3FH4A

Crystal structure of recombinant vibrio proteolyticus aminopeptidase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterologous expression and purification of Vibrio proteolyticus (Aeromonas proteolytica) aminopeptidase: a rapid protocol
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3fh4A00
2QYVA 2HC9A 1Q7LA 3MRUA 2ZOGA 3NH5A 4OIDA 2ZEFA 4B6ZA 3DGVA 2IJZA 1HDUA 4OP4A 2GU2A 2AFUA 2PJBA 1Z8LA 4OC5A 4A94A 3RZAA 5DS0A 4GM5A 1YW6A 4UEEA 3D67A 1DE4C 3KR5A 4EMEA 1TXRA 2EK8A 4ZY1A 5HVGA 5F09A 2C6PA 2BO9A 1BLLE 4PXBA 3WT4A 5K8PA 5JGFA 1QQ9A 1IGBA 1UWYA 5CBMA 4UEFA 1TKJA 4ZY2A 3ISZA 3TC8A 4PXDA 1CX8A 1BPNA 2WYRA 5HVFA 4DYOA 1LFWA 4PXCA 1LANA 2ZEGA 2ZEOA 3PFEA 4NFRA 4OC2A 4JZ0A 3B3SA 1ZG7A 2BOAA 4X3RA 1R43A 3SI0A 1ZLHA 2V8HA 3GLJA 5LYIA 3FECA 1LCPA 4OIWA 4OC0A 4MCQA 3MN8A 4MCRA 2ZELA 3PRTA 5LRJA 6CPAA 3FX6A 3PB4X 3VARA 3B3VA 1CG2A 2J9AA 1YSJA 2GREA 3B2YA 1XBUA 4H2KA 3IC1A 4A37A 1KWMA 4MHPA 4A39A 2ABZA 2CF4A 3PB9X 3VATA 2XEFA 4P4BA 3KASA 3WC7A 2V77A 3L2NA 3QNVA 2ZEMA 2PJ5A 4NJQA 2PJ2A 3KHXA 1ZG9A 1F57A 3PFOA 3CPAA 3IIBA 4ZYQA 2PCUA 2PJCA 5LRKA 3D7FA 2C1CA 4DUKA 2GLFA 2OR4A 3BHXA 1TKHA 4IAVA 1PCAA 2CTBA 4MCSA 1M4LA 5D29A 5CPAA 2PJ3A 3NH4A 4MCPA 4R76A 1FT7A 2BCOA 5LYFA 3IWWA 3HLPA 3IJ3A 2ZOFA 4RUHA 1OBRA 3NFZA 5K8OA 2Q4ZA 2V8GA 3KR4A 4Z65A 2PJ8A 1ZG8A 1VHEA 4NGQA 4EFDA 3NH8A 2AFZA 1Z5RA 3SI1A 4ZY0A 3D68A 3IO1A 4O23A 1BAVA 3PEIA 2V8VA 4A38A 4G1PA 1XFOA 3I1UA 3B7IA 1CBXA 3B3CA 1XMBA 4P4FA 3K2KA 1VHOA 4F9UA 2NSMA 1NSAA 4FBEA 3FMCA 4FAIA 2XEGA 2VL1A 2Q43A 2CTCA 4OKOA 5LYLA 5HXDA 3FEDA 3K9TA 4LQGA 3IFEA 2PJAA 3GB0A 1Y0YA 4TNUA 2PRQA 4NJRA 4X8IA 3CDXA 5LYDA 2F8HA 3ISXA 3WC6A 3N5FA 4K3NA 3WABA 2O4HA 2V8DA 4Q7AA 3SJXA 1RTQA 4JYWA 4ZX9A 1QMUA 1H8LA 1F2PA 2AFXA 3FVLA 3SJGA 2PJ6A 3PB8X 4P44A 1ARLA 3GUXA 4PPZA 3V7ZA 3WC5A 4YU9A 4YWYA 3LWUA 1CPSA 4TWEA 3S9NA 1YW4A 2DEAA 1TF9A 1ELMP 2JBKA 4OC3A 4MRIA 2ZEDA 2JBJA 4UF4A 1LAMA 2PIZA 3KQZA 1LOKA 2XEIA 2IQ6A 5ELYA 2PJ7A 1F2OA 3NA6A 1AMPA 3B3TA 1LAPA 5K8NA 5THWA 2NYQA 2GLJA 4UIBA 4UIAA 3CT9A 4P4JA 3B3WA 1VGYA 3PBEA 3KI9A 4MHYA 2ZENA 2WZNA 1Y7EA 4WJBA 4ZI6A 2O53A 4NGRA 5HVHA 1CP7A 3BXMA 3FJUA 5I4MA 2AFMA 2EK9A 5K8MA 5D8NA 2ZEHA 1DTDA 2POKA 1XJOA 4W9YA 1GYTA 3KQXA 3BI1A 2HB6A 3S9MA 1ELLP 2PJ0A 2PJ9A 4NGPA 1JQGA 1PYTB 4EWTA 2JEWA 2Q51A 2C6CA 3JRUA 1YLOA 1TKFA 4OMEA 3D7DA 3IEHA 3D4UA 1R3NA 2I3CA 2ZEPA 8CPAA 1Z2LA 2C6GA 3SI2A 2PJ1A 3H8GA 3TX8A 4CPAA 2EWBA 2OOTA 4P4IA 3D7HA 3KZWA 4MXUA 5JH9A 4UEZA 3V38A 3HUVA 3BI0A 3RBUA 4P45A 2RB7A 3T8WA 4P4DA 2ANPA 2F7VA 2PE3A 1Y0RA 1AYEA 3D66A 4OC4A 2QVPA 1TF8A 3B35A 4OC1A 3PB6X 3H8EA 4FWUA 1XRYA 3FH4A 4NGTA 4DJLA 4X2TA 2PJ4A 3RAMA 4P6YA 3DLJA 1CPXA 4NGSA 4F8ZA 3CPXA 2IMOA 1ARMA 3D7GA 2AFSA 2PVVA 3VH9A 1FNOA 2RFHA 3LMSA 3SJEA 4R7MA 7CPAA 3S9LA 4F9VA 4PQAA 1IY7A 4WWVA 4R8FA 4ONWA 4P4EA 3FEEA 1YMEA 1VIXA 3SJFA 1HEEA 5J1QA 5LRGA 4P10A 2CIJA 4MHNA 2G9DA 4PXEA 2PVWA 1HDQA 4R6TA 2ZEEA 3KHZA 4ZX8A 2AFOA 4AXVA 4IK2A 2FVGA 1EE3P 3FF3A 3KGQA 3KL9A 1BPMA 4KSIA 3PBBA 4MHZA 3PB7X 1ZLIA 2XEJA 5IB9A 4NGNA 3H8FA 4NGMA 2QJ8A 4MMOA 4IHMA 4BD9A 4FUUA 1CP6A 5JM6A 2AFWA 2PIYA
chains in the Genus database with same CATH superfamily
1KUVA 1M4IA 2PR8A 2HC9A 2QYVA 1Q7LA 1XE4A 3MRUA 2ODFA 1Z9UA 1YK3A 5AG4A 3D8PA 4JWPA 5A27A 2ZOGA 3NH5A 2P6EA 1YLEA 4OIDA 4C2XA 2QMLA 3CXPA 2ZEFA 4B6ZA 3DGVA 2IJZA 1HDUA 4OP4A 2GU2A 2WPWA 2AFUA 2PJBA 3IU2A 2ZW4A 3EO4A 3P2HA 4A32A 1Z8LA 2R98A 4OC5A 4UWIA 4A94A 1Z4EA 4B10A 3D2MA 5F48A 3RZAA 5I0CA 1QSMA 5DS0A 4GM5A 2EUIA 1YW6A 1JWQA 1BOBA 4UEEA 4ONUA 3D67A 1DE4C 1P4NA 2JDDA 3KR5A 2PQ8A 5AG7A 4C2ZA 1TXRA 4CAEA 4EMEA 2EK8A 4ZY1A 5HVGA 2G0BA 5F09A 2C6PA 2BO9A 1BLLE 4KOWA 2CNTA 4PXBA 3R1KA 3WT4A 5JGFA 5K8PA 2Y0MA 1QQ9A 4LUAA 2GANA 1IGBA 4BMHA 4CGNA 1UWYA 1TIQA 5CBMA 4UEFA 1TKJA 4ZY2A 2J8MA 3ISZA 3TC8A 4PXDA 1CX8A 2B3VA 4PSWA 3ZJ0A 2PDOA 1S7KA 1BPNA 2WYRA 3TE4A 4AVAA 5HVFA 1MJAA 5F47A 1M44A 4M6GA 1SQHA 1X12A 4DYOA 4MFPA 1LFWA 4PXCA 1LANA 2B5GA 1Z4RA 2ZEGA 2ZEOA 3PFEA 3IU1A 4NFRA 4OC2A 1MJBA 3JVNA 3EXNA 3B3SA 4KORA 1YGHA 4JZ0A 1ZG7A 2BOAA 4X3RA 4B13A 4CYPA 1M4GA 4MY0A 1R43A 4ORFA 3SI0A 4AB7A 5JPHA 2JLMA 1ZLHA 2V8HA 3GLJA 5LYIA 3FECA 3W6SA 4C7IA 4X5KA 1LCPA 4OIWA 1S7LA 2ZW7A 2VZZA 3CXQA 3GY9A 4MCQA 2PC1A 3B8GA 2HQYA 3I9SA 2ZELA 3MN8A 1IU8A 3PRTA 1IB1E 4MCRA 1S5KA 5LRJA 6CPAA 4R3LA 5H86A 2Z0ZA 3FX6A 3PB4X 4H89A 1J4JA 4H6UA 4XPDB 4I49A 3VARA 4PK2A 3B3VA 1ZO0A 1CG2A 2D4OA 2J9AA 3EFAA 1AUGA 1YSJA 2GREA 2Q4YA 3BJ8A 2FXFA 5AGEA 3B2YA 3GKRA 3KKWA 4U9YA 1XBUA 3SXOA 4H2KA 3IC1A 4PV6A 4A37A 1KWMA 4MHPA 3BJ7A 4A39A 2ABZA 2CF4A 3PB9X 3VATA 4LQ6A 1B87A 2FE7A 1MJ9A 2YNCA 2XEFA 1RO5A 3C26A 4R9MA 4P4BA 3KASA 3WC7A 3G3SA 2V77A 3L2NA 1A2ZA 3QNVA 4CGOA 2ZEMA 2PJ5A 2B3UA 4NJQA 2P0WA 2ZPAA 2JEVA 2PJ2A 3KHXA 4BBHA 5KTCA 1Q2YA 1ZG9A 1F57A 3GYAA 4KOTA 4UWJA 3PFOA 3CPAA 3IIBA 1S7NA 2PCUA 2PJCA 4IUSA 3NE8A 4ZYQA 2I00A 5LRKA 2BEIA 3D7FA 2C1CA 3N7ZA 4DUKA 2B58A 2REFA 2GLFA 2CNMA 2Q44A 2OR4A 3BHXA 5EMIA 3S6FA 4HNXB 1TKHA 4IAVA 1PCAA 2YNDA 5FVJA 4B5PB 1VHSA 1Y7RA 2CTBA 4MCSA 1M4LA 5D29A 5CPAA 2PJ3A 4E2AA 3NH4A 4MCPA 4YGOA 4R76A 5CNPA 1FT7A 4Y49C 3TO7A 2BCOA 4CAXA 5LYFA 3IWWA 3HLPA 4A95A 4Y49B 4KUAA 3IJ3A 2FL4A 2ZOFA 4RUHA 1OBRA 3LD2A 3NFZA 5K8OA 2Z10A 2Q4ZA 2V8GA 1IYLA 4OAEA 3KR4A 1U6MA 4Z65A 3K9UA 2PJ8A 1ZG8A 3D3SA 3T90A 1IOIA 1VHEA 4NGQA 4EFDA 2PR1A 3NH8A 2AFZA 3TO9A 1Z5RA 1GHEA 4R3KA 3SI1A 4ZY0A 4QC6A 3D68A 1P0HA 1VKCA 1XEBA 4FD4A 4R57A 3R95A 3LODA 2YNCC 3IO1A 4O23A 4CRZB 4CYQA 3R96A 2ZW6A 4NXYA 1BAVA 3PEIA 1NSLA 4CAFA 3JTKA 4KZTA 4J3GA 1YREA 2Q7BA 4B14A 4JD6A 4CYNA 3TTHA 2OU2A 4PK3A 2CY2A 2V8VA 4A38A 4G1PA 1XFOA 1M1DA 2R1IA 4FD7A 4CAWA 3I1UA 5H84A 3TOBA 3FBUA 2Z3MA 3B7IA 1CBXA 2P6GA 1S60A 3B3CA 1XMBA 2VZYA 2IL4A 2DPTA 4P4FA 5IX3A 4NSQA 4R87A 3FB3A 1S7FA 1NMTA 2ARHA 3D2PA 3K2KA 4ZBGA 1VHOA 4MY3A 4F9UA 2NSMA 3V8IA 5HMNA 3PGPA 1NSAA 4MFJA 2EO8A 2FCKA 4KSAA 4FBEA 1YX0A 4RN7A 3FMCA 4FAIA 2XEGA 3H5ZA 2VL1A 1XMTA 4UBRA 2Q43A 2CTCA 4OKOA 4QVTA 2REEA 5LYLA 1UFHA 5HXDA 3FEDA 3K9TA 4U9ZA 2WSAA 4FD6A 5KTDA 2CXAA 4LQGA 1PU9A 2PSWA 2B4BA 3IFEA 2PJAA 3IGRA 2H5MA 1M4DA 3GB0A 1Y0YA 3FYNA 2Z3LA 2C27A 4TNUA 2PRQA 2Q04A 2K5TA 3R9FA 3CZXA 4NJRA 4X8IA 3CDXA 5LYDA 4RI1A 2F8HA 4XNHC 5GCNA 3TCVA 3ISXA 3WC6A 1RXTA 2FIWA 3N5FA 4K3NA 3WABA 4MBUA 2O4HA 2V8DA 5G21A 3DR8A 5J8CA 4Q7AA 3SJXA 1RTQA 5C82A 4CYOA 4KOVA 2FT0A 4JYWA 4ZX9A 1QMUA 1H8LA 4KLWA 4NF1A 4XPKA 4CGLA 1F2PA 2AFXA 3FVLA 3S6KA 2Z11A 2OZHA 3SJGA 2PJ6A 1B6BA 3PB8X 4P44A 5G20A 1ARLA 3GUXA 4PPZA 3V7ZA 3WC5A 5HH1A 2Z3OA 4YU9A 2HV2A 4YWYA 4GXHA 3PZJA 1S3ZA 3LWUA 4L8AA 2OB0A 2R8VA 1CPSA 3QAHA 4TWEA 4EVYA 2BUEA 3S9NA 1YW4A 2DEAA 1TF9A 4OLLA 5EBVA 3LACA 1ELMP 2JBKA 4OC3A 3FRMA 4MRIA 2ZEDA 4HPSA 2JBJA 1L0CA 4UF4A 1LAMA 2PIZA 1Q2DA 3KQZA 4DNCA 4JXRA 1KUYA 3W91A 2VI7A 3UY5A 3ZZIA 1LOKA 3FIXA 2A4NA 2XEIA 2YGWA 3R9GA 2IQ6A 5ELYA 1LRZA 2PJ7A 5DWMA 1F2OA 4AG9A 2D4PA 3NA6A 1AMPA 2OH1A 3QAYA 1R57A 4FD5A 3B3TA 3I3GA 1LAPA 5K8NA 5THWA 1I21A 2NYQA 5BWAB 2ATRA 2GLJA 1IYKA 4M3SA 3A9LA 4Q38A 4B12A 3F0AA 1QSNA 2PRBA 2VXKA 4UIBA 4UIAA 3CT9A 4MFKA 4P4JA 2OZGA 4NCZA 3B3WA 3TFYA 1VGYA 2FS5A 2GE3A 3NE7A 3PBEA 1MK4A 3KI9A 4MHYA 2ZENA 3MGDA 2P6FA 2WZNA 5DWNA 1Y7EA 2G3AA 4OC0A 4WJBA 3RYOA 3W6XA 2FSRA 3DDDA 5KTAA 4M85A 1V0CA 3TOAA 4CS0B 4ZI6A 1CJWA 4B11A 2FIAA 3VWDA 4IF5A 3R9EA 4XPDC 3VWEA 1K4JA 2O53A 2B4DA 3RNZA 4NGRA 5HVHA 1CP7A 3BXMA 3FJUA 1KUXA 2X7BA 5I4MA 2AFMA 2EK9A 1BO4A 5IB0A 1IIDA 5K8MA 3P2FA 2KCWA 5D8NA 4C68A 2J8NA 2ZEHA 2O28A 1YVOA 4MFQA 1DTDA 4MFLA 2POKA 1XJOA 4KVOE 4W9YA 3SXNA 2B4DB 4L89A 2Z3KA 2Q4VA 1GYTA 4JJXA 3KQXA 4M6IA 4F0XA 5J8FA 3BI1A 4CGMA 2HB6A 3S9MA 1XF8A 5AG6A 4AVBA 1ELLP 2PJ0A 3BLNA 1Z8WA 2Q7SA 1Z8TA 2ZXVA 2PJ9A 4KVME 4NGPA 4OADA 1JQGA 5F46A 3EC4A 1PYTB 4EWTA 1QSTA 2JEWA 1I12A 2Q51A 2DF5A 4AG7A 2Z3NA 2C6CA 3RO0A 2R7HA 3JRUA 1YLOA 1TKFA 3D7DA 4H6ZA 3FXTA 3IEHA 4OMEA 4UFXA 5A28A 1FY7A 1R3NA 3D4UA 2I3CA 5IV0A 2Q0YA 4ZGYB 2ZEPA 3CXSA 8CPAA 1Y9KA 4F6AA 1Z2LA 1N71A 2C6GA 4K30A 1NE9A 5JQ4A 3SI2A 5EC4A 1KZFA 4YRHA 1OZPA 4QBJA 2PJ1A 3H8GA 4GS4A 3TX8A 3T9YA 4KOYA 2EBJA 4CPAA 2EWBA 3IWEA 4C7HA 4UA3A 2OOTA 4P4IA 2I79A 4XNHB 3D7HA 1PUAA 2GFQA 3KZWA 4MXUA 5E96A 2GIVA 2BSWA 1YR0A 3PP9A 1I1DA 1WWZA 4UEZA 3V38A 5JH9A 3TT2A 3HUVA 3EY5A 3BI0A 3RBUA 2WUUA 4UCPA 4P45A 2RB7A 3DNSA 4QUSA 3T8WA 4CAVA 3DSBA 2DXQA 1CM0A 3JUWA 2QECA 2ANPA 2F7VA 2VEZA 4KS9A 2Z3PA 4P4DA 4C2YA 3S6GA 2PE3A 1AYEA 1Y0RA 3D66A 1YQEA 4E8OA 4OC4A 4B5OA 4KOXA 2QVPA 3FNCA 1TF8A 3B35A 4OC1A 4PSXA 3F8KA 3E0KA 3WR7A 4M6HA 4MJ8A 4II9A 3PB6X 2HUZA 3H8EA 4FWUA 1XRYA 3FH4A 4MI4A 4NGTA 2QIRA 4X2TA 4DJLA 4HNYB 4XPLA 2PJ4A 3IWGA 3TO6A 2WPXA 3RAMA 2AE6A 4P6YA 3DLJA 1CPXA 1QSOA 4NGSA 4F8ZA 1XOVA 5ISVA 4JXQA 3CPXA 2IMOA 4A30A 1ARMA 3D7GA 2AFSA 2PVVA 3VH9A 1QSRA 1FNOA 2CNSA 2RFHA 3LMSA 3SJEA 1Z8XA 4KVXA 4LX9A 4A33A 4R7MA 2VQYA 7CPAA 4CRYB 2EVNA 4BINA 4HNWB 1IOFA 3S9LA 4MFZA 4JLYA 1XIXA 4MHDA 4F9VA 4UCNA 4PQAA 1IY7A 2AJ6A 4U5YA 2OZUA 4KLVA 4WWVA 4R8FA 4ONWA 2JDCA 5G1ZA 4P4EA 3FEEA 2RC4A 4A31A 2VBQA 1YMEA 4B5PA 4HKFA 1VIXA 3SJFA 4CGPA 4F0YA 1HEEA 4NEXA 5J1QA 2YNEA 4KSFA 4Q36A 3DR6A 4P10A 2CIJA 4MHNA 3QB8A 5LRGA 4A2ZA 2G9DA 4PXEA 3G8WA 3H4QA 2PVWA 1HDQA 2ZEEA 3KHZA 4R6TA 4AVCA 4ZX8A 2AFOA 4AXVA 4IK2A 5AG5A 4UFWA 4QB9A 2FVGA 1EE3P 2G3TA 3FF3A 3KGQA 3KL9A 1BPMA 2DPSA 3PBBA 4KSIA 4MHZA 5F49A 3PB7X 4KOSA 1ZLIA 2NMTA 2XEJA 5IB9A 1IICA 4NGNA 3H8FA 1Y9WA 1WK4A 4NGMA 2J8RA 2QJ8A 1X10A 4KOUA 1Q2CA 3GIUA 3SHPA 3F5BA 1ON0A 4YFJA 2BL1A 4MMOA 5G22A 4IHMA 2ZW5A 4BD9A 4KUBA 2F5IA 4FUUA 4RS2A 5C88A 2B5GB 3OWCA 4UCMA 3S6HA 4UFVA 1CP6A 5JM6A 2AFWA 4E0AA 2PIYA 1YVKA
chains in the Genus database with same CATH topology
2QYVA 2HC9A 1Q7LA 3MRUA 2ZOGA 3NH5A 4OIDA 2ZEFA 4B6ZA 3DGVA 2IJZA 1HDUA 4OP4A 2GU2A 2AFUA 2PJBA 1Z8LA 4OC5A 4A94A 3RZAA 5DS0A 4GM5A 1YW6A 4UEEA 3D67A 1DE4C 3KR5A 4EMEA 1TXRA 2EK8A 4ZY1A 5HVGA 5F09A 2C6PA 2BO9A 1BLLE 4PXBA 3WT4A 5K8PA 5JGFA 1QQ9A 1IGBA 1UWYA 5CBMA 4UEFA 1TKJA 4ZY2A 3ISZA 3TC8A 4PXDA 1CX8A 1BPNA 2WYRA 5HVFA 4DYOA 1LFWA 4PXCA 1LANA 2ZEGA 2ZEOA 3PFEA 4NFRA 4OC2A 4JZ0A 3B3SA 1ZG7A 2BOAA 4X3RA 1R43A 3SI0A 1ZLHA 2V8HA 3GLJA 5LYIA 3FECA 1LCPA 4OIWA 4OC0A 4MCQA 3MN8A 4MCRA 2ZELA 3PRTA 5LRJA 6CPAA 3FX6A 3PB4X 3VARA 3B3VA 1CG2A 2J9AA 1YSJA 2GREA 3B2YA 1XBUA 4H2KA 3IC1A 4A37A 1KWMA 4MHPA 4A39A 2ABZA 2CF4A 3PB9X 3VATA 2XEFA 4P4BA 3KASA 3WC7A 2V77A 3L2NA 3QNVA 2ZEMA 2PJ5A 4NJQA 2PJ2A 3KHXA 1ZG9A 1F57A 3PFOA 3CPAA 3IIBA 4ZYQA 2PCUA 2PJCA 5LRKA 3D7FA 2C1CA 4DUKA 2GLFA 2OR4A 3BHXA 1TKHA 4IAVA 1PCAA 2CTBA 4MCSA 1M4LA 5D29A 5CPAA 2PJ3A 3NH4A 4MCPA 4R76A 1FT7A 2BCOA 5LYFA 3IWWA 3HLPA 3IJ3A 2ZOFA 4RUHA 1OBRA 3NFZA 5K8OA 2Q4ZA 2V8GA 3KR4A 4Z65A 2PJ8A 1ZG8A 1VHEA 4NGQA 4EFDA 3NH8A 2AFZA 1Z5RA 3SI1A 4ZY0A 3D68A 3IO1A 4O23A 1BAVA 3PEIA 2V8VA 4A38A 4G1PA 1XFOA 3I1UA 3B7IA 1CBXA 3B3CA 1XMBA 4P4FA 3K2KA 1VHOA 4F9UA 2NSMA 1NSAA 4FBEA 3FMCA 4FAIA 2XEGA 2VL1A 2Q43A 2CTCA 4OKOA 5LYLA 5HXDA 3FEDA 3K9TA 4LQGA 3IFEA 2PJAA 3GB0A 1Y0YA 4TNUA 2PRQA 4NJRA 4X8IA 3CDXA 5LYDA 2F8HA 3ISXA 3WC6A 3N5FA 4K3NA 3WABA 2O4HA 2V8DA 4Q7AA 3SJXA 1RTQA 4JYWA 4ZX9A 1QMUA 1H8LA 1F2PA 2AFXA 3FVLA 3SJGA 2PJ6A 3PB8X 4P44A 1ARLA 3GUXA 4PPZA 3V7ZA 3WC5A 4YU9A 4YWYA 3LWUA 1CPSA 4TWEA 3S9NA 1YW4A 2DEAA 1TF9A 1ELMP 2JBKA 4OC3A 4MRIA 2ZEDA 2JBJA 4UF4A 1LAMA 2PIZA 3KQZA 1LOKA 2XEIA 2IQ6A 5ELYA 2PJ7A 1F2OA 3NA6A 1AMPA 3B3TA 1LAPA 5K8NA 5THWA 2NYQA 2GLJA 4UIBA 4UIAA 3CT9A 4P4JA 3B3WA 1VGYA 3PBEA 3KI9A 4MHYA 2ZENA 2WZNA 1Y7EA 4WJBA 4ZI6A 2O53A 4NGRA 5HVHA 1CP7A 3BXMA 3FJUA 5I4MA 2AFMA 2EK9A 5K8MA 5D8NA 2ZEHA 1DTDA 2POKA 1XJOA 4W9YA 1GYTA 3KQXA 3BI1A 2HB6A 3S9MA 1ELLP 2PJ0A 2PJ9A 4NGPA 1JQGA 1PYTB 4EWTA 2JEWA 2Q51A 2C6CA 3JRUA 1YLOA 1TKFA 4OMEA 3D7DA 3IEHA 3D4UA 1R3NA 2I3CA 2ZEPA 8CPAA 1Z2LA 2C6GA 3SI2A 2PJ1A 3H8GA 3TX8A 4CPAA 2EWBA 2OOTA 4P4IA 3D7HA 3KZWA 4MXUA 5JH9A 4UEZA 3V38A 3HUVA 3BI0A 3RBUA 4P45A 2RB7A 3T8WA 4P4DA 2ANPA 2F7VA 2PE3A 1Y0RA 1AYEA 3D66A 4OC4A 2QVPA 1TF8A 3B35A 4OC1A 3PB6X 3H8EA 4FWUA 1XRYA 3FH4A 4NGTA 4DJLA 4X2TA 2PJ4A 3RAMA 4P6YA 3DLJA 1CPXA 4NGSA 4F8ZA 3CPXA 2IMOA 1ARMA 3D7GA 2AFSA 2PVVA 3VH9A 1FNOA 2RFHA 3LMSA 3SJEA 4R7MA 7CPAA 3S9LA 4F9VA 4PQAA 1IY7A 4WWVA 4R8FA 4ONWA 4P4EA 3FEEA 1YMEA 1VIXA 3SJFA 1HEEA 5J1QA 5LRGA 4P10A 2CIJA 4MHNA 2G9DA 4PXEA 2PVWA 1HDQA 4R6TA 2ZEEA 3KHZA 4ZX8A 2AFOA 4AXVA 4IK2A 2FVGA 1EE3P 3FF3A 3KGQA 3KL9A 1BPMA 4KSIA 3PBBA 4MHZA 3PB7X 1ZLIA 2XEJA 5IB9A 4NGNA 3H8FA 4NGMA 2QJ8A 4MMOA 4IHMA 4BD9A 4FUUA 1CP6A 5JM6A 2AFWA 2PIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYV A;  2HC9 A;  1Q7L A;  3MRU A;  2ZOG A;  3NH5 A;  4OID A;  2ZEF A;  4B6Z A;  3DGV A;  2IJZ A;  1HDU A;  4OP4 A;  2GU2 A;  2AFU A;  2PJB A;  1Z8L A;  4OC5 A;  4A94 A;  3RZA A;  5DS0 A;  4GM5 A;  1YW6 A;  4UEE A;  3D67 A;  1DE4 C;  3KR5 A;  4EME A;  1TXR A;  2EK8 A;  4ZY1 A;  5HVG A;  5F09 A;  2C6P A;  2BO9 A;  1BLL E;  4PXB A;  3WT4 A;  5K8P A;  5JGF A;  1QQ9 A;  1IGB A;  1UWY A;  5CBM A;  4UEF A;  1TKJ A;  4ZY2 A;  3ISZ A;  3TC8 A;  4PXD A;  1CX8 A;  1BPN A;  2WYR A;  5HVF A;  4DYO A;  1LFW A;  4PXC A;  1LAN A;  2ZEG A;  2ZEO A;  3PFE A;  4NFR A;  4OC2 A;  4JZ0 A;  3B3S A;  1ZG7 A;  2BOA A;  4X3R A;  1R43 A;  3SI0 A;  1ZLH A;  2V8H A;  3GLJ A;  5LYI A;  3FEC A;  1LCP A;  4OIW A;  4OC0 A;  4MCQ A;  3MN8 A;  4MCR A;  2ZEL A;  3PRT A;  5LRJ A;  6CPA A;  3FX6 A;  3PB4 X;  3VAR A;  3B3V A;  1CG2 A;  2J9A A;  1YSJ A;  2GRE A;  3B2Y A;  1XBU A;  4H2K A;  3IC1 A;  4A37 A;  1KWM A;  4MHP A;  4A39 A;  2ABZ A;  2CF4 A;  3PB9 X;  3VAT A;  2XEF A;  4P4B A;  3KAS A;  3WC7 A;  2V77 A;  3L2N A;  3QNV A;  2ZEM A;  2PJ5 A;  4NJQ A;  2PJ2 A;  3KHX A;  1ZG9 A;  1F57 A;  3PFO A;  3CPA A;  3IIB A;  4ZYQ A;  2PCU A;  2PJC A;  5LRK A;  3D7F A;  2C1C A;  4DUK A;  2GLF A;  2OR4 A;  3BHX A;  1TKH A;  4IAV A;  1PCA A;  2CTB A;  4MCS A;  1M4L A;  5D29 A;  5CPA A;  2PJ3 A;  3NH4 A;  4MCP A;  4R76 A;  1FT7 A;  2BCO A;  5LYF A;  3IWW A;  3HLP A;  3IJ3 A;  2ZOF A;  4RUH A;  1OBR A;  3NFZ A;  5K8O A;  2Q4Z A;  2V8G A;  3KR4 A;  4Z65 A;  2PJ8 A;  1ZG8 A;  1VHE A;  4NGQ A;  4EFD A;  3NH8 A;  2AFZ A;  1Z5R A;  3SI1 A;  4ZY0 A;  3D68 A;  3IO1 A;  4O23 A;  1BAV A;  3PEI A;  2V8V A;  4A38 A;  4G1P A;  1XFO A;  3I1U A;  3B7I A;  1CBX A;  3B3C A;  1XMB A;  4P4F A;  3K2K A;  1VHO A;  4F9U A;  2NSM A;  1NSA A;  4FBE A;  3FMC A;  4FAI A;  2XEG A;  2VL1 A;  2Q43 A;  2CTC A;  4OKO A;  5LYL A;  5HXD A;  3FED A;  3K9T A;  4LQG A;  3IFE A;  2PJA A;  3GB0 A;  1Y0Y A;  4TNU A;  2PRQ A;  4NJR A;  4X8I A;  3CDX A;  5LYD A;  2F8H A;  3ISX A;  3WC6 A;  3N5F A;  4K3N A;  3WAB A;  2O4H A;  2V8D A;  4Q7A A;  3SJX A;  1RTQ A;  4JYW A;  4ZX9 A;  1QMU A;  1H8L A;  1F2P A;  2AFX A;  3FVL A;  3SJG A;  2PJ6 A;  3PB8 X;  4P44 A;  1ARL A;  3GUX A;  4PPZ A;  3V7Z A;  3WC5 A;  4YU9 A;  4YWY A;  3LWU A;  1CPS A;  4TWE A;  3S9N A;  1YW4 A;  2DEA A;  1TF9 A;  1ELM P;  2JBK A;  4OC3 A;  4MRI A;  2ZED A;  2JBJ A;  4UF4 A;  1LAM A;  2PIZ A;  3KQZ A;  1LOK A;  2XEI A;  2IQ6 A;  5ELY A;  2PJ7 A;  1F2O A;  3NA6 A;  1AMP A;  3B3T A;  1LAP A;  5K8N A;  5THW A;  2NYQ A;  2GLJ A;  4UIB A;  4UIA A;  3CT9 A;  4P4J A;  3B3W A;  1VGY A;  3PBE A;  3KI9 A;  4MHY A;  2ZEN A;  2WZN A;  1Y7E A;  4WJB A;  4ZI6 A;  2O53 A;  4NGR A;  5HVH A;  1CP7 A;  3BXM A;  3FJU A;  5I4M A;  2AFM A;  2EK9 A;  5K8M A;  5D8N A;  2ZEH A;  1DTD A;  2POK A;  1XJO A;  4W9Y A;  1GYT A;  3KQX A;  3BI1 A;  2HB6 A;  3S9M A;  1ELL P;  2PJ0 A;  2PJ9 A;  4NGP A;  1JQG A;  1PYT B;  4EWT A;  2JEW A;  2Q51 A;  2C6C A;  3JRU A;  1YLO A;  1TKF A;  4OME A;  3D7D A;  3IEH A;  3D4U A;  1R3N A;  2I3C A;  2ZEP A;  8CPA A;  1Z2L A;  2C6G A;  3SI2 A;  2PJ1 A;  3H8G A;  3TX8 A;  4CPA A;  2EWB A;  2OOT A;  4P4I A;  3D7H A;  3KZW A;  4MXU A;  5JH9 A;  4UEZ A;  3V38 A;  3HUV A;  3BI0 A;  3RBU A;  4P45 A;  2RB7 A;  3T8W A;  4P4D A;  2ANP A;  2F7V A;  2PE3 A;  1Y0R A;  1AYE A;  3D66 A;  4OC4 A;  2QVP A;  1TF8 A;  3B35 A;  4OC1 A;  3PB6 X;  3H8E A;  4FWU A;  1XRY A;  3FH4 A;  4NGT A;  4DJL A;  4X2T A;  2PJ4 A;  3RAM A;  4P6Y A;  3DLJ A;  1CPX A;  4NGS A;  4F8Z A;  3CPX A;  2IMO A;  1ARM A;  3D7G A;  2AFS A;  2PVV A;  3VH9 A;  1FNO A;  2RFH A;  3LMS A;  3SJE A;  4R7M A;  7CPA A;  3S9L A;  4F9V A;  4PQA A;  1IY7 A;  4WWV A;  4R8F A;  4ONW A;  4P4E A;  3FEE A;  1YME A;  1VIX A;  3SJF A;  1HEE A;  5J1Q A;  5LRG A;  4P10 A;  2CIJ A;  4MHN A;  2G9D A;  4PXE A;  2PVW A;  1HDQ A;  4R6T A;  2ZEE A;  3KHZ A;  4ZX8 A;  2AFO A;  4AXV A;  4IK2 A;  2FVG A;  1EE3 P;  3FF3 A;  3KGQ A;  3KL9 A;  1BPM A;  4KSI A;  3PBB A;  4MHZ A;  3PB7 X;  1ZLI A;  2XEJ A;  5IB9 A;  4NGN A;  3H8F A;  4NGM A;  2QJ8 A;  4MMO A;  4IHM A;  4BD9 A;  4FUU A;  1CP6 A;  5JM6 A;  2AFW A;  2PIY A; 
#chains in the Genus database with same CATH topology
 1KUV A;  1M4I A;  2PR8 A;  2HC9 A;  2QYV A;  1Q7L A;  1XE4 A;  3MRU A;  2ODF A;  1Z9U A;  1YK3 A;  5AG4 A;  3D8P A;  4JWP A;  5A27 A;  2ZOG A;  3NH5 A;  2P6E A;  1YLE A;  4OID A;  4C2X A;  2QML A;  3CXP A;  2ZEF A;  4B6Z A;  3DGV A;  2IJZ A;  1HDU A;  4OP4 A;  2GU2 A;  2WPW A;  2AFU A;  2PJB A;  3IU2 A;  2ZW4 A;  3EO4 A;  3P2H A;  4A32 A;  1Z8L A;  2R98 A;  4OC5 A;  4UWI A;  4A94 A;  1Z4E A;  4B10 A;  3D2M A;  5F48 A;  3RZA A;  5I0C A;  1QSM A;  5DS0 A;  4GM5 A;  2EUI A;  1YW6 A;  1JWQ A;  1BOB A;  4UEE A;  4ONU A;  3D67 A;  1DE4 C;  1P4N A;  2JDD A;  3KR5 A;  2PQ8 A;  5AG7 A;  4C2Z A;  1TXR A;  4CAE A;  4EME A;  2EK8 A;  4ZY1 A;  5HVG A;  2G0B A;  5F09 A;  2C6P A;  2BO9 A;  1BLL E;  4KOW A;  2CNT A;  4PXB A;  3R1K A;  3WT4 A;  5JGF A;  5K8P A;  2Y0M A;  1QQ9 A;  4LUA A;  2GAN A;  1IGB A;  4BMH A;  4CGN A;  1UWY A;  1TIQ A;  5CBM A;  4UEF A;  1TKJ A;  4ZY2 A;  2J8M A;  3ISZ A;  3TC8 A;  4PXD A;  1CX8 A;  2B3V A;  4PSW A;  3ZJ0 A;  2PDO A;  1S7K A;  1BPN A;  2WYR A;  3TE4 A;  4AVA A;  5HVF A;  1MJA A;  5F47 A;  1M44 A;  4M6G A;  1SQH A;  1X12 A;  4DYO A;  4MFP A;  1LFW A;  4PXC A;  1LAN A;  2B5G A;  1Z4R A;  2ZEG A;  2ZEO A;  3PFE A;  3IU1 A;  4NFR A;  4OC2 A;  1MJB A;  3JVN A;  3EXN A;  3B3S A;  4KOR A;  1YGH A;  4JZ0 A;  1ZG7 A;  2BOA A;  4X3R A;  4B13 A;  4CYP A;  1M4G A;  4MY0 A;  1R43 A;  4ORF A;  3SI0 A;  4AB7 A;  5JPH A;  2JLM A;  1ZLH A;  2V8H A;  3GLJ A;  5LYI A;  3FEC A;  3W6S A;  4C7I A;  4X5K A;  1LCP A;  4OIW A;  1S7L A;  2ZW7 A;  2VZZ A;  3CXQ A;  3GY9 A;  4MCQ A;  2PC1 A;  3B8G A;  2HQY A;  3I9S A;  2ZEL A;  3MN8 A;  1IU8 A;  3PRT A;  1IB1 E;  4MCR A;  1S5K A;  5LRJ A;  6CPA A;  4R3L A;  5H86 A;  2Z0Z A;  3FX6 A;  3PB4 X;  4H89 A;  1J4J A;  4H6U A;  4XPD B;  4I49 A;  3VAR A;  4PK2 A;  3B3V A;  1ZO0 A;  1CG2 A;  2D4O A;  2J9A A;  3EFA A;  1AUG A;  1YSJ A;  2GRE A;  2Q4Y A;  3BJ8 A;  2FXF A;  5AGE A;  3B2Y A;  3GKR A;  3KKW A;  4U9Y A;  1XBU A;  3SXO A;  4H2K A;  3IC1 A;  4PV6 A;  4A37 A;  1KWM A;  4MHP A;  3BJ7 A;  4A39 A;  2ABZ A;  2CF4 A;  3PB9 X;  3VAT A;  4LQ6 A;  1B87 A;  2FE7 A;  1MJ9 A;  2YNC A;  2XEF A;  1RO5 A;  3C26 A;  4R9M A;  4P4B A;  3KAS A;  3WC7 A;  3G3S A;  2V77 A;  3L2N A;  1A2Z A;  3QNV A;  4CGO A;  2ZEM A;  2PJ5 A;  2B3U A;  4NJQ A;  2P0W A;  2ZPA A;  2JEV A;  2PJ2 A;  3KHX A;  4BBH A;  5KTC A;  1Q2Y A;  1ZG9 A;  1F57 A;  3GYA A;  4KOT A;  4UWJ A;  3PFO A;  3CPA A;  3IIB A;  1S7N A;  2PCU A;  2PJC A;  4IUS A;  3NE8 A;  4ZYQ A;  2I00 A;  5LRK A;  2BEI A;  3D7F A;  2C1C A;  3N7Z A;  4DUK A;  2B58 A;  2REF A;  2GLF A;  2CNM A;  2Q44 A;  2OR4 A;  3BHX A;  5EMI A;  3S6F A;  4HNX B;  1TKH A;  4IAV A;  1PCA A;  2YND A;  5FVJ A;  4B5P B;  1VHS A;  1Y7R A;  2CTB A;  4MCS A;  1M4L A;  5D29 A;  5CPA A;  2PJ3 A;  4E2A A;  3NH4 A;  4MCP A;  4YGO A;  4R76 A;  5CNP A;  1FT7 A;  4Y49 C;  3TO7 A;  2BCO A;  4CAX A;  5LYF A;  3IWW A;  3HLP A;  4A95 A;  4Y49 B;  4KUA A;  3IJ3 A;  2FL4 A;  2ZOF A;  4RUH A;  1OBR A;  3LD2 A;  3NFZ A;  5K8O A;  2Z10 A;  2Q4Z A;  2V8G A;  1IYL A;  4OAE A;  3KR4 A;  1U6M A;  4Z65 A;  3K9U A;  2PJ8 A;  1ZG8 A;  3D3S A;  3T90 A;  1IOI A;  1VHE A;  4NGQ A;  4EFD A;  2PR1 A;  3NH8 A;  2AFZ A;  3TO9 A;  1Z5R A;  1GHE A;  4R3K A;  3SI1 A;  4ZY0 A;  4QC6 A;  3D68 A;  1P0H A;  1VKC A;  1XEB A;  4FD4 A;  4R57 A;  3R95 A;  3LOD A;  2YNC C;  3IO1 A;  4O23 A;  4CRZ B;  4CYQ A;  3R96 A;  2ZW6 A;  4NXY A;  1BAV A;  3PEI A;  1NSL A;  4CAF A;  3JTK A;  4KZT A;  4J3G A;  1YRE A;  2Q7B A;  4B14 A;  4JD6 A;  4CYN A;  3TTH A;  2OU2 A;  4PK3 A;  2CY2 A;  2V8V A;  4A38 A;  4G1P A;  1XFO A;  1M1D A;  2R1I A;  4FD7 A;  4CAW A;  3I1U A;  5H84 A;  3TOB A;  3FBU A;  2Z3M A;  3B7I A;  1CBX A;  2P6G A;  1S60 A;  3B3C A;  1XMB A;  2VZY A;  2IL4 A;  2DPT A;  4P4F A;  5IX3 A;  4NSQ A;  4R87 A;  3FB3 A;  1S7F A;  1NMT A;  2ARH A;  3D2P A;  3K2K A;  4ZBG A;  1VHO A;  4MY3 A;  4F9U A;  2NSM A;  3V8I A;  5HMN A;  3PGP A;  1NSA A;  4MFJ A;  2EO8 A;  2FCK A;  4KSA A;  4FBE A;  1YX0 A;  4RN7 A;  3FMC A;  4FAI A;  2XEG A;  3H5Z A;  2VL1 A;  1XMT A;  4UBR A;  2Q43 A;  2CTC A;  4OKO A;  4QVT A;  2REE A;  5LYL A;  1UFH A;  5HXD A;  3FED A;  3K9T A;  4U9Z A;  2WSA A;  4FD6 A;  5KTD A;  2CXA A;  4LQG A;  1PU9 A;  2PSW A;  2B4B A;  3IFE A;  2PJA A;  3IGR A;  2H5M A;  1M4D A;  3GB0 A;  1Y0Y A;  3FYN A;  2Z3L A;  2C27 A;  4TNU A;  2PRQ A;  2Q04 A;  2K5T A;  3R9F A;  3CZX A;  4NJR A;  4X8I A;  3CDX A;  5LYD A;  4RI1 A;  2F8H A;  4XNH C;  5GCN A;  3TCV A;  3ISX A;  3WC6 A;  1RXT A;  2FIW A;  3N5F A;  4K3N A;  3WAB A;  4MBU A;  2O4H A;  2V8D A;  5G21 A;  3DR8 A;  5J8C A;  4Q7A A;  3SJX A;  1RTQ A;  5C82 A;  4CYO A;  4KOV A;  2FT0 A;  4JYW A;  4ZX9 A;  1QMU A;  1H8L A;  4KLW A;  4NF1 A;  4XPK A;  4CGL A;  1F2P A;  2AFX A;  3FVL A;  3S6K A;  2Z11 A;  2OZH A;  3SJG A;  2PJ6 A;  1B6B A;  3PB8 X;  4P44 A;  5G20 A;  1ARL A;  3GUX A;  4PPZ A;  3V7Z A;  3WC5 A;  5HH1 A;  2Z3O A;  4YU9 A;  2HV2 A;  4YWY A;  4GXH A;  3PZJ A;  1S3Z A;  3LWU A;  4L8A A;  2OB0 A;  2R8V A;  1CPS A;  3QAH A;  4TWE A;  4EVY A;  2BUE A;  3S9N A;  1YW4 A;  2DEA A;  1TF9 A;  4OLL A;  5EBV A;  3LAC A;  1ELM P;  2JBK A;  4OC3 A;  3FRM A;  4MRI A;  2ZED A;  4HPS A;  2JBJ A;  1L0C A;  4UF4 A;  1LAM A;  2PIZ A;  1Q2D A;  3KQZ A;  4DNC A;  4JXR A;  1KUY A;  3W91 A;  2VI7 A;  3UY5 A;  3ZZI A;  1LOK A;  3FIX A;  2A4N A;  2XEI A;  2YGW A;  3R9G A;  2IQ6 A;  5ELY A;  1LRZ A;  2PJ7 A;  5DWM A;  1F2O A;  4AG9 A;  2D4P A;  3NA6 A;  1AMP A;  2OH1 A;  3QAY A;  1R57 A;  4FD5 A;  3B3T A;  3I3G A;  1LAP A;  5K8N A;  5THW A;  1I21 A;  2NYQ A;  5BWA B;  2ATR A;  2GLJ A;  1IYK A;  4M3S A;  3A9L A;  4Q38 A;  4B12 A;  3F0A A;  1QSN A;  2PRB A;  2VXK A;  4UIB A;  4UIA A;  3CT9 A;  4MFK A;  4P4J A;  2OZG A;  4NCZ A;  3B3W A;  3TFY A;  1VGY A;  2FS5 A;  2GE3 A;  3NE7 A;  3PBE A;  1MK4 A;  3KI9 A;  4MHY A;  2ZEN A;  3MGD A;  2P6F A;  2WZN A;  5DWN A;  1Y7E A;  2G3A A;  4OC0 A;  4WJB A;  3RYO A;  3W6X A;  2FSR A;  3DDD A;  5KTA A;  4M85 A;  1V0C A;  3TOA A;  4CS0 B;  4ZI6 A;  1CJW A;  4B11 A;  2FIA A;  3VWD A;  4IF5 A;  3R9E A;  4XPD C;  3VWE A;  1K4J A;  2O53 A;  2B4D A;  3RNZ A;  4NGR A;  5HVH A;  1CP7 A;  3BXM A;  3FJU A;  1KUX A;  2X7B A;  5I4M A;  2AFM A;  2EK9 A;  1BO4 A;  5IB0 A;  1IID A;  5K8M A;  3P2F A;  2KCW A;  5D8N A;  4C68 A;  2J8N A;  2ZEH A;  2O28 A;  1YVO A;  4MFQ A;  1DTD A;  4MFL A;  2POK A;  1XJO A;  4KVO E;  4W9Y A;  3SXN A;  2B4D B;  4L89 A;  2Z3K A;  2Q4V A;  1GYT A;  4JJX A;  3KQX A;  4M6I A;  4F0X A;  5J8F A;  3BI1 A;  4CGM A;  2HB6 A;  3S9M A;  1XF8 A;  5AG6 A;  4AVB A;  1ELL P;  2PJ0 A;  3BLN A;  1Z8W A;  2Q7S A;  1Z8T A;  2ZXV A;  2PJ9 A;  4KVM E;  4NGP A;  4OAD A;  1JQG A;  5F46 A;  3EC4 A;  1PYT B;  4EWT A;  1QST A;  2JEW A;  1I12 A;  2Q51 A;  2DF5 A;  4AG7 A;  2Z3N A;  2C6C A;  3RO0 A;  2R7H A;  3JRU A;  1YLO A;  1TKF A;  3D7D A;  4H6Z A;  3FXT A;  3IEH A;  4OME A;  4UFX A;  5A28 A;  1FY7 A;  1R3N A;  3D4U A;  2I3C A;  5IV0 A;  2Q0Y A;  4ZGY B;  2ZEP A;  3CXS A;  8CPA A;  1Y9K A;  4F6A A;  1Z2L A;  1N71 A;  2C6G A;  4K30 A;  1NE9 A;  5JQ4 A;  3SI2 A;  5EC4 A;  1KZF A;  4YRH A;  1OZP A;  4QBJ A;  2PJ1 A;  3H8G A;  4GS4 A;  3TX8 A;  3T9Y A;  4KOY A;  2EBJ A;  4CPA A;  2EWB A;  3IWE A;  4C7H A;  4UA3 A;  2OOT A;  4P4I A;  2I79 A;  4XNH B;  3D7H A;  1PUA A;  2GFQ A;  3KZW A;  4MXU A;  5E96 A;  2GIV A;  2BSW A;  1YR0 A;  3PP9 A;  1I1D A;  1WWZ A;  4UEZ A;  3V38 A;  5JH9 A;  3TT2 A;  3HUV A;  3EY5 A;  3BI0 A;  3RBU A;  2WUU A;  4UCP A;  4P45 A;  2RB7 A;  3DNS A;  4QUS A;  3T8W A;  4CAV A;  3DSB A;  2DXQ A;  1CM0 A;  3JUW A;  2QEC A;  2ANP A;  2F7V A;  2VEZ A;  4KS9 A;  2Z3P A;  4P4D A;  4C2Y A;  3S6G A;  2PE3 A;  1AYE A;  1Y0R A;  3D66 A;  1YQE A;  4E8O A;  4OC4 A;  4B5O A;  4KOX A;  2QVP A;  3FNC A;  1TF8 A;  3B35 A;  4OC1 A;  4PSX A;  3F8K A;  3E0K A;  3WR7 A;  4M6H A;  4MJ8 A;  4II9 A;  3PB6 X;  2HUZ A;  3H8E A;  4FWU A;  1XRY A;  3FH4 A;  4MI4 A;  4NGT A;  2QIR A;  4X2T A;  4DJL A;  4HNY B;  4XPL A;  2PJ4 A;  3IWG A;  3TO6 A;  2WPX A;  3RAM A;  2AE6 A;  4P6Y A;  3DLJ A;  1CPX A;  1QSO A;  4NGS A;  4F8Z A;  1XOV A;  5ISV A;  4JXQ A;  3CPX A;  2IMO A;  4A30 A;  1ARM A;  3D7G A;  2AFS A;  2PVV A;  3VH9 A;  1QSR A;  1FNO A;  2CNS A;  2RFH A;  3LMS A;  3SJE A;  1Z8X A;  4KVX A;  4LX9 A;  4A33 A;  4R7M A;  2VQY A;  7CPA A;  4CRY B;  2EVN A;  4BIN A;  4HNW B;  1IOF A;  3S9L A;  4MFZ A;  4JLY A;  1XIX A;  4MHD A;  4F9V A;  4UCN A;  4PQA A;  1IY7 A;  2AJ6 A;  4U5Y A;  2OZU A;  4KLV A;  4WWV A;  4R8F A;  4ONW A;  2JDC A;  5G1Z A;  4P4E A;  3FEE A;  2RC4 A;  4A31 A;  2VBQ A;  1YME A;  4B5P A;  4HKF A;  1VIX A;  3SJF A;  4CGP A;  4F0Y A;  1HEE A;  4NEX A;  5J1Q A;  2YNE A;  4KSF A;  4Q36 A;  3DR6 A;  4P10 A;  2CIJ A;  4MHN A;  3QB8 A;  5LRG A;  4A2Z A;  2G9D A;  4PXE A;  3G8W A;  3H4Q A;  2PVW A;  1HDQ A;  2ZEE A;  3KHZ A;  4R6T A;  4AVC A;  4ZX8 A;  2AFO A;  4AXV A;  4IK2 A;  5AG5 A;  4UFW A;  4QB9 A;  2FVG A;  1EE3 P;  2G3T A;  3FF3 A;  3KGQ A;  3KL9 A;  1BPM A;  2DPS A;  3PBB A;  4KSI A;  4MHZ A;  5F49 A;  3PB7 X;  4KOS A;  1ZLI A;  2NMT A;  2XEJ A;  5IB9 A;  1IIC A;  4NGN A;  3H8F A;  1Y9W A;  1WK4 A;  4NGM A;  2J8R A;  2QJ8 A;  1X10 A;  4KOU A;  1Q2C A;  3GIU A;  3SHP A;  3F5B A;  1ON0 A;  4YFJ A;  2BL1 A;  4MMO A;  5G22 A;  4IHM A;  2ZW5 A;  4BD9 A;  4KUB A;  2F5I A;  4FUU A;  4RS2 A;  5C88 A;  2B5G B;  3OWC A;  4UCM A;  3S6H A;  4UFV A;  1CP6 A;  5JM6 A;  2AFW A;  4E0A A;  2PIY A;  1YVK A; 
#chains in the Genus database with same CATH homology
 2QYV A;  2HC9 A;  1Q7L A;  3MRU A;  2ZOG A;  3NH5 A;  4OID A;  2ZEF A;  4B6Z A;  3DGV A;  2IJZ A;  1HDU A;  4OP4 A;  2GU2 A;  2AFU A;  2PJB A;  1Z8L A;  4OC5 A;  4A94 A;  3RZA A;  5DS0 A;  4GM5 A;  1YW6 A;  4UEE A;  3D67 A;  1DE4 C;  3KR5 A;  4EME A;  1TXR A;  2EK8 A;  4ZY1 A;  5HVG A;  5F09 A;  2C6P A;  2BO9 A;  1BLL E;  4PXB A;  3WT4 A;  5K8P A;  5JGF A;  1QQ9 A;  1IGB A;  1UWY A;  5CBM A;  4UEF A;  1TKJ A;  4ZY2 A;  3ISZ A;  3TC8 A;  4PXD A;  1CX8 A;  1BPN A;  2WYR A;  5HVF A;  4DYO A;  1LFW A;  4PXC A;  1LAN A;  2ZEG A;  2ZEO A;  3PFE A;  4NFR A;  4OC2 A;  4JZ0 A;  3B3S A;  1ZG7 A;  2BOA A;  4X3R A;  1R43 A;  3SI0 A;  1ZLH A;  2V8H A;  3GLJ A;  5LYI A;  3FEC A;  1LCP A;  4OIW A;  4OC0 A;  4MCQ A;  3MN8 A;  4MCR A;  2ZEL A;  3PRT A;  5LRJ A;  6CPA A;  3FX6 A;  3PB4 X;  3VAR A;  3B3V A;  1CG2 A;  2J9A A;  1YSJ A;  2GRE A;  3B2Y A;  1XBU A;  4H2K A;  3IC1 A;  4A37 A;  1KWM A;  4MHP A;  4A39 A;  2ABZ A;  2CF4 A;  3PB9 X;  3VAT A;  2XEF A;  4P4B A;  3KAS A;  3WC7 A;  2V77 A;  3L2N A;  3QNV A;  2ZEM A;  2PJ5 A;  4NJQ A;  2PJ2 A;  3KHX A;  1ZG9 A;  1F57 A;  3PFO A;  3CPA A;  3IIB A;  4ZYQ A;  2PCU A;  2PJC A;  5LRK A;  3D7F A;  2C1C A;  4DUK A;  2GLF A;  2OR4 A;  3BHX A;  1TKH A;  4IAV A;  1PCA A;  2CTB A;  4MCS A;  1M4L A;  5D29 A;  5CPA A;  2PJ3 A;  3NH4 A;  4MCP A;  4R76 A;  1FT7 A;  2BCO A;  5LYF A;  3IWW A;  3HLP A;  3IJ3 A;  2ZOF A;  4RUH A;  1OBR A;  3NFZ A;  5K8O A;  2Q4Z A;  2V8G A;  3KR4 A;  4Z65 A;  2PJ8 A;  1ZG8 A;  1VHE A;  4NGQ A;  4EFD A;  3NH8 A;  2AFZ A;  1Z5R A;  3SI1 A;  4ZY0 A;  3D68 A;  3IO1 A;  4O23 A;  1BAV A;  3PEI A;  2V8V A;  4A38 A;  4G1P A;  1XFO A;  3I1U A;  3B7I A;  1CBX A;  3B3C A;  1XMB A;  4P4F A;  3K2K A;  1VHO A;  4F9U A;  2NSM A;  1NSA A;  4FBE A;  3FMC A;  4FAI A;  2XEG A;  2VL1 A;  2Q43 A;  2CTC A;  4OKO A;  5LYL A;  5HXD A;  3FED A;  3K9T A;  4LQG A;  3IFE A;  2PJA A;  3GB0 A;  1Y0Y A;  4TNU A;  2PRQ A;  4NJR A;  4X8I A;  3CDX A;  5LYD A;  2F8H A;  3ISX A;  3WC6 A;  3N5F A;  4K3N A;  3WAB A;  2O4H A;  2V8D A;  4Q7A A;  3SJX A;  1RTQ A;  4JYW A;  4ZX9 A;  1QMU A;  1H8L A;  1F2P A;  2AFX A;  3FVL A;  3SJG A;  2PJ6 A;  3PB8 X;  4P44 A;  1ARL A;  3GUX A;  4PPZ A;  3V7Z A;  3WC5 A;  4YU9 A;  4YWY A;  3LWU A;  1CPS A;  4TWE A;  3S9N A;  1YW4 A;  2DEA A;  1TF9 A;  1ELM P;  2JBK A;  4OC3 A;  4MRI A;  2ZED A;  2JBJ A;  4UF4 A;  1LAM A;  2PIZ A;  3KQZ A;  1LOK A;  2XEI A;  2IQ6 A;  5ELY A;  2PJ7 A;  1F2O A;  3NA6 A;  1AMP A;  3B3T A;  1LAP A;  5K8N A;  5THW A;  2NYQ A;  2GLJ A;  4UIB A;  4UIA A;  3CT9 A;  4P4J A;  3B3W A;  1VGY A;  3PBE A;  3KI9 A;  4MHY A;  2ZEN A;  2WZN A;  1Y7E A;  4WJB A;  4ZI6 A;  2O53 A;  4NGR A;  5HVH A;  1CP7 A;  3BXM A;  3FJU A;  5I4M A;  2AFM A;  2EK9 A;  5K8M A;  5D8N A;  2ZEH A;  1DTD A;  2POK A;  1XJO A;  4W9Y A;  1GYT A;  3KQX A;  3BI1 A;  2HB6 A;  3S9M A;  1ELL P;  2PJ0 A;  2PJ9 A;  4NGP A;  1JQG A;  1PYT B;  4EWT A;  2JEW A;  2Q51 A;  2C6C A;  3JRU A;  1YLO A;  1TKF A;  4OME A;  3D7D A;  3IEH A;  3D4U A;  1R3N A;  2I3C A;  2ZEP A;  8CPA A;  1Z2L A;  2C6G A;  3SI2 A;  2PJ1 A;  3H8G A;  3TX8 A;  4CPA A;  2EWB A;  2OOT A;  4P4I A;  3D7H A;  3KZW A;  4MXU A;  5JH9 A;  4UEZ A;  3V38 A;  3HUV A;  3BI0 A;  3RBU A;  4P45 A;  2RB7 A;  3T8W A;  4P4D A;  2ANP A;  2F7V A;  2PE3 A;  1Y0R A;  1AYE A;  3D66 A;  4OC4 A;  2QVP A;  1TF8 A;  3B35 A;  4OC1 A;  3PB6 X;  3H8E A;  4FWU A;  1XRY A;  3FH4 A;  4NGT A;  4DJL A;  4X2T A;  2PJ4 A;  3RAM A;  4P6Y A;  3DLJ A;  1CPX A;  4NGS A;  4F8Z A;  3CPX A;  2IMO A;  1ARM A;  3D7G A;  2AFS A;  2PVV A;  3VH9 A;  1FNO A;  2RFH A;  3LMS A;  3SJE A;  4R7M A;  7CPA A;  3S9L A;  4F9V A;  4PQA A;  1IY7 A;  4WWV A;  4R8F A;  4ONW A;  4P4E A;  3FEE A;  1YME A;  1VIX A;  3SJF A;  1HEE A;  5J1Q A;  5LRG A;  4P10 A;  2CIJ A;  4MHN A;  2G9D A;  4PXE A;  2PVW A;  1HDQ A;  4R6T A;  2ZEE A;  3KHZ A;  4ZX8 A;  2AFO A;  4AXV A;  4IK2 A;  2FVG A;  1EE3 P;  3FF3 A;  3KGQ A;  3KL9 A;  1BPM A;  4KSI A;  3PBB A;  4MHZ A;  3PB7 X;  1ZLI A;  2XEJ A;  5IB9 A;  4NGN A;  3H8F A;  4NGM A;  2QJ8 A;  4MMO A;  4IHM A;  4BD9 A;  4FUU A;  1CP6 A;  5JM6 A;  2AFW A;  2PIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...