4FAIA

Crystal structure of mitochondrial isoform of glutaminyl cyclase from drosophila melanogaster
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
302
Chain Sequence
ELVDIPKISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYMPGVEFLGATDSAVPCAMLLNLAQVLQEQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords CG5976, isoform B
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 103
structure length 302
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4faiA00
3NH5A 4P45A 4ZY1A 2OR4A 2PVVA 2WZNA 3KHZA 4OC3A 4IAVA 2ANPA 4W9YA 5LYFA 3BHXA 1XJOA 3KASA 3FVLA 4F9VA 3D67A 1H8LA 3S9NA 1TF8A 3IO1A 5HXDA 1CP7A 4ZX8A 2G9DA 4ZI6A 4EFDA 4ZY2A 1OBRA 1R3NA 3L2NA 3D7HA 4MXUA 3QNVA 1ZG7A 1Q7LA 3DGVA 5K8MA 1YSJA 3SJFA 4ZX9A 1ARMA 4X8IA 3FEEA 4MCSA 1UWYA 2QVPA 2O4HA 4OIWA 1BPMA 3IIBA 2CTCA 2XEIA 1Z5RA 4NGSA 5DS0A 3K2KA 4NJQA 2V8DA 4A94A 1IGBA 5I4MA 4JZ0A 3FH4A 3FMCA 2AFWA 4P4IA 4G1PA 4OC1A 4FAIA 3KQXA 2ZEGA 4FBEA 5LRGA 1VIXA 3HLPA 2CF4A 2AFSA 2AFUA 2ZEHA 3BI1A 2EK8A 2V8VA 4UEZA 3B3VA 5JM6A 3N5FA 3D66A 3TX8A 3I1UA 4WWVA 2WYRA 3B3CA 5LYIA 1CPXA 1LFWA 5LRJA 1CX8A 4PQAA 4OC5A 4ZYQA 4MHYA 1CP6A 1TXRA 1BPNA 2PJ7A 3PFOA 2XEFA 2CTBA 4DUKA 5LRKA 4Q7AA 4FWUA 5D29A 2HC9A 3B2YA 4B6ZA 4R7MA 4JYWA 3PRTA 3SI0A 4O23A 3V7ZA 4X3RA 3NA6A 3PB6X 4NJRA 2JBKA 1EE3P 3KGQA 4OC2A 1ARLA 2PJ8A 2C6PA 3KR5A 4MHPA 2FVGA 3PEIA 2PIYA 2AFXA 2EWBA 2GLFA 2PJ9A 2ZELA 3MRUA 4MHNA 2V8GA 4X2TA 1PCAA 1YMEA 3B3WA 2AFZA 2Q4ZA 3FJUA 1DTDA 4OC0A 2PJ6A 4P4EA 4UEFA 3FECA 1VHEA 1QMUA 3WC7A 3PB7X 5HVGA 2BCOA 2ZOFA 2J9AA 4NGQA 2C6GA 3KQZA 1LAMA 1ZG8A 2IJZA 2NYQA 2ZEEA 5IB9A 6CPAA 2V8HA 4EMEA 4A38A 3WC5A 4WJBA 2POKA 4YWYA 1Z2LA 4MMOA 3LWUA 5F09A 1CG2A 5LYDA 4NGNA 4P4BA 4MCPA 1YW4A 4NFRA 3RAMA 1Y7EA 3SI2A 2I3CA 2XEGA 2ABZA 3NH8A 4UEEA 3WC6A 2ZENA 3S9LA 4P4JA 1CBXA 4YU9A 1IY7A 1LANA 4ONWA 4PPZA 1CPSA 3PB9X 2C1CA 2F8HA 4BD9A 1TKJA 3NH4A 3CDXA 1NSAA 3SJGA 1HDQA 2ZEMA 1XBUA 4A39A 4MRIA 3PBBA 4PXCA 2ZEFA 4R8FA 4PXEA 2Q51A 2C6CA 3V38A 2JEWA 3CT9A 4R76A 3IWWA 1ZLIA 4NGMA 4OC4A 4H2KA 2GLJA 2DEAA 2PJ1A 3D68A 3GLJA 4IHMA 4DJLA 1QQ9A 1TKFA 4P4FA 2NSMA 1TF9A 1F57A 1VGYA 4FUUA 1BLLE 2Q43A 3BXMA 3S9MA 1ZLHA 3VATA 4CPAA 3PB4X 2O53A 3CPAA 4OMEA 2PVWA 2IMOA 2BO9A 5LYLA 4P6YA 1GYTA 4MCRA 1YLOA 4P10A 5CBMA 3RBUA 1YW6A 4OP4A 4MHZA 3H8EA 1M4LA 2OOTA 1HEEA 3DLJA 2ZOGA 2EK9A 3VH9A 5THWA 4LQGA 1R43A 5K8OA 2PJ4A 3KI9A 3D7FA 3FF3A 4ZY0A 2PJ2A 2ZEDA 3SJEA 1LAPA 1LOKA 3FEDA 3HUVA 5K8PA 4PXDA 2ZEPA 4F9UA 3PBEA 4GM5A 4A37A 5J1QA 5JGFA 1ELMP 3JRUA 3B7IA 1DE4C 2PJCA 1ELLP 3K9TA 2PIZA 1Z8LA 2PCUA 3WABA 3SI1A 1AMPA 3IEHA 4Z65A 4AXVA 3MN8A 3ISZA 1VHOA 3KHXA 3IC1A 1FT7A 4R6TA 4TWEA 1PYTB 4RUHA 4UIBA 1RTQA 3IFEA 2VL1A 2F7VA 5D8NA 4P44A 2IQ6A 2RFHA 4F8ZA 5CPAA 1FNOA 1LCPA 5HVHA 4NGTA 3H8FA 3SJXA 4EWTA 4TNUA 1BAVA 1KWMA 4K3NA 3D7DA 3H8GA 3PFEA 7CPAA 1TKHA 3GB0A 2QJ8A 2CIJA 2PJBA 1XMBA 2RB7A 3NFZA 1XFOA 1XRYA 4DYOA 1Y0RA 3BI0A 4UIAA 2PJ0A 2BOAA 5ELYA 4NGPA 8CPAA 1F2OA 3KR4A 1JQGA 2AFOA 3CPXA 3TC8A 2V77A 3D4UA 3KZWA 3PB8X 5K8NA 2XEJA 2GU2A 4NGRA 3RZAA 2PJ5A 4PXBA 3WT4A 3B3SA 3T8WA 3D7GA 4IK2A 3IJ3A 3FX6A 2PRQA 5JH9A 3LMSA 3GUXA 2PJ3A 4OIDA 3B35A 4OKOA 2JBJA 3KL9A 4P4DA 2QYVA 2AFMA 2PJAA 1ZG9A 3ISXA 1Y0YA 1F2PA 1HDUA 4UF4A 2GREA 1AYEA 5HVFA 2ZEOA 4KSIA 2HB6A 2PE3A 3B3TA 3VARA 4MCQA
chains in the Genus database with same CATH superfamily
3NH5A 2Q44A 4P45A 4B12A 1Z8TA 2Z3MA 4CYOA 4ZY1A 4CAEA 2OR4A 2PVVA 2WZNA 3KHZA 4CYQA 4KUAA 4OC3A 5KTDA 2OZUA 2B4DB 2Z3NA 4IAVA 2ANPA 4W9YA 4QC6A 2JLMA 3S6HA 1QSMA 4MHDA 2G3AA 5LYFA 3C26A 3R95A 3BHXA 1XJOA 3KASA 3FVLA 2Q7SA 4F9VA 4CGNA 3D67A 1I1DA 1H8LA 3IWEA 3S9NA 2D4PA 2YNCA 3SXOA 1TF8A 3G3SA 3IO1A 2Q0YA 5HXDA 5J8FA 1ON0A 3VWDA 1CP7A 1BOBA 4ZX8A 3R9FA 3TO7A 2G9DA 2PDOA 4ZI6A 4EFDA 3EFAA 4ZY2A 1AUGA 1OBRA 2FIAA 1R3NA 3L2NA 3D7HA 2YNDA 1S7LA 4MXUA 3QNVA 4R3LA 1Q2YA 1ZG7A 1Q7LA 4CS0B 3TE4A 1QSTA 3DGVA 2BUEA 5K8MA 1YSJA 2G3TA 2PSWA 3SJFA 4PK3A 4ZX9A 1ARMA 5AG6A 3TOAA 4OAEA 3FEEA 4MCSA 4X8IA 1UWYA 2QVPA 2VBQA 2O4HA 1XE4A 2IL4A 2P6EA 4OIWA 1BPMA 3IIBA 4ONUA 2CTCA 4K30A 1V0CA 2GFQA 2XEIA 1Z5RA 4NGSA 5DS0A 3K2KA 3T9YA 4NJQA 2V8DA 4KOTA 2DXQA 4A94A 1IGBA 5J8CA 5I4MA 3RYOA 3I3GA 4KOWA 2NMTA 4JZ0A 3FH4A 2Z3PA 4RS2A 4CRYB 4KSFA 3FMCA 4AG7A 2AFWA 2B4BA 2BSWA 4P4IA 1S7KA 4G1PA 4M85A 5G21A 4OC1A 4FAIA 3QAYA 4RI1A 4B13A 3IGRA 5G20A 5HMNA 4MY0A 3KQXA 2ZEGA 1I12A 4FBEA 2ATRA 5LRGA 1QSRA 4HNXB 4CAWA 1VIXA 2VZZA 3HLPA 2CF4A 4QBJA 4HKFA 4BBHA 4A31A 1VHSA 1CM0A 2AFSA 2FT0A 2AFUA 2YNEA 1YR0A 1S3ZA 2ZEHA 4U9YA 2B5GA 4RN7A 3BI1A 2EK8A 2V8VA 4UEZA 3B3VA 5JM6A 3N5FA 2Q04A 1IOFA 2Q4YA 3D3SA 3S6FA 4CAVA 1FY7A 4R3KA 1BO4A 2A4NA 3D66A 3TX8A 3I1UA 1MJAA 2ZW6A 4Q38A 2WYRA 2GE3A 3B3CA 4WWVA 5LYIA 1CPXA 1Q2DA 4M3SA 3RNZA 4AVAA 1LFWA 5LRJA 3PZJA 1CX8A 5AG7A 3FBUA 4OC5A 4PQAA 3R9GA 4ZYQA 4MHYA 1CP6A 4UCMA 3CZXA 2Q4VA 1TXRA 4Y49C 4MFKA 1M4GA 4M6IA 1BPNA 3GYAA 2OZGA 4B10A 2Z3KA 2PJ7A 3PFOA 4UCPA 4C7IA 4MFPA 2XEFA 1NSLA 2CTBA 1N71A 4CGLA 4NF1A 4DUKA 4B5PB 5LRKA 4KORA 4Q7AA 2H5MA 4NEXA 1IICA 4FWUA 4MFZA 4IUSA 5D29A 4XPLA 4C2ZA 4FD4A 2HC9A 4LUAA 3B2YA 4A32A 4B6ZA 2Z0ZA 3JUWA 4I49A 4U9ZA 1YVOA 4R7MA 4GXHA 4JYWA 3PRTA 1S7FA 4O23A 3SI0A 4QUSA 3V7ZA 3PP9A 4X3RA 2I79A 3NA6A 3PB6X 4PSWA 1UFHA 2ZXVA 4L8AA 4DNCA 4NJRA 2JBKA 1EE3P 4MBUA 3KGQA 1L0CA 4E2AA 3LD2A 4OC2A 4M6HA 4LX9A 2AJ6A 1ARLA 2PJ8A 5BWAB 2CNMA 1NMTA 1YLEA 1Y9KA 2C6PA 2EO8A 2QIRA 1PU9A 2FVGA 3KR5A 2PIYA 3PEIA 2CY2A 2KCWA 2JEVA 5F47A 3R9EA 3TT2A 5KTAA 1Q2CA 2AFXA 2EWBA 3SHPA 2DPTA 2GLFA 2PJ9A 2ZELA 4AVCA 1OZPA 2AE6A 3TTHA 3MRUA 4MHNA 2V8GA 4H6UA 5AG5A 1XIXA 4R57A 4X2TA 1PCAA 5C88A 4CGMA 2CXAA 1YMEA 3B3WA 2AFZA 2Q4ZA 2ZW4A 4GS4A 3FJUA 1DTDA 4OC0A 2PJ6A 2QMLA 1IU8A 4P4EA 4UEFA 3DSBA 2RC4A 2FE7A 2B3VA 4KVXA 1S7NA 1I21A 2FS5A 2J8NA 4H89A 2R98A 4E8OA 2FIWA 3F0AA 3DNSA 2HUZA 3BJ8A 3FECA 2YGWA 1IYKA 1VHEA 1QMUA 4B5OA 4NSQA 3WC7A 3PB7X 1NE9A 5HVGA 2VZYA 2BCOA 2ZOFA 3EY5A 2J9AA 4NGQA 1MJ9A 2C6GA 3H4QA 1LAMA 3KQZA 1ZG8A 2IJZA 2NYQA 2ZW7A 1IOIA 5EBVA 3LACA 2ZEEA 1X12A 1Z4EA 6CPAA 5IB9A 2V8HA 4EMEA 4UBRA 4A38A 3WC5A 4UFXA 4WJBA 2POKA 2Z10A 1Z2LA 1WWZA 3IU2A 4MMOA 4YWYA 3LWUA 3WR7A 3EC4A 4U5YA 3QB8A 5F09A 1CG2A 5LYDA 2CNTA 4NGNA 4P4BA 4YGOA 4JXQA 4MCPA 4B11A 1YW4A 1KUYA 4NFRA 3RAMA 1Y7EA 4PV6A 3SI2A 2B4DA 2I3CA 4OADA 2XEGA 2ABZA 3NH8A 4UEEA 2Z11A 2FL4A 3WC6A 3P2FA 2ZENA 3S9LA 4P4JA 1CBXA 2DPSA 4JXRA 4YU9A 3V8IA 4M6GA 3CXPA 1IY7A 4FD6A 3ZJ0A 1RO5A 4EVYA 5A28A 1LANA 2JDCA 4F6AA 1GHEA 4ONWA 1XOVA 4J3GA 4PPZA 1CPSA 4BMHA 3TO6A 1S5KA 3PB9X 5G1ZA 2I00A 2Q7BA 2C1CA 5DWMA 2F8HA 4UFVA 1WK4A 4BD9A 1U6MA 2Y0MA 1TKJA 3MGDA 3BLNA 2BL1A 3IU1A 3NH4A 5AGEA 5AG4A 3CDXA 1NSAA 3SJGA 1HDQA 4OLLA 2ZEMA 1XBUA 3S6GA 4JLYA 4A39A 2OU2A 4MRIA 4AVBA 4R87A 1Z8XA 3PBBA 4H6ZA 1R57A 4PXCA 2ZEFA 4R8FA 4PXEA 2GIVA 2Q51A 4CGOA 3B8GA 4FD5A 2C6CA 4KLWA 3D2PA 3V38A 4IF5A 4UFWA 2JEWA 2Z3OA 3CT9A 4C7HA 4R76A 3IWWA 1ZLIA 4NGMA 4OC4A 4MHPA 2QECA 2JDDA 3UY5A 4H2KA 1RXTA 2YNCC 4KSAA 4AG9A 3CXSA 2GLJA 3I9SA 1KUVA 2DEAA 4XPDC 2PJ1A 2HV2A 2D4OA 3D68A 5JQ4A 5F46A 3EO4A 3GLJA 3BJ7A 3NE7A 4IHMA 4PK2A 1QQ9A 1TKFA 4NXYA 1P4NA 2NSMA 2ODFA 2R1IA 4P4FA 5F48A 3TCVA 3GIUA 1TF9A 1F57A 1XF8A 2REEA 1VGYA 2REFA 5IB0A 3GY9A 1ZO0A 4FUUA 1BLLE 2Q43A 3BXMA 4MFQA 3F8KA 3S9MA 3TOBA 3W91A 4II9A 1ZLHA 4QVTA 3DR8A 1S60A 3QAHA 1X10A 2J8RA 4C68A 3VATA 3JTKA 1M1DA 1VKCA 1XMTA 4Y49B 2B3UA 4CPAA 3PB4X 2O53A 5CNPA 4MJ8A 1K4JA 3CPAA 2P6FA 4OMEA 3F5BA 3FB3A 2F5IA 2PVWA 5IX3A 3ZZIA 2IMOA 2BO9A 4DJLA 4CAXA 2WUUA 5LYLA 1M4IA 4KOUA 4P6YA 1GYTA 4ZGYB 2FXFA 4MCRA 1YLOA 1KZFA 4P10A 4A33A 3RBUA 4MFLA 2ZW5A 1YW6A 5CBMA 5ISVA 5DWNA 4CRZB 4OP4A 4MHZA 3H8EA 1M4LA 2HQYA 2OZHA 2OOTA 1HEEA 2PQ8A 3DLJA 3P2HA 2ZOGA 4XNHC 4A2ZA 4CYPA 2EK9A 1TIQA 3VH9A 1PUAA 3N7ZA 5THWA 3VWEA 4LQGA 1R43A 1YGHA 3SXNA 2PJ4A 5K8OA 3IWGA 3KI9A 3D7FA 5KTCA 3FF3A 3FYNA 4ZY0A 2PJ2A 2ZEDA 3SJEA 1LAPA 1LOKA 3FEDA 3GKRA 3HUVA 4JD6A 5K8PA 4PXDA 4Q36A 5IV0A 2ZEPA 4F9UA 3PBEA 4GM5A 4A37A 3W6XA 5J1QA 5JGFA 2FSRA 3EXNA 4PSXA 4R9MA 4MFJA 1ELMP 4L89A 3JRUA 2PRBA 1DE4C 3B7IA 4FD7A 3W6SA 4B14A 2PJCA 4KVOE 1ELLP 3TFYA 5EMIA 4KS9A 3FXTA 3K9TA 2PIZA 2EVNA 4HNWB 1Z8LA 2PCUA 3PGPA 2O28A 3T90A 3WABA 3SI1A 5C82A 5HH1A 1MJBA 3FNCA 2EBJA 1AMPA 4LQ6A 3IEHA 3DDDA 4JJXA 3TO9A 1SQHA 4Z65A 4AB7A 4XNHB 4CYNA 4AXVA 1Y7RA 2OB0A 4MI4A 2ZPAA 2B5GB 4CGPA 5JPHA 4QB9A 3MN8A 1J4JA 3ISZA 1VHOA 4A95A 3KHXA 1Z8WA 3IC1A 1FT7A 4R6TA 4UA3A 4TWEA 1B87A 1PYTB 4CAFA 3OWCA 5H86A 4ZBGA 4RUHA 1LRZA 2VEZA 1RTQA 3IFEA 4UIBA 2VL1A 4KOYA 4X5KA 1QSOA 2F7VA 5D8NA 3LODA 4P44A 1M44A 2PR8A 2IQ6A 2RFHA 1YVKA 4KUBA 1Z9UA 1FNOA 2Z3LA 1LCPA 5CPAA 4F8ZA 1YREA 5HVHA 4NGTA 3H8FA 4UWIA 3SJXA 2VI7A 4UCNA 2OH1A 4EWTA 4TNUA 5I0CA 1BAVA 1IYLA 1KWMA 4HNYB 4K3NA 4YRHA 3D7DA 3S6KA 1KUXA 3H8GA 3PFEA 4KZTA 3DR6A 7CPAA 4ORFA 1TKHA 2ARHA 1CJWA 3GB0A 3JVNA 2QJ8A 2CIJA 1IIDA 2PJBA 4JWPA 2X7BA 1XMBA 1Z4RA 2RB7A 3NFZA 1XFOA 2WPXA 1XRYA 4DYOA 4E0AA 1QSNA 1Y0RA 4KLVA 1JWQA 2DF5A 1M4DA 3BI0A 3R96A 4UIAA 2BEIA 1A2ZA 2CNSA 2GANA 2PJ0A 2J8MA 2BOAA 5ELYA 2P0WA 4NGPA 8CPAA 4MY3A 2VXKA 2G0BA 1F2OA 4F0YA 5FVJA 3KR4A 3E0KA 1JQGA 2AFOA 2P6GA 3CPXA 3TC8A 2V77A 3D4UA 4C2XA 3KZWA 3PB8X 4KOXA 2PC1A 2XEJA 5K8NA 2GU2A 4NGRA 3R1KA 3RZAA 4F0XA 1P0HA 2PJ5A 4PXBA 3WT4A 3B3SA 3T8WA 4BINA 1MK4A 4KOVA 1XEBA 3D7GA 3IJ3A 4IK2A 1B6BA 3FX6A 2PRQA 5JH9A 3LMSA 3K9UA 3GUXA 2PJ3A 4OIDA 4UWJA 4C2YA 2FCKA 4A30A 5F49A 3B35A 4HPSA 2JBJA 4OKOA 2WSAA 3KL9A 4P4DA 3KKWA 2PR1A 2QYVA 5EC4A 1Y9WA 2AFMA 1YQEA 4XPKA 3D8PA 2PJAA 1YX0A 1ZG9A 3FRMA 1Y0YA 3FIXA 1F2PA 3ISXA 4NCZA 3G8WA 4XPDB 2K5TA 1IB1E 2VQYA 5GCNA 3RO0A 4KOSA 1HDUA 2C27A 4KVME 5H84A 2B58A 3H5ZA 4UF4A 2GREA 4B5PA 3D2MA 1AYEA 5HVFA 2R8VA 3A9LA 1YK3A 2ZEOA 4KSIA 5G22A 2R7HA 5E96A 2HB6A 2WPWA 3NE8A 2PE3A 5A27A 2EUIA 4YFJA 3CXQA 3B3TA 3VARA 4MCQA
chains in the Genus database with same CATH topology
3NH5A 4P45A 4ZY1A 2OR4A 2PVVA 2WZNA 3KHZA 4OC3A 4IAVA 2ANPA 4W9YA 5LYFA 3BHXA 1XJOA 3KASA 3FVLA 4F9VA 3D67A 1H8LA 3S9NA 1TF8A 3IO1A 5HXDA 1CP7A 4ZX8A 2G9DA 4ZI6A 4EFDA 4ZY2A 1OBRA 1R3NA 3L2NA 3D7HA 4MXUA 3QNVA 1ZG7A 1Q7LA 3DGVA 5K8MA 1YSJA 3SJFA 4ZX9A 1ARMA 4X8IA 3FEEA 4MCSA 1UWYA 2QVPA 2O4HA 4OIWA 1BPMA 3IIBA 2CTCA 2XEIA 1Z5RA 4NGSA 5DS0A 3K2KA 4NJQA 2V8DA 4A94A 1IGBA 5I4MA 4JZ0A 3FH4A 3FMCA 2AFWA 4P4IA 4G1PA 4OC1A 4FAIA 3KQXA 2ZEGA 4FBEA 5LRGA 1VIXA 3HLPA 2CF4A 2AFSA 2AFUA 2ZEHA 3BI1A 2EK8A 2V8VA 4UEZA 3B3VA 5JM6A 3N5FA 3D66A 3TX8A 3I1UA 4WWVA 2WYRA 3B3CA 5LYIA 1CPXA 1LFWA 5LRJA 1CX8A 4PQAA 4OC5A 4ZYQA 4MHYA 1CP6A 1TXRA 1BPNA 2PJ7A 3PFOA 2XEFA 2CTBA 4DUKA 5LRKA 4Q7AA 4FWUA 5D29A 2HC9A 3B2YA 4B6ZA 4R7MA 4JYWA 3PRTA 3SI0A 4O23A 3V7ZA 4X3RA 3NA6A 3PB6X 4NJRA 2JBKA 1EE3P 3KGQA 4OC2A 1ARLA 2PJ8A 2C6PA 3KR5A 4MHPA 2FVGA 3PEIA 2PIYA 2AFXA 2EWBA 2GLFA 2PJ9A 2ZELA 3MRUA 4MHNA 2V8GA 4X2TA 1PCAA 1YMEA 3B3WA 2AFZA 2Q4ZA 3FJUA 1DTDA 4OC0A 2PJ6A 4P4EA 4UEFA 3FECA 1VHEA 1QMUA 3WC7A 3PB7X 5HVGA 2BCOA 2ZOFA 2J9AA 4NGQA 2C6GA 3KQZA 1LAMA 1ZG8A 2IJZA 2NYQA 2ZEEA 5IB9A 6CPAA 2V8HA 4EMEA 4A38A 3WC5A 4WJBA 2POKA 4YWYA 1Z2LA 4MMOA 3LWUA 5F09A 1CG2A 5LYDA 4NGNA 4P4BA 4MCPA 1YW4A 4NFRA 3RAMA 1Y7EA 3SI2A 2I3CA 2XEGA 2ABZA 3NH8A 4UEEA 3WC6A 2ZENA 3S9LA 4P4JA 1CBXA 4YU9A 1IY7A 1LANA 4ONWA 4PPZA 1CPSA 3PB9X 2C1CA 2F8HA 4BD9A 1TKJA 3NH4A 3CDXA 1NSAA 3SJGA 1HDQA 2ZEMA 1XBUA 4A39A 4MRIA 3PBBA 4PXCA 2ZEFA 4R8FA 4PXEA 2Q51A 2C6CA 3V38A 2JEWA 3CT9A 4R76A 3IWWA 1ZLIA 4NGMA 4OC4A 4H2KA 2GLJA 2DEAA 2PJ1A 3D68A 3GLJA 4IHMA 4DJLA 1QQ9A 1TKFA 4P4FA 2NSMA 1TF9A 1F57A 1VGYA 4FUUA 1BLLE 2Q43A 3BXMA 3S9MA 1ZLHA 3VATA 4CPAA 3PB4X 2O53A 3CPAA 4OMEA 2PVWA 2IMOA 2BO9A 5LYLA 4P6YA 1GYTA 4MCRA 1YLOA 4P10A 5CBMA 3RBUA 1YW6A 4OP4A 4MHZA 3H8EA 1M4LA 2OOTA 1HEEA 3DLJA 2ZOGA 2EK9A 3VH9A 5THWA 4LQGA 1R43A 5K8OA 2PJ4A 3KI9A 3D7FA 3FF3A 4ZY0A 2PJ2A 2ZEDA 3SJEA 1LAPA 1LOKA 3FEDA 3HUVA 5K8PA 4PXDA 2ZEPA 4F9UA 3PBEA 4GM5A 4A37A 5J1QA 5JGFA 1ELMP 3JRUA 3B7IA 1DE4C 2PJCA 1ELLP 3K9TA 2PIZA 1Z8LA 2PCUA 3WABA 3SI1A 1AMPA 3IEHA 4Z65A 4AXVA 3MN8A 3ISZA 1VHOA 3KHXA 3IC1A 1FT7A 4R6TA 4TWEA 1PYTB 4RUHA 4UIBA 1RTQA 3IFEA 2VL1A 2F7VA 5D8NA 4P44A 2IQ6A 2RFHA 4F8ZA 5CPAA 1FNOA 1LCPA 5HVHA 4NGTA 3H8FA 3SJXA 4EWTA 4TNUA 1BAVA 1KWMA 4K3NA 3D7DA 3H8GA 3PFEA 7CPAA 1TKHA 3GB0A 2QJ8A 2CIJA 2PJBA 1XMBA 2RB7A 3NFZA 1XFOA 1XRYA 4DYOA 1Y0RA 3BI0A 4UIAA 2PJ0A 2BOAA 5ELYA 4NGPA 8CPAA 1F2OA 3KR4A 1JQGA 2AFOA 3CPXA 3TC8A 2V77A 3D4UA 3KZWA 3PB8X 5K8NA 2XEJA 2GU2A 4NGRA 3RZAA 2PJ5A 4PXBA 3WT4A 3B3SA 3T8WA 3D7GA 4IK2A 3IJ3A 3FX6A 2PRQA 5JH9A 3LMSA 3GUXA 2PJ3A 4OIDA 3B35A 4OKOA 2JBJA 3KL9A 4P4DA 2QYVA 2AFMA 2PJAA 1ZG9A 3ISXA 1Y0YA 1F2PA 1HDUA 4UF4A 2GREA 1AYEA 5HVFA 2ZEOA 4KSIA 2HB6A 2PE3A 3B3TA 3VARA 4MCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH5 A;  4P45 A;  4ZY1 A;  2OR4 A;  2PVV A;  2WZN A;  3KHZ A;  4OC3 A;  4IAV A;  2ANP A;  4W9Y A;  5LYF A;  3BHX A;  1XJO A;  3KAS A;  3FVL A;  4F9V A;  3D67 A;  1H8L A;  3S9N A;  1TF8 A;  3IO1 A;  5HXD A;  1CP7 A;  4ZX8 A;  2G9D A;  4ZI6 A;  4EFD A;  4ZY2 A;  1OBR A;  1R3N A;  3L2N A;  3D7H A;  4MXU A;  3QNV A;  1ZG7 A;  1Q7L A;  3DGV A;  5K8M A;  1YSJ A;  3SJF A;  4ZX9 A;  1ARM A;  4X8I A;  3FEE A;  4MCS A;  1UWY A;  2QVP A;  2O4H A;  4OIW A;  1BPM A;  3IIB A;  2CTC A;  2XEI A;  1Z5R A;  4NGS A;  5DS0 A;  3K2K A;  4NJQ A;  2V8D A;  4A94 A;  1IGB A;  5I4M A;  4JZ0 A;  3FH4 A;  3FMC A;  2AFW A;  4P4I A;  4G1P A;  4OC1 A;  4FAI A;  3KQX A;  2ZEG A;  4FBE A;  5LRG A;  1VIX A;  3HLP A;  2CF4 A;  2AFS A;  2AFU A;  2ZEH A;  3BI1 A;  2EK8 A;  2V8V A;  4UEZ A;  3B3V A;  5JM6 A;  3N5F A;  3D66 A;  3TX8 A;  3I1U A;  4WWV A;  2WYR A;  3B3C A;  5LYI A;  1CPX A;  1LFW A;  5LRJ A;  1CX8 A;  4PQA A;  4OC5 A;  4ZYQ A;  4MHY A;  1CP6 A;  1TXR A;  1BPN A;  2PJ7 A;  3PFO A;  2XEF A;  2CTB A;  4DUK A;  5LRK A;  4Q7A A;  4FWU A;  5D29 A;  2HC9 A;  3B2Y A;  4B6Z A;  4R7M A;  4JYW A;  3PRT A;  3SI0 A;  4O23 A;  3V7Z A;  4X3R A;  3NA6 A;  3PB6 X;  4NJR A;  2JBK A;  1EE3 P;  3KGQ A;  4OC2 A;  1ARL A;  2PJ8 A;  2C6P A;  3KR5 A;  4MHP A;  2FVG A;  3PEI A;  2PIY A;  2AFX A;  2EWB A;  2GLF A;  2PJ9 A;  2ZEL A;  3MRU A;  4MHN A;  2V8G A;  4X2T A;  1PCA A;  1YME A;  3B3W A;  2AFZ A;  2Q4Z A;  3FJU A;  1DTD A;  4OC0 A;  2PJ6 A;  4P4E A;  4UEF A;  3FEC A;  1VHE A;  1QMU A;  3WC7 A;  3PB7 X;  5HVG A;  2BCO A;  2ZOF A;  2J9A A;  4NGQ A;  2C6G A;  3KQZ A;  1LAM A;  1ZG8 A;  2IJZ A;  2NYQ A;  2ZEE A;  5IB9 A;  6CPA A;  2V8H A;  4EME A;  4A38 A;  3WC5 A;  4WJB A;  2POK A;  4YWY A;  1Z2L A;  4MMO A;  3LWU A;  5F09 A;  1CG2 A;  5LYD A;  4NGN A;  4P4B A;  4MCP A;  1YW4 A;  4NFR A;  3RAM A;  1Y7E A;  3SI2 A;  2I3C A;  2XEG A;  2ABZ A;  3NH8 A;  4UEE A;  3WC6 A;  2ZEN A;  3S9L A;  4P4J A;  1CBX A;  4YU9 A;  1IY7 A;  1LAN A;  4ONW A;  4PPZ A;  1CPS A;  3PB9 X;  2C1C A;  2F8H A;  4BD9 A;  1TKJ A;  3NH4 A;  3CDX A;  1NSA A;  3SJG A;  1HDQ A;  2ZEM A;  1XBU A;  4A39 A;  4MRI A;  3PBB A;  4PXC A;  2ZEF A;  4R8F A;  4PXE A;  2Q51 A;  2C6C A;  3V38 A;  2JEW A;  3CT9 A;  4R76 A;  3IWW A;  1ZLI A;  4NGM A;  4OC4 A;  4H2K A;  2GLJ A;  2DEA A;  2PJ1 A;  3D68 A;  3GLJ A;  4IHM A;  4DJL A;  1QQ9 A;  1TKF A;  4P4F A;  2NSM A;  1TF9 A;  1F57 A;  1VGY A;  4FUU A;  1BLL E;  2Q43 A;  3BXM A;  3S9M A;  1ZLH A;  3VAT A;  4CPA A;  3PB4 X;  2O53 A;  3CPA A;  4OME A;  2PVW A;  2IMO A;  2BO9 A;  5LYL A;  4P6Y A;  1GYT A;  4MCR A;  1YLO A;  4P10 A;  5CBM A;  3RBU A;  1YW6 A;  4OP4 A;  4MHZ A;  3H8E A;  1M4L A;  2OOT A;  1HEE A;  3DLJ A;  2ZOG A;  2EK9 A;  3VH9 A;  5THW A;  4LQG A;  1R43 A;  5K8O A;  2PJ4 A;  3KI9 A;  3D7F A;  3FF3 A;  4ZY0 A;  2PJ2 A;  2ZED A;  3SJE A;  1LAP A;  1LOK A;  3FED A;  3HUV A;  5K8P A;  4PXD A;  2ZEP A;  4F9U A;  3PBE A;  4GM5 A;  4A37 A;  5J1Q A;  5JGF A;  1ELM P;  3JRU A;  3B7I A;  1DE4 C;  2PJC A;  1ELL P;  3K9T A;  2PIZ A;  1Z8L A;  2PCU A;  3WAB A;  3SI1 A;  1AMP A;  3IEH A;  4Z65 A;  4AXV A;  3MN8 A;  3ISZ A;  1VHO A;  3KHX A;  3IC1 A;  1FT7 A;  4R6T A;  4TWE A;  1PYT B;  4RUH A;  4UIB A;  1RTQ A;  3IFE A;  2VL1 A;  2F7V A;  5D8N A;  4P44 A;  2IQ6 A;  2RFH A;  4F8Z A;  5CPA A;  1FNO A;  1LCP A;  5HVH A;  4NGT A;  3H8F A;  3SJX A;  4EWT A;  4TNU A;  1BAV A;  1KWM A;  4K3N A;  3D7D A;  3H8G A;  3PFE A;  7CPA A;  1TKH A;  3GB0 A;  2QJ8 A;  2CIJ A;  2PJB A;  1XMB A;  2RB7 A;  3NFZ A;  1XFO A;  1XRY A;  4DYO A;  1Y0R A;  3BI0 A;  4UIA A;  2PJ0 A;  2BOA A;  5ELY A;  4NGP A;  8CPA A;  1F2O A;  3KR4 A;  1JQG A;  2AFO A;  3CPX A;  3TC8 A;  2V77 A;  3D4U A;  3KZW A;  3PB8 X;  5K8N A;  2XEJ A;  2GU2 A;  4NGR A;  3RZA A;  2PJ5 A;  4PXB A;  3WT4 A;  3B3S A;  3T8W A;  3D7G A;  4IK2 A;  3IJ3 A;  3FX6 A;  2PRQ A;  5JH9 A;  3LMS A;  3GUX A;  2PJ3 A;  4OID A;  3B35 A;  4OKO A;  2JBJ A;  3KL9 A;  4P4D A;  2QYV A;  2AFM A;  2PJA A;  1ZG9 A;  3ISX A;  1Y0Y A;  1F2P A;  1HDU A;  4UF4 A;  2GRE A;  1AYE A;  5HVF A;  2ZEO A;  4KSI A;  2HB6 A;  2PE3 A;  3B3T A;  3VAR A;  4MCQ A; 
#chains in the Genus database with same CATH topology
 3NH5 A;  2Q44 A;  4P45 A;  4B12 A;  1Z8T A;  2Z3M A;  4CYO A;  4ZY1 A;  4CAE A;  2OR4 A;  2PVV A;  2WZN A;  3KHZ A;  4CYQ A;  4KUA A;  4OC3 A;  5KTD A;  2OZU A;  2B4D B;  2Z3N A;  4IAV A;  2ANP A;  4W9Y A;  4QC6 A;  2JLM A;  3S6H A;  1QSM A;  4MHD A;  2G3A A;  5LYF A;  3C26 A;  3R95 A;  3BHX A;  1XJO A;  3KAS A;  3FVL A;  2Q7S A;  4F9V A;  4CGN A;  3D67 A;  1I1D A;  1H8L A;  3IWE A;  3S9N A;  2D4P A;  2YNC A;  3SXO A;  1TF8 A;  3G3S A;  3IO1 A;  2Q0Y A;  5HXD A;  5J8F A;  1ON0 A;  3VWD A;  1CP7 A;  1BOB A;  4ZX8 A;  3R9F A;  3TO7 A;  2G9D A;  2PDO A;  4ZI6 A;  4EFD A;  3EFA A;  4ZY2 A;  1AUG A;  1OBR A;  2FIA A;  1R3N A;  3L2N A;  3D7H A;  2YND A;  1S7L A;  4MXU A;  3QNV A;  4R3L A;  1Q2Y A;  1ZG7 A;  1Q7L A;  4CS0 B;  3TE4 A;  1QST A;  3DGV A;  2BUE A;  5K8M A;  1YSJ A;  2G3T A;  2PSW A;  3SJF A;  4PK3 A;  4ZX9 A;  1ARM A;  5AG6 A;  3TOA A;  4OAE A;  3FEE A;  4MCS A;  4X8I A;  1UWY A;  2QVP A;  2VBQ A;  2O4H A;  1XE4 A;  2IL4 A;  2P6E A;  4OIW A;  1BPM A;  3IIB A;  4ONU A;  2CTC A;  4K30 A;  1V0C A;  2GFQ A;  2XEI A;  1Z5R A;  4NGS A;  5DS0 A;  3K2K A;  3T9Y A;  4NJQ A;  2V8D A;  4KOT A;  2DXQ A;  4A94 A;  1IGB A;  5J8C A;  5I4M A;  3RYO A;  3I3G A;  4KOW A;  2NMT A;  4JZ0 A;  3FH4 A;  2Z3P A;  4RS2 A;  4CRY B;  4KSF A;  3FMC A;  4AG7 A;  2AFW A;  2B4B A;  2BSW A;  4P4I A;  1S7K A;  4G1P A;  4M85 A;  5G21 A;  4OC1 A;  4FAI A;  3QAY A;  4RI1 A;  4B13 A;  3IGR A;  5G20 A;  5HMN A;  4MY0 A;  3KQX A;  2ZEG A;  1I12 A;  4FBE A;  2ATR A;  5LRG A;  1QSR A;  4HNX B;  4CAW A;  1VIX A;  2VZZ A;  3HLP A;  2CF4 A;  4QBJ A;  4HKF A;  4BBH A;  4A31 A;  1VHS A;  1CM0 A;  2AFS A;  2FT0 A;  2AFU A;  2YNE A;  1YR0 A;  1S3Z A;  2ZEH A;  4U9Y A;  2B5G A;  4RN7 A;  3BI1 A;  2EK8 A;  2V8V A;  4UEZ A;  3B3V A;  5JM6 A;  3N5F A;  2Q04 A;  1IOF A;  2Q4Y A;  3D3S A;  3S6F A;  4CAV A;  1FY7 A;  4R3K A;  1BO4 A;  2A4N A;  3D66 A;  3TX8 A;  3I1U A;  1MJA A;  2ZW6 A;  4Q38 A;  2WYR A;  2GE3 A;  3B3C A;  4WWV A;  5LYI A;  1CPX A;  1Q2D A;  4M3S A;  3RNZ A;  4AVA A;  1LFW A;  5LRJ A;  3PZJ A;  1CX8 A;  5AG7 A;  3FBU A;  4OC5 A;  4PQA A;  3R9G A;  4ZYQ A;  4MHY A;  1CP6 A;  4UCM A;  3CZX A;  2Q4V A;  1TXR A;  4Y49 C;  4MFK A;  1M4G A;  4M6I A;  1BPN A;  3GYA A;  2OZG A;  4B10 A;  2Z3K A;  2PJ7 A;  3PFO A;  4UCP A;  4C7I A;  4MFP A;  2XEF A;  1NSL A;  2CTB A;  1N71 A;  4CGL A;  4NF1 A;  4DUK A;  4B5P B;  5LRK A;  4KOR A;  4Q7A A;  2H5M A;  4NEX A;  1IIC A;  4FWU A;  4MFZ A;  4IUS A;  5D29 A;  4XPL A;  4C2Z A;  4FD4 A;  2HC9 A;  4LUA A;  3B2Y A;  4A32 A;  4B6Z A;  2Z0Z A;  3JUW A;  4I49 A;  4U9Z A;  1YVO A;  4R7M A;  4GXH A;  4JYW A;  3PRT A;  1S7F A;  4O23 A;  3SI0 A;  4QUS A;  3V7Z A;  3PP9 A;  4X3R A;  2I79 A;  3NA6 A;  3PB6 X;  4PSW A;  1UFH A;  2ZXV A;  4L8A A;  4DNC A;  4NJR A;  2JBK A;  1EE3 P;  4MBU A;  3KGQ A;  1L0C A;  4E2A A;  3LD2 A;  4OC2 A;  4M6H A;  4LX9 A;  2AJ6 A;  1ARL A;  2PJ8 A;  5BWA B;  2CNM A;  1NMT A;  1YLE A;  1Y9K A;  2C6P A;  2EO8 A;  2QIR A;  1PU9 A;  2FVG A;  3KR5 A;  2PIY A;  3PEI A;  2CY2 A;  2KCW A;  2JEV A;  5F47 A;  3R9E A;  3TT2 A;  5KTA A;  1Q2C A;  2AFX A;  2EWB A;  3SHP A;  2DPT A;  2GLF A;  2PJ9 A;  2ZEL A;  4AVC A;  1OZP A;  2AE6 A;  3TTH A;  3MRU A;  4MHN A;  2V8G A;  4H6U A;  5AG5 A;  1XIX A;  4R57 A;  4X2T A;  1PCA A;  5C88 A;  4CGM A;  2CXA A;  1YME A;  3B3W A;  2AFZ A;  2Q4Z A;  2ZW4 A;  4GS4 A;  3FJU A;  1DTD A;  4OC0 A;  2PJ6 A;  2QML A;  1IU8 A;  4P4E A;  4UEF A;  3DSB A;  2RC4 A;  2FE7 A;  2B3V A;  4KVX A;  1S7N A;  1I21 A;  2FS5 A;  2J8N A;  4H89 A;  2R98 A;  4E8O A;  2FIW A;  3F0A A;  3DNS A;  2HUZ A;  3BJ8 A;  3FEC A;  2YGW A;  1IYK A;  1VHE A;  1QMU A;  4B5O A;  4NSQ A;  3WC7 A;  3PB7 X;  1NE9 A;  5HVG A;  2VZY A;  2BCO A;  2ZOF A;  3EY5 A;  2J9A A;  4NGQ A;  1MJ9 A;  2C6G A;  3H4Q A;  1LAM A;  3KQZ A;  1ZG8 A;  2IJZ A;  2NYQ A;  2ZW7 A;  1IOI A;  5EBV A;  3LAC A;  2ZEE A;  1X12 A;  1Z4E A;  6CPA A;  5IB9 A;  2V8H A;  4EME A;  4UBR A;  4A38 A;  3WC5 A;  4UFX A;  4WJB A;  2POK A;  2Z10 A;  1Z2L A;  1WWZ A;  3IU2 A;  4MMO A;  4YWY A;  3LWU A;  3WR7 A;  3EC4 A;  4U5Y A;  3QB8 A;  5F09 A;  1CG2 A;  5LYD A;  2CNT A;  4NGN A;  4P4B A;  4YGO A;  4JXQ A;  4MCP A;  4B11 A;  1YW4 A;  1KUY A;  4NFR A;  3RAM A;  1Y7E A;  4PV6 A;  3SI2 A;  2B4D A;  2I3C A;  4OAD A;  2XEG A;  2ABZ A;  3NH8 A;  4UEE A;  2Z11 A;  2FL4 A;  3WC6 A;  3P2F A;  2ZEN A;  3S9L A;  4P4J A;  1CBX A;  2DPS A;  4JXR A;  4YU9 A;  3V8I A;  4M6G A;  3CXP A;  1IY7 A;  4FD6 A;  3ZJ0 A;  1RO5 A;  4EVY A;  5A28 A;  1LAN A;  2JDC A;  4F6A A;  1GHE A;  4ONW A;  1XOV A;  4J3G A;  4PPZ A;  1CPS A;  4BMH A;  3TO6 A;  1S5K A;  3PB9 X;  5G1Z A;  2I00 A;  2Q7B A;  2C1C A;  5DWM A;  2F8H A;  4UFV A;  1WK4 A;  4BD9 A;  1U6M A;  2Y0M A;  1TKJ A;  3MGD A;  3BLN A;  2BL1 A;  3IU1 A;  3NH4 A;  5AGE A;  5AG4 A;  3CDX A;  1NSA A;  3SJG A;  1HDQ A;  4OLL A;  2ZEM A;  1XBU A;  3S6G A;  4JLY A;  4A39 A;  2OU2 A;  4MRI A;  4AVB A;  4R87 A;  1Z8X A;  3PBB A;  4H6Z A;  1R57 A;  4PXC A;  2ZEF A;  4R8F A;  4PXE A;  2GIV A;  2Q51 A;  4CGO A;  3B8G A;  4FD5 A;  2C6C A;  4KLW A;  3D2P A;  3V38 A;  4IF5 A;  4UFW A;  2JEW A;  2Z3O A;  3CT9 A;  4C7H A;  4R76 A;  3IWW A;  1ZLI A;  4NGM A;  4OC4 A;  4MHP A;  2QEC A;  2JDD A;  3UY5 A;  4H2K A;  1RXT A;  2YNC C;  4KSA A;  4AG9 A;  3CXS A;  2GLJ A;  3I9S A;  1KUV A;  2DEA A;  4XPD C;  2PJ1 A;  2HV2 A;  2D4O A;  3D68 A;  5JQ4 A;  5F46 A;  3EO4 A;  3GLJ A;  3BJ7 A;  3NE7 A;  4IHM A;  4PK2 A;  1QQ9 A;  1TKF A;  4NXY A;  1P4N A;  2NSM A;  2ODF A;  2R1I A;  4P4F A;  5F48 A;  3TCV A;  3GIU A;  1TF9 A;  1F57 A;  1XF8 A;  2REE A;  1VGY A;  2REF A;  5IB0 A;  3GY9 A;  1ZO0 A;  4FUU A;  1BLL E;  2Q43 A;  3BXM A;  4MFQ A;  3F8K A;  3S9M A;  3TOB A;  3W91 A;  4II9 A;  1ZLH A;  4QVT A;  3DR8 A;  1S60 A;  3QAH A;  1X10 A;  2J8R A;  4C68 A;  3VAT A;  3JTK A;  1M1D A;  1VKC A;  1XMT A;  4Y49 B;  2B3U A;  4CPA A;  3PB4 X;  2O53 A;  5CNP A;  4MJ8 A;  1K4J A;  3CPA A;  2P6F A;  4OME A;  3F5B A;  3FB3 A;  2F5I A;  2PVW A;  5IX3 A;  3ZZI A;  2IMO A;  2BO9 A;  4DJL A;  4CAX A;  2WUU A;  5LYL A;  1M4I A;  4KOU A;  4P6Y A;  1GYT A;  4ZGY B;  2FXF A;  4MCR A;  1YLO A;  1KZF A;  4P10 A;  4A33 A;  3RBU A;  4MFL A;  2ZW5 A;  1YW6 A;  5CBM A;  5ISV A;  5DWN A;  4CRZ B;  4OP4 A;  4MHZ A;  3H8E A;  1M4L A;  2HQY A;  2OZH A;  2OOT A;  1HEE A;  2PQ8 A;  3DLJ A;  3P2H A;  2ZOG A;  4XNH C;  4A2Z A;  4CYP A;  2EK9 A;  1TIQ A;  3VH9 A;  1PUA A;  3N7Z A;  5THW A;  3VWE A;  4LQG A;  1R43 A;  1YGH A;  3SXN A;  2PJ4 A;  5K8O A;  3IWG A;  3KI9 A;  3D7F A;  5KTC A;  3FF3 A;  3FYN A;  4ZY0 A;  2PJ2 A;  2ZED A;  3SJE A;  1LAP A;  1LOK A;  3FED A;  3GKR A;  3HUV A;  4JD6 A;  5K8P A;  4PXD A;  4Q36 A;  5IV0 A;  2ZEP A;  4F9U A;  3PBE A;  4GM5 A;  4A37 A;  3W6X A;  5J1Q A;  5JGF A;  2FSR A;  3EXN A;  4PSX A;  4R9M A;  4MFJ A;  1ELM P;  4L89 A;  3JRU A;  2PRB A;  1DE4 C;  3B7I A;  4FD7 A;  3W6S A;  4B14 A;  2PJC A;  4KVO E;  1ELL P;  3TFY A;  5EMI A;  4KS9 A;  3FXT A;  3K9T A;  2PIZ A;  2EVN A;  4HNW B;  1Z8L A;  2PCU A;  3PGP A;  2O28 A;  3T90 A;  3WAB A;  3SI1 A;  5C82 A;  5HH1 A;  1MJB A;  3FNC A;  2EBJ A;  1AMP A;  4LQ6 A;  3IEH A;  3DDD A;  4JJX A;  3TO9 A;  1SQH A;  4Z65 A;  4AB7 A;  4XNH B;  4CYN A;  4AXV A;  1Y7R A;  2OB0 A;  4MI4 A;  2ZPA A;  2B5G B;  4CGP A;  5JPH A;  4QB9 A;  3MN8 A;  1J4J A;  3ISZ A;  1VHO A;  4A95 A;  3KHX A;  1Z8W A;  3IC1 A;  1FT7 A;  4R6T A;  4UA3 A;  4TWE A;  1B87 A;  1PYT B;  4CAF A;  3OWC A;  5H86 A;  4ZBG A;  4RUH A;  1LRZ A;  2VEZ A;  1RTQ A;  3IFE A;  4UIB A;  2VL1 A;  4KOY A;  4X5K A;  1QSO A;  2F7V A;  5D8N A;  3LOD A;  4P44 A;  1M44 A;  2PR8 A;  2IQ6 A;  2RFH A;  1YVK A;  4KUB A;  1Z9U A;  1FNO A;  2Z3L A;  1LCP A;  5CPA A;  4F8Z A;  1YRE A;  5HVH A;  4NGT A;  3H8F A;  4UWI A;  3SJX A;  2VI7 A;  4UCN A;  2OH1 A;  4EWT A;  4TNU A;  5I0C A;  1BAV A;  1IYL A;  1KWM A;  4HNY B;  4K3N A;  4YRH A;  3D7D A;  3S6K A;  1KUX A;  3H8G A;  3PFE A;  4KZT A;  3DR6 A;  7CPA A;  4ORF A;  1TKH A;  2ARH A;  1CJW A;  3GB0 A;  3JVN A;  2QJ8 A;  2CIJ A;  1IID A;  2PJB A;  4JWP A;  2X7B A;  1XMB A;  1Z4R A;  2RB7 A;  3NFZ A;  1XFO A;  2WPX A;  1XRY A;  4DYO A;  4E0A A;  1QSN A;  1Y0R A;  4KLV A;  1JWQ A;  2DF5 A;  1M4D A;  3BI0 A;  3R96 A;  4UIA A;  2BEI A;  1A2Z A;  2CNS A;  2GAN A;  2PJ0 A;  2J8M A;  2BOA A;  5ELY A;  2P0W A;  4NGP A;  8CPA A;  4MY3 A;  2VXK A;  2G0B A;  1F2O A;  4F0Y A;  5FVJ A;  3KR4 A;  3E0K A;  1JQG A;  2AFO A;  2P6G A;  3CPX A;  3TC8 A;  2V77 A;  3D4U A;  4C2X A;  3KZW A;  3PB8 X;  4KOX A;  2PC1 A;  2XEJ A;  5K8N A;  2GU2 A;  4NGR A;  3R1K A;  3RZA A;  4F0X A;  1P0H A;  2PJ5 A;  4PXB A;  3WT4 A;  3B3S A;  3T8W A;  4BIN A;  1MK4 A;  4KOV A;  1XEB A;  3D7G A;  3IJ3 A;  4IK2 A;  1B6B A;  3FX6 A;  2PRQ A;  5JH9 A;  3LMS A;  3K9U A;  3GUX A;  2PJ3 A;  4OID A;  4UWJ A;  4C2Y A;  2FCK A;  4A30 A;  5F49 A;  3B35 A;  4HPS A;  2JBJ A;  4OKO A;  2WSA A;  3KL9 A;  4P4D A;  3KKW A;  2PR1 A;  2QYV A;  5EC4 A;  1Y9W A;  2AFM A;  1YQE A;  4XPK A;  3D8P A;  2PJA A;  1YX0 A;  1ZG9 A;  3FRM A;  1Y0Y A;  3FIX A;  1F2P A;  3ISX A;  4NCZ A;  3G8W A;  4XPD B;  2K5T A;  1IB1 E;  2VQY A;  5GCN A;  3RO0 A;  4KOS A;  1HDU A;  2C27 A;  4KVM E;  5H84 A;  2B58 A;  3H5Z A;  4UF4 A;  2GRE A;  4B5P A;  3D2M A;  1AYE A;  5HVF A;  2R8V A;  3A9L A;  1YK3 A;  2ZEO A;  4KSI A;  5G22 A;  2R7H A;  5E96 A;  2HB6 A;  2WPW A;  3NE8 A;  2PE3 A;  5A27 A;  2EUI A;  4YFJ A;  3CXQ A;  3B3T A;  3VAR A;  4MCQ A; 
#chains in the Genus database with same CATH homology
 3NH5 A;  4P45 A;  4ZY1 A;  2OR4 A;  2PVV A;  2WZN A;  3KHZ A;  4OC3 A;  4IAV A;  2ANP A;  4W9Y A;  5LYF A;  3BHX A;  1XJO A;  3KAS A;  3FVL A;  4F9V A;  3D67 A;  1H8L A;  3S9N A;  1TF8 A;  3IO1 A;  5HXD A;  1CP7 A;  4ZX8 A;  2G9D A;  4ZI6 A;  4EFD A;  4ZY2 A;  1OBR A;  1R3N A;  3L2N A;  3D7H A;  4MXU A;  3QNV A;  1ZG7 A;  1Q7L A;  3DGV A;  5K8M A;  1YSJ A;  3SJF A;  4ZX9 A;  1ARM A;  4X8I A;  3FEE A;  4MCS A;  1UWY A;  2QVP A;  2O4H A;  4OIW A;  1BPM A;  3IIB A;  2CTC A;  2XEI A;  1Z5R A;  4NGS A;  5DS0 A;  3K2K A;  4NJQ A;  2V8D A;  4A94 A;  1IGB A;  5I4M A;  4JZ0 A;  3FH4 A;  3FMC A;  2AFW A;  4P4I A;  4G1P A;  4OC1 A;  4FAI A;  3KQX A;  2ZEG A;  4FBE A;  5LRG A;  1VIX A;  3HLP A;  2CF4 A;  2AFS A;  2AFU A;  2ZEH A;  3BI1 A;  2EK8 A;  2V8V A;  4UEZ A;  3B3V A;  5JM6 A;  3N5F A;  3D66 A;  3TX8 A;  3I1U A;  4WWV A;  2WYR A;  3B3C A;  5LYI A;  1CPX A;  1LFW A;  5LRJ A;  1CX8 A;  4PQA A;  4OC5 A;  4ZYQ A;  4MHY A;  1CP6 A;  1TXR A;  1BPN A;  2PJ7 A;  3PFO A;  2XEF A;  2CTB A;  4DUK A;  5LRK A;  4Q7A A;  4FWU A;  5D29 A;  2HC9 A;  3B2Y A;  4B6Z A;  4R7M A;  4JYW A;  3PRT A;  3SI0 A;  4O23 A;  3V7Z A;  4X3R A;  3NA6 A;  3PB6 X;  4NJR A;  2JBK A;  1EE3 P;  3KGQ A;  4OC2 A;  1ARL A;  2PJ8 A;  2C6P A;  3KR5 A;  4MHP A;  2FVG A;  3PEI A;  2PIY A;  2AFX A;  2EWB A;  2GLF A;  2PJ9 A;  2ZEL A;  3MRU A;  4MHN A;  2V8G A;  4X2T A;  1PCA A;  1YME A;  3B3W A;  2AFZ A;  2Q4Z A;  3FJU A;  1DTD A;  4OC0 A;  2PJ6 A;  4P4E A;  4UEF A;  3FEC A;  1VHE A;  1QMU A;  3WC7 A;  3PB7 X;  5HVG A;  2BCO A;  2ZOF A;  2J9A A;  4NGQ A;  2C6G A;  3KQZ A;  1LAM A;  1ZG8 A;  2IJZ A;  2NYQ A;  2ZEE A;  5IB9 A;  6CPA A;  2V8H A;  4EME A;  4A38 A;  3WC5 A;  4WJB A;  2POK A;  4YWY A;  1Z2L A;  4MMO A;  3LWU A;  5F09 A;  1CG2 A;  5LYD A;  4NGN A;  4P4B A;  4MCP A;  1YW4 A;  4NFR A;  3RAM A;  1Y7E A;  3SI2 A;  2I3C A;  2XEG A;  2ABZ A;  3NH8 A;  4UEE A;  3WC6 A;  2ZEN A;  3S9L A;  4P4J A;  1CBX A;  4YU9 A;  1IY7 A;  1LAN A;  4ONW A;  4PPZ A;  1CPS A;  3PB9 X;  2C1C A;  2F8H A;  4BD9 A;  1TKJ A;  3NH4 A;  3CDX A;  1NSA A;  3SJG A;  1HDQ A;  2ZEM A;  1XBU A;  4A39 A;  4MRI A;  3PBB A;  4PXC A;  2ZEF A;  4R8F A;  4PXE A;  2Q51 A;  2C6C A;  3V38 A;  2JEW A;  3CT9 A;  4R76 A;  3IWW A;  1ZLI A;  4NGM A;  4OC4 A;  4H2K A;  2GLJ A;  2DEA A;  2PJ1 A;  3D68 A;  3GLJ A;  4IHM A;  4DJL A;  1QQ9 A;  1TKF A;  4P4F A;  2NSM A;  1TF9 A;  1F57 A;  1VGY A;  4FUU A;  1BLL E;  2Q43 A;  3BXM A;  3S9M A;  1ZLH A;  3VAT A;  4CPA A;  3PB4 X;  2O53 A;  3CPA A;  4OME A;  2PVW A;  2IMO A;  2BO9 A;  5LYL A;  4P6Y A;  1GYT A;  4MCR A;  1YLO A;  4P10 A;  5CBM A;  3RBU A;  1YW6 A;  4OP4 A;  4MHZ A;  3H8E A;  1M4L A;  2OOT A;  1HEE A;  3DLJ A;  2ZOG A;  2EK9 A;  3VH9 A;  5THW A;  4LQG A;  1R43 A;  5K8O A;  2PJ4 A;  3KI9 A;  3D7F A;  3FF3 A;  4ZY0 A;  2PJ2 A;  2ZED A;  3SJE A;  1LAP A;  1LOK A;  3FED A;  3HUV A;  5K8P A;  4PXD A;  2ZEP A;  4F9U A;  3PBE A;  4GM5 A;  4A37 A;  5J1Q A;  5JGF A;  1ELM P;  3JRU A;  3B7I A;  1DE4 C;  2PJC A;  1ELL P;  3K9T A;  2PIZ A;  1Z8L A;  2PCU A;  3WAB A;  3SI1 A;  1AMP A;  3IEH A;  4Z65 A;  4AXV A;  3MN8 A;  3ISZ A;  1VHO A;  3KHX A;  3IC1 A;  1FT7 A;  4R6T A;  4TWE A;  1PYT B;  4RUH A;  4UIB A;  1RTQ A;  3IFE A;  2VL1 A;  2F7V A;  5D8N A;  4P44 A;  2IQ6 A;  2RFH A;  4F8Z A;  5CPA A;  1FNO A;  1LCP A;  5HVH A;  4NGT A;  3H8F A;  3SJX A;  4EWT A;  4TNU A;  1BAV A;  1KWM A;  4K3N A;  3D7D A;  3H8G A;  3PFE A;  7CPA A;  1TKH A;  3GB0 A;  2QJ8 A;  2CIJ A;  2PJB A;  1XMB A;  2RB7 A;  3NFZ A;  1XFO A;  1XRY A;  4DYO A;  1Y0R A;  3BI0 A;  4UIA A;  2PJ0 A;  2BOA A;  5ELY A;  4NGP A;  8CPA A;  1F2O A;  3KR4 A;  1JQG A;  2AFO A;  3CPX A;  3TC8 A;  2V77 A;  3D4U A;  3KZW A;  3PB8 X;  5K8N A;  2XEJ A;  2GU2 A;  4NGR A;  3RZA A;  2PJ5 A;  4PXB A;  3WT4 A;  3B3S A;  3T8W A;  3D7G A;  4IK2 A;  3IJ3 A;  3FX6 A;  2PRQ A;  5JH9 A;  3LMS A;  3GUX A;  2PJ3 A;  4OID A;  3B35 A;  4OKO A;  2JBJ A;  3KL9 A;  4P4D A;  2QYV A;  2AFM A;  2PJA A;  1ZG9 A;  3ISX A;  1Y0Y A;  1F2P A;  1HDU A;  4UF4 A;  2GRE A;  1AYE A;  5HVF A;  2ZEO A;  4KSI A;  2HB6 A;  2PE3 A;  3B3T A;  3VAR A;  4MCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...