3FH4A

Crystal structure of recombinant vibrio proteolyticus aminopeptidase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Heterologous expression and purification of Vibrio proteolyticus (Aeromonas proteolytica) aminopeptidase: a rapid protocol
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fh4A00
1Y7EA 1AMPA 3ISXA 5HXDA 3K9TA 3BI1A 3PB7X 2PJ0A 4NGSA 1YLOA 4ZY2A 4FWUA 4DUKA 3FVLA 1XRYA 3PB9X 3HLPA 3GUXA 4OC3A 1JQGA 2FVGA 3LMSA 1HDUA 2PIZA 1TKHA 2IJZA 2PJ9A 3IFEA 3N5FA 3CPXA 3WC7A 4W9YA 4ZY1A 2PJAA 5LRKA 2O4HA 4P45A 3L2NA 4P4DA 1ZLIA 2WZNA 5D29A 2PJ4A 3PBEA 3DLJA 4OC0A 2C6CA 2ABZA 2ZELA 1LCPA 3TX8A 4B6ZA 4F9UA 3NH4A 3SJXA 2OR4A 3MN8A 4NJQA 3KHZA 4P4FA 1XBUA 3IO1A 4PXBA 3B7IA 2ZOFA 5THWA 3HUVA 4X3RA 1R3NA 1TKFA 1Z5RA 4EFDA 5I4MA 1QMUA 3VARA 2PJ2A 1Z8LA 1CBXA 3I1UA 2C1CA 2ZEEA 1ZG9A 3SJGA 1YW4A 4O23A 1ARLA 3QNVA 3FJUA 2AFXA 2ZEPA 2AFZA 4A37A 4MCRA 1LANA 4Z65A 4X8IA 4OC1A 1CG2A 3CDXA 2XEGA 2I3CA 2PJ7A 3VH9A 4P4JA 3H8FA 5LYIA 2CTCA 1ZG8A 3VATA 2ZEMA 3K2KA 2JEWA 2AFWA 3FEEA 3PB8X 4P4IA 5HVHA 4UEZA 3WT4A 4JZ0A 3NH8A 5LYLA 2WYRA 2AFSA 4FAIA 4NJRA 3IEHA 1ELMP 4OC4A 3PFOA 3B3VA 1TKJA 3D7HA 3V38A 4NGNA 2PJ1A 2NYQA 2C6GA 1VIXA 2RFHA 1DTDA 3NH5A 3KQZA 3PEIA 1HDQA 2V77A 4MCPA 1XJOA 1LOKA 5K8OA 4CPAA 3PFEA 1LFWA 4R76A 1YSJA 3D7GA 4NGMA 1BAVA 3SJEA 4DJLA 2GLFA 4OC5A 4IK2A 4H2KA 3PB4X 3D67A 1BPMA 2G9DA 1F57A 1DE4C 4AXVA 4NGPA 1CP7A 3B3SA 2J9AA 3IJ3A 4NGTA 3WC5A 1CX8A 4UIAA 4A94A 2AFOA 5HVFA 1PCAA 3KZWA 4X2TA 5JH9A 4OMEA 3S9MA 3T8WA 2XEJA 3PRTA 3LWUA 4OIDA 2V8VA 4PPZA 1ARMA 2EK9A 3CT9A 3GLJA 2GLJA 2EWBA 2XEIA 2Q4ZA 4MHYA 2AFUA 4P4BA 1ZLHA 2O53A 2PE3A 3D68A 2CF4A 1TF9A 3B3CA 1YMEA 2IMOA 1CPSA 4WJBA 4OP4A 4ZX9A 4TWEA 3H8EA 4OC2A 2BOAA 3CPAA 3KI9A 4MCSA 2HB6A 4YU9A 3NA6A 4BD9A 4MXUA 2PJ8A 1RTQA 2CIJA 1QQ9A 4PXEA 5LYFA 4UIBA 3PBBA 2PJ6A 4KSIA 1CPXA 2Q43A 3WABA 3KR5A 4ONWA 4WWVA 4ZYQA 1OBRA 3SI1A 2F8HA 2AFMA 3S9LA 2XEFA 1FNOA 4EWTA 3FEDA 1TF8A 2VL1A 3H8GA 1Y0YA 2JBKA 3NFZA 4MMOA 1PYTB 4R6TA 1HEEA 2RB7A 3JRUA 2BCOA 3BXMA 2BO9A 1Z2LA 4R8FA 3KL9A 4MHZA 2GU2A 4GM5A 1EE3P 1BLLE 1NSAA 3IIBA 3B3WA 1ZG7A 2PJCA 3B35A 4LQGA 1TXRA 1AYEA 1LAMA 2PIYA 4MHNA 3B3TA 5J1QA 4UF4A 5HVGA 2NSMA 2V8HA 3D4UA 3RZAA 8CPAA 2PJ5A 4PXDA 2OOTA 1KWMA 1M4LA 3B2YA 2QJ8A 3SI0A 3DGVA 4P4EA 4UEFA 1UWYA 2ZEGA 2EK8A 3BHXA 3KHXA 5IB9A 4OKOA 2ZEHA 1VGYA 2PVVA 6CPAA 4JYWA 2ZEDA 4ZX8A 4OIWA 2ZEOA 1VHEA 3SI2A 5LRGA 3S9NA 2PRQA 3PB6X 3RBUA 4NGQA 5LYDA 2PCUA 5DS0A 2C6PA 3FF3A 2DEAA 5K8NA 2ZENA 3KR4A 2CTBA 3TC8A 2PVWA 3ISZA 1Y0RA 4P44A 1GYTA 4PXCA 2PJBA 2V8GA 3BI0A 1BPNA 2F7VA 4MCQA 4P6YA 4YWYA 2POKA 4A39A 1XFOA 4Q7AA 5JM6A 3WC6A 2PJ3A 1F2PA 4TNUA 1LAPA 4DYOA 1H8LA 2ZEFA 3D7FA 1YW6A 3RAMA 5CBMA 4R7MA 5F09A 5JGFA 3FH4A 4IHMA 4MRIA 4A38A 1XMBA 2QYVA 3IC1A 4F8ZA 1FT7A 3KQXA 3KASA 4ZY0A 5D8NA 1ELLP 2ANPA 3D66A 2Q51A 4NGRA 2IQ6A 4RUHA 4F9VA 1Q7LA 4UEEA 4K3NA 7CPAA 1IGBA 2V8DA 4FBEA 5K8MA 1VHOA 1F2OA 2JBJA 4MHPA 2QVPA 4G1PA 1R43A 3D7DA 3FX6A 3KGQA 4P10A 3IWWA 3V7ZA 1CP6A 2GREA 1IY7A 4ZI6A 4IAVA 3MRUA 4EMEA 2HC9A 5LRJA 2ZOGA 5ELYA 4PQAA 3GB0A 4FUUA 5CPAA 3FECA 4NFRA 3FMCA 5K8PA 3SJFA
chains in the Genus database with same CATH superfamily
1Y7EA 2FIWA 1AMPA 2Z0ZA 4M6GA 5GCNA 2GFQA 3ISXA 1Z4EA 5HXDA 4B12A 3K9TA 1XMTA 5C88A 3T9YA 3BI1A 2J8RA 3PB7X 2PJ0A 4Q38A 4NGSA 1FY7A 2FL4A 4NCZA 1YLOA 4ZY2A 4FWUA 2JEVA 4M3SA 3TT2A 4DUKA 3FVLA 4I49A 3F5BA 1B6BA 1XRYA 3PB9X 3HLPA 3GUXA 4OC3A 1JQGA 4JXQA 4CYNA 4H6ZA 2VQYA 4QUSA 3SHPA 2FVGA 4Y49B 3LMSA 5K8PA 1A2ZA 1BO4A 1HDUA 4UCMA 4CAEA 4CYPA 2PIZA 1TKHA 2IJZA 2OU2A 2PJ9A 2EBJA 3IFEA 3CXSA 4YRHA 3N5FA 3CPXA 1VHSA 3WC7A 4W9YA 3WR7A 4RN7A 4ZY1A 2PJAA 4NFRA 5LRKA 2O4HA 4P45A 3L2NA 4KZTA 4P4DA 3FXTA 1CJWA 4IUSA 1ZLIA 4LUAA 2WZNA 4F0YA 5D29A 2PJ4A 2A4NA 3PBEA 3DLJA 2Q7BA 4OC0A 2C6CA 2ABZA 2ZELA 1LCPA 1QSNA 5CNPA 3TX8A 2VZYA 4B6ZA 3NH4A 4F9UA 3IWEA 1K4JA 2QIRA 3SJXA 3TO6A 4RS2A 2OR4A 3MN8A 3P2HA 3I3GA 1YK3A 4KVXA 3C26A 2YGWA 4NJQA 4MJ8A 1MJBA 3KHZA 1XBUA 3IO1A 3OWCA 4OLLA 2EUIA 3DR8A 4P4FA 3FYNA 4CAXA 3SXOA 2Q4VA 4PXBA 3B7IA 2ZOFA 5THWA 3HUVA 4X3RA 3FNCA 1R3NA 2Q44A 4C7IA 1TKFA 1Z5RA 4EFDA 2AJ6A 5I4MA 3D3SA 2BEIA 1QMUA 3S6FA 3VARA 2PJ2A 1Z8LA 2O28A 1YVKA 1CBXA 3I1UA 1Z8XA 2PSWA 2C1CA 2B3VA 2ZW4A 2ZEEA 1YVOA 1ZG9A 5J8CA 2Z11A 5J8FA 2BSWA 3SJGA 1YW4A 1B87A 1Q2CA 4O23A 5F48A 1ARLA 3QNVA 5DWNA 4KOUA 3FJUA 4XPLA 4FD6A 1MJAA 2AFXA 2ZEPA 2AFZA 4A37A 1KZFA 2EVNA 2ODFA 2Y0MA 4CGNA 3JVNA 1I1DA 4MCRA 2PR1A 2JDCA 2OB0A 2QMLA 2CNSA 3LD2A 1LANA 3TTHA 4Z65A 4KUBA 1YGHA 1Z8WA 3NE7A 4X8IA 4KLVA 4OC1A 2R7HA 2Z3PA 1CG2A 3CDXA 2XEGA 4IF5A 2I3CA 1IYKA 2JDDA 2PJ7A 3VH9A 4P4JA 1S7FA 2GE3A 3H8FA 4UFWA 1ZO0A 5LYIA 2CTCA 2Q4YA 4QC6A 4CGPA 1ZG8A 5AG6A 2BL1A 4UA3A 3VATA 1NMTA 3FB3A 2ZEMA 4MY0A 4RI1A 4XNHC 3K2KA 2JEWA 3FBUA 4CGOA 2AFWA 3FEEA 1P4NA 3TOAA 2HQYA 3F0AA 2B4DA 2FIAA 2FXFA 4MFQA 3PB8X 4P4IA 3R9GA 1QSRA 4PK3A 2DXQA 5HVHA 2WPWA 3DSBA 1M44A 4UEZA 3WT4A 4E8OA 4JZ0A 4A33A 1MK4A 3NH8A 4JWPA 3CXQA 5LYLA 2WYRA 2RC4A 2AFSA 4FAIA 4NJRA 3DDDA 5AG5A 3IEHA 1ELMP 1Y7RA 4HKFA 4OC4A 2D4PA 4OAEA 3PFOA 3B3VA 4B5OA 1TKJA 2PQ8A 3D2MA 3D7HA 4K30A 3V38A 4C68A 3H5ZA 4NGNA 4BBHA 1XIXA 2PJ1A 3QB8A 2REEA 2NYQA 2YNCA 4A32A 2C6GA 1RO5A 1VIXA 2RFHA 4KSAA 1DTDA 4GS4A 3NH5A 3KQZA 3PEIA 1HDQA 2V77A 4MCPA 1XJOA 1LOKA 4YGOA 3FRMA 5K8OA 2YNCC 2B5GB 2Z3NA 4CPAA 3PFEA 2GANA 1LFWA 4R76A 1YSJA 4B14A 3D7GA 4NGMA 3N7ZA 1BAVA 3CXPA 3SJEA 4DJLA 2VBQA 4XPDB 5BWAB 2GLFA 4OC5A 3D8PA 4IK2A 2Q04A 2ZPAA 4PK2A 1M4IA 3GKRA 4UFXA 4JJXA 4H2KA 4HPSA 3PB4X 1VKCA 1BPMA 2REFA 2G9DA 3D67A 2K5TA 1F57A 1XF8A 1XOVA 1DE4C 3MGDA 4AXVA 1L0CA 4NGPA 1CP7A 2FCKA 2J9AA 3B3SA 3IJ3A 4NGTA 2ARHA 3WC5A 4HNWB 1CX8A 3A9LA 4UIAA 2Z3OA 1NSLA 2Z10A 4A94A 2AFOA 3NE8A 4GXHA 1PCAA 5HVFA 3KZWA 3SXNA 2FS5A 2ZW5A 4R87A 3P2FA 3EFAA 4X2TA 4A95A 4AVCA 4EVYA 5JH9A 3IU2A 4LX9A 4OMEA 4B11A 3S9MA 3T8WA 2XEJA 3PRTA 2DF5A 3LWUA 5IB0A 4OIDA 2V8VA 4PPZA 1ARMA 2VXKA 2EK9A 1KUXA 3G8WA 3CT9A 4CS0B 3GLJA 4M85A 2GLJA 4QVTA 2EWBA 2XEIA 4R3KA 2GIVA 1Y9KA 1IOIA 2Q4ZA 2ZW7A 4MHYA 2BUEA 4ZBGA 5KTCA 2AFUA 1PUAA 4P4BA 4KOTA 1YR0A 1MJ9A 5AG4A 2G3TA 3QAYA 1X10A 4H6UA 1ZLHA 2I79A 2O53A 4CAWA 4UBRA 2PE3A 3S6KA 1I21A 2B3UA 2CXAA 4KSFA 5G21A 3D68A 1GHEA 5G20A 2CF4A 1TF9A 4LQ6A 2P6EA 3B3CA 3B8GA 2OH1A 1YMEA 2IMOA 3PZJA 1Z8TA 5G1ZA 5ISVA 1CPSA 4WJBA 4OP4A 4ZX9A 4PV6A 4TWEA 4JXRA 2C27A 4KVOE 5FVJA 1YREA 3H8EA 3JTKA 4OC2A 2BOAA 2I00A 2J8MA 4B5PB 3CPAA 3KI9A 4KORA 4MCSA 4KUAA 2HB6A 4QBJA 2Q0YA 4KOVA 4YU9A 1S7KA 3NA6A 4MXUA 2PJ8A 3R95A 4BD9A 4R57A 3VWEA 4F6AA 4C2ZA 4Y49C 1KUYA 5IV0A 5JQ4A 1RTQA 1IB1E 2CIJA 1QQ9A 4AVAA 3W6XA 4ZGYB 4PXEA 1XE4A 4UIBA 4E0AA 5LYFA 5G22A 3PBBA 2PJ6A 2WUUA 4KSIA 1CPXA 2Q43A 4R9MA 3WABA 3KR5A 3R1KA 4ONWA 4WWVA 4ZYQA 3TFYA 1OBRA 2G3AA 4A31A 3SI1A 4A30A 5F49A 1S3ZA 2F8HA 2OZUA 2QECA 3V8IA 2AFMA 3S9LA 2XEFA 2Z3MA 1FNOA 2X7BA 4EWTA 3FEDA 3R9EA 4CGLA 1Q2YA 4CRZB 2ZW6A 5KTDA 4XPKA 1TF8A 2VL1A 4MBUA 3H8GA 2WPXA 1Y0YA 1XEBA 2JBKA 3NFZA 1M4GA 3ZZIA 3IU1A 4MMOA 1PYTB 4C7HA 2VI7A 4R6TA 3S6GA 3H4QA 1AUGA 3I9SA 1HEEA 4MFZA 2YNDA 2RB7A 4MY3A 3JRUA 2BCOA 3BXMA 4JD6A 2BO9A 2P6FA 1Z2LA 4R8FA 3KL9A 4MHZA 3TE4A 2GU2A 2OZHA 3CZXA 3W6SA 5A28A 4Q36A 4GM5A 5E96A 2CNTA 4F0XA 1N71A 1EE3P 3W91A 4QB9A 1BLLE 3DNSA 1NSAA 3IIBA 3B3WA 4J3GA 1ZG7A 1YQEA 2PJCA 1SQHA 1IIDA 3B35A 2FSRA 4LQGA 4CYQA 1TXRA 3K9UA 1AYEA 4CAFA 1Y9WA 2R1IA 3LODA 1LAMA 2PC1A 2PIYA 2PDOA 3B3TA 4MHNA 3EY5A 2Z3LA 4NXYA 3R9FA 5J1QA 1ON0A 4UF4A 2P6GA 1P0HA 5HVGA 2NSMA 2V8HA 1YLEA 3RNZA 4CYOA 3D4UA 3TO9A 1LRZA 5KTAA 3RZAA 5DWMA 8CPAA 4C2XA 3TCVA 2PJ5A 3RYOA 4L89A 1QSMA 4PXDA 4BMHA 2OOTA 5A27A 1KWMA 5H84A 4M6IA 1M4LA 1IU8A 3B2YA 1X12A 4C2YA 1YX0A 2HUZA 4ONUA 2QJ8A 4JLYA 2WSAA 4UWIA 3R96A 2CY2A 3SI0A 1IICA 3DGVA 3IGRA 1UWYA 2ZEGA 4KOXA 4P4EA 4UEFA 2EK8A 4BINA 4PSXA 3BJ7A 3BHXA 3KHXA 3VWDA 5IB9A 4NEXA 4OKOA 2ZEHA 1VGYA 3G3SA 4AVBA 2PVVA 6CPAA 4JYWA 1NE9A 3D2PA 2ZEDA 3EC4A 3EO4A 4ZX8A 1PU9A 4OIWA 3UY5A 2P0WA 4FD7A 2ZEOA 2AE6A 4HNYB 3T90A 1VHEA 3SI2A 5LRGA 1Z9UA 2PRQA 1TIQA 2FT0A 4YFJA 3S9NA 2ZXVA 3PB6X 3DR6A 4XNHB 3RBUA 4NGQA 5LYDA 2PCUA 2NMTA 5IX3A 2DPSA 4CGMA 4KOSA 5DS0A 3JUWA 3BJ8A 4B13A 2C6PA 1S5KA 2EO8A 2H5MA 3FF3A 4MFLA 4MFPA 1QSTA 1IYLA 2DEAA 4A2ZA 2ZENA 5K8NA 3KR4A 4FD4A 2CTBA 3TC8A 3LACA 2PR8A 2B4DB 1JWQA 1KUVA 2PVWA 3GIUA 5JPHA 1S60A 2D4OA 3ISZA 2FE7A 3RO0A 3ZJ0A 4AG9A 1Y0RA 2B5GA 2VEZA 3E0KA 3KKWA 4P44A 1GYTA 4PXCA 2PJBA 2V8GA 3BI0A 4MFKA 4KLWA 1BPNA 4ORFA 4L8AA 2F7VA 3FIXA 4MCQA 4U9ZA 4P6YA 4YWYA 4B10A 2POKA 4A39A 4KOWA 1XFOA 2OZGA 4Q7AA 5HMNA 5JM6A 4NF1A 5HH1A 1CM0A 4FD5A 3WC6A 2PJ3A 1F2PA 4TNUA 1LAPA 4X5KA 4DYOA 2B4BA 2ATRA 1H8LA 1UFHA 2Q7SA 2ZEFA 4XPDC 3BLNA 5H86A 4AB7A 3D7FA 1YW6A 3GY9A 3RAMA 5CBMA 3IWGA 1M1DA 1WWZA 5I0CA 4MFJA 4R7MA 5F09A 5JGFA 3FH4A 4IHMA 4MRIA 4U9YA 3F8KA 4A38A 4KOYA 1QSOA 1XMBA 2QYVA 3IC1A 4F8ZA 1J4JA 1FT7A 1WK4A 2G0BA 1M4DA 1V0CA 3KQXA 4UWJA 4CRYB 3KASA 1BOBA 4UCPA 1S7LA 4UCNA 5D8NA 4ZY0A 1I12A 2F5IA 4KS9A 2R8VA 2Z3KA 1ELLP 1U6MA 2ANPA 5F46A 3D66A 4H89A 1IOFA 4E2AA 5EMIA 2Q51A 4AG7A 2HV2A 1Z4RA 4NGRA 2IQ6A 3PGPA 4RUHA 1S7NA 4NSQA 4F9VA 1Q7LA 4UEEA 2KCWA 4K3NA 7CPAA 4HNXB 1IGBA 2V8DA 4FBEA 5K8MA 1OZPA 1VHOA 4R3LA 1F2OA 2JBJA 2PRBA 2JLMA 2VZZA 1R57A 4MHPA 3EXNA 4OADA 3S6HA 2QVPA 5C82A 3PP9A 4G1PA 2B58A 1R43A 3D7DA 5EBVA 3FX6A 2R98A 3KGQA 1RXTA 5AG7A 4P10A 3IWWA 3TO7A 3V7ZA 4PSWA 4CAVA 4KVME 4UFVA 1CP6A 2GREA 2J8NA 1IY7A 4U5YA 4ZI6A 4IAVA 5F47A 3GYAA 3MRUA 4EMEA 2HC9A 4M6HA 2YNEA 2IL4A 5LRJA 3TOBA 2ZOGA 4MI4A 5ELYA 4PQAA 3GB0A 4B5PA 2CNMA 4FUUA 4DNCA 4II9A 5CPAA 1Q2DA 3FECA 5AGEA 2DPTA 3FMCA 4MHDA 3SJFA 3QAHA 5EC4A
chains in the Genus database with same CATH topology
1Y7EA 1AMPA 3ISXA 5HXDA 3K9TA 3BI1A 3PB7X 2PJ0A 4NGSA 1YLOA 4ZY2A 4FWUA 4DUKA 3FVLA 1XRYA 3PB9X 3HLPA 3GUXA 4OC3A 1JQGA 2FVGA 3LMSA 1HDUA 2PIZA 1TKHA 2IJZA 2PJ9A 3IFEA 3N5FA 3CPXA 3WC7A 4W9YA 4ZY1A 2PJAA 5LRKA 2O4HA 4P45A 3L2NA 4P4DA 1ZLIA 2WZNA 5D29A 2PJ4A 3PBEA 3DLJA 4OC0A 2C6CA 2ABZA 2ZELA 1LCPA 3TX8A 4B6ZA 4F9UA 3NH4A 3SJXA 2OR4A 3MN8A 4NJQA 3KHZA 4P4FA 1XBUA 3IO1A 4PXBA 3B7IA 2ZOFA 5THWA 3HUVA 4X3RA 1R3NA 1TKFA 1Z5RA 4EFDA 5I4MA 1QMUA 3VARA 2PJ2A 1Z8LA 1CBXA 3I1UA 2C1CA 2ZEEA 1ZG9A 3SJGA 1YW4A 4O23A 1ARLA 3QNVA 3FJUA 2AFXA 2ZEPA 2AFZA 4A37A 4MCRA 1LANA 4Z65A 4X8IA 4OC1A 1CG2A 3CDXA 2XEGA 2I3CA 2PJ7A 3VH9A 4P4JA 3H8FA 5LYIA 2CTCA 1ZG8A 3VATA 2ZEMA 3K2KA 2JEWA 2AFWA 3FEEA 3PB8X 4P4IA 5HVHA 4UEZA 3WT4A 4JZ0A 3NH8A 5LYLA 2WYRA 2AFSA 4FAIA 4NJRA 3IEHA 1ELMP 4OC4A 3PFOA 3B3VA 1TKJA 3D7HA 3V38A 4NGNA 2PJ1A 2NYQA 2C6GA 1VIXA 2RFHA 1DTDA 3NH5A 3KQZA 3PEIA 1HDQA 2V77A 4MCPA 1XJOA 1LOKA 5K8OA 4CPAA 3PFEA 1LFWA 4R76A 1YSJA 3D7GA 4NGMA 1BAVA 3SJEA 4DJLA 2GLFA 4OC5A 4IK2A 4H2KA 3PB4X 3D67A 1BPMA 2G9DA 1F57A 1DE4C 4AXVA 4NGPA 1CP7A 3B3SA 2J9AA 3IJ3A 4NGTA 3WC5A 1CX8A 4UIAA 4A94A 2AFOA 5HVFA 1PCAA 3KZWA 4X2TA 5JH9A 4OMEA 3S9MA 3T8WA 2XEJA 3PRTA 3LWUA 4OIDA 2V8VA 4PPZA 1ARMA 2EK9A 3CT9A 3GLJA 2GLJA 2EWBA 2XEIA 2Q4ZA 4MHYA 2AFUA 4P4BA 1ZLHA 2O53A 2PE3A 3D68A 2CF4A 1TF9A 3B3CA 1YMEA 2IMOA 1CPSA 4WJBA 4OP4A 4ZX9A 4TWEA 3H8EA 4OC2A 2BOAA 3CPAA 3KI9A 4MCSA 2HB6A 4YU9A 3NA6A 4BD9A 4MXUA 2PJ8A 1RTQA 2CIJA 1QQ9A 4PXEA 5LYFA 4UIBA 3PBBA 2PJ6A 4KSIA 1CPXA 2Q43A 3WABA 3KR5A 4ONWA 4WWVA 4ZYQA 1OBRA 3SI1A 2F8HA 2AFMA 3S9LA 2XEFA 1FNOA 4EWTA 3FEDA 1TF8A 2VL1A 3H8GA 1Y0YA 2JBKA 3NFZA 4MMOA 1PYTB 4R6TA 1HEEA 2RB7A 3JRUA 2BCOA 3BXMA 2BO9A 1Z2LA 4R8FA 3KL9A 4MHZA 2GU2A 4GM5A 1EE3P 1BLLE 1NSAA 3IIBA 3B3WA 1ZG7A 2PJCA 3B35A 4LQGA 1TXRA 1AYEA 1LAMA 2PIYA 4MHNA 3B3TA 5J1QA 4UF4A 5HVGA 2NSMA 2V8HA 3D4UA 3RZAA 8CPAA 2PJ5A 4PXDA 2OOTA 1KWMA 1M4LA 3B2YA 2QJ8A 3SI0A 3DGVA 4P4EA 4UEFA 1UWYA 2ZEGA 2EK8A 3BHXA 3KHXA 5IB9A 4OKOA 2ZEHA 1VGYA 2PVVA 6CPAA 4JYWA 2ZEDA 4ZX8A 4OIWA 2ZEOA 1VHEA 3SI2A 5LRGA 3S9NA 2PRQA 3PB6X 3RBUA 4NGQA 5LYDA 2PCUA 5DS0A 2C6PA 3FF3A 2DEAA 5K8NA 2ZENA 3KR4A 2CTBA 3TC8A 2PVWA 3ISZA 1Y0RA 4P44A 1GYTA 4PXCA 2PJBA 2V8GA 3BI0A 1BPNA 2F7VA 4MCQA 4P6YA 4YWYA 2POKA 4A39A 1XFOA 4Q7AA 5JM6A 3WC6A 2PJ3A 1F2PA 4TNUA 1LAPA 4DYOA 1H8LA 2ZEFA 3D7FA 1YW6A 3RAMA 5CBMA 4R7MA 5F09A 5JGFA 3FH4A 4IHMA 4MRIA 4A38A 1XMBA 2QYVA 3IC1A 4F8ZA 1FT7A 3KQXA 3KASA 4ZY0A 5D8NA 1ELLP 2ANPA 3D66A 2Q51A 4NGRA 2IQ6A 4RUHA 4F9VA 1Q7LA 4UEEA 4K3NA 7CPAA 1IGBA 2V8DA 4FBEA 5K8MA 1VHOA 1F2OA 2JBJA 4MHPA 2QVPA 4G1PA 1R43A 3D7DA 3FX6A 3KGQA 4P10A 3IWWA 3V7ZA 1CP6A 2GREA 1IY7A 4ZI6A 4IAVA 3MRUA 4EMEA 2HC9A 5LRJA 2ZOGA 5ELYA 4PQAA 3GB0A 4FUUA 5CPAA 3FECA 4NFRA 3FMCA 5K8PA 3SJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7E A;  1AMP A;  3ISX A;  5HXD A;  3K9T A;  3BI1 A;  3PB7 X;  2PJ0 A;  4NGS A;  1YLO A;  4ZY2 A;  4FWU A;  4DUK A;  3FVL A;  1XRY A;  3PB9 X;  3HLP A;  3GUX A;  4OC3 A;  1JQG A;  2FVG A;  3LMS A;  1HDU A;  2PIZ A;  1TKH A;  2IJZ A;  2PJ9 A;  3IFE A;  3N5F A;  3CPX A;  3WC7 A;  4W9Y A;  4ZY1 A;  2PJA A;  5LRK A;  2O4H A;  4P45 A;  3L2N A;  4P4D A;  1ZLI A;  2WZN A;  5D29 A;  2PJ4 A;  3PBE A;  3DLJ A;  4OC0 A;  2C6C A;  2ABZ A;  2ZEL A;  1LCP A;  3TX8 A;  4B6Z A;  4F9U A;  3NH4 A;  3SJX A;  2OR4 A;  3MN8 A;  4NJQ A;  3KHZ A;  4P4F A;  1XBU A;  3IO1 A;  4PXB A;  3B7I A;  2ZOF A;  5THW A;  3HUV A;  4X3R A;  1R3N A;  1TKF A;  1Z5R A;  4EFD A;  5I4M A;  1QMU A;  3VAR A;  2PJ2 A;  1Z8L A;  1CBX A;  3I1U A;  2C1C A;  2ZEE A;  1ZG9 A;  3SJG A;  1YW4 A;  4O23 A;  1ARL A;  3QNV A;  3FJU A;  2AFX A;  2ZEP A;  2AFZ A;  4A37 A;  4MCR A;  1LAN A;  4Z65 A;  4X8I A;  4OC1 A;  1CG2 A;  3CDX A;  2XEG A;  2I3C A;  2PJ7 A;  3VH9 A;  4P4J A;  3H8F A;  5LYI A;  2CTC A;  1ZG8 A;  3VAT A;  2ZEM A;  3K2K A;  2JEW A;  2AFW A;  3FEE A;  3PB8 X;  4P4I A;  5HVH A;  4UEZ A;  3WT4 A;  4JZ0 A;  3NH8 A;  5LYL A;  2WYR A;  2AFS A;  4FAI A;  4NJR A;  3IEH A;  1ELM P;  4OC4 A;  3PFO A;  3B3V A;  1TKJ A;  3D7H A;  3V38 A;  4NGN A;  2PJ1 A;  2NYQ A;  2C6G A;  1VIX A;  2RFH A;  1DTD A;  3NH5 A;  3KQZ A;  3PEI A;  1HDQ A;  2V77 A;  4MCP A;  1XJO A;  1LOK A;  5K8O A;  4CPA A;  3PFE A;  1LFW A;  4R76 A;  1YSJ A;  3D7G A;  4NGM A;  1BAV A;  3SJE A;  4DJL A;  2GLF A;  4OC5 A;  4IK2 A;  4H2K A;  3PB4 X;  3D67 A;  1BPM A;  2G9D A;  1F57 A;  1DE4 C;  4AXV A;  4NGP A;  1CP7 A;  3B3S A;  2J9A A;  3IJ3 A;  4NGT A;  3WC5 A;  1CX8 A;  4UIA A;  4A94 A;  2AFO A;  5HVF A;  1PCA A;  3KZW A;  4X2T A;  5JH9 A;  4OME A;  3S9M A;  3T8W A;  2XEJ A;  3PRT A;  3LWU A;  4OID A;  2V8V A;  4PPZ A;  1ARM A;  2EK9 A;  3CT9 A;  3GLJ A;  2GLJ A;  2EWB A;  2XEI A;  2Q4Z A;  4MHY A;  2AFU A;  4P4B A;  1ZLH A;  2O53 A;  2PE3 A;  3D68 A;  2CF4 A;  1TF9 A;  3B3C A;  1YME A;  2IMO A;  1CPS A;  4WJB A;  4OP4 A;  4ZX9 A;  4TWE A;  3H8E A;  4OC2 A;  2BOA A;  3CPA A;  3KI9 A;  4MCS A;  2HB6 A;  4YU9 A;  3NA6 A;  4BD9 A;  4MXU A;  2PJ8 A;  1RTQ A;  2CIJ A;  1QQ9 A;  4PXE A;  5LYF A;  4UIB A;  3PBB A;  2PJ6 A;  4KSI A;  1CPX A;  2Q43 A;  3WAB A;  3KR5 A;  4ONW A;  4WWV A;  4ZYQ A;  1OBR A;  3SI1 A;  2F8H A;  2AFM A;  3S9L A;  2XEF A;  1FNO A;  4EWT A;  3FED A;  1TF8 A;  2VL1 A;  3H8G A;  1Y0Y A;  2JBK A;  3NFZ A;  4MMO A;  1PYT B;  4R6T A;  1HEE A;  2RB7 A;  3JRU A;  2BCO A;  3BXM A;  2BO9 A;  1Z2L A;  4R8F A;  3KL9 A;  4MHZ A;  2GU2 A;  4GM5 A;  1EE3 P;  1BLL E;  1NSA A;  3IIB A;  3B3W A;  1ZG7 A;  2PJC A;  3B35 A;  4LQG A;  1TXR A;  1AYE A;  1LAM A;  2PIY A;  4MHN A;  3B3T A;  5J1Q A;  4UF4 A;  5HVG A;  2NSM A;  2V8H A;  3D4U A;  3RZA A;  8CPA A;  2PJ5 A;  4PXD A;  2OOT A;  1KWM A;  1M4L A;  3B2Y A;  2QJ8 A;  3SI0 A;  3DGV A;  4P4E A;  4UEF A;  1UWY A;  2ZEG A;  2EK8 A;  3BHX A;  3KHX A;  5IB9 A;  4OKO A;  2ZEH A;  1VGY A;  2PVV A;  6CPA A;  4JYW A;  2ZED A;  4ZX8 A;  4OIW A;  2ZEO A;  1VHE A;  3SI2 A;  5LRG A;  3S9N A;  2PRQ A;  3PB6 X;  3RBU A;  4NGQ A;  5LYD A;  2PCU A;  5DS0 A;  2C6P A;  3FF3 A;  2DEA A;  5K8N A;  2ZEN A;  3KR4 A;  2CTB A;  3TC8 A;  2PVW A;  3ISZ A;  1Y0R A;  4P44 A;  1GYT A;  4PXC A;  2PJB A;  2V8G A;  3BI0 A;  1BPN A;  2F7V A;  4MCQ A;  4P6Y A;  4YWY A;  2POK A;  4A39 A;  1XFO A;  4Q7A A;  5JM6 A;  3WC6 A;  2PJ3 A;  1F2P A;  4TNU A;  1LAP A;  4DYO A;  1H8L A;  2ZEF A;  3D7F A;  1YW6 A;  3RAM A;  5CBM A;  4R7M A;  5F09 A;  5JGF A;  3FH4 A;  4IHM A;  4MRI A;  4A38 A;  1XMB A;  2QYV A;  3IC1 A;  4F8Z A;  1FT7 A;  3KQX A;  3KAS A;  4ZY0 A;  5D8N A;  1ELL P;  2ANP A;  3D66 A;  2Q51 A;  4NGR A;  2IQ6 A;  4RUH A;  4F9V A;  1Q7L A;  4UEE A;  4K3N A;  7CPA A;  1IGB A;  2V8D A;  4FBE A;  5K8M A;  1VHO A;  1F2O A;  2JBJ A;  4MHP A;  2QVP A;  4G1P A;  1R43 A;  3D7D A;  3FX6 A;  3KGQ A;  4P10 A;  3IWW A;  3V7Z A;  1CP6 A;  2GRE A;  1IY7 A;  4ZI6 A;  4IAV A;  3MRU A;  4EME A;  2HC9 A;  5LRJ A;  2ZOG A;  5ELY A;  4PQA A;  3GB0 A;  4FUU A;  5CPA A;  3FEC A;  4NFR A;  3FMC A;  5K8P A;  3SJF A; 
#chains in the Genus database with same CATH topology
 1Y7E A;  2FIW A;  1AMP A;  2Z0Z A;  4M6G A;  5GCN A;  2GFQ A;  3ISX A;  1Z4E A;  5HXD A;  4B12 A;  3K9T A;  1XMT A;  5C88 A;  3T9Y A;  3BI1 A;  2J8R A;  3PB7 X;  2PJ0 A;  4Q38 A;  4NGS A;  1FY7 A;  2FL4 A;  4NCZ A;  1YLO A;  4ZY2 A;  4FWU A;  2JEV A;  4M3S A;  3TT2 A;  4DUK A;  3FVL A;  4I49 A;  3F5B A;  1B6B A;  1XRY A;  3PB9 X;  3HLP A;  3GUX A;  4OC3 A;  1JQG A;  4JXQ A;  4CYN A;  4H6Z A;  2VQY A;  4QUS A;  3SHP A;  2FVG A;  4Y49 B;  3LMS A;  5K8P A;  1A2Z A;  1BO4 A;  1HDU A;  4UCM A;  4CAE A;  4CYP A;  2PIZ A;  1TKH A;  2IJZ A;  2OU2 A;  2PJ9 A;  2EBJ A;  3IFE A;  3CXS A;  4YRH A;  3N5F A;  3CPX A;  1VHS A;  3WC7 A;  4W9Y A;  3WR7 A;  4RN7 A;  4ZY1 A;  2PJA A;  4NFR A;  5LRK A;  2O4H A;  4P45 A;  3L2N A;  4KZT A;  4P4D A;  3FXT A;  1CJW A;  4IUS A;  1ZLI A;  4LUA A;  2WZN A;  4F0Y A;  5D29 A;  2PJ4 A;  2A4N A;  3PBE A;  3DLJ A;  2Q7B A;  4OC0 A;  2C6C A;  2ABZ A;  2ZEL A;  1LCP A;  1QSN A;  5CNP A;  3TX8 A;  2VZY A;  4B6Z A;  3NH4 A;  4F9U A;  3IWE A;  1K4J A;  2QIR A;  3SJX A;  3TO6 A;  4RS2 A;  2OR4 A;  3MN8 A;  3P2H A;  3I3G A;  1YK3 A;  4KVX A;  3C26 A;  2YGW A;  4NJQ A;  4MJ8 A;  1MJB A;  3KHZ A;  1XBU A;  3IO1 A;  3OWC A;  4OLL A;  2EUI A;  3DR8 A;  4P4F A;  3FYN A;  4CAX A;  3SXO A;  2Q4V A;  4PXB A;  3B7I A;  2ZOF A;  5THW A;  3HUV A;  4X3R A;  3FNC A;  1R3N A;  2Q44 A;  4C7I A;  1TKF A;  1Z5R A;  4EFD A;  2AJ6 A;  5I4M A;  3D3S A;  2BEI A;  1QMU A;  3S6F A;  3VAR A;  2PJ2 A;  1Z8L A;  2O28 A;  1YVK A;  1CBX A;  3I1U A;  1Z8X A;  2PSW A;  2C1C A;  2B3V A;  2ZW4 A;  2ZEE A;  1YVO A;  1ZG9 A;  5J8C A;  2Z11 A;  5J8F A;  2BSW A;  3SJG A;  1YW4 A;  1B87 A;  1Q2C A;  4O23 A;  5F48 A;  1ARL A;  3QNV A;  5DWN A;  4KOU A;  3FJU A;  4XPL A;  4FD6 A;  1MJA A;  2AFX A;  2ZEP A;  2AFZ A;  4A37 A;  1KZF A;  2EVN A;  2ODF A;  2Y0M A;  4CGN A;  3JVN A;  1I1D A;  4MCR A;  2PR1 A;  2JDC A;  2OB0 A;  2QML A;  2CNS A;  3LD2 A;  1LAN A;  3TTH A;  4Z65 A;  4KUB A;  1YGH A;  1Z8W A;  3NE7 A;  4X8I A;  4KLV A;  4OC1 A;  2R7H A;  2Z3P A;  1CG2 A;  3CDX A;  2XEG A;  4IF5 A;  2I3C A;  1IYK A;  2JDD A;  2PJ7 A;  3VH9 A;  4P4J A;  1S7F A;  2GE3 A;  3H8F A;  4UFW A;  1ZO0 A;  5LYI A;  2CTC A;  2Q4Y A;  4QC6 A;  4CGP A;  1ZG8 A;  5AG6 A;  2BL1 A;  4UA3 A;  3VAT A;  1NMT A;  3FB3 A;  2ZEM A;  4MY0 A;  4RI1 A;  4XNH C;  3K2K A;  2JEW A;  3FBU A;  4CGO A;  2AFW A;  3FEE A;  1P4N A;  3TOA A;  2HQY A;  3F0A A;  2B4D A;  2FIA A;  2FXF A;  4MFQ A;  3PB8 X;  4P4I A;  3R9G A;  1QSR A;  4PK3 A;  2DXQ A;  5HVH A;  2WPW A;  3DSB A;  1M44 A;  4UEZ A;  3WT4 A;  4E8O A;  4JZ0 A;  4A33 A;  1MK4 A;  3NH8 A;  4JWP A;  3CXQ A;  5LYL A;  2WYR A;  2RC4 A;  2AFS A;  4FAI A;  4NJR A;  3DDD A;  5AG5 A;  3IEH A;  1ELM P;  1Y7R A;  4HKF A;  4OC4 A;  2D4P A;  4OAE A;  3PFO A;  3B3V A;  4B5O A;  1TKJ A;  2PQ8 A;  3D2M A;  3D7H A;  4K30 A;  3V38 A;  4C68 A;  3H5Z A;  4NGN A;  4BBH A;  1XIX A;  2PJ1 A;  3QB8 A;  2REE A;  2NYQ A;  2YNC A;  4A32 A;  2C6G A;  1RO5 A;  1VIX A;  2RFH A;  4KSA A;  1DTD A;  4GS4 A;  3NH5 A;  3KQZ A;  3PEI A;  1HDQ A;  2V77 A;  4MCP A;  1XJO A;  1LOK A;  4YGO A;  3FRM A;  5K8O A;  2YNC C;  2B5G B;  2Z3N A;  4CPA A;  3PFE A;  2GAN A;  1LFW A;  4R76 A;  1YSJ A;  4B14 A;  3D7G A;  4NGM A;  3N7Z A;  1BAV A;  3CXP A;  3SJE A;  4DJL A;  2VBQ A;  4XPD B;  5BWA B;  2GLF A;  4OC5 A;  3D8P A;  4IK2 A;  2Q04 A;  2ZPA A;  4PK2 A;  1M4I A;  3GKR A;  4UFX A;  4JJX A;  4H2K A;  4HPS A;  3PB4 X;  1VKC A;  1BPM A;  2REF A;  2G9D A;  3D67 A;  2K5T A;  1F57 A;  1XF8 A;  1XOV A;  1DE4 C;  3MGD A;  4AXV A;  1L0C A;  4NGP A;  1CP7 A;  2FCK A;  2J9A A;  3B3S A;  3IJ3 A;  4NGT A;  2ARH A;  3WC5 A;  4HNW B;  1CX8 A;  3A9L A;  4UIA A;  2Z3O A;  1NSL A;  2Z10 A;  4A94 A;  2AFO A;  3NE8 A;  4GXH A;  1PCA A;  5HVF A;  3KZW A;  3SXN A;  2FS5 A;  2ZW5 A;  4R87 A;  3P2F A;  3EFA A;  4X2T A;  4A95 A;  4AVC A;  4EVY A;  5JH9 A;  3IU2 A;  4LX9 A;  4OME A;  4B11 A;  3S9M A;  3T8W A;  2XEJ A;  3PRT A;  2DF5 A;  3LWU A;  5IB0 A;  4OID A;  2V8V A;  4PPZ A;  1ARM A;  2VXK A;  2EK9 A;  1KUX A;  3G8W A;  3CT9 A;  4CS0 B;  3GLJ A;  4M85 A;  2GLJ A;  4QVT A;  2EWB A;  2XEI A;  4R3K A;  2GIV A;  1Y9K A;  1IOI A;  2Q4Z A;  2ZW7 A;  4MHY A;  2BUE A;  4ZBG A;  5KTC A;  2AFU A;  1PUA A;  4P4B A;  4KOT A;  1YR0 A;  1MJ9 A;  5AG4 A;  2G3T A;  3QAY A;  1X10 A;  4H6U A;  1ZLH A;  2I79 A;  2O53 A;  4CAW A;  4UBR A;  2PE3 A;  3S6K A;  1I21 A;  2B3U A;  2CXA A;  4KSF A;  5G21 A;  3D68 A;  1GHE A;  5G20 A;  2CF4 A;  1TF9 A;  4LQ6 A;  2P6E A;  3B3C A;  3B8G A;  2OH1 A;  1YME A;  2IMO A;  3PZJ A;  1Z8T A;  5G1Z A;  5ISV A;  1CPS A;  4WJB A;  4OP4 A;  4ZX9 A;  4PV6 A;  4TWE A;  4JXR A;  2C27 A;  4KVO E;  5FVJ A;  1YRE A;  3H8E A;  3JTK A;  4OC2 A;  2BOA A;  2I00 A;  2J8M A;  4B5P B;  3CPA A;  3KI9 A;  4KOR A;  4MCS A;  4KUA A;  2HB6 A;  4QBJ A;  2Q0Y A;  4KOV A;  4YU9 A;  1S7K A;  3NA6 A;  4MXU A;  2PJ8 A;  3R95 A;  4BD9 A;  4R57 A;  3VWE A;  4F6A A;  4C2Z A;  4Y49 C;  1KUY A;  5IV0 A;  5JQ4 A;  1RTQ A;  1IB1 E;  2CIJ A;  1QQ9 A;  4AVA A;  3W6X A;  4ZGY B;  4PXE A;  1XE4 A;  4UIB A;  4E0A A;  5LYF A;  5G22 A;  3PBB A;  2PJ6 A;  2WUU A;  4KSI A;  1CPX A;  2Q43 A;  4R9M A;  3WAB A;  3KR5 A;  3R1K A;  4ONW A;  4WWV A;  4ZYQ A;  3TFY A;  1OBR A;  2G3A A;  4A31 A;  3SI1 A;  4A30 A;  5F49 A;  1S3Z A;  2F8H A;  2OZU A;  2QEC A;  3V8I A;  2AFM A;  3S9L A;  2XEF A;  2Z3M A;  1FNO A;  2X7B A;  4EWT A;  3FED A;  3R9E A;  4CGL A;  1Q2Y A;  4CRZ B;  2ZW6 A;  5KTD A;  4XPK A;  1TF8 A;  2VL1 A;  4MBU A;  3H8G A;  2WPX A;  1Y0Y A;  1XEB A;  2JBK A;  3NFZ A;  1M4G A;  3ZZI A;  3IU1 A;  4MMO A;  1PYT B;  4C7H A;  2VI7 A;  4R6T A;  3S6G A;  3H4Q A;  1AUG A;  3I9S A;  1HEE A;  4MFZ A;  2YND A;  2RB7 A;  4MY3 A;  3JRU A;  2BCO A;  3BXM A;  4JD6 A;  2BO9 A;  2P6F A;  1Z2L A;  4R8F A;  3KL9 A;  4MHZ A;  3TE4 A;  2GU2 A;  2OZH A;  3CZX A;  3W6S A;  5A28 A;  4Q36 A;  4GM5 A;  5E96 A;  2CNT A;  4F0X A;  1N71 A;  1EE3 P;  3W91 A;  4QB9 A;  1BLL E;  3DNS A;  1NSA A;  3IIB A;  3B3W A;  4J3G A;  1ZG7 A;  1YQE A;  2PJC A;  1SQH A;  1IID A;  3B35 A;  2FSR A;  4LQG A;  4CYQ A;  1TXR A;  3K9U A;  1AYE A;  4CAF A;  1Y9W A;  2R1I A;  3LOD A;  1LAM A;  2PC1 A;  2PIY A;  2PDO A;  3B3T A;  4MHN A;  3EY5 A;  2Z3L A;  4NXY A;  3R9F A;  5J1Q A;  1ON0 A;  4UF4 A;  2P6G A;  1P0H A;  5HVG A;  2NSM A;  2V8H A;  1YLE A;  3RNZ A;  4CYO A;  3D4U A;  3TO9 A;  1LRZ A;  5KTA A;  3RZA A;  5DWM A;  8CPA A;  4C2X A;  3TCV A;  2PJ5 A;  3RYO A;  4L89 A;  1QSM A;  4PXD A;  4BMH A;  2OOT A;  5A27 A;  1KWM A;  5H84 A;  4M6I A;  1M4L A;  1IU8 A;  3B2Y A;  1X12 A;  4C2Y A;  1YX0 A;  2HUZ A;  4ONU A;  2QJ8 A;  4JLY A;  2WSA A;  4UWI A;  3R96 A;  2CY2 A;  3SI0 A;  1IIC A;  3DGV A;  3IGR A;  1UWY A;  2ZEG A;  4KOX A;  4P4E A;  4UEF A;  2EK8 A;  4BIN A;  4PSX A;  3BJ7 A;  3BHX A;  3KHX A;  3VWD A;  5IB9 A;  4NEX A;  4OKO A;  2ZEH A;  1VGY A;  3G3S A;  4AVB A;  2PVV A;  6CPA A;  4JYW A;  1NE9 A;  3D2P A;  2ZED A;  3EC4 A;  3EO4 A;  4ZX8 A;  1PU9 A;  4OIW A;  3UY5 A;  2P0W A;  4FD7 A;  2ZEO A;  2AE6 A;  4HNY B;  3T90 A;  1VHE A;  3SI2 A;  5LRG A;  1Z9U A;  2PRQ A;  1TIQ A;  2FT0 A;  4YFJ A;  3S9N A;  2ZXV A;  3PB6 X;  3DR6 A;  4XNH B;  3RBU A;  4NGQ A;  5LYD A;  2PCU A;  2NMT A;  5IX3 A;  2DPS A;  4CGM A;  4KOS A;  5DS0 A;  3JUW A;  3BJ8 A;  4B13 A;  2C6P A;  1S5K A;  2EO8 A;  2H5M A;  3FF3 A;  4MFL A;  4MFP A;  1QST A;  1IYL A;  2DEA A;  4A2Z A;  2ZEN A;  5K8N A;  3KR4 A;  4FD4 A;  2CTB A;  3TC8 A;  3LAC A;  2PR8 A;  2B4D B;  1JWQ A;  1KUV A;  2PVW A;  3GIU A;  5JPH A;  1S60 A;  2D4O A;  3ISZ A;  2FE7 A;  3RO0 A;  3ZJ0 A;  4AG9 A;  1Y0R A;  2B5G A;  2VEZ A;  3E0K A;  3KKW A;  4P44 A;  1GYT A;  4PXC A;  2PJB A;  2V8G A;  3BI0 A;  4MFK A;  4KLW A;  1BPN A;  4ORF A;  4L8A A;  2F7V A;  3FIX A;  4MCQ A;  4U9Z A;  4P6Y A;  4YWY A;  4B10 A;  2POK A;  4A39 A;  4KOW A;  1XFO A;  2OZG A;  4Q7A A;  5HMN A;  5JM6 A;  4NF1 A;  5HH1 A;  1CM0 A;  4FD5 A;  3WC6 A;  2PJ3 A;  1F2P A;  4TNU A;  1LAP A;  4X5K A;  4DYO A;  2B4B A;  2ATR A;  1H8L A;  1UFH A;  2Q7S A;  2ZEF A;  4XPD C;  3BLN A;  5H86 A;  4AB7 A;  3D7F A;  1YW6 A;  3GY9 A;  3RAM A;  5CBM A;  3IWG A;  1M1D A;  1WWZ A;  5I0C A;  4MFJ A;  4R7M A;  5F09 A;  5JGF A;  3FH4 A;  4IHM A;  4MRI A;  4U9Y A;  3F8K A;  4A38 A;  4KOY A;  1QSO A;  1XMB A;  2QYV A;  3IC1 A;  4F8Z A;  1J4J A;  1FT7 A;  1WK4 A;  2G0B A;  1M4D A;  1V0C A;  3KQX A;  4UWJ A;  4CRY B;  3KAS A;  1BOB A;  4UCP A;  1S7L A;  4UCN A;  5D8N A;  4ZY0 A;  1I12 A;  2F5I A;  4KS9 A;  2R8V A;  2Z3K A;  1ELL P;  1U6M A;  2ANP A;  5F46 A;  3D66 A;  4H89 A;  1IOF A;  4E2A A;  5EMI A;  2Q51 A;  4AG7 A;  2HV2 A;  1Z4R A;  4NGR A;  2IQ6 A;  3PGP A;  4RUH A;  1S7N A;  4NSQ A;  4F9V A;  1Q7L A;  4UEE A;  2KCW A;  4K3N A;  7CPA A;  4HNX B;  1IGB A;  2V8D A;  4FBE A;  5K8M A;  1OZP A;  1VHO A;  4R3L A;  1F2O A;  2JBJ A;  2PRB A;  2JLM A;  2VZZ A;  1R57 A;  4MHP A;  3EXN A;  4OAD A;  3S6H A;  2QVP A;  5C82 A;  3PP9 A;  4G1P A;  2B58 A;  1R43 A;  3D7D A;  5EBV A;  3FX6 A;  2R98 A;  3KGQ A;  1RXT A;  5AG7 A;  4P10 A;  3IWW A;  3TO7 A;  3V7Z A;  4PSW A;  4CAV A;  4KVM E;  4UFV A;  1CP6 A;  2GRE A;  2J8N A;  1IY7 A;  4U5Y A;  4ZI6 A;  4IAV A;  5F47 A;  3GYA A;  3MRU A;  4EME A;  2HC9 A;  4M6H A;  2YNE A;  2IL4 A;  5LRJ A;  3TOB A;  2ZOG A;  4MI4 A;  5ELY A;  4PQA A;  3GB0 A;  4B5P A;  2CNM A;  4FUU A;  4DNC A;  4II9 A;  5CPA A;  1Q2D A;  3FEC A;  5AGE A;  2DPT A;  3FMC A;  4MHD A;  3SJF A;  3QAH A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 1Y7E A;  1AMP A;  3ISX A;  5HXD A;  3K9T A;  3BI1 A;  3PB7 X;  2PJ0 A;  4NGS A;  1YLO A;  4ZY2 A;  4FWU A;  4DUK A;  3FVL A;  1XRY A;  3PB9 X;  3HLP A;  3GUX A;  4OC3 A;  1JQG A;  2FVG A;  3LMS A;  1HDU A;  2PIZ A;  1TKH A;  2IJZ A;  2PJ9 A;  3IFE A;  3N5F A;  3CPX A;  3WC7 A;  4W9Y A;  4ZY1 A;  2PJA A;  5LRK A;  2O4H A;  4P45 A;  3L2N A;  4P4D A;  1ZLI A;  2WZN A;  5D29 A;  2PJ4 A;  3PBE A;  3DLJ A;  4OC0 A;  2C6C A;  2ABZ A;  2ZEL A;  1LCP A;  3TX8 A;  4B6Z A;  4F9U A;  3NH4 A;  3SJX A;  2OR4 A;  3MN8 A;  4NJQ A;  3KHZ A;  4P4F A;  1XBU A;  3IO1 A;  4PXB A;  3B7I A;  2ZOF A;  5THW A;  3HUV A;  4X3R A;  1R3N A;  1TKF A;  1Z5R A;  4EFD A;  5I4M A;  1QMU A;  3VAR A;  2PJ2 A;  1Z8L A;  1CBX A;  3I1U A;  2C1C A;  2ZEE A;  1ZG9 A;  3SJG A;  1YW4 A;  4O23 A;  1ARL A;  3QNV A;  3FJU A;  2AFX A;  2ZEP A;  2AFZ A;  4A37 A;  4MCR A;  1LAN A;  4Z65 A;  4X8I A;  4OC1 A;  1CG2 A;  3CDX A;  2XEG A;  2I3C A;  2PJ7 A;  3VH9 A;  4P4J A;  3H8F A;  5LYI A;  2CTC A;  1ZG8 A;  3VAT A;  2ZEM A;  3K2K A;  2JEW A;  2AFW A;  3FEE A;  3PB8 X;  4P4I A;  5HVH A;  4UEZ A;  3WT4 A;  4JZ0 A;  3NH8 A;  5LYL A;  2WYR A;  2AFS A;  4FAI A;  4NJR A;  3IEH A;  1ELM P;  4OC4 A;  3PFO A;  3B3V A;  1TKJ A;  3D7H A;  3V38 A;  4NGN A;  2PJ1 A;  2NYQ A;  2C6G A;  1VIX A;  2RFH A;  1DTD A;  3NH5 A;  3KQZ A;  3PEI A;  1HDQ A;  2V77 A;  4MCP A;  1XJO A;  1LOK A;  5K8O A;  4CPA A;  3PFE A;  1LFW A;  4R76 A;  1YSJ A;  3D7G A;  4NGM A;  1BAV A;  3SJE A;  4DJL A;  2GLF A;  4OC5 A;  4IK2 A;  4H2K A;  3PB4 X;  3D67 A;  1BPM A;  2G9D A;  1F57 A;  1DE4 C;  4AXV A;  4NGP A;  1CP7 A;  3B3S A;  2J9A A;  3IJ3 A;  4NGT A;  3WC5 A;  1CX8 A;  4UIA A;  4A94 A;  2AFO A;  5HVF A;  1PCA A;  3KZW A;  4X2T A;  5JH9 A;  4OME A;  3S9M A;  3T8W A;  2XEJ A;  3PRT A;  3LWU A;  4OID A;  2V8V A;  4PPZ A;  1ARM A;  2EK9 A;  3CT9 A;  3GLJ A;  2GLJ A;  2EWB A;  2XEI A;  2Q4Z A;  4MHY A;  2AFU A;  4P4B A;  1ZLH A;  2O53 A;  2PE3 A;  3D68 A;  2CF4 A;  1TF9 A;  3B3C A;  1YME A;  2IMO A;  1CPS A;  4WJB A;  4OP4 A;  4ZX9 A;  4TWE A;  3H8E A;  4OC2 A;  2BOA A;  3CPA A;  3KI9 A;  4MCS A;  2HB6 A;  4YU9 A;  3NA6 A;  4BD9 A;  4MXU A;  2PJ8 A;  1RTQ A;  2CIJ A;  1QQ9 A;  4PXE A;  5LYF A;  4UIB A;  3PBB A;  2PJ6 A;  4KSI A;  1CPX A;  2Q43 A;  3WAB A;  3KR5 A;  4ONW A;  4WWV A;  4ZYQ A;  1OBR A;  3SI1 A;  2F8H A;  2AFM A;  3S9L A;  2XEF A;  1FNO A;  4EWT A;  3FED A;  1TF8 A;  2VL1 A;  3H8G A;  1Y0Y A;  2JBK A;  3NFZ A;  4MMO A;  1PYT B;  4R6T A;  1HEE A;  2RB7 A;  3JRU A;  2BCO A;  3BXM A;  2BO9 A;  1Z2L A;  4R8F A;  3KL9 A;  4MHZ A;  2GU2 A;  4GM5 A;  1EE3 P;  1BLL E;  1NSA A;  3IIB A;  3B3W A;  1ZG7 A;  2PJC A;  3B35 A;  4LQG A;  1TXR A;  1AYE A;  1LAM A;  2PIY A;  4MHN A;  3B3T A;  5J1Q A;  4UF4 A;  5HVG A;  2NSM A;  2V8H A;  3D4U A;  3RZA A;  8CPA A;  2PJ5 A;  4PXD A;  2OOT A;  1KWM A;  1M4L A;  3B2Y A;  2QJ8 A;  3SI0 A;  3DGV A;  4P4E A;  4UEF A;  1UWY A;  2ZEG A;  2EK8 A;  3BHX A;  3KHX A;  5IB9 A;  4OKO A;  2ZEH A;  1VGY A;  2PVV A;  6CPA A;  4JYW A;  2ZED A;  4ZX8 A;  4OIW A;  2ZEO A;  1VHE A;  3SI2 A;  5LRG A;  3S9N A;  2PRQ A;  3PB6 X;  3RBU A;  4NGQ A;  5LYD A;  2PCU A;  5DS0 A;  2C6P A;  3FF3 A;  2DEA A;  5K8N A;  2ZEN A;  3KR4 A;  2CTB A;  3TC8 A;  2PVW A;  3ISZ A;  1Y0R A;  4P44 A;  1GYT A;  4PXC A;  2PJB A;  2V8G A;  3BI0 A;  1BPN A;  2F7V A;  4MCQ A;  4P6Y A;  4YWY A;  2POK A;  4A39 A;  1XFO A;  4Q7A A;  5JM6 A;  3WC6 A;  2PJ3 A;  1F2P A;  4TNU A;  1LAP A;  4DYO A;  1H8L A;  2ZEF A;  3D7F A;  1YW6 A;  3RAM A;  5CBM A;  4R7M A;  5F09 A;  5JGF A;  3FH4 A;  4IHM A;  4MRI A;  4A38 A;  1XMB A;  2QYV A;  3IC1 A;  4F8Z A;  1FT7 A;  3KQX A;  3KAS A;  4ZY0 A;  5D8N A;  1ELL P;  2ANP A;  3D66 A;  2Q51 A;  4NGR A;  2IQ6 A;  4RUH A;  4F9V A;  1Q7L A;  4UEE A;  4K3N A;  7CPA A;  1IGB A;  2V8D A;  4FBE A;  5K8M A;  1VHO A;  1F2O A;  2JBJ A;  4MHP A;  2QVP A;  4G1P A;  1R43 A;  3D7D A;  3FX6 A;  3KGQ A;  4P10 A;  3IWW A;  3V7Z A;  1CP6 A;  2GRE A;  1IY7 A;  4ZI6 A;  4IAV A;  3MRU A;  4EME A;  2HC9 A;  5LRJ A;  2ZOG A;  5ELY A;  4PQA A;  3GB0 A;  4FUU A;  5CPA A;  3FEC A;  4NFR A;  3FMC A;  5K8P A;  3SJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...