5C88A

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus in monoclinic form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
pubmed doi rcsb
source organism Sulfolobus solfataricus strain p2
molecule tags Transferase
molecule keywords Uncharacterized N-acetyltransferase SSO0209
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c88A00
5J8CA 1YVOA 1QSTA 1YREA 4KUAA 4U9YA 3FIXA 4B5PA 2A4NA 4JD6A 2F5IA 4R57A 2B5GA 3JUWA 4QVTA 3TFYA 1MJAA 2HV2A 5F49A 3DNSA 1YK3A 3RYOA 4MI4A 3D8PA 3SXOA 2QMLA 3MGDA 3V8IA 2P0WA 2VBQA 5DWMA 5E96A 3PP9A 1Q2YA 1XMTA 2JDCA 2VQYA 3EFAA 4U9ZA 1QSNA 1WK4A 1YX0A 2QIRA 3F8KA 2JLMA 4HNXB 1M4GA 4Y49B 1XF8A 2R1IA 3W91A 4E8OA 4E0AA 1WWZA 1LRZA 3I9SA 4NF1A 1U6MA 3S6HA 2EVNA 4PSXA 1SQHA 3DR8A 2OB0A 2FCKA 2OH1A 2B58A 5J8FA 4KLWA 4OAEA 1I12A 2P6FA 2Q4YA 3CXSA 3D3SA 4JLYA 1I1DA 3FXTA 2OZUA 1NSLA 2OU2A 3KKWA 1XEBA 2DXQA 3QB8A 4M3SA 2OZHA 4L8AA 1YVKA 4II9A 4PK2A 3UY5A 5ISVA 2PR8A 1QSOA 3BLNA 1S7LA 1R57A 2GE3A 3EXNA 4NEXA 4IUSA 5IX3A 1OZPA 4PSWA 1I21A 4KOWA 4JWPA 3CXQA 4MBUA 3TO9A 3G8WA 1MJ9A 3VWEA 3ZJ0A 3K9UA 4M85A 1B6BA 3WR7A 5HMNA 1NE9A 1Y7RA 2BEIA 2WPXA 4YGOA 5F48A 1Y9KA 4MJ8A 4XPDB 3GKRA 4HKFA 2H5MA 1KUXA 1IIDA 2PSWA 3W6XA 3N7ZA 3S6GA 4XPLA 4JXQA 3B8GA 4H89A 3FNCA 2VZYA 4KUBA 1CJWA 5IV0A 1ON0A 1GHEA 2REEA 2J8MA 4KVXA 4OLLA 2BUEA 4HNYB 4KOUA 3E0KA 1Q2DA 2D4OA 3TT2A 1IB1E 3LODA 2CNTA 4FD4A 4OADA 1Y9WA 2VI7A 1XE4A 2Z11A 3TO6A 2REFA 1Z4RA 4B5OA 4LX9A 5EC4A 1YR0A 4QBJA 2R7HA 4ORFA 4R87A 1UFHA 1J4JA 4BMHA 1NMTA 2QECA 4YFJA 1BO4A 2FS5A 5KTDA 4NSQA 2FXFA 3R9FA 1VHSA 3TOBA 2Z0ZA 2ARHA 2D4PA 5F46A 4QB9A 4KOTA 4ZBGA 2Q04A 2R98A 4FD5A 3VWDA 5HH1A 2X7BA 3SHPA 1PU9A 4JJXA 2C27A 3R9EA 3DR6A 2PC1A 3FB3A 2B4BA 4CAXA 4MHDA 3P2HA 2AJ6A 1MJBA 2I79A 1IICA 3LD2A 3R96A 2ZXVA 4YRHA 1B87A 3IGRA 3FRMA 1S3ZA 3EC4A 2FSRA 1FY7A 4K30A 2FIWA 4H6UA 4EVYA 3NE7A 3H4QA 2FIAA 1TIQA 1XIXA 2ZW5A 2Q7BA 5C88A 1MK4A 2VXKA 4F6AA 3QAHA 3BJ8A 1YLEA 1M1DA 4KOSA 3TE4A 2BL1A 3JVNA 2J8RA 4GS4A 3TOAA 1Z4EA 4KVOE 2CNMA 4XNHB 3W6SA 1KUVA 2KCWA 3DSBA 1Z9UA 2RC4A 2PDOA 4CRYB 1IYLA 1KZFA 4FD7A 4HNWB 2OZGA 4UWIA 2Z10A 1S7NA 2B5GB 2HQYA 3T9YA 1RXTA 4I49A 2I00A 1QSRA 2ZW6A 4AVCA 4XNHC 5C82A 4QC6A 2JDDA 4PV6A 1KUYA 2AE6A 2G3AA 3D2MA 1YGHA 2ZW4A 3FYNA 3F0AA 3FBUA 1K4JA 3C26A 2PQ8A 2P6EA 2IL4A 5H86A 4UA3A 3R95A 2FL4A 3CXPA 2PR1A 1M44A 3OWCA 2GANA 4AG9A 2ZW7A 1M4IA 1P0HA 4KLVA 2ZPAA 1BOBA 4AB7A 2Y0MA 2NMTA 2CY2A 4CAWA 5KTAA 2FT0A 1QSMA 3IWGA 4CAVA 4R3KA 4FD6A 3DDDA 1L0CA 4QUSA 3S6KA 4KOVA 3D2PA 4KORA 4MY0A 4E2AA 1P4NA 1S7FA 4R3LA 2GIVA 2WPWA 1S7KA 3R1KA 4Y49C 2PRBA 4X5KA 4NXYA 4RI1A 2ATRA 2B4DB 4RS2A 4IF5A 4KOYA 5IB0A 4KOXA 2VEZA 5GCNA 4B5PB 4DNCA 2Q4VA 1S60A 2HUZA 2VZZA 1M4DA 2JEVA 5FVJA 3R9GA 2B3VA 2R8VA 3SXNA 2K5TA 2Q44A 3T90A 2J8NA 3TTHA 4XPKA 1S5KA 2P6GA 1RO5A 4UBRA 2B4DA 5CNPA 2FE7A 2Q0YA 5JQ4A 5KTCA 4AVAA 4H6ZA 2BSWA 3TO7A 1N71A 4F0YA 5JPHA 3PZJA 4R9MA 2CNSA 3I3GA 4UWJA 3EO4A 5EBVA 2G3TA 4JXRA 3ZZIA 3BJ7A 4CRZB 1PUAA 2B3UA 3GYAA 4MY3A 4CS0B 3TCVA 2O28A 1Q2CA 3EY5A 3S6FA 4KVME 4LUAA 1IYKA 2EUIA 3GY9A 4XPDC 4U5YA 5DWNA 5H84A 4PK3A 3G3SA 1VKCA 4AG7A 1CM0A 4KZTA 3P2FA 4ONUA 1V0CA 4J3GA 3F5BA 5I0CA 4AVBA 3PGPA 2G0BA 4NCZA 4L89A 5F47A
chains in the Genus database with same CATH superfamily
1GYTA 3HLPA 4OMEA 5J8CA 4NFRA 4MCRA 3PB6X 1YVOA 1IY7A 4YU9A 1QSTA 2IMOA 1YREA 2G9DA 4KUAA 4NGTA 4U9YA 2PJAA 3FIXA 2O53A 5AG4A 1ELLP 4B5PA 4BD9A 2A4NA 4F9VA 4JD6A 2F5IA 4A95A 2EK8A 1ARLA 2RB7A 4A37A 4P4BA 2Z3PA 2B5GA 2AFUA 3JUWA 4G1PA 4R57A 4UIAA 4WWVA 4A33A 4A32A 4QVTA 3TFYA 3LACA 1MJAA 1Y7EA 2CTCA 4C2ZA 2HV2A 1QMUA 4CPAA 4KS9A 4CYOA 2VL1A 4A94A 5F49A 3DNSA 1YK3A 3RYOA 4MI4A 3PB7X 3D8PA 3SXOA 2QMLA 4R76A 2WSAA 3MGDA 2Q51A 3V8IA 4BBHA 2WUUA 2P0WA 2VBQA 4ZY1A 1Z8WA 3WC6A 5A28A 2EWBA 3HUVA 3VARA 3DGVA 4MFJA 3CZXA 5DWMA 1AUGA 1HDQA 5E96A 3NE8A 3WC5A 3FX6A 1Q2YA 3H8GA 3PP9A 2PIZA 3V38A 1XMTA 2JDCA 2VQYA 2PJ9A 3EFAA 1VIXA 3IO1A 1PYTB 4U9ZA 1VGYA 1QSNA 2F8HA 1WK4A 2Z3KA 3GUXA 4OC5A 1YX0A 3PB9X 1TF8A 2QIRA 3D7GA 4X8IA 3F8KA 4OP4A 2JLMA 4UCNA 4MFPA 4HNXB 1M4GA 2ODFA 3MRUA 4Y49B 1XF8A 2GFQA 2R1IA 3W91A 4E8OA 4F9UA 1YQEA 3B3SA 4E0AA 1WWZA 3IU1A 1LRZA 3I9SA 2JBJA 1CBXA 1XRYA 1U6MA 4NF1A 3RAMA 2EVNA 3S6HA 1F2PA 1SQHA 3DR8A 4PSXA 2OB0A 2FCKA 2OH1A 4WJBA 2Z3NA 1Z5RA 1XJOA 3D68A 2B58A 4HPSA 1AYEA 1TKJA 4EFDA 5J8FA 3QAYA 1ZG8A 2CIJA 4K3NA 2QJ8A 4KLWA 3D7HA 4OAEA 5LRJA 4LQ6A 4M6IA 3T8WA 1I12A 2P6FA 2ZELA 3D4UA 1FT7A 3B2YA 4TNUA 2Q4YA 2ABZA 3RBUA 2XEFA 2J9AA 1R3NA 3CXSA 3D3SA 4CGNA 4P4JA 4C7IA 4JLYA 1I1DA 2JEWA 3ISXA 3FXTA 2DF5A 2OZUA 3FH4A 1Z2LA 2OU2A 3KKWA 1XEBA 1NSLA 4C2YA 2DXQA 3B3WA 3QB8A 4M3SA 2OZHA 5I4MA 2ZEGA 4L8AA 4FAIA 2OOTA 1YVKA 4II9A 4Q36A 4PK2A 3UY5A 3D7FA 4UFWA 2PR8A 3KQZA 5ISVA 1QSOA 1YW6A 3BHXA 4MHPA 1Y0RA 3BLNA 1S7LA 1R57A 2GE3A 2NYQA 3ISZA 4P45A 3EXNA 4KSAA 3GB0A 3KR4A 1M4LA 2ZEHA 4IUSA 1LCPA 4NEXA 3SI2A 1H8LA 2XEIA 5IX3A 1OZPA 4PSWA 1I21A 4KOWA 4JWPA 4MCQA 3CXQA 4MBUA 2IJZA 3TO9A 4A2ZA 3B7IA 3G8WA 1MJ9A 3KZWA 3VWEA 5K8PA 3ZJ0A 3K9UA 4M85A 4MMOA 4RN7A 1B6BA 3WR7A 4NGPA 5HMNA 4UEFA 5LYDA 1NE9A 1Y7RA 3BI0A 2BEIA 2WPXA 4IHMA 1TKFA 4YGOA 2XEGA 4F8ZA 5F48A 1Y9KA 5K8OA 4O23A 2OR4A 2Z3LA 4MJ8A 4XPDB 3WC7A 1UWYA 3GKRA 3FMCA 2V8HA 4HKFA 2AFXA 2PJ1A 2H5MA 3KR5A 4MCPA 5LRKA 1KUXA 1IIDA 2DPSA 2PSWA 4B14A 3W6XA 4UEZA 3N7ZA 2EO8A 3S6GA 4XPLA 4JXQA 3B8GA 4H89A 2C1CA 3WABA 3SJFA 3FNCA 2VZYA 4KUBA 1LAPA 1CJWA 3RNZA 5IV0A 1ON0A 4MFZA 3SI1A 4ZX8A 4A31A 4CGMA 1Q7LA 1GHEA 3B35A 4OIDA 1FNOA 4CYQA 2REEA 2J8MA 3GIUA 4KVXA 2BUEA 4HNYB 4OLLA 5F09A 4KOUA 3E0KA 4B6ZA 1Q2DA 2D4OA 1IU8A 3TT2A 2PJ5A 1IB1E 2PRQA 3LODA 2CNTA 3PRTA 2PJ7A 4FD4A 4PXCA 4OADA 4UF4A 3H5ZA 1Y9WA 2PJ0A 2VI7A 2ZEFA 1XE4A 2ZOGA 2Z11A 3IC1A 3TO6A 1LFWA 5JM6A 2REFA 3SJGA 5IB9A 1Z4RA 3JTKA 5LRGA 4B5OA 4LX9A 5EC4A 1YR0A 3FVLA 4QBJA 1R43A 4A38A 3BXMA 2JBKA 2R7HA 4ORFA 3V7ZA 2BOAA 4R87A 1UFHA 4JYWA 4AXVA 5CBMA 1J4JA 4OIWA 1Z8LA 4CGOA 2DEAA 1NMTA 4NJQA 4BMHA 2QECA 2PJ2A 1BO4A 4YFJA 2FS5A 1YSJA 5KTDA 3JRUA 4FWUA 4NSQA 4PPZA 2FXFA 2PJCA 3R9FA 1VHSA 3TOBA 2BO9A 3CDXA 2Z0ZA 3LWUA 2ARHA 2D4PA 3KHZA 4F0XA 5F46A 2C6CA 5G1ZA 4QB9A 4BINA 4KOTA 1KWMA 4ZBGA 1ARMA 2YGWA 2Q04A 4B13A 1CPSA 2F7VA 2R98A 1AMPA 4FD5A 3NH4A 4C68A 3VWDA 5HH1A 5G22A 3RO0A 2X7BA 3D7DA 5HXDA 5D29A 3SHPA 3IWEA 1PU9A 4FUUA 4JJXA 2C27A 4CGPA 3R9EA 1LOKA 3D66A 3DR6A 4P6YA 2PC1A 4UIBA 1TF9A 5HVHA 3FB3A 5DS0A 3TC8A 5K8NA 2B4BA 4CAXA 3KL9A 4CYNA 1DE4C 3KQXA 3IEHA 2PVVA 5G20A 4MHDA 2PIYA 3P2HA 2AJ6A 1MJBA 2I79A 1IICA 1LAMA 2YNDA 3LD2A 3R96A 4M6HA 2ZXVA 4YRHA 4P10A 2V8GA 4IAVA 1B87A 3IJ3A 4P4EA 3IGRA 2ZEOA 1S3ZA 3FRMA 2CXAA 3EC4A 2FSRA 1FY7A 4R7MA 2PVWA 4K30A 3CT9A 2FIWA 4H6UA 4ZX9A 4MRIA 6CPAA 4EVYA 3NE7A 2YNEA 4UFXA 1VHEA 3H4QA 2FIAA 1TIQA 1XIXA 3SJEA 5LYLA 2ZW5A 2V8DA 3SJXA 2Q7BA 5C88A 3LMSA 1MK4A 2VXKA 2AFMA 4F6AA 3QAHA 5JGFA 3BJ8A 1YLEA 1M1DA 4OC4A 4KOSA 1XFOA 4NGSA 4ZYQA 3NFZA 3TE4A 2BL1A 3JVNA 3I1UA 2Z3OA 1EE3P 2J8RA 1ELMP 4GS4A 1Z4EA 4KVOE 2CNMA 3TOAA 1YMEA 1DTDA 4C2XA 8CPAA 4XNHB 3W6SA 1KUVA 2XEJA 1ZO0A 2KCWA 3DSBA 3VH9A 1Z9UA 4ZY0A 2RC4A 1IOIA 2IQ6A 2PDOA 1VHOA 2Q4ZA 5HVGA 4CRYB 1XMBA 2I3CA 1IYLA 1KZFA 4FD7A 4Z65A 1F57A 4OC2A 3H8EA 4HNWB 2OZGA 2ZEMA 3IU2A 2HB6A 3PEIA 4UWIA 3S9LA 2Z10A 1S7NA 2B5GB 2HQYA 3T9YA 1RXTA 4I49A 1CP6A 2I00A 2POKA 1QSRA 2ZW6A 3RZAA 4IK2A 4XNHC 4AVCA 4ZI6A 1HDUA 5C82A 4QC6A 2BCOA 2JDDA 5LYIA 4PV6A 1KUYA 2AE6A 2G3AA 3D2MA 4MHZA 1X12A 1X10A 1YGHA 2ZW4A 1ZLIA 3FYNA 4X2TA 2ZEPA 3D67A 1F2OA 3F0AA 3CPAA 3N5FA 3FBUA 1K4JA 1OBRA 3C26A 1A2ZA 1XBUA 5EMIA 2WZNA 2PQ8A 2CTBA 4PXBA 2P6EA 1TXRA 2IL4A 3FJUA 5H86A 4UA3A 2DPTA 4MFLA 2FL4A 2Q43A 3CXPA 2PR1A 1M44A 3R95A 3OWCA 2QYVA 4DJLA 1BLLE 3NH5A 2ZENA 2PCUA 1ZG9A 2GANA 2NSMA 3PB8X 4AG9A 1PCAA 1BPMA 4UFVA 2ZW7A 1M4IA 1P0HA 2YNCC 4KLVA 1XOVA 4DUKA 2AFWA 2RFHA 2ZOFA 4R6TA 2ZPAA 1BOBA 2ZEDA 4GM5A 4AB7A 3K9TA 2Y0MA 3CPXA 2NMTA 2V8VA 1IGBA 3KHXA 2CY2A 4CAWA 1RTQA 5KTAA 5THWA 5ELYA 2FT0A 1QSMA 3IWGA 4PQAA 2PJ8A 4W9YA 4CAVA 7CPAA 3FECA 4R3KA 1CX8A 1LANA 3FEDA 4P4IA 2PJ3A 4LQGA 4OC1A 2CF4A 4YWYA 4FD6A 3IWWA 3SI0A 3DDDA 1IOFA 4NGMA 1JWQA 2HC9A 1L0CA 2GLFA 2ANPA 4MFKA 4UEEA 2C6GA 2WYRA 4QUSA 1YLOA 3S6KA 3VATA 2PJ6A 4KOVA 3H8FA 4MFQA 1ZG7A 3D2PA 1ZLHA 2V77A 3NA6A 3PB4X 4RUHA 4KORA 4KSFA 4P4FA 4MY0A 4PXDA 2Z3MA 4TWEA 2C6PA 1P4NA 1S7FA 4X3RA 4R3LA 4E2AA 4NJRA 1BAVA 1Z8TA 2GIVA 2WPWA 1Y0YA 1S7KA 5A27A 3KASA 1CG2A 2Q7SA 3R1KA 4Y49C 2PRBA 4X5KA 1CPXA 5HVFA 3TX8A 4GXHA 4NXYA 4RI1A 2ATRA 2B4DB 4RS2A 1QQ9A 4IF5A 4KOYA 4OC0A 5IB0A 4KOXA 5AG5A 2VEZA 4KSIA 5GCNA 3WT4A 4B5PB 4DNCA 3PBEA 2Q4VA 3MN8A 1S60A 4FBEA 2HUZA 3B3CA 3B3TA 3QNVA 5AG6A 2VZZA 1CP7A 5AGEA 1M4DA 2GLJA 2JEVA 4P4DA 4PXEA 4C7HA 2GU2A 5FVJA 2B3VA 2R8VA 3R9GA 2K5TA 2Q44A 3SXNA 3T90A 2J8NA 3S9MA 2ZEEA 3TTHA 4A30A 2QVPA 4XPKA 1S5KA 4MHYA 2P6GA 2YNCA 1RO5A 4UBRA 5JH9A 3PBBA 3IIBA 3KI9A 2O4HA 5BWAB 1HEEA 2B4DA 5CNPA 2FE7A 1JQGA 3IFEA 4NGNA 1NSAA 2Q0YA 4Q7AA 5JQ4A 3B3VA 1YW4A 4ZY2A 4P44A 2PJBA 5KTCA 4H2KA 4AVAA 4H6ZA 3DLJA 2BSWA 4NGQA 3TO7A 1N71A 4F0YA 4CYPA 5JPHA 4ONWA 4CAEA 5G21A 3PZJA 1TKHA 4B10A 4R9MA 2CNSA 2EBJA 3I3GA 4UWJA 3EO4A 5EBVA 2EK9A 2G3TA 3FF3A 4JXRA 3S9NA 3ZZIA 3BJ7A 4CRZB 5J1QA 2GREA 5AG7A 1BPNA 4MHNA 1PUAA 2AFSA 2B3UA 4CGLA 2AFOA 3GYAA 4MY3A 4B12A 4CS0B 4JZ0A 4B11A 3TCVA 2O28A 4EWTA 4MXUA 4MCSA 3KGQA 1Q2CA 4Q38A 3EY5A 3S6FA 4KVME 4LUAA 4UCPA 1IYKA 3L2NA 5LYFA 3NH8A 2EUIA 3FEEA 3GY9A 4XPDC 4A39A 4EMEA 4M6GA 5D8NA 4U5YA 2AFZA 5DWNA 3PFEA 3GLJA 5H84A 4PK3A 3PFOA 4OKOA 3A9LA 3G3SA 1VKCA 4AG7A 5K8MA 1CM0A 4KZTA 3P2FA 2PJ4A 4ZGYB 4ONUA 1V0CA 4J3GA 2PE3A 4OC3A 3K2KA 4R8FA 2FVGA 3F5BA 4AVBA 4NGRA 3PGPA 5I0CA 2G0BA 4UCMA 4CAFA 3BI1A 4DYOA 1Z8XA 4NCZA 4L89A 5F47A 5CPAA
chains in the Genus database with same CATH topology
5J8CA 1YVOA 1QSTA 1YREA 4KUAA 4U9YA 3FIXA 5AG4A 4B5PA 2A4NA 4JD6A 2F5IA 4A95A 2Z3PA 2B5GA 3JUWA 4R57A 4A33A 4A32A 4QVTA 3TFYA 1MJAA 4C2ZA 2HV2A 4KS9A 4CYOA 5F49A 3DNSA 1YK3A 3RYOA 4MI4A 3D8PA 3SXOA 2QMLA 2WSAA 3MGDA 3V8IA 4BBHA 2WUUA 2P0WA 2VBQA 5A28A 4MFJA 5DWMA 5E96A 3PP9A 1Q2YA 1XMTA 2JDCA 2VQYA 3EFAA 4U9ZA 1QSNA 1WK4A 2Z3KA 1YX0A 2QIRA 3F8KA 4UCNA 2JLMA 4MFPA 4HNXB 1M4GA 4Y49B 1XF8A 2R1IA 3W91A 4E8OA 4E0AA 1WWZA 3IU1A 1LRZA 3I9SA 4NF1A 1U6MA 3S6HA 2EVNA 4PSXA 1SQHA 3DR8A 2OB0A 2FCKA 2OH1A 2Z3NA 2B58A 5J8FA 4KLWA 4OAEA 1I12A 2P6FA 2Q4YA 3CXSA 3D3SA 4CGNA 4C7IA 4JLYA 1I1DA 3FXTA 2OZUA 1NSLA 2OU2A 3KKWA 1XEBA 4C2YA 2DXQA 3QB8A 4M3SA 2OZHA 4L8AA 1YVKA 4II9A 4Q36A 4PK2A 3UY5A 4UFWA 2PR8A 5ISVA 1QSOA 3BLNA 1S7LA 1R57A 2GE3A 3EXNA 4KSAA 4IUSA 4NEXA 5IX3A 1OZPA 4PSWA 1I21A 4KOWA 4JWPA 3CXQA 4MBUA 3TO9A 4A2ZA 3G8WA 1MJ9A 3VWEA 3ZJ0A 3K9UA 4M85A 1B6BA 3WR7A 5HMNA 1NE9A 1Y7RA 2BEIA 2WPXA 4YGOA 5F48A 1Y9KA 2Z3LA 4MJ8A 4XPDB 3GKRA 4HKFA 2H5MA 1KUXA 1IIDA 2DPSA 2PSWA 4B14A 3W6XA 3N7ZA 3S6GA 4XPLA 4JXQA 3B8GA 4H89A 3FNCA 2VZYA 4KUBA 1CJWA 5IV0A 1ON0A 4MFZA 4A31A 4CGMA 4CYQA 1GHEA 2REEA 2J8MA 4KVXA 4OLLA 2BUEA 4HNYB 4KOUA 3E0KA 1Q2DA 2D4OA 3TT2A 1IB1E 3LODA 2CNTA 4FD4A 4OADA 3H5ZA 1Y9WA 2VI7A 1XE4A 2Z11A 3TO6A 2REFA 1Z4RA 3JTKA 4B5OA 4LX9A 5EC4A 1YR0A 4QBJA 2R7HA 4ORFA 4R87A 1UFHA 1J4JA 4CGOA 4BMHA 1NMTA 2QECA 4YFJA 1BO4A 2FS5A 5KTDA 4NSQA 2FXFA 3R9FA 1VHSA 3TOBA 2Z0ZA 2ARHA 2D4PA 5F46A 4F0XA 5G1ZA 4QB9A 4KOTA 4ZBGA 2YGWA 2Q04A 4B13A 2R98A 4FD5A 4C68A 3VWDA 5HH1A 5G22A 2X7BA 3SHPA 3IWEA 1PU9A 4JJXA 4CGPA 2C27A 3R9EA 3DR6A 2PC1A 3FB3A 2B4BA 4CAXA 4CYNA 5G20A 4MHDA 3P2HA 2AJ6A 1MJBA 2I79A 1IICA 2YNDA 3LD2A 3R96A 2ZXVA 4YRHA 1B87A 3IGRA 3FRMA 1S3ZA 2CXAA 3EC4A 2FSRA 1FY7A 4K30A 2FIWA 4H6UA 4EVYA 3NE7A 2YNEA 4UFXA 3H4QA 2FIAA 1TIQA 1XIXA 2ZW5A 2Q7BA 5C88A 1MK4A 2VXKA 4F6AA 3QAHA 3BJ8A 1YLEA 1M1DA 4KOSA 3TE4A 2BL1A 3JVNA 2Z3OA 2J8RA 4GS4A 3TOAA 1Z4EA 4KVOE 2CNMA 4C2XA 4XNHB 3W6SA 1KUVA 1ZO0A 2KCWA 3DSBA 1Z9UA 2RC4A 2PDOA 4CRYB 1IYLA 1KZFA 4FD7A 4HNWB 2OZGA 4UWIA 3IU2A 2Z10A 1S7NA 2B5GB 2HQYA 3T9YA 1RXTA 4I49A 2I00A 1QSRA 2ZW6A 4AVCA 4XNHC 5C82A 4QC6A 2JDDA 4PV6A 1KUYA 2AE6A 2G3AA 3D2MA 1YGHA 2ZW4A 3FYNA 3F0AA 3FBUA 1K4JA 3C26A 2PQ8A 2P6EA 2IL4A 5H86A 4UA3A 4MFLA 2DPTA 2FL4A 3R95A 3CXPA 2PR1A 1M44A 3OWCA 2GANA 4AG9A 4UFVA 2ZW7A 1M4IA 1P0HA 2YNCC 4KLVA 2ZPAA 1BOBA 4AB7A 2Y0MA 2NMTA 2CY2A 4CAWA 5KTAA 2FT0A 1QSMA 3IWGA 4CAVA 4R3KA 4FD6A 3DDDA 1L0CA 4MFKA 4QUSA 3S6KA 4KOVA 4MFQA 3D2PA 4KORA 4KSFA 4MY0A 2Z3MA 4E2AA 1P4NA 1S7FA 4R3LA 2GIVA 2WPWA 1S7KA 5A27A 3R1KA 4Y49C 2PRBA 4X5KA 4NXYA 4RI1A 2ATRA 2B4DB 4RS2A 4IF5A 4KOYA 5IB0A 4KOXA 5AG5A 2VEZA 5GCNA 4B5PB 4DNCA 2Q4VA 1S60A 2HUZA 5AG6A 2VZZA 5AGEA 1M4DA 2JEVA 4C7HA 5FVJA 3R9GA 2B3VA 2R8VA 3SXNA 2K5TA 2Q44A 3T90A 2J8NA 3TTHA 4A30A 4XPKA 1S5KA 2P6GA 2YNCA 1RO5A 4UBRA 5BWAB 2B4DA 5CNPA 2FE7A 2Q0YA 5JQ4A 5KTCA 4AVAA 4H6ZA 2BSWA 3TO7A 1N71A 4F0YA 4CYPA 5JPHA 4CAEA 5G21A 3PZJA 4B10A 4R9MA 2CNSA 3I3GA 4UWJA 3EO4A 5EBVA 2G3TA 4JXRA 3ZZIA 3BJ7A 4CRZB 5AG7A 1PUAA 2B3UA 4CGLA 3GYAA 4MY3A 4B12A 4CS0B 4B11A 3TCVA 2O28A 1Q2CA 4Q38A 3EY5A 3S6FA 4KVME 4LUAA 4UCPA 1IYKA 2EUIA 3GY9A 4XPDC 4U5YA 5DWNA 5H84A 4PK3A 3A9LA 3G3SA 1VKCA 4AG7A 1CM0A 4KZTA 3P2FA 4ZGYB 4ONUA 1V0CA 4J3GA 3F5BA 5I0CA 4AVBA 3PGPA 2G0BA 4UCMA 4CAFA 4NCZA 4L89A 5F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8C A;  1YVO A;  1QST A;  1YRE A;  4KUA A;  4U9Y A;  3FIX A;  4B5P A;  2A4N A;  4JD6 A;  2F5I A;  4R57 A;  2B5G A;  3JUW A;  4QVT A;  3TFY A;  1MJA A;  2HV2 A;  5F49 A;  3DNS A;  1YK3 A;  3RYO A;  4MI4 A;  3D8P A;  3SXO A;  2QML A;  3MGD A;  3V8I A;  2P0W A;  2VBQ A;  5DWM A;  5E96 A;  3PP9 A;  1Q2Y A;  1XMT A;  2JDC A;  2VQY A;  3EFA A;  4U9Z A;  1QSN A;  1WK4 A;  1YX0 A;  2QIR A;  3F8K A;  2JLM A;  4HNX B;  1M4G A;  4Y49 B;  1XF8 A;  2R1I A;  3W91 A;  4E8O A;  4E0A A;  1WWZ A;  1LRZ A;  3I9S A;  4NF1 A;  1U6M A;  3S6H A;  2EVN A;  4PSX A;  1SQH A;  3DR8 A;  2OB0 A;  2FCK A;  2OH1 A;  2B58 A;  5J8F A;  4KLW A;  4OAE A;  1I12 A;  2P6F A;  2Q4Y A;  3CXS A;  3D3S A;  4JLY A;  1I1D A;  3FXT A;  2OZU A;  1NSL A;  2OU2 A;  3KKW A;  1XEB A;  2DXQ A;  3QB8 A;  4M3S A;  2OZH A;  4L8A A;  1YVK A;  4II9 A;  4PK2 A;  3UY5 A;  5ISV A;  2PR8 A;  1QSO A;  3BLN A;  1S7L A;  1R57 A;  2GE3 A;  3EXN A;  4NEX A;  4IUS A;  5IX3 A;  1OZP A;  4PSW A;  1I21 A;  4KOW A;  4JWP A;  3CXQ A;  4MBU A;  3TO9 A;  3G8W A;  1MJ9 A;  3VWE A;  3ZJ0 A;  3K9U A;  4M85 A;  1B6B A;  3WR7 A;  5HMN A;  1NE9 A;  1Y7R A;  2BEI A;  2WPX A;  4YGO A;  5F48 A;  1Y9K A;  4MJ8 A;  4XPD B;  3GKR A;  4HKF A;  2H5M A;  1KUX A;  1IID A;  2PSW A;  3W6X A;  3N7Z A;  3S6G A;  4XPL A;  4JXQ A;  3B8G A;  4H89 A;  3FNC A;  2VZY A;  4KUB A;  1CJW A;  5IV0 A;  1ON0 A;  1GHE A;  2REE A;  2J8M A;  4KVX A;  4OLL A;  2BUE A;  4HNY B;  4KOU A;  3E0K A;  1Q2D A;  2D4O A;  3TT2 A;  1IB1 E;  3LOD A;  2CNT A;  4FD4 A;  4OAD A;  1Y9W A;  2VI7 A;  1XE4 A;  2Z11 A;  3TO6 A;  2REF A;  1Z4R A;  4B5O A;  4LX9 A;  5EC4 A;  1YR0 A;  4QBJ A;  2R7H A;  4ORF A;  4R87 A;  1UFH A;  1J4J A;  4BMH A;  1NMT A;  2QEC A;  4YFJ A;  1BO4 A;  2FS5 A;  5KTD A;  4NSQ A;  2FXF A;  3R9F A;  1VHS A;  3TOB A;  2Z0Z A;  2ARH A;  2D4P A;  5F46 A;  4QB9 A;  4KOT A;  4ZBG A;  2Q04 A;  2R98 A;  4FD5 A;  3VWD A;  5HH1 A;  2X7B A;  3SHP A;  1PU9 A;  4JJX A;  2C27 A;  3R9E A;  3DR6 A;  2PC1 A;  3FB3 A;  2B4B A;  4CAX A;  4MHD A;  3P2H A;  2AJ6 A;  1MJB A;  2I79 A;  1IIC A;  3LD2 A;  3R96 A;  2ZXV A;  4YRH A;  1B87 A;  3IGR A;  3FRM A;  1S3Z A;  3EC4 A;  2FSR A;  1FY7 A;  4K30 A;  2FIW A;  4H6U A;  4EVY A;  3NE7 A;  3H4Q A;  2FIA A;  1TIQ A;  1XIX A;  2ZW5 A;  2Q7B A;  5C88 A;  1MK4 A;  2VXK A;  4F6A A;  3QAH A;  3BJ8 A;  1YLE A;  1M1D A;  4KOS A;  3TE4 A;  2BL1 A;  3JVN A;  2J8R A;  4GS4 A;  3TOA A;  1Z4E A;  4KVO E;  2CNM A;  4XNH B;  3W6S A;  1KUV A;  2KCW A;  3DSB A;  1Z9U A;  2RC4 A;  2PDO A;  4CRY B;  1IYL A;  1KZF A;  4FD7 A;  4HNW B;  2OZG A;  4UWI A;  2Z10 A;  1S7N A;  2B5G B;  2HQY A;  3T9Y A;  1RXT A;  4I49 A;  2I00 A;  1QSR A;  2ZW6 A;  4AVC A;  4XNH C;  5C82 A;  4QC6 A;  2JDD A;  4PV6 A;  1KUY A;  2AE6 A;  2G3A A;  3D2M A;  1YGH A;  2ZW4 A;  3FYN A;  3F0A A;  3FBU A;  1K4J A;  3C26 A;  2PQ8 A;  2P6E A;  2IL4 A;  5H86 A;  4UA3 A;  3R95 A;  2FL4 A;  3CXP A;  2PR1 A;  1M44 A;  3OWC A;  2GAN A;  4AG9 A;  2ZW7 A;  1M4I A;  1P0H A;  4KLV A;  2ZPA A;  1BOB A;  4AB7 A;  2Y0M A;  2NMT A;  2CY2 A;  4CAW A;  5KTA A;  2FT0 A;  1QSM A;  3IWG A;  4CAV A;  4R3K A;  4FD6 A;  3DDD A;  1L0C A;  4QUS A;  3S6K A;  4KOV A;  3D2P A;  4KOR A;  4MY0 A;  4E2A A;  1P4N A;  1S7F A;  4R3L A;  2GIV A;  2WPW A;  1S7K A;  3R1K A;  4Y49 C;  2PRB A;  4X5K A;  4NXY A;  4RI1 A;  2ATR A;  2B4D B;  4RS2 A;  4IF5 A;  4KOY A;  5IB0 A;  4KOX A;  2VEZ A;  5GCN A;  4B5P B;  4DNC A;  2Q4V A;  1S60 A;  2HUZ A;  2VZZ A;  1M4D A;  2JEV A;  5FVJ A;  3R9G A;  2B3V A;  2R8V A;  3SXN A;  2K5T A;  2Q44 A;  3T90 A;  2J8N A;  3TTH A;  4XPK A;  1S5K A;  2P6G A;  1RO5 A;  4UBR A;  2B4D A;  5CNP A;  2FE7 A;  2Q0Y A;  5JQ4 A;  5KTC A;  4AVA A;  4H6Z A;  2BSW A;  3TO7 A;  1N71 A;  4F0Y A;  5JPH A;  3PZJ A;  4R9M A;  2CNS A;  3I3G A;  4UWJ A;  3EO4 A;  5EBV A;  2G3T A;  4JXR A;  3ZZI A;  3BJ7 A;  4CRZ B;  1PUA A;  2B3U A;  3GYA A;  4MY3 A;  4CS0 B;  3TCV A;  2O28 A;  1Q2C A;  3EY5 A;  3S6F A;  4KVM E;  4LUA A;  1IYK A;  2EUI A;  3GY9 A;  4XPD C;  4U5Y A;  5DWN A;  5H84 A;  4PK3 A;  3G3S A;  1VKC A;  4AG7 A;  1CM0 A;  4KZT A;  3P2F A;  4ONU A;  1V0C A;  4J3G A;  3F5B A;  5I0C A;  4AVB A;  3PGP A;  2G0B A;  4NCZ A;  4L89 A;  5F47 A; 
#chains in the Genus database with same CATH topology
 1GYT A;  3HLP A;  4OME A;  5J8C A;  4NFR A;  4MCR A;  3PB6 X;  1YVO A;  1IY7 A;  4YU9 A;  1QST A;  2IMO A;  1YRE A;  2G9D A;  4KUA A;  4NGT A;  4U9Y A;  2PJA A;  3FIX A;  2O53 A;  5AG4 A;  1ELL P;  4B5P A;  4BD9 A;  2A4N A;  4F9V A;  4JD6 A;  2F5I A;  4A95 A;  2EK8 A;  1ARL A;  2RB7 A;  4A37 A;  4P4B A;  2Z3P A;  2B5G A;  2AFU A;  3JUW A;  4G1P A;  4R57 A;  4UIA A;  4WWV A;  4A33 A;  4A32 A;  4QVT A;  3TFY A;  3LAC A;  1MJA A;  1Y7E A;  2CTC A;  4C2Z A;  2HV2 A;  1QMU A;  4CPA A;  4KS9 A;  4CYO A;  2VL1 A;  4A94 A;  5F49 A;  3DNS A;  1YK3 A;  3RYO A;  4MI4 A;  3PB7 X;  3D8P A;  3SXO A;  2QML A;  4R76 A;  2WSA A;  3MGD A;  2Q51 A;  3V8I A;  4BBH A;  2WUU A;  2P0W A;  2VBQ A;  4ZY1 A;  1Z8W A;  3WC6 A;  5A28 A;  2EWB A;  3HUV A;  3VAR A;  3DGV A;  4MFJ A;  3CZX A;  5DWM A;  1AUG A;  1HDQ A;  5E96 A;  3NE8 A;  3WC5 A;  3FX6 A;  1Q2Y A;  3H8G A;  3PP9 A;  2PIZ A;  3V38 A;  1XMT A;  2JDC A;  2VQY A;  2PJ9 A;  3EFA A;  1VIX A;  3IO1 A;  1PYT B;  4U9Z A;  1VGY A;  1QSN A;  2F8H A;  1WK4 A;  2Z3K A;  3GUX A;  4OC5 A;  1YX0 A;  3PB9 X;  1TF8 A;  2QIR A;  3D7G A;  4X8I A;  3F8K A;  4OP4 A;  2JLM A;  4UCN A;  4MFP A;  4HNX B;  1M4G A;  2ODF A;  3MRU A;  4Y49 B;  1XF8 A;  2GFQ A;  2R1I A;  3W91 A;  4E8O A;  4F9U A;  1YQE A;  3B3S A;  4E0A A;  1WWZ A;  3IU1 A;  1LRZ A;  3I9S A;  2JBJ A;  1CBX A;  1XRY A;  1U6M A;  4NF1 A;  3RAM A;  2EVN A;  3S6H A;  1F2P A;  1SQH A;  3DR8 A;  4PSX A;  2OB0 A;  2FCK A;  2OH1 A;  4WJB A;  2Z3N A;  1Z5R A;  1XJO A;  3D68 A;  2B58 A;  4HPS A;  1AYE A;  1TKJ A;  4EFD A;  5J8F A;  3QAY A;  1ZG8 A;  2CIJ A;  4K3N A;  2QJ8 A;  4KLW A;  3D7H A;  4OAE A;  5LRJ A;  4LQ6 A;  4M6I A;  3T8W A;  1I12 A;  2P6F A;  2ZEL A;  3D4U A;  1FT7 A;  3B2Y A;  4TNU A;  2Q4Y A;  2ABZ A;  3RBU A;  2XEF A;  2J9A A;  1R3N A;  3CXS A;  3D3S A;  4CGN A;  4P4J A;  4C7I A;  4JLY A;  1I1D A;  2JEW A;  3ISX A;  3FXT A;  2DF5 A;  2OZU A;  3FH4 A;  1Z2L A;  2OU2 A;  3KKW A;  1XEB A;  1NSL A;  4C2Y A;  2DXQ A;  3B3W A;  3QB8 A;  4M3S A;  2OZH A;  5I4M A;  2ZEG A;  4L8A A;  4FAI A;  2OOT A;  1YVK A;  4II9 A;  4Q36 A;  4PK2 A;  3UY5 A;  3D7F A;  4UFW A;  2PR8 A;  3KQZ A;  5ISV A;  1QSO A;  1YW6 A;  3BHX A;  4MHP A;  1Y0R A;  3BLN A;  1S7L A;  1R57 A;  2GE3 A;  2NYQ A;  3ISZ A;  4P45 A;  3EXN A;  4KSA A;  3GB0 A;  3KR4 A;  1M4L A;  2ZEH A;  4IUS A;  1LCP A;  4NEX A;  3SI2 A;  1H8L A;  2XEI A;  5IX3 A;  1OZP A;  4PSW A;  1I21 A;  4KOW A;  4JWP A;  4MCQ A;  3CXQ A;  4MBU A;  2IJZ A;  3TO9 A;  4A2Z A;  3B7I A;  3G8W A;  1MJ9 A;  3KZW A;  3VWE A;  5K8P A;  3ZJ0 A;  3K9U A;  4M85 A;  4MMO A;  4RN7 A;  1B6B A;  3WR7 A;  4NGP A;  5HMN A;  4UEF A;  5LYD A;  1NE9 A;  1Y7R A;  3BI0 A;  2BEI A;  2WPX A;  4IHM A;  1TKF A;  4YGO A;  2XEG A;  4F8Z A;  5F48 A;  1Y9K A;  5K8O A;  4O23 A;  2OR4 A;  2Z3L A;  4MJ8 A;  4XPD B;  3WC7 A;  1UWY A;  3GKR A;  3FMC A;  2V8H A;  4HKF A;  2AFX A;  2PJ1 A;  2H5M A;  3KR5 A;  4MCP A;  5LRK A;  1KUX A;  1IID A;  2DPS A;  2PSW A;  4B14 A;  3W6X A;  4UEZ A;  3N7Z A;  2EO8 A;  3S6G A;  4XPL A;  4JXQ A;  3B8G A;  4H89 A;  2C1C A;  3WAB A;  3SJF A;  3FNC A;  2VZY A;  4KUB A;  1LAP A;  1CJW A;  3RNZ A;  5IV0 A;  1ON0 A;  4MFZ A;  3SI1 A;  4ZX8 A;  4A31 A;  4CGM A;  1Q7L A;  1GHE A;  3B35 A;  4OID A;  1FNO A;  4CYQ A;  2REE A;  2J8M A;  3GIU A;  4KVX A;  2BUE A;  4HNY B;  4OLL A;  5F09 A;  4KOU A;  3E0K A;  4B6Z A;  1Q2D A;  2D4O A;  1IU8 A;  3TT2 A;  2PJ5 A;  1IB1 E;  2PRQ A;  3LOD A;  2CNT A;  3PRT A;  2PJ7 A;  4FD4 A;  4PXC A;  4OAD A;  4UF4 A;  3H5Z A;  1Y9W A;  2PJ0 A;  2VI7 A;  2ZEF A;  1XE4 A;  2ZOG A;  2Z11 A;  3IC1 A;  3TO6 A;  1LFW A;  5JM6 A;  2REF A;  3SJG A;  5IB9 A;  1Z4R A;  3JTK A;  5LRG A;  4B5O A;  4LX9 A;  5EC4 A;  1YR0 A;  3FVL A;  4QBJ A;  1R43 A;  4A38 A;  3BXM A;  2JBK A;  2R7H A;  4ORF A;  3V7Z A;  2BOA A;  4R87 A;  1UFH A;  4JYW A;  4AXV A;  5CBM A;  1J4J A;  4OIW A;  1Z8L A;  4CGO A;  2DEA A;  1NMT A;  4NJQ A;  4BMH A;  2QEC A;  2PJ2 A;  1BO4 A;  4YFJ A;  2FS5 A;  1YSJ A;  5KTD A;  3JRU A;  4FWU A;  4NSQ A;  4PPZ A;  2FXF A;  2PJC A;  3R9F A;  1VHS A;  3TOB A;  2BO9 A;  3CDX A;  2Z0Z A;  3LWU A;  2ARH A;  2D4P A;  3KHZ A;  4F0X A;  5F46 A;  2C6C A;  5G1Z A;  4QB9 A;  4BIN A;  4KOT A;  1KWM A;  4ZBG A;  1ARM A;  2YGW A;  2Q04 A;  4B13 A;  1CPS A;  2F7V A;  2R98 A;  1AMP A;  4FD5 A;  3NH4 A;  4C68 A;  3VWD A;  5HH1 A;  5G22 A;  3RO0 A;  2X7B A;  3D7D A;  5HXD A;  5D29 A;  3SHP A;  3IWE A;  1PU9 A;  4FUU A;  4JJX A;  2C27 A;  4CGP A;  3R9E A;  1LOK A;  3D66 A;  3DR6 A;  4P6Y A;  2PC1 A;  4UIB A;  1TF9 A;  5HVH A;  3FB3 A;  5DS0 A;  3TC8 A;  5K8N A;  2B4B A;  4CAX A;  3KL9 A;  4CYN A;  1DE4 C;  3KQX A;  3IEH A;  2PVV A;  5G20 A;  4MHD A;  2PIY A;  3P2H A;  2AJ6 A;  1MJB A;  2I79 A;  1IIC A;  1LAM A;  2YND A;  3LD2 A;  3R96 A;  4M6H A;  2ZXV A;  4YRH A;  4P10 A;  2V8G A;  4IAV A;  1B87 A;  3IJ3 A;  4P4E A;  3IGR A;  2ZEO A;  1S3Z A;  3FRM A;  2CXA A;  3EC4 A;  2FSR A;  1FY7 A;  4R7M A;  2PVW A;  4K30 A;  3CT9 A;  2FIW A;  4H6U A;  4ZX9 A;  4MRI A;  6CPA A;  4EVY A;  3NE7 A;  2YNE A;  4UFX A;  1VHE A;  3H4Q A;  2FIA A;  1TIQ A;  1XIX A;  3SJE A;  5LYL A;  2ZW5 A;  2V8D A;  3SJX A;  2Q7B A;  5C88 A;  3LMS A;  1MK4 A;  2VXK A;  2AFM A;  4F6A A;  3QAH A;  5JGF A;  3BJ8 A;  1YLE A;  1M1D A;  4OC4 A;  4KOS A;  1XFO A;  4NGS A;  4ZYQ A;  3NFZ A;  3TE4 A;  2BL1 A;  3JVN A;  3I1U A;  2Z3O A;  1EE3 P;  2J8R A;  1ELM P;  4GS4 A;  1Z4E A;  4KVO E;  2CNM A;  3TOA A;  1YME A;  1DTD A;  4C2X A;  8CPA A;  4XNH B;  3W6S A;  1KUV A;  2XEJ A;  1ZO0 A;  2KCW A;  3DSB A;  3VH9 A;  1Z9U A;  4ZY0 A;  2RC4 A;  1IOI A;  2IQ6 A;  2PDO A;  1VHO A;  2Q4Z A;  5HVG A;  4CRY B;  1XMB A;  2I3C A;  1IYL A;  1KZF A;  4FD7 A;  4Z65 A;  1F57 A;  4OC2 A;  3H8E A;  4HNW B;  2OZG A;  2ZEM A;  3IU2 A;  2HB6 A;  3PEI A;  4UWI A;  3S9L A;  2Z10 A;  1S7N A;  2B5G B;  2HQY A;  3T9Y A;  1RXT A;  4I49 A;  1CP6 A;  2I00 A;  2POK A;  1QSR A;  2ZW6 A;  3RZA A;  4IK2 A;  4XNH C;  4AVC A;  4ZI6 A;  1HDU A;  5C82 A;  4QC6 A;  2BCO A;  2JDD A;  5LYI A;  4PV6 A;  1KUY A;  2AE6 A;  2G3A A;  3D2M A;  4MHZ A;  1X12 A;  1X10 A;  1YGH A;  2ZW4 A;  1ZLI A;  3FYN A;  4X2T A;  2ZEP A;  3D67 A;  1F2O A;  3F0A A;  3CPA A;  3N5F A;  3FBU A;  1K4J A;  1OBR A;  3C26 A;  1A2Z A;  1XBU A;  5EMI A;  2WZN A;  2PQ8 A;  2CTB A;  4PXB A;  2P6E A;  1TXR A;  2IL4 A;  3FJU A;  5H86 A;  4UA3 A;  2DPT A;  4MFL A;  2FL4 A;  2Q43 A;  3CXP A;  2PR1 A;  1M44 A;  3R95 A;  3OWC A;  2QYV A;  4DJL A;  1BLL E;  3NH5 A;  2ZEN A;  2PCU A;  1ZG9 A;  2GAN A;  2NSM A;  3PB8 X;  4AG9 A;  1PCA A;  1BPM A;  4UFV A;  2ZW7 A;  1M4I A;  1P0H A;  2YNC C;  4KLV A;  1XOV A;  4DUK A;  2AFW A;  2RFH A;  2ZOF A;  4R6T A;  2ZPA A;  1BOB A;  2ZED A;  4GM5 A;  4AB7 A;  3K9T A;  2Y0M A;  3CPX A;  2NMT A;  2V8V A;  1IGB A;  3KHX A;  2CY2 A;  4CAW A;  1RTQ A;  5KTA A;  5THW A;  5ELY A;  2FT0 A;  1QSM A;  3IWG A;  4PQA A;  2PJ8 A;  4W9Y A;  4CAV A;  7CPA A;  3FEC A;  4R3K A;  1CX8 A;  1LAN A;  3FED A;  4P4I A;  2PJ3 A;  4LQG A;  4OC1 A;  2CF4 A;  4YWY A;  4FD6 A;  3IWW A;  3SI0 A;  3DDD A;  1IOF A;  4NGM A;  1JWQ A;  2HC9 A;  1L0C A;  2GLF A;  2ANP A;  4MFK A;  4UEE A;  2C6G A;  2WYR A;  4QUS A;  1YLO A;  3S6K A;  3VAT A;  2PJ6 A;  4KOV A;  3H8F A;  4MFQ A;  1ZG7 A;  3D2P A;  1ZLH A;  2V77 A;  3NA6 A;  3PB4 X;  4RUH A;  4KOR A;  4KSF A;  4P4F A;  4MY0 A;  4PXD A;  2Z3M A;  4TWE A;  2C6P A;  1P4N A;  1S7F A;  4X3R A;  4R3L A;  4E2A A;  4NJR A;  1BAV A;  1Z8T A;  2GIV A;  2WPW A;  1Y0Y A;  1S7K A;  5A27 A;  3KAS A;  1CG2 A;  2Q7S A;  3R1K A;  4Y49 C;  2PRB A;  4X5K A;  1CPX A;  5HVF A;  3TX8 A;  4GXH A;  4NXY A;  4RI1 A;  2ATR A;  2B4D B;  4RS2 A;  1QQ9 A;  4IF5 A;  4KOY A;  4OC0 A;  5IB0 A;  4KOX A;  5AG5 A;  2VEZ A;  4KSI A;  5GCN A;  3WT4 A;  4B5P B;  4DNC A;  3PBE A;  2Q4V A;  3MN8 A;  1S60 A;  4FBE A;  2HUZ A;  3B3C A;  3B3T A;  3QNV A;  5AG6 A;  2VZZ A;  1CP7 A;  5AGE A;  1M4D A;  2GLJ A;  2JEV A;  4P4D A;  4PXE A;  4C7H A;  2GU2 A;  5FVJ A;  2B3V A;  2R8V A;  3R9G A;  2K5T A;  2Q44 A;  3SXN A;  3T90 A;  2J8N A;  3S9M A;  2ZEE A;  3TTH A;  4A30 A;  2QVP A;  4XPK A;  1S5K A;  4MHY A;  2P6G A;  2YNC A;  1RO5 A;  4UBR A;  5JH9 A;  3PBB A;  3IIB A;  3KI9 A;  2O4H A;  5BWA B;  1HEE A;  2B4D A;  5CNP A;  2FE7 A;  1JQG A;  3IFE A;  4NGN A;  1NSA A;  2Q0Y A;  4Q7A A;  5JQ4 A;  3B3V A;  1YW4 A;  4ZY2 A;  4P44 A;  2PJB A;  5KTC A;  4H2K A;  4AVA A;  4H6Z A;  3DLJ A;  2BSW A;  4NGQ A;  3TO7 A;  1N71 A;  4F0Y A;  4CYP A;  5JPH A;  4ONW A;  4CAE A;  5G21 A;  3PZJ A;  1TKH A;  4B10 A;  4R9M A;  2CNS A;  2EBJ A;  3I3G A;  4UWJ A;  3EO4 A;  5EBV A;  2EK9 A;  2G3T A;  3FF3 A;  4JXR A;  3S9N A;  3ZZI A;  3BJ7 A;  4CRZ B;  5J1Q A;  2GRE A;  5AG7 A;  1BPN A;  4MHN A;  1PUA A;  2AFS A;  2B3U A;  4CGL A;  2AFO A;  3GYA A;  4MY3 A;  4B12 A;  4CS0 B;  4JZ0 A;  4B11 A;  3TCV A;  2O28 A;  4EWT A;  4MXU A;  4MCS A;  3KGQ A;  1Q2C A;  4Q38 A;  3EY5 A;  3S6F A;  4KVM E;  4LUA A;  4UCP A;  1IYK A;  3L2N A;  5LYF A;  3NH8 A;  2EUI A;  3FEE A;  3GY9 A;  4XPD C;  4A39 A;  4EME A;  4M6G A;  5D8N A;  4U5Y A;  2AFZ A;  5DWN A;  3PFE A;  3GLJ A;  5H84 A;  4PK3 A;  3PFO A;  4OKO A;  3A9L A;  3G3S A;  1VKC A;  4AG7 A;  5K8M A;  1CM0 A;  4KZT A;  3P2F A;  2PJ4 A;  4ZGY B;  4ONU A;  1V0C A;  4J3G A;  2PE3 A;  4OC3 A;  3K2K A;  4R8F A;  2FVG A;  3F5B A;  4AVB A;  4NGR A;  3PGP A;  5I0C A;  2G0B A;  4UCM A;  4CAF A;  3BI1 A;  4DYO A;  1Z8X A;  4NCZ A;  4L89 A;  5F47 A;  5CPA A; 
#chains in the Genus database with same CATH homology
 5J8C A;  1YVO A;  1QST A;  1YRE A;  4KUA A;  4U9Y A;  3FIX A;  5AG4 A;  4B5P A;  2A4N A;  4JD6 A;  2F5I A;  4A95 A;  2Z3P A;  2B5G A;  3JUW A;  4R57 A;  4A33 A;  4A32 A;  4QVT A;  3TFY A;  1MJA A;  4C2Z A;  2HV2 A;  4KS9 A;  4CYO A;  5F49 A;  3DNS A;  1YK3 A;  3RYO A;  4MI4 A;  3D8P A;  3SXO A;  2QML A;  2WSA A;  3MGD A;  3V8I A;  4BBH A;  2WUU A;  2P0W A;  2VBQ A;  5A28 A;  4MFJ A;  5DWM A;  5E96 A;  3PP9 A;  1Q2Y A;  1XMT A;  2JDC A;  2VQY A;  3EFA A;  4U9Z A;  1QSN A;  1WK4 A;  2Z3K A;  1YX0 A;  2QIR A;  3F8K A;  4UCN A;  2JLM A;  4MFP A;  4HNX B;  1M4G A;  4Y49 B;  1XF8 A;  2R1I A;  3W91 A;  4E8O A;  4E0A A;  1WWZ A;  3IU1 A;  1LRZ A;  3I9S A;  4NF1 A;  1U6M A;  3S6H A;  2EVN A;  4PSX A;  1SQH A;  3DR8 A;  2OB0 A;  2FCK A;  2OH1 A;  2Z3N A;  2B58 A;  5J8F A;  4KLW A;  4OAE A;  1I12 A;  2P6F A;  2Q4Y A;  3CXS A;  3D3S A;  4CGN A;  4C7I A;  4JLY A;  1I1D A;  3FXT A;  2OZU A;  1NSL A;  2OU2 A;  3KKW A;  1XEB A;  4C2Y A;  2DXQ A;  3QB8 A;  4M3S A;  2OZH A;  4L8A A;  1YVK A;  4II9 A;  4Q36 A;  4PK2 A;  3UY5 A;  4UFW A;  2PR8 A;  5ISV A;  1QSO A;  3BLN A;  1S7L A;  1R57 A;  2GE3 A;  3EXN A;  4KSA A;  4IUS A;  4NEX A;  5IX3 A;  1OZP A;  4PSW A;  1I21 A;  4KOW A;  4JWP A;  3CXQ A;  4MBU A;  3TO9 A;  4A2Z A;  3G8W A;  1MJ9 A;  3VWE A;  3ZJ0 A;  3K9U A;  4M85 A;  1B6B A;  3WR7 A;  5HMN A;  1NE9 A;  1Y7R A;  2BEI A;  2WPX A;  4YGO A;  5F48 A;  1Y9K A;  2Z3L A;  4MJ8 A;  4XPD B;  3GKR A;  4HKF A;  2H5M A;  1KUX A;  1IID A;  2DPS A;  2PSW A;  4B14 A;  3W6X A;  3N7Z A;  3S6G A;  4XPL A;  4JXQ A;  3B8G A;  4H89 A;  3FNC A;  2VZY A;  4KUB A;  1CJW A;  5IV0 A;  1ON0 A;  4MFZ A;  4A31 A;  4CGM A;  4CYQ A;  1GHE A;  2REE A;  2J8M A;  4KVX A;  4OLL A;  2BUE A;  4HNY B;  4KOU A;  3E0K A;  1Q2D A;  2D4O A;  3TT2 A;  1IB1 E;  3LOD A;  2CNT A;  4FD4 A;  4OAD A;  3H5Z A;  1Y9W A;  2VI7 A;  1XE4 A;  2Z11 A;  3TO6 A;  2REF A;  1Z4R A;  3JTK A;  4B5O A;  4LX9 A;  5EC4 A;  1YR0 A;  4QBJ A;  2R7H A;  4ORF A;  4R87 A;  1UFH A;  1J4J A;  4CGO A;  4BMH A;  1NMT A;  2QEC A;  4YFJ A;  1BO4 A;  2FS5 A;  5KTD A;  4NSQ A;  2FXF A;  3R9F A;  1VHS A;  3TOB A;  2Z0Z A;  2ARH A;  2D4P A;  5F46 A;  4F0X A;  5G1Z A;  4QB9 A;  4KOT A;  4ZBG A;  2YGW A;  2Q04 A;  4B13 A;  2R98 A;  4FD5 A;  4C68 A;  3VWD A;  5HH1 A;  5G22 A;  2X7B A;  3SHP A;  3IWE A;  1PU9 A;  4JJX A;  4CGP A;  2C27 A;  3R9E A;  3DR6 A;  2PC1 A;  3FB3 A;  2B4B A;  4CAX A;  4CYN A;  5G20 A;  4MHD A;  3P2H A;  2AJ6 A;  1MJB A;  2I79 A;  1IIC A;  2YND A;  3LD2 A;  3R96 A;  2ZXV A;  4YRH A;  1B87 A;  3IGR A;  3FRM A;  1S3Z A;  2CXA A;  3EC4 A;  2FSR A;  1FY7 A;  4K30 A;  2FIW A;  4H6U A;  4EVY A;  3NE7 A;  2YNE A;  4UFX A;  3H4Q A;  2FIA A;  1TIQ A;  1XIX A;  2ZW5 A;  2Q7B A;  5C88 A;  1MK4 A;  2VXK A;  4F6A A;  3QAH A;  3BJ8 A;  1YLE A;  1M1D A;  4KOS A;  3TE4 A;  2BL1 A;  3JVN A;  2Z3O A;  2J8R A;  4GS4 A;  3TOA A;  1Z4E A;  4KVO E;  2CNM A;  4C2X A;  4XNH B;  3W6S A;  1KUV A;  1ZO0 A;  2KCW A;  3DSB A;  1Z9U A;  2RC4 A;  2PDO A;  4CRY B;  1IYL A;  1KZF A;  4FD7 A;  4HNW B;  2OZG A;  4UWI A;  3IU2 A;  2Z10 A;  1S7N A;  2B5G B;  2HQY A;  3T9Y A;  1RXT A;  4I49 A;  2I00 A;  1QSR A;  2ZW6 A;  4AVC A;  4XNH C;  5C82 A;  4QC6 A;  2JDD A;  4PV6 A;  1KUY A;  2AE6 A;  2G3A A;  3D2M A;  1YGH A;  2ZW4 A;  3FYN A;  3F0A A;  3FBU A;  1K4J A;  3C26 A;  2PQ8 A;  2P6E A;  2IL4 A;  5H86 A;  4UA3 A;  4MFL A;  2DPT A;  2FL4 A;  3R95 A;  3CXP A;  2PR1 A;  1M44 A;  3OWC A;  2GAN A;  4AG9 A;  4UFV A;  2ZW7 A;  1M4I A;  1P0H A;  2YNC C;  4KLV A;  2ZPA A;  1BOB A;  4AB7 A;  2Y0M A;  2NMT A;  2CY2 A;  4CAW A;  5KTA A;  2FT0 A;  1QSM A;  3IWG A;  4CAV A;  4R3K A;  4FD6 A;  3DDD A;  1L0C A;  4MFK A;  4QUS A;  3S6K A;  4KOV A;  4MFQ A;  3D2P A;  4KOR A;  4KSF A;  4MY0 A;  2Z3M A;  4E2A A;  1P4N A;  1S7F A;  4R3L A;  2GIV A;  2WPW A;  1S7K A;  5A27 A;  3R1K A;  4Y49 C;  2PRB A;  4X5K A;  4NXY A;  4RI1 A;  2ATR A;  2B4D B;  4RS2 A;  4IF5 A;  4KOY A;  5IB0 A;  4KOX A;  5AG5 A;  2VEZ A;  5GCN A;  4B5P B;  4DNC A;  2Q4V A;  1S60 A;  2HUZ A;  5AG6 A;  2VZZ A;  5AGE A;  1M4D A;  2JEV A;  4C7H A;  5FVJ A;  3R9G A;  2B3V A;  2R8V A;  3SXN A;  2K5T A;  2Q44 A;  3T90 A;  2J8N A;  3TTH A;  4A30 A;  4XPK A;  1S5K A;  2P6G A;  2YNC A;  1RO5 A;  4UBR A;  5BWA B;  2B4D A;  5CNP A;  2FE7 A;  2Q0Y A;  5JQ4 A;  5KTC A;  4AVA A;  4H6Z A;  2BSW A;  3TO7 A;  1N71 A;  4F0Y A;  4CYP A;  5JPH A;  4CAE A;  5G21 A;  3PZJ A;  4B10 A;  4R9M A;  2CNS A;  3I3G A;  4UWJ A;  3EO4 A;  5EBV A;  2G3T A;  4JXR A;  3ZZI A;  3BJ7 A;  4CRZ B;  5AG7 A;  1PUA A;  2B3U A;  4CGL A;  3GYA A;  4MY3 A;  4B12 A;  4CS0 B;  4B11 A;  3TCV A;  2O28 A;  1Q2C A;  4Q38 A;  3EY5 A;  3S6F A;  4KVM E;  4LUA A;  4UCP A;  1IYK A;  2EUI A;  3GY9 A;  4XPD C;  4U5Y A;  5DWN A;  5H84 A;  4PK3 A;  3A9L A;  3G3S A;  1VKC A;  4AG7 A;  1CM0 A;  4KZT A;  3P2F A;  4ZGY B;  4ONU A;  1V0C A;  4J3G A;  3F5B A;  5I0C A;  4AVB A;  3PGP A;  2G0B A;  4UCM A;  4CAF A;  4NCZ A;  4L89 A;  5F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...