2G0BA

The structure of feem, an n-acyl amino acid synthase from uncultured soil microbes
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
188
Chain Sequence
GSMTPRKVARILVAPNERDAARRIVRTTYEAQGYAIDESFATFLEGPSATTFGLFNGEVLYGTISIINDGAQGLPMDSIYAVELAAWRGEGKKLAEVVQFAMDHTLYEAVASPFEAASLFTMVLTYALETHIDYLCISINPKHDTFYSLLGFTQIGALKHYGTVNAPAIARALYVPEWRSQTLLAQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FeeM
publication title FeeM, an N-Acyl Amino Acid Synthase from an Uncultured Soil Microbe: Structure, Mechanism, and Acyl Carrier Protein Binding.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 57
structure length 188
sequence length 192
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.-:
pdb deposition date 2006-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g0bA01
2GANA 4PK2A 2P6GA 1YVKA 2REEA 1N71A 4BMHA 4R3KA 1I12A 1Y7RA 4XPDC 4CRZB 2B58A 2VEZA 4CAXA 5EBVA 4H6UA 2I79A 4M3SA 3FNCA 1Z9UA 3SXNA 3FB3A 1UFHA 2CNSA 1QSMA 4OAEA 3BLNA 5J8CA 4QB9A 4Y49C 4KLVA 4MY3A 4LUAA 3F5BA 4UWIA 2FL4A 5KTCA 1QSOA 2AE6A 2B4DB 3SXOA 4AG7A 2CNMA 3I3GA 4II9A 2PDOA 3D8PA 1R57A 4YRHA 2G3AA 2RC4A 4KLWA 5KTAA 3PGPA 4UA3A 2H5MA 4U9YA 1QSNA 2BUEA 4LX9A 1Z4EA 4XPKA 2PR1A 3OWCA 4GS4A 4KOXA 3T90A 1KUXA 4CS0B 2Q0YA 2ZW4A 3CXPA 3WR7A 3GKRA 1M1DA 3FRMA 4XNHB 1S7NA 4MJ8A 4YFJA 4F6AA 1PU9A 2ZPAA 2ZW5A 5JQ4A 3JVNA 4AG9A 1CM0A 2O28A 2K5TA 4CRYB 5IB0A 5HMNA 3QB8A 2PC1A 2P6EA 3R1KA 5F47A 4L89A 1XEBA 3IGRA 1KZFA 2X7BA 1M4DA 5IV0A 3TOAA 1MJBA 1L0CA 1YVOA 4KOUA 3EC4A 4QVTA 4I49A 3B8GA 4AVBA 1YLEA 3TO6A 1QSRA 2G3TA 2B3UA 4XPDB 3K9UA 4QUSA 5F46A 1CJWA 4ORFA 2I00A 5DWNA 4MI4A 3PP9A 1BOBA 3EXNA 2VZYA 3G8WA 2B4DA 3D3SA 2FSRA 2G0BA 4XNHC 1IICA 5F48A 4KVXA 2IL4A 3LD2A 2DXQA 2Z10A 2JEVA 1XE4A 1ON0A 3CXQA 3TE4A 2Z0ZA 3V8IA 4RI1A 4KOTA 1Y9WA 4AVAA 2QMLA 4ZBGA 4CAVA 1RXTA 3FXTA 1FY7A 4KOSA 3EFAA 2B3VA 1V0CA 3SHPA 3R9FA 4HNXB 3E0KA 1QSTA 3R9EA 3TTHA 5E96A 4NSQA 3S6FA 4E8OA 1YX0A 3RYOA 2Q4YA 4U5YA 2ATRA 5H86A 4NEXA 2F5IA 1B87A 2WPXA 3W6SA 4JLYA 1Q2CA 4QC6A 4M85A 4JJXA 1M4GA 4KOWA 1RO5A 2D4OA 4R3LA 1S60A 1S7LA 4KVME 1K4JA 3G3SA 3JUWA 4OLLA 5C82A 5EC4A 1IIDA 4XPLA 4PV6A 1YR0A 3MGDA 1BO4A 4HNYB 4JXRA 2VI7A 4YGOA 1XIXA 5KTDA 2P0WA 1Y9KA 2D4PA 4E2AA 3EY5A 1Q2YA 2CNTA 2CY2A 2PRBA 2VZZA 3CXSA 3I9SA 1WK4A 2B5GA 2Q44A 2Q4VA 3NE7A 1P4NA 4QBJA 2WPWA 5C88A 4JXQA 2FIAA 3H4QA 2FS5A 4FD4A 2AJ6A 2ZW6A 2PR8A 4NF1A 1I1DA 4NXYA 4KZTA 2NMTA 2OZGA 5DWMA 4DNCA 1Z4RA 1LRZA 3W6XA 1M4IA 1WWZA 2Y0MA 4AB7A 4KVOE 3N7ZA 4JD6A 4U9ZA 2Z11A 2VQYA 1YK3A 4X5KA 2R98A 3D2PA 3DDDA 3GY9A 2OH1A 2EUIA 4OADA 3S6GA 2B4BA 4B5OA 4JWPA 1KUVA 4FD5A 2OU2A 3DR6A 1NSLA 1J4JA 4IF5A 2OZUA 2R7HA 2B5GB 2REFA 3FIXA 2PSWA 3DR8A 4KOYA 1I21A 2ARHA 3ZJ0A 3PZJA 2J8NA 4IUSA 2JDCA 3D2MA 4AVCA 4L8AA 4NCZA 2ZXVA 2FIWA 5ISVA 2HUZA 4UBRA 3GYAA 3P2FA 1TIQA 4FD7A 2FXFA 2FT0A 5IX3A 2P6FA 3TOBA 3UY5A 4E0AA 3R96A 2GE3A 1MJAA 3VWEA 3QAHA 2J8RA 4KORA 4R9MA 2QECA 3IWGA 2C27A 2BL1A 3TT2A 1S7FA 5HH1A 5CNPA 2EVNA 4CAWA 3FBUA 3R95A 4PK3A 4B5PB 2J8MA 2HQYA 1YREA 2HV2A 3DSBA 2BSWA 1S7KA 3S6KA 5H84A 1XMTA 2JDDA 5I0CA 1IB1E 3EO4A 3S6HA 4R87A 1B6BA 1IYLA 2R1IA 2Q7BA 3R9GA 2VXKA 2OB0A 4KUBA 3TO9A 4MY0A 3TCVA 2PQ8A 2KCWA 2FCKA 3TO7A 3F8KA 3W91A 2A4NA 1Q2DA 4RS2A 4FD6A 1NMTA 3BJ8A 1U6MA 3ZZIA 3VWDA 4J3GA 3C26A 3LODA 3DNSA 1MK4A 1S3ZA 1OZPA 2FE7A 4MBUA 4PSXA 4ONUA 2OZHA 4H89A 1NE9A 2Q04A 4K30A 2BEIA 4HNWB 4H6ZA 4F0YA 1VHSA 3T9YA 2ZW7A 1GHEA 4EVYA 3FYNA 4B5PA 3F0AA 4UWJA 1YGHA 2GIVA 1P0HA 4MHDA 1S5KA 4KOVA 1KUYA 1XF8A 5F49A 1IYKA 1MJ9A 2VBQA 3KKWA 5FVJA 2R8VA 5J8FA 3BJ7A 1SQHA 5JPHA 2JLMA 1PUAA 4R57A 4Y49B 3TFYA 2QIRA 4PSWA 5GCNA 1M44A 4HKFA 3P2HA 1VKCA 4KUAA
chains in the Genus database with same CATH superfamily
2GANA 2PCUA 3N5FA 4PK2A 2P6GA 1YVKA 5AGEA 2REEA 3RO0A 4A95A 1XBUA 3TX8A 4ZY0A 1N71A 1ELLP 4BMHA 2PIZA 2POKA 4P4JA 4R3KA 2GFQA 2PJ2A 1I12A 3B2YA 1Y7RA 3PB9X 4XPDC 3FX6A 4CRZB 3GB0A 2B58A 2VEZA 4CAXA 5EBVA 4H6UA 2I79A 2PVWA 3SI2A 3JRUA 2IMOA 3CT9A 1Z8TA 1LCPA 1XFOA 1CG2A 2V77A 4M3SA 3FNCA 4F0XA 1BAVA 1Z9UA 5LRGA 3SXNA 3B35A 3FB3A 1UFHA 4MFKA 2CNSA 2PJ1A 2OOTA 2CIJA 4A32A 1QSMA 3SJFA 5HVFA 4OAEA 2YGWA 4EFDA 5LYFA 3IIBA 6CPAA 3BLNA 3NE8A 5J8CA 3D66A 3PB4X 1OBRA 4Q38A 2Z3KA 4QB9A 4Y49C 4KLVA 5IB9A 4MY3A 4LUAA 5DS0A 3F5BA 2EWBA 2FL4A 4UWIA 3VATA 4A39A 1LAMA 4F9VA 5THWA 3B3TA 3IO1A 4ZYQA 1Q7LA 4NGPA 5KTCA 3VH9A 4Q36A 1QSOA 1YMEA 2AE6A 2B4DB 1ZLIA 4GM5A 3SXOA 2CNMA 1CPXA 3I3GA 4AG7A 4II9A 2V8HA 2PDOA 1IOFA 1R57A 3D8PA 4YRHA 2V8DA 4Q7AA 2G3AA 1VHOA 2RC4A 3KR4A 4KLWA 5KTAA 3PGPA 4UA3A 2H5MA 4U9YA 4W9YA 4HPSA 1QSNA 2BUEA 4LX9A 1Z4EA 4XPKA 3CDXA 2PR1A 4MCQA 1Y7EA 3OWCA 4GS4A 4KOXA 4P44A 1KUXA 3T90A 4B14A 4BD9A 4CS0B 2Q0YA 4C2XA 4NGRA 4BINA 4DJLA 2C6CA 2ZW4A 3CXPA 3WR7A 3GKRA 3S9LA 1M1DA 2WSAA 1PCAA 3S9MA 2PRQA 3DLJA 1LOKA 3FRMA 2ZOGA 2Q51A 4M6HA 4XNHB 4MCPA 1S7NA 4MJ8A 4YFJA 4OC4A 4MFLA 4MHZA 4F6AA 2NYQA 2DF5A 1PU9A 2ZPAA 2ZW5A 3IWWA 3JTKA 3JVNA 4YU9A 4AG9A 4RUHA 4ZY1A 5JQ4A 1CM0A 3FMCA 2O28A 2K5TA 3GUXA 4CRYB 5IB0A 3PRTA 4OIDA 3B3SA 2CF4A 3D7HA 3D7DA 4ZY2A 4AXVA 5HMNA 2QYVA 3QB8A 2PC1A 2P6EA 3R1KA 5F47A 2RFHA 4L89A 2Q43A 1XEBA 3BHXA 3IGRA 5G1ZA 1KZFA 2X7BA 1M4DA 5IV0A 2IJZA 1ZG9A 2ZEEA 4JYWA 3WC7A 4DUKA 3TOAA 1CX8A 3FEDA 3A9LA 1MJBA 4MXUA 5D29A 1L0CA 1LAPA 1YVOA 4KOUA 3EC4A 4QVTA 1XMBA 4I49A 3B8GA 4AVBA 4UCNA 1YLEA 3TO6A 1QSRA 2G3TA 2B3UA 4OC1A 4XPDB 3K2KA 4CYOA 1Z8WA 3K9UA 2PJAA 4QUSA 5D8NA 3IFEA 5F46A 1YQEA 1CJWA 4ORFA 2I00A 5DWNA 4NGNA 4A30A 4EWTA 2YNDA 4MI4A 5BWAB 3PP9A 1BOBA 3EXNA 2VZYA 3G8WA 2B4DA 1HDQA 2PJCA 3D3SA 2FSRA 2G0BA 1DE4C 3ISXA 4XNHC 4Z65A 1IICA 3BI0A 5F48A 4KVXA 3CPAA 2IL4A 4P10A 3LD2A 4MHPA 2DXQA 3NA6A 4OC3A 2Z10A 3FECA 3TC8A 2JEVA 4CAFA 1JQGA 1XE4A 3T8WA 1ON0A 3LMSA 1JWQA 3CXQA 3TE4A 2Z0ZA 3V8IA 3D4UA 4RI1A 4KOTA 1Y9WA 5ELYA 4AVAA 2V8GA 1DTDA 2QMLA 5JM6A 4ZBGA 4CAVA 2ZELA 3PFEA 1RXTA 3FXTA 1FY7A 4KOSA 3EFAA 2B3VA 3DGVA 1V0CA 3SHPA 4ZGYB 3HUVA 4MFJA 2J9AA 3E0KA 3PB7X 4HNXB 2QJ8A 3R9FA 1QSTA 2HB6A 3R9EA 3TTHA 4FBEA 5E96A 1XOVA 2VL1A 4MFPA 4NSQA 2XEJA 3S6FA 4PXEA 4E8OA 1YX0A 3RYOA 4FAIA 4P4DA 4UFXA 2Q4YA 3WT4A 4P6YA 2Z3OA 4U5YA 2ATRA 5H86A 1ZO0A 3V7ZA 5CBMA 1YSJA 2F5IA 4MCRA 4NEXA 1Z8XA 1B87A 2BO9A 3IJ3A 2PJBA 2WPXA 5AG7A 2ZEMA 1YLOA 3W6SA 4JLYA 1Q2CA 2CXAA 2C6GA 2EK8A 1CP7A 1ARMA 1X10A 3GLJA 4JJXA 3NH8A 4M85A 1M4GA 4QC6A 4KOWA 1RO5A 2D4OA 4X8IA 4R3LA 1S60A 3H5ZA 4P4FA 1S7LA 4KVME 1K4JA 3BXMA 3G3SA 4PXCA 3JUWA 4OLLA 5LYDA 1TF8A 3S9NA 5C82A 1F57A 5EC4A 4CGOA 2ANPA 2IQ6A 3NH5A 3MRUA 5AG4A 2JBKA 2GU2A 2PJ5A 1IIDA 4UFWA 3CZXA 2I3CA 3FVLA 4XPLA 1IOIA 4NJRA 4PV6A 2ZEDA 1YR0A 4LQ6A 2PIYA 3KL9A 4P4IA 3B7IA 3MGDA 1BO4A 4HNYB 4MHNA 4JXRA 2VI7A 4YGOA 1XIXA 5KTDA 2P0WA 1Y9KA 2D4PA 4E2AA 3KASA 3EY5A 3CPXA 4JZ0A 1Q2YA 2CNTA 2CY2A 2PRBA 2VZZA 3B3WA 3CXSA 3H8FA 3I9SA 4NFRA 4P45A 3SJEA 4YWYA 1WK4A 2B5GA 2Q44A 2AFWA 2Q4VA 5JGFA 3NE7A 1ZG8A 1P4NA 5AG5A 4QBJA 2WPWA 1KWMA 4ZX9A 2AFUA 2ODFA 4JXQA 2FIAA 4B11A 5C88A 3H4QA 1CBXA 4TNUA 1ELMP 2FS5A 4FD4A 2AJ6A 2ZW6A 4OC5A 2PR8A 2OR4A 4NF1A 3QNVA 5J1QA 1I1DA 4NXYA 4KZTA 5K8NA 3FF3A 2NMTA 2PE3A 2C1CA 1YW4A 2ZEOA 1X12A 1QQ9A 3I1UA 2PJ8A 3IWEA 2OZGA 3WC6A 4H2KA 4B6ZA 1Y0RA 3IU1A 5DWMA 4DNCA 3QAYA 1VIXA 3FH4A 2BOAA 1Z8LA 4FWUA 3NH4A 3WC5A 5JH9A 3GIUA 1Z4RA 1LRZA 3W6XA 1M4IA 4KS9A 1WWZA 1IU8A 2Y0MA 2PVVA 1Z5RA 2DPSA 4AB7A 3KGQA 3KHZA 1H8LA 2PJ4A 1TXRA 1LFWA 4GXHA 4CYNA 3KI9A 4KVOE 3PB8X 4DYOA 2ABZA 3N7ZA 3H8GA 4P4EA 5A27A 8CPAA 4JD6A 4A31A 1CP6A 4U9ZA 3PB6X 2F8HA 2Z11A 2VQYA 1YK3A 4PQAA 2ZEFA 2R98A 3D2PA 3DDDA 3GY9A 4X5KA 1HEEA 2OH1A 4B13A 2EUIA 4WWVA 2Z3MA 2HC9A 4OADA 3S6GA 3B3VA 2B4BA 4B5OA 4JWPA 1KUVA 4FD5A 2OU2A 3NFZA 1EE3P 4IHMA 3DR6A 1NSLA 1J4JA 3K9TA 1ZLHA 4IF5A 2OZUA 2R7HA 3MN8A 2AFXA 2B5GB 4NGTA 2AFSA 2REFA 2PSWA 3FIXA 4K3NA 2O4HA 3DR8A 4UCPA 4A33A 5A28A 2FVGA 3D7GA 3LWUA 1I21A 4IK2A 4KOYA 2ARHA 4F8ZA 2BCOA 3D68A 3ZJ0A 3PZJA 1CPSA 2PJ9A 2J8NA 2GREA 4IUSA 2JDCA 3SJXA 4OC2A 3D2MA 2CTCA 4AVCA 4L8AA 4NCZA 5I4MA 2Z3NA 4C7IA 2ZXVA 2AFZA 3PEIA 2FIWA 2Z3PA 1VHEA 5K8PA 5ISVA 2AFMA 3PFOA 4MCSA 2HUZA 2O53A 3GYAA 4NJQA 4UBRA 1XRYA 1TIQA 3P2FA 4FD7A 2YNCC 1IY7A 3IEHA 1M4LA 2FXFA 4OC0A 4F9UA 2FT0A 3KQZA 4MFZA 5IX3A 2P6FA 4NGSA 3TOBA 2JBJA 3UY5A 4E0AA 2DEAA 3RNZA 4WJBA 3R96A 2PJ7A 5K8MA 2GE3A 1MJAA 4ZI6A 2XEGA 2DPTA 3HLPA 4KSAA 3VWEA 3QAHA 1IGBA 2WYRA 2J8RA 4KORA 4R9MA 2ZEHA 2QECA 1ARLA 3IWGA 2C27A 5HVHA 3SI1A 2BL1A 2YNEA 3KHXA 7CPAA 3TT2A 4OKOA 4A37A 5K8OA 4OIWA 1S7FA 5HH1A 4B12A 5CNPA 2CTBA 3RZAA 2EVNA 1Y0YA 1FNOA 4C7HA 1BPNA 4R7MA 2WZNA 5EMIA 3SJGA 2YNCA 2JEWA 4UEFA 1UWYA 2ZEPA 1HDUA 4CAWA 3FBUA 4FUUA 4OP4A 4PK3A 4UIBA 4UIAA 2J8MA 4PXBA 2HQYA 3R95A 1YREA 3H8EA 2RB7A 2AFOA 4NGMA 4UF4A 2HV2A 3DSBA 2BSWA 4ONWA 3FJUA 1S7KA 2XEFA 3S6KA 5H84A 1XMTA 2JDDA 1F2PA 4G1PA 5I0CA 1IB1E 3EO4A 3ISZA 4O23A 1ZG7A 2XEIA 4MMOA 3S6HA 4CGPA 4R87A 4M6IA 5AG6A 4A94A 1B6BA 1IYLA 4R6TA 4TWEA 5F09A 4C2ZA 2R1IA 3D67A 4P4BA 3V38A 2Q7BA 3R9GA 4CGNA 1TKJA 2ZOFA 4A2ZA 2VXKA 2OB0A 4KUBA 4B10A 3TO9A 4MY0A 5LRKA 4M6GA 1LANA 4ZX8A 3TCVA 4BBHA 2PQ8A 1TKHA 2KCWA 2FCKA 3TO7A 3F8KA 1PYTB 4CAEA 4CGLA 4X3RA 3SI0A 3W91A 3IU2A 2NSMA 4UFVA 5CPAA 2WUUA 1XJOA 2A4NA 1Q2DA 4RS2A 4FD6A 1NMTA 3BJ8A 1R43A 1QMUA 1U6MA 4OMEA 3ZZIA 3VWDA 3RBUA 4RN7A 4J3GA 4NGQA 4PPZA 4C68A 3C26A 3LODA 2G9DA 4IAVA 2GLJA 3DNSA 1MK4A 1FT7A 1RTQA 2PJ6A 4CGMA 1S3ZA 1BPMA 2Q7SA 1OZPA 2FE7A 3FEEA 3PBEA 4MBUA 1BLLE 1TF9A 2GLFA 4EMEA 5G22A 4CYQA 2PJ3A 3KR5A 2Z3LA 5G20A 4PSXA 4ONUA 2OZHA 3IC1A 2ZENA 4CYPA 4C2YA 4UCMA 1AMPA 4H89A 3LACA 1NE9A 2Q04A 4K30A 2BEIA 4HNWB 4H6ZA 3BI1A 5LYIA 1VHSA 3T9YA 2ZW7A 4F0YA 1GHEA 2C6PA 2EBJA 4R76A 4EVYA 2QVPA 3FYNA 4A38A 4B5PA 3F0AA 1TKFA 2ZEGA 3WABA 3L2NA 4B5PB 4UWJA 1YGHA 4CPAA 2GIVA 1P0HA 4MHDA 2EK9A 1GYTA 1S5KA 2PJ0A 4KOVA 4UEZA 1KUYA 1XF8A 4KSIA 1AYEA 4MRIA 4X2TA 5F49A 1IYKA 4MHYA 3KZWA 1MJ9A 2VBQA 5HXDA 2V8VA 1AUGA 3KKWA 5FVJA 5LYLA 2R8VA 1YW6A 5J8FA 3BJ7A 1R3NA 3PBBA 1SQHA 5JPHA 2JLMA 3D7FA 1PUAA 1NSAA 4R57A 4Y49B 3TFYA 2F7VA 3VARA 4UEEA 2QIRA 4MFQA 4PSWA 5LRJA 1A2ZA 3KQXA 5HVGA 2Q4ZA 4R8FA 3B3CA 5GCNA 4LQGA 1VGYA 4PXDA 1M44A 3RAMA 4HKFA 3P2HA 4KSFA 2EO8A 1VKCA 1Z2LA 5G21A 4KUAA 1F2OA
chains in the Genus database with same CATH topology
2GANA 4PK2A 2P6GA 1YVKA 5AGEA 2REEA 4A95A 1N71A 4BMHA 4R3KA 1I12A 1Y7RA 4XPDC 4CRZB 2B58A 2VEZA 4CAXA 5EBVA 4H6UA 2I79A 4M3SA 3FNCA 4F0XA 1Z9UA 3SXNA 3FB3A 1UFHA 4MFKA 2CNSA 4A32A 1QSMA 4OAEA 2YGWA 3BLNA 5J8CA 4Q38A 2Z3KA 4QB9A 4Y49C 4KLVA 4MY3A 4LUAA 3F5BA 4UWIA 2FL4A 5KTCA 4Q36A 1QSOA 2AE6A 2B4DB 3SXOA 4AG7A 2CNMA 3I3GA 4II9A 2PDOA 3D8PA 1R57A 4YRHA 2G3AA 2RC4A 4KLWA 5KTAA 3PGPA 4UA3A 2H5MA 4U9YA 1QSNA 2BUEA 4LX9A 1Z4EA 4XPKA 2PR1A 3OWCA 4GS4A 4KOXA 3T90A 1KUXA 4B14A 4CS0B 2Q0YA 4C2XA 2ZW4A 3CXPA 3WR7A 3GKRA 1M1DA 2WSAA 3FRMA 4XNHB 1S7NA 4MJ8A 4YFJA 4MFLA 4F6AA 1PU9A 2ZPAA 2ZW5A 3JTKA 3JVNA 5JQ4A 4AG9A 1CM0A 2O28A 2K5TA 4CRYB 5IB0A 5HMNA 3QB8A 2PC1A 2P6EA 3R1KA 5F47A 4L89A 1XEBA 5G1ZA 3IGRA 1KZFA 2X7BA 1M4DA 5IV0A 3TOAA 3A9LA 1MJBA 1L0CA 1YVOA 4KOUA 3EC4A 4QVTA 4I49A 3B8GA 4AVBA 4UCNA 1YLEA 3TO6A 1QSRA 2G3TA 2B3UA 4XPDB 4CYOA 3K9UA 4QUSA 5F46A 1CJWA 4ORFA 2I00A 5DWNA 4A30A 2YNDA 4MI4A 5BWAB 3PP9A 1BOBA 3EXNA 2VZYA 3G8WA 2B4DA 3D3SA 2FSRA 2G0BA 4XNHC 1IICA 5F48A 4KVXA 2IL4A 3LD2A 2DXQA 2Z10A 4CAFA 2JEVA 1XE4A 1ON0A 3CXQA 3TE4A 2Z0ZA 3V8IA 4RI1A 4KOTA 1Y9WA 4AVAA 2QMLA 4ZBGA 4CAVA 1RXTA 3FXTA 1FY7A 4KOSA 3EFAA 2B3VA 1V0CA 3SHPA 4ZGYB 4MFJA 4HNXB 3E0KA 3R9FA 1QSTA 3R9EA 3TTHA 5E96A 4MFPA 4NSQA 3S6FA 4E8OA 1YX0A 3RYOA 4UFXA 2Q4YA 2Z3OA 4U5YA 2ATRA 5H86A 1ZO0A 4NEXA 2F5IA 1B87A 2WPXA 5AG7A 3W6SA 4JLYA 1Q2CA 2CXAA 4QC6A 4M85A 4JJXA 1M4GA 4KOWA 1RO5A 2D4OA 4R3LA 1S60A 3H5ZA 1S7LA 4KVME 1K4JA 3G3SA 3JUWA 4OLLA 5C82A 5EC4A 4CGOA 5AG4A 1IIDA 4UFWA 4XPLA 4PV6A 1YR0A 3MGDA 1BO4A 4HNYB 4JXRA 2VI7A 4YGOA 1XIXA 5KTDA 2P0WA 1Y9KA 2D4PA 4E2AA 3EY5A 1Q2YA 2CNTA 2CY2A 2PRBA 2VZZA 3CXSA 3I9SA 1WK4A 2B5GA 2Q44A 2Q4VA 3NE7A 5AG5A 1P4NA 4QBJA 2WPWA 5C88A 4B11A 4JXQA 2FIAA 3H4QA 2FS5A 4FD4A 2AJ6A 2ZW6A 2PR8A 4NF1A 1I1DA 4NXYA 4KZTA 2NMTA 3IWEA 2OZGA 3IU1A 5DWMA 4DNCA 1Z4RA 1LRZA 3W6XA 1M4IA 4KS9A 1WWZA 2Y0MA 4AB7A 2DPSA 4CYNA 4KVOE 3N7ZA 5A27A 4JD6A 4A31A 4U9ZA 2Z11A 2VQYA 1YK3A 4X5KA 2R98A 3D2PA 3DDDA 3GY9A 4B13A 2OH1A 2EUIA 2Z3MA 4OADA 3S6GA 2B4BA 4B5OA 4JWPA 1KUVA 4FD5A 2OU2A 3DR6A 1NSLA 1J4JA 4IF5A 2OZUA 2R7HA 2B5GB 2REFA 3FIXA 2PSWA 5A28A 3DR8A 4A33A 4UCPA 4KOYA 1I21A 2ARHA 3ZJ0A 3PZJA 2J8NA 4IUSA 2JDCA 3D2MA 4AVCA 4L8AA 4NCZA 2Z3NA 4C7IA 2ZXVA 2FIWA 2Z3PA 5ISVA 2HUZA 4UBRA 3GYAA 3P2FA 1TIQA 4FD7A 2YNCC 2FXFA 2FT0A 4MFZA 5IX3A 2P6FA 3TOBA 3UY5A 4E0AA 3R96A 2GE3A 1MJAA 2DPTA 4KSAA 3VWEA 3QAHA 2J8RA 4KORA 4R9MA 2QECA 3IWGA 2C27A 2BL1A 2YNEA 3TT2A 1S7FA 5HH1A 4B12A 5CNPA 2EVNA 4C7HA 2YNCA 4CAWA 3FBUA 3R95A 4PK3A 4B5PB 2J8MA 2HQYA 1YREA 2HV2A 3DSBA 2BSWA 1S7KA 3S6KA 5H84A 1XMTA 2JDDA 5I0CA 1IB1E 3EO4A 3S6HA 4CGPA 4R87A 5AG6A 1B6BA 1IYLA 4C2ZA 2R1IA 2Q7BA 3R9GA 4CGNA 4A2ZA 2VXKA 2OB0A 4KUBA 4B10A 3TO9A 4MY0A 3TCVA 4BBHA 2PQ8A 2KCWA 2FCKA 3TO7A 3F8KA 4CAEA 4CGLA 3W91A 3IU2A 4UFVA 2WUUA 2A4NA 1Q2DA 4RS2A 4FD6A 1NMTA 3BJ8A 1U6MA 3ZZIA 3VWDA 4J3GA 4C68A 3C26A 3LODA 3DNSA 1MK4A 4CGMA 1S3ZA 1OZPA 2FE7A 4MBUA 5G22A 4CYQA 2Z3LA 5G20A 4PSXA 4ONUA 2OZHA 4CYPA 4C2YA 4UCMA 4H89A 1NE9A 2Q04A 4K30A 2BEIA 4HNWB 4H6ZA 4F0YA 1VHSA 3T9YA 2ZW7A 1GHEA 4EVYA 3FYNA 4B5PA 3F0AA 4UWJA 1YGHA 2GIVA 1P0HA 4MHDA 1S5KA 4KOVA 1KUYA 1XF8A 5F49A 1IYKA 1MJ9A 2VBQA 3KKWA 5FVJA 2R8VA 5J8FA 3BJ7A 1SQHA 5JPHA 2JLMA 1PUAA 4R57A 4Y49B 3TFYA 2QIRA 4MFQA 4PSWA 5GCNA 1M44A 4HKFA 3P2HA 4KSFA 1VKCA 5G21A 4KUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAN A;  4PK2 A;  2P6G A;  1YVK A;  2REE A;  1N71 A;  4BMH A;  4R3K A;  1I12 A;  1Y7R A;  4XPD C;  4CRZ B;  2B58 A;  2VEZ A;  4CAX A;  5EBV A;  4H6U A;  2I79 A;  4M3S A;  3FNC A;  1Z9U A;  3SXN A;  3FB3 A;  1UFH A;  2CNS A;  1QSM A;  4OAE A;  3BLN A;  5J8C A;  4QB9 A;  4Y49 C;  4KLV A;  4MY3 A;  4LUA A;  3F5B A;  4UWI A;  2FL4 A;  5KTC A;  1QSO A;  2AE6 A;  2B4D B;  3SXO A;  4AG7 A;  2CNM A;  3I3G A;  4II9 A;  2PDO A;  3D8P A;  1R57 A;  4YRH A;  2G3A A;  2RC4 A;  4KLW A;  5KTA A;  3PGP A;  4UA3 A;  2H5M A;  4U9Y A;  1QSN A;  2BUE A;  4LX9 A;  1Z4E A;  4XPK A;  2PR1 A;  3OWC A;  4GS4 A;  4KOX A;  3T90 A;  1KUX A;  4CS0 B;  2Q0Y A;  2ZW4 A;  3CXP A;  3WR7 A;  3GKR A;  1M1D A;  3FRM A;  4XNH B;  1S7N A;  4MJ8 A;  4YFJ A;  4F6A A;  1PU9 A;  2ZPA A;  2ZW5 A;  5JQ4 A;  3JVN A;  4AG9 A;  1CM0 A;  2O28 A;  2K5T A;  4CRY B;  5IB0 A;  5HMN A;  3QB8 A;  2PC1 A;  2P6E A;  3R1K A;  5F47 A;  4L89 A;  1XEB A;  3IGR A;  1KZF A;  2X7B A;  1M4D A;  5IV0 A;  3TOA A;  1MJB A;  1L0C A;  1YVO A;  4KOU A;  3EC4 A;  4QVT A;  4I49 A;  3B8G A;  4AVB A;  1YLE A;  3TO6 A;  1QSR A;  2G3T A;  2B3U A;  4XPD B;  3K9U A;  4QUS A;  5F46 A;  1CJW A;  4ORF A;  2I00 A;  5DWN A;  4MI4 A;  3PP9 A;  1BOB A;  3EXN A;  2VZY A;  3G8W A;  2B4D A;  3D3S A;  2FSR A;  2G0B A;  4XNH C;  1IIC A;  5F48 A;  4KVX A;  2IL4 A;  3LD2 A;  2DXQ A;  2Z10 A;  2JEV A;  1XE4 A;  1ON0 A;  3CXQ A;  3TE4 A;  2Z0Z A;  3V8I A;  4RI1 A;  4KOT A;  1Y9W A;  4AVA A;  2QML A;  4ZBG A;  4CAV A;  1RXT A;  3FXT A;  1FY7 A;  4KOS A;  3EFA A;  2B3V A;  1V0C A;  3SHP A;  3R9F A;  4HNX B;  3E0K A;  1QST A;  3R9E A;  3TTH A;  5E96 A;  4NSQ A;  3S6F A;  4E8O A;  1YX0 A;  3RYO A;  2Q4Y A;  4U5Y A;  2ATR A;  5H86 A;  4NEX A;  2F5I A;  1B87 A;  2WPX A;  3W6S A;  4JLY A;  1Q2C A;  4QC6 A;  4M85 A;  4JJX A;  1M4G A;  4KOW A;  1RO5 A;  2D4O A;  4R3L A;  1S60 A;  1S7L A;  4KVM E;  1K4J A;  3G3S A;  3JUW A;  4OLL A;  5C82 A;  5EC4 A;  1IID A;  4XPL A;  4PV6 A;  1YR0 A;  3MGD A;  1BO4 A;  4HNY B;  4JXR A;  2VI7 A;  4YGO A;  1XIX A;  5KTD A;  2P0W A;  1Y9K A;  2D4P A;  4E2A A;  3EY5 A;  1Q2Y A;  2CNT A;  2CY2 A;  2PRB A;  2VZZ A;  3CXS A;  3I9S A;  1WK4 A;  2B5G A;  2Q44 A;  2Q4V A;  3NE7 A;  1P4N A;  4QBJ A;  2WPW A;  5C88 A;  4JXQ A;  2FIA A;  3H4Q A;  2FS5 A;  4FD4 A;  2AJ6 A;  2ZW6 A;  2PR8 A;  4NF1 A;  1I1D A;  4NXY A;  4KZT A;  2NMT A;  2OZG A;  5DWM A;  4DNC A;  1Z4R A;  1LRZ A;  3W6X A;  1M4I A;  1WWZ A;  2Y0M A;  4AB7 A;  4KVO E;  3N7Z A;  4JD6 A;  4U9Z A;  2Z11 A;  2VQY A;  1YK3 A;  4X5K A;  2R98 A;  3D2P A;  3DDD A;  3GY9 A;  2OH1 A;  2EUI A;  4OAD A;  3S6G A;  2B4B A;  4B5O A;  4JWP A;  1KUV A;  4FD5 A;  2OU2 A;  3DR6 A;  1NSL A;  1J4J A;  4IF5 A;  2OZU A;  2R7H A;  2B5G B;  2REF A;  3FIX A;  2PSW A;  3DR8 A;  4KOY A;  1I21 A;  2ARH A;  3ZJ0 A;  3PZJ A;  2J8N A;  4IUS A;  2JDC A;  3D2M A;  4AVC A;  4L8A A;  4NCZ A;  2ZXV A;  2FIW A;  5ISV A;  2HUZ A;  4UBR A;  3GYA A;  3P2F A;  1TIQ A;  4FD7 A;  2FXF A;  2FT0 A;  5IX3 A;  2P6F A;  3TOB A;  3UY5 A;  4E0A A;  3R96 A;  2GE3 A;  1MJA A;  3VWE A;  3QAH A;  2J8R A;  4KOR A;  4R9M A;  2QEC A;  3IWG A;  2C27 A;  2BL1 A;  3TT2 A;  1S7F A;  5HH1 A;  5CNP A;  2EVN A;  4CAW A;  3FBU A;  3R95 A;  4PK3 A;  4B5P B;  2J8M A;  2HQY A;  1YRE A;  2HV2 A;  3DSB A;  2BSW A;  1S7K A;  3S6K A;  5H84 A;  1XMT A;  2JDD A;  5I0C A;  1IB1 E;  3EO4 A;  3S6H A;  4R87 A;  1B6B A;  1IYL A;  2R1I A;  2Q7B A;  3R9G A;  2VXK A;  2OB0 A;  4KUB A;  3TO9 A;  4MY0 A;  3TCV A;  2PQ8 A;  2KCW A;  2FCK A;  3TO7 A;  3F8K A;  3W91 A;  2A4N A;  1Q2D A;  4RS2 A;  4FD6 A;  1NMT A;  3BJ8 A;  1U6M A;  3ZZI A;  3VWD A;  4J3G A;  3C26 A;  3LOD A;  3DNS A;  1MK4 A;  1S3Z A;  1OZP A;  2FE7 A;  4MBU A;  4PSX A;  4ONU A;  2OZH A;  4H89 A;  1NE9 A;  2Q04 A;  4K30 A;  2BEI A;  4HNW B;  4H6Z A;  4F0Y A;  1VHS A;  3T9Y A;  2ZW7 A;  1GHE A;  4EVY A;  3FYN A;  4B5P A;  3F0A A;  4UWJ A;  1YGH A;  2GIV A;  1P0H A;  4MHD A;  1S5K A;  4KOV A;  1KUY A;  1XF8 A;  5F49 A;  1IYK A;  1MJ9 A;  2VBQ A;  3KKW A;  5FVJ A;  2R8V A;  5J8F A;  3BJ7 A;  1SQH A;  5JPH A;  2JLM A;  1PUA A;  4R57 A;  4Y49 B;  3TFY A;  2QIR A;  4PSW A;  5GCN A;  1M44 A;  4HKF A;  3P2H A;  1VKC A;  4KUA A; 
#chains in the Genus database with same CATH topology
 2GAN A;  2PCU A;  3N5F A;  4PK2 A;  2P6G A;  1YVK A;  5AGE A;  2REE A;  3RO0 A;  4A95 A;  1XBU A;  3TX8 A;  4ZY0 A;  1N71 A;  1ELL P;  4BMH A;  2PIZ A;  2POK A;  4P4J A;  4R3K A;  2GFQ A;  2PJ2 A;  1I12 A;  3B2Y A;  1Y7R A;  3PB9 X;  4XPD C;  3FX6 A;  4CRZ B;  3GB0 A;  2B58 A;  2VEZ A;  4CAX A;  5EBV A;  4H6U A;  2I79 A;  2PVW A;  3SI2 A;  3JRU A;  2IMO A;  3CT9 A;  1Z8T A;  1LCP A;  1XFO A;  1CG2 A;  2V77 A;  4M3S A;  3FNC A;  4F0X A;  1BAV A;  1Z9U A;  5LRG A;  3SXN A;  3B35 A;  3FB3 A;  1UFH A;  4MFK A;  2CNS A;  2PJ1 A;  2OOT A;  2CIJ A;  4A32 A;  1QSM A;  3SJF A;  5HVF A;  4OAE A;  2YGW A;  4EFD A;  5LYF A;  3IIB A;  6CPA A;  3BLN A;  3NE8 A;  5J8C A;  3D66 A;  3PB4 X;  1OBR A;  4Q38 A;  2Z3K A;  4QB9 A;  4Y49 C;  4KLV A;  5IB9 A;  4MY3 A;  4LUA A;  5DS0 A;  3F5B A;  2EWB A;  2FL4 A;  4UWI A;  3VAT A;  4A39 A;  1LAM A;  4F9V A;  5THW A;  3B3T A;  3IO1 A;  4ZYQ A;  1Q7L A;  4NGP A;  5KTC A;  3VH9 A;  4Q36 A;  1QSO A;  1YME A;  2AE6 A;  2B4D B;  1ZLI A;  4GM5 A;  3SXO A;  2CNM A;  1CPX A;  3I3G A;  4AG7 A;  4II9 A;  2V8H A;  2PDO A;  1IOF A;  1R57 A;  3D8P A;  4YRH A;  2V8D A;  4Q7A A;  2G3A A;  1VHO A;  2RC4 A;  3KR4 A;  4KLW A;  5KTA A;  3PGP A;  4UA3 A;  2H5M A;  4U9Y A;  4W9Y A;  4HPS A;  1QSN A;  2BUE A;  4LX9 A;  1Z4E A;  4XPK A;  3CDX A;  2PR1 A;  4MCQ A;  1Y7E A;  3OWC A;  4GS4 A;  4KOX A;  4P44 A;  1KUX A;  3T90 A;  4B14 A;  4BD9 A;  4CS0 B;  2Q0Y A;  4C2X A;  4NGR A;  4BIN A;  4DJL A;  2C6C A;  2ZW4 A;  3CXP A;  3WR7 A;  3GKR A;  3S9L A;  1M1D A;  2WSA A;  1PCA A;  3S9M A;  2PRQ A;  3DLJ A;  1LOK A;  3FRM A;  2ZOG A;  2Q51 A;  4M6H A;  4XNH B;  4MCP A;  1S7N A;  4MJ8 A;  4YFJ A;  4OC4 A;  4MFL A;  4MHZ A;  4F6A A;  2NYQ A;  2DF5 A;  1PU9 A;  2ZPA A;  2ZW5 A;  3IWW A;  3JTK A;  3JVN A;  4YU9 A;  4AG9 A;  4RUH A;  4ZY1 A;  5JQ4 A;  1CM0 A;  3FMC A;  2O28 A;  2K5T A;  3GUX A;  4CRY B;  5IB0 A;  3PRT A;  4OID A;  3B3S A;  2CF4 A;  3D7H A;  3D7D A;  4ZY2 A;  4AXV A;  5HMN A;  2QYV A;  3QB8 A;  2PC1 A;  2P6E A;  3R1K A;  5F47 A;  2RFH A;  4L89 A;  2Q43 A;  1XEB A;  3BHX A;  3IGR A;  5G1Z A;  1KZF A;  2X7B A;  1M4D A;  5IV0 A;  2IJZ A;  1ZG9 A;  2ZEE A;  4JYW A;  3WC7 A;  4DUK A;  3TOA A;  1CX8 A;  3FED A;  3A9L A;  1MJB A;  4MXU A;  5D29 A;  1L0C A;  1LAP A;  1YVO A;  4KOU A;  3EC4 A;  4QVT A;  1XMB A;  4I49 A;  3B8G A;  4AVB A;  4UCN A;  1YLE A;  3TO6 A;  1QSR A;  2G3T A;  2B3U A;  4OC1 A;  4XPD B;  3K2K A;  4CYO A;  1Z8W A;  3K9U A;  2PJA A;  4QUS A;  5D8N A;  3IFE A;  5F46 A;  1YQE A;  1CJW A;  4ORF A;  2I00 A;  5DWN A;  4NGN A;  4A30 A;  4EWT A;  2YND A;  4MI4 A;  5BWA B;  3PP9 A;  1BOB A;  3EXN A;  2VZY A;  3G8W A;  2B4D A;  1HDQ A;  2PJC A;  3D3S A;  2FSR A;  2G0B A;  1DE4 C;  3ISX A;  4XNH C;  4Z65 A;  1IIC A;  3BI0 A;  5F48 A;  4KVX A;  3CPA A;  2IL4 A;  4P10 A;  3LD2 A;  4MHP A;  2DXQ A;  3NA6 A;  4OC3 A;  2Z10 A;  3FEC A;  3TC8 A;  2JEV A;  4CAF A;  1JQG A;  1XE4 A;  3T8W A;  1ON0 A;  3LMS A;  1JWQ A;  3CXQ A;  3TE4 A;  2Z0Z A;  3V8I A;  3D4U A;  4RI1 A;  4KOT A;  1Y9W A;  5ELY A;  4AVA A;  2V8G A;  1DTD A;  2QML A;  5JM6 A;  4ZBG A;  4CAV A;  2ZEL A;  3PFE A;  1RXT A;  3FXT A;  1FY7 A;  4KOS A;  3EFA A;  2B3V A;  3DGV A;  1V0C A;  3SHP A;  4ZGY B;  3HUV A;  4MFJ A;  2J9A A;  3E0K A;  3PB7 X;  4HNX B;  2QJ8 A;  3R9F A;  1QST A;  2HB6 A;  3R9E A;  3TTH A;  4FBE A;  5E96 A;  1XOV A;  2VL1 A;  4MFP A;  4NSQ A;  2XEJ A;  3S6F A;  4PXE A;  4E8O A;  1YX0 A;  3RYO A;  4FAI A;  4P4D A;  4UFX A;  2Q4Y A;  3WT4 A;  4P6Y A;  2Z3O A;  4U5Y A;  2ATR A;  5H86 A;  1ZO0 A;  3V7Z A;  5CBM A;  1YSJ A;  2F5I A;  4MCR A;  4NEX A;  1Z8X A;  1B87 A;  2BO9 A;  3IJ3 A;  2PJB A;  2WPX A;  5AG7 A;  2ZEM A;  1YLO A;  3W6S A;  4JLY A;  1Q2C A;  2CXA A;  2C6G A;  2EK8 A;  1CP7 A;  1ARM A;  1X10 A;  3GLJ A;  4JJX A;  3NH8 A;  4M85 A;  1M4G A;  4QC6 A;  4KOW A;  1RO5 A;  2D4O A;  4X8I A;  4R3L A;  1S60 A;  3H5Z A;  4P4F A;  1S7L A;  4KVM E;  1K4J A;  3BXM A;  3G3S A;  4PXC A;  3JUW A;  4OLL A;  5LYD A;  1TF8 A;  3S9N A;  5C82 A;  1F57 A;  5EC4 A;  4CGO A;  2ANP A;  2IQ6 A;  3NH5 A;  3MRU A;  5AG4 A;  2JBK A;  2GU2 A;  2PJ5 A;  1IID A;  4UFW A;  3CZX A;  2I3C A;  3FVL A;  4XPL A;  1IOI A;  4NJR A;  4PV6 A;  2ZED A;  1YR0 A;  4LQ6 A;  2PIY A;  3KL9 A;  4P4I A;  3B7I A;  3MGD A;  1BO4 A;  4HNY B;  4MHN A;  4JXR A;  2VI7 A;  4YGO A;  1XIX A;  5KTD A;  2P0W A;  1Y9K A;  2D4P A;  4E2A A;  3KAS A;  3EY5 A;  3CPX A;  4JZ0 A;  1Q2Y A;  2CNT A;  2CY2 A;  2PRB A;  2VZZ A;  3B3W A;  3CXS A;  3H8F A;  3I9S A;  4NFR A;  4P45 A;  3SJE A;  4YWY A;  1WK4 A;  2B5G A;  2Q44 A;  2AFW A;  2Q4V A;  5JGF A;  3NE7 A;  1ZG8 A;  1P4N A;  5AG5 A;  4QBJ A;  2WPW A;  1KWM A;  4ZX9 A;  2AFU A;  2ODF A;  4JXQ A;  2FIA A;  4B11 A;  5C88 A;  3H4Q A;  1CBX A;  4TNU A;  1ELM P;  2FS5 A;  4FD4 A;  2AJ6 A;  2ZW6 A;  4OC5 A;  2PR8 A;  2OR4 A;  4NF1 A;  3QNV A;  5J1Q A;  1I1D A;  4NXY A;  4KZT A;  5K8N A;  3FF3 A;  2NMT A;  2PE3 A;  2C1C A;  1YW4 A;  2ZEO A;  1X12 A;  1QQ9 A;  3I1U A;  2PJ8 A;  3IWE A;  2OZG A;  3WC6 A;  4H2K A;  4B6Z A;  1Y0R A;  3IU1 A;  5DWM A;  4DNC A;  3QAY A;  1VIX A;  3FH4 A;  2BOA A;  1Z8L A;  4FWU A;  3NH4 A;  3WC5 A;  5JH9 A;  3GIU A;  1Z4R A;  1LRZ A;  3W6X A;  1M4I A;  4KS9 A;  1WWZ A;  1IU8 A;  2Y0M A;  2PVV A;  1Z5R A;  2DPS A;  4AB7 A;  3KGQ A;  3KHZ A;  1H8L A;  2PJ4 A;  1TXR A;  1LFW A;  4GXH A;  4CYN A;  3KI9 A;  4KVO E;  3PB8 X;  4DYO A;  2ABZ A;  3N7Z A;  3H8G A;  4P4E A;  5A27 A;  8CPA A;  4JD6 A;  4A31 A;  1CP6 A;  4U9Z A;  3PB6 X;  2F8H A;  2Z11 A;  2VQY A;  1YK3 A;  4PQA A;  2ZEF A;  2R98 A;  3D2P A;  3DDD A;  3GY9 A;  4X5K A;  1HEE A;  2OH1 A;  4B13 A;  2EUI A;  4WWV A;  2Z3M A;  2HC9 A;  4OAD A;  3S6G A;  3B3V A;  2B4B A;  4B5O A;  4JWP A;  1KUV A;  4FD5 A;  2OU2 A;  3NFZ A;  1EE3 P;  4IHM A;  3DR6 A;  1NSL A;  1J4J A;  3K9T A;  1ZLH A;  4IF5 A;  2OZU A;  2R7H A;  3MN8 A;  2AFX A;  2B5G B;  4NGT A;  2AFS A;  2REF A;  2PSW A;  3FIX A;  4K3N A;  2O4H A;  3DR8 A;  4UCP A;  4A33 A;  5A28 A;  2FVG A;  3D7G A;  3LWU A;  1I21 A;  4IK2 A;  4KOY A;  2ARH A;  4F8Z A;  2BCO A;  3D68 A;  3ZJ0 A;  3PZJ A;  1CPS A;  2PJ9 A;  2J8N A;  2GRE A;  4IUS A;  2JDC A;  3SJX A;  4OC2 A;  3D2M A;  2CTC A;  4AVC A;  4L8A A;  4NCZ A;  5I4M A;  2Z3N A;  4C7I A;  2ZXV A;  2AFZ A;  3PEI A;  2FIW A;  2Z3P A;  1VHE A;  5K8P A;  5ISV A;  2AFM A;  3PFO A;  4MCS A;  2HUZ A;  2O53 A;  3GYA A;  4NJQ A;  4UBR A;  1XRY A;  1TIQ A;  3P2F A;  4FD7 A;  2YNC C;  1IY7 A;  3IEH A;  1M4L A;  2FXF A;  4OC0 A;  4F9U A;  2FT0 A;  3KQZ A;  4MFZ A;  5IX3 A;  2P6F A;  4NGS A;  3TOB A;  2JBJ A;  3UY5 A;  4E0A A;  2DEA A;  3RNZ A;  4WJB A;  3R96 A;  2PJ7 A;  5K8M A;  2GE3 A;  1MJA A;  4ZI6 A;  2XEG A;  2DPT A;  3HLP A;  4KSA A;  3VWE A;  3QAH A;  1IGB A;  2WYR A;  2J8R A;  4KOR A;  4R9M A;  2ZEH A;  2QEC A;  1ARL A;  3IWG A;  2C27 A;  5HVH A;  3SI1 A;  2BL1 A;  2YNE A;  3KHX A;  7CPA A;  3TT2 A;  4OKO A;  4A37 A;  5K8O A;  4OIW A;  1S7F A;  5HH1 A;  4B12 A;  5CNP A;  2CTB A;  3RZA A;  2EVN A;  1Y0Y A;  1FNO A;  4C7H A;  1BPN A;  4R7M A;  2WZN A;  5EMI A;  3SJG A;  2YNC A;  2JEW A;  4UEF A;  1UWY A;  2ZEP A;  1HDU A;  4CAW A;  3FBU A;  4FUU A;  4OP4 A;  4PK3 A;  4UIB A;  4UIA A;  2J8M A;  4PXB A;  2HQY A;  3R95 A;  1YRE A;  3H8E A;  2RB7 A;  2AFO A;  4NGM A;  4UF4 A;  2HV2 A;  3DSB A;  2BSW A;  4ONW A;  3FJU A;  1S7K A;  2XEF A;  3S6K A;  5H84 A;  1XMT A;  2JDD A;  1F2P A;  4G1P A;  5I0C A;  1IB1 E;  3EO4 A;  3ISZ A;  4O23 A;  1ZG7 A;  2XEI A;  4MMO A;  3S6H A;  4CGP A;  4R87 A;  4M6I A;  5AG6 A;  4A94 A;  1B6B A;  1IYL A;  4R6T A;  4TWE A;  5F09 A;  4C2Z A;  2R1I A;  3D67 A;  4P4B A;  3V38 A;  2Q7B A;  3R9G A;  4CGN A;  1TKJ A;  2ZOF A;  4A2Z A;  2VXK A;  2OB0 A;  4KUB A;  4B10 A;  3TO9 A;  4MY0 A;  5LRK A;  4M6G A;  1LAN A;  4ZX8 A;  3TCV A;  4BBH A;  2PQ8 A;  1TKH A;  2KCW A;  2FCK A;  3TO7 A;  3F8K A;  1PYT B;  4CAE A;  4CGL A;  4X3R A;  3SI0 A;  3W91 A;  3IU2 A;  2NSM A;  4UFV A;  5CPA A;  2WUU A;  1XJO A;  2A4N A;  1Q2D A;  4RS2 A;  4FD6 A;  1NMT A;  3BJ8 A;  1R43 A;  1QMU A;  1U6M A;  4OME A;  3ZZI A;  3VWD A;  3RBU A;  4RN7 A;  4J3G A;  4NGQ A;  4PPZ A;  4C68 A;  3C26 A;  3LOD A;  2G9D A;  4IAV A;  2GLJ A;  3DNS A;  1MK4 A;  1FT7 A;  1RTQ A;  2PJ6 A;  4CGM A;  1S3Z A;  1BPM A;  2Q7S A;  1OZP A;  2FE7 A;  3FEE A;  3PBE A;  4MBU A;  1BLL E;  1TF9 A;  2GLF A;  4EME A;  5G22 A;  4CYQ A;  2PJ3 A;  3KR5 A;  2Z3L A;  5G20 A;  4PSX A;  4ONU A;  2OZH A;  3IC1 A;  2ZEN A;  4CYP A;  4C2Y A;  4UCM A;  1AMP A;  4H89 A;  3LAC A;  1NE9 A;  2Q04 A;  4K30 A;  2BEI A;  4HNW B;  4H6Z A;  3BI1 A;  5LYI A;  1VHS A;  3T9Y A;  2ZW7 A;  4F0Y A;  1GHE A;  2C6P A;  2EBJ A;  4R76 A;  4EVY A;  2QVP A;  3FYN A;  4A38 A;  4B5P A;  3F0A A;  1TKF A;  2ZEG A;  3WAB A;  3L2N A;  4B5P B;  4UWJ A;  1YGH A;  4CPA A;  2GIV A;  1P0H A;  4MHD A;  2EK9 A;  1GYT A;  1S5K A;  2PJ0 A;  4KOV A;  4UEZ A;  1KUY A;  1XF8 A;  4KSI A;  1AYE A;  4MRI A;  4X2T A;  5F49 A;  1IYK A;  4MHY A;  3KZW A;  1MJ9 A;  2VBQ A;  5HXD A;  2V8V A;  1AUG A;  3KKW A;  5FVJ A;  5LYL A;  2R8V A;  1YW6 A;  5J8F A;  3BJ7 A;  1R3N A;  3PBB A;  1SQH A;  5JPH A;  2JLM A;  3D7F A;  1PUA A;  1NSA A;  4R57 A;  4Y49 B;  3TFY A;  2F7V A;  3VAR A;  4UEE A;  2QIR A;  4MFQ A;  4PSW A;  5LRJ A;  1A2Z A;  3KQX A;  5HVG A;  2Q4Z A;  4R8F A;  3B3C A;  5GCN A;  4LQG A;  1VGY A;  4PXD A;  1M44 A;  3RAM A;  4HKF A;  3P2H A;  4KSF A;  2EO8 A;  1VKC A;  1Z2L A;  5G21 A;  4KUA A;  1F2O A; 
#chains in the Genus database with same CATH homology
 2GAN A;  4PK2 A;  2P6G A;  1YVK A;  5AGE A;  2REE A;  4A95 A;  1N71 A;  4BMH A;  4R3K A;  1I12 A;  1Y7R A;  4XPD C;  4CRZ B;  2B58 A;  2VEZ A;  4CAX A;  5EBV A;  4H6U A;  2I79 A;  4M3S A;  3FNC A;  4F0X A;  1Z9U A;  3SXN A;  3FB3 A;  1UFH A;  4MFK A;  2CNS A;  4A32 A;  1QSM A;  4OAE A;  2YGW A;  3BLN A;  5J8C A;  4Q38 A;  2Z3K A;  4QB9 A;  4Y49 C;  4KLV A;  4MY3 A;  4LUA A;  3F5B A;  4UWI A;  2FL4 A;  5KTC A;  4Q36 A;  1QSO A;  2AE6 A;  2B4D B;  3SXO A;  4AG7 A;  2CNM A;  3I3G A;  4II9 A;  2PDO A;  3D8P A;  1R57 A;  4YRH A;  2G3A A;  2RC4 A;  4KLW A;  5KTA A;  3PGP A;  4UA3 A;  2H5M A;  4U9Y A;  1QSN A;  2BUE A;  4LX9 A;  1Z4E A;  4XPK A;  2PR1 A;  3OWC A;  4GS4 A;  4KOX A;  3T90 A;  1KUX A;  4B14 A;  4CS0 B;  2Q0Y A;  4C2X A;  2ZW4 A;  3CXP A;  3WR7 A;  3GKR A;  1M1D A;  2WSA A;  3FRM A;  4XNH B;  1S7N A;  4MJ8 A;  4YFJ A;  4MFL A;  4F6A A;  1PU9 A;  2ZPA A;  2ZW5 A;  3JTK A;  3JVN A;  5JQ4 A;  4AG9 A;  1CM0 A;  2O28 A;  2K5T A;  4CRY B;  5IB0 A;  5HMN A;  3QB8 A;  2PC1 A;  2P6E A;  3R1K A;  5F47 A;  4L89 A;  1XEB A;  5G1Z A;  3IGR A;  1KZF A;  2X7B A;  1M4D A;  5IV0 A;  3TOA A;  3A9L A;  1MJB A;  1L0C A;  1YVO A;  4KOU A;  3EC4 A;  4QVT A;  4I49 A;  3B8G A;  4AVB A;  4UCN A;  1YLE A;  3TO6 A;  1QSR A;  2G3T A;  2B3U A;  4XPD B;  4CYO A;  3K9U A;  4QUS A;  5F46 A;  1CJW A;  4ORF A;  2I00 A;  5DWN A;  4A30 A;  2YND A;  4MI4 A;  5BWA B;  3PP9 A;  1BOB A;  3EXN A;  2VZY A;  3G8W A;  2B4D A;  3D3S A;  2FSR A;  2G0B A;  4XNH C;  1IIC A;  5F48 A;  4KVX A;  2IL4 A;  3LD2 A;  2DXQ A;  2Z10 A;  4CAF A;  2JEV A;  1XE4 A;  1ON0 A;  3CXQ A;  3TE4 A;  2Z0Z A;  3V8I A;  4RI1 A;  4KOT A;  1Y9W A;  4AVA A;  2QML A;  4ZBG A;  4CAV A;  1RXT A;  3FXT A;  1FY7 A;  4KOS A;  3EFA A;  2B3V A;  1V0C A;  3SHP A;  4ZGY B;  4MFJ A;  4HNX B;  3E0K A;  3R9F A;  1QST A;  3R9E A;  3TTH A;  5E96 A;  4MFP A;  4NSQ A;  3S6F A;  4E8O A;  1YX0 A;  3RYO A;  4UFX A;  2Q4Y A;  2Z3O A;  4U5Y A;  2ATR A;  5H86 A;  1ZO0 A;  4NEX A;  2F5I A;  1B87 A;  2WPX A;  5AG7 A;  3W6S A;  4JLY A;  1Q2C A;  2CXA A;  4QC6 A;  4M85 A;  4JJX A;  1M4G A;  4KOW A;  1RO5 A;  2D4O A;  4R3L A;  1S60 A;  3H5Z A;  1S7L A;  4KVM E;  1K4J A;  3G3S A;  3JUW A;  4OLL A;  5C82 A;  5EC4 A;  4CGO A;  5AG4 A;  1IID A;  4UFW A;  4XPL A;  4PV6 A;  1YR0 A;  3MGD A;  1BO4 A;  4HNY B;  4JXR A;  2VI7 A;  4YGO A;  1XIX A;  5KTD A;  2P0W A;  1Y9K A;  2D4P A;  4E2A A;  3EY5 A;  1Q2Y A;  2CNT A;  2CY2 A;  2PRB A;  2VZZ A;  3CXS A;  3I9S A;  1WK4 A;  2B5G A;  2Q44 A;  2Q4V A;  3NE7 A;  5AG5 A;  1P4N A;  4QBJ A;  2WPW A;  5C88 A;  4B11 A;  4JXQ A;  2FIA A;  3H4Q A;  2FS5 A;  4FD4 A;  2AJ6 A;  2ZW6 A;  2PR8 A;  4NF1 A;  1I1D A;  4NXY A;  4KZT A;  2NMT A;  3IWE A;  2OZG A;  3IU1 A;  5DWM A;  4DNC A;  1Z4R A;  1LRZ A;  3W6X A;  1M4I A;  4KS9 A;  1WWZ A;  2Y0M A;  4AB7 A;  2DPS A;  4CYN A;  4KVO E;  3N7Z A;  5A27 A;  4JD6 A;  4A31 A;  4U9Z A;  2Z11 A;  2VQY A;  1YK3 A;  4X5K A;  2R98 A;  3D2P A;  3DDD A;  3GY9 A;  4B13 A;  2OH1 A;  2EUI A;  2Z3M A;  4OAD A;  3S6G A;  2B4B A;  4B5O A;  4JWP A;  1KUV A;  4FD5 A;  2OU2 A;  3DR6 A;  1NSL A;  1J4J A;  4IF5 A;  2OZU A;  2R7H A;  2B5G B;  2REF A;  3FIX A;  2PSW A;  5A28 A;  3DR8 A;  4A33 A;  4UCP A;  4KOY A;  1I21 A;  2ARH A;  3ZJ0 A;  3PZJ A;  2J8N A;  4IUS A;  2JDC A;  3D2M A;  4AVC A;  4L8A A;  4NCZ A;  2Z3N A;  4C7I A;  2ZXV A;  2FIW A;  2Z3P A;  5ISV A;  2HUZ A;  4UBR A;  3GYA A;  3P2F A;  1TIQ A;  4FD7 A;  2YNC C;  2FXF A;  2FT0 A;  4MFZ A;  5IX3 A;  2P6F A;  3TOB A;  3UY5 A;  4E0A A;  3R96 A;  2GE3 A;  1MJA A;  2DPT A;  4KSA A;  3VWE A;  3QAH A;  2J8R A;  4KOR A;  4R9M A;  2QEC A;  3IWG A;  2C27 A;  2BL1 A;  2YNE A;  3TT2 A;  1S7F A;  5HH1 A;  4B12 A;  5CNP A;  2EVN A;  4C7H A;  2YNC A;  4CAW A;  3FBU A;  3R95 A;  4PK3 A;  4B5P B;  2J8M A;  2HQY A;  1YRE A;  2HV2 A;  3DSB A;  2BSW A;  1S7K A;  3S6K A;  5H84 A;  1XMT A;  2JDD A;  5I0C A;  1IB1 E;  3EO4 A;  3S6H A;  4CGP A;  4R87 A;  5AG6 A;  1B6B A;  1IYL A;  4C2Z A;  2R1I A;  2Q7B A;  3R9G A;  4CGN A;  4A2Z A;  2VXK A;  2OB0 A;  4KUB A;  4B10 A;  3TO9 A;  4MY0 A;  3TCV A;  4BBH A;  2PQ8 A;  2KCW A;  2FCK A;  3TO7 A;  3F8K A;  4CAE A;  4CGL A;  3W91 A;  3IU2 A;  4UFV A;  2WUU A;  2A4N A;  1Q2D A;  4RS2 A;  4FD6 A;  1NMT A;  3BJ8 A;  1U6M A;  3ZZI A;  3VWD A;  4J3G A;  4C68 A;  3C26 A;  3LOD A;  3DNS A;  1MK4 A;  4CGM A;  1S3Z A;  1OZP A;  2FE7 A;  4MBU A;  5G22 A;  4CYQ A;  2Z3L A;  5G20 A;  4PSX A;  4ONU A;  2OZH A;  4CYP A;  4C2Y A;  4UCM A;  4H89 A;  1NE9 A;  2Q04 A;  4K30 A;  2BEI A;  4HNW B;  4H6Z A;  4F0Y A;  1VHS A;  3T9Y A;  2ZW7 A;  1GHE A;  4EVY A;  3FYN A;  4B5P A;  3F0A A;  4UWJ A;  1YGH A;  2GIV A;  1P0H A;  4MHD A;  1S5K A;  4KOV A;  1KUY A;  1XF8 A;  5F49 A;  1IYK A;  1MJ9 A;  2VBQ A;  3KKW A;  5FVJ A;  2R8V A;  5J8F A;  3BJ7 A;  1SQH A;  5JPH A;  2JLM A;  1PUA A;  4R57 A;  4Y49 B;  3TFY A;  2QIR A;  4MFQ A;  4PSW A;  5GCN A;  1M44 A;  4HKF A;  3P2H A;  4KSF A;  1VKC A;  5G21 A;  4KUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...