3FH4A

Crystal structure of recombinant vibrio proteolyticus aminopeptidase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Heterologous expression and purification of Vibrio proteolyticus (Aeromonas proteolytica) aminopeptidase: a rapid protocol
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fh4A00
2NYQA 2EK9A 3KZWA 5LRGA 2ZELA 1VHEA 4K3NA 2WZNA 2PIYA 2PIZA 2GLJA 4EWTA 3VH9A 2ZEGA 2PJ2A 5K8OA 3FEDA 5LRJA 4X3RA 4OC3A 3IO1A 1UWYA 1AYEA 1Q7LA 4X8IA 2OOTA 4YU9A 3KI9A 2PVWA 2Q51A 3KASA 4MCPA 1KWMA 3FEEA 4A38A 2C1CA 5DS0A 3TX8A 2C6CA 2PJ3A 4P4FA 4UIBA 4LQGA 1TKFA 1Z5RA 3S9MA 4ZY1A 4OC4A 1LCPA 1ZG7A 1HEEA 3PB6X 1VHOA 2XEFA 2CTBA 4FBEA 1RTQA 2POKA 3PBBA 4R7MA 2JEWA 3SJFA 1IGBA 4PXDA 5JGFA 2AFWA 3B3WA 4CPAA 4WWVA 4UEFA 3N5FA 3VATA 2ZENA 4WJBA 2PJ7A 3CPAA 3DGVA 5LYLA 3H8FA 2F7VA 3SI1A 3D4UA 1JQGA 4FWUA 4PXBA 1QMUA 5ELYA 4DJLA 5LYIA 4ZX8A 2QJ8A 5HVGA 3V38A 2PJ6A 2C6GA 3I1UA 3ISZA 3NH4A 2ZOFA 4P6YA 1LANA 2PJ8A 3IWWA 1CX8A 1FNOA 3B3CA 1ELMP 3K2KA 2ZEEA 1YW6A 3B3TA 2ABZA 3D7GA 4P10A 4TWEA 3VARA 4A94A 2RFHA 5CPAA 5HXDA 2V77A 4OC2A 5HVFA 4UEEA 4MHNA 4FUUA 3V7ZA 1PCAA 3PEIA 1LFWA 1QQ9A 1PYTB 1YSJA 3B35A 1CPXA 3NH5A 4EFDA 3GLJA 4NGNA 2V8VA 4ZI6A 1AMPA 1F2OA 1TKJA 1ARLA 3PRTA 4OIDA 5JM6A 3TC8A 2AFOA 1NSAA 1ZG9A 3KGQA 4F9UA 2EWBA 1BAVA 1TKHA 2PJ5A 4MCQA 2ANPA 4NGMA 3ISXA 5D8NA 3SJXA 4GM5A 5HVHA 4G1PA 2IMOA 2PJ0A 3BI1A 4IK2A 3QNVA 2ZEDA 4ONWA 8CPAA 2AFSA 2EK8A 2QVPA 4W9YA 3WC6A 4KSIA 3WT4A 4MRIA 4OIWA 1XFOA 1BPNA 2ZEFA 1ARMA 3PB8X 2DEAA 3BXMA 4UEZA 2PRQA 3KHXA 3SI0A 3FH4A 1Z2LA 1CP6A 2PJCA 1TF8A 3NFZA 3PBEA 1Y7EA 4YWYA 3FMCA 4RUHA 4P44A 2J9AA 3KR5A 3WABA 2O4HA 4R8FA 3NH8A 4R76A 3B7IA 2WYRA 2PJ4A 1BLLE 4DUKA 4OC5A 1HDUA 3D66A 4F8ZA 3KL9A 3PB9X 1ZG8A 1CP7A 1XJOA 1F57A 2V8HA 5D29A 1Y0RA 4NGSA 3L2NA 4ZY0A 5K8MA 1ELLP 2ZEOA 2PE3A 4OKOA 2GLFA 3WC5A 4P4JA 2PJ9A 1M4LA 3KR4A 4Q7AA 3FECA 4F9VA 1VIXA 1LAMA 4Z65A 1DE4C 4OC1A 1CPSA 4JYWA 1F2PA 1XMBA 4TNUA 4IHMA 4DYOA 7CPAA 4P4EA 3SJGA 4AXVA 1HDQA 4MXUA 2PVVA 1EE3P 2CF4A 2RB7A 3PFEA 4P45A 2C6PA 1TF9A 3D7FA 5K8NA 6CPAA 3CT9A 3D67A 1R43A 4PXCA 4PPZA 2PJ1A 4OC0A 2V8DA 2I3CA 2Q43A 4OMEA 3IIBA 2O53A 1BPMA 3B3SA 1DTDA 2G9DA 3GUXA 3RBUA 3B2YA 3B3VA 1LOKA 2ZOGA 5CBMA 2HB6A 2IQ6A 4BD9A 1IY7A 5THWA 3CPXA 3RZAA 2OR4A 2IJZA 2BOAA 1VGYA 2QYVA 3SJEA 4NFRA 4O23A 5LYDA 2AFMA 2CTCA 4EMEA 1CBXA 3IC1A 2PJBA 3LMSA 3S9LA 1YLOA 4OP4A 4NJQA 3HUVA 1LAPA 3MRUA 4NJRA 4X2TA 3IJ3A 1Y0YA 3FVLA 2GU2A 1ZLHA 3D7HA 2JBJA 4MHPA 1H8LA 5IB9A 2AFXA 2NSMA 4PXEA 3PB7X 4FAIA 4ZY2A 2XEJA 2Q4ZA 3JRUA 3WC7A 3K9TA 3PB4X 4JZ0A 1CG2A 4UIAA 4A37A 3HLPA 2AFUA 4NGPA 3MN8A 3KQXA 4A39A 1XRYA 5I4MA 4IAVA 2GREA 3FF3A 3H8EA 2XEIA 4H2KA 5J1QA 2BO9A 3GB0A 2PCUA 3CDXA 4MHYA 3T8WA 2V8GA 1XBUA 4ZX9A 1ZLIA 4P4BA 4P4IA 2AFZA 3PFOA 1YW4A 2ZEHA 2HC9A 3LWUA 4R6TA 5LYFA 4NGQA 1FT7A 3RAMA 5JH9A 3NA6A 3FJUA 4UF4A 2CIJA 3IFEA 3H8GA 3D68A 3KHZA 4B6ZA 1YMEA 3BI0A 4MMOA 1Z8LA 1TXRA 4NGRA 3S9NA 2F8HA 5F09A 2PJAA 5LRKA 3FX6A 3BHXA 2JBKA 4PQAA 4MHZA 4MCSA 4ZYQA 4MCRA 4P4DA 2VL1A 3IEHA 5K8PA 3KQZA 4NGTA 3DLJA 1OBRA 1GYTA 2ZEPA 1R3NA 3D7DA 2BCOA 2ZEMA 3SI2A 2XEGA 2FVGA
chains in the Genus database with same CATH superfamily
2NYQA 1MJAA 2EK9A 3KZWA 5LRGA 2ZELA 1VHEA 4K3NA 1YGHA 2WZNA 1CJWA 3E0KA 4UFXA 4R3KA 2PIYA 2Z3NA 2PIZA 4IF5A 2GLJA 1XE4A 3VH9A 3IU2A 4EWTA 4KUBA 2WPXA 2ZEGA 4QUSA 2PJ2A 5K8OA 3FEDA 1B6BA 5LRJA 5GCNA 4CYOA 4KSFA 2FSRA 1Z8WA 5CNPA 4X3RA 2D4OA 4OC3A 2KCWA 5J8CA 3P2HA 3IO1A 1Z9UA 1UWYA 2PR1A 1AYEA 3CXSA 4C68A 1BOBA 1Q7LA 3FBUA 4X8IA 4E0AA 4PSWA 4B14A 2OOTA 4YU9A 3KI9A 3VWEA 2PVWA 1XEBA 2GFQA 2HQYA 1S7LA 2J8RA 2Z3PA 4CAEA 2Q51A 3DNSA 3KASA 4MCPA 4M6HA 3RO0A 5C82A 2PR8A 4HNXB 1KWMA 3FEEA 4QC6A 2FIWA 4A38A 2C1CA 5DS0A 2JLMA 3R1KA 4JXRA 5EC4A 3TX8A 4HNWB 2C6CA 2PJ3A 4F0YA 4P4FA 1QSRA 4KUAA 5A27A 1YVOA 4JJXA 4MFLA 1A2ZA 4UIBA 2FXFA 4RN7A 4UFWA 2Q44A 4LQGA 1AUGA 2VEZA 5DWMA 2GIVA 5G22A 3TCVA 1TKFA 1Z5RA 5G1ZA 3S9MA 2FL4A 4ZY1A 1S7NA 3FIXA 4NF1A 4OC4A 1KZFA 1LCPA 1M4IA 1HEEA 1ZG7A 3PB6X 1VHOA 4B11A 4KOTA 1KUXA 2XEFA 4CGOA 2CTBA 4MY3A 4FBEA 1RTQA 5JQ4A 4Q38A 2POKA 4KORA 3FNCA 3PBBA 4MBUA 5G20A 1M4DA 4R7MA 2JEWA 5IB0A 1YREA 3SJFA 1IGBA 5C88A 3F0AA 1SQHA 4NXYA 2Z3LA 3S6KA 4PXDA 2ATRA 3CXPA 4E2AA 5JGFA 5BWAB 1QSNA 2P0WA 2B3UA 5A28A 2AFWA 3B3WA 4NCZA 4CPAA 1Q2DA 3S6GA 4WWVA 1Q2YA 4UEFA 3N5FA 2B5GA 3VATA 4UWJA 1YK3A 1I21A 1I1DA 1Y9KA 2D4PA 2ZW4A 2ZENA 5HMNA 4WJBA 2PJ7A 3D3SA 2QECA 3CPAA 1X12A 4KOYA 3BLNA 3TFYA 3DGVA 3TOAA 5LYLA 1Z8XA 2F7VA 3H8FA 1MJ9A 3SI1A 3D4UA 1S7KA 4CGPA 1JQGA 4XNHB 3R9EA 4FWUA 4PXBA 5F47A 2PQ8A 1Y7RA 1QMUA 5ELYA 4CAWA 4DJLA 5LYIA 2CNTA 3DR6A 4ZX8A 2QJ8A 2B58A 3FRMA 3R96A 5HVGA 3V38A 3GYAA 4PSXA 2PJ6A 2B4DA 2C6GA 3I1UA 3ISZA 1WWZA 3NH4A 2ZOFA 1IICA 4P6YA 4CGMA 4B12A 1LANA 2PJ8A 3IWWA 4NSQA 1CX8A 1FNOA 3B3CA 1ELMP 3K2KA 2YNEA 2ZEEA 4HKFA 4LX9A 1YW6A 1XMTA 1Q2CA 3K9UA 3G3SA 2Q4YA 3B3TA 2YNCA 4JXQA 3DDDA 2ABZA 2AE6A 3D7GA 3LD2A 1XF8A 4AVBA 2REEA 4KVXA 4P10A 4UCPA 4TWEA 3VARA 3W6XA 4A94A 2Z11A 2RFHA 5CPAA 2Q04A 3PGPA 3LACA 2FIAA 5HXDA 4A32A 2V77A 4YFJA 4OC2A 4XPDC 2J8MA 4KLWA 2EVNA 4XPKA 5HVFA 4UEEA 4AG9A 4MHNA 3T9YA 2A4NA 4MY0A 4FUUA 3V7ZA 4AVAA 2Q7SA 4U9YA 1Z4EA 1PCAA 2ZPAA 3ZJ0A 2VQYA 2IL4A 1LFWA 1QQ9A 1XIXA 1PYTB 1YSJA 3B35A 3PEIA 5F49A 1CPXA 5IV0A 3NH5A 1S7FA 3D8PA 4EFDA 1R57A 4GXHA 4L8AA 1RO5A 3C26A 3GLJA 4KVOE 4NGNA 2V8VA 4R87A 4BINA 4ZI6A 1AMPA 1F2OA 4CAVA 4A30A 4ONUA 1TKJA 1ARLA 3PRTA 2VXKA 2FS5A 2NMTA 2OH1A 4UCMA 4OIDA 5JM6A 4CYQA 1V0CA 5DWNA 2AFOA 3TC8A 1NSAA 1ZG9A 2Q0YA 2RC4A 4UWIA 3KGQA 2JEVA 1QSMA 4B5OA 4F9UA 1YVKA 2EWBA 5AG4A 1BAVA 1TKHA 2ARHA 2PJ5A 1XOVA 1Z8TA 3I3GA 4MCQA 1ZO0A 2ANPA 4NGMA 4OADA 3ISXA 2K5TA 3GKRA 5D8NA 3SJXA 4GM5A 5HVHA 4G1PA 2IMOA 5J8FA 1BO4A 2PJ0A 2O28A 3BI1A 4IK2A 4KOSA 2I79A 3TOBA 4L89A 3QNVA 4X5KA 2B3VA 2X7BA 2ZEDA 3IWEA 4ONWA 4PK3A 2AFSA 8CPAA 5F46A 2EK8A 2PC1A 3H5ZA 3FB3A 5KTDA 2R1IA 2QVPA 4W9YA 3TT2A 3WC6A 4FD4A 2F5IA 4KSIA 3WT4A 4MRIA 4OIWA 1XFOA 1BPNA 1KUYA 2ZEFA 2WUUA 4MFZA 1YR0A 4MJ8A 1ARMA 3PB8X 2DEAA 1B87A 3BXMA 4UEZA 1IOIA 3V8IA 4A95A 2OU2A 2PRQA 3KHXA 3SI0A 1K4JA 1Z2LA 1CP6A 3FH4A 2OZUA 4RS2A 4CAXA 1M44A 1TF8A 2PJCA 3IWGA 1Y7EA 3NFZA 2EBJA 2GANA 3FMCA 2YGWA 3PBEA 4YWYA 4RUHA 4P44A 2J9AA 3R9GA 4JD6A 2FT0A 3KR5A 4K30A 3WABA 2O4HA 3MGDA 3NH8A 4R8FA 4R76A 3B7IA 5FVJA 2WYRA 4M3SA 2R98A 4Y49C 3PP9A 2PJ4A 1BLLE 3B8GA 4I49A 2FCKA 2JDDA 4MFKA 4DUKA 4OC5A 1HDUA 3D66A 1P4NA 2HUZA 1NMTA 4KOVA 2H5MA 3EXNA 3KL9A 4F8ZA 3PB9X 3TO7A 1TIQA 4C2XA 2BSWA 4DNCA 4FD5A 1ZG8A 1CP7A 1XJOA 1F57A 3NE8A 4CGLA 3EY5A 2V8HA 2ZXVA 1Y0RA 5D29A 3NE7A 4NGSA 3L2NA 4ZY0A 2WPWA 5AG6A 4UA3A 4JLYA 3S6FA 3W91A 2VZYA 2PSWA 3D2PA 4KLVA 1ELLP 2ZEOA 4QVTA 3IU1A 2PE3A 3T90A 4A33A 5K8MA 2Q4VA 4OKOA 2GLFA 3WC5A 5KTAA 2CNSA 4P4JA 2PJ9A 1M4LA 3KR4A 4Q7AA 4Q36A 1JWQA 4AVCA 1NSLA 1Y9WA 3FECA 4F9VA 1VIXA 1LAMA 4Z65A 4HNYB 1DE4C 4OC1A 1LRZA 3QAYA 1CPSA 3EO4A 4JYWA 1F2PA 1XMBA 4CYPA 4TNUA 1S5KA 3KKWA 4IHMA 2Z3KA 2OZHA 4DYOA 3ZZIA 4C7IA 2BUEA 7CPAA 4KOWA 1S3ZA 4P4EA 1PU9A 4R3LA 3SJGA 4MI4A 1OZPA 4AXVA 2CNMA 4BMHA 3H4QA 1HDQA 4MXUA 2PVVA 4E8OA 1EE3P 4QB9A 2CF4A 4F0XA 2RB7A 4KOUA 3PFEA 2VZZA 4P45A 2WSAA 2P6EA 5IX3A 1YLEA 2YNCC 2C6PA 1TF9A 3D7FA 5K8NA 6CPAA 3CT9A 4QBJA 2ODFA 3D67A 1R43A 4J3GA 4PXCA 4B10A 4PPZA 2PJ1A 4FD7A 4OC0A 4CRZB 2V8DA 3F8KA 2JDCA 4R9MA 2HV2A 2I3CA 4PK2A 4F6AA 1QSOA 2Q43A 4OMEA 3EFAA 5ISVA 3IIBA 2O53A 1BPMA 3B3SA 1DTDA 2G9DA 4KZTA 4YRHA 4H89A 3GUXA 4CYNA 3RBUA 1IU8A 3B2YA 3B3VA 2ZW7A 1LOKA 2ZOGA 3PZJA 4KOXA 4CS0B 5CBMA 2HB6A 2CY2A 3EC4A 2IQ6A 4BD9A 1IY7A 2OZGA 4YGOA 5THWA 3CPXA 3RZAA 2OR4A 2DPTA 2IJZA 4C2ZA 2BOAA 1VGYA 3SHPA 2QYVA 3SJEA 4CRYB 4IUSA 2PRBA 4NFRA 4O23A 5LYDA 2Z10A 4XPDB 1VHSA 4A2ZA 2EUIA 2AFMA 2CTCA 4EMEA 1CBXA 3IC1A 1MK4A 1M1DA 4U5YA 1IOFA 2PJBA 1IYKA 3LMSA 3S9LA 1YLOA 2Y0MA 5H84A 4A31A 3CZXA 3FXTA 4U9ZA 1N71A 4OP4A 5KTCA 4II9A 4R57A 2R8VA 4M85A 3JUWA 4NJQA 5AG5A 4B13A 4M6IA 3HUVA 4LQ6A 4EVYA 1U6MA 5E96A 1LAPA 2ZW6A 3MRUA 4NJRA 1QSTA 4X2TA 2J8NA 2REFA 4XPLA 4BBHA 3IJ3A 1Y0YA 3FVLA 2GU2A 1S60A 5I0CA 1ZLHA 2Z3MA 3D7HA 2DXQA 4RI1A 3RYOA 2JBJA 4UBRA 4CAFA 4MHPA 5JPHA 1H8LA 4JWPA 5IB9A 1M4GA 2BL1A 3VWDA 4GS4A 2AFXA 2NSMA 4PXEA 2DPSA 3PB7X 4FAIA 4PV6A 4ZY2A 3IGRA 2XEJA 4NEXA 2Q4ZA 5AGEA 3R9FA 3JRUA 3QB8A 3WC7A 3RNZA 1X10A 3K9TA 3PB4X 4JZ0A 1CG2A 2Z0ZA 4UIAA 1IIDA 4A37A 3HLPA 2AFUA 4NGPA 3MN8A 3KQXA 3QAHA 4MHDA 4A39A 1XRYA 3SXOA 4IAVA 2GREA 5I4MA 2P6GA 3S6HA 3FF3A 1KUVA 1VKCA 3H8EA 5G21A 2ZW5A 2XEIA 4FD6A 3W6SA 4H2KA 2G0BA 5J1QA 3DR8A 1PUAA 3SXNA 2BO9A 3UY5A 3GB0A 2P6FA 2PCUA 4MFJA 3CDXA 4MHYA 3T8WA 1ON0A 2V8GA 2CXAA 1XBUA 4ZBGA 4ZX9A 1ZLIA 4P4BA 3DSBA 3FYNA 4P4IA 2AFZA 2R7HA 3PFOA 3G8WA 2C27A 1YW4A 3TO6A 2ZEHA 2HC9A 3LWUA 4R6TA 4XNHC 4Y49B 3JTKA 4MFPA 3JVNA 4NGQA 5LYFA 1FT7A 2FE7A 2Z3OA 4AG7A 1P0HA 2VBQA 3RAMA 5JH9A 2I00A 3NA6A 3FJUA 4UF4A 2G3AA 2CIJA 3IFEA 4CGNA 4LUAA 1YQEA 3H8GA 4UCNA 3WR7A 4AB7A 3BJ7A 3TE4A 1NE9A 1FY7A 3D68A 3TTHA 3KHZA 4B6ZA 1GHEA 1YMEA 1I12A 1Z4RA 3BI0A 2EO8A 1J4JA 2B5GB 4MMOA 1Z8LA 3A9LA 3BJ8A 2OB0A 1TXRA 4NGRA 1IB1E 3S9NA 2B4BA 5H86A 5F48A 4HPSA 4KS9A 4OLLA 2F8HA 5F09A 4ZGYB 5EBVA 4KSAA 2PJAA 3GIUA 5LRKA 3FX6A 3BHXA 4UFVA 2JBKA 2G3TA 1UFHA 3I9SA 3N7ZA 1WK4A 4MHZA 4PQAA 4MCSA 4ORFA 4ZYQA 4MCRA 4P4DA 2B4DB 4MFQA 2Q7BA 1CM0A 4B5PA 1IYLA 4H6UA 2GE3A 2VL1A 3GY9A 3IEHA 2QIRA 2AJ6A 3P2FA 2QMLA 3LODA 2VI7A 4B5PB 5K8PA 3KQZA 1YX0A 3R95A 4NGTA 3F5BA 2DF5A 3DLJA 1MJBA 4H6ZA 4M6GA 1OBRA 1GYTA 4OAEA 5EMIA 2ZEPA 3D2MA 4KVME 3OWCA 1R3NA 2BEIA 3D7DA 3CXQA 2PDOA 2BCOA 2ZEMA 3TO9A 5AG7A 3SI2A 1RXTA 2XEGA 4C7HA 4C2YA 2FVGA 1L0CA 2YNDA 5HH1A
chains in the Genus database with same CATH topology
2NYQA 2EK9A 3KZWA 5LRGA 2ZELA 1VHEA 4K3NA 2WZNA 2PIYA 2PIZA 2GLJA 4EWTA 3VH9A 2ZEGA 2PJ2A 5K8OA 3FEDA 5LRJA 4X3RA 4OC3A 3IO1A 1UWYA 1AYEA 1Q7LA 4X8IA 2OOTA 4YU9A 3KI9A 2PVWA 2Q51A 3KASA 4MCPA 1KWMA 3FEEA 4A38A 2C1CA 5DS0A 3TX8A 2C6CA 2PJ3A 4P4FA 4UIBA 4LQGA 1TKFA 1Z5RA 3S9MA 4ZY1A 4OC4A 1LCPA 1ZG7A 1HEEA 3PB6X 1VHOA 2XEFA 2CTBA 4FBEA 1RTQA 2POKA 3PBBA 4R7MA 2JEWA 3SJFA 1IGBA 4PXDA 5JGFA 2AFWA 3B3WA 4CPAA 4WWVA 4UEFA 3N5FA 3VATA 2ZENA 4WJBA 2PJ7A 3CPAA 3DGVA 5LYLA 3H8FA 2F7VA 3SI1A 3D4UA 1JQGA 4FWUA 4PXBA 1QMUA 5ELYA 4DJLA 5LYIA 4ZX8A 2QJ8A 5HVGA 3V38A 2PJ6A 2C6GA 3I1UA 3ISZA 3NH4A 2ZOFA 4P6YA 1LANA 2PJ8A 3IWWA 1CX8A 1FNOA 3B3CA 1ELMP 3K2KA 2ZEEA 1YW6A 3B3TA 2ABZA 3D7GA 4P10A 4TWEA 3VARA 4A94A 2RFHA 5CPAA 5HXDA 2V77A 4OC2A 5HVFA 4UEEA 4MHNA 4FUUA 3V7ZA 1PCAA 3PEIA 1LFWA 1QQ9A 1PYTB 1YSJA 3B35A 1CPXA 3NH5A 4EFDA 3GLJA 4NGNA 2V8VA 4ZI6A 1AMPA 1F2OA 1TKJA 1ARLA 3PRTA 4OIDA 5JM6A 3TC8A 2AFOA 1NSAA 1ZG9A 3KGQA 4F9UA 2EWBA 1BAVA 1TKHA 2PJ5A 4MCQA 2ANPA 4NGMA 3ISXA 5D8NA 3SJXA 4GM5A 5HVHA 4G1PA 2IMOA 2PJ0A 3BI1A 4IK2A 3QNVA 2ZEDA 4ONWA 8CPAA 2AFSA 2EK8A 2QVPA 4W9YA 3WC6A 4KSIA 3WT4A 4MRIA 4OIWA 1XFOA 1BPNA 2ZEFA 1ARMA 3PB8X 2DEAA 3BXMA 4UEZA 2PRQA 3KHXA 3SI0A 3FH4A 1Z2LA 1CP6A 2PJCA 1TF8A 3NFZA 3PBEA 1Y7EA 4YWYA 3FMCA 4RUHA 4P44A 2J9AA 3KR5A 3WABA 2O4HA 4R8FA 3NH8A 4R76A 3B7IA 2WYRA 2PJ4A 1BLLE 4DUKA 4OC5A 1HDUA 3D66A 4F8ZA 3KL9A 3PB9X 1ZG8A 1CP7A 1XJOA 1F57A 2V8HA 5D29A 1Y0RA 4NGSA 3L2NA 4ZY0A 5K8MA 1ELLP 2ZEOA 2PE3A 4OKOA 2GLFA 3WC5A 4P4JA 2PJ9A 1M4LA 3KR4A 4Q7AA 3FECA 4F9VA 1VIXA 1LAMA 4Z65A 1DE4C 4OC1A 1CPSA 4JYWA 1F2PA 1XMBA 4TNUA 4IHMA 4DYOA 7CPAA 4P4EA 3SJGA 4AXVA 1HDQA 4MXUA 2PVVA 1EE3P 2CF4A 2RB7A 3PFEA 4P45A 2C6PA 1TF9A 3D7FA 5K8NA 6CPAA 3CT9A 3D67A 1R43A 4PXCA 4PPZA 2PJ1A 4OC0A 2V8DA 2I3CA 2Q43A 4OMEA 3IIBA 2O53A 1BPMA 3B3SA 1DTDA 2G9DA 3GUXA 3RBUA 3B2YA 3B3VA 1LOKA 2ZOGA 5CBMA 2HB6A 2IQ6A 4BD9A 1IY7A 5THWA 3CPXA 3RZAA 2OR4A 2IJZA 2BOAA 1VGYA 2QYVA 3SJEA 4NFRA 4O23A 5LYDA 2AFMA 2CTCA 4EMEA 1CBXA 3IC1A 2PJBA 3LMSA 3S9LA 1YLOA 4OP4A 4NJQA 3HUVA 1LAPA 3MRUA 4NJRA 4X2TA 3IJ3A 1Y0YA 3FVLA 2GU2A 1ZLHA 3D7HA 2JBJA 4MHPA 1H8LA 5IB9A 2AFXA 2NSMA 4PXEA 3PB7X 4FAIA 4ZY2A 2XEJA 2Q4ZA 3JRUA 3WC7A 3K9TA 3PB4X 4JZ0A 1CG2A 4UIAA 4A37A 3HLPA 2AFUA 4NGPA 3MN8A 3KQXA 4A39A 1XRYA 5I4MA 4IAVA 2GREA 3FF3A 3H8EA 2XEIA 4H2KA 5J1QA 2BO9A 3GB0A 2PCUA 3CDXA 4MHYA 3T8WA 2V8GA 1XBUA 4ZX9A 1ZLIA 4P4BA 4P4IA 2AFZA 3PFOA 1YW4A 2ZEHA 2HC9A 3LWUA 4R6TA 5LYFA 4NGQA 1FT7A 3RAMA 5JH9A 3NA6A 3FJUA 4UF4A 2CIJA 3IFEA 3H8GA 3D68A 3KHZA 4B6ZA 1YMEA 3BI0A 4MMOA 1Z8LA 1TXRA 4NGRA 3S9NA 2F8HA 5F09A 2PJAA 5LRKA 3FX6A 3BHXA 2JBKA 4PQAA 4MHZA 4MCSA 4ZYQA 4MCRA 4P4DA 2VL1A 3IEHA 5K8PA 3KQZA 4NGTA 3DLJA 1OBRA 1GYTA 2ZEPA 1R3NA 3D7DA 2BCOA 2ZEMA 3SI2A 2XEGA 2FVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYQ A;  2EK9 A;  3KZW A;  5LRG A;  2ZEL A;  1VHE A;  4K3N A;  2WZN A;  2PIY A;  2PIZ A;  2GLJ A;  4EWT A;  3VH9 A;  2ZEG A;  2PJ2 A;  5K8O A;  3FED A;  5LRJ A;  4X3R A;  4OC3 A;  3IO1 A;  1UWY A;  1AYE A;  1Q7L A;  4X8I A;  2OOT A;  4YU9 A;  3KI9 A;  2PVW A;  2Q51 A;  3KAS A;  4MCP A;  1KWM A;  3FEE A;  4A38 A;  2C1C A;  5DS0 A;  3TX8 A;  2C6C A;  2PJ3 A;  4P4F A;  4UIB A;  4LQG A;  1TKF A;  1Z5R A;  3S9M A;  4ZY1 A;  4OC4 A;  1LCP A;  1ZG7 A;  1HEE A;  3PB6 X;  1VHO A;  2XEF A;  2CTB A;  4FBE A;  1RTQ A;  2POK A;  3PBB A;  4R7M A;  2JEW A;  3SJF A;  1IGB A;  4PXD A;  5JGF A;  2AFW A;  3B3W A;  4CPA A;  4WWV A;  4UEF A;  3N5F A;  3VAT A;  2ZEN A;  4WJB A;  2PJ7 A;  3CPA A;  3DGV A;  5LYL A;  3H8F A;  2F7V A;  3SI1 A;  3D4U A;  1JQG A;  4FWU A;  4PXB A;  1QMU A;  5ELY A;  4DJL A;  5LYI A;  4ZX8 A;  2QJ8 A;  5HVG A;  3V38 A;  2PJ6 A;  2C6G A;  3I1U A;  3ISZ A;  3NH4 A;  2ZOF A;  4P6Y A;  1LAN A;  2PJ8 A;  3IWW A;  1CX8 A;  1FNO A;  3B3C A;  1ELM P;  3K2K A;  2ZEE A;  1YW6 A;  3B3T A;  2ABZ A;  3D7G A;  4P10 A;  4TWE A;  3VAR A;  4A94 A;  2RFH A;  5CPA A;  5HXD A;  2V77 A;  4OC2 A;  5HVF A;  4UEE A;  4MHN A;  4FUU A;  3V7Z A;  1PCA A;  3PEI A;  1LFW A;  1QQ9 A;  1PYT B;  1YSJ A;  3B35 A;  1CPX A;  3NH5 A;  4EFD A;  3GLJ A;  4NGN A;  2V8V A;  4ZI6 A;  1AMP A;  1F2O A;  1TKJ A;  1ARL A;  3PRT A;  4OID A;  5JM6 A;  3TC8 A;  2AFO A;  1NSA A;  1ZG9 A;  3KGQ A;  4F9U A;  2EWB A;  1BAV A;  1TKH A;  2PJ5 A;  4MCQ A;  2ANP A;  4NGM A;  3ISX A;  5D8N A;  3SJX A;  4GM5 A;  5HVH A;  4G1P A;  2IMO A;  2PJ0 A;  3BI1 A;  4IK2 A;  3QNV A;  2ZED A;  4ONW A;  8CPA A;  2AFS A;  2EK8 A;  2QVP A;  4W9Y A;  3WC6 A;  4KSI A;  3WT4 A;  4MRI A;  4OIW A;  1XFO A;  1BPN A;  2ZEF A;  1ARM A;  3PB8 X;  2DEA A;  3BXM A;  4UEZ A;  2PRQ A;  3KHX A;  3SI0 A;  3FH4 A;  1Z2L A;  1CP6 A;  2PJC A;  1TF8 A;  3NFZ A;  3PBE A;  1Y7E A;  4YWY A;  3FMC A;  4RUH A;  4P44 A;  2J9A A;  3KR5 A;  3WAB A;  2O4H A;  4R8F A;  3NH8 A;  4R76 A;  3B7I A;  2WYR A;  2PJ4 A;  1BLL E;  4DUK A;  4OC5 A;  1HDU A;  3D66 A;  4F8Z A;  3KL9 A;  3PB9 X;  1ZG8 A;  1CP7 A;  1XJO A;  1F57 A;  2V8H A;  5D29 A;  1Y0R A;  4NGS A;  3L2N A;  4ZY0 A;  5K8M A;  1ELL P;  2ZEO A;  2PE3 A;  4OKO A;  2GLF A;  3WC5 A;  4P4J A;  2PJ9 A;  1M4L A;  3KR4 A;  4Q7A A;  3FEC A;  4F9V A;  1VIX A;  1LAM A;  4Z65 A;  1DE4 C;  4OC1 A;  1CPS A;  4JYW A;  1F2P A;  1XMB A;  4TNU A;  4IHM A;  4DYO A;  7CPA A;  4P4E A;  3SJG A;  4AXV A;  1HDQ A;  4MXU A;  2PVV A;  1EE3 P;  2CF4 A;  2RB7 A;  3PFE A;  4P45 A;  2C6P A;  1TF9 A;  3D7F A;  5K8N A;  6CPA A;  3CT9 A;  3D67 A;  1R43 A;  4PXC A;  4PPZ A;  2PJ1 A;  4OC0 A;  2V8D A;  2I3C A;  2Q43 A;  4OME A;  3IIB A;  2O53 A;  1BPM A;  3B3S A;  1DTD A;  2G9D A;  3GUX A;  3RBU A;  3B2Y A;  3B3V A;  1LOK A;  2ZOG A;  5CBM A;  2HB6 A;  2IQ6 A;  4BD9 A;  1IY7 A;  5THW A;  3CPX A;  3RZA A;  2OR4 A;  2IJZ A;  2BOA A;  1VGY A;  2QYV A;  3SJE A;  4NFR A;  4O23 A;  5LYD A;  2AFM A;  2CTC A;  4EME A;  1CBX A;  3IC1 A;  2PJB A;  3LMS A;  3S9L A;  1YLO A;  4OP4 A;  4NJQ A;  3HUV A;  1LAP A;  3MRU A;  4NJR A;  4X2T A;  3IJ3 A;  1Y0Y A;  3FVL A;  2GU2 A;  1ZLH A;  3D7H A;  2JBJ A;  4MHP A;  1H8L A;  5IB9 A;  2AFX A;  2NSM A;  4PXE A;  3PB7 X;  4FAI A;  4ZY2 A;  2XEJ A;  2Q4Z A;  3JRU A;  3WC7 A;  3K9T A;  3PB4 X;  4JZ0 A;  1CG2 A;  4UIA A;  4A37 A;  3HLP A;  2AFU A;  4NGP A;  3MN8 A;  3KQX A;  4A39 A;  1XRY A;  5I4M A;  4IAV A;  2GRE A;  3FF3 A;  3H8E A;  2XEI A;  4H2K A;  5J1Q A;  2BO9 A;  3GB0 A;  2PCU A;  3CDX A;  4MHY A;  3T8W A;  2V8G A;  1XBU A;  4ZX9 A;  1ZLI A;  4P4B A;  4P4I A;  2AFZ A;  3PFO A;  1YW4 A;  2ZEH A;  2HC9 A;  3LWU A;  4R6T A;  5LYF A;  4NGQ A;  1FT7 A;  3RAM A;  5JH9 A;  3NA6 A;  3FJU A;  4UF4 A;  2CIJ A;  3IFE A;  3H8G A;  3D68 A;  3KHZ A;  4B6Z A;  1YME A;  3BI0 A;  4MMO A;  1Z8L A;  1TXR A;  4NGR A;  3S9N A;  2F8H A;  5F09 A;  2PJA A;  5LRK A;  3FX6 A;  3BHX A;  2JBK A;  4PQA A;  4MHZ A;  4MCS A;  4ZYQ A;  4MCR A;  4P4D A;  2VL1 A;  3IEH A;  5K8P A;  3KQZ A;  4NGT A;  3DLJ A;  1OBR A;  1GYT A;  2ZEP A;  1R3N A;  3D7D A;  2BCO A;  2ZEM A;  3SI2 A;  2XEG A;  2FVG A; 
#chains in the Genus database with same CATH topology
 2NYQ A;  1MJA A;  2EK9 A;  3KZW A;  5LRG A;  2ZEL A;  1VHE A;  4K3N A;  1YGH A;  2WZN A;  1CJW A;  3E0K A;  4UFX A;  4R3K A;  2PIY A;  2Z3N A;  2PIZ A;  4IF5 A;  2GLJ A;  1XE4 A;  3VH9 A;  3IU2 A;  4EWT A;  4KUB A;  2WPX A;  2ZEG A;  4QUS A;  2PJ2 A;  5K8O A;  3FED A;  1B6B A;  5LRJ A;  5GCN A;  4CYO A;  4KSF A;  2FSR A;  1Z8W A;  5CNP A;  4X3R A;  2D4O A;  4OC3 A;  2KCW A;  5J8C A;  3P2H A;  3IO1 A;  1Z9U A;  1UWY A;  2PR1 A;  1AYE A;  3CXS A;  4C68 A;  1BOB A;  1Q7L A;  3FBU A;  4X8I A;  4E0A A;  4PSW A;  4B14 A;  2OOT A;  4YU9 A;  3KI9 A;  3VWE A;  2PVW A;  1XEB A;  2GFQ A;  2HQY A;  1S7L A;  2J8R A;  2Z3P A;  4CAE A;  2Q51 A;  3DNS A;  3KAS A;  4MCP A;  4M6H A;  3RO0 A;  5C82 A;  2PR8 A;  4HNX B;  1KWM A;  3FEE A;  4QC6 A;  2FIW A;  4A38 A;  2C1C A;  5DS0 A;  2JLM A;  3R1K A;  4JXR A;  5EC4 A;  3TX8 A;  4HNW B;  2C6C A;  2PJ3 A;  4F0Y A;  4P4F A;  1QSR A;  4KUA A;  5A27 A;  1YVO A;  4JJX A;  4MFL A;  1A2Z A;  4UIB A;  2FXF A;  4RN7 A;  4UFW A;  2Q44 A;  4LQG A;  1AUG A;  2VEZ A;  5DWM A;  2GIV A;  5G22 A;  3TCV A;  1TKF A;  1Z5R A;  5G1Z A;  3S9M A;  2FL4 A;  4ZY1 A;  1S7N A;  3FIX A;  4NF1 A;  4OC4 A;  1KZF A;  1LCP A;  1M4I A;  1HEE A;  1ZG7 A;  3PB6 X;  1VHO A;  4B11 A;  4KOT A;  1KUX A;  2XEF A;  4CGO A;  2CTB A;  4MY3 A;  4FBE A;  1RTQ A;  5JQ4 A;  4Q38 A;  2POK A;  4KOR A;  3FNC A;  3PBB A;  4MBU A;  5G20 A;  1M4D A;  4R7M A;  2JEW A;  5IB0 A;  1YRE A;  3SJF A;  1IGB A;  5C88 A;  3F0A A;  1SQH A;  4NXY A;  2Z3L A;  3S6K A;  4PXD A;  2ATR A;  3CXP A;  4E2A A;  5JGF A;  5BWA B;  1QSN A;  2P0W A;  2B3U A;  5A28 A;  2AFW A;  3B3W A;  4NCZ A;  4CPA A;  1Q2D A;  3S6G A;  4WWV A;  1Q2Y A;  4UEF A;  3N5F A;  2B5G A;  3VAT A;  4UWJ A;  1YK3 A;  1I21 A;  1I1D A;  1Y9K A;  2D4P A;  2ZW4 A;  2ZEN A;  5HMN A;  4WJB A;  2PJ7 A;  3D3S A;  2QEC A;  3CPA A;  1X12 A;  4KOY A;  3BLN A;  3TFY A;  3DGV A;  3TOA A;  5LYL A;  1Z8X A;  2F7V A;  3H8F A;  1MJ9 A;  3SI1 A;  3D4U A;  1S7K A;  4CGP A;  1JQG A;  4XNH B;  3R9E A;  4FWU A;  4PXB A;  5F47 A;  2PQ8 A;  1Y7R A;  1QMU A;  5ELY A;  4CAW A;  4DJL A;  5LYI A;  2CNT A;  3DR6 A;  4ZX8 A;  2QJ8 A;  2B58 A;  3FRM A;  3R96 A;  5HVG A;  3V38 A;  3GYA A;  4PSX A;  2PJ6 A;  2B4D A;  2C6G A;  3I1U A;  3ISZ A;  1WWZ A;  3NH4 A;  2ZOF A;  1IIC A;  4P6Y A;  4CGM A;  4B12 A;  1LAN A;  2PJ8 A;  3IWW A;  4NSQ A;  1CX8 A;  1FNO A;  3B3C A;  1ELM P;  3K2K A;  2YNE A;  2ZEE A;  4HKF A;  4LX9 A;  1YW6 A;  1XMT A;  1Q2C A;  3K9U A;  3G3S A;  2Q4Y A;  3B3T A;  2YNC A;  4JXQ A;  3DDD A;  2ABZ A;  2AE6 A;  3D7G A;  3LD2 A;  1XF8 A;  4AVB A;  2REE A;  4KVX A;  4P10 A;  4UCP A;  4TWE A;  3VAR A;  3W6X A;  4A94 A;  2Z11 A;  2RFH A;  5CPA A;  2Q04 A;  3PGP A;  3LAC A;  2FIA A;  5HXD A;  4A32 A;  2V77 A;  4YFJ A;  4OC2 A;  4XPD C;  2J8M A;  4KLW A;  2EVN A;  4XPK A;  5HVF A;  4UEE A;  4AG9 A;  4MHN A;  3T9Y A;  2A4N A;  4MY0 A;  4FUU A;  3V7Z A;  4AVA A;  2Q7S A;  4U9Y A;  1Z4E A;  1PCA A;  2ZPA A;  3ZJ0 A;  2VQY A;  2IL4 A;  1LFW A;  1QQ9 A;  1XIX A;  1PYT B;  1YSJ A;  3B35 A;  3PEI A;  5F49 A;  1CPX A;  5IV0 A;  3NH5 A;  1S7F A;  3D8P A;  4EFD A;  1R57 A;  4GXH A;  4L8A A;  1RO5 A;  3C26 A;  3GLJ A;  4KVO E;  4NGN A;  2V8V A;  4R87 A;  4BIN A;  4ZI6 A;  1AMP A;  1F2O A;  4CAV A;  4A30 A;  4ONU A;  1TKJ A;  1ARL A;  3PRT A;  2VXK A;  2FS5 A;  2NMT A;  2OH1 A;  4UCM A;  4OID A;  5JM6 A;  4CYQ A;  1V0C A;  5DWN A;  2AFO A;  3TC8 A;  1NSA A;  1ZG9 A;  2Q0Y A;  2RC4 A;  4UWI A;  3KGQ A;  2JEV A;  1QSM A;  4B5O A;  4F9U A;  1YVK A;  2EWB A;  5AG4 A;  1BAV A;  1TKH A;  2ARH A;  2PJ5 A;  1XOV A;  1Z8T A;  3I3G A;  4MCQ A;  1ZO0 A;  2ANP A;  4NGM A;  4OAD A;  3ISX A;  2K5T A;  3GKR A;  5D8N A;  3SJX A;  4GM5 A;  5HVH A;  4G1P A;  2IMO A;  5J8F A;  1BO4 A;  2PJ0 A;  2O28 A;  3BI1 A;  4IK2 A;  4KOS A;  2I79 A;  3TOB A;  4L89 A;  3QNV A;  4X5K A;  2B3V A;  2X7B A;  2ZED A;  3IWE A;  4ONW A;  4PK3 A;  2AFS A;  8CPA A;  5F46 A;  2EK8 A;  2PC1 A;  3H5Z A;  3FB3 A;  5KTD A;  2R1I A;  2QVP A;  4W9Y A;  3TT2 A;  3WC6 A;  4FD4 A;  2F5I A;  4KSI A;  3WT4 A;  4MRI A;  4OIW A;  1XFO A;  1BPN A;  1KUY A;  2ZEF A;  2WUU A;  4MFZ A;  1YR0 A;  4MJ8 A;  1ARM A;  3PB8 X;  2DEA A;  1B87 A;  3BXM A;  4UEZ A;  1IOI A;  3V8I A;  4A95 A;  2OU2 A;  2PRQ A;  3KHX A;  3SI0 A;  1K4J A;  1Z2L A;  1CP6 A;  3FH4 A;  2OZU A;  4RS2 A;  4CAX A;  1M44 A;  1TF8 A;  2PJC A;  3IWG A;  1Y7E A;  3NFZ A;  2EBJ A;  2GAN A;  3FMC A;  2YGW A;  3PBE A;  4YWY A;  4RUH A;  4P44 A;  2J9A A;  3R9G A;  4JD6 A;  2FT0 A;  3KR5 A;  4K30 A;  3WAB A;  2O4H A;  3MGD A;  3NH8 A;  4R8F A;  4R76 A;  3B7I A;  5FVJ A;  2WYR A;  4M3S A;  2R98 A;  4Y49 C;  3PP9 A;  2PJ4 A;  1BLL E;  3B8G A;  4I49 A;  2FCK A;  2JDD A;  4MFK A;  4DUK A;  4OC5 A;  1HDU A;  3D66 A;  1P4N A;  2HUZ A;  1NMT A;  4KOV A;  2H5M A;  3EXN A;  3KL9 A;  4F8Z A;  3PB9 X;  3TO7 A;  1TIQ A;  4C2X A;  2BSW A;  4DNC A;  4FD5 A;  1ZG8 A;  1CP7 A;  1XJO A;  1F57 A;  3NE8 A;  4CGL A;  3EY5 A;  2V8H A;  2ZXV A;  1Y0R A;  5D29 A;  3NE7 A;  4NGS A;  3L2N A;  4ZY0 A;  2WPW A;  5AG6 A;  4UA3 A;  4JLY A;  3S6F A;  3W91 A;  2VZY A;  2PSW A;  3D2P A;  4KLV A;  1ELL P;  2ZEO A;  4QVT A;  3IU1 A;  2PE3 A;  3T90 A;  4A33 A;  5K8M A;  2Q4V A;  4OKO A;  2GLF A;  3WC5 A;  5KTA A;  2CNS A;  4P4J A;  2PJ9 A;  1M4L A;  3KR4 A;  4Q7A A;  4Q36 A;  1JWQ A;  4AVC A;  1NSL A;  1Y9W A;  3FEC A;  4F9V A;  1VIX A;  1LAM A;  4Z65 A;  4HNY B;  1DE4 C;  4OC1 A;  1LRZ A;  3QAY A;  1CPS A;  3EO4 A;  4JYW A;  1F2P A;  1XMB A;  4CYP A;  4TNU A;  1S5K A;  3KKW A;  4IHM A;  2Z3K A;  2OZH A;  4DYO A;  3ZZI A;  4C7I A;  2BUE A;  7CPA A;  4KOW A;  1S3Z A;  4P4E A;  1PU9 A;  4R3L A;  3SJG A;  4MI4 A;  1OZP A;  4AXV A;  2CNM A;  4BMH A;  3H4Q A;  1HDQ A;  4MXU A;  2PVV A;  4E8O A;  1EE3 P;  4QB9 A;  2CF4 A;  4F0X A;  2RB7 A;  4KOU A;  3PFE A;  2VZZ A;  4P45 A;  2WSA A;  2P6E A;  5IX3 A;  1YLE A;  2YNC C;  2C6P A;  1TF9 A;  3D7F A;  5K8N A;  6CPA A;  3CT9 A;  4QBJ A;  2ODF A;  3D67 A;  1R43 A;  4J3G A;  4PXC A;  4B10 A;  4PPZ A;  2PJ1 A;  4FD7 A;  4OC0 A;  4CRZ B;  2V8D A;  3F8K A;  2JDC A;  4R9M A;  2HV2 A;  2I3C A;  4PK2 A;  4F6A A;  1QSO A;  2Q43 A;  4OME A;  3EFA A;  5ISV A;  3IIB A;  2O53 A;  1BPM A;  3B3S A;  1DTD A;  2G9D A;  4KZT A;  4YRH A;  4H89 A;  3GUX A;  4CYN A;  3RBU A;  1IU8 A;  3B2Y A;  3B3V A;  2ZW7 A;  1LOK A;  2ZOG A;  3PZJ A;  4KOX A;  4CS0 B;  5CBM A;  2HB6 A;  2CY2 A;  3EC4 A;  2IQ6 A;  4BD9 A;  1IY7 A;  2OZG A;  4YGO A;  5THW A;  3CPX A;  3RZA A;  2OR4 A;  2DPT A;  2IJZ A;  4C2Z A;  2BOA A;  1VGY A;  3SHP A;  2QYV A;  3SJE A;  4CRY B;  4IUS A;  2PRB A;  4NFR A;  4O23 A;  5LYD A;  2Z10 A;  4XPD B;  1VHS A;  4A2Z A;  2EUI A;  2AFM A;  2CTC A;  4EME A;  1CBX A;  3IC1 A;  1MK4 A;  1M1D A;  4U5Y A;  1IOF A;  2PJB A;  1IYK A;  3LMS A;  3S9L A;  1YLO A;  2Y0M A;  5H84 A;  4A31 A;  3CZX A;  3FXT A;  4U9Z A;  1N71 A;  4OP4 A;  5KTC A;  4II9 A;  4R57 A;  2R8V A;  4M85 A;  3JUW A;  4NJQ A;  5AG5 A;  4B13 A;  4M6I A;  3HUV A;  4LQ6 A;  4EVY A;  1U6M A;  5E96 A;  1LAP A;  2ZW6 A;  3MRU A;  4NJR A;  1QST A;  4X2T A;  2J8N A;  2REF A;  4XPL A;  4BBH A;  3IJ3 A;  1Y0Y A;  3FVL A;  2GU2 A;  1S60 A;  5I0C A;  1ZLH A;  2Z3M A;  3D7H A;  2DXQ A;  4RI1 A;  3RYO A;  2JBJ A;  4UBR A;  4CAF A;  4MHP A;  5JPH A;  1H8L A;  4JWP A;  5IB9 A;  1M4G A;  2BL1 A;  3VWD A;  4GS4 A;  2AFX A;  2NSM A;  4PXE A;  2DPS A;  3PB7 X;  4FAI A;  4PV6 A;  4ZY2 A;  3IGR A;  2XEJ A;  4NEX A;  2Q4Z A;  5AGE A;  3R9F A;  3JRU A;  3QB8 A;  3WC7 A;  3RNZ A;  1X10 A;  3K9T A;  3PB4 X;  4JZ0 A;  1CG2 A;  2Z0Z A;  4UIA A;  1IID A;  4A37 A;  3HLP A;  2AFU A;  4NGP A;  3MN8 A;  3KQX A;  3QAH A;  4MHD A;  4A39 A;  1XRY A;  3SXO A;  4IAV A;  2GRE A;  5I4M A;  2P6G A;  3S6H A;  3FF3 A;  1KUV A;  1VKC A;  3H8E A;  5G21 A;  2ZW5 A;  2XEI A;  4FD6 A;  3W6S A;  4H2K A;  2G0B A;  5J1Q A;  3DR8 A;  1PUA A;  3SXN A;  2BO9 A;  3UY5 A;  3GB0 A;  2P6F A;  2PCU A;  4MFJ A;  3CDX A;  4MHY A;  3T8W A;  1ON0 A;  2V8G A;  2CXA A;  1XBU A;  4ZBG A;  4ZX9 A;  1ZLI A;  4P4B A;  3DSB A;  3FYN A;  4P4I A;  2AFZ A;  2R7H A;  3PFO A;  3G8W A;  2C27 A;  1YW4 A;  3TO6 A;  2ZEH A;  2HC9 A;  3LWU A;  4R6T A;  4XNH C;  4Y49 B;  3JTK A;  4MFP A;  3JVN A;  4NGQ A;  5LYF A;  1FT7 A;  2FE7 A;  2Z3O A;  4AG7 A;  1P0H A;  2VBQ A;  3RAM A;  5JH9 A;  2I00 A;  3NA6 A;  3FJU A;  4UF4 A;  2G3A A;  2CIJ A;  3IFE A;  4CGN A;  4LUA A;  1YQE A;  3H8G A;  4UCN A;  3WR7 A;  4AB7 A;  3BJ7 A;  3TE4 A;  1NE9 A;  1FY7 A;  3D68 A;  3TTH A;  3KHZ A;  4B6Z A;  1GHE A;  1YME A;  1I12 A;  1Z4R A;  3BI0 A;  2EO8 A;  1J4J A;  2B5G B;  4MMO A;  1Z8L A;  3A9L A;  3BJ8 A;  2OB0 A;  1TXR A;  4NGR A;  1IB1 E;  3S9N A;  2B4B A;  5H86 A;  5F48 A;  4HPS A;  4KS9 A;  4OLL A;  2F8H A;  5F09 A;  4ZGY B;  5EBV A;  4KSA A;  2PJA A;  3GIU A;  5LRK A;  3FX6 A;  3BHX A;  4UFV A;  2JBK A;  2G3T A;  1UFH A;  3I9S A;  3N7Z A;  1WK4 A;  4MHZ A;  4PQA A;  4MCS A;  4ORF A;  4ZYQ A;  4MCR A;  4P4D A;  2B4D B;  4MFQ A;  2Q7B A;  1CM0 A;  4B5P A;  1IYL A;  4H6U A;  2GE3 A;  2VL1 A;  3GY9 A;  3IEH A;  2QIR A;  2AJ6 A;  3P2F A;  2QML A;  3LOD A;  2VI7 A;  4B5P B;  5K8P A;  3KQZ A;  1YX0 A;  3R95 A;  4NGT A;  3F5B A;  2DF5 A;  3DLJ A;  1MJB A;  4H6Z A;  4M6G A;  1OBR A;  1GYT A;  4OAE A;  5EMI A;  2ZEP A;  3D2M A;  4KVM E;  3OWC A;  1R3N A;  2BEI A;  3D7D A;  3CXQ A;  2PDO A;  2BCO A;  2ZEM A;  3TO9 A;  5AG7 A;  3SI2 A;  1RXT A;  2XEG A;  4C7H A;  4C2Y A;  2FVG A;  1L0C A;  2YND A;  5HH1 A; 
#chains in the Genus database with same CATH homology
 2NYQ A;  2EK9 A;  3KZW A;  5LRG A;  2ZEL A;  1VHE A;  4K3N A;  2WZN A;  2PIY A;  2PIZ A;  2GLJ A;  4EWT A;  3VH9 A;  2ZEG A;  2PJ2 A;  5K8O A;  3FED A;  5LRJ A;  4X3R A;  4OC3 A;  3IO1 A;  1UWY A;  1AYE A;  1Q7L A;  4X8I A;  2OOT A;  4YU9 A;  3KI9 A;  2PVW A;  2Q51 A;  3KAS A;  4MCP A;  1KWM A;  3FEE A;  4A38 A;  2C1C A;  5DS0 A;  3TX8 A;  2C6C A;  2PJ3 A;  4P4F A;  4UIB A;  4LQG A;  1TKF A;  1Z5R A;  3S9M A;  4ZY1 A;  4OC4 A;  1LCP A;  1ZG7 A;  1HEE A;  3PB6 X;  1VHO A;  2XEF A;  2CTB A;  4FBE A;  1RTQ A;  2POK A;  3PBB A;  4R7M A;  2JEW A;  3SJF A;  1IGB A;  4PXD A;  5JGF A;  2AFW A;  3B3W A;  4CPA A;  4WWV A;  4UEF A;  3N5F A;  3VAT A;  2ZEN A;  4WJB A;  2PJ7 A;  3CPA A;  3DGV A;  5LYL A;  3H8F A;  2F7V A;  3SI1 A;  3D4U A;  1JQG A;  4FWU A;  4PXB A;  1QMU A;  5ELY A;  4DJL A;  5LYI A;  4ZX8 A;  2QJ8 A;  5HVG A;  3V38 A;  2PJ6 A;  2C6G A;  3I1U A;  3ISZ A;  3NH4 A;  2ZOF A;  4P6Y A;  1LAN A;  2PJ8 A;  3IWW A;  1CX8 A;  1FNO A;  3B3C A;  1ELM P;  3K2K A;  2ZEE A;  1YW6 A;  3B3T A;  2ABZ A;  3D7G A;  4P10 A;  4TWE A;  3VAR A;  4A94 A;  2RFH A;  5CPA A;  5HXD A;  2V77 A;  4OC2 A;  5HVF A;  4UEE A;  4MHN A;  4FUU A;  3V7Z A;  1PCA A;  3PEI A;  1LFW A;  1QQ9 A;  1PYT B;  1YSJ A;  3B35 A;  1CPX A;  3NH5 A;  4EFD A;  3GLJ A;  4NGN A;  2V8V A;  4ZI6 A;  1AMP A;  1F2O A;  1TKJ A;  1ARL A;  3PRT A;  4OID A;  5JM6 A;  3TC8 A;  2AFO A;  1NSA A;  1ZG9 A;  3KGQ A;  4F9U A;  2EWB A;  1BAV A;  1TKH A;  2PJ5 A;  4MCQ A;  2ANP A;  4NGM A;  3ISX A;  5D8N A;  3SJX A;  4GM5 A;  5HVH A;  4G1P A;  2IMO A;  2PJ0 A;  3BI1 A;  4IK2 A;  3QNV A;  2ZED A;  4ONW A;  8CPA A;  2AFS A;  2EK8 A;  2QVP A;  4W9Y A;  3WC6 A;  4KSI A;  3WT4 A;  4MRI A;  4OIW A;  1XFO A;  1BPN A;  2ZEF A;  1ARM A;  3PB8 X;  2DEA A;  3BXM A;  4UEZ A;  2PRQ A;  3KHX A;  3SI0 A;  3FH4 A;  1Z2L A;  1CP6 A;  2PJC A;  1TF8 A;  3NFZ A;  3PBE A;  1Y7E A;  4YWY A;  3FMC A;  4RUH A;  4P44 A;  2J9A A;  3KR5 A;  3WAB A;  2O4H A;  4R8F A;  3NH8 A;  4R76 A;  3B7I A;  2WYR A;  2PJ4 A;  1BLL E;  4DUK A;  4OC5 A;  1HDU A;  3D66 A;  4F8Z A;  3KL9 A;  3PB9 X;  1ZG8 A;  1CP7 A;  1XJO A;  1F57 A;  2V8H A;  5D29 A;  1Y0R A;  4NGS A;  3L2N A;  4ZY0 A;  5K8M A;  1ELL P;  2ZEO A;  2PE3 A;  4OKO A;  2GLF A;  3WC5 A;  4P4J A;  2PJ9 A;  1M4L A;  3KR4 A;  4Q7A A;  3FEC A;  4F9V A;  1VIX A;  1LAM A;  4Z65 A;  1DE4 C;  4OC1 A;  1CPS A;  4JYW A;  1F2P A;  1XMB A;  4TNU A;  4IHM A;  4DYO A;  7CPA A;  4P4E A;  3SJG A;  4AXV A;  1HDQ A;  4MXU A;  2PVV A;  1EE3 P;  2CF4 A;  2RB7 A;  3PFE A;  4P45 A;  2C6P A;  1TF9 A;  3D7F A;  5K8N A;  6CPA A;  3CT9 A;  3D67 A;  1R43 A;  4PXC A;  4PPZ A;  2PJ1 A;  4OC0 A;  2V8D A;  2I3C A;  2Q43 A;  4OME A;  3IIB A;  2O53 A;  1BPM A;  3B3S A;  1DTD A;  2G9D A;  3GUX A;  3RBU A;  3B2Y A;  3B3V A;  1LOK A;  2ZOG A;  5CBM A;  2HB6 A;  2IQ6 A;  4BD9 A;  1IY7 A;  5THW A;  3CPX A;  3RZA A;  2OR4 A;  2IJZ A;  2BOA A;  1VGY A;  2QYV A;  3SJE A;  4NFR A;  4O23 A;  5LYD A;  2AFM A;  2CTC A;  4EME A;  1CBX A;  3IC1 A;  2PJB A;  3LMS A;  3S9L A;  1YLO A;  4OP4 A;  4NJQ A;  3HUV A;  1LAP A;  3MRU A;  4NJR A;  4X2T A;  3IJ3 A;  1Y0Y A;  3FVL A;  2GU2 A;  1ZLH A;  3D7H A;  2JBJ A;  4MHP A;  1H8L A;  5IB9 A;  2AFX A;  2NSM A;  4PXE A;  3PB7 X;  4FAI A;  4ZY2 A;  2XEJ A;  2Q4Z A;  3JRU A;  3WC7 A;  3K9T A;  3PB4 X;  4JZ0 A;  1CG2 A;  4UIA A;  4A37 A;  3HLP A;  2AFU A;  4NGP A;  3MN8 A;  3KQX A;  4A39 A;  1XRY A;  5I4M A;  4IAV A;  2GRE A;  3FF3 A;  3H8E A;  2XEI A;  4H2K A;  5J1Q A;  2BO9 A;  3GB0 A;  2PCU A;  3CDX A;  4MHY A;  3T8W A;  2V8G A;  1XBU A;  4ZX9 A;  1ZLI A;  4P4B A;  4P4I A;  2AFZ A;  3PFO A;  1YW4 A;  2ZEH A;  2HC9 A;  3LWU A;  4R6T A;  5LYF A;  4NGQ A;  1FT7 A;  3RAM A;  5JH9 A;  3NA6 A;  3FJU A;  4UF4 A;  2CIJ A;  3IFE A;  3H8G A;  3D68 A;  3KHZ A;  4B6Z A;  1YME A;  3BI0 A;  4MMO A;  1Z8L A;  1TXR A;  4NGR A;  3S9N A;  2F8H A;  5F09 A;  2PJA A;  5LRK A;  3FX6 A;  3BHX A;  2JBK A;  4PQA A;  4MHZ A;  4MCS A;  4ZYQ A;  4MCR A;  4P4D A;  2VL1 A;  3IEH A;  5K8P A;  3KQZ A;  4NGT A;  3DLJ A;  1OBR A;  1GYT A;  2ZEP A;  1R3N A;  3D7D A;  2BCO A;  2ZEM A;  3SI2 A;  2XEG A;  2FVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...