4FAIA

Crystal structure of mitochondrial isoform of glutaminyl cyclase from drosophila melanogaster
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
302
Chain Sequence
ELVDIPKISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYMPGVEFLGATDSAVPCAMLLNLAQVLQEQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
molecule keywords CG5976, isoform B
total genus 103
structure length 302
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4faiA00
2ZEFA 2POKA 2WYRA 4X8IA 2QVPA 3IFEA 2XEGA 4P4JA 3PB6X 1YSJA 2EK9A 3K2KA 2PJ1A 5HVGA 3IO1A 2PJ2A 4WJBA 1QQ9A 1TF9A 4MHNA 4TNUA 2OR4A 4FUUA 1PYTB 1JQGA 2C6PA 3S9NA 1Z2LA 3D7GA 3H8EA 6CPAA 4X2TA 4ONWA 2PIZA 3IC1A 4IK2A 2OOTA 3CDXA 3PB9X 3PB4X 2CIJA 4PQAA 2XEFA 2ZEOA 1Y0RA 1AYEA 1LCPA 1RTQA 4ZI6A 4NGQA 1ZG9A 3PB8X 1BPMA 2NYQA 4IAVA 3PB7X 4PXDA 1TXRA 4OP4A 3KZWA 3KHXA 2JBKA 2QJ8A 1FNOA 4R7MA 3KQZA 2NSMA 5JH9A 1QMUA 1Z5RA 1CPXA 4MRIA 4IHMA 5CPAA 5LRKA 2AFSA 4OC1A 3IIBA 2GLFA 5LYIA 5HVFA 4NGRA 3CPXA 3FJUA 3FX6A 4ZYQA 3VH9A 5IB9A 4FBEA 3L2NA 4GM5A 1TKHA 3WC7A 3FMCA 3WABA 5K8OA 3B2YA 3TC8A 2CTCA 3B3VA 2Q51A 3KHZA 1ARLA 3H8GA 4ZY2A 2ZEMA 4LQGA 3TX8A 1IY7A 1EE3P 3D4UA 3ISZA 3DGVA 3IEHA 4R6TA 1ZLIA 2EWBA 2JBJA 3NFZA 2AFWA 3V7ZA 2ANPA 3D66A 2IMOA 3GUXA 3S9MA 3JRUA 4ZY1A 2VL1A 2PJCA 4OC3A 4CPAA 4NGTA 1TKJA 4UF4A 2HB6A 5CBMA 1XFOA 2V8GA 2ZOGA 4OIWA 5LYDA 4F9UA 4FAIA 3HLPA 3PBBA 4P4IA 2F7VA 2O4HA 3BI0A 3KL9A 3SI0A 4F9VA 3PBEA 4ZY0A 2ZELA 3B3SA 2PRQA 2GREA 1KWMA 1CX8A 2ZOFA 3D7HA 2AFUA 1PCAA 5K8MA 1IGBA 4UEEA 2C6GA 4MCPA 3S9LA 1CBXA 2PJ6A 4P10A 1DE4C 1F2PA 1BLLE 3BI1A 5LYLA 3D67A 4KSIA 3D68A 4Q7AA 3QNVA 2PJ9A 2V77A 4P4FA 5D29A 2G9DA 1VIXA 4WWVA 1R43A 1ELLP 2Q43A 1ZG7A 3GB0A 3ISXA 4PXCA 4H2KA 2CF4A 3KQXA 4A38A 4JZ0A 1ARMA 2ZEGA 4UIBA 3KGQA 3PFOA 4EFDA 1CP6A 3B3TA 3SJEA 2PVWA 4Z65A 2AFXA 2ZEEA 2PJ8A 1CP7A 4P44A 2RB7A 2BCOA 2PJ3A 4NJRA 1HDQA 4G1PA 4B6ZA 3FEEA 2ZEDA 2BO9A 3H8FA 2CTBA 4MCSA 4YWYA 5THWA 3B3WA 1GYTA 4OKOA 4R76A 5HVHA 4EMEA 3NH8A 3VARA 2IJZA 1BPNA 2PJ5A 3HUVA 1HEEA 3PFEA 1ZLHA 1Z8LA 4W9YA 4NFRA 3FECA 1UWYA 1ZG8A 2ZENA 3RZAA 1YMEA 4DYOA 2QYVA 1Y7EA 3RAMA 3SI2A 4MCQA 3IWWA 1XRYA 2ZEHA 3D7FA 3MN8A 2GU2A 3IJ3A 4P45A 1ELMP 2V8DA 3PRTA 4P4EA 4A37A 1LFWA 3LWUA 3NA6A 2C1CA 4PXEA 3B35A 3KR4A 4P4BA 4MMOA 5LYFA 4X3RA 3SJXA 3SJGA 2GLJA 4MHPA 4MHYA 4BD9A 3KI9A 3BHXA 2JEWA 5DS0A 2PJAA 4UEZA 3B7IA 4AXVA 4R8FA 4OC0A 2PCUA 1XBUA 5F09A 2AFOA 1DTDA 4P6YA 4MHZA 3PEIA 2O53A 1VHOA 3SJFA 4NGMA 3GLJA 2XEIA 2PJ0A 4MXUA 2ZEPA 2IQ6A 4ZX9A 4MCRA 1F2OA 1R3NA 1XJOA 5I4MA 4F8ZA 3B3CA 1F57A 8CPAA 1HDUA 4TWEA 1NSAA 2RFHA 3K9TA 1LAMA 4OC2A 1Y0YA 5K8PA 3D7DA 5LRJA 4DUKA 3N5FA 2PVVA 3WC5A 2PJ7A 4NGNA 4O23A 4OC5A 4A94A 3KR5A 4DJLA 2PIYA 5LRGA 2WZNA 3FEDA 3FF3A 5J1QA 5JM6A 1YLOA 4P4DA 1FT7A 1M4LA 4ZX8A 1LANA 1AMPA 3WC6A 3FH4A 1Q7LA 2BOAA 1OBRA 1VGYA 4K3NA 3VATA 5JGFA 4OC4A 4NGPA 4UEFA 1TKFA 5D8NA 2FVGA 7CPAA 3LMSA 3V38A 4JYWA 3DLJA 2V8HA 2HC9A 3NH4A 1LOKA 1H8LA 1XMBA 4NGSA 4NJQA 4PPZA 2XEJA 1VHEA 3SI1A 3CPAA 2V8VA 2DEAA 1CG2A 2EK8A 3I1UA 1BAVA 4A39A 4FWUA 2F8HA 1YW4A 3WT4A 2I3CA 5K8NA 4OMEA 1CPSA 2AFMA 3FVLA 2Q4ZA 2C6CA 4UIAA 2J9AA 3MRUA 3BXMA 2AFZA 3CT9A 1YW6A 5ELYA 4YU9A 4RUHA 1LAPA 2PJBA 3RBUA 3T8WA 4OIDA 4PXBA 2ABZA 4EWTA 1TF8A 2PJ4A 5HXDA 3KASA 2PE3A 3NH5A
chains in the Genus database with same CATH superfamily
2ZEFA 1V0CA 3GYAA 4MBUA 2POKA 3S6HA 2BEIA 2WYRA 4X8IA 4KORA 4XPKA 2QVPA 4U9YA 3IFEA 2B5GB 2EBJA 2XEGA 4P4JA 3TO6A 2CNSA 1RO5A 5IV0A 2BL1A 3PB6X 5DWNA 3W6XA 2PR8A 1YSJA 2Q4YA 1XE4A 2EK9A 4KVXA 3ZZIA 3K2KA 3IU2A 3FBUA 2GANA 2PJ1A 5AG6A 4JXRA 4QBJA 5HVGA 3DNSA 4XPLA 3IO1A 1Z8TA 2Z3NA 4C7IA 2PJ2A 1MK4A 4WJBA 4YRHA 1YREA 1XOVA 1QQ9A 1TF9A 3W91A 1VKCA 1Q2CA 4Q38A 5KTCA 2J8RA 3GIUA 4MHNA 4UFVA 4MFKA 2Q0YA 2REFA 4TNUA 4M6GA 2OR4A 4HNYB 4FUUA 1IU8A 1PYTB 1JQGA 2C6PA 3S9NA 4CRYB 3JUWA 1Q2YA 1Z2LA 3D7GA 4KOWA 4CAVA 5C88A 3H8EA 4FD5A 6CPAA 4FD7A 1Y9KA 4X2TA 2Q44A 4ONWA 3OWCA 3R1KA 2PIZA 2ZXVA 3IC1A 4IK2A 2C27A 2WSAA 3P2HA 4AVBA 3T90A 4M3SA 4OLLA 2OOTA 2PDOA 2ZW7A 5DWMA 2PR1A 4F0YA 3CDXA 3PB9X 3FXTA 4X5KA 2WPXA 4KS9A 3PB4X 4U9ZA 3EY5A 2CIJA 4PQAA 2XEFA 2ZEOA 4U5YA 3SXOA 1Y0RA 2P6GA 4UFXA 1Y9WA 5KTAA 3D2MA 2FS5A 1AYEA 1LCPA 1RTQA 2VEZA 4CYQA 2FSRA 3QAYA 4ZI6A 4KSFA 1B87A 4NGQA 1ZG9A 3PB8X 3PP9A 4NF1A 1BPMA 1BO4A 2NYQA 4IAVA 1AUGA 3PB7X 4PXDA 2I79A 1TXRA 4OP4A 4B5OA 2IL4A 4CGMA 3KZWA 4CAFA 2Q7SA 1YQEA 4IUSA 2VI7A 3KHXA 2JBKA 2OU2A 2OZUA 4QB9A 5EC4A 2B58A 1FNOA 2QJ8A 4R7MA 1Y7RA 3KQZA 2D4PA 2JDCA 2NSMA 5C82A 5JH9A 1QMUA 2Q4VA 1Z5RA 1CPXA 1XF8A 4MRIA 4UBRA 3S6KA 5HMNA 2VZZA 4KOUA 3N7ZA 4KOSA 3D3SA 4IHMA 5CPAA 5LRKA 2FT0A 2AFSA 3QB8A 4K30A 3IWEA 1WK4A 4XPDC 5A28A 3K9UA 1KUXA 4OC1A 3IIBA 1Z8WA 2O28A 2GLFA 4Y49B 4C2ZA 3A9LA 4CRZB 5LYIA 5HVFA 3TT2A 5CNPA 2FIAA 3CPXA 3FJUA 3FX6A 4NGRA 4ZYQA 3VH9A 4B5PA 5JQ4A 2DXQA 4KLVA 5IB9A 4UCMA 4FBEA 3L2NA 3NE8A 1Z9UA 4GM5A 3WR7A 4A31A 1TKHA 3BJ8A 3WC7A 3FMCA 1I1DA 4B14A 3WABA 2FL4A 5K8OA 3B2YA 4MFZA 3TC8A 2CTCA 3B3VA 4CYPA 4PSXA 4A30A 4MY0A 1ON0A 3RYOA 1S3ZA 4AB7A 2Q51A 2F5IA 2YNDA 3R9GA 2Y0MA 1ARLA 3H8GA 3KHZA 4QVTA 4R3KA 2ZEMA 4ZY2A 4LQGA 3TX8A 4CAXA 3LACA 4CAWA 5KTDA 1QSRA 1IY7A 1KUYA 4A33A 3RNZA 1EE3P 3D4UA 4KZTA 4BMHA 3D2PA 1S7FA 3ISZA 3DGVA 4GS4A 3IEHA 3IU1A 4R6TA 1ZLIA 1IOIA 2EWBA 2JDDA 2JBJA 3R9FA 5I0CA 5J8CA 3NFZA 2AFWA 3V7ZA 4A32A 2ANPA 3D66A 2Z3MA 2IMOA 4KLWA 3BJ7A 3GUXA 4J3GA 3S9MA 2B5GA 4MFQA 4ORFA 5A27A 3JRUA 1NSLA 2R8VA 2G3AA 4LX9A 4ZY1A 2VL1A 2PJCA 4OC3A 4UCNA 4Y49C 4CPAA 4NGTA 1TKJA 4UF4A 1RXTA 2HB6A 5CBMA 1XFOA 2V8GA 2ZOGA 4OIWA 5LYDA 1S5KA 4R87A 2YNCA 4F9UA 4FAIA 4YFJA 2YGWA 5JPHA 3HLPA 4KUBA 2R1IA 3PBBA 2Z3OA 4P4IA 2F7VA 2O4HA 3BI0A 3S6GA 2DF5A 3KL9A 5ISVA 3SI0A 2RC4A 4F9VA 4QUSA 3PBEA 2G0BA 3P2FA 4ZY0A 4R9MA 2ZELA 4AG7A 3B3SA 2PRQA 2GREA 3RO0A 1KZFA 1KWMA 2PSWA 1I21A 2KCWA 1CX8A 5H86A 1I12A 3JVNA 2ZOFA 3D7HA 2B3VA 2AFUA 2WUUA 1PCAA 5K8MA 1IGBA 3TE4A 2AJ6A 4UEEA 4BBHA 4PK2A 2C6GA 1M4GA 4MCPA 4A95A 3GKRA 3S9LA 1CBXA 2ZW4A 1FY7A 2J8MA 2PJ6A 2OZGA 3SHPA 1MJAA 3DSBA 4P10A 2K5TA 5AG4A 1DE4C 1F2PA 4LQ6A 5G20A 1BLLE 3BI1A 5LYLA 3D67A 1MJBA 2ZPAA 4KSIA 3D68A 2B3UA 4Q7AA 3QNVA 2PJ9A 2V77A 4H6UA 4P4FA 5D29A 2EUIA 3SXNA 2H5MA 2G9DA 1VIXA 2JLMA 4WWVA 4KUAA 4RN7A 1R43A 1ELLP 1P4NA 1YGHA 2OZHA 2B4DB 4JJXA 2Q43A 1KUVA 1ZG7A 3FB3A 3GB0A 4H6ZA 3ISXA 2PQ8A 4C2XA 4PXCA 3H5ZA 4YGOA 3TO7A 4H2KA 2CF4A 3KQXA 2Q7BA 3TOBA 4JZ0A 4A38A 5H84A 1ARMA 1XIXA 2P6EA 2ZEGA 4PK3A 1S7NA 4UIBA 3KGQA 1YX0A 5J8FA 3PFOA 4EFDA 3PZJA 4NEXA 1P0HA 3TTHA 2J8NA 1CP6A 3B3TA 3SJEA 2PC1A 2PVWA 4Z65A 4BINA 2Z3KA 2AFXA 2ZEEA 2PJ8A 1CP7A 2GFQA 3CZXA 2RB7A 4P44A 2BCOA 2PJ3A 3EFAA 2GE3A 4NJRA 4AVAA 5FVJA 1HDQA 2AE6A 4HNWB 4R57A 4G1PA 4B6ZA 1S60A 3FEEA 3H4QA 2ZEDA 4CGNA 1MJ9A 2FE7A 1XEBA 2BO9A 3H8FA 1X10A 2CTBA 4MCSA 4RI1A 4YWYA 2ZW5A 5THWA 1X12A 1YVKA 3B3WA 4MFPA 4E2AA 1GYTA 3V8IA 4OKOA 4R76A 2EVNA 3VWEA 2B4DA 5HVHA 4EMEA 4CAEA 4HNXB 3NH8A 4UCPA 4FD6A 3VARA 1XMTA 2IJZA 1BPNA 4E8OA 2PJ5A 1QSOA 3HUVA 1HEEA 2EO8A 3PFEA 5HH1A 1ZLHA 1Z8LA 4W9YA 4NFRA 3FECA 3IWGA 3BLNA 4IF5A 1UWYA 1ZG8A 3I3GA 4B12A 4RS2A 2ZENA 5AG5A 1OZPA 1YMEA 3RZAA 4DYOA 2QYVA 2ODFA 1Y7EA 3RAMA 3SI2A 4MCQA 3IWWA 3G3SA 1XRYA 2WPWA 3FRMA 1UFHA 2B4BA 1L0CA 2ZEHA 3D7FA 3MN8A 4F0XA 4UWIA 3R9EA 2GU2A 3IJ3A 3NE7A 1ELMP 4KOYA 4KSAA 1SQHA 4P45A 4AG9A 2DPSA 2V8DA 3PRTA 1PUAA 1CJWA 1YR0A 2DPTA 3KKWA 4P4EA 1QSTA 4M6IA 5IX3A 3F0AA 2REEA 1LFWA 1B6BA 3LWUA 3NA6A 3DR6A 4MFLA 1M1DA 2C1CA 4GXHA 1M44A 2JEVA 3B35A 3KR4A 4P4BA 4PXEA 4MMOA 5LYFA 1S7LA 4X3RA 4MHDA 4XNHB 5F48A 1J4JA 3SJXA 4C7HA 4JWPA 3R96A 3DR8A 3SJGA 2VBQA 2GLJA 4DNCA 3TOAA 3EO4A 1IYLA 1Z4RA 3CXSA 4MHPA 5EBVA 4II9A 1R57A 2FXFA 4MHYA 1NE9A 4HKFA 4BD9A 3KI9A 1QSNA 4C68A 3BHXA 2JEWA 5DS0A 2PJAA 2R7HA 5E96A 4ONUA 4UEZA 2R98A 3B7IA 4R8FA 2Z3LA 4OC0A 3UY5A 3I9SA 4AXVA 2CNMA 2PCUA 3LODA 4NCZA 1XBUA 2CXAA 1S7KA 1NMTA 4HPSA 5F09A 5AGEA 2AFOA 4KOTA 1DTDA 4OADA 2ATRA 3CXPA 4L8AA 4P6YA 4MHZA 3TO9A 3VWDA 4CYOA 3PEIA 4CS0B 2O53A 2ARHA 5IB0A 1VHOA 2GIVA 4JD6A 4NGMA 3SJFA 1IYKA 3GLJA 3EC4A 1LRZA 2XEIA 2Z10A 4MJ8A 3E0KA 5EMIA 2PJ0A 4MXUA 1IB1E 2G3TA 2ZEPA 2IQ6A 4ZX9A 4E0AA 3JTKA 4XNHC 4MCRA 1F2OA 4FD4A 3TFYA 1R3NA 1XJOA 3W6SA 4LUAA 5I4MA 4F8ZA 1Z8XA 2YNEA 2Z0ZA 3B3CA 1F57A 8CPAA 1HDUA 4TWEA 4B10A 1NSAA 2RFHA 5GCNA 3K9TA 4B13A 2ZW6A 1LAMA 4OC2A 2QECA 1Y0YA 5K8PA 3D7DA 4H89A 5LRJA 2P6FA 2P0WA 3IGRA 3N5FA 4DUKA 3D8PA 2PVVA 3WC5A 5F47A 1TIQA 2PJ7A 4NGNA 4O23A 1GHEA 1YK3A 2BUEA 4OC5A 4A94A 3KR5A 1K4JA 4DJLA 4B11A 2PIYA 4UFWA 5LRGA 2VXKA 2WZNA 3FEDA 4C2YA 5G22A 1PU9A 3FF3A 2HV2A 3PGPA 1A2ZA 5J1QA 3C26A 2OB0A 4KVME 4PV6A 3T9YA 2D4OA 5JM6A 1YLOA 2QIRA 4P4DA 1FT7A 1BOBA 1M4LA 1QSMA 3FNCA 4ZX8A 1LANA 1IICA 1AMPA 5F49A 3WC6A 3FH4A 2Z3PA 1Q7LA 4MI4A 3EXNA 4OAEA 2BOAA 1OBRA 5G1ZA 1U6MA 4QC6A 4NSQA 1VGYA 2Q04A 4K3NA 4B5PB 3VATA 5G21A 5JGFA 1IIDA 1M4IA 4JXQA 4UA3A 4OC4A 4NGPA 4UEFA 1TKFA 4XPDB 5D8NA 2FVGA 4CGPA 1CM0A 7CPAA 3LMSA 1Z4EA 3DDDA 2PRBA 2CNTA 2FIWA 3V38A 2NMTA 4JYWA 1M4DA 3DLJA 3ZJ0A 2CY2A 2V8HA 3QAHA 4CGLA 2HC9A 4M6HA 1YVOA 3NH4A 1LOKA 1H8LA 1XMBA 4NGSA 3FIXA 4AVCA 1VHSA 3S6FA 3F8KA 3CXQA 4NJQA 4JLYA 4PPZA 2XEJA 1JWQA 1VHEA 2OH1A 3SI1A 3LD2A 3CPAA 2V8VA 5BWAB 1IOFA 2DEAA 1CG2A 2EK8A 2FCKA 3I1UA 4PSWA 1BAVA 4EVYA 4A39A 3GY9A 4ZBGA 4FWUA 4M85A 2VQYA 4MY3A 2F8HA 1YW4A 3B8GA 4CGOA 2VZYA 3WT4A 5F46A 2HUZA 3MGDA 2I3CA 4I49A 4KOXA 4KVOE 5K8NA 4OMEA 1CPSA 1WWZA 4A2ZA 3G8WA 2HQYA 3R95A 1YLEA 3F5BA 2AFMA 3FVLA 4F6AA 1ZO0A 2Q4ZA 2A4NA 2C6CA 4UIAA 2J9AA 3MRUA 3BXMA 4L89A 2AFZA 3CT9A 2Z11A 4UWJA 2YNCC 4ZGYB 1YW6A 5ELYA 4A37A 4CYNA 2I00A 4YU9A 2BSWA 4RUHA 4Q36A 1LAPA 2PJBA 3RBUA 3T8WA 4KOVA 4R3LA 4OIDA 4PXBA 3TCVA 1Q2DA 2ABZA 4EWTA 1TF8A 2PJ4A 2QMLA 4MFJA 2X7BA 5HXDA 5AG7A 3KASA 3FYNA 1N71A 2PE3A 3NH5A 4NXYA
chains in the Genus database with same CATH topology
2ZEFA 2POKA 2WYRA 4X8IA 2QVPA 3IFEA 2XEGA 4P4JA 3PB6X 1YSJA 2EK9A 3K2KA 2PJ1A 5HVGA 3IO1A 2PJ2A 4WJBA 1QQ9A 1TF9A 4MHNA 4TNUA 2OR4A 4FUUA 1PYTB 1JQGA 2C6PA 3S9NA 1Z2LA 3D7GA 3H8EA 6CPAA 4X2TA 4ONWA 2PIZA 3IC1A 4IK2A 2OOTA 3CDXA 3PB9X 3PB4X 2CIJA 4PQAA 2XEFA 2ZEOA 1Y0RA 1AYEA 1LCPA 1RTQA 4ZI6A 4NGQA 1ZG9A 3PB8X 1BPMA 2NYQA 4IAVA 3PB7X 4PXDA 1TXRA 4OP4A 3KZWA 3KHXA 2JBKA 2QJ8A 1FNOA 4R7MA 3KQZA 2NSMA 5JH9A 1QMUA 1Z5RA 1CPXA 4MRIA 4IHMA 5CPAA 5LRKA 2AFSA 4OC1A 3IIBA 2GLFA 5LYIA 5HVFA 4NGRA 3CPXA 3FJUA 3FX6A 4ZYQA 3VH9A 5IB9A 4FBEA 3L2NA 4GM5A 1TKHA 3WC7A 3FMCA 3WABA 5K8OA 3B2YA 3TC8A 2CTCA 3B3VA 2Q51A 3KHZA 1ARLA 3H8GA 4ZY2A 2ZEMA 4LQGA 3TX8A 1IY7A 1EE3P 3D4UA 3ISZA 3DGVA 3IEHA 4R6TA 1ZLIA 2EWBA 2JBJA 3NFZA 2AFWA 3V7ZA 2ANPA 3D66A 2IMOA 3GUXA 3S9MA 3JRUA 4ZY1A 2VL1A 2PJCA 4OC3A 4CPAA 4NGTA 1TKJA 4UF4A 2HB6A 5CBMA 1XFOA 2V8GA 2ZOGA 4OIWA 5LYDA 4F9UA 4FAIA 3HLPA 3PBBA 4P4IA 2F7VA 2O4HA 3BI0A 3KL9A 3SI0A 4F9VA 3PBEA 4ZY0A 2ZELA 3B3SA 2PRQA 2GREA 1KWMA 1CX8A 2ZOFA 3D7HA 2AFUA 1PCAA 5K8MA 1IGBA 4UEEA 2C6GA 4MCPA 3S9LA 1CBXA 2PJ6A 4P10A 1DE4C 1F2PA 1BLLE 3BI1A 5LYLA 3D67A 4KSIA 3D68A 4Q7AA 3QNVA 2PJ9A 2V77A 4P4FA 5D29A 2G9DA 1VIXA 4WWVA 1R43A 1ELLP 2Q43A 1ZG7A 3GB0A 3ISXA 4PXCA 4H2KA 2CF4A 3KQXA 4A38A 4JZ0A 1ARMA 2ZEGA 4UIBA 3KGQA 3PFOA 4EFDA 1CP6A 3B3TA 3SJEA 2PVWA 4Z65A 2AFXA 2ZEEA 2PJ8A 1CP7A 4P44A 2RB7A 2BCOA 2PJ3A 4NJRA 1HDQA 4G1PA 4B6ZA 3FEEA 2ZEDA 2BO9A 3H8FA 2CTBA 4MCSA 4YWYA 5THWA 3B3WA 1GYTA 4OKOA 4R76A 5HVHA 4EMEA 3NH8A 3VARA 2IJZA 1BPNA 2PJ5A 3HUVA 1HEEA 3PFEA 1ZLHA 1Z8LA 4W9YA 4NFRA 3FECA 1UWYA 1ZG8A 2ZENA 3RZAA 1YMEA 4DYOA 2QYVA 1Y7EA 3RAMA 3SI2A 4MCQA 3IWWA 1XRYA 2ZEHA 3D7FA 3MN8A 2GU2A 3IJ3A 4P45A 1ELMP 2V8DA 3PRTA 4P4EA 4A37A 1LFWA 3LWUA 3NA6A 2C1CA 4PXEA 3B35A 3KR4A 4P4BA 4MMOA 5LYFA 4X3RA 3SJXA 3SJGA 2GLJA 4MHPA 4MHYA 4BD9A 3KI9A 3BHXA 2JEWA 5DS0A 2PJAA 4UEZA 3B7IA 4AXVA 4R8FA 4OC0A 2PCUA 1XBUA 5F09A 2AFOA 1DTDA 4P6YA 4MHZA 3PEIA 2O53A 1VHOA 3SJFA 4NGMA 3GLJA 2XEIA 2PJ0A 4MXUA 2ZEPA 2IQ6A 4ZX9A 4MCRA 1F2OA 1R3NA 1XJOA 5I4MA 4F8ZA 3B3CA 1F57A 8CPAA 1HDUA 4TWEA 1NSAA 2RFHA 3K9TA 1LAMA 4OC2A 1Y0YA 5K8PA 3D7DA 5LRJA 4DUKA 3N5FA 2PVVA 3WC5A 2PJ7A 4NGNA 4O23A 4OC5A 4A94A 3KR5A 4DJLA 2PIYA 5LRGA 2WZNA 3FEDA 3FF3A 5J1QA 5JM6A 1YLOA 4P4DA 1FT7A 1M4LA 4ZX8A 1LANA 1AMPA 3WC6A 3FH4A 1Q7LA 2BOAA 1OBRA 1VGYA 4K3NA 3VATA 5JGFA 4OC4A 4NGPA 4UEFA 1TKFA 5D8NA 2FVGA 7CPAA 3LMSA 3V38A 4JYWA 3DLJA 2V8HA 2HC9A 3NH4A 1LOKA 1H8LA 1XMBA 4NGSA 4NJQA 4PPZA 2XEJA 1VHEA 3SI1A 3CPAA 2V8VA 2DEAA 1CG2A 2EK8A 3I1UA 1BAVA 4A39A 4FWUA 2F8HA 1YW4A 3WT4A 2I3CA 5K8NA 4OMEA 1CPSA 2AFMA 3FVLA 2Q4ZA 2C6CA 4UIAA 2J9AA 3MRUA 3BXMA 2AFZA 3CT9A 1YW6A 5ELYA 4YU9A 4RUHA 1LAPA 2PJBA 3RBUA 3T8WA 4OIDA 4PXBA 2ABZA 4EWTA 1TF8A 2PJ4A 5HXDA 3KASA 2PE3A 3NH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEF A;  2POK A;  2WYR A;  4X8I A;  2QVP A;  3IFE A;  2XEG A;  4P4J A;  3PB6 X;  1YSJ A;  2EK9 A;  3K2K A;  2PJ1 A;  5HVG A;  3IO1 A;  2PJ2 A;  4WJB A;  1QQ9 A;  1TF9 A;  4MHN A;  4TNU A;  2OR4 A;  4FUU A;  1PYT B;  1JQG A;  2C6P A;  3S9N A;  1Z2L A;  3D7G A;  3H8E A;  6CPA A;  4X2T A;  4ONW A;  2PIZ A;  3IC1 A;  4IK2 A;  2OOT A;  3CDX A;  3PB9 X;  3PB4 X;  2CIJ A;  4PQA A;  2XEF A;  2ZEO A;  1Y0R A;  1AYE A;  1LCP A;  1RTQ A;  4ZI6 A;  4NGQ A;  1ZG9 A;  3PB8 X;  1BPM A;  2NYQ A;  4IAV A;  3PB7 X;  4PXD A;  1TXR A;  4OP4 A;  3KZW A;  3KHX A;  2JBK A;  2QJ8 A;  1FNO A;  4R7M A;  3KQZ A;  2NSM A;  5JH9 A;  1QMU A;  1Z5R A;  1CPX A;  4MRI A;  4IHM A;  5CPA A;  5LRK A;  2AFS A;  4OC1 A;  3IIB A;  2GLF A;  5LYI A;  5HVF A;  4NGR A;  3CPX A;  3FJU A;  3FX6 A;  4ZYQ A;  3VH9 A;  5IB9 A;  4FBE A;  3L2N A;  4GM5 A;  1TKH A;  3WC7 A;  3FMC A;  3WAB A;  5K8O A;  3B2Y A;  3TC8 A;  2CTC A;  3B3V A;  2Q51 A;  3KHZ A;  1ARL A;  3H8G A;  4ZY2 A;  2ZEM A;  4LQG A;  3TX8 A;  1IY7 A;  1EE3 P;  3D4U A;  3ISZ A;  3DGV A;  3IEH A;  4R6T A;  1ZLI A;  2EWB A;  2JBJ A;  3NFZ A;  2AFW A;  3V7Z A;  2ANP A;  3D66 A;  2IMO A;  3GUX A;  3S9M A;  3JRU A;  4ZY1 A;  2VL1 A;  2PJC A;  4OC3 A;  4CPA A;  4NGT A;  1TKJ A;  4UF4 A;  2HB6 A;  5CBM A;  1XFO A;  2V8G A;  2ZOG A;  4OIW A;  5LYD A;  4F9U A;  4FAI A;  3HLP A;  3PBB A;  4P4I A;  2F7V A;  2O4H A;  3BI0 A;  3KL9 A;  3SI0 A;  4F9V A;  3PBE A;  4ZY0 A;  2ZEL A;  3B3S A;  2PRQ A;  2GRE A;  1KWM A;  1CX8 A;  2ZOF A;  3D7H A;  2AFU A;  1PCA A;  5K8M A;  1IGB A;  4UEE A;  2C6G A;  4MCP A;  3S9L A;  1CBX A;  2PJ6 A;  4P10 A;  1DE4 C;  1F2P A;  1BLL E;  3BI1 A;  5LYL A;  3D67 A;  4KSI A;  3D68 A;  4Q7A A;  3QNV A;  2PJ9 A;  2V77 A;  4P4F A;  5D29 A;  2G9D A;  1VIX A;  4WWV A;  1R43 A;  1ELL P;  2Q43 A;  1ZG7 A;  3GB0 A;  3ISX A;  4PXC A;  4H2K A;  2CF4 A;  3KQX A;  4A38 A;  4JZ0 A;  1ARM A;  2ZEG A;  4UIB A;  3KGQ A;  3PFO A;  4EFD A;  1CP6 A;  3B3T A;  3SJE A;  2PVW A;  4Z65 A;  2AFX A;  2ZEE A;  2PJ8 A;  1CP7 A;  4P44 A;  2RB7 A;  2BCO A;  2PJ3 A;  4NJR A;  1HDQ A;  4G1P A;  4B6Z A;  3FEE A;  2ZED A;  2BO9 A;  3H8F A;  2CTB A;  4MCS A;  4YWY A;  5THW A;  3B3W A;  1GYT A;  4OKO A;  4R76 A;  5HVH A;  4EME A;  3NH8 A;  3VAR A;  2IJZ A;  1BPN A;  2PJ5 A;  3HUV A;  1HEE A;  3PFE A;  1ZLH A;  1Z8L A;  4W9Y A;  4NFR A;  3FEC A;  1UWY A;  1ZG8 A;  2ZEN A;  3RZA A;  1YME A;  4DYO A;  2QYV A;  1Y7E A;  3RAM A;  3SI2 A;  4MCQ A;  3IWW A;  1XRY A;  2ZEH A;  3D7F A;  3MN8 A;  2GU2 A;  3IJ3 A;  4P45 A;  1ELM P;  2V8D A;  3PRT A;  4P4E A;  4A37 A;  1LFW A;  3LWU A;  3NA6 A;  2C1C A;  4PXE A;  3B35 A;  3KR4 A;  4P4B A;  4MMO A;  5LYF A;  4X3R A;  3SJX A;  3SJG A;  2GLJ A;  4MHP A;  4MHY A;  4BD9 A;  3KI9 A;  3BHX A;  2JEW A;  5DS0 A;  2PJA A;  4UEZ A;  3B7I A;  4AXV A;  4R8F A;  4OC0 A;  2PCU A;  1XBU A;  5F09 A;  2AFO A;  1DTD A;  4P6Y A;  4MHZ A;  3PEI A;  2O53 A;  1VHO A;  3SJF A;  4NGM A;  3GLJ A;  2XEI A;  2PJ0 A;  4MXU A;  2ZEP A;  2IQ6 A;  4ZX9 A;  4MCR A;  1F2O A;  1R3N A;  1XJO A;  5I4M A;  4F8Z A;  3B3C A;  1F57 A;  8CPA A;  1HDU A;  4TWE A;  1NSA A;  2RFH A;  3K9T A;  1LAM A;  4OC2 A;  1Y0Y A;  5K8P A;  3D7D A;  5LRJ A;  4DUK A;  3N5F A;  2PVV A;  3WC5 A;  2PJ7 A;  4NGN A;  4O23 A;  4OC5 A;  4A94 A;  3KR5 A;  4DJL A;  2PIY A;  5LRG A;  2WZN A;  3FED A;  3FF3 A;  5J1Q A;  5JM6 A;  1YLO A;  4P4D A;  1FT7 A;  1M4L A;  4ZX8 A;  1LAN A;  1AMP A;  3WC6 A;  3FH4 A;  1Q7L A;  2BOA A;  1OBR A;  1VGY A;  4K3N A;  3VAT A;  5JGF A;  4OC4 A;  4NGP A;  4UEF A;  1TKF A;  5D8N A;  2FVG A;  7CPA A;  3LMS A;  3V38 A;  4JYW A;  3DLJ A;  2V8H A;  2HC9 A;  3NH4 A;  1LOK A;  1H8L A;  1XMB A;  4NGS A;  4NJQ A;  4PPZ A;  2XEJ A;  1VHE A;  3SI1 A;  3CPA A;  2V8V A;  2DEA A;  1CG2 A;  2EK8 A;  3I1U A;  1BAV A;  4A39 A;  4FWU A;  2F8H A;  1YW4 A;  3WT4 A;  2I3C A;  5K8N A;  4OME A;  1CPS A;  2AFM A;  3FVL A;  2Q4Z A;  2C6C A;  4UIA A;  2J9A A;  3MRU A;  3BXM A;  2AFZ A;  3CT9 A;  1YW6 A;  5ELY A;  4YU9 A;  4RUH A;  1LAP A;  2PJB A;  3RBU A;  3T8W A;  4OID A;  4PXB A;  2ABZ A;  4EWT A;  1TF8 A;  2PJ4 A;  5HXD A;  3KAS A;  2PE3 A;  3NH5 A; 
#chains in the Genus database with same CATH topology
 2ZEF A;  1V0C A;  3GYA A;  4MBU A;  2POK A;  3S6H A;  2BEI A;  2WYR A;  4X8I A;  4KOR A;  4XPK A;  2QVP A;  4U9Y A;  3IFE A;  2B5G B;  2EBJ A;  2XEG A;  4P4J A;  3TO6 A;  2CNS A;  1RO5 A;  5IV0 A;  2BL1 A;  3PB6 X;  5DWN A;  3W6X A;  2PR8 A;  1YSJ A;  2Q4Y A;  1XE4 A;  2EK9 A;  4KVX A;  3ZZI A;  3K2K A;  3IU2 A;  3FBU A;  2GAN A;  2PJ1 A;  5AG6 A;  4JXR A;  4QBJ A;  5HVG A;  3DNS A;  4XPL A;  3IO1 A;  1Z8T A;  2Z3N A;  4C7I A;  2PJ2 A;  1MK4 A;  4WJB A;  4YRH A;  1YRE A;  1XOV A;  1QQ9 A;  1TF9 A;  3W91 A;  1VKC A;  1Q2C A;  4Q38 A;  5KTC A;  2J8R A;  3GIU A;  4MHN A;  4UFV A;  4MFK A;  2Q0Y A;  2REF A;  4TNU A;  4M6G A;  2OR4 A;  4HNY B;  4FUU A;  1IU8 A;  1PYT B;  1JQG A;  2C6P A;  3S9N A;  4CRY B;  3JUW A;  1Q2Y A;  1Z2L A;  3D7G A;  4KOW A;  4CAV A;  5C88 A;  3H8E A;  4FD5 A;  6CPA A;  4FD7 A;  1Y9K A;  4X2T A;  2Q44 A;  4ONW A;  3OWC A;  3R1K A;  2PIZ A;  2ZXV A;  3IC1 A;  4IK2 A;  2C27 A;  2WSA A;  3P2H A;  4AVB A;  3T90 A;  4M3S A;  4OLL A;  2OOT A;  2PDO A;  2ZW7 A;  5DWM A;  2PR1 A;  4F0Y A;  3CDX A;  3PB9 X;  3FXT A;  4X5K A;  2WPX A;  4KS9 A;  3PB4 X;  4U9Z A;  3EY5 A;  2CIJ A;  4PQA A;  2XEF A;  2ZEO A;  4U5Y A;  3SXO A;  1Y0R A;  2P6G A;  4UFX A;  1Y9W A;  5KTA A;  3D2M A;  2FS5 A;  1AYE A;  1LCP A;  1RTQ A;  2VEZ A;  4CYQ A;  2FSR A;  3QAY A;  4ZI6 A;  4KSF A;  1B87 A;  4NGQ A;  1ZG9 A;  3PB8 X;  3PP9 A;  4NF1 A;  1BPM A;  1BO4 A;  2NYQ A;  4IAV A;  1AUG A;  3PB7 X;  4PXD A;  2I79 A;  1TXR A;  4OP4 A;  4B5O A;  2IL4 A;  4CGM A;  3KZW A;  4CAF A;  2Q7S A;  1YQE A;  4IUS A;  2VI7 A;  3KHX A;  2JBK A;  2OU2 A;  2OZU A;  4QB9 A;  5EC4 A;  2B58 A;  1FNO A;  2QJ8 A;  4R7M A;  1Y7R A;  3KQZ A;  2D4P A;  2JDC A;  2NSM A;  5C82 A;  5JH9 A;  1QMU A;  2Q4V A;  1Z5R A;  1CPX A;  1XF8 A;  4MRI A;  4UBR A;  3S6K A;  5HMN A;  2VZZ A;  4KOU A;  3N7Z A;  4KOS A;  3D3S A;  4IHM A;  5CPA A;  5LRK A;  2FT0 A;  2AFS A;  3QB8 A;  4K30 A;  3IWE A;  1WK4 A;  4XPD C;  5A28 A;  3K9U A;  1KUX A;  4OC1 A;  3IIB A;  1Z8W A;  2O28 A;  2GLF A;  4Y49 B;  4C2Z A;  3A9L A;  4CRZ B;  5LYI A;  5HVF A;  3TT2 A;  5CNP A;  2FIA A;  3CPX A;  3FJU A;  3FX6 A;  4NGR A;  4ZYQ A;  3VH9 A;  4B5P A;  5JQ4 A;  2DXQ A;  4KLV A;  5IB9 A;  4UCM A;  4FBE A;  3L2N A;  3NE8 A;  1Z9U A;  4GM5 A;  3WR7 A;  4A31 A;  1TKH A;  3BJ8 A;  3WC7 A;  3FMC A;  1I1D A;  4B14 A;  3WAB A;  2FL4 A;  5K8O A;  3B2Y A;  4MFZ A;  3TC8 A;  2CTC A;  3B3V A;  4CYP A;  4PSX A;  4A30 A;  4MY0 A;  1ON0 A;  3RYO A;  1S3Z A;  4AB7 A;  2Q51 A;  2F5I A;  2YND A;  3R9G A;  2Y0M A;  1ARL A;  3H8G A;  3KHZ A;  4QVT A;  4R3K A;  2ZEM A;  4ZY2 A;  4LQG A;  3TX8 A;  4CAX A;  3LAC A;  4CAW A;  5KTD A;  1QSR A;  1IY7 A;  1KUY A;  4A33 A;  3RNZ A;  1EE3 P;  3D4U A;  4KZT A;  4BMH A;  3D2P A;  1S7F A;  3ISZ A;  3DGV A;  4GS4 A;  3IEH A;  3IU1 A;  4R6T A;  1ZLI A;  1IOI A;  2EWB A;  2JDD A;  2JBJ A;  3R9F A;  5I0C A;  5J8C A;  3NFZ A;  2AFW A;  3V7Z A;  4A32 A;  2ANP A;  3D66 A;  2Z3M A;  2IMO A;  4KLW A;  3BJ7 A;  3GUX A;  4J3G A;  3S9M A;  2B5G A;  4MFQ A;  4ORF A;  5A27 A;  3JRU A;  1NSL A;  2R8V A;  2G3A A;  4LX9 A;  4ZY1 A;  2VL1 A;  2PJC A;  4OC3 A;  4UCN A;  4Y49 C;  4CPA A;  4NGT A;  1TKJ A;  4UF4 A;  1RXT A;  2HB6 A;  5CBM A;  1XFO A;  2V8G A;  2ZOG A;  4OIW A;  5LYD A;  1S5K A;  4R87 A;  2YNC A;  4F9U A;  4FAI A;  4YFJ A;  2YGW A;  5JPH A;  3HLP A;  4KUB A;  2R1I A;  3PBB A;  2Z3O A;  4P4I A;  2F7V A;  2O4H A;  3BI0 A;  3S6G A;  2DF5 A;  3KL9 A;  5ISV A;  3SI0 A;  2RC4 A;  4F9V A;  4QUS A;  3PBE A;  2G0B A;  3P2F A;  4ZY0 A;  4R9M A;  2ZEL A;  4AG7 A;  3B3S A;  2PRQ A;  2GRE A;  3RO0 A;  1KZF A;  1KWM A;  2PSW A;  1I21 A;  2KCW A;  1CX8 A;  5H86 A;  1I12 A;  3JVN A;  2ZOF A;  3D7H A;  2B3V A;  2AFU A;  2WUU A;  1PCA A;  5K8M A;  1IGB A;  3TE4 A;  2AJ6 A;  4UEE A;  4BBH A;  4PK2 A;  2C6G A;  1M4G A;  4MCP A;  4A95 A;  3GKR A;  3S9L A;  1CBX A;  2ZW4 A;  1FY7 A;  2J8M A;  2PJ6 A;  2OZG A;  3SHP A;  1MJA A;  3DSB A;  4P10 A;  2K5T A;  5AG4 A;  1DE4 C;  1F2P A;  4LQ6 A;  5G20 A;  1BLL E;  3BI1 A;  5LYL A;  3D67 A;  1MJB A;  2ZPA A;  4KSI A;  3D68 A;  2B3U A;  4Q7A A;  3QNV A;  2PJ9 A;  2V77 A;  4H6U A;  4P4F A;  5D29 A;  2EUI A;  3SXN A;  2H5M A;  2G9D A;  1VIX A;  2JLM A;  4WWV A;  4KUA A;  4RN7 A;  1R43 A;  1ELL P;  1P4N A;  1YGH A;  2OZH A;  2B4D B;  4JJX A;  2Q43 A;  1KUV A;  1ZG7 A;  3FB3 A;  3GB0 A;  4H6Z A;  3ISX A;  2PQ8 A;  4C2X A;  4PXC A;  3H5Z A;  4YGO A;  3TO7 A;  4H2K A;  2CF4 A;  3KQX A;  2Q7B A;  3TOB A;  4JZ0 A;  4A38 A;  5H84 A;  1ARM A;  1XIX A;  2P6E A;  2ZEG A;  4PK3 A;  1S7N A;  4UIB A;  3KGQ A;  1YX0 A;  5J8F A;  3PFO A;  4EFD A;  3PZJ A;  4NEX A;  1P0H A;  3TTH A;  2J8N A;  1CP6 A;  3B3T A;  3SJE A;  2PC1 A;  2PVW A;  4Z65 A;  4BIN A;  2Z3K A;  2AFX A;  2ZEE A;  2PJ8 A;  1CP7 A;  2GFQ A;  3CZX A;  2RB7 A;  4P44 A;  2BCO A;  2PJ3 A;  3EFA A;  2GE3 A;  4NJR A;  4AVA A;  5FVJ A;  1HDQ A;  2AE6 A;  4HNW B;  4R57 A;  4G1P A;  4B6Z A;  1S60 A;  3FEE A;  3H4Q A;  2ZED A;  4CGN A;  1MJ9 A;  2FE7 A;  1XEB A;  2BO9 A;  3H8F A;  1X10 A;  2CTB A;  4MCS A;  4RI1 A;  4YWY A;  2ZW5 A;  5THW A;  1X12 A;  1YVK A;  3B3W A;  4MFP A;  4E2A A;  1GYT A;  3V8I A;  4OKO A;  4R76 A;  2EVN A;  3VWE A;  2B4D A;  5HVH A;  4EME A;  4CAE A;  4HNX B;  3NH8 A;  4UCP A;  4FD6 A;  3VAR A;  1XMT A;  2IJZ A;  1BPN A;  4E8O A;  2PJ5 A;  1QSO A;  3HUV A;  1HEE A;  2EO8 A;  3PFE A;  5HH1 A;  1ZLH A;  1Z8L A;  4W9Y A;  4NFR A;  3FEC A;  3IWG A;  3BLN A;  4IF5 A;  1UWY A;  1ZG8 A;  3I3G A;  4B12 A;  4RS2 A;  2ZEN A;  5AG5 A;  1OZP A;  1YME A;  3RZA A;  4DYO A;  2QYV A;  2ODF A;  1Y7E A;  3RAM A;  3SI2 A;  4MCQ A;  3IWW A;  3G3S A;  1XRY A;  2WPW A;  3FRM A;  1UFH A;  2B4B A;  1L0C A;  2ZEH A;  3D7F A;  3MN8 A;  4F0X A;  4UWI A;  3R9E A;  2GU2 A;  3IJ3 A;  3NE7 A;  1ELM P;  4KOY A;  4KSA A;  1SQH A;  4P45 A;  4AG9 A;  2DPS A;  2V8D A;  3PRT A;  1PUA A;  1CJW A;  1YR0 A;  2DPT A;  3KKW A;  4P4E A;  1QST A;  4M6I A;  5IX3 A;  3F0A A;  2REE A;  1LFW A;  1B6B A;  3LWU A;  3NA6 A;  3DR6 A;  4MFL A;  1M1D A;  2C1C A;  4GXH A;  1M44 A;  2JEV A;  3B35 A;  3KR4 A;  4P4B A;  4PXE A;  4MMO A;  5LYF A;  1S7L A;  4X3R A;  4MHD A;  4XNH B;  5F48 A;  1J4J A;  3SJX A;  4C7H A;  4JWP A;  3R96 A;  3DR8 A;  3SJG A;  2VBQ A;  2GLJ A;  4DNC A;  3TOA A;  3EO4 A;  1IYL A;  1Z4R A;  3CXS A;  4MHP A;  5EBV A;  4II9 A;  1R57 A;  2FXF A;  4MHY A;  1NE9 A;  4HKF A;  4BD9 A;  3KI9 A;  1QSN A;  4C68 A;  3BHX A;  2JEW A;  5DS0 A;  2PJA A;  2R7H A;  5E96 A;  4ONU A;  4UEZ A;  2R98 A;  3B7I A;  4R8F A;  2Z3L A;  4OC0 A;  3UY5 A;  3I9S A;  4AXV A;  2CNM A;  2PCU A;  3LOD A;  4NCZ A;  1XBU A;  2CXA A;  1S7K A;  1NMT A;  4HPS A;  5F09 A;  5AGE A;  2AFO A;  4KOT A;  1DTD A;  4OAD A;  2ATR A;  3CXP A;  4L8A A;  4P6Y A;  4MHZ A;  3TO9 A;  3VWD A;  4CYO A;  3PEI A;  4CS0 B;  2O53 A;  2ARH A;  5IB0 A;  1VHO A;  2GIV A;  4JD6 A;  4NGM A;  3SJF A;  1IYK A;  3GLJ A;  3EC4 A;  1LRZ A;  2XEI A;  2Z10 A;  4MJ8 A;  3E0K A;  5EMI A;  2PJ0 A;  4MXU A;  1IB1 E;  2G3T A;  2ZEP A;  2IQ6 A;  4ZX9 A;  4E0A A;  3JTK A;  4XNH C;  4MCR A;  1F2O A;  4FD4 A;  3TFY A;  1R3N A;  1XJO A;  3W6S A;  4LUA A;  5I4M A;  4F8Z A;  1Z8X A;  2YNE A;  2Z0Z A;  3B3C A;  1F57 A;  8CPA A;  1HDU A;  4TWE A;  4B10 A;  1NSA A;  2RFH A;  5GCN A;  3K9T A;  4B13 A;  2ZW6 A;  1LAM A;  4OC2 A;  2QEC A;  1Y0Y A;  5K8P A;  3D7D A;  4H89 A;  5LRJ A;  2P6F A;  2P0W A;  3IGR A;  3N5F A;  4DUK A;  3D8P A;  2PVV A;  3WC5 A;  5F47 A;  1TIQ A;  2PJ7 A;  4NGN A;  4O23 A;  1GHE A;  1YK3 A;  2BUE A;  4OC5 A;  4A94 A;  3KR5 A;  1K4J A;  4DJL A;  4B11 A;  2PIY A;  4UFW A;  5LRG A;  2VXK A;  2WZN A;  3FED A;  4C2Y A;  5G22 A;  1PU9 A;  3FF3 A;  2HV2 A;  3PGP A;  1A2Z A;  5J1Q A;  3C26 A;  2OB0 A;  4KVM E;  4PV6 A;  3T9Y A;  2D4O A;  5JM6 A;  1YLO A;  2QIR A;  4P4D A;  1FT7 A;  1BOB A;  1M4L A;  1QSM A;  3FNC A;  4ZX8 A;  1LAN A;  1IIC A;  1AMP A;  5F49 A;  3WC6 A;  3FH4 A;  2Z3P A;  1Q7L A;  4MI4 A;  3EXN A;  4OAE A;  2BOA A;  1OBR A;  5G1Z A;  1U6M A;  4QC6 A;  4NSQ A;  1VGY A;  2Q04 A;  4K3N A;  4B5P B;  3VAT A;  5G21 A;  5JGF A;  1IID A;  1M4I A;  4JXQ A;  4UA3 A;  4OC4 A;  4NGP A;  4UEF A;  1TKF A;  4XPD B;  5D8N A;  2FVG A;  4CGP A;  1CM0 A;  7CPA A;  3LMS A;  1Z4E A;  3DDD A;  2PRB A;  2CNT A;  2FIW A;  3V38 A;  2NMT A;  4JYW A;  1M4D A;  3DLJ A;  3ZJ0 A;  2CY2 A;  2V8H A;  3QAH A;  4CGL A;  2HC9 A;  4M6H A;  1YVO A;  3NH4 A;  1LOK A;  1H8L A;  1XMB A;  4NGS A;  3FIX A;  4AVC A;  1VHS A;  3S6F A;  3F8K A;  3CXQ A;  4NJQ A;  4JLY A;  4PPZ A;  2XEJ A;  1JWQ A;  1VHE A;  2OH1 A;  3SI1 A;  3LD2 A;  3CPA A;  2V8V A;  5BWA B;  1IOF A;  2DEA A;  1CG2 A;  2EK8 A;  2FCK A;  3I1U A;  4PSW A;  1BAV A;  4EVY A;  4A39 A;  3GY9 A;  4ZBG A;  4FWU A;  4M85 A;  2VQY A;  4MY3 A;  2F8H A;  1YW4 A;  3B8G A;  4CGO A;  2VZY A;  3WT4 A;  5F46 A;  2HUZ A;  3MGD A;  2I3C A;  4I49 A;  4KOX A;  4KVO E;  5K8N A;  4OME A;  1CPS A;  1WWZ A;  4A2Z A;  3G8W A;  2HQY A;  3R95 A;  1YLE A;  3F5B A;  2AFM A;  3FVL A;  4F6A A;  1ZO0 A;  2Q4Z A;  2A4N A;  2C6C A;  4UIA A;  2J9A A;  3MRU A;  3BXM A;  4L89 A;  2AFZ A;  3CT9 A;  2Z11 A;  4UWJ A;  2YNC C;  4ZGY B;  1YW6 A;  5ELY A;  4A37 A;  4CYN A;  2I00 A;  4YU9 A;  2BSW A;  4RUH A;  4Q36 A;  1LAP A;  2PJB A;  3RBU A;  3T8W A;  4KOV A;  4R3L A;  4OID A;  4PXB A;  3TCV A;  1Q2D A;  2ABZ A;  4EWT A;  1TF8 A;  2PJ4 A;  2QML A;  4MFJ A;  2X7B A;  5HXD A;  5AG7 A;  3KAS A;  3FYN A;  1N71 A;  2PE3 A;  3NH5 A;  4NXY A; 
#chains in the Genus database with same CATH homology
 2ZEF A;  2POK A;  2WYR A;  4X8I A;  2QVP A;  3IFE A;  2XEG A;  4P4J A;  3PB6 X;  1YSJ A;  2EK9 A;  3K2K A;  2PJ1 A;  5HVG A;  3IO1 A;  2PJ2 A;  4WJB A;  1QQ9 A;  1TF9 A;  4MHN A;  4TNU A;  2OR4 A;  4FUU A;  1PYT B;  1JQG A;  2C6P A;  3S9N A;  1Z2L A;  3D7G A;  3H8E A;  6CPA A;  4X2T A;  4ONW A;  2PIZ A;  3IC1 A;  4IK2 A;  2OOT A;  3CDX A;  3PB9 X;  3PB4 X;  2CIJ A;  4PQA A;  2XEF A;  2ZEO A;  1Y0R A;  1AYE A;  1LCP A;  1RTQ A;  4ZI6 A;  4NGQ A;  1ZG9 A;  3PB8 X;  1BPM A;  2NYQ A;  4IAV A;  3PB7 X;  4PXD A;  1TXR A;  4OP4 A;  3KZW A;  3KHX A;  2JBK A;  2QJ8 A;  1FNO A;  4R7M A;  3KQZ A;  2NSM A;  5JH9 A;  1QMU A;  1Z5R A;  1CPX A;  4MRI A;  4IHM A;  5CPA A;  5LRK A;  2AFS A;  4OC1 A;  3IIB A;  2GLF A;  5LYI A;  5HVF A;  4NGR A;  3CPX A;  3FJU A;  3FX6 A;  4ZYQ A;  3VH9 A;  5IB9 A;  4FBE A;  3L2N A;  4GM5 A;  1TKH A;  3WC7 A;  3FMC A;  3WAB A;  5K8O A;  3B2Y A;  3TC8 A;  2CTC A;  3B3V A;  2Q51 A;  3KHZ A;  1ARL A;  3H8G A;  4ZY2 A;  2ZEM A;  4LQG A;  3TX8 A;  1IY7 A;  1EE3 P;  3D4U A;  3ISZ A;  3DGV A;  3IEH A;  4R6T A;  1ZLI A;  2EWB A;  2JBJ A;  3NFZ A;  2AFW A;  3V7Z A;  2ANP A;  3D66 A;  2IMO A;  3GUX A;  3S9M A;  3JRU A;  4ZY1 A;  2VL1 A;  2PJC A;  4OC3 A;  4CPA A;  4NGT A;  1TKJ A;  4UF4 A;  2HB6 A;  5CBM A;  1XFO A;  2V8G A;  2ZOG A;  4OIW A;  5LYD A;  4F9U A;  4FAI A;  3HLP A;  3PBB A;  4P4I A;  2F7V A;  2O4H A;  3BI0 A;  3KL9 A;  3SI0 A;  4F9V A;  3PBE A;  4ZY0 A;  2ZEL A;  3B3S A;  2PRQ A;  2GRE A;  1KWM A;  1CX8 A;  2ZOF A;  3D7H A;  2AFU A;  1PCA A;  5K8M A;  1IGB A;  4UEE A;  2C6G A;  4MCP A;  3S9L A;  1CBX A;  2PJ6 A;  4P10 A;  1DE4 C;  1F2P A;  1BLL E;  3BI1 A;  5LYL A;  3D67 A;  4KSI A;  3D68 A;  4Q7A A;  3QNV A;  2PJ9 A;  2V77 A;  4P4F A;  5D29 A;  2G9D A;  1VIX A;  4WWV A;  1R43 A;  1ELL P;  2Q43 A;  1ZG7 A;  3GB0 A;  3ISX A;  4PXC A;  4H2K A;  2CF4 A;  3KQX A;  4A38 A;  4JZ0 A;  1ARM A;  2ZEG A;  4UIB A;  3KGQ A;  3PFO A;  4EFD A;  1CP6 A;  3B3T A;  3SJE A;  2PVW A;  4Z65 A;  2AFX A;  2ZEE A;  2PJ8 A;  1CP7 A;  4P44 A;  2RB7 A;  2BCO A;  2PJ3 A;  4NJR A;  1HDQ A;  4G1P A;  4B6Z A;  3FEE A;  2ZED A;  2BO9 A;  3H8F A;  2CTB A;  4MCS A;  4YWY A;  5THW A;  3B3W A;  1GYT A;  4OKO A;  4R76 A;  5HVH A;  4EME A;  3NH8 A;  3VAR A;  2IJZ A;  1BPN A;  2PJ5 A;  3HUV A;  1HEE A;  3PFE A;  1ZLH A;  1Z8L A;  4W9Y A;  4NFR A;  3FEC A;  1UWY A;  1ZG8 A;  2ZEN A;  3RZA A;  1YME A;  4DYO A;  2QYV A;  1Y7E A;  3RAM A;  3SI2 A;  4MCQ A;  3IWW A;  1XRY A;  2ZEH A;  3D7F A;  3MN8 A;  2GU2 A;  3IJ3 A;  4P45 A;  1ELM P;  2V8D A;  3PRT A;  4P4E A;  4A37 A;  1LFW A;  3LWU A;  3NA6 A;  2C1C A;  4PXE A;  3B35 A;  3KR4 A;  4P4B A;  4MMO A;  5LYF A;  4X3R A;  3SJX A;  3SJG A;  2GLJ A;  4MHP A;  4MHY A;  4BD9 A;  3KI9 A;  3BHX A;  2JEW A;  5DS0 A;  2PJA A;  4UEZ A;  3B7I A;  4AXV A;  4R8F A;  4OC0 A;  2PCU A;  1XBU A;  5F09 A;  2AFO A;  1DTD A;  4P6Y A;  4MHZ A;  3PEI A;  2O53 A;  1VHO A;  3SJF A;  4NGM A;  3GLJ A;  2XEI A;  2PJ0 A;  4MXU A;  2ZEP A;  2IQ6 A;  4ZX9 A;  4MCR A;  1F2O A;  1R3N A;  1XJO A;  5I4M A;  4F8Z A;  3B3C A;  1F57 A;  8CPA A;  1HDU A;  4TWE A;  1NSA A;  2RFH A;  3K9T A;  1LAM A;  4OC2 A;  1Y0Y A;  5K8P A;  3D7D A;  5LRJ A;  4DUK A;  3N5F A;  2PVV A;  3WC5 A;  2PJ7 A;  4NGN A;  4O23 A;  4OC5 A;  4A94 A;  3KR5 A;  4DJL A;  2PIY A;  5LRG A;  2WZN A;  3FED A;  3FF3 A;  5J1Q A;  5JM6 A;  1YLO A;  4P4D A;  1FT7 A;  1M4L A;  4ZX8 A;  1LAN A;  1AMP A;  3WC6 A;  3FH4 A;  1Q7L A;  2BOA A;  1OBR A;  1VGY A;  4K3N A;  3VAT A;  5JGF A;  4OC4 A;  4NGP A;  4UEF A;  1TKF A;  5D8N A;  2FVG A;  7CPA A;  3LMS A;  3V38 A;  4JYW A;  3DLJ A;  2V8H A;  2HC9 A;  3NH4 A;  1LOK A;  1H8L A;  1XMB A;  4NGS A;  4NJQ A;  4PPZ A;  2XEJ A;  1VHE A;  3SI1 A;  3CPA A;  2V8V A;  2DEA A;  1CG2 A;  2EK8 A;  3I1U A;  1BAV A;  4A39 A;  4FWU A;  2F8H A;  1YW4 A;  3WT4 A;  2I3C A;  5K8N A;  4OME A;  1CPS A;  2AFM A;  3FVL A;  2Q4Z A;  2C6C A;  4UIA A;  2J9A A;  3MRU A;  3BXM A;  2AFZ A;  3CT9 A;  1YW6 A;  5ELY A;  4YU9 A;  4RUH A;  1LAP A;  2PJB A;  3RBU A;  3T8W A;  4OID A;  4PXB A;  2ABZ A;  4EWT A;  1TF8 A;  2PJ4 A;  5HXD A;  3KAS A;  2PE3 A;  3NH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...