;  3EFA A;  4CAX A;  4U9Z A;  4C2Z A;  3F0A A;  3W6X A;  5KTD A;  4CS0 B;  1K4J A;  1P4N A;  5FVJ A;  3R95 A;  4CGP A;  1WK4 A;  1YK3 A;  3TO9 A;  3BJ7 A;  3FNC A;  3JTK A;  2B3V A;  2OZH A;  5DWM A;  2I00 A;  3F5B A;  3VWD A;  3G3S A;  2WPX A;  5AG5 A;  3R9E A;  4KZT A;  3LOD A;  3T90 A;  2KCW A;  4ONU A;  5H86 A;  5C82 A;  4L8A A;  2YNC A;  4ORF A;  2VZY A;  2QIR A;  2BL1 A;  3IU2 A;  2Q04 A;  4IUS A;  5F47 A;  4E2A A;  2J8N A;  4BMH A;  4JWP A;  2DXQ A;  2FXF A;  2G3T A;  2Z11 A;  3W6S A;  4OAD A;  4KS9 A;  2VEZ A;  4I49 A;  1XIX A;  1B87 A;  4FD5 A;  2PDO A;  4PSX A;  1V0C A;  1M4I A;  3TTH A;  2B4B A;  4MY0 A;  1S7N A;  1XE4 A;  1CM0 A;  4KOT A;  2OU2 A;  2Z0Z A;  2B58 A;  3D3S A;  4GS4 A;  4PK2 A;  3EY5 A;  3SXO A;  1MK4 A;  4Q36 A;  1IB1 E;  4MFQ A;  1YLE A;  2BEI A;  1ON0 A;  4CYO A;  2H5M A;  4B10 A;  4KOV A;  3JVN A;  5HMN A;  4CAF A;  3KKW A;  4UFX A;  2P6G A;  4F6A A;  3DSB A;  4C68 A;  2PR1 A;  2R1I A;  4CGL A;  1I1D A;  3R96 A;  2HUZ A;  4KOY A;  2Z10 A;  2C27 A;  4JJX A;  3FXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...