5C88A

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus in monoclinic form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
b'DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
pubmed doi rcsb
source organism Sulfolobus solfataricus strain p2
molecule tags Transferase
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c88A00
4GS4A 5IX3A 1YR0A 1I1DA 1M4GA 3VWEA 2FXFA 3PP9A 1V0CA 2KCWA 2B4DB 2PC1A 4OAEA 3DR6A 2B58A 5KTDA 2EUIA 2B4DA 2RC4A 1YK3A 1SQHA 3CXQA 4H6ZA 2Q04A 4BMHA 2ATRA 4CRYB 1NMTA 3F8KA 3MGDA 3V8IA 2J8NA 2Z11A 4R9MA 3TO6A 4YFJA 4JD6A 3ZJ0A 2Q4YA 3ZZIA 1XMTA 4R87A 3R9EA 2OB0A 2Q0YA 3KKWA 4JJXA 3TCVA 4M85A 1KUYA 1QSTA 2WPWA 5CNPA 3EXNA 5F47A 3EO4A 2Q7BA 4F6AA 2P0WA 2Z10A 1YREA 3OWCA 2PSWA 4L8AA 2R98A 2FT0A 3TO9A 3D2MA 5F46A 4KUBA 2VEZA 4FD6A 2OU2A 2FSRA 4J3GA 3IGRA 4B5OA 4ZBGA 5JPHA 2FL4A 3F0AA 1Y9WA 3FBUA 3H4QA 5H84A 4XNHC 1YVOA 1S5KA 1Y7RA 2B5GA 4QB9A 5KTAA 1RO5A 2FIAA 5C88A 1IB1E 2JEVA 5ISVA 1NE9A 4ORFA 1MJAA 1VHSA 4KORA 2PQ8A 4KZTA 3C26A 1TIQA 1IYKA 4I49A 2NMTA 3WR7A 2QMLA 3LD2A 1M1DA 2OZGA 3FIXA 5I0CA 2R7HA 3UY5A 4CS0B 4XPDC 4KOWA 2FE7A 3W6XA 2CNTA 4ONUA 3CXSA 4E2AA 3SXOA 3CXPA 1WWZA 2PR8A 1I12A 2AJ6A 2VZYA 4MBUA 4NCZA 4NXYA 4CAWA 4KLVA 4QC6A 4H89A 5J8FA 4XNHB 1QSOA 2GE3A 4M3SA 2A4NA 1R57A 2J8RA 3R1KA 2P6GA 2BSWA 1B6BA 1Q2YA 1MK4A 3GYAA 5J8CA 5E96A 4JXQA 2BEIA 5JQ4A 4HKFA 4PSWA 5HH1A 2Q44A 4IUSA 4XPDB 2G3TA 1N71A 4R3LA 4KOVA 5F49A 5EBVA 2PDOA 3I9SA 2BL1A 1QSMA 2VXKA 3TOBA 1Q2CA 4FD5A 4KVME 1IIDA 4MY0A 4KOTA 4PK3A 3D8PA 2WPXA 3EC4A 1ON0A 4KOYA 4JWPA 4NEXA 4U9YA 4HNXB 4JLYA 4IF5A 3P2FA 1MJBA 4UWIA 1CM0A 4DNCA 2Y0MA 2GIVA 3R96A 3TTHA 2VQYA 1I21A 3DNSA 2HUZA 2O28A 2JDDA 1BOBA 3BJ7A 5FVJA 2ARHA 3S6HA 1P4NA 4H6UA 2DXQA 3DR8A 3EY5A 4KUAA 3DDDA 3BLNA 2B5GB 4II9A 4QVTA 2VI7A 4R57A 1YGHA 4KVXA 1KUVA 4YGOA 3BJ8A 3JUWA 2REEA 2R1IA 1S7NA 2REFA 4NF1A 1UFHA 2VZZA 4KLWA 1IYLA 2B3UA 5KTCA 3R9FA 1XIXA 2G0BA 4KOSA 1BO4A 1L0CA 4XPKA 2K5TA 4UA3A 2ZW5A 4AVCA 3RYOA 2G3AA 5DWNA 4OLLA 4X5KA 5GCNA 3FB3A 2C27A 3FXTA 4XPLA 2JDCA 1XF8A 5F48A 1PUAA 3SHPA 5IB0A 1P0HA 4L89A 2B4BA 4PV6A 2GANA 3K9UA 1M44A 2ZW6A 4LUAA 5EC4A 3D3SA 2CNMA 3D2PA 3T90A 4MI4A 4YRHA 4K30A 2ZXVA 2BUEA 3T9YA 2F5IA 1S7FA 2FIWA 1Z9UA 1S7KA 3R95A 3PGPA 1M4IA 1FY7A 3R9GA 4B5PB 3TOAA 4U9ZA 1Z4EA 4CAVA 2FS5A 2HQYA 2ZW4A 3QAHA 4B5PA 1Y9KA 4PSXA 3GKRA 2CY2A 2D4OA 1NSLA 4CAXA 1Q2DA 3W91A 1CJWA 3LODA 1KZFA 3FYNA 2CNSA 2R8VA 3FNCA 1K4JA 4MY3A 1S7LA 2OH1A 2X7BA 1XEBA 4R3KA 2OZHA 4Y49B 1U6MA 2EVNA 2JLMA 3B8GA 2I00A 1B87A 1S3ZA 3EFAA 3NE7A 4RS2A 2ZW7A 4FD4A 4FD7A 3SXNA 4KOUA 5DWMA 3DSBA 3S6KA 1YLEA 3I3GA 1M4DA 4MHDA 4AG7A 2VBQA 4QUSA 3P2HA 3S6FA 3QB8A 2PRBA 4CRZB 4PK2A 3TO7A 3W6SA 3G3SA 4UBRA 1IICA 2J8MA 3TE4A 3IWGA 3S6GA 4E0AA 5H86A 3G8WA 2H5MA 1LRZA 2PR1A 2B3VA 2ZPAA 4RI1A 4HNYB 2I79A 4E8OA 4U5YA 1OZPA 4JXRA 1YVKA 4HNWB 2D4PA 4F0YA 2HV2A 4OADA 4LX9A 2Q4VA 4AG9A 5C82A 1J4JA 3N7ZA 4KOXA 1QSRA 4KVOE 2Z0ZA 4AVBA 3FRMA 4MJ8A 1Z4RA 3JVNA 3TFYA 3TT2A 5HMNA 1PU9A 1MJ9A 1YX0A 1GHEA 2P6FA 3E0KA 3F5BA 1RXTA 1KUXA 5IV0A 1VKCA 4AVAA 2QIRA 4AB7A 2AE6A 1QSNA 2OZUA 2FCKA 4NSQA 2P6EA 3GY9A 1XE4A 1S60A 4UWJA 4Y49C 1WK4A 3VWDA 2IL4A 4EVYA 3PZJA 4QBJA 2QECA
chains in the Genus database with same CATH superfamily
3IO1A 4GS4A 4BD9A 4C7IA 2ZEDA 4ZGYB 5IX3A 2ZEMA 1YR0A 1Z5RA 1I1DA 1M4GA 4RN7A 4B12A 1CG2A 3VWEA 1IGBA 2FXFA 3PP9A 1V0CA 1LFWA 4CYNA 2KCWA 2B4DB 1ZG7A 2PC1A 3KR5A 1JQGA 1F2PA 4OAEA 4ZY1A 3DR6A 2Z3LA 2B58A 2QYVA 2WSAA 4A30A 5KTDA 2EUIA 3RNZA 1TKJA 2B4DA 1YK3A 2RC4A 4JYWA 1SQHA 3CXQA 3BXMA 4H6ZA 2Q04A 4BMHA 2ATRA 4MFLA 4CRYB 1NMTA 7CPAA 2OOTA 4WWVA 3F8KA 3MGDA 2PCUA 4TNUA 4PPZA 3S9LA 3V8IA 3WT4A 2J8NA 4CGMA 2Z11A 4A32A 4R9MA 3TO6A 3FMCA 4YFJA 4JD6A 1EE3P 3ZJ0A 2Q4YA 3ZZIA 1ARMA 1XMTA 4R87A 1Y7EA 3R9EA 2OB0A 2Q0YA 3KKWA 2AFZA 1YW4A 4JJXA 3TCVA 4M85A 1XMBA 1KUYA 1QSTA 2PJ5A 2WPWA 4MFQA 3WC5A 5CNPA 1CX8A 1AUGA 3EXNA 5F47A 3EO4A 2Q7BA 4F6AA 2P0WA 4R7MA 2Z10A 4UCNA 1YREA 4P44A 3SJEA 4C2XA 3D7HA 4OP4A 3PB4X 4AVCA 4UF4A 3V38A 4EWTA 3B3VA 1CBXA 1ZG8A 2PSWA 2Q51A 3OWCA 2ZENA 4L8AA 4OMEA 3RO0A 5JH9A 4K3NA 1IY7A 3H8GA 2R98A 2ZOGA 2FT0A 4OC5A 1IOFA 1LOKA 4H2KA 3TO9A 4B10A 3S9MA 3D2MA 1XBUA 4EFDA 5F46A 4Q38A 4NGPA 4KUBA 2VEZA 4FD6A 4PXDA 4R6TA 2PJ1A 2OU2A 3L2NA 3KZWA 2FSRA 5K8MA 2WYRA 2WUUA 4J3GA 3VH9A 4CGOA 1Y0RA 3IGRA 4B5OA 1LAPA 4ZBGA 5JPHA 2FL4A 2J9AA 3CPXA 3F0AA 3NA6A 5LYDA 1X10A 4P45A 4CYQA 2PRQA 2IMOA 1Y9WA 3FBUA 3PFEA 3H4QA 2EK8A 5H84A 3SI1A 1ZG9A 2PJ3A 3SJFA 4XNHC 1YVOA 4UFXA 4F9UA 4IHMA 4NGRA 1LANA 4DJLA 1S5KA 4ZI6A 1Y7RA 2B5GA 3B3WA 2NSMA 1RO5A 4QB9A 5KTAA 1VIXA 2EO8A 2FIAA 5C88A 1IB1E 4ZY2A 3B2YA 3T8WA 4CYOA 3TX8A 3B7IA 2JEVA 1F2OA 2PJ6A 5ISVA 1NE9A 4ORFA 1MJAA 1Q7LA 2BCOA 1VHSA 3D66A 4KORA 4KSIA 2PQ8A 1BPMA 4KZTA 3C26A 4NGSA 1TIQA 2RFHA 4MCRA 1IYKA 4I49A 4FBEA 1FT7A 2NMTA 3WR7A 4P4DA 2QMLA 4IK2A 3LD2A 2PJBA 1M1DA 2OZGA 3FIXA 5I0CA 2R7HA 5A28A 3UY5A 4CS0B 3D67A 3DLJA 1Y0YA 4KOWA 4XPDC 5LRKA 3IWEA 2AFWA 2FE7A 4UFVA 4MHNA 3CPAA 2CNTA 3W6XA 4ONUA 3CXSA 4NJRA 4Q36A 5LRJA 2NYQA 4E2AA 2Q4ZA 3NH4A 4NFRA 3CXPA 4M6IA 3PEIA 2V8GA 3SXOA 4FAIA 1WWZA 4LQGA 2PR8A 1IOIA 1I12A 2AJ6A 3KQZA 2VZYA 3PRTA 1OBRA 4MBUA 3KHXA 4NCZA 4CGLA 3IU1A 1F57A 4NXYA 4CAWA 2PIYA 4KLVA 4MHZA 1Z8XA 5HVGA 3TC8A 4QC6A 2Z3OA 4H89A 4A95A 2PJ2A 5J8FA 2JBJA 2O53A 4XNHB 1YSJA 4OKOA 2ZELA 4UFWA 3LWUA 1QSOA 3SI0A 5BWAB 5AG7A 2GE3A 4M3SA 4BINA 2A4NA 4X3RA 1R57A 2ODFA 2J8RA 4UIBA 2POKA 2ZEEA 3R1KA 4NGQA 5HVFA 4A94A 1YMEA 3NE8A 1KWMA 2PJ7A 4MFJA 2P6GA 2BSWA 1B6BA 6CPAA 2Q43A 2V77A 1Q2YA 1MK4A 3GYAA 1JWQA 3KHZA 8CPAA 5J8CA 4P6YA 1PYTB 2PJ9A 5E96A 2PIZA 4GXHA 3RBUA 4JXQA 2BEIA 1BPNA 3JTKA 5JQ4A 4HKFA 4PSWA 2FVGA 4A2ZA 2CTCA 5HH1A 4Z65A 2Q44A 4IUSA 1ZLIA 4CAEA 4ZYQA 1Z8TA 4XPDB 2G3TA 1N71A 1PCAA 3HLPA 4JZ0A 4R3LA 4KOVA 5F49A 4F9VA 4OC2A 2GLJA 5EBVA 2PDOA 3GLJA 4P4FA 3ISZA 2AFMA 2V8DA 3DGVA 4MCQA 1H8LA 3I9SA 2JBKA 4CYPA 4A37A 2BL1A 3FJUA 2ABZA 2F8HA 1QSMA 4CGPA 3BHXA 2VXKA 3TOBA 1Q2CA 2O4HA 4FD5A 1IIDA 4KVME 5JM6A 3VATA 4MY0A 3H8FA 4KOTA 4KS9A 3KR4A 1BAVA 4PK3A 5IB9A 1LAMA 3D8PA 3K9TA 1YQEA 1IU8A 2WPXA 4MXUA 4M6HA 1UWYA 1R43A 2YNEA 2ZEPA 1ON0A 3EC4A 4KOYA 4PQAA 4JWPA 4NEXA 3GUXA 4U9YA 2ZOFA 2C6PA 2XEIA 4HNXB 4JLYA 4B11A 4IF5A 1MJBA 3P2FA 3FX6A 4UWIA 1CM0A 3BI0A 4DNCA 2Y0MA 1HDQA 2GIVA 1QQ9A 3PB9X 3R96A 4B13A 3TTHA 3NH8A 2VQYA 4RUHA 2PJ4A 3IEHA 1I21A 3DNSA 5D29A 5J1QA 2HUZA 2O28A 2JDDA 4NGTA 1Z8WA 2I3CA 3BI1A 2G9DA 1BOBA 3BJ7A 3KL9A 4W9YA 5FVJA 2ARHA 4GM5A 1P4NA 3S6HA 4H6UA 2DXQA 2EBJA 5CPAA 3DR8A 1ELMP 3EY5A 3DDDA 4KUAA 4YU9A 2C6CA 3BLNA 3WABA 2B5GB 4II9A 4OC4A 4QVTA 2VI7A 3H5ZA 3HUVA 4R57A 1YGHA 3IU2A 2ZEFA 1KUVA 4KVXA 4YGOA 4B6ZA 1ARLA 3BJ8A 3LMSA 1TF8A 5ELYA 3JUWA 2REEA 4TWEA 2R1IA 1S7NA 2REFA 4NF1A 4X8IA 3MN8A 1UFHA 2V8VA 4R8FA 5K8OA 2VZZA 2CXAA 3D7DA 4KLWA 4C2YA 2JEWA 5AG6A 2V8HA 1IYLA 2B3UA 2GREA 3D7GA 5KTCA 1TF9A 3R9FA 1XIXA 4CAFA 2GLFA 3KI9A 4R76A 5HXDA 2G0BA 4KOSA 4MHYA 4OC0A 4MFZA 1BO4A 1L0CA 2AFSA 2K5TA 4UA3A 2ZW5A 4XPKA 3H8EA 5EMIA 2G3AA 5DWNA 4OLLA 2Z3PA 4X5KA 3PBEA 5GCNA 3RYOA 4F0XA 3FB3A 2HB6A 4CGNA 2C27A 5G21A 3FXTA 4XPLA 2JDCA 1Z8LA 1XF8A 2QVPA 5F48A 1PUAA 4OIWA 4EMEA 5F09A 3SHPA 2PVVA 5IB0A 1P0HA 1A2ZA 1CP6A 2F7VA 4L89A 2B4BA 4PV6A 1CPSA 2GANA 4KSFA 3K9UA 3IWWA 1M44A 2QJ8A 2ZW6A 4LUAA 5EC4A 3KQXA 3D68A 3CZXA 4MFKA 3D3SA 2CNMA 3KASA 3D2PA 3T90A 4MI4A 1XFOA 2GFQA 4ZX9A 3CDXA 2RB7A 5AG4A 3FECA 5JGFA 1QMUA 5A27A 3WC7A 1YW6A 5LYFA 4YRHA 2YNCC 4K30A 4DUKA 2ZEOA 2BUEA 2ZXVA 4IAVA 4PXCA 3T9YA 3I1UA 3A9LA 3IJ3A 2PVWA 2F5IA 4MFPA 2WZNA 3FVLA 4A31A 4FUUA 1S7FA 2FIWA 1Z9UA 1S7KA 3R95A 3PGPA 1M4IA 1FY7A 2PJ0A 4MCPA 3R9GA 4B5PB 3ISXA 3PFOA 3TOAA 1R3NA 4U9ZA 3NH5A 3IFEA 3RZAA 1Z4EA 3S9NA 4Q7AA 4NGMA 4CAVA 2FS5A 1DTDA 2HQYA 5AG5A 5HVHA 2ZW4A 3QAHA 4B5PA 1XOVA 1Y9KA 4PSXA 3VARA 3GKRA 4P4IA 1ZLHA 2CY2A 2AFOA 3RAMA 3PB8X 2D4OA 1NSLA 4CAXA 1Q2DA 1XRYA 3W91A 1CP7A 1FNOA 2PJ8A 1CJWA 3LODA 1KZFA 1BLLE 3FYNA 2CNSA 2R8VA 3FNCA 3QAYA 1K4JA 5DS0A 2Z3MA 4CPAA 3CT9A 4MY3A 1S7LA 4P4EA 3MRUA 2OH1A 2CTBA 2X7BA 4UEFA 1XEBA 3GB0A 5D8NA 1TKHA 1LCPA 5LYIA 4R3KA 2PJCA 2OZHA 4KSAA 4Y49B 3WC6A 1U6MA 2EVNA 2JLMA 3NFZA 4OC1A 3PB7X 2Z3NA 3B8GA 2I00A 1B87A 1S3ZA 3EFAA 3K2KA 3NE7A 2YNCA 4RS2A 4C2ZA 4PXBA 5I4MA 2ZW7A 4FWUA 2BOAA 3FEDA 3SI2A 3SJGA 4FD4A 4FD7A 3SXNA 4PXEA 1TXRA 4KOUA 5DWMA 4M6GA 4UCMA 3FH4A 3DSBA 3S6KA 4MMOA 5K8NA 1YLEA 3FEEA 5LYLA 2BO9A 3I3GA 1M4DA 3B3TA 4UIAA 1AYEA 4MHDA 4AG7A 4G1PA 2CIJA 4B14A 2VBQA 4QUSA 3P2HA 3S6FA 3QB8A 2EWBA 2PRBA 2Z3KA 4OC3A 4WJBA 4PK2A 4AXVA 4CRZB 3B3CA 3TO7A 3D4UA 3W6SA 3G3SA 4UBRA 5LRGA 2IJZA 1IICA 2J8MA 4P4BA 4HPSA 3TE4A 1HEEA 3B3SA 2PE3A 1AMPA 3IWGA 2XEFA 3S6GA 4ZY0A 1TKFA 4BBHA 4E0AA 3LACA 3N5FA 4X2TA 2YGWA 3GIUA 2EK9A 4ONWA 5H86A 4C7HA 1GYTA 2HC9A 3G8WA 2DPSA 1XJOA 1LRZA 2H5MA 2DPTA 2PR1A 2ZEHA 4UEEA 5G22A 2B3VA 2ZPAA 5CBMA 3PB6X 4HNYB 4RI1A 2ANPA 2I79A 4YWYA 4E8OA 4U5YA 1OZPA 3V7ZA 4NGNA 4JXRA 4OIDA 4MHPA 4A39A 2VL1A 3QNVA 3SJXA 4P4JA 1YVKA 4HNWB 2D4PA 4C68A 3PBBA 1YLOA 1M4LA 4F8ZA 2CF4A 3FF3A 4F0YA 4UEZA 2HV2A 4OADA 2IQ6A 1VHEA 4LX9A 5THWA 2XEGA 2Q4VA 1VGYA 2Q7SA 2ZEGA 4AG9A 5C82A 1J4JA 4O23A 1DE4C 1RTQA 3N7ZA 4KOXA 1QSRA 3IIBA 4KVOE 4NJQA 2Z0ZA 4AVBA 3B35A 3FRMA 1HDUA 4MJ8A 1Z4RA 3D7FA 3JVNA 5K8PA 3TFYA 1Z2LA 3TT2A 5HMNA 1PU9A 3JRUA 1MJ9A 5G1ZA 1YX0A 1GHEA 2P6FA 3E0KA 3F5BA 4A38A 1RXTA 1KUXA 5IV0A 1VKCA 2DF5A 1X12A 5AGEA 2AFUA 1ELLP 4AVAA 1NSAA 2XEJA 2QIRA 4ZX8A 4AB7A 2AE6A 2YNDA 2OZUA 1QSNA 3KGQA 2FCKA 4NSQA 4MRIA 1VHOA 2P6EA 4P10A 3GY9A 2GU2A 1XE4A 1S60A 4UWJA 4Y49C 2OR4A 4DYOA 2C1CA 1CPXA 1WK4A 3IC1A 5G20A 4A33A 3VWDA 2AFXA 2IL4A 4EVYA 2DEAA 3PZJA 4LQ6A 4QBJA 2PJAA 2QECA 4MCSA 4UCPA 1ZO0A 2C6GA
chains in the Genus database with same CATH topology
4GS4A 4C7IA 4ZGYB 5IX3A 1YR0A 1I1DA 1M4GA 4B12A 3VWEA 2FXFA 3PP9A 1V0CA 4CYNA 2KCWA 2B4DB 2PC1A 4OAEA 3DR6A 2Z3LA 2B58A 2WSAA 4A30A 5KTDA 2EUIA 2B4DA 2RC4A 1YK3A 1SQHA 3CXQA 4H6ZA 2Q04A 4BMHA 2ATRA 4MFLA 4CRYB 1NMTA 3F8KA 3MGDA 3V8IA 2J8NA 4CGMA 2Z11A 4A32A 4R9MA 3TO6A 4YFJA 4JD6A 3ZJ0A 2Q4YA 3ZZIA 1XMTA 4R87A 3R9EA 2OB0A 2Q0YA 3KKWA 4JJXA 3TCVA 4M85A 1KUYA 1QSTA 4MFQA 2WPWA 5CNPA 3EXNA 5F47A 3EO4A 2Q7BA 4F6AA 2P0WA 2Z10A 4UCNA 1YREA 4C2XA 3OWCA 2PSWA 4L8AA 2R98A 2FT0A 3TO9A 4B10A 3D2MA 5F46A 4Q38A 4KUBA 2VEZA 4FD6A 2OU2A 2FSRA 4CGOA 2WUUA 4J3GA 3IGRA 4B5OA 4ZBGA 5JPHA 2FL4A 3F0AA 4CYQA 1Y9WA 3FBUA 3H4QA 5H84A 4XNHC 1YVOA 4UFXA 1S5KA 1Y7RA 2B5GA 4QB9A 5KTAA 1RO5A 2FIAA 5C88A 1IB1E 4CYOA 2JEVA 5ISVA 1NE9A 4ORFA 1MJAA 1VHSA 4KORA 2PQ8A 4KZTA 3C26A 1TIQA 1IYKA 4I49A 2NMTA 3WR7A 2QMLA 3LD2A 1M1DA 2OZGA 3FIXA 5I0CA 2R7HA 5A28A 3UY5A 4CS0B 4XPDC 4KOWA 3IWEA 2FE7A 4UFVA 3W6XA 2CNTA 4ONUA 3CXSA 4Q36A 4E2AA 3SXOA 3CXPA 1WWZA 2PR8A 1I12A 2AJ6A 2VZYA 4CGLA 4MBUA 4NCZA 3IU1A 4NXYA 4CAWA 4KLVA 4QC6A 2Z3OA 4H89A 4A95A 5J8FA 4XNHB 4UFWA 1QSOA 5BWAB 5AG7A 2GE3A 4M3SA 2A4NA 1R57A 2J8RA 3R1KA 4MFJA 2P6GA 2BSWA 1B6BA 1Q2YA 1MK4A 3GYAA 5J8CA 5E96A 4JXQA 2BEIA 5JQ4A 3JTKA 4HKFA 4PSWA 4A2ZA 5HH1A 2Q44A 4IUSA 4CAEA 4XPDB 2G3TA 1N71A 4R3LA 4KOVA 5F49A 5EBVA 2PDOA 3I9SA 4CYPA 2BL1A 4CGPA 1QSMA 2VXKA 3TOBA 1Q2CA 4FD5A 4KVME 1IIDA 4MY0A 4KS9A 4KOTA 4PK3A 3D8PA 2WPXA 2YNEA 3EC4A 1ON0A 4KOYA 4JWPA 4NEXA 4U9YA 4HNXB 4JLYA 4B11A 4IF5A 3P2FA 1MJBA 4UWIA 1CM0A 4DNCA 2Y0MA 2GIVA 3R96A 4B13A 3TTHA 2VQYA 1I21A 3DNSA 2HUZA 2O28A 2JDDA 1BOBA 3BJ7A 5FVJA 2ARHA 3S6HA 1P4NA 4H6UA 2DXQA 3DR8A 3EY5A 4KUAA 3DDDA 3BLNA 2B5GB 4II9A 4QVTA 2VI7A 3H5ZA 4R57A 1YGHA 3IU2A 4KVXA 1KUVA 4YGOA 3BJ8A 3JUWA 2REEA 2R1IA 1S7NA 2REFA 4NF1A 1UFHA 2VZZA 2CXAA 4KLWA 4C2YA 5AG6A 1IYLA 2B3UA 5KTCA 4CAFA 3R9FA 1XIXA 2G0BA 4KOSA 4MFZA 1BO4A 1L0CA 4XPKA 2K5TA 4UA3A 2ZW5A 4AVCA 3RYOA 2G3AA 5DWNA 4OLLA 2Z3PA 4X5KA 4F0XA 5GCNA 3FB3A 4CGNA 2C27A 5G21A 3FXTA 4XPLA 2JDCA 1XF8A 5F48A 1PUAA 3SHPA 5IB0A 1P0HA 4L89A 2B4BA 4PV6A 2GANA 4KSFA 3K9UA 1M44A 2ZW6A 4LUAA 5EC4A 4MFKA 3D3SA 2CNMA 3D2PA 3T90A 4MI4A 5AG4A 5A27A 4YRHA 2YNCC 4K30A 2ZXVA 2BUEA 3T9YA 3A9LA 2F5IA 4MFPA 4A31A 1S7FA 2FIWA 1Z9UA 1S7KA 3R95A 3PGPA 1M4IA 1FY7A 3R9GA 4B5PB 3TOAA 4U9ZA 1Z4EA 4CAVA 2FS5A 2HQYA 5AG5A 2ZW4A 3QAHA 4B5PA 1Y9KA 4PSXA 3GKRA 2CY2A 2D4OA 1NSLA 4CAXA 1Q2DA 3W91A 1CJWA 3LODA 1KZFA 3FYNA 2CNSA 2R8VA 3FNCA 1K4JA 2Z3MA 4MY3A 1S7LA 2OH1A 2X7BA 1XEBA 4R3KA 2OZHA 4KSAA 4Y49B 1U6MA 2EVNA 2JLMA 2Z3NA 3B8GA 2I00A 1B87A 1S3ZA 3EFAA 3NE7A 2YNCA 4RS2A 4C2ZA 2ZW7A 4FD4A 4FD7A 3SXNA 4KOUA 5DWMA 4UCMA 3DSBA 3S6KA 1YLEA 3I3GA 1M4DA 4MHDA 4AG7A 4B14A 2VBQA 4QUSA 3P2HA 3S6FA 3QB8A 2PRBA 2Z3KA 4CRZB 4PK2A 3TO7A 3W6SA 3G3SA 4UBRA 1IICA 2J8MA 3TE4A 3IWGA 3S6GA 4BBHA 4E0AA 2YGWA 4C7HA 5H86A 3G8WA 2DPSA 2H5MA 1LRZA 5G22A 2DPTA 2PR1A 2B3VA 2ZPAA 4RI1A 4HNYB 2I79A 4E8OA 4U5YA 1OZPA 4JXRA 1YVKA 4HNWB 2D4PA 4C68A 4F0YA 2HV2A 4OADA 4LX9A 2Q4VA 4AG9A 5C82A 1J4JA 3N7ZA 4KOXA 1QSRA 4KVOE 2Z0ZA 4AVBA 3FRMA 4MJ8A 1Z4RA 3JVNA 3TFYA 3TT2A 5HMNA 1PU9A 1MJ9A 5G1ZA 1YX0A 1GHEA 2P6FA 3E0KA 3F5BA 1RXTA 1KUXA 5IV0A 1VKCA 5AGEA 4AVAA 2QIRA 4AB7A 2AE6A 2YNDA 1QSNA 2OZUA 2FCKA 4NSQA 2P6EA 3GY9A 1XE4A 1S60A 4UWJA 4Y49C 5G20A 1WK4A 4A33A 3VWDA 2IL4A 4EVYA 3PZJA 4QBJA 2QECA 4UCPA 1ZO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS4 A;  5IX3 A;  1YR0 A;  1I1D A;  1M4G A;  3VWE A;  2FXF A;  3PP9 A;  1V0C A;  2KCW A;  2B4D B;  2PC1 A;  4OAE A;  3DR6 A;  2B58 A;  5KTD A;  2EUI A;  2B4D A;  2RC4 A;  1YK3 A;  1SQH A;  3CXQ A;  4H6Z A;  2Q04 A;  4BMH A;  2ATR A;  4CRY B;  1NMT A;  3F8K A;  3MGD A;  3V8I A;  2J8N A;  2Z11 A;  4R9M A;  3TO6 A;  4YFJ A;  4JD6 A;  3ZJ0 A;  2Q4Y A;  3ZZI A;  1XMT A;  4R87 A;  3R9E A;  2OB0 A;  2Q0Y A;  3KKW A;  4JJX A;  3TCV A;  4M85 A;  1KUY A;  1QST A;  2WPW A;  5CNP A;  3EXN A;  5F47 A;  3EO4 A;  2Q7B A;  4F6A A;  2P0W A;  2Z10 A;  1YRE A;  3OWC A;  2PSW A;  4L8A A;  2R98 A;  2FT0 A;  3TO9 A;  3D2M A;  5F46 A;  4KUB A;  2VEZ A;  4FD6 A;  2OU2 A;  2FSR A;  4J3G A;  3IGR A;  4B5O A;  4ZBG A;  5JPH A;  2FL4 A;  3F0A A;  1Y9W A;  3FBU A;  3H4Q A;  5H84 A;  4XNH C;  1YVO A;  1S5K A;  1Y7R A;  2B5G A;  4QB9 A;  5KTA A;  1RO5 A;  2FIA A;  5C88 A;  1IB1 E;  2JEV A;  5ISV A;  1NE9 A;  4ORF A;  1MJA A;  1VHS A;  4KOR A;  2PQ8 A;  4KZT A;  3C26 A;  1TIQ A;  1IYK A;  4I49 A;  2NMT A;  3WR7 A;  2QML A;  3LD2 A;  1M1D A;  2OZG A;  3FIX A;  5I0C A;  2R7H A;  3UY5 A;  4CS0 B;  4XPD C;  4KOW A;  2FE7 A;  3W6X A;  2CNT A;  4ONU A;  3CXS A;  4E2A A;  3SXO A;  3CXP A;  1WWZ A;  2PR8 A;  1I12 A;  2AJ6 A;  2VZY A;  4MBU A;  4NCZ A;  4NXY A;  4CAW A;  4KLV A;  4QC6 A;  4H89 A;  5J8F A;  4XNH B;  1QSO A;  2GE3 A;  4M3S A;  2A4N A;  1R57 A;  2J8R A;  3R1K A;  2P6G A;  2BSW A;  1B6B A;  1Q2Y A;  1MK4 A;  3GYA A;  5J8C A;  5E96 A;  4JXQ A;  2BEI A;  5JQ4 A;  4HKF A;  4PSW A;  5HH1 A;  2Q44 A;  4IUS A;  4XPD B;  2G3T A;  1N71 A;  4R3L A;  4KOV A;  5F49 A;  5EBV A;  2PDO A;  3I9S A;  2BL1 A;  1QSM A;  2VXK A;  3TOB A;  1Q2C A;  4FD5 A;  4KVM E;  1IID A;  4MY0 A;  4KOT A;  4PK3 A;  3D8P A;  2WPX A;  3EC4 A;  1ON0 A;  4KOY A;  4JWP A;  4NEX A;  4U9Y A;  4HNX B;  4JLY A;  4IF5 A;  3P2F A;  1MJB A;  4UWI A;  1CM0 A;  4DNC A;  2Y0M A;  2GIV A;  3R96 A;  3TTH A;  2VQY A;  1I21 A;  3DNS A;  2HUZ A;  2O28 A;  2JDD A;  1BOB A;  3BJ7 A;  5FVJ A;  2ARH A;  3S6H A;  1P4N A;  4H6U A;  2DXQ A;  3DR8 A;  3EY5 A;  4KUA A;  3DDD A;  3BLN A;  2B5G B;  4II9 A;  4QVT A;  2VI7 A;  4R57 A;  1YGH A;  4KVX A;  1KUV A;  4YGO A;  3BJ8 A;  3JUW A;  2REE A;  2R1I A;  1S7N A;  2REF A;  4NF1 A;  1UFH A;  2VZZ A;  4KLW A;  1IYL A;  2B3U A;  5KTC A;  3R9F A;  1XIX A;  2G0B A;  4KOS A;  1BO4 A;  1L0C A;  4XPK A;  2K5T A;  4UA3 A;  2ZW5 A;  4AVC A;  3RYO A;  2G3A A;  5DWN A;  4OLL A;  4X5K A;  5GCN A;  3FB3 A;  2C27 A;  3FXT A;  4XPL A;  2JDC A;  1XF8 A;  5F48 A;  1PUA A;  3SHP A;  5IB0 A;  1P0H A;  4L89 A;  2B4B A;  4PV6 A;  2GAN A;  3K9U A;  1M44 A;  2ZW6 A;  4LUA A;  5EC4 A;  3D3S A;  2CNM A;  3D2P A;  3T90 A;  4MI4 A;  4YRH A;  4K30 A;  2ZXV A;  2BUE A;  3T9Y A;  2F5I A;  1S7F A;  2FIW A;  1Z9U A;  1S7K A;  3R95 A;  3PGP A;  1M4I A;  1FY7 A;  3R9G A;  4B5P B;  3TOA A;  4U9Z A;  1Z4E A;  4CAV A;  2FS5 A;  2HQY A;  2ZW4 A;  3QAH A;  4B5P A;  1Y9K A;  4PSX A;  3GKR A;  2CY2 A;  2D4O A;  1NSL A;  4CAX A;  1Q2D A;  3W91 A;  1CJW A;  3LOD A;  1KZF A;  3FYN A;  2CNS A;  2R8V A;  3FNC A;  1K4J A;  4MY3 A;  1S7L A;  2OH1 A;  2X7B A;  1XEB A;  4R3K A;  2OZH A;  4Y49 B;  1U6M A;  2EVN A;  2JLM A;  3B8G A;  2I00 A;  1B87 A;  1S3Z A;  3EFA A;  3NE7 A;  4RS2 A;  2ZW7 A;  4FD4 A;  4FD7 A;  3SXN A;  4KOU A;  5DWM A;  3DSB A;  3S6K A;  1YLE A;  3I3G A;  1M4D A;  4MHD A;  4AG7 A;  2VBQ A;  4QUS A;  3P2H A;  3S6F A;  3QB8 A;  2PRB A;  4CRZ B;  4PK2 A;  3TO7 A;  3W6S A;  3G3S A;  4UBR A;  1IIC A;  2J8M A;  3TE4 A;  3IWG A;  3S6G A;  4E0A A;  5H86 A;  3G8W A;  2H5M A;  1LRZ A;  2PR1 A;  2B3V A;  2ZPA A;  4RI1 A;  4HNY B;  2I79 A;  4E8O A;  4U5Y A;  1OZP A;  4JXR A;  1YVK A;  4HNW B;  2D4P A;  4F0Y A;  2HV2 A;  4OAD A;  4LX9 A;  2Q4V A;  4AG9 A;  5C82 A;  1J4J A;  3N7Z A;  4KOX A;  1QSR A;  4KVO E;  2Z0Z A;  4AVB A;  3FRM A;  4MJ8 A;  1Z4R A;  3JVN A;  3TFY A;  3TT2 A;  5HMN A;  1PU9 A;  1MJ9 A;  1YX0 A;  1GHE A;  2P6F A;  3E0K A;  3F5B A;  1RXT A;  1KUX A;  5IV0 A;  1VKC A;  4AVA A;  2QIR A;  4AB7 A;  2AE6 A;  1QSN A;  2OZU A;  2FCK A;  4NSQ A;  2P6E A;  3GY9 A;  1XE4 A;  1S60 A;  4UWJ A;  4Y49 C;  1WK4 A;  3VWD A;  2IL4 A;  4EVY A;  3PZJ A;  4QBJ A;  2QEC A; 
#chains in the Genus database with same CATH topology
 3IO1 A;  4GS4 A;  4BD9 A;  4C7I A;  2ZED A;  4ZGY B;  5IX3 A;  2ZEM A;  1YR0 A;  1Z5R A;  1I1D A;  1M4G A;  4RN7 A;  4B12 A;  1CG2 A;  3VWE A;  1IGB A;  2FXF A;  3PP9 A;  1V0C A;  1LFW A;  4CYN A;  2KCW A;  2B4D B;  1ZG7 A;  2PC1 A;  3KR5 A;  1JQG A;  1F2P A;  4OAE A;  4ZY1 A;  3DR6 A;  2Z3L A;  2B58 A;  2QYV A;  2WSA A;  4A30 A;  5KTD A;  2EUI A;  3RNZ A;  1TKJ A;  2B4D A;  1YK3 A;  2RC4 A;  4JYW A;  1SQH A;  3CXQ A;  3BXM A;  4H6Z A;  2Q04 A;  4BMH A;  2ATR A;  4MFL A;  4CRY B;  1NMT A;  7CPA A;  2OOT A;  4WWV A;  3F8K A;  3MGD A;  2PCU A;  4TNU A;  4PPZ A;  3S9L A;  3V8I A;  3WT4 A;  2J8N A;  4CGM A;  2Z11 A;  4A32 A;  4R9M A;  3TO6 A;  3FMC A;  4YFJ A;  4JD6 A;  1EE3 P;  3ZJ0 A;  2Q4Y A;  3ZZI A;  1ARM A;  1XMT A;  4R87 A;  1Y7E A;  3R9E A;  2OB0 A;  2Q0Y A;  3KKW A;  2AFZ A;  1YW4 A;  4JJX A;  3TCV A;  4M85 A;  1XMB A;  1KUY A;  1QST A;  2PJ5 A;  2WPW A;  4MFQ A;  3WC5 A;  5CNP A;  1CX8 A;  1AUG A;  3EXN A;  5F47 A;  3EO4 A;  2Q7B A;  4F6A A;  2P0W A;  4R7M A;  2Z10 A;  4UCN A;  1YRE A;  4P44 A;  3SJE A;  4C2X A;  3D7H A;  4OP4 A;  3PB4 X;  4AVC A;  4UF4 A;  3V38 A;  4EWT A;  3B3V A;  1CBX A;  1ZG8 A;  2PSW A;  2Q51 A;  3OWC A;  2ZEN A;  4L8A A;  4OME A;  3RO0 A;  5JH9 A;  4K3N A;  1IY7 A;  3H8G A;  2R98 A;  2ZOG A;  2FT0 A;  4OC5 A;  1IOF A;  1LOK A;  4H2K A;  3TO9 A;  4B10 A;  3S9M A;  3D2M A;  1XBU A;  4EFD A;  5F46 A;  4Q38 A;  4NGP A;  4KUB A;  2VEZ A;  4FD6 A;  4PXD A;  4R6T A;  2PJ1 A;  2OU2 A;  3L2N A;  3KZW A;  2FSR A;  5K8M A;  2WYR A;  2WUU A;  4J3G A;  3VH9 A;  4CGO A;  1Y0R A;  3IGR A;  4B5O A;  1LAP A;  4ZBG A;  5JPH A;  2FL4 A;  2J9A A;  3CPX A;  3F0A A;  3NA6 A;  5LYD A;  1X10 A;  4P45 A;  4CYQ A;  2PRQ A;  2IMO A;  1Y9W A;  3FBU A;  3PFE A;  3H4Q A;  2EK8 A;  5H84 A;  3SI1 A;  1ZG9 A;  2PJ3 A;  3SJF A;  4XNH C;  1YVO A;  4UFX A;  4F9U A;  4IHM A;  4NGR A;  1LAN A;  4DJL A;  1S5K A;  4ZI6 A;  1Y7R A;  2B5G A;  3B3W A;  2NSM A;  1RO5 A;  4QB9 A;  5KTA A;  1VIX A;  2EO8 A;  2FIA A;  5C88 A;  1IB1 E;  4ZY2 A;  3B2Y A;  3T8W A;  4CYO A;  3TX8 A;  3B7I A;  2JEV A;  1F2O A;  2PJ6 A;  5ISV A;  1NE9 A;  4ORF A;  1MJA A;  1Q7L A;  2BCO A;  1VHS A;  3D66 A;  4KOR A;  4KSI A;  2PQ8 A;  1BPM A;  4KZT A;  3C26 A;  4NGS A;  1TIQ A;  2RFH A;  4MCR A;  1IYK A;  4I49 A;  4FBE A;  1FT7 A;  2NMT A;  3WR7 A;  4P4D A;  2QML A;  4IK2 A;  3LD2 A;  2PJB A;  1M1D A;  2OZG A;  3FIX A;  5I0C A;  2R7H A;  5A28 A;  3UY5 A;  4CS0 B;  3D67 A;  3DLJ A;  1Y0Y A;  4KOW A;  4XPD C;  5LRK A;  3IWE A;  2AFW A;  2FE7 A;  4UFV A;  4MHN A;  3CPA A;  2CNT A;  3W6X A;  4ONU A;  3CXS A;  4NJR A;  4Q36 A;  5LRJ A;  2NYQ A;  4E2A A;  2Q4Z A;  3NH4 A;  4NFR A;  3CXP A;  4M6I A;  3PEI A;  2V8G A;  3SXO A;  4FAI A;  1WWZ A;  4LQG A;  2PR8 A;  1IOI A;  1I12 A;  2AJ6 A;  3KQZ A;  2VZY A;  3PRT A;  1OBR A;  4MBU A;  3KHX A;  4NCZ A;  4CGL A;  3IU1 A;  1F57 A;  4NXY A;  4CAW A;  2PIY A;  4KLV A;  4MHZ A;  1Z8X A;  5HVG A;  3TC8 A;  4QC6 A;  2Z3O A;  4H89 A;  4A95 A;  2PJ2 A;  5J8F A;  2JBJ A;  2O53 A;  4XNH B;  1YSJ A;  4OKO A;  2ZEL A;  4UFW A;  3LWU A;  1QSO A;  3SI0 A;  5BWA B;  5AG7 A;  2GE3 A;  4M3S A;  4BIN A;  2A4N A;  4X3R A;  1R57 A;  2ODF A;  2J8R A;  4UIB A;  2POK A;  2ZEE A;  3R1K A;  4NGQ A;  5HVF A;  4A94 A;  1YME A;  3NE8 A;  1KWM A;  2PJ7 A;  4MFJ A;  2P6G A;  2BSW A;  1B6B A;  6CPA A;  2Q43 A;  2V77 A;  1Q2Y A;  1MK4 A;  3GYA A;  1JWQ A;  3KHZ A;  8CPA A;  5J8C A;  4P6Y A;  1PYT B;  2PJ9 A;  5E96 A;  2PIZ A;  4GXH A;  3RBU A;  4JXQ A;  2BEI A;  1BPN A;  3JTK A;  5JQ4 A;  4HKF A;  4PSW A;  2FVG A;  4A2Z A;  2CTC A;  5HH1 A;  4Z65 A;  2Q44 A;  4IUS A;  1ZLI A;  4CAE A;  4ZYQ A;  1Z8T A;  4XPD B;  2G3T A;  1N71 A;  1PCA A;  3HLP A;  4JZ0 A;  4R3L A;  4KOV A;  5F49 A;  4F9V A;  4OC2 A;  2GLJ A;  5EBV A;  2PDO A;  3GLJ A;  4P4F A;  3ISZ A;  2AFM A;  2V8D A;  3DGV A;  4MCQ A;  1H8L A;  3I9S A;  2JBK A;  4CYP A;  4A37 A;  2BL1 A;  3FJU A;  2ABZ A;  2F8H A;  1QSM A;  4CGP A;  3BHX A;  2VXK A;  3TOB A;  1Q2C A;  2O4H A;  4FD5 A;  1IID A;  4KVM E;  5JM6 A;  3VAT A;  4MY0 A;  3H8F A;  4KOT A;  4KS9 A;  3KR4 A;  1BAV A;  4PK3 A;  5IB9 A;  1LAM A;  3D8P A;  3K9T A;  1YQE A;  1IU8 A;  2WPX A;  4MXU A;  4M6H A;  1UWY A;  1R43 A;  2YNE A;  2ZEP A;  1ON0 A;  3EC4 A;  4KOY A;  4PQA A;  4JWP A;  4NEX A;  3GUX A;  4U9Y A;  2ZOF A;  2C6P A;  2XEI A;  4HNX B;  4JLY A;  4B11 A;  4IF5 A;  1MJB A;  3P2F A;  3FX6 A;  4UWI A;  1CM0 A;  3BI0 A;  4DNC A;  2Y0M A;  1HDQ A;  2GIV A;  1QQ9 A;  3PB9 X;  3R96 A;  4B13 A;  3TTH A;  3NH8 A;  2VQY A;  4RUH A;  2PJ4 A;  3IEH A;  1I21 A;  3DNS A;  5D29 A;  5J1Q A;  2HUZ A;  2O28 A;  2JDD A;  4NGT A;  1Z8W A;  2I3C A;  3BI1 A;  2G9D A;  1BOB A;  3BJ7 A;  3KL9 A;  4W9Y A;  5FVJ A;  2ARH A;  4GM5 A;  1P4N A;  3S6H A;  4H6U A;  2DXQ A;  2EBJ A;  5CPA A;  3DR8 A;  1ELM P;  3EY5 A;  3DDD A;  4KUA A;  4YU9 A;  2C6C A;  3BLN A;  3WAB A;  2B5G B;  4II9 A;  4OC4 A;  4QVT A;  2VI7 A;  3H5Z A;  3HUV A;  4R57 A;  1YGH A;  3IU2 A;  2ZEF A;  1KUV A;  4KVX A;  4YGO A;  4B6Z A;  1ARL A;  3BJ8 A;  3LMS A;  1TF8 A;  5ELY A;  3JUW A;  2REE A;  4TWE A;  2R1I A;  1S7N A;  2REF A;  4NF1 A;  4X8I A;  3MN8 A;  1UFH A;  2V8V A;  4R8F A;  5K8O A;  2VZZ A;  2CXA A;  3D7D A;  4KLW A;  4C2Y A;  2JEW A;  5AG6 A;  2V8H A;  1IYL A;  2B3U A;  2GRE A;  3D7G A;  5KTC A;  1TF9 A;  3R9F A;  1XIX A;  4CAF A;  2GLF A;  3KI9 A;  4R76 A;  5HXD A;  2G0B A;  4KOS A;  4MHY A;  4OC0 A;  4MFZ A;  1BO4 A;  1L0C A;  2AFS A;  2K5T A;  4UA3 A;  2ZW5 A;  4XPK A;  3H8E A;  5EMI A;  2G3A A;  5DWN A;  4OLL A;  2Z3P A;  4X5K A;  3PBE A;  5GCN A;  3RYO A;  4F0X A;  3FB3 A;  2HB6 A;  4CGN A;  2C27 A;  5G21 A;  3FXT A;  4XPL A;  2JDC A;  1Z8L A;  1XF8 A;  2QVP A;  5F48 A;  1PUA A;  4OIW A;  4EME A;  5F09 A;  3SHP A;  2PVV A;  5IB0 A;  1P0H A;  1A2Z A;  1CP6 A;  2F7V A;  4L89 A;  2B4B A;  4PV6 A;  1CPS A;  2GAN A;  4KSF A;  3K9U A;  3IWW A;  1M44 A;  2QJ8 A;  2ZW6 A;  4LUA A;  5EC4 A;  3KQX A;  3D68 A;  3CZX A;  4MFK A;  3D3S A;  2CNM A;  3KAS A;  3D2P A;  3T90 A;  4MI4 A;  1XFO A;  2GFQ A;  4ZX9 A;  3CDX A;  2RB7 A;  5AG4 A;  3FEC A;  5JGF A;  1QMU A;  5A27 A;  3WC7 A;  1YW6 A;  5LYF A;  4YRH A;  2YNC C;  4K30 A;  4DUK A;  2ZEO A;  2BUE A;  2ZXV A;  4IAV A;  4PXC A;  3T9Y A;  3I1U A;  3A9L A;  3IJ3 A;  2PVW A;  2F5I A;  4MFP A;  2WZN A;  3FVL A;  4A31 A;  4FUU A;  1S7F A;  2FIW A;  1Z9U A;  1S7K A;  3R95 A;  3PGP A;  1M4I A;  1FY7 A;  2PJ0 A;  4MCP A;  3R9G A;  4B5P B;  3ISX A;  3PFO A;  3TOA A;  1R3N A;  4U9Z A;  3NH5 A;  3IFE A;  3RZA A;  1Z4E A;  3S9N A;  4Q7A A;  4NGM A;  4CAV A;  2FS5 A;  1DTD A;  2HQY A;  5AG5 A;  5HVH A;  2ZW4 A;  3QAH A;  4B5P A;  1XOV A;  1Y9K A;  4PSX A;  3VAR A;  3GKR A;  4P4I A;  1ZLH A;  2CY2 A;  2AFO A;  3RAM A;  3PB8 X;  2D4O A;  1NSL A;  4CAX A;  1Q2D A;  1XRY A;  3W91 A;  1CP7 A;  1FNO A;  2PJ8 A;  1CJW A;  3LOD A;  1KZF A;  1BLL E;  3FYN A;  2CNS A;  2R8V A;  3FNC A;  3QAY A;  1K4J A;  5DS0 A;  2Z3M A;  4CPA A;  3CT9 A;  4MY3 A;  1S7L A;  4P4E A;  3MRU A;  2OH1 A;  2CTB A;  2X7B A;  4UEF A;  1XEB A;  3GB0 A;  5D8N A;  1TKH A;  1LCP A;  5LYI A;  4R3K A;  2PJC A;  2OZH A;  4KSA A;  4Y49 B;  3WC6 A;  1U6M A;  2EVN A;  2JLM A;  3NFZ A;  4OC1 A;  3PB7 X;  2Z3N A;  3B8G A;  2I00 A;  1B87 A;  1S3Z A;  3EFA A;  3K2K A;  3NE7 A;  2YNC A;  4RS2 A;  4C2Z A;  4PXB A;  5I4M A;  2ZW7 A;  4FWU A;  2BOA A;  3FED A;  3SI2 A;  3SJG A;  4FD4 A;  4FD7 A;  3SXN A;  4PXE A;  1TXR A;  4KOU A;  5DWM A;  4M6G A;  4UCM A;  3FH4 A;  3DSB A;  3S6K A;  4MMO A;  5K8N A;  1YLE A;  3FEE A;  5LYL A;  2BO9 A;  3I3G A;  1M4D A;  3B3T A;  4UIA A;  1AYE A;  4MHD A;  4AG7 A;  4G1P A;  2CIJ A;  4B14 A;  2VBQ A;  4QUS A;  3P2H A;  3S6F A;  3QB8 A;  2EWB A;  2PRB A;  2Z3K A;  4OC3 A;  4WJB A;  4PK2 A;  4AXV A;  4CRZ B;  3B3C A;  3TO7 A;  3D4U A;  3W6S A;  3G3S A;  4UBR A;  5LRG A;  2IJZ A;  1IIC A;  2J8M A;  4P4B A;  4HPS A;  3TE4 A;  1HEE A;  3B3S A;  2PE3 A;  1AMP A;  3IWG A;  2XEF A;  3S6G A;  4ZY0 A;  1TKF A;  4BBH A;  4E0A A;  3LAC A;  3N5F A;  4X2T A;  2YGW A;  3GIU A;  2EK9 A;  4ONW A;  5H86 A;  4C7H A;  1GYT A;  2HC9 A;  3G8W A;  2DPS A;  1XJO A;  1LRZ A;  2H5M A;  2DPT A;  2PR1 A;  2ZEH A;  4UEE A;  5G22 A;  2B3V A;  2ZPA A;  5CBM A;  3PB6 X;  4HNY B;  4RI1 A;  2ANP A;  2I79 A;  4YWY A;  4E8O A;  4U5Y A;  1OZP A;  3V7Z A;  4NGN A;  4JXR A;  4OID A;  4MHP A;  4A39 A;  2VL1 A;  3QNV A;  3SJX A;  4P4J A;  1YVK A;  4HNW B;  2D4P A;  4C68 A;  3PBB A;  1YLO A;  1M4L A;  4F8Z A;  2CF4 A;  3FF3 A;  4F0Y A;  4UEZ A;  2HV2 A;  4OAD A;  2IQ6 A;  1VHE A;  4LX9 A;  5THW A;  2XEG A;  2Q4V A;  1VGY A;  2Q7S A;  2ZEG A;  4AG9 A;  5C82 A;  1J4J A;  4O23 A;  1DE4 C;  1RTQ A;  3N7Z A;  4KOX A;  1QSR A;  3IIB A;  4KVO E;  4NJQ A;  2Z0Z A;  4AVB A;  3B35 A;  3FRM A;  1HDU A;  4MJ8 A;  1Z4R A;  3D7F A;  3JVN A;  5K8P A;  3TFY A;  1Z2L A;  3TT2 A;  5HMN A;  1PU9 A;  3JRU A;  1MJ9 A;  5G1Z A;  1YX0 A;  1GHE A;  2P6F A;  3E0K A;  3F5B A;  4A38 A;  1RXT A;  1KUX A;  5IV0 A;  1VKC A;  2DF5 A;  1X12 A;  5AGE A;  2AFU A;  1ELL P;  4AVA A;  1NSA A;  2XEJ A;  2QIR A;  4ZX8 A;  4AB7 A;  2AE6 A;  2YND A;  2OZU A;  1QSN A;  3KGQ A;  2FCK A;  4NSQ A;  4MRI A;  1VHO A;  2P6E A;  4P10 A;  3GY9 A;  2GU2 A;  1XE4 A;  1S60 A;  4UWJ A;  4Y49 C;  2OR4 A;  4DYO A;  2C1C A;  1CPX A;  1WK4 A;  3IC1 A;  5G20 A;  4A33 A;  3VWD A;  2AFX A;  2IL4 A;  4EVY A;  2DEA A;  3PZJ A;  4LQ6 A;  4QBJ A;  2PJA A;  2QEC A;  4MCS A;  4UCP A;  1ZO0 A;  2C6G A; 
#chains in the Genus database with same CATH homology
 4GS4 A;  4C7I A;  4ZGY B;  5IX3 A;  1YR0 A;  1I1D A;  1M4G A;  4B12 A;  3VWE A;  2FXF A;  3PP9 A;  1V0C A;  4CYN A;  2KCW A;  2B4D B;  2PC1 A;  4OAE A;  3DR6 A;  2Z3L A;  2B58 A;  2WSA A;  4A30 A;  5KTD A;  2EUI A;  2B4D A;  2RC4 A;  1YK3 A;  1SQH A;  3CXQ A;  4H6Z A;  2Q04 A;  4BMH A;  2ATR A;  4MFL A;  4CRY B;  1NMT A;  3F8K A;  3MGD A;  3V8I A;  2J8N A;  4CGM A;  2Z11 A;  4A32 A;  4R9M A;  3TO6 A;  4YFJ A;  4JD6 A;  3ZJ0 A;  2Q4Y A;  3ZZI A;  1XMT A;  4R87 A;  3R9E A;  2OB0 A;  2Q0Y A;  3KKW A;  4JJX A;  3TCV A;  4M85 A;  1KUY A;  1QST A;  4MFQ A;  2WPW A;  5CNP A;  3EXN A;  5F47 A;  3EO4 A;  2Q7B A;  4F6A A;  2P0W A;  2Z10 A;  4UCN A;  1YRE A;  4C2X A;  3OWC A;  2PSW A;  4L8A A;  2R98 A;  2FT0 A;  3TO9 A;  4B10 A;  3D2M A;  5F46 A;  4Q38 A;  4KUB A;  2VEZ A;  4FD6 A;  2OU2 A;  2FSR A;  4CGO A;  2WUU A;  4J3G A;  3IGR A;  4B5O A;  4ZBG A;  5JPH A;  2FL4 A;  3F0A A;  4CYQ A;  1Y9W A;  3FBU A;  3H4Q A;  5H84 A;  4XNH C;  1YVO A;  4UFX A;  1S5K A;  1Y7R A;  2B5G A;  4QB9 A;  5KTA A;  1RO5 A;  2FIA A;  5C88 A;  1IB1 E;  4CYO A;  2JEV A;  5ISV A;  1NE9 A;  4ORF A;  1MJA A;  1VHS A;  4KOR A;  2PQ8 A;  4KZT A;  3C26 A;  1TIQ A;  1IYK A;  4I49 A;  2NMT A;  3WR7 A;  2QML A;  3LD2 A;  1M1D A;  2OZG A;  3FIX A;  5I0C A;  2R7H A;  5A28 A;  3UY5 A;  4CS0 B;  4XPD C;  4KOW A;  3IWE A;  2FE7 A;  4UFV A;  3W6X A;  2CNT A;  4ONU A;  3CXS A;  4Q36 A;  4E2A A;  3SXO A;  3CXP A;  1WWZ A;  2PR8 A;  1I12 A;  2AJ6 A;  2VZY A;  4CGL A;  4MBU A;  4NCZ A;  3IU1 A;  4NXY A;  4CAW A;  4KLV A;  4QC6 A;  2Z3O A;  4H89 A;  4A95 A;  5J8F A;  4XNH B;  4UFW A;  1QSO A;  5BWA B;  5AG7 A;  2GE3 A;  4M3S A;  2A4N A;  1R57 A;  2J8R A;  3R1K A;  4MFJ A;  2P6G A;  2BSW A;  1B6B A;  1Q2Y A;  1MK4 A;  3GYA A;  5J8C A;  5E96 A;  4JXQ A;  2BEI A;  5JQ4 A;  3JTK A;  4HKF A;  4PSW A;  4A2Z A;  5HH1 A;  2Q44 A;  4IUS A;  4CAE A;  4XPD B;  2G3T A;  1N71 A;  4R3L A;  4KOV A;  5F49 A;  5EBV A;  2PDO A;  3I9S A;  4CYP A;  2BL1 A;  4CGP A;  1QSM A;  2VXK A;  3TOB A;  1Q2C A;  4FD5 A;  4KVM E;  1IID A;  4MY0 A;  4KS9 A;  4KOT A;  4PK3 A;  3D8P A;  2WPX A;  2YNE A;  3EC4 A;  1ON0 A;  4KOY A;  4JWP A;  4NEX A;  4U9Y A;  4HNX B;  4JLY A;  4B11 A;  4IF5 A;  3P2F A;  1MJB A;  4UWI A;  1CM0 A;  4DNC A;  2Y0M A;  2GIV A;  3R96 A;  4B13 A;  3TTH A;  2VQY A;  1I21 A;  3DNS A;  2HUZ A;  2O28 A;  2JDD A;  1BOB A;  3BJ7 A;  5FVJ A;  2ARH A;  3S6H A;  1P4N A;  4H6U A;  2DXQ A;  3DR8 A;  3EY5 A;  4KUA A;  3DDD A;  3BLN A;  2B5G B;  4II9 A;  4QVT A;  2VI7 A;  3H5Z A;  4R57 A;  1YGH A;  3IU2 A;  4KVX A;  1KUV A;  4YGO A;  3BJ8 A;  3JUW A;  2REE A;  2R1I A;  1S7N A;  2REF A;  4NF1 A;  1UFH A;  2VZZ A;  2CXA A;  4KLW A;  4C2Y A;  5AG6 A;  1IYL A;  2B3U A;  5KTC A;  4CAF A;  3R9F A;  1XIX A;  2G0B A;  4KOS A;  4MFZ A;  1BO4 A;  1L0C A;  4XPK A;  2K5T A;  4UA3 A;  2ZW5 A;  4AVC A;  3RYO A;  2G3A A;  5DWN A;  4OLL A;  2Z3P A;  4X5K A;  4F0X A;  5GCN A;  3FB3 A;  4CGN A;  2C27 A;  5G21 A;  3FXT A;  4XPL A;  2JDC A;  1XF8 A;  5F48 A;  1PUA A;  3SHP A;  5IB0 A;  1P0H A;  4L89 A;  2B4B A;  4PV6 A;  2GAN A;  4KSF A;  3K9U A;  1M44 A;  2ZW6 A;  4LUA A;  5EC4 A;  4MFK A;  3D3S A;  2CNM A;  3D2P A;  3T90 A;  4MI4 A;  5AG4 A;  5A27 A;  4YRH A;  2YNC C;  4K30 A;  2ZXV A;  2BUE A;  3T9Y A;  3A9L A;  2F5I A;  4MFP A;  4A31 A;  1S7F A;  2FIW A;  1Z9U A;  1S7K A;  3R95 A;  3PGP A;  1M4I A;  1FY7 A;  3R9G A;  4B5P B;  3TOA A;  4U9Z A;  1Z4E A;  4CAV A;  2FS5 A;  2HQY A;  5AG5 A;  2ZW4 A;  3QAH A;  4B5P A;  1Y9K A;  4PSX A;  3GKR A;  2CY2 A;  2D4O A;  1NSL A;  4CAX A;  1Q2D A;  3W91 A;  1CJW A;  3LOD A;  1KZF A;  3FYN A;  2CNS A;  2R8V A;  3FNC A;  1K4J A;  2Z3M A;  4MY3 A;  1S7L A;  2OH1 A;  2X7B A;  1XEB A;  4R3K A;  2OZH A;  4KSA A;  4Y49 B;  1U6M A;  2EVN A;  2JLM A;  2Z3N A;  3B8G A;  2I00 A;  1B87 A;  1S3Z A;  3EFA A;  3NE7 A;  2YNC A;  4RS2 A;  4C2Z A;  2ZW7 A;  4FD4 A;  4FD7 A;  3SXN A;  4KOU A;  5DWM A;  4UCM A;  3DSB A;  3S6K A;  1YLE A;  3I3G A;  1M4D A;  4MHD A;  4AG7 A;  4B14 A;  2VBQ A;  4QUS A;  3P2H A;  3S6F A;  3QB8 A;  2PRB A;  2Z3K A;  4CRZ B;  4PK2 A;  3TO7 A;  3W6S A;  3G3S A;  4UBR A;  1IIC A;  2J8M A;  3TE4 A;  3IWG A;  3S6G A;  4BBH A;  4E0A A;  2YGW A;  4C7H A;  5H86 A;  3G8W A;  2DPS A;  2H5M A;  1LRZ A;  5G22 A;  2DPT A;  2PR1 A;  2B3V A;  2ZPA A;  4RI1 A;  4HNY B;  2I79 A;  4E8O A;  4U5Y A;  1OZP A;  4JXR A;  1YVK A;  4HNW B;  2D4P A;  4C68 A;  4F0Y A;  2HV2 A;  4OAD A;  4LX9 A;  2Q4V A;  4AG9 A;  5C82 A;  1J4J A;  3N7Z A;  4KOX A;  1QSR A;  4KVO E;  2Z0Z A;  4AVB A;  3FRM A;  4MJ8 A;  1Z4R A;  3JVN A;  3TFY A;  3TT2 A;  5HMN A;  1PU9 A;  1MJ9 A;  5G1Z A;  1YX0 A;  1GHE A;  2P6F A;  3E0K A;  3F5B A;  1RXT A;  1KUX A;  5IV0 A;  1VKC A;  5AGE A;  4AVA A;  2QIR A;  4AB7 A;  2AE6 A;  2YND A;  1QSN A;  2OZU A;  2FCK A;  4NSQ A;  2P6E A;  3GY9 A;  1XE4 A;  1S60 A;  4UWJ A;  4Y49 C;  5G20 A;  1WK4 A;  4A33 A;  3VWD A;  2IL4 A;  4EVY A;  3PZJ A;  4QBJ A;  2QEC A;  4UCP A;  1ZO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...