5C88A

Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus in monoclinic form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
DFTLRNARMDDIDQIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGFSNIKQLPSLVRKGHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYYADGEDAYLMARPLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized N-acetyltransferase SSO0209
publication title Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
pubmed doi rcsb
source organism Sulfolobus solfataricus strain p2
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5c88A00
4YFJA 2ARHA 1Y7RA 3F8KA 3EC4A 2R1IA 3I3GA 3IWGA 1XF8A 4UBRA 1XIXA 4DNCA 4KVOE 4JXRA 3DDDA 4H89A 2OU2A 5H86A 1XE4A 3SHPA 1NSLA 4KOTA 1IICA 4XPKA 1TIQA 1QSRA 2B3UA 4MBUA 3PZJA 4PK3A 4HKFA 2JDDA 3PP9A 2FCKA 1B87A 2AJ6A 2Z10A 1QSNA 1YGHA 3V8IA 4KVME 4L89A 1R57A 3SXOA 4IF5A 3JVNA 3G3SA 2Q0YA 2VI7A 2A4NA 2PRBA 2ZW4A 4Y49C 3R96A 1YREA 2P6GA 4XNHC 3WR7A 3FB3A 1ON0A 4R87A 3G8WA 3TT2A 1Q2YA 2CY2A 2OZUA 4CAXA 3DNSA 2ZW5A 1IYLA 2X7BA 4JWPA 4ORFA 1S3ZA 3ZZIA 2FT0A 4KLVA 3FIXA 5C88A 1S5KA 1Y9WA 4ONUA 3QAHA 3W91A 5E96A 1XEBA 1S7FA 4H6ZA 4B5OA 1M44A 4X5KA 1B6BA 2F5IA 4MJ8A 2OZGA 4AG7A 1FY7A 2AE6A 2HQYA 3T90A 4RS2A 2BL1A 1YVKA 4XNHB 2I79A 3ZJ0A 2Z11A 1YX0A 1S7NA 1MJBA 2ZW7A 1M4GA 1XMTA 4E2AA 4EVYA 4AVCA 1RO5A 4RI1A 3BLNA 2WPWA 4IUSA 2P0WA 2B5GA 1IB1E 1Q2DA 2HUZA 1M4DA 1Y9KA 2REFA 4U5YA 3VWDA 2DXQA 3GYAA 2BSWA 1OZPA 4XPDC 2FSRA 5KTAA 4LUAA 5IX3A 4MI4A 3TTHA 4F0YA 2B58A 1I1DA 1QSOA 3GY9A 4E0AA 3FYNA 4CRZB 2KCWA 2PR1A 1YK3A 5F47A 4KOXA 3LODA 2R7HA 4GS4A 3NE7A 5EC4A 2H5MA 2JDCA 3FXTA 5HMNA 1SQHA 2CNSA 2Q4VA 2G0BA 1N71A 2VQYA 4I49A 4UWJA 2K5TA 4L8AA 3CXPA 2J8MA 4PSXA 1CJWA 4AG9A 1L0CA 1KUYA 1VHSA 1VKCA 3FNCA 1UFHA 1Z9UA 2B5GB 5EBVA 1YVOA 2D4PA 4JXQA 4AVAA 1Z4RA 4XPDB 1K4JA 4M3SA 3R9EA 4KOWA 4YRHA 1PUAA 4NF1A 2WPXA 3DSBA 4R9MA 2EVNA 5DWNA 1S60A 4JD6A 5F49A 1NMTA 4ZBGA 5H84A 2B3VA 3S6FA 3UY5A 4QC6A 1NE9A 2CNTA 1CM0A 3S6GA 3EO4A 1PU9A 2O28A 2RC4A 3EXNA 4KZTA 3KKWA 3EY5A 4AB7A 2JEVA 3TOAA 2OH1A 2R8VA 3R1KA 2QIRA 2PSWA 3B8GA 4H6UA 4CS0B 1QSMA 3S6HA 5F46A 4KOYA 2FS5A 2Q04A 2B4BA 1BOBA 3TOBA 3D3SA 3RYOA 1P4NA 4OLLA 5FVJA 2P6FA 4HNYB 4R3KA 4M85A 4F6AA 2VZZA 5J8CA 4UWIA 2J8NA 3LD2A 4KOUA 1MJ9A 2HV2A 4QVTA 2C27A 5IV0A 4PK2A 1S7LA 4NEXA 2B4DA 1M1DA 4KOVA 2VZYA 1YR0A 4MY3A 1IYKA 2PQ8A 1QSTA 1BO4A 3TO9A 3CXSA 4QUSA 3QB8A 4KOSA 4B5PA 2P6EA 1KZFA 3IGRA 2FE7A 3DR8A 4QB9A 3BJ7A 4FD7A 4KVXA 4HNWB 3TCVA 2GANA 4KLWA 4KUBA 2REEA 2Q7BA 4E8OA 5GCNA 3FBUA 3DR6A 3F0AA 2NMTA 4BMHA 5JPHA 2FXFA 5ISVA 1V0CA 3JUWA 3TE4A 2R98A 4LX9A 1WWZA 1P0HA 4QBJA 2B4DB 4YGOA 4NXYA 4UA3A 3W6XA 4MHDA 2FIWA 2G3AA 4K30A 3D2PA 5KTCA 1Q2CA 4U9ZA 4B5PB 2OZHA 2IL4A 3TO6A 3W6SA 1WK4A 5IB0A 4II9A 3D8PA 4FD6A 4HNXB 2PC1A 3TO7A 3N7ZA 4NSQA 3BJ8A 5F48A 3GKRA 2ZW6A 4OADA 2J8RA 1U6MA 3K9UA 2GIVA 3H4QA 5DWMA 4FD5A 4PV6A 1GHEA 2G3TA 3EFAA 5CNPA 5J8FA 1MJAA 4KORA 4MY0A 1I12A 4R57A 2Y0MA 2OB0A 4J3GA 1KUXA 4CAWA 4NCZA 1YLEA 2FL4A 4PSWA 3R9FA 2ATRA 4OAEA 4XPLA 2FIAA 3P2HA 3CXQA 2I00A 3SXNA 3OWCA 3D2MA 1LRZA 3E0KA 1MK4A 2BUEA 4AVBA 2BEIA 4JJXA 3MGDA 2Q44A 2JLMA 3S6KA 3T9YA 3R9GA 4Y49B 4KUAA 3C26A 2Q4YA 2PDOA 3F5BA 5HH1A 2VBQA 2QMLA 4U9YA 2GE3A 4FD4A 5KTDA 4R3LA 3PGPA 5C82A 2D4OA 1J4JA 4CRYB 2VEZA 1Z4EA 1I21A 3VWEA 2ZPAA 1S7KA 2PR8A 2ZXVA 4JLYA 1M4IA 5JQ4A 5I0CA 2QECA 1RXTA 2EUIA 2VXKA 3P2FA 1KUVA 4CAVA 2CNMA 2Z0ZA 3R95A 3I9SA 3FRMA 3TFYA 1IIDA
chains in the Genus database with same CATH superfamily
2ZEDA 4YFJA 2ARHA 1Y7RA 4YWYA 3F8KA 3LWUA 4ZYQA 5LYFA 4KSAA 4A37A 3EC4A 2R1IA 2BCOA 3I3GA 4YU9A 3CPXA 3IWGA 2Q51A 1XF8A 2PJ3A 2PJ4A 3KASA 1PCAA 2PJ9A 4UBRA 5HVHA 5LRGA 1XIXA 4DNCA 3QAYA 4KVOE 4B13A 4UCNA 2PJ5A 5AG5A 4JXRA 3DDDA 4H89A 1IU8A 2OU2A 5F09A 2ZEHA 2I3CA 5ELYA 4C7HA 4PXDA 5H86A 1XE4A 2OR4A 4R7MA 3SHPA 1CP6A 1NSLA 3VARA 2PIZA 4KOTA 3IU2A 1IICA 4XPKA 1TIQA 1QSRA 2B3UA 3DGVA 4MBUA 2XEIA 1CPSA 1XBUA 3D67A 2JDDA 3PZJA 4HKFA 3PP9A 2FCKA 4PK3A 2AFWA 4NJRA 1B87A 2AJ6A 2EK8A 5CPAA 4A39A 2Z10A 5HXDA 1QSNA 2RFHA 5D8NA 3IWWA 4P4BA 1YGHA 3V8IA 4KVME 4F8ZA 4L89A 1R57A 5G20A 4ZX8A 3VATA 3SXOA 4IF5A 2AFXA 5G1ZA 3JVNA 4ONWA 3G3SA 2Q0YA 2VI7A 2A4NA 2G9DA 2PRBA 4MHPA 1H8LA 2AFSA 2ZW4A 3IWEA 4Y49C 3R96A 1YREA 4BINA 2P6GA 4Q36A 2EBJA 4XNHC 3KI9A 2XEFA 3KGQA 3WR7A 3FB3A 3DLJA 1XOVA 1ON0A 3FECA 4CGNA 4P4IA 2Q4ZA 3G8WA 4R87A 3TT2A 3B7IA 1Q2YA 3BXMA 3I1UA 3IFEA 3SJFA 4WWVA 2CY2A 2HB6A 2OZUA 4C2YA 4CAXA 3DNSA 2V8VA 1IGBA 2ZW5A 1IYLA 2EK9A 4P10A 2X7BA 4JWPA 2ZEPA 1TKFA 1JWQA 3RNZA 5A27A 3B35A 4R8FA 3VH9A 4EWTA 4ORFA 1S3ZA 3ZZIA 1CG2A 5AG6A 2FT0A 4KLVA 3FIXA 5C88A 1S5KA 3SI2A 1Y9WA 4ONUA 3QAHA 3B3CA 5JH9A 3W91A 2Z3NA 5E96A 4W9YA 4CYPA 3D7DA 1XEBA 1S7FA 1ZO0A 5A28A 4H6ZA 2Z3KA 3GUXA 4FAIA 1Y0RA 4Q7AA 3IIBA 2ZEEA 1M44A 4B5OA 2ZEMA 4X5KA 5K8PA 1B6BA 4BD9A 2F5IA 4MJ8A 3KQXA 2OZGA 2OOTA 4EMEA 4AG7A 1FY7A 2AE6A 1VHEA 1Y7EA 1ARMA 2HQYA 2O53A 4F9UA 2PJCA 3K2KA 3T90A 3GIUA 3PFEA 1YMEA 4NFRA 2CTBA 4P4JA 3JTKA 2CTCA 4RS2A 1YVKA 2BL1A 1Z8LA 4XNHB 4B14A 1M4LA 1VIXA 2I79A 3ZJ0A 4DJLA 1Z8XA 2Z11A 5K8MA 3HUVA 1YX0A 4R76A 1S7NA 1MJBA 2ZW7A 3KL9A 1M4GA 2PJ0A 1XMTA 4C68A 4E2AA 2C6GA 3KQZA 4P6YA 3D7FA 4EVYA 1OBRA 4TNUA 3WABA 4HPSA 3S9LA 4AVCA 1RO5A 1HDQA 4RI1A 3BLNA 2WPWA 1Z2LA 2YNCA 4IUSA 2P0WA 2B5GA 1IB1E 1Q2DA 4R6TA 4X2TA 2HUZA 1M4DA 1Y9KA 2REFA 4U5YA 2YNCC 4CYNA 3VWDA 4AXVA 2DXQA 2IMOA 3V7ZA 1LFWA 3GYAA 1BAVA 3SI0A 5JGFA 3FX6A 4UEFA 4NGTA 4KSIA 2ZOGA 2BSWA 4ZGYB 1OZPA 4NJQA 2FSRA 4XPDC 5LRKA 2C1CA 2GLFA 5KTAA 4LUAA 4MFQA 5IX3A 1LANA 4OC1A 3KHZA 4MCRA 4ZX9A 4C7IA 2PJAA 2F7VA 4MI4A 2ZELA 3TTHA 2JBKA 4F0YA 2PJBA 2B58A 1I1DA 1QSOA 3KZWA 2V8DA 3GY9A 4E0AA 4MCPA 4OC0A 3FYNA 3WC7A 4DUKA 4CRZB 2KCWA 2PR1A 3RO0A 4CGPA 4EFDA 4MHZA 1YK3A 5F47A 3FMCA 1UWYA 2EO8A 2XEJA 3N5FA 4KOXA 3LACA 3LODA 4A30A 2R7HA 4UFWA 3MRUA 5K8OA 5K8NA 4IAVA 4PXBA 4GS4A 4CAEA 3SJXA 2V8GA 3NE7A 5EC4A 4C2XA 2H5MA 2JDCA 3FXTA 5D29A 5HMNA 1SQHA 2CNSA 4NGMA 1LAPA 2Q4VA 3RZAA 2G0BA 1N71A 5DS0A 2VQYA 4I49A 4UWJA 2WZNA 2K5TA 3H8GA 4L8AA 3CXPA 2J8MA 3ISZA 1CJWA 4PSXA 4NGPA 4AG9A 1L0CA 3IC1A 1KUYA 1VHSA 5LYLA 3SJEA 1VKCA 3FNCA 2CF4A 1UFHA 5HVFA 4MFKA 1ARLA 3PRTA 2WUUA 1Z9UA 2B5GB 4IK2A 1YVOA 2D4PA 4JXQA 5EBVA 4A38A 4AVAA 1Z4RA 2ABZA 4B12A 4X8IA 2AFZA 4XPDB 1ZLIA 4KSFA 4RN7A 3GB0A 3H5ZA 1K4JA 4M3SA 4OIDA 3R9EA 4KOWA 4YRHA 1PUAA 1Z5RA 1QQ9A 2ZEFA 3NFZA 2NYQA 4NF1A 2WPXA 3DSBA 1IY7A 1ZG9A 4LQGA 4O23A 1LCPA 2RB7A 4R9MA 3RBUA 3LMSA 2PVVA 2EVNA 4B6ZA 1ELLP 5DWNA 1S60A 4MFJA 3S9NA 2PVWA 4OC3A 4JD6A 5F49A 1NMTA 3BI1A 4JYWA 3FEEA 3IU1A 4ZBGA 1F2OA 3B3WA 2B3VA 3PBBA 5H84A 4QC6A 3S6FA 3UY5A 1NE9A 4GXHA 1CBXA 1CP7A 3B3TA 2CNTA 2WSAA 7CPAA 4CGOA 1CM0A 4OC2A 3S6GA 3EO4A 4CGMA 3MN8A 1YW4A 2PJ1A 1CPXA 1PU9A 2O28A 2RC4A 3EXNA 2CIJA 4KZTA 2ZOFA 3EY5A 3KKWA 3T8WA 1AYEA 3FH4A 4AB7A 2JEVA 3TOAA 5BWAB 3D68A 1FNOA 2ODFA 2OH1A 2R8VA 4OP4A 4ZY1A 3R1KA 1FT7A 2QIRA 2PSWA 1Z8TA 3B8GA 4H6UA 4CS0B 4ZI6A 4MFZA 1BLLE 1QSMA 3S6HA 4B11A 5F46A 4OKOA 4KOYA 1PYTB 1X12A 2FS5A 4UIBA 2Q04A 2BO9A 4P4DA 2B4BA 1BOBA 3TOBA 4UFXA 5THWA 1TKHA 3D3SA 1GYTA 3RYOA 1HDUA 1P4NA 3D7GA 4OLLA 3WT4A 5FVJA 2P6FA 2YNEA 3B3VA 4HNYB 4R3KA 2IQ6A 4M85A 4F6AA 2VZZA 1AMPA 5J8CA 2AFUA 4UWIA 2WYRA 3D4UA 5AG4A 2J8NA 3LD2A 4KOUA 2C6PA 3PB9X 4PQAA 1MJ9A 2HV2A 4QVTA 2C27A 4A33A 5IV0A 3IJ3A 4NGNA 2O4HA 4PK2A 2QVPA 5EMIA 3NA6A 1S7LA 4NEXA 2PJ2A 2B4DA 1M1DA 4KOVA 4MFPA 2VZYA 4F0XA 2V8HA 4RUHA 4CAFA 1YR0A 5HVGA 1DE4C 4LQ6A 2YNDA 1XRYA 1R3NA 1Z8WA 4GM5A 4MY3A 2F8HA 4M6IA 3KR5A 3V38A 1YLOA 3PB8X 1IYKA 5G22A 2PQ8A 1QSTA 3CDXA 4CPAA 1BO4A 4F9VA 3D66A 3TO9A 3CXSA 2ZEGA 4QUSA 1ZG8A 3QB8A 4KOSA 4B5PA 2P6EA 1KZFA 3IGRA 5IB9A 2GFQA 8CPAA 2FE7A 4UFVA 4B10A 4JZ0A 3RAMA 2AFMA 2PJ6A 2XEGA 3DR8A 4QB9A 4UEEA 1ELMP 3WC6A 3BJ7A 4FD7A 4KVXA 4HNWB 4FWUA 1A2ZA 3TCVA 2GANA 4KLWA 4PPZA 4KUBA 3GLJA 4P4EA 2REEA 2Q7SA 2Q7BA 3PBEA 4E8OA 3JRUA 5GCNA 3FBUA 1HEEA 3DR6A 3F0AA 4MFLA 6CPAA 4CYOA 2NMTA 5J1QA 4BMHA 1XJOA 2FXFA 5JPHA 3SI1A 5ISVA 1V0CA 3JUWA 5G21A 4A32A 3TE4A 1TF8A 2R98A 4LX9A 1WWZA 1P0HA 2C6CA 4QBJA 2POKA 2B4DB 3CPAA 4G1PA 1JQGA 1TXRA 4UCMA 3L2NA 4YGOA 1XMBA 1IOIA 1VGYA 4NXYA 4OIWA 2DEAA 3KR4A 4UA3A 3W6XA 3ISXA 4MHDA 2FIWA 4WJBA 4K3NA 2G3AA 4NGQA 4K30A 4NGRA 3D2PA 1KWMA 5KTCA 3B2YA 1Q2CA 4U9ZA 4MHYA 4UF4A 5LRJA 2QJ8A 3TX8A 4B5PB 1QMUA 3D7HA 1F2PA 1TKJA 2ANPA 3HLPA 4Q38A 3S9MA 4UCPA 3FF3A 3NH8A 3BHXA 2OZHA 4DYOA 2DF5A 2IL4A 2VL1A 3TO6A 3W6SA 1WK4A 2HC9A 5IB0A 4II9A 3D8PA 4NGSA 4ZY2A 4FD6A 1LAMA 4OC4A 4CYQA 4HNXB 2PC1A 3TO7A 3N7ZA 2GREA 4NSQA 1F57A 3BJ8A 5F48A 3CZXA 4BBHA 1IOFA 2DPSA 5AGEA 2CXAA 3GKRA 1Q7LA 2Z3PA 3B3SA 2ZW6A 4MCQA 4OADA 5LYIA 2J8RA 2Z3OA 1U6MA 3K9UA 4TWEA 2BOAA 2GIVA 5AG7A 1ZLHA 3H4QA 3A9LA 3BI0A 5I4MA 5DWMA 4FD5A 4PV6A 1R43A 1GHEA 2G3TA 3EFAA 3IEHA 5CNPA 2ZEOA 4A95A 5J8FA 3FVLA 1MJAA 5LYDA 1AUGA 2PJ8A 4KORA 4MY0A 1I12A 4R57A 2Y0MA 3NH4A 2OB0A 4J3GA 1KUXA 4CAWA 3K9TA 4NCZA 4C2ZA 2PJ7A 1YLEA 2FL4A 4IHMA 2ZENA 2JBJA 4PSWA 1EE3P 5CBMA 2PE3A 3R9FA 2ATRA 4OAEA 4CGLA 2FVGA 4XPLA 2FIAA 3P2HA 3CXQA 4P45A 2I00A 1DTDA 3SXNA 3OWCA 2V77A 4X3RA 2DPTA 1CX8A 1XFOA 1NSAA 2IJZA 2PRQA 3D2MA 1LRZA 4A31A 3E0KA 3H8EA 1MK4A 4MMOA 2BUEA 4AVBA 2BEIA 4H2KA 4JJXA 4OC5A 4M6GA 4PXCA 3MGDA 4KS9A 2Q44A 3NE8A 1YSJA 3PEIA 1ZG7A 1X10A 4P44A 1RTQA 3FJUA 2JLMA 3IO1A 1TF9A 3S6KA 4PXEA 3T9YA 3R9GA 4P4FA 1YQEA 3PB7X 4Y49B 4KUAA 2PIYA 2Q4YA 3C26A 3KHXA 1LOKA 1BPMA 2PDOA 3F5BA 2JEWA 5HH1A 2EWBA 1Y0YA 2QMLA 2VBQA 5JM6A 1VHOA 4U9YA 2GE3A 4OMEA 3SJGA 4A94A 4FD4A 5KTDA 3WC5A 3CT9A 4FBEA 4MCSA 2J9AA 4R3LA 4M6HA 2AFOA 3PGPA 3QNVA 4MXUA 4ZY0A 1BPNA 2D4OA 3PB4X 5C82A 4Z65A 4MHNA 1J4JA 4CRYB 2VEZA 3FEDA 1Z4EA 1I21A 3VWEA 2ZPAA 1S7KA 2PR8A 2ZXVA 2Q43A 4JLYA 1M4IA 5JQ4A 5I0CA 3NH5A 2QECA 1RXTA 2EUIA 2VXKA 2Z3LA 3P2FA 1KUVA 3PB6X 4UEZA 4CAVA 4MRIA 2NSMA 1YW6A 3H8FA 4FUUA 2GLJA 2CNMA 2Z0ZA 3R95A 2QYVA 2YGWA 3I9SA 4UIAA 2GU2A 3PFOA 3TC8A 3FRMA 3TFYA 1IIDA 4A2ZA 2Z3MA 2PCUA
chains in the Genus database with same CATH topology
4YFJA 2ARHA 1Y7RA 3F8KA 4KSAA 3EC4A 2R1IA 3I3GA 3IWGA 1XF8A 4UBRA 1XIXA 4DNCA 4KVOE 4B13A 4UCNA 5AG5A 4JXRA 3DDDA 4H89A 2OU2A 4C7HA 5H86A 1XE4A 3SHPA 1NSLA 4KOTA 3IU2A 1IICA 4XPKA 1TIQA 1QSRA 2B3UA 4MBUA 3PZJA 4PK3A 4HKFA 2JDDA 3PP9A 2FCKA 1B87A 2AJ6A 2Z10A 1QSNA 1YGHA 3V8IA 4KVME 4L89A 1R57A 5G20A 3SXOA 4IF5A 5G1ZA 3JVNA 3G3SA 2Q0YA 2VI7A 2A4NA 2PRBA 2ZW4A 3IWEA 4Y49C 3R96A 1YREA 2P6GA 4Q36A 4XNHC 3WR7A 3FB3A 1ON0A 4CGNA 4R87A 3G8WA 3TT2A 1Q2YA 4C2YA 2CY2A 2OZUA 4CAXA 3DNSA 2ZW5A 1IYLA 2X7BA 4JWPA 5A27A 4ORFA 1S3ZA 3ZZIA 5AG6A 2FT0A 4KLVA 3FIXA 5C88A 1S5KA 1Y9WA 4ONUA 3QAHA 3W91A 2Z3NA 5E96A 4CYPA 1XEBA 1S7FA 1ZO0A 5A28A 4H6ZA 2Z3KA 4B5OA 1M44A 4X5KA 1B6BA 2F5IA 4MJ8A 2OZGA 4AG7A 1FY7A 2AE6A 2HQYA 3T90A 3JTKA 4RS2A 2BL1A 1YVKA 4XNHB 4B14A 2I79A 3ZJ0A 2Z11A 1YX0A 1S7NA 1MJBA 2ZW7A 4C68A 1M4GA 1XMTA 4E2AA 4EVYA 4AVCA 1RO5A 4RI1A 3BLNA 2WPWA 4IUSA 2YNCA 2P0WA 2B5GA 1IB1E 1Q2DA 2HUZA 1M4DA 1Y9KA 2REFA 4U5YA 2YNCC 4CYNA 3VWDA 2DXQA 3GYAA 2BSWA 4ZGYB 1OZPA 4XPDC 2FSRA 5KTAA 4LUAA 4MFQA 5IX3A 4C7IA 4MI4A 3TTHA 4F0YA 2B58A 1I1DA 1QSOA 3GY9A 4E0AA 3FYNA 4CRZB 2KCWA 2PR1A 4CGPA 1YK3A 5F47A 4KOXA 3LODA 4A30A 2R7HA 4UFWA 4GS4A 4CAEA 3NE7A 5EC4A 4C2XA 2H5MA 2JDCA 3FXTA 5HMNA 1SQHA 2CNSA 2Q4VA 2G0BA 1N71A 2VQYA 4I49A 4UWJA 2K5TA 4L8AA 3CXPA 2J8MA 4PSXA 1CJWA 4AG9A 1L0CA 1KUYA 1VHSA 1VKCA 3FNCA 1UFHA 4MFKA 2WUUA 1Z9UA 2B5GB 5EBVA 1YVOA 2D4PA 4JXQA 4AVAA 1Z4RA 4B12A 4XPDB 4KSFA 3H5ZA 1K4JA 4M3SA 3R9EA 4KOWA 4YRHA 1PUAA 4NF1A 2WPXA 3DSBA 4R9MA 2EVNA 5DWNA 1S60A 4MFJA 4JD6A 5F49A 1NMTA 3IU1A 4ZBGA 5H84A 2B3VA 3S6FA 3UY5A 4QC6A 1NE9A 2CNTA 2WSAA 4CGOA 1CM0A 3S6GA 3EO4A 4CGMA 1PU9A 2O28A 2RC4A 3EXNA 4KZTA 3KKWA 3EY5A 4AB7A 2JEVA 3TOAA 5BWAB 2OH1A 2R8VA 3R1KA 2QIRA 2PSWA 3B8GA 4H6UA 4CS0B 4MFZA 1QSMA 3S6HA 5F46A 4B11A 4KOYA 2FS5A 2Q04A 2B4BA 1BOBA 3TOBA 4UFXA 3D3SA 3RYOA 1P4NA 4OLLA 5FVJA 2P6FA 2YNEA 4HNYB 4R3KA 4M85A 4F6AA 2VZZA 5J8CA 4UWIA 5AG4A 2J8NA 3LD2A 4KOUA 1MJ9A 2HV2A 4QVTA 2C27A 4A33A 5IV0A 4PK2A 1S7LA 4NEXA 2B4DA 1M1DA 4KOVA 4MFPA 2VZYA 4F0XA 4CAFA 1YR0A 2YNDA 4MY3A 1IYKA 5G22A 2PQ8A 1QSTA 1BO4A 3TO9A 3CXSA 4QUSA 3QB8A 4KOSA 4B5PA 2P6EA 1KZFA 3IGRA 2FE7A 4UFVA 4B10A 3DR8A 4QB9A 3BJ7A 4FD7A 4KVXA 4HNWB 3TCVA 2GANA 4KLWA 4KUBA 2REEA 2Q7BA 4E8OA 5GCNA 3FBUA 3DR6A 3F0AA 4MFLA 4CYOA 2NMTA 4BMHA 5JPHA 2FXFA 5ISVA 1V0CA 3JUWA 5G21A 4A32A 3TE4A 2R98A 4LX9A 1WWZA 1P0HA 4QBJA 2B4DB 4UCMA 4YGOA 4NXYA 4UA3A 3W6XA 4MHDA 2FIWA 2G3AA 4K30A 3D2PA 5KTCA 1Q2CA 4U9ZA 4B5PB 4Q38A 4UCPA 2OZHA 2IL4A 3TO6A 3W6SA 1WK4A 5IB0A 4II9A 3D8PA 4FD6A 4CYQA 4HNXB 2PC1A 3TO7A 3N7ZA 4NSQA 3BJ8A 5F48A 4BBHA 2DPSA 5AGEA 2CXAA 3GKRA 2Z3PA 2ZW6A 4OADA 2J8RA 2Z3OA 1U6MA 3K9UA 2GIVA 5AG7A 3H4QA 3A9LA 5DWMA 4FD5A 4PV6A 1GHEA 2G3TA 3EFAA 5CNPA 4A95A 5J8FA 1MJAA 4KORA 4MY0A 1I12A 4R57A 2Y0MA 2OB0A 4J3GA 1KUXA 4CAWA 4NCZA 4C2ZA 1YLEA 2FL4A 4PSWA 3R9FA 2ATRA 4OAEA 4CGLA 4XPLA 2FIAA 3P2HA 3CXQA 2I00A 3SXNA 3OWCA 2DPTA 3D2MA 1LRZA 4A31A 3E0KA 1MK4A 2BUEA 4AVBA 2BEIA 4JJXA 3MGDA 4KS9A 2Q44A 2JLMA 3S6KA 3T9YA 3R9GA 4Y49B 4KUAA 3C26A 2Q4YA 2PDOA 3F5BA 5HH1A 2VBQA 2QMLA 4U9YA 2GE3A 4FD4A 5KTDA 4R3LA 3PGPA 5C82A 2D4OA 1J4JA 4CRYB 2VEZA 1Z4EA 1I21A 3VWEA 2ZPAA 1S7KA 2PR8A 2ZXVA 4JLYA 1M4IA 5JQ4A 5I0CA 2QECA 1RXTA 2EUIA 2VXKA 2Z3LA 3P2FA 1KUVA 4CAVA 2CNMA 2Z0ZA 3R95A 2YGWA 3I9SA 3FRMA 3TFYA 1IIDA 4A2ZA 2Z3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFJ A;  2ARH A;  1Y7R A;  3F8K A;  3EC4 A;  2R1I A;  3I3G A;  3IWG A;  1XF8 A;  4UBR A;  1XIX A;  4DNC A;  4KVO E;  4JXR A;  3DDD A;  4H89 A;  2OU2 A;  5H86 A;  1XE4 A;  3SHP A;  1NSL A;  4KOT A;  1IIC A;  4XPK A;  1TIQ A;  1QSR A;  2B3U A;  4MBU A;  3PZJ A;  4PK3 A;  4HKF A;  2JDD A;  3PP9 A;  2FCK A;  1B87 A;  2AJ6 A;  2Z10 A;  1QSN A;  1YGH A;  3V8I A;  4KVM E;  4L89 A;  1R57 A;  3SXO A;  4IF5 A;  3JVN A;  3G3S A;  2Q0Y A;  2VI7 A;  2A4N A;  2PRB A;  2ZW4 A;  4Y49 C;  3R96 A;  1YRE A;  2P6G A;  4XNH C;  3WR7 A;  3FB3 A;  1ON0 A;  4R87 A;  3G8W A;  3TT2 A;  1Q2Y A;  2CY2 A;  2OZU A;  4CAX A;  3DNS A;  2ZW5 A;  1IYL A;  2X7B A;  4JWP A;  4ORF A;  1S3Z A;  3ZZI A;  2FT0 A;  4KLV A;  3FIX A;  5C88 A;  1S5K A;  1Y9W A;  4ONU A;  3QAH A;  3W91 A;  5E96 A;  1XEB A;  1S7F A;  4H6Z A;  4B5O A;  1M44 A;  4X5K A;  1B6B A;  2F5I A;  4MJ8 A;  2OZG A;  4AG7 A;  1FY7 A;  2AE6 A;  2HQY A;  3T90 A;  4RS2 A;  2BL1 A;  1YVK A;  4XNH B;  2I79 A;  3ZJ0 A;  2Z11 A;  1YX0 A;  1S7N A;  1MJB A;  2ZW7 A;  1M4G A;  1XMT A;  4E2A A;  4EVY A;  4AVC A;  1RO5 A;  4RI1 A;  3BLN A;  2WPW A;  4IUS A;  2P0W A;  2B5G A;  1IB1 E;  1Q2D A;  2HUZ A;  1M4D A;  1Y9K A;  2REF A;  4U5Y A;  3VWD A;  2DXQ A;  3GYA A;  2BSW A;  1OZP A;  4XPD C;  2FSR A;  5KTA A;  4LUA A;  5IX3 A;  4MI4 A;  3TTH A;  4F0Y A;  2B58 A;  1I1D A;  1QSO A;  3GY9 A;  4E0A A;  3FYN A;  4CRZ B;  2KCW A;  2PR1 A;  1YK3 A;  5F47 A;  4KOX A;  3LOD A;  2R7H A;  4GS4 A;  3NE7 A;  5EC4 A;  2H5M A;  2JDC A;  3FXT A;  5HMN A;  1SQH A;  2CNS A;  2Q4V A;  2G0B A;  1N71 A;  2VQY A;  4I49 A;  4UWJ A;  2K5T A;  4L8A A;  3CXP A;  2J8M A;  4PSX A;  1CJW A;  4AG9 A;  1L0C A;  1KUY A;  1VHS A;  1VKC A;  3FNC A;  1UFH A;  1Z9U A;  2B5G B;  5EBV A;  1YVO A;  2D4P A;  4JXQ A;  4AVA A;  1Z4R A;  4XPD B;  1K4J A;  4M3S A;  3R9E A;  4KOW A;  4YRH A;  1PUA A;  4NF1 A;  2WPX A;  3DSB A;  4R9M A;  2EVN A;  5DWN A;  1S60 A;  4JD6 A;  5F49 A;  1NMT A;  4ZBG A;  5H84 A;  2B3V A;  3S6F A;  3UY5 A;  4QC6 A;  1NE9 A;  2CNT A;  1CM0 A;  3S6G A;  3EO4 A;  1PU9 A;  2O28 A;  2RC4 A;  3EXN A;  4KZT A;  3KKW A;  3EY5 A;  4AB7 A;  2JEV A;  3TOA A;  2OH1 A;  2R8V A;  3R1K A;  2QIR A;  2PSW A;  3B8G A;  4H6U A;  4CS0 B;  1QSM A;  3S6H A;  5F46 A;  4KOY A;  2FS5 A;  2Q04 A;  2B4B A;  1BOB A;  3TOB A;  3D3S A;  3RYO A;  1P4N A;  4OLL A;  5FVJ A;  2P6F A;  4HNY B;  4R3K A;  4M85 A;  4F6A A;  2VZZ A;  5J8C A;  4UWI A;  2J8N A;  3LD2 A;  4KOU A;  1MJ9 A;  2HV2 A;  4QVT A;  2C27 A;  5IV0 A;  4PK2 A;  1S7L A;  4NEX A;  2B4D A;  1M1D A;  4KOV A;  2VZY A;  1YR0 A;  4MY3 A;  1IYK A;  2PQ8 A;  1QST A;  1BO4 A;  3TO9 A;  3CXS A;  4QUS A;  3QB8 A;  4KOS A;  4B5P A;  2P6E A;  1KZF A;  3IGR A;  2FE7 A;  3DR8 A;  4QB9 A;  3BJ7 A;  4FD7 A;  4KVX A;  4HNW B;  3TCV A;  2GAN A;  4KLW A;  4KUB A;  2REE A;  2Q7B A;  4E8O A;  5GCN A;  3FBU A;  3DR6 A;  3F0A A;  2NMT A;  4BMH A;  5JPH A;  2FXF A;  5ISV A;  1V0C A;  3JUW A;  3TE4 A;  2R98 A;  4LX9 A;  1WWZ A;  1P0H A;  4QBJ A;  2B4D B;  4YGO A;  4NXY A;  4UA3 A;  3W6X A;  4MHD A;  2FIW A;  2G3A A;  4K30 A;  3D2P A;  5KTC A;  1Q2C A;  4U9Z A;  4B5P B;  2OZH A;  2IL4 A;  3TO6 A;  3W6S A;  1WK4 A;  5IB0 A;  4II9 A;  3D8P A;  4FD6 A;  4HNX B;  2PC1 A;  3TO7 A;  3N7Z A;  4NSQ A;  3BJ8 A;  5F48 A;  3GKR A;  2ZW6 A;  4OAD A;  2J8R A;  1U6M A;  3K9U A;  2GIV A;  3H4Q A;  5DWM A;  4FD5 A;  4PV6 A;  1GHE A;  2G3T A;  3EFA A;  5CNP A;  5J8F A;  1MJA A;  4KOR A;  4MY0 A;  1I12 A;  4R57 A;  2Y0M A;  2OB0 A;  4J3G A;  1KUX A;  4CAW A;  4NCZ A;  1YLE A;  2FL4 A;  4PSW A;  3R9F A;  2ATR A;  4OAE A;  4XPL A;  2FIA A;  3P2H A;  3CXQ A;  2I00 A;  3SXN A;  3OWC A;  3D2M A;  1LRZ A;  3E0K A;  1MK4 A;  2BUE A;  4AVB A;  2BEI A;  4JJX A;  3MGD A;  2Q44 A;  2JLM A;  3S6K A;  3T9Y A;  3R9G A;  4Y49 B;  4KUA A;  3C26 A;  2Q4Y A;  2PDO A;  3F5B A;  5HH1 A;  2VBQ A;  2QML A;  4U9Y A;  2GE3 A;  4FD4 A;  5KTD A;  4R3L A;  3PGP A;  5C82 A;  2D4O A;  1J4J A;  4CRY B;  2VEZ A;  1Z4E A;  1I21 A;  3VWE A;  2ZPA A;  1S7K A;  2PR8 A;  2ZXV A;  4JLY A;  1M4I A;  5JQ4 A;  5I0C A;  2QEC A;  1RXT A;  2EUI A;  2VXK A;  3P2F A;  1KUV A;  4CAV A;  2CNM A;  2Z0Z A;  3R95 A;  3I9S A;  3FRM A;  3TFY A;  1IID A; 
#chains in the Genus database with same CATH topology
 2ZED A;  4YFJ A;  2ARH A;  1Y7R A;  4YWY A;  3F8K A;  3LWU A;  4ZYQ A;  5LYF A;  4KSA A;  4A37 A;  3EC4 A;  2R1I A;  2BCO A;  3I3G A;  4YU9 A;  3CPX A;  3IWG A;  2Q51 A;  1XF8 A;  2PJ3 A;  2PJ4 A;  3KAS A;  1PCA A;  2PJ9 A;  4UBR A;  5HVH A;  5LRG A;  1XIX A;  4DNC A;  3QAY A;  4KVO E;  4B13 A;  4UCN A;  2PJ5 A;  5AG5 A;  4JXR A;  3DDD A;  4H89 A;  1IU8 A;  2OU2 A;  5F09 A;  2ZEH A;  2I3C A;  5ELY A;  4C7H A;  4PXD A;  5H86 A;  1XE4 A;  2OR4 A;  4R7M A;  3SHP A;  1CP6 A;  1NSL A;  3VAR A;  2PIZ A;  4KOT A;  3IU2 A;  1IIC A;  4XPK A;  1TIQ A;  1QSR A;  2B3U A;  3DGV A;  4MBU A;  2XEI A;  1CPS A;  1XBU A;  3D67 A;  2JDD A;  3PZJ A;  4HKF A;  3PP9 A;  2FCK A;  4PK3 A;  2AFW A;  4NJR A;  1B87 A;  2AJ6 A;  2EK8 A;  5CPA A;  4A39 A;  2Z10 A;  5HXD A;  1QSN A;  2RFH A;  5D8N A;  3IWW A;  4P4B A;  1YGH A;  3V8I A;  4KVM E;  4F8Z A;  4L89 A;  1R57 A;  5G20 A;  4ZX8 A;  3VAT A;  3SXO A;  4IF5 A;  2AFX A;  5G1Z A;  3JVN A;  4ONW A;  3G3S A;  2Q0Y A;  2VI7 A;  2A4N A;  2G9D A;  2PRB A;  4MHP A;  1H8L A;  2AFS A;  2ZW4 A;  3IWE A;  4Y49 C;  3R96 A;  1YRE A;  4BIN A;  2P6G A;  4Q36 A;  2EBJ A;  4XNH C;  3KI9 A;  2XEF A;  3KGQ A;  3WR7 A;  3FB3 A;  3DLJ A;  1XOV A;  1ON0 A;  3FEC A;  4CGN A;  4P4I A;  2Q4Z A;  3G8W A;  4R87 A;  3TT2 A;  3B7I A;  1Q2Y A;  3BXM A;  3I1U A;  3IFE A;  3SJF A;  4WWV A;  2CY2 A;  2HB6 A;  2OZU A;  4C2Y A;  4CAX A;  3DNS A;  2V8V A;  1IGB A;  2ZW5 A;  1IYL A;  2EK9 A;  4P10 A;  2X7B A;  4JWP A;  2ZEP A;  1TKF A;  1JWQ A;  3RNZ A;  5A27 A;  3B35 A;  4R8F A;  3VH9 A;  4EWT A;  4ORF A;  1S3Z A;  3ZZI A;  1CG2 A;  5AG6 A;  2FT0 A;  4KLV A;  3FIX A;  5C88 A;  1S5K A;  3SI2 A;  1Y9W A;  4ONU A;  3QAH A;  3B3C A;  5JH9 A;  3W91 A;  2Z3N A;  5E96 A;  4W9Y A;  4CYP A;  3D7D A;  1XEB A;  1S7F A;  1ZO0 A;  5A28 A;  4H6Z A;  2Z3K A;  3GUX A;  4FAI A;  1Y0R A;  4Q7A A;  3IIB A;  2ZEE A;  1M44 A;  4B5O A;  2ZEM A;  4X5K A;  5K8P A;  1B6B A;  4BD9 A;  2F5I A;  4MJ8 A;  3KQX A;  2OZG A;  2OOT A;  4EME A;  4AG7 A;  1FY7 A;  2AE6 A;  1VHE A;  1Y7E A;  1ARM A;  2HQY A;  2O53 A;  4F9U A;  2PJC A;  3K2K A;  3T90 A;  3GIU A;  3PFE A;  1YME A;  4NFR A;  2CTB A;  4P4J A;  3JTK A;  2CTC A;  4RS2 A;  1YVK A;  2BL1 A;  1Z8L A;  4XNH B;  4B14 A;  1M4L A;  1VIX A;  2I79 A;  3ZJ0 A;  4DJL A;  1Z8X A;  2Z11 A;  5K8M A;  3HUV A;  1YX0 A;  4R76 A;  1S7N A;  1MJB A;  2ZW7 A;  3KL9 A;  1M4G A;  2PJ0 A;  1XMT A;  4C68 A;  4E2A A;  2C6G A;  3KQZ A;  4P6Y A;  3D7F A;  4EVY A;  1OBR A;  4TNU A;  3WAB A;  4HPS A;  3S9L A;  4AVC A;  1RO5 A;  1HDQ A;  4RI1 A;  3BLN A;  2WPW A;  1Z2L A;  2YNC A;  4IUS A;  2P0W A;  2B5G A;  1IB1 E;  1Q2D A;  4R6T A;  4X2T A;  2HUZ A;  1M4D A;  1Y9K A;  2REF A;  4U5Y A;  2YNC C;  4CYN A;  3VWD A;  4AXV A;  2DXQ A;  2IMO A;  3V7Z A;  1LFW A;  3GYA A;  1BAV A;  3SI0 A;  5JGF A;  3FX6 A;  4UEF A;  4NGT A;  4KSI A;  2ZOG A;  2BSW A;  4ZGY B;  1OZP A;  4NJQ A;  2FSR A;  4XPD C;  5LRK A;  2C1C A;  2GLF A;  5KTA A;  4LUA A;  4MFQ A;  5IX3 A;  1LAN A;  4OC1 A;  3KHZ A;  4MCR A;  4ZX9 A;  4C7I A;  2PJA A;  2F7V A;  4MI4 A;  2ZEL A;  3TTH A;  2JBK A;  4F0Y A;  2PJB A;  2B58 A;  1I1D A;  1QSO A;  3KZW A;  2V8D A;  3GY9 A;  4E0A A;  4MCP A;  4OC0 A;  3FYN A;  3WC7 A;  4DUK A;  4CRZ B;  2KCW A;  2PR1 A;  3RO0 A;  4CGP A;  4EFD A;  4MHZ A;  1YK3 A;  5F47 A;  3FMC A;  1UWY A;  2EO8 A;  2XEJ A;  3N5F A;  4KOX A;  3LAC A;  3LOD A;  4A30 A;  2R7H A;  4UFW A;  3MRU A;  5K8O A;  5K8N A;  4IAV A;  4PXB A;  4GS4 A;  4CAE A;  3SJX A;  2V8G A;  3NE7 A;  5EC4 A;  4C2X A;  2H5M A;  2JDC A;  3FXT A;  5D29 A;  5HMN A;  1SQH A;  2CNS A;  4NGM A;  1LAP A;  2Q4V A;  3RZA A;  2G0B A;  1N71 A;  5DS0 A;  2VQY A;  4I49 A;  4UWJ A;  2WZN A;  2K5T A;  3H8G A;  4L8A A;  3CXP A;  2J8M A;  3ISZ A;  1CJW A;  4PSX A;  4NGP A;  4AG9 A;  1L0C A;  3IC1 A;  1KUY A;  1VHS A;  5LYL A;  3SJE A;  1VKC A;  3FNC A;  2CF4 A;  1UFH A;  5HVF A;  4MFK A;  1ARL A;  3PRT A;  2WUU A;  1Z9U A;  2B5G B;  4IK2 A;  1YVO A;  2D4P A;  4JXQ A;  5EBV A;  4A38 A;  4AVA A;  1Z4R A;  2ABZ A;  4B12 A;  4X8I A;  2AFZ A;  4XPD B;  1ZLI A;  4KSF A;  4RN7 A;  3GB0 A;  3H5Z A;  1K4J A;  4M3S A;  4OID A;  3R9E A;  4KOW A;  4YRH A;  1PUA A;  1Z5R A;  1QQ9 A;  2ZEF A;  3NFZ A;  2NYQ A;  4NF1 A;  2WPX A;  3DSB A;  1IY7 A;  1ZG9 A;  4LQG A;  4O23 A;  1LCP A;  2RB7 A;  4R9M A;  3RBU A;  3LMS A;  2PVV A;  2EVN A;  4B6Z A;  1ELL P;  5DWN A;  1S60 A;  4MFJ A;  3S9N A;  2PVW A;  4OC3 A;  4JD6 A;  5F49 A;  1NMT A;  3BI1 A;  4JYW A;  3FEE A;  3IU1 A;  4ZBG A;  1F2O A;  3B3W A;  2B3V A;  3PBB A;  5H84 A;  4QC6 A;  3S6F A;  3UY5 A;  1NE9 A;  4GXH A;  1CBX A;  1CP7 A;  3B3T A;  2CNT A;  2WSA A;  7CPA A;  4CGO A;  1CM0 A;  4OC2 A;  3S6G A;  3EO4 A;  4CGM A;  3MN8 A;  1YW4 A;  2PJ1 A;  1CPX A;  1PU9 A;  2O28 A;  2RC4 A;  3EXN A;  2CIJ A;  4KZT A;  2ZOF A;  3EY5 A;  3KKW A;  3T8W A;  1AYE A;  3FH4 A;  4AB7 A;  2JEV A;  3TOA A;  5BWA B;  3D68 A;  1FNO A;  2ODF A;  2OH1 A;  2R8V A;  4OP4 A;  4ZY1 A;  3R1K A;  1FT7 A;  2QIR A;  2PSW A;  1Z8T A;  3B8G A;  4H6U A;  4CS0 B;  4ZI6 A;  4MFZ A;  1BLL E;  1QSM A;  3S6H A;  4B11 A;  5F46 A;  4OKO A;  4KOY A;  1PYT B;  1X12 A;  2FS5 A;  4UIB A;  2Q04 A;  2BO9 A;  4P4D A;  2B4B A;  1BOB A;  3TOB A;  4UFX A;  5THW A;  1TKH A;  3D3S A;  1GYT A;  3RYO A;  1HDU A;  1P4N A;  3D7G A;  4OLL A;  3WT4 A;  5FVJ A;  2P6F A;  2YNE A;  3B3V A;  4HNY B;  4R3K A;  2IQ6 A;  4M85 A;  4F6A A;  2VZZ A;  1AMP A;  5J8C A;  2AFU A;  4UWI A;  2WYR A;  3D4U A;  5AG4 A;  2J8N A;  3LD2 A;  4KOU A;  2C6P A;  3PB9 X;  4PQA A;  1MJ9 A;  2HV2 A;  4QVT A;  2C27 A;  4A33 A;  5IV0 A;  3IJ3 A;  4NGN A;  2O4H A;  4PK2 A;  2QVP A;  5EMI A;  3NA6 A;  1S7L A;  4NEX A;  2PJ2 A;  2B4D A;  1M1D A;  4KOV A;  4MFP A;  2VZY A;  4F0X A;  2V8H A;  4RUH A;  4CAF A;  1YR0 A;  5HVG A;  1DE4 C;  4LQ6 A;  2YND A;  1XRY A;  1R3N A;  1Z8W A;  4GM5 A;  4MY3 A;  2F8H A;  4M6I A;  3KR5 A;  3V38 A;  1YLO A;  3PB8 X;  1IYK A;  5G22 A;  2PQ8 A;  1QST A;  3CDX A;  4CPA A;  1BO4 A;  4F9V A;  3D66 A;  3TO9 A;  3CXS A;  2ZEG A;  4QUS A;  1ZG8 A;  3QB8 A;  4KOS A;  4B5P A;  2P6E A;  1KZF A;  3IGR A;  5IB9 A;  2GFQ A;  8CPA A;  2FE7 A;  4UFV A;  4B10 A;  4JZ0 A;  3RAM A;  2AFM A;  2PJ6 A;  2XEG A;  3DR8 A;  4QB9 A;  4UEE A;  1ELM P;  3WC6 A;  3BJ7 A;  4FD7 A;  4KVX A;  4HNW B;  4FWU A;  1A2Z A;  3TCV A;  2GAN A;  4KLW A;  4PPZ A;  4KUB A;  3GLJ A;  4P4E A;  2REE A;  2Q7S A;  2Q7B A;  3PBE A;  4E8O A;  3JRU A;  5GCN A;  3FBU A;  1HEE A;  3DR6 A;  3F0A A;  4MFL A;  6CPA A;  4CYO A;  2NMT A;  5J1Q A;  4BMH A;  1XJO A;  2FXF A;  5JPH A;  3SI1 A;  5ISV A;  1V0C A;  3JUW A;  5G21 A;  4A32 A;  3TE4 A;  1TF8 A;  2R98 A;  4LX9 A;  1WWZ A;  1P0H A;  2C6C A;  4QBJ A;  2POK A;  2B4D B;  3CPA A;  4G1P A;  1JQG A;  1TXR A;  4UCM A;  3L2N A;  4YGO A;  1XMB A;  1IOI A;  1VGY A;  4NXY A;  4OIW A;  2DEA A;  3KR4 A;  4UA3 A;  3W6X A;  3ISX A;  4MHD A;  2FIW A;  4WJB A;  4K3N A;  2G3A A;  4NGQ A;  4K30 A;  4NGR A;  3D2P A;  1KWM A;  5KTC A;  3B2Y A;  1Q2C A;  4U9Z A;  4MHY A;  4UF4 A;  5LRJ A;  2QJ8 A;  3TX8 A;  4B5P B;  1QMU A;  3D7H A;  1F2P A;  1TKJ A;  2ANP A;  3HLP A;  4Q38 A;  3S9M A;  4UCP A;  3FF3 A;  3NH8 A;  3BHX A;  2OZH A;  4DYO A;  2DF5 A;  2IL4 A;  2VL1 A;  3TO6 A;  3W6S A;  1WK4 A;  2HC9 A;  5IB0 A;  4II9 A;  3D8P A;  4NGS A;  4ZY2 A;  4FD6 A;  1LAM A;  4OC4 A;  4CYQ A;  4HNX B;  2PC1 A;  3TO7 A;  3N7Z A;  2GRE A;  4NSQ A;  1F57 A;  3BJ8 A;  5F48 A;  3CZX A;  4BBH A;  1IOF A;  2DPS A;  5AGE A;  2CXA A;  3GKR A;  1Q7L A;  2Z3P A;  3B3S A;  2ZW6 A;  4MCQ A;  4OAD A;  5LYI A;  2J8R A;  2Z3O A;  1U6M A;  3K9U A;  4TWE A;  2BOA A;  2GIV A;  5AG7 A;  1ZLH A;  3H4Q A;  3A9L A;  3BI0 A;  5I4M A;  5DWM A;  4FD5 A;  4PV6 A;  1R43 A;  1GHE A;  2G3T A;  3EFA A;  3IEH A;  5CNP A;  2ZEO A;  4A95 A;  5J8F A;  3FVL A;  1MJA A;  5LYD A;  1AUG A;  2PJ8 A;  4KOR A;  4MY0 A;  1I12 A;  4R57 A;  2Y0M A;  3NH4 A;  2OB0 A;  4J3G A;  1KUX A;  4CAW A;  3K9T A;  4NCZ A;  4C2Z A;  2PJ7 A;  1YLE A;  2FL4 A;  4IHM A;  2ZEN A;  2JBJ A;  4PSW A;  1EE3 P;  5CBM A;  2PE3 A;  3R9F A;  2ATR A;  4OAE A;  4CGL A;  2FVG A;  4XPL A;  2FIA A;  3P2H A;  3CXQ A;  4P45 A;  2I00 A;  1DTD A;  3SXN A;  3OWC A;  2V77 A;  4X3R A;  2DPT A;  1CX8 A;  1XFO A;  1NSA A;  2IJZ A;  2PRQ A;  3D2M A;  1LRZ A;  4A31 A;  3E0K A;  3H8E A;  1MK4 A;  4MMO A;  2BUE A;  4AVB A;  2BEI A;  4H2K A;  4JJX A;  4OC5 A;  4M6G A;  4PXC A;  3MGD A;  4KS9 A;  2Q44 A;  3NE8 A;  1YSJ A;  3PEI A;  1ZG7 A;  1X10 A;  4P44 A;  1RTQ A;  3FJU A;  2JLM A;  3IO1 A;  1TF9 A;  3S6K A;  4PXE A;  3T9Y A;  3R9G A;  4P4F A;  1YQE A;  3PB7 X;  4Y49 B;  4KUA A;  2PIY A;  2Q4Y A;  3C26 A;  3KHX A;  1LOK A;  1BPM A;  2PDO A;  3F5B A;  2JEW A;  5HH1 A;  2EWB A;  1Y0Y A;  2QML A;  2VBQ A;  5JM6 A;  1VHO A;  4U9Y A;  2GE3 A;  4OME A;  3SJG A;  4A94 A;  4FD4 A;  5KTD A;  3WC5 A;  3CT9 A;  4FBE A;  4MCS A;  2J9A A;  4R3L A;  4M6H A;  2AFO A;  3PGP A;  3QNV A;  4MXU A;  4ZY0 A;  1BPN A;  2D4O A;  3PB4 X;  5C82 A;  4Z65 A;  4MHN A;  1J4J A;  4CRY B;  2VEZ A;  3FED A;  1Z4E A;  1I21 A;  3VWE A;  2ZPA A;  1S7K A;  2PR8 A;  2ZXV A;  2Q43 A;  4JLY A;  1M4I A;  5JQ4 A;  5I0C A;  3NH5 A;  2QEC A;  1RXT A;  2EUI A;  2VXK A;  2Z3L A;  3P2F A;  1KUV A;  3PB6 X;  4UEZ A;  4CAV A;  4MRI A;  2NSM A;  1YW6 A;  3H8F A;  4FUU A;  2GLJ A;  2CNM A;  2Z0Z A;  3R95 A;  2QYV A;  2YGW A;  3I9S A;  4UIA A;  2GU2 A;  3PFO A;  3TC8 A;  3FRM A;  3TFY A;  1IID A;  4A2Z A;  2Z3M A;  2PCU A; 
#chains in the Genus database with same CATH homology
 4YFJ A;  2ARH A;  1Y7R A;  3F8K A;  4KSA A;  3EC4 A;  2R1I A;  3I3G A;  3IWG A;  1XF8 A;  4UBR A;  1XIX A;  4DNC A;  4KVO E;  4B13 A;  4UCN A;  5AG5 A;  4JXR A;  3DDD A;  4H89 A;  2OU2 A;  4C7H A;  5H86 A;  1XE4 A;  3SHP A;  1NSL A;  4KOT A;  3IU2 A;  1IIC A;  4XPK A;  1TIQ A;  1QSR A;  2B3U A;  4MBU A;  3PZJ A;  4PK3 A;  4HKF A;  2JDD A;  3PP9 A;  2FCK A;  1B87 A;  2AJ6 A;  2Z10 A;  1QSN A;  1YGH A;  3V8I A;  4KVM E;  4L89 A;  1R57 A;  5G20 A;  3SXO A;  4IF5 A;  5G1Z A;  3JVN A;  3G3S A;  2Q0Y A;  2VI7 A;  2A4N A;  2PRB A;  2ZW4 A;  3IWE A;  4Y49 C;  3R96 A;  1YRE A;  2P6G A;  4Q36 A;  4XNH C;  3WR7 A;  3FB3 A;  1ON0 A;  4CGN A;  4R87 A;  3G8W A;  3TT2 A;  1Q2Y A;  4C2Y A;  2CY2 A;  2OZU A;  4CAX A;  3DNS A;  2ZW5 A;  1IYL A;  2X7B A;  4JWP A;  5A27 A;  4ORF A;  1S3Z A;  3ZZI A;  5AG6 A;  2FT0 A;  4KLV A;  3FIX A;  5C88 A;  1S5K A;  1Y9W A;  4ONU A;  3QAH A;  3W91 A;  2Z3N A;  5E96 A;  4CYP A;  1XEB A;  1S7F A;  1ZO0 A;  5A28 A;  4H6Z A;  2Z3K A;  4B5O A;  1M44 A;  4X5K A;  1B6B A;  2F5I A;  4MJ8 A;  2OZG A;  4AG7 A;  1FY7 A;  2AE6 A;  2HQY A;  3T90 A;  3JTK A;  4RS2 A;  2BL1 A;  1YVK A;  4XNH B;  4B14 A;  2I79 A;  3ZJ0 A;  2Z11 A;  1YX0 A;  1S7N A;  1MJB A;  2ZW7 A;  4C68 A;  1M4G A;  1XMT A;  4E2A A;  4EVY A;  4AVC A;  1RO5 A;  4RI1 A;  3BLN A;  2WPW A;  4IUS A;  2YNC A;  2P0W A;  2B5G A;  1IB1 E;  1Q2D A;  2HUZ A;  1M4D A;  1Y9K A;  2REF A;  4U5Y A;  2YNC C;  4CYN A;  3VWD A;  2DXQ A;  3GYA A;  2BSW A;  4ZGY B;  1OZP A;  4XPD C;  2FSR A;  5KTA A;  4LUA A;  4MFQ A;  5IX3 A;  4C7I A;  4MI4 A;  3TTH A;  4F0Y A;  2B58 A;  1I1D A;  1QSO A;  3GY9 A;  4E0A A;  3FYN A;  4CRZ B;  2KCW A;  2PR1 A;  4CGP A;  1YK3 A;  5F47 A;  4KOX A;  3LOD A;  4A30 A;  2R7H A;  4UFW A;  4GS4 A;  4CAE A;  3NE7 A;  5EC4 A;  4C2X A;  2H5M A;  2JDC A;  3FXT A;  5HMN A;  1SQH A;  2CNS A;  2Q4V A;  2G0B A;  1N71 A;  2VQY A;  4I49 A;  4UWJ A;  2K5T A;  4L8A A;  3CXP A;  2J8M A;  4PSX A;  1CJW A;  4AG9 A;  1L0C A;  1KUY A;  1VHS A;  1VKC A;  3FNC A;  1UFH A;  4MFK A;  2WUU A;  1Z9U A;  2B5G B;  5EBV A;  1YVO A;  2D4P A;  4JXQ A;  4AVA A;  1Z4R A;  4B12 A;  4XPD B;  4KSF A;  3H5Z A;  1K4J A;  4M3S A;  3R9E A;  4KOW A;  4YRH A;  1PUA A;  4NF1 A;  2WPX A;  3DSB A;  4R9M A;  2EVN A;  5DWN A;  1S60 A;  4MFJ A;  4JD6 A;  5F49 A;  1NMT A;  3IU1 A;  4ZBG A;  5H84 A;  2B3V A;  3S6F A;  3UY5 A;  4QC6 A;  1NE9 A;  2CNT A;  2WSA A;  4CGO A;  1CM0 A;  3S6G A;  3EO4 A;  4CGM A;  1PU9 A;  2O28 A;  2RC4 A;  3EXN A;  4KZT A;  3KKW A;  3EY5 A;  4AB7 A;  2JEV A;  3TOA A;  5BWA B;  2OH1 A;  2R8V A;  3R1K A;  2QIR A;  2PSW A;  3B8G A;  4H6U A;  4CS0 B;  4MFZ A;  1QSM A;  3S6H A;  5F46 A;  4B11 A;  4KOY A;  2FS5 A;  2Q04 A;  2B4B A;  1BOB A;  3TOB A;  4UFX A;  3D3S A;  3RYO A;  1P4N A;  4OLL A;  5FVJ A;  2P6F A;  2YNE A;  4HNY B;  4R3K A;  4M85 A;  4F6A A;  2VZZ A;  5J8C A;  4UWI A;  5AG4 A;  2J8N A;  3LD2 A;  4KOU A;  1MJ9 A;  2HV2 A;  4QVT A;  2C27 A;  4A33 A;  5IV0 A;  4PK2 A;  1S7L A;  4NEX A;  2B4D A;  1M1D A;  4KOV A;  4MFP A;  2VZY A;  4F0X A;  4CAF A;  1YR0 A;  2YND A;  4MY3 A;  1IYK A;  5G22 A;  2PQ8 A;  1QST A;  1BO4 A;  3TO9 A;  3CXS A;  4QUS A;  3QB8 A;  4KOS A;  4B5P A;  2P6E A;  1KZF A;  3IGR A;  2FE7 A;  4UFV A;  4B10 A;  3DR8 A;  4QB9 A;  3BJ7 A;  4FD7 A;  4KVX A;  4HNW B;  3TCV A;  2GAN A;  4KLW A;  4KUB A;  2REE A;  2Q7B A;  4E8O A;  5GCN A;  3FBU A;  3DR6 A;  3F0A A;  4MFL A;  4CYO A;  2NMT A;  4BMH A;  5JPH A;  2FXF A;  5ISV A;  1V0C A;  3JUW A;  5G21 A;  4A32 A;  3TE4 A;  2R98 A;  4LX9 A;  1WWZ A;  1P0H A;  4QBJ A;  2B4D B;  4UCM A;  4YGO A;  4NXY A;  4UA3 A;  3W6X A;  4MHD A;  2FIW A;  2G3A A;  4K30 A;  3D2P A;  5KTC A;  1Q2C A;  4U9Z A;  4B5P B;  4Q38 A;  4UCP A;  2OZH A;  2IL4 A;  3TO6 A;  3W6S A;  1WK4 A;  5IB0 A;  4II9 A;  3D8P A;  4FD6 A;  4CYQ A;  4HNX B;  2PC1 A;  3TO7 A;  3N7Z A;  4NSQ A;  3BJ8 A;  5F48 A;  4BBH A;  2DPS A;  5AGE A;  2CXA A;  3GKR A;  2Z3P A;  2ZW6 A;  4OAD A;  2J8R A;  2Z3O A;  1U6M A;  3K9U A;  2GIV A;  5AG7 A;  3H4Q A;  3A9L A;  5DWM A;  4FD5 A;  4PV6 A;  1GHE A;  2G3T A;  3EFA A;  5CNP A;  4A95 A;  5J8F A;  1MJA A;  4KOR A;  4MY0 A;  1I12 A;  4R57 A;  2Y0M A;  2OB0 A;  4J3G A;  1KUX A;  4CAW A;  4NCZ A;  4C2Z A;  1YLE A;  2FL4 A;  4PSW A;  3R9F A;  2ATR A;  4OAE A;  4CGL A;  4XPL A;  2FIA A;  3P2H A;  3CXQ A;  2I00 A;  3SXN A;  3OWC A;  2DPT A;  3D2M A;  1LRZ A;  4A31 A;  3E0K A;  1MK4 A;  2BUE A;  4AVB A;  2BEI A;  4JJX A;  3MGD A;  4KS9 A;  2Q44 A;  2JLM A;  3S6K A;  3T9Y A;  3R9G A;  4Y49 B;  4KUA A;  3C26 A;  2Q4Y A;  2PDO A;  3F5B A;  5HH1 A;  2VBQ A;  2QML A;  4U9Y A;  2GE3 A;  4FD4 A;  5KTD A;  4R3L A;  3PGP A;  5C82 A;  2D4O A;  1J4J A;  4CRY B;  2VEZ A;  1Z4E A;  1I21 A;  3VWE A;  2ZPA A;  1S7K A;  2PR8 A;  2ZXV A;  4JLY A;  1M4I A;  5JQ4 A;  5I0C A;  2QEC A;  1RXT A;  2EUI A;  2VXK A;  2Z3L A;  3P2F A;  1KUV A;  4CAV A;  2CNM A;  2Z0Z A;  3R95 A;  2YGW A;  3I9S A;  3FRM A;  3TFY A;  1IID A;  4A2Z A;  2Z3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...