4FAIA

Crystal structure of mitochondrial isoform of glutaminyl cyclase from drosophila melanogaster
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
317
structure length
302
Chain Sequence
ELVDIPKISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYMPGVEFLGATDSAVPCAMLLNLAQVLQEQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLRYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5976, isoform B
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
total genus 103
structure length 302
sequence length 317
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4faiA00
3SJEA 2PJ2A 2CTBA 1DTDA 5J1QA 2V8HA 1CBXA 1LFWA 4UEZA 2AFWA 2VL1A 1ARLA 1QQ9A 2Q43A 4H2KA 5LYDA 4A38A 4OMEA 5THWA 3FF3A 4X3RA 3D68A 2PJBA 2RB7A 5JH9A 5LRKA 4DYOA 2ZOGA 4RUHA 2BOAA 1ZLHA 1UWYA 1NSAA 1FNOA 4P4JA 4UIBA 3IEHA 3IJ3A 2O53A 3NH4A 2PE3A 4JYWA 2ANPA 1IGBA 2AFUA 2XEJA 3B2YA 5I4MA 2ZEGA 4CPAA 3SI1A 2PIYA 3N5FA 4ONWA 2Q4ZA 4ZY0A 4ZX8A 2JEWA 2XEGA 2AFXA 3SI2A 3BHXA 1HDUA 2AFZA 3TX8A 1AYEA 1Q7LA 3KGQA 3B3SA 3PRTA 4MHPA 2QJ8A 2DEAA 3PBBA 4ZX9A 2BO9A 2ZOFA 2WZNA 3B3TA 5CPAA 4BD9A 2C6PA 4R8FA 2PJ6A 3D7FA 3GUXA 4MCSA 1F2PA 1VGYA 3VARA 3FX6A 1BPMA 1CG2A 1XFOA 3KR5A 2HC9A 3B3VA 4EMEA 2Q51A 3D4UA 4P4IA 3D7DA 4OKOA 2WYRA 5K8OA 4P4BA 2GLFA 3KQXA 4Z65A 3IWWA 2PJ4A 4PQAA 2GREA 2IQ6A 3NH5A 1LAPA 2XEIA 2BCOA 4Q7AA 1Y7EA 1HEEA 2QYVA 4FAIA 3FJUA 4UF4A 2GLJA 1YW4A 3PB4X 3KQZA 2ZEEA 5K8MA 2ZEDA 2V8VA 1TF8A 2POKA 3QNVA 2CTCA 4OC1A 4ZI6A 1CPXA 5HVHA 4F9VA 8CPAA 2NYQA 3FH4A 2CF4A 2EWBA 3NA6A 3WABA 1LAMA 4MRIA 3RAMA 3D7GA 4OC4A 1ELLP 2ZELA 3KHZA 3FEDA 3KI9A 4WJBA 1IY7A 1XBUA 3K9TA 4NFRA 4IK2A 1ZG9A 3ISZA 3H8GA 3S9NA 5IB9A 2EK9A 2QVPA 3GLJA 1R43A 5HXDA 3S9LA 4OC0A 4B6ZA 4F9UA 2PJ9A 2JBJA 1YW6A 1DE4C 3B7IA 1BAVA 4MCQA 1QMUA 2PJ7A 3HLPA 3DGVA 1XRYA 5ELYA 3RBUA 1VHOA 2AFSA 2C1CA 1TF9A 4YU9A 1KWMA 5CBMA 3PEIA 4EWTA 3PFOA 3MN8A 4X2TA 4FWUA 3IFEA 1Y0YA 4OP4A 2PJCA 3CPXA 1YLOA 1FT7A 1ZG7A 2F8HA 5JGFA 4ZY2A 5LYLA 4P4FA 5DS0A 1PCAA 4W9YA 2ABZA 1CP6A 2PRQA 3KZWA 5LRJA 4FUUA 4MCPA 3SJGA 4MXUA 3GB0A 4P44A 1LCPA 2V8DA 4TNUA 5D8NA 1F2OA 3D7HA 5K8PA 3BXMA 3V7ZA 1F57A 2O4HA 3IO1A 4TWEA 1ARMA 1OBRA 4A39A 2IMOA 3LWUA 1CPSA 7CPAA 4K3NA 2HB6A 4OC3A 1M4LA 4JZ0A 1LOKA 1YMEA 1VIXA 4MMOA 1BPNA 2PJ1A 3K2KA 2IJZA 3KASA 4MCRA 4G1PA 4P45A 3CDXA 1LANA 4YWYA 3S9MA 3T8WA 5LYFA 3CT9A 2OOTA 2C6CA 1ZG8A 3PB6X 6CPAA 1Z8LA 2GU2A 2XEFA 4R76A 1BLLE 2NSMA 4NGTA 3NFZA 2C6GA 3DLJA 1Z2LA 2AFOA 3D66A 1YSJA 5LRGA 4A37A 4X8IA 1RTQA 4NGMA 2ZEHA 3RZAA 3WC7A 3PBEA 4O23A 2PJ3A 4IAVA 1Z5RA 2JBKA 4GM5A 2PVWA 1TXRA 3BI1A 4UEFA 3H8FA 2PJ0A 4NGRA 3WT4A 3KL9A 2G9DA 4MHYA 4OC5A 2ZEFA 2ZEOA 2J9AA 4R6TA 5JM6A 3H8EA 3TC8A 2PJ8A 4A94A 3B3CA 1PYTB 3VATA 2AFMA 3I1UA 1H8LA 3FVLA 4MHNA 1AMPA 1ELMP 3PB8X 4EFDA 3VH9A 3NH8A 2PCUA 3LMSA 3B3WA 2I3CA 3PB9X 5HVFA 4ZYQA 4NGPA 1CX8A 2OR4A 4ZY1A 2V77A 4UIAA 1TKHA 2FVGA 4PXDA 2CIJA 3KR4A 3JRUA 4NJRA 4UEEA 4WWVA 3CPAA 4PXEA 4R7MA 1GYTA 4P6YA 5F09A 2ZEPA 1TKFA 3D67A 4KSIA 2RFHA 1CP7A 4OIWA 4DUKA 3FMCA 3WC6A 3MRUA 3IIBA 2PJAA 4FBEA 4NGNA 4MHZA 2PJ5A 3ISXA 3KHXA 4P10A 5LYIA 1HDQA 4P4EA 3SJXA 1XJOA 3SJFA 4AXVA 4P4DA 4NGQA 1EE3P 4OC2A 2PVVA 4NJQA 5K8NA 3HUVA 4DJLA 4IHMA 3L2NA 3V38A 2PIZA 1TKJA 1ZLIA 3BI0A 4NGSA 3SI0A 1R3NA 3WC5A 4PXBA 2V8GA 4OIDA 3PB7X 1JQGA 3IC1A 1Y0RA 1VHEA 2F7VA 4F8ZA 5HVGA 4LQGA 4PXCA 3PFEA 2EK8A 3B35A 3FEEA 2ZENA 3FECA 1XMBA 5D29A 4PPZA 2ZEMA
chains in the Genus database with same CATH superfamily
4R3KA 3SJEA 2PJ2A 3V8IA 2CTBA 1DTDA 2PSWA 4CGPA 5J1QA 1MJAA 2V8HA 4MFLA 1CBXA 4CAWA 3EFAA 1LFWA 4OAEA 4UEZA 4RS2A 2AFWA 1Z8WA 5G21A 2VL1A 1YQEA 1ARLA 1QQ9A 2Q43A 3W6SA 2QECA 3IWGA 4MFQA 4U5YA 4H2KA 1Z8XA 3H4QA 3GY9A 5LYDA 3QB8A 4A38A 2CNMA 4OMEA 3ZJ0A 5THWA 2ZW5A 4RI1A 5DWNA 3FF3A 4Q38A 4X3RA 3D68A 2PJBA 2RB7A 1S3ZA 5JH9A 5LRKA 4DYOA 2ZOGA 4RUHA 2BOAA 1CJWA 1ZLHA 1S7FA 1YVOA 1UWYA 2D4OA 3FB3A 3K9UA 1NSAA 1XIXA 3N7ZA 2EO8A 1FNOA 4P4JA 4UIBA 3IEHA 3IJ3A 2B58A 2O53A 3NH4A 2AJ6A 2Z0ZA 2PE3A 4JYWA 5JPHA 2Z3LA 2ANPA 1KUYA 1IGBA 1X12A 1K4JA 2AFUA 2XEJA 3B2YA 2ZEGA 5I4MA 4CPAA 2EVNA 3SI1A 2PIYA 3N5FA 2YNEA 2Q4ZA 4ONWA 4ZY0A 4ZX8A 2EBJA 4C2ZA 2JEWA 3R9GA 2XEGA 1Q2YA 3B8GA 4XNHB 2AFXA 1B6BA 4BMHA 2WPWA 3R1KA 3SI2A 1YGHA 3BHXA 5F46A 1HDUA 2AFZA 2DF5A 4KSFA 3EO4A 3TX8A 4Y49B 1AYEA 1U6MA 2FE7A 2PRBA 2PDOA 4YFJA 5IX3A 1Q7LA 2PR8A 3DNSA 3KGQA 1KUVA 3B3SA 3CXPA 3PRTA 5AGEA 4F0XA 2Q04A 4MHPA 2QJ8A 4A2ZA 4KOSA 4MY3A 1QSMA 2DEAA 4F6AA 3PBBA 4ZX9A 2OZHA 2BO9A 2CNSA 2ZOFA 2WZNA 3B3TA 5CPAA 4YGOA 2C6PA 4R8FA 4KLWA 4BD9A 5IB0A 2PJ6A 1FY7A 3JVNA 3D7FA 3GUXA 4MCSA 4J3GA 3VWEA 4C68A 2X7BA 1F2PA 3GKRA 4AG9A 1VGYA 3VARA 1ON0A 3FX6A 1BPMA 2HUZA 1CG2A 3RNZA 5ISVA 1XFOA 3KR5A 1YLEA 2Q4YA 1WWZA 2HC9A 2CY2A 3B3VA 2R1IA 1VKCA 4EMEA 4PSXA 2BSWA 2Q51A 2REEA 3D4UA 2DPTA 4P4IA 3I3GA 3D7DA 4OKOA 2WYRA 4B5PA 5K8OA 4OLLA 5AG4A 4R9MA 4P4BA 4HNYB 2GLFA 3KQXA 4Z65A 3EC4A 3TOBA 5BWAB 4X5KA 3IWWA 4CGMA 2PJ4A 4PQAA 4BBHA 2GREA 2IQ6A 2YNCC 3NH5A 3D2MA 4H6ZA 1LAPA 5AG6A 2XEIA 4A32A 1IOFA 2QMLA 4MY0A 4FD4A 2VXKA 2BCOA 4Q7AA 4K30A 1Y7EA 3EXNA 1HEEA 2G3AA 2P6GA 2FIWA 1TIQA 2QYVA 4FD7A 4KZTA 4FAIA 4KVOE 4R57A 2G0BA 2RC4A 3FJUA 4UWJA 4IF5A 4CYQA 2A4NA 2J8RA 4UF4A 2Z11A 2AE6A 1QSTA 2GLJA 1Z4EA 5HH1A 1IB1E 1YW4A 1IIDA 3PB4X 3KQZA 3LODA 2ZEEA 2JLMA 2B3UA 1XEBA 5K8MA 4XPLA 4B10A 2R8VA 2ZEDA 5EBVA 2V8VA 4DNCA 4R87A 2B5GB 1TF8A 2POKA 2PQ8A 3QNVA 3MGDA 3TO7A 4KSAA 2CTCA 4OC1A 4ZI6A 1CPXA 5HVHA 4F9VA 5J8FA 8CPAA 2G3TA 2NYQA 2DPSA 2P6EA 4PK2A 3FH4A 2CF4A 4KORA 2EWBA 3BJ8A 3NA6A 3WABA 1LAMA 4MRIA 3RAMA 3D7GA 4JWPA 3NE8A 4OC4A 3W6XA 1KUXA 4F0YA 1ELLP 4M6IA 3IU2A 4QVTA 2ZELA 3C26A 4H6UA 2CNTA 3KHZA 3JTKA 4JD6A 3EY5A 1Z8TA 3FEDA 3KI9A 4WJBA 1IY7A 1XBUA 4CS0B 4I49A 3RYOA 3K9TA 4NFRA 3QAYA 3A9LA 3F8KA 2HQYA 2ODFA 4IK2A 1ZG9A 3ISZA 3H8GA 3S9NA 1QSRA 3DR8A 5IB9A 2EK9A 2QVPA 3GLJA 1R43A 4HKFA 5HXDA 3LACA 3S9LA 4M85A 5H86A 2OZGA 4MFJA 3T90A 4OC0A 4B11A 4B6ZA 4F9UA 1NE9A 2PJ9A 5G20A 4NSQA 1I12A 1S60A 1V0CA 2FXFA 2B4BA 2P0WA 2JBJA 4MHDA 1M1DA 1S5KA 2ATRA 2VQYA 1YW6A 1DE4C 3BLNA 2FS5A 3B7IA 3F0AA 4XPDC 1BAVA 5G1ZA 3WR7A 4QBJA 2JDCA 4KOYA 2BL1A 1JWQA 1QMUA 2J8NA 4KLVA 1AUGA 3E0KA 4MCQA 4YRHA 4JXRA 1X10A 2PJ7A 3G8WA 3HLPA 4ZBGA 3T9YA 4C7IA 2EUIA 1ZO0A 4MI4A 4R3LA 5CNPA 1S7NA 1N71A 3DGVA 3CZXA 1XRYA 4A30A 1M4IA 4UCNA 4L89A 5ELYA 3RBUA 1YK3A 5EC4A 1VHOA 2AFSA 4OADA 1Z9UA 4KOVA 2C1CA 1B87A 1TF9A 4YU9A 1KWMA 3RO0A 5CBMA 4Q36A 2IL4A 3PEIA 4UBRA 1BO4A 4MFZA 3PFOA 4EWTA 3MN8A 4X2TA 4FWUA 5GCNA 3JUWA 3IFEA 1Y0YA 4OP4A 2PJCA 3CPXA 1YLOA 1FT7A 1ZG7A 4GXHA 1QSOA 1UFHA 2GANA 4QB9A 4UFXA 4B12A 4B5PB 2F8HA 5JGFA 3FBUA 4ZY2A 5LYLA 4P4FA 4CGLA 4MJ8A 4UFVA 1PUAA 1PCAA 1Q2CA 5DS0A 4E0AA 1VHSA 4W9YA 2ABZA 1CP6A 2PRQA 3KZWA 5LRJA 4FUUA 4MCPA 4XPKA 3SJGA 2B4DA 2KCWA 4MXUA 3GB0A 1BOBA 5A27A 4P44A 1LCPA 2V8DA 4TNUA 5D8NA 1F2OA 4M6HA 3D7HA 5K8PA 1M4GA 2Z3MA 3BXMA 4JJXA 4KS9A 4C2XA 1GHEA 2PC1A 5F48A 5JQ4A 3V7ZA 1F57A 4FD6A 2O4HA 3P2HA 3IO1A 4TWEA 4RN7A 2OZUA 3IU1A 1ARMA 4BINA 1OBRA 4QC6A 4A39A 2I79A 2IMOA 3LWUA 1CPSA 7CPAA 4U9YA 4AVCA 3FNCA 4K3NA 2HB6A 4AVAA 1KZFA 4ZGYB 4KOXA 4OC3A 1M4LA 4JZ0A 3S6GA 1LOKA 3TT2A 4AB7A 1YMEA 1VIXA 5IV0A 5H84A 4MMOA 1XOVA 4B13A 3ZZIA 2CXAA 1BPNA 2Q0YA 2PJ1A 4UA3A 3TO6A 2D4PA 3K2KA 3W91A 1IYKA 2IJZA 3H5ZA 2GE3A 4CRYB 2Z10A 3TE4A 3KASA 4MCRA 2FSRA 2Q4VA 4G1PA 1P4NA 4P45A 3GIUA 5DWMA 2YNDA 3CDXA 1LANA 4YWYA 1R57A 3I9SA 3S9MA 3T8WA 5LYFA 3CT9A 1XE4A 5HMNA 2OOTA 2C6CA 1ZG8A 3PB6X 4KOUA 6CPAA 3TOAA 2ZPAA 1I21A 1Z8LA 2GU2A 4CGNA 2XEFA 5C88A 4R76A 1BLLE 1S7LA 2NSMA 3DDDA 4NGTA 3NFZA 2C6GA 2H5MA 3DLJA 1Z2LA 2AFOA 3D66A 1YSJA 4NXYA 5LRGA 4A37A 1Q2DA 4X8IA 2PR1A 1RTQA 1RO5A 2DXQA 2FL4A 1NSLA 4NGMA 5KTCA 4KOWA 1NMTA 2ZEHA 2Q7SA 3RZAA 3S6KA 4MFPA 3PBEA 1P0HA 3OWCA 4U9ZA 4O23A 3TCVA 3WC7A 2PJ3A 1Z5RA 2JBKA 4IAVA 4GM5A 2PVWA 2ZW7A 2ZXVA 4CYOA 1TXRA 3BI1A 4KUAA 4UEFA 5AG5A 4NEXA 1CM0A 3H8FA 4CAFA 2PJ0A 2OU2A 4NGRA 1I1DA 3WT4A 4CRZB 3D8PA 3KL9A 2FCKA 3FYNA 4H89A 2G9DA 2P6FA 2VEZA 4MHYA 4OC5A 3SHPA 2ZEFA 2ZEOA 2I00A 4CAEA 2J9AA 4R6TA 3DR6A 2WUUA 5JM6A 4AG7A 2Q44A 2OB0A 3H8EA 5AG7A 3TC8A 2PJ8A 1IYLA 4A94A 4M3SA 1LRZA 2B5GA 3B3CA 3F5BA 2BEIA 4XPDB 2VI7A 1PYTB 1XF8A 4ORFA 3VATA 4EVYA 2AFMA 1L0CA 5EMIA 4E8OA 1IOIA 3I1UA 4KVME 4AVBA 5I0CA 2Z3OA 1Y9WA 1H8LA 3FVLA 4ONUA 4L8AA 4MHNA 1AMPA 1ELMP 3PB8X 4C2YA 4EFDA 3VH9A 3NH8A 2PCUA 1M4DA 5KTDA 3LMSA 1WK4A 1A2ZA 5KTAA 1RXTA 2B4DB 2Z3PA 4C7HA 3B3WA 2O28A 2I3CA 3PB9X 4M6GA 4PSWA 2R98A 4MFKA 5HVFA 4ZYQA 4NGPA 4NF1A 3CXQA 1YR0A 1CX8A 3CXSA 4B5OA 2OR4A 3BJ7A 2GFQA 1SQHA 4ZY1A 2V77A 4UIAA 1TKHA 2FVGA 2K5TA 4PXDA 2CIJA 1YVKA 3KR4A 3JRUA 4NJRA 4UEEA 1QSNA 4CGOA 4XNHC 3KKWA 3LD2A 2OH1A 4LQ6A 4WWVA 3VWDA 3CPAA 4PXEA 4R7MA 1GYTA 3UY5A 3G3SA 4P6YA 2FT0A 2JEVA 3IGRA 5F09A 2ZEPA 4Y49C 3PZJA 1TKFA 2WSAA 3R9FA 3D67A 2R7HA 5G22A 2VZZA 4CAXA 2JDDA 4KVXA 4KSIA 4UWIA 3FIXA 5E96A 2RFHA 2VZYA 1CP7A 2F5IA 1M44A 2ZW6A 3FXTA 4LUAA 4OIWA 4HNWB 3FMCA 4DUKA 4LX9A 3S6HA 2Y0MA 3WC6A 3SXNA 3MRUA 3R96A 4E2AA 2FIAA 2PJAA 3IIBA 3PGPA 4FBEA 4NGNA 5J8CA 1Z4RA 4MHZA 2PJ5A 4MBUA 3TTHA 4NCZA 3ISXA 3IWEA 3KHXA 4GS4A 4P10A 2B3VA 5LYIA 1HDQA 4P4EA 2Q7BA 4UCMA 1IU8A 2QIRA 4PK3A 3QAHA 3D2PA 4UFWA 3SJXA 2WPXA 1XJOA 3PP9A 3SJFA 3D3SA 4AXVA 4P4DA 4NGQA 2VBQA 1MJ9A 2ARHA 2Z3KA 1EE3P 4QUSA 4OC2A 3GYAA 2PVVA 2REFA 4A33A 4A95A 1J4JA 4NJQA 5K8NA 3TFYA 3HUVA 3S6FA 4KOTA 5FVJA 1Y7RA 2YGWA 4DJLA 4HPSA 4IHMA 3R9EA 3L2NA 4JXQA 3R95A 2BUEA 3V38A 2PIZA 1TKJA 1ZLIA 3BI0A 3FRMA 4NGSA 2Z3NA 2J8MA 3SI0A 1R3NA 4FD5A 3WC5A 5C82A 4PXBA 1Y9KA 1S7KA 5F47A 2V8GA 4OIDA 3PB7X 4CYPA 1JQGA 4JLYA 3IC1A 4CAVA 1Y0RA 3DSBA 1YX0A 1VHEA 2C27A 1IICA 1PU9A 2F7VA 2HV2A 4F8ZA 5HVGA 1MJBA 4LQGA 4PXCA 3PFEA 4CYNA 3SXOA 2EK8A 2GIVA 2NMTA 5F49A 2ZW4A 3B35A 3FEEA 2ZENA 3P2FA 4HNXB 3FECA 4KUBA 1XMBA 2YNCA 3TO9A 5D29A 4UCPA 4PV6A 4A31A 5A28A 4II9A 3NE7A 4B14A 1YREA 1XMTA 4PPZA 4IUSA 1OZPA 2ZEMA 1MK4A
chains in the Genus database with same CATH topology
3SJEA 2PJ2A 2CTBA 1DTDA 5J1QA 2V8HA 1CBXA 1LFWA 4UEZA 2AFWA 2VL1A 1ARLA 1QQ9A 2Q43A 4H2KA 5LYDA 4A38A 4OMEA 5THWA 3FF3A 4X3RA 3D68A 2PJBA 2RB7A 5JH9A 5LRKA 4DYOA 2ZOGA 4RUHA 2BOAA 1ZLHA 1UWYA 1NSAA 1FNOA 4P4JA 4UIBA 3IEHA 3IJ3A 2O53A 3NH4A 2PE3A 4JYWA 2ANPA 1IGBA 2AFUA 2XEJA 3B2YA 5I4MA 2ZEGA 4CPAA 3SI1A 2PIYA 3N5FA 4ONWA 2Q4ZA 4ZY0A 4ZX8A 2JEWA 2XEGA 2AFXA 3SI2A 3BHXA 1HDUA 2AFZA 3TX8A 1AYEA 1Q7LA 3KGQA 3B3SA 3PRTA 4MHPA 2QJ8A 2DEAA 3PBBA 4ZX9A 2BO9A 2ZOFA 2WZNA 3B3TA 5CPAA 4BD9A 2C6PA 4R8FA 2PJ6A 3D7FA 3GUXA 4MCSA 1F2PA 1VGYA 3VARA 3FX6A 1BPMA 1CG2A 1XFOA 3KR5A 2HC9A 3B3VA 4EMEA 2Q51A 3D4UA 4P4IA 3D7DA 4OKOA 2WYRA 5K8OA 4P4BA 2GLFA 3KQXA 4Z65A 3IWWA 2PJ4A 4PQAA 2GREA 2IQ6A 3NH5A 1LAPA 2XEIA 2BCOA 4Q7AA 1Y7EA 1HEEA 2QYVA 4FAIA 3FJUA 4UF4A 2GLJA 1YW4A 3PB4X 3KQZA 2ZEEA 5K8MA 2ZEDA 2V8VA 1TF8A 2POKA 3QNVA 2CTCA 4OC1A 4ZI6A 1CPXA 5HVHA 4F9VA 8CPAA 2NYQA 3FH4A 2CF4A 2EWBA 3NA6A 3WABA 1LAMA 4MRIA 3RAMA 3D7GA 4OC4A 1ELLP 2ZELA 3KHZA 3FEDA 3KI9A 4WJBA 1IY7A 1XBUA 3K9TA 4NFRA 4IK2A 1ZG9A 3ISZA 3H8GA 3S9NA 5IB9A 2EK9A 2QVPA 3GLJA 1R43A 5HXDA 3S9LA 4OC0A 4B6ZA 4F9UA 2PJ9A 2JBJA 1YW6A 1DE4C 3B7IA 1BAVA 4MCQA 1QMUA 2PJ7A 3HLPA 3DGVA 1XRYA 5ELYA 3RBUA 1VHOA 2AFSA 2C1CA 1TF9A 4YU9A 1KWMA 5CBMA 3PEIA 4EWTA 3PFOA 3MN8A 4X2TA 4FWUA 3IFEA 1Y0YA 4OP4A 2PJCA 3CPXA 1YLOA 1FT7A 1ZG7A 2F8HA 5JGFA 4ZY2A 5LYLA 4P4FA 5DS0A 1PCAA 4W9YA 2ABZA 1CP6A 2PRQA 3KZWA 5LRJA 4FUUA 4MCPA 3SJGA 4MXUA 3GB0A 4P44A 1LCPA 2V8DA 4TNUA 5D8NA 1F2OA 3D7HA 5K8PA 3BXMA 3V7ZA 1F57A 2O4HA 3IO1A 4TWEA 1ARMA 1OBRA 4A39A 2IMOA 3LWUA 1CPSA 7CPAA 4K3NA 2HB6A 4OC3A 1M4LA 4JZ0A 1LOKA 1YMEA 1VIXA 4MMOA 1BPNA 2PJ1A 3K2KA 2IJZA 3KASA 4MCRA 4G1PA 4P45A 3CDXA 1LANA 4YWYA 3S9MA 3T8WA 5LYFA 3CT9A 2OOTA 2C6CA 1ZG8A 3PB6X 6CPAA 1Z8LA 2GU2A 2XEFA 4R76A 1BLLE 2NSMA 4NGTA 3NFZA 2C6GA 3DLJA 1Z2LA 2AFOA 3D66A 1YSJA 5LRGA 4A37A 4X8IA 1RTQA 4NGMA 2ZEHA 3RZAA 3WC7A 3PBEA 4O23A 2PJ3A 4IAVA 1Z5RA 2JBKA 4GM5A 2PVWA 1TXRA 3BI1A 4UEFA 3H8FA 2PJ0A 4NGRA 3WT4A 3KL9A 2G9DA 4MHYA 4OC5A 2ZEFA 2ZEOA 2J9AA 4R6TA 5JM6A 3H8EA 3TC8A 2PJ8A 4A94A 3B3CA 1PYTB 3VATA 2AFMA 3I1UA 1H8LA 3FVLA 4MHNA 1AMPA 1ELMP 3PB8X 4EFDA 3VH9A 3NH8A 2PCUA 3LMSA 3B3WA 2I3CA 3PB9X 5HVFA 4ZYQA 4NGPA 1CX8A 2OR4A 4ZY1A 2V77A 4UIAA 1TKHA 2FVGA 4PXDA 2CIJA 3KR4A 3JRUA 4NJRA 4UEEA 4WWVA 3CPAA 4PXEA 4R7MA 1GYTA 4P6YA 5F09A 2ZEPA 1TKFA 3D67A 4KSIA 2RFHA 1CP7A 4OIWA 4DUKA 3FMCA 3WC6A 3MRUA 3IIBA 2PJAA 4FBEA 4NGNA 4MHZA 2PJ5A 3ISXA 3KHXA 4P10A 5LYIA 1HDQA 4P4EA 3SJXA 1XJOA 3SJFA 4AXVA 4P4DA 4NGQA 1EE3P 4OC2A 2PVVA 4NJQA 5K8NA 3HUVA 4DJLA 4IHMA 3L2NA 3V38A 2PIZA 1TKJA 1ZLIA 3BI0A 4NGSA 3SI0A 1R3NA 3WC5A 4PXBA 2V8GA 4OIDA 3PB7X 1JQGA 3IC1A 1Y0RA 1VHEA 2F7VA 4F8ZA 5HVGA 4LQGA 4PXCA 3PFEA 2EK8A 3B35A 3FEEA 2ZENA 3FECA 1XMBA 5D29A 4PPZA 2ZEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJE A;  2PJ2 A;  2CTB A;  1DTD A;  5J1Q A;  2V8H A;  1CBX A;  1LFW A;  4UEZ A;  2AFW A;  2VL1 A;  1ARL A;  1QQ9 A;  2Q43 A;  4H2K A;  5LYD A;  4A38 A;  4OME A;  5THW A;  3FF3 A;  4X3R A;  3D68 A;  2PJB A;  2RB7 A;  5JH9 A;  5LRK A;  4DYO A;  2ZOG A;  4RUH A;  2BOA A;  1ZLH A;  1UWY A;  1NSA A;  1FNO A;  4P4J A;  4UIB A;  3IEH A;  3IJ3 A;  2O53 A;  3NH4 A;  2PE3 A;  4JYW A;  2ANP A;  1IGB A;  2AFU A;  2XEJ A;  3B2Y A;  5I4M A;  2ZEG A;  4CPA A;  3SI1 A;  2PIY A;  3N5F A;  4ONW A;  2Q4Z A;  4ZY0 A;  4ZX8 A;  2JEW A;  2XEG A;  2AFX A;  3SI2 A;  3BHX A;  1HDU A;  2AFZ A;  3TX8 A;  1AYE A;  1Q7L A;  3KGQ A;  3B3S A;  3PRT A;  4MHP A;  2QJ8 A;  2DEA A;  3PBB A;  4ZX9 A;  2BO9 A;  2ZOF A;  2WZN A;  3B3T A;  5CPA A;  4BD9 A;  2C6P A;  4R8F A;  2PJ6 A;  3D7F A;  3GUX A;  4MCS A;  1F2P A;  1VGY A;  3VAR A;  3FX6 A;  1BPM A;  1CG2 A;  1XFO A;  3KR5 A;  2HC9 A;  3B3V A;  4EME A;  2Q51 A;  3D4U A;  4P4I A;  3D7D A;  4OKO A;  2WYR A;  5K8O A;  4P4B A;  2GLF A;  3KQX A;  4Z65 A;  3IWW A;  2PJ4 A;  4PQA A;  2GRE A;  2IQ6 A;  3NH5 A;  1LAP A;  2XEI A;  2BCO A;  4Q7A A;  1Y7E A;  1HEE A;  2QYV A;  4FAI A;  3FJU A;  4UF4 A;  2GLJ A;  1YW4 A;  3PB4 X;  3KQZ A;  2ZEE A;  5K8M A;  2ZED A;  2V8V A;  1TF8 A;  2POK A;  3QNV A;  2CTC A;  4OC1 A;  4ZI6 A;  1CPX A;  5HVH A;  4F9V A;  8CPA A;  2NYQ A;  3FH4 A;  2CF4 A;  2EWB A;  3NA6 A;  3WAB A;  1LAM A;  4MRI A;  3RAM A;  3D7G A;  4OC4 A;  1ELL P;  2ZEL A;  3KHZ A;  3FED A;  3KI9 A;  4WJB A;  1IY7 A;  1XBU A;  3K9T A;  4NFR A;  4IK2 A;  1ZG9 A;  3ISZ A;  3H8G A;  3S9N A;  5IB9 A;  2EK9 A;  2QVP A;  3GLJ A;  1R43 A;  5HXD A;  3S9L A;  4OC0 A;  4B6Z A;  4F9U A;  2PJ9 A;  2JBJ A;  1YW6 A;  1DE4 C;  3B7I A;  1BAV A;  4MCQ A;  1QMU A;  2PJ7 A;  3HLP A;  3DGV A;  1XRY A;  5ELY A;  3RBU A;  1VHO A;  2AFS A;  2C1C A;  1TF9 A;  4YU9 A;  1KWM A;  5CBM A;  3PEI A;  4EWT A;  3PFO A;  3MN8 A;  4X2T A;  4FWU A;  3IFE A;  1Y0Y A;  4OP4 A;  2PJC A;  3CPX A;  1YLO A;  1FT7 A;  1ZG7 A;  2F8H A;  5JGF A;  4ZY2 A;  5LYL A;  4P4F A;  5DS0 A;  1PCA A;  4W9Y A;  2ABZ A;  1CP6 A;  2PRQ A;  3KZW A;  5LRJ A;  4FUU A;  4MCP A;  3SJG A;  4MXU A;  3GB0 A;  4P44 A;  1LCP A;  2V8D A;  4TNU A;  5D8N A;  1F2O A;  3D7H A;  5K8P A;  3BXM A;  3V7Z A;  1F57 A;  2O4H A;  3IO1 A;  4TWE A;  1ARM A;  1OBR A;  4A39 A;  2IMO A;  3LWU A;  1CPS A;  7CPA A;  4K3N A;  2HB6 A;  4OC3 A;  1M4L A;  4JZ0 A;  1LOK A;  1YME A;  1VIX A;  4MMO A;  1BPN A;  2PJ1 A;  3K2K A;  2IJZ A;  3KAS A;  4MCR A;  4G1P A;  4P45 A;  3CDX A;  1LAN A;  4YWY A;  3S9M A;  3T8W A;  5LYF A;  3CT9 A;  2OOT A;  2C6C A;  1ZG8 A;  3PB6 X;  6CPA A;  1Z8L A;  2GU2 A;  2XEF A;  4R76 A;  1BLL E;  2NSM A;  4NGT A;  3NFZ A;  2C6G A;  3DLJ A;  1Z2L A;  2AFO A;  3D66 A;  1YSJ A;  5LRG A;  4A37 A;  4X8I A;  1RTQ A;  4NGM A;  2ZEH A;  3RZA A;  3WC7 A;  3PBE A;  4O23 A;  2PJ3 A;  4IAV A;  1Z5R A;  2JBK A;  4GM5 A;  2PVW A;  1TXR A;  3BI1 A;  4UEF A;  3H8F A;  2PJ0 A;  4NGR A;  3WT4 A;  3KL9 A;  2G9D A;  4MHY A;  4OC5 A;  2ZEF A;  2ZEO A;  2J9A A;  4R6T A;  5JM6 A;  3H8E A;  3TC8 A;  2PJ8 A;  4A94 A;  3B3C A;  1PYT B;  3VAT A;  2AFM A;  3I1U A;  1H8L A;  3FVL A;  4MHN A;  1AMP A;  1ELM P;  3PB8 X;  4EFD A;  3VH9 A;  3NH8 A;  2PCU A;  3LMS A;  3B3W A;  2I3C A;  3PB9 X;  5HVF A;  4ZYQ A;  4NGP A;  1CX8 A;  2OR4 A;  4ZY1 A;  2V77 A;  4UIA A;  1TKH A;  2FVG A;  4PXD A;  2CIJ A;  3KR4 A;  3JRU A;  4NJR A;  4UEE A;  4WWV A;  3CPA A;  4PXE A;  4R7M A;  1GYT A;  4P6Y A;  5F09 A;  2ZEP A;  1TKF A;  3D67 A;  4KSI A;  2RFH A;  1CP7 A;  4OIW A;  4DUK A;  3FMC A;  3WC6 A;  3MRU A;  3IIB A;  2PJA A;  4FBE A;  4NGN A;  4MHZ A;  2PJ5 A;  3ISX A;  3KHX A;  4P10 A;  5LYI A;  1HDQ A;  4P4E A;  3SJX A;  1XJO A;  3SJF A;  4AXV A;  4P4D A;  4NGQ A;  1EE3 P;  4OC2 A;  2PVV A;  4NJQ A;  5K8N A;  3HUV A;  4DJL A;  4IHM A;  3L2N A;  3V38 A;  2PIZ A;  1TKJ A;  1ZLI A;  3BI0 A;  4NGS A;  3SI0 A;  1R3N A;  3WC5 A;  4PXB A;  2V8G A;  4OID A;  3PB7 X;  1JQG A;  3IC1 A;  1Y0R A;  1VHE A;  2F7V A;  4F8Z A;  5HVG A;  4LQG A;  4PXC A;  3PFE A;  2EK8 A;  3B35 A;  3FEE A;  2ZEN A;  3FEC A;  1XMB A;  5D29 A;  4PPZ A;  2ZEM A; 
#chains in the Genus database with same CATH topology
 4R3K A;  3SJE A;  2PJ2 A;  3V8I A;  2CTB A;  1DTD A;  2PSW A;  4CGP A;  5J1Q A;  1MJA A;  2V8H A;  4MFL A;  1CBX A;  4CAW A;  3EFA A;  1LFW A;  4OAE A;  4UEZ A;  4RS2 A;  2AFW A;  1Z8W A;  5G21 A;  2VL1 A;  1YQE A;  1ARL A;  1QQ9 A;  2Q43 A;  3W6S A;  2QEC A;  3IWG A;  4MFQ A;  4U5Y A;  4H2K A;  1Z8X A;  3H4Q A;  3GY9 A;  5LYD A;  3QB8 A;  4A38 A;  2CNM A;  4OME A;  3ZJ0 A;  5THW A;  2ZW5 A;  4RI1 A;  5DWN A;  3FF3 A;  4Q38 A;  4X3R A;  3D68 A;  2PJB A;  2RB7 A;  1S3Z A;  5JH9 A;  5LRK A;  4DYO A;  2ZOG A;  4RUH A;  2BOA A;  1CJW A;  1ZLH A;  1S7F A;  1YVO A;  1UWY A;  2D4O A;  3FB3 A;  3K9U A;  1NSA A;  1XIX A;  3N7Z A;  2EO8 A;  1FNO A;  4P4J A;  4UIB A;  3IEH A;  3IJ3 A;  2B58 A;  2O53 A;  3NH4 A;  2AJ6 A;  2Z0Z A;  2PE3 A;  4JYW A;  5JPH A;  2Z3L A;  2ANP A;  1KUY A;  1IGB A;  1X12 A;  1K4J A;  2AFU A;  2XEJ A;  3B2Y A;  2ZEG A;  5I4M A;  4CPA A;  2EVN A;  3SI1 A;  2PIY A;  3N5F A;  2YNE A;  2Q4Z A;  4ONW A;  4ZY0 A;  4ZX8 A;  2EBJ A;  4C2Z A;  2JEW A;  3R9G A;  2XEG A;  1Q2Y A;  3B8G A;  4XNH B;  2AFX A;  1B6B A;  4BMH A;  2WPW A;  3R1K A;  3SI2 A;  1YGH A;  3BHX A;  5F46 A;  1HDU A;  2AFZ A;  2DF5 A;  4KSF A;  3EO4 A;  3TX8 A;  4Y49 B;  1AYE A;  1U6M A;  2FE7 A;  2PRB A;  2PDO A;  4YFJ A;  5IX3 A;  1Q7L A;  2PR8 A;  3DNS A;  3KGQ A;  1KUV A;  3B3S A;  3CXP A;  3PRT A;  5AGE A;  4F0X A;  2Q04 A;  4MHP A;  2QJ8 A;  4A2Z A;  4KOS A;  4MY3 A;  1QSM A;  2DEA A;  4F6A A;  3PBB A;  4ZX9 A;  2OZH A;  2BO9 A;  2CNS A;  2ZOF A;  2WZN A;  3B3T A;  5CPA A;  4YGO A;  2C6P A;  4R8F A;  4KLW A;  4BD9 A;  5IB0 A;  2PJ6 A;  1FY7 A;  3JVN A;  3D7F A;  3GUX A;  4MCS A;  4J3G A;  3VWE A;  4C68 A;  2X7B A;  1F2P A;  3GKR A;  4AG9 A;  1VGY A;  3VAR A;  1ON0 A;  3FX6 A;  1BPM A;  2HUZ A;  1CG2 A;  3RNZ A;  5ISV A;  1XFO A;  3KR5 A;  1YLE A;  2Q4Y A;  1WWZ A;  2HC9 A;  2CY2 A;  3B3V A;  2R1I A;  1VKC A;  4EME A;  4PSX A;  2BSW A;  2Q51 A;  2REE A;  3D4U A;  2DPT A;  4P4I A;  3I3G A;  3D7D A;  4OKO A;  2WYR A;  4B5P A;  5K8O A;  4OLL A;  5AG4 A;  4R9M A;  4P4B A;  4HNY B;  2GLF A;  3KQX A;  4Z65 A;  3EC4 A;  3TOB A;  5BWA B;  4X5K A;  3IWW A;  4CGM A;  2PJ4 A;  4PQA A;  4BBH A;  2GRE A;  2IQ6 A;  2YNC C;  3NH5 A;  3D2M A;  4H6Z A;  1LAP A;  5AG6 A;  2XEI A;  4A32 A;  1IOF A;  2QML A;  4MY0 A;  4FD4 A;  2VXK A;  2BCO A;  4Q7A A;  4K30 A;  1Y7E A;  3EXN A;  1HEE A;  2G3A A;  2P6G A;  2FIW A;  1TIQ A;  2QYV A;  4FD7 A;  4KZT A;  4FAI A;  4KVO E;  4R57 A;  2G0B A;  2RC4 A;  3FJU A;  4UWJ A;  4IF5 A;  4CYQ A;  2A4N A;  2J8R A;  4UF4 A;  2Z11 A;  2AE6 A;  1QST A;  2GLJ A;  1Z4E A;  5HH1 A;  1IB1 E;  1YW4 A;  1IID A;  3PB4 X;  3KQZ A;  3LOD A;  2ZEE A;  2JLM A;  2B3U A;  1XEB A;  5K8M A;  4XPL A;  4B10 A;  2R8V A;  2ZED A;  5EBV A;  2V8V A;  4DNC A;  4R87 A;  2B5G B;  1TF8 A;  2POK A;  2PQ8 A;  3QNV A;  3MGD A;  3TO7 A;  4KSA A;  2CTC A;  4OC1 A;  4ZI6 A;  1CPX A;  5HVH A;  4F9V A;  5J8F A;  8CPA A;  2G3T A;  2NYQ A;  2DPS A;  2P6E A;  4PK2 A;  3FH4 A;  2CF4 A;  4KOR A;  2EWB A;  3BJ8 A;  3NA6 A;  3WAB A;  1LAM A;  4MRI A;  3RAM A;  3D7G A;  4JWP A;  3NE8 A;  4OC4 A;  3W6X A;  1KUX A;  4F0Y A;  1ELL P;  4M6I A;  3IU2 A;  4QVT A;  2ZEL A;  3C26 A;  4H6U A;  2CNT A;  3KHZ A;  3JTK A;  4JD6 A;  3EY5 A;  1Z8T A;  3FED A;  3KI9 A;  4WJB A;  1IY7 A;  1XBU A;  4CS0 B;  4I49 A;  3RYO A;  3K9T A;  4NFR A;  3QAY A;  3A9L A;  3F8K A;  2HQY A;  2ODF A;  4IK2 A;  1ZG9 A;  3ISZ A;  3H8G A;  3S9N A;  1QSR A;  3DR8 A;  5IB9 A;  2EK9 A;  2QVP A;  3GLJ A;  1R43 A;  4HKF A;  5HXD A;  3LAC A;  3S9L A;  4M85 A;  5H86 A;  2OZG A;  4MFJ A;  3T90 A;  4OC0 A;  4B11 A;  4B6Z A;  4F9U A;  1NE9 A;  2PJ9 A;  5G20 A;  4NSQ A;  1I12 A;  1S60 A;  1V0C A;  2FXF A;  2B4B A;  2P0W A;  2JBJ A;  4MHD A;  1M1D A;  1S5K A;  2ATR A;  2VQY A;  1YW6 A;  1DE4 C;  3BLN A;  2FS5 A;  3B7I A;  3F0A A;  4XPD C;  1BAV A;  5G1Z A;  3WR7 A;  4QBJ A;  2JDC A;  4KOY A;  2BL1 A;  1JWQ A;  1QMU A;  2J8N A;  4KLV A;  1AUG A;  3E0K A;  4MCQ A;  4YRH A;  4JXR A;  1X10 A;  2PJ7 A;  3G8W A;  3HLP A;  4ZBG A;  3T9Y A;  4C7I A;  2EUI A;  1ZO0 A;  4MI4 A;  4R3L A;  5CNP A;  1S7N A;  1N71 A;  3DGV A;  3CZX A;  1XRY A;  4A30 A;  1M4I A;  4UCN A;  4L89 A;  5ELY A;  3RBU A;  1YK3 A;  5EC4 A;  1VHO A;  2AFS A;  4OAD A;  1Z9U A;  4KOV A;  2C1C A;  1B87 A;  1TF9 A;  4YU9 A;  1KWM A;  3RO0 A;  5CBM A;  4Q36 A;  2IL4 A;  3PEI A;  4UBR A;  1BO4 A;  4MFZ A;  3PFO A;  4EWT A;  3MN8 A;  4X2T A;  4FWU A;  5GCN A;  3JUW A;  3IFE A;  1Y0Y A;  4OP4 A;  2PJC A;  3CPX A;  1YLO A;  1FT7 A;  1ZG7 A;  4GXH A;  1QSO A;  1UFH A;  2GAN A;  4QB9 A;  4UFX A;  4B12 A;  4B5P B;  2F8H A;  5JGF A;  3FBU A;  4ZY2 A;  5LYL A;  4P4F A;  4CGL A;  4MJ8 A;  4UFV A;  1PUA A;  1PCA A;  1Q2C A;  5DS0 A;  4E0A A;  1VHS A;  4W9Y A;  2ABZ A;  1CP6 A;  2PRQ A;  3KZW A;  5LRJ A;  4FUU A;  4MCP A;  4XPK A;  3SJG A;  2B4D A;  2KCW A;  4MXU A;  3GB0 A;  1BOB A;  5A27 A;  4P44 A;  1LCP A;  2V8D A;  4TNU A;  5D8N A;  1F2O A;  4M6H A;  3D7H A;  5K8P A;  1M4G A;  2Z3M A;  3BXM A;  4JJX A;  4KS9 A;  4C2X A;  1GHE A;  2PC1 A;  5F48 A;  5JQ4 A;  3V7Z A;  1F57 A;  4FD6 A;  2O4H A;  3P2H A;  3IO1 A;  4TWE A;  4RN7 A;  2OZU A;  3IU1 A;  1ARM A;  4BIN A;  1OBR A;  4QC6 A;  4A39 A;  2I79 A;  2IMO A;  3LWU A;  1CPS A;  7CPA A;  4U9Y A;  4AVC A;  3FNC A;  4K3N A;  2HB6 A;  4AVA A;  1KZF A;  4ZGY B;  4KOX A;  4OC3 A;  1M4L A;  4JZ0 A;  3S6G A;  1LOK A;  3TT2 A;  4AB7 A;  1YME A;  1VIX A;  5IV0 A;  5H84 A;  4MMO A;  1XOV A;  4B13 A;  3ZZI A;  2CXA A;  1BPN A;  2Q0Y A;  2PJ1 A;  4UA3 A;  3TO6 A;  2D4P A;  3K2K A;  3W91 A;  1IYK A;  2IJZ A;  3H5Z A;  2GE3 A;  4CRY B;  2Z10 A;  3TE4 A;  3KAS A;  4MCR A;  2FSR A;  2Q4V A;  4G1P A;  1P4N A;  4P45 A;  3GIU A;  5DWM A;  2YND A;  3CDX A;  1LAN A;  4YWY A;  1R57 A;  3I9S A;  3S9M A;  3T8W A;  5LYF A;  3CT9 A;  1XE4 A;  5HMN A;  2OOT A;  2C6C A;  1ZG8 A;  3PB6 X;  4KOU A;  6CPA A;  3TOA A;  2ZPA A;  1I21 A;  1Z8L A;  2GU2 A;  4CGN A;  2XEF A;  5C88 A;  4R76 A;  1BLL E;  1S7L A;  2NSM A;  3DDD A;  4NGT A;  3NFZ A;  2C6G A;  2H5M A;  3DLJ A;  1Z2L A;  2AFO A;  3D66 A;  1YSJ A;  4NXY A;  5LRG A;  4A37 A;  1Q2D A;  4X8I A;  2PR1 A;  1RTQ A;  1RO5 A;  2DXQ A;  2FL4 A;  1NSL A;  4NGM A;  5KTC A;  4KOW A;  1NMT A;  2ZEH A;  2Q7S A;  3RZA A;  3S6K A;  4MFP A;  3PBE A;  1P0H A;  3OWC A;  4U9Z A;  4O23 A;  3TCV A;  3WC7 A;  2PJ3 A;  1Z5R A;  2JBK A;  4IAV A;  4GM5 A;  2PVW A;  2ZW7 A;  2ZXV A;  4CYO A;  1TXR A;  3BI1 A;  4KUA A;  4UEF A;  5AG5 A;  4NEX A;  1CM0 A;  3H8F A;  4CAF A;  2PJ0 A;  2OU2 A;  4NGR A;  1I1D A;  3WT4 A;  4CRZ B;  3D8P A;  3KL9 A;  2FCK A;  3FYN A;  4H89 A;  2G9D A;  2P6F A;  2VEZ A;  4MHY A;  4OC5 A;  3SHP A;  2ZEF A;  2ZEO A;  2I00 A;  4CAE A;  2J9A A;  4R6T A;  3DR6 A;  2WUU A;  5JM6 A;  4AG7 A;  2Q44 A;  2OB0 A;  3H8E A;  5AG7 A;  3TC8 A;  2PJ8 A;  1IYL A;  4A94 A;  4M3S A;  1LRZ A;  2B5G A;  3B3C A;  3F5B A;  2BEI A;  4XPD B;  2VI7 A;  1PYT B;  1XF8 A;  4ORF A;  3VAT A;  4EVY A;  2AFM A;  1L0C A;  5EMI A;  4E8O A;  1IOI A;  3I1U A;  4KVM E;  4AVB A;  5I0C A;  2Z3O A;  1Y9W A;  1H8L A;  3FVL A;  4ONU A;  4L8A A;  4MHN A;  1AMP A;  1ELM P;  3PB8 X;  4C2Y A;  4EFD A;  3VH9 A;  3NH8 A;  2PCU A;  1M4D A;  5KTD A;  3LMS A;  1WK4 A;  1A2Z A;  5KTA A;  1RXT A;  2B4D B;  2Z3P A;  4C7H A;  3B3W A;  2O28 A;  2I3C A;  3PB9 X;  4M6G A;  4PSW A;  2R98 A;  4MFK A;  5HVF A;  4ZYQ A;  4NGP A;  4NF1 A;  3CXQ A;  1YR0 A;  1CX8 A;  3CXS A;  4B5O A;  2OR4 A;  3BJ7 A;  2GFQ A;  1SQH A;  4ZY1 A;  2V77 A;  4UIA A;  1TKH A;  2FVG A;  2K5T A;  4PXD A;  2CIJ A;  1YVK A;  3KR4 A;  3JRU A;  4NJR A;  4UEE A;  1QSN A;  4CGO A;  4XNH C;  3KKW A;  3LD2 A;  2OH1 A;  4LQ6 A;  4WWV A;  3VWD A;  3CPA A;  4PXE A;  4R7M A;  1GYT A;  3UY5 A;  3G3S A;  4P6Y A;  2FT0 A;  2JEV A;  3IGR A;  5F09 A;  2ZEP A;  4Y49 C;  3PZJ A;  1TKF A;  2WSA A;  3R9F A;  3D67 A;  2R7H A;  5G22 A;  2VZZ A;  4CAX A;  2JDD A;  4KVX A;  4KSI A;  4UWI A;  3FIX A;  5E96 A;  2RFH A;  2VZY A;  1CP7 A;  2F5I A;  1M44 A;  2ZW6 A;  3FXT A;  4LUA A;  4OIW A;  4HNW B;  3FMC A;  4DUK A;  4LX9 A;  3S6H A;  2Y0M A;  3WC6 A;  3SXN A;  3MRU A;  3R96 A;  4E2A A;  2FIA A;  2PJA A;  3IIB A;  3PGP A;  4FBE A;  4NGN A;  5J8C A;  1Z4R A;  4MHZ A;  2PJ5 A;  4MBU A;  3TTH A;  4NCZ A;  3ISX A;  3IWE A;  3KHX A;  4GS4 A;  4P10 A;  2B3V A;  5LYI A;  1HDQ A;  4P4E A;  2Q7B A;  4UCM A;  1IU8 A;  2QIR A;  4PK3 A;  3QAH A;  3D2P A;  4UFW A;  3SJX A;  2WPX A;  1XJO A;  3PP9 A;  3SJF A;  3D3S A;  4AXV A;  4P4D A;  4NGQ A;  2VBQ A;  1MJ9 A;  2ARH A;  2Z3K A;  1EE3 P;  4QUS A;  4OC2 A;  3GYA A;  2PVV A;  2REF A;  4A33 A;  4A95 A;  1J4J A;  4NJQ A;  5K8N A;  3TFY A;  3HUV A;  3S6F A;  4KOT A;  5FVJ A;  1Y7R A;  2YGW A;  4DJL A;  4HPS A;  4IHM A;  3R9E A;  3L2N A;  4JXQ A;  3R95 A;  2BUE A;  3V38 A;  2PIZ A;  1TKJ A;  1ZLI A;  3BI0 A;  3FRM A;  4NGS A;  2Z3N A;  2J8M A;  3SI0 A;  1R3N A;  4FD5 A;  3WC5 A;  5C82 A;  4PXB A;  1Y9K A;  1S7K A;  5F47 A;  2V8G A;  4OID A;  3PB7 X;  4CYP A;  1JQG A;  4JLY A;  3IC1 A;  4CAV A;  1Y0R A;  3DSB A;  1YX0 A;  1VHE A;  2C27 A;  1IIC A;  1PU9 A;  2F7V A;  2HV2 A;  4F8Z A;  5HVG A;  1MJB A;  4LQG A;  4PXC A;  3PFE A;  4CYN A;  3SXO A;  2EK8 A;  2GIV A;  2NMT A;  5F49 A;  2ZW4 A;  3B35 A;  3FEE A;  2ZEN A;  3P2F A;  4HNX B;  3FEC A;  4KUB A;  1XMB A;  2YNC A;  3TO9 A;  5D29 A;  4UCP A;  4PV6 A;  4A31 A;  5A28 A;  4II9 A;  3NE7 A;  4B14 A;  1YRE A;  1XMT A;  4PPZ A;  4IUS A;  1OZP A;  2ZEM A;  1MK4 A; 
#chains in the Genus database with same CATH homology
 3SJE A;  2PJ2 A;  2CTB A;  1DTD A;  5J1Q A;  2V8H A;  1CBX A;  1LFW A;  4UEZ A;  2AFW A;  2VL1 A;  1ARL A;  1QQ9 A;  2Q43 A;  4H2K A;  5LYD A;  4A38 A;  4OME A;  5THW A;  3FF3 A;  4X3R A;  3D68 A;  2PJB A;  2RB7 A;  5JH9 A;  5LRK A;  4DYO A;  2ZOG A;  4RUH A;  2BOA A;  1ZLH A;  1UWY A;  1NSA A;  1FNO A;  4P4J A;  4UIB A;  3IEH A;  3IJ3 A;  2O53 A;  3NH4 A;  2PE3 A;  4JYW A;  2ANP A;  1IGB A;  2AFU A;  2XEJ A;  3B2Y A;  5I4M A;  2ZEG A;  4CPA A;  3SI1 A;  2PIY A;  3N5F A;  4ONW A;  2Q4Z A;  4ZY0 A;  4ZX8 A;  2JEW A;  2XEG A;  2AFX A;  3SI2 A;  3BHX A;  1HDU A;  2AFZ A;  3TX8 A;  1AYE A;  1Q7L A;  3KGQ A;  3B3S A;  3PRT A;  4MHP A;  2QJ8 A;  2DEA A;  3PBB A;  4ZX9 A;  2BO9 A;  2ZOF A;  2WZN A;  3B3T A;  5CPA A;  4BD9 A;  2C6P A;  4R8F A;  2PJ6 A;  3D7F A;  3GUX A;  4MCS A;  1F2P A;  1VGY A;  3VAR A;  3FX6 A;  1BPM A;  1CG2 A;  1XFO A;  3KR5 A;  2HC9 A;  3B3V A;  4EME A;  2Q51 A;  3D4U A;  4P4I A;  3D7D A;  4OKO A;  2WYR A;  5K8O A;  4P4B A;  2GLF A;  3KQX A;  4Z65 A;  3IWW A;  2PJ4 A;  4PQA A;  2GRE A;  2IQ6 A;  3NH5 A;  1LAP A;  2XEI A;  2BCO A;  4Q7A A;  1Y7E A;  1HEE A;  2QYV A;  4FAI A;  3FJU A;  4UF4 A;  2GLJ A;  1YW4 A;  3PB4 X;  3KQZ A;  2ZEE A;  5K8M A;  2ZED A;  2V8V A;  1TF8 A;  2POK A;  3QNV A;  2CTC A;  4OC1 A;  4ZI6 A;  1CPX A;  5HVH A;  4F9V A;  8CPA A;  2NYQ A;  3FH4 A;  2CF4 A;  2EWB A;  3NA6 A;  3WAB A;  1LAM A;  4MRI A;  3RAM A;  3D7G A;  4OC4 A;  1ELL P;  2ZEL A;  3KHZ A;  3FED A;  3KI9 A;  4WJB A;  1IY7 A;  1XBU A;  3K9T A;  4NFR A;  4IK2 A;  1ZG9 A;  3ISZ A;  3H8G A;  3S9N A;  5IB9 A;  2EK9 A;  2QVP A;  3GLJ A;  1R43 A;  5HXD A;  3S9L A;  4OC0 A;  4B6Z A;  4F9U A;  2PJ9 A;  2JBJ A;  1YW6 A;  1DE4 C;  3B7I A;  1BAV A;  4MCQ A;  1QMU A;  2PJ7 A;  3HLP A;  3DGV A;  1XRY A;  5ELY A;  3RBU A;  1VHO A;  2AFS A;  2C1C A;  1TF9 A;  4YU9 A;  1KWM A;  5CBM A;  3PEI A;  4EWT A;  3PFO A;  3MN8 A;  4X2T A;  4FWU A;  3IFE A;  1Y0Y A;  4OP4 A;  2PJC A;  3CPX A;  1YLO A;  1FT7 A;  1ZG7 A;  2F8H A;  5JGF A;  4ZY2 A;  5LYL A;  4P4F A;  5DS0 A;  1PCA A;  4W9Y A;  2ABZ A;  1CP6 A;  2PRQ A;  3KZW A;  5LRJ A;  4FUU A;  4MCP A;  3SJG A;  4MXU A;  3GB0 A;  4P44 A;  1LCP A;  2V8D A;  4TNU A;  5D8N A;  1F2O A;  3D7H A;  5K8P A;  3BXM A;  3V7Z A;  1F57 A;  2O4H A;  3IO1 A;  4TWE A;  1ARM A;  1OBR A;  4A39 A;  2IMO A;  3LWU A;  1CPS A;  7CPA A;  4K3N A;  2HB6 A;  4OC3 A;  1M4L A;  4JZ0 A;  1LOK A;  1YME A;  1VIX A;  4MMO A;  1BPN A;  2PJ1 A;  3K2K A;  2IJZ A;  3KAS A;  4MCR A;  4G1P A;  4P45 A;  3CDX A;  1LAN A;  4YWY A;  3S9M A;  3T8W A;  5LYF A;  3CT9 A;  2OOT A;  2C6C A;  1ZG8 A;  3PB6 X;  6CPA A;  1Z8L A;  2GU2 A;  2XEF A;  4R76 A;  1BLL E;  2NSM A;  4NGT A;  3NFZ A;  2C6G A;  3DLJ A;  1Z2L A;  2AFO A;  3D66 A;  1YSJ A;  5LRG A;  4A37 A;  4X8I A;  1RTQ A;  4NGM A;  2ZEH A;  3RZA A;  3WC7 A;  3PBE A;  4O23 A;  2PJ3 A;  4IAV A;  1Z5R A;  2JBK A;  4GM5 A;  2PVW A;  1TXR A;  3BI1 A;  4UEF A;  3H8F A;  2PJ0 A;  4NGR A;  3WT4 A;  3KL9 A;  2G9D A;  4MHY A;  4OC5 A;  2ZEF A;  2ZEO A;  2J9A A;  4R6T A;  5JM6 A;  3H8E A;  3TC8 A;  2PJ8 A;  4A94 A;  3B3C A;  1PYT B;  3VAT A;  2AFM A;  3I1U A;  1H8L A;  3FVL A;  4MHN A;  1AMP A;  1ELM P;  3PB8 X;  4EFD A;  3VH9 A;  3NH8 A;  2PCU A;  3LMS A;  3B3W A;  2I3C A;  3PB9 X;  5HVF A;  4ZYQ A;  4NGP A;  1CX8 A;  2OR4 A;  4ZY1 A;  2V77 A;  4UIA A;  1TKH A;  2FVG A;  4PXD A;  2CIJ A;  3KR4 A;  3JRU A;  4NJR A;  4UEE A;  4WWV A;  3CPA A;  4PXE A;  4R7M A;  1GYT A;  4P6Y A;  5F09 A;  2ZEP A;  1TKF A;  3D67 A;  4KSI A;  2RFH A;  1CP7 A;  4OIW A;  4DUK A;  3FMC A;  3WC6 A;  3MRU A;  3IIB A;  2PJA A;  4FBE A;  4NGN A;  4MHZ A;  2PJ5 A;  3ISX A;  3KHX A;  4P10 A;  5LYI A;  1HDQ A;  4P4E A;  3SJX A;  1XJO A;  3SJF A;  4AXV A;  4P4D A;  4NGQ A;  1EE3 P;  4OC2 A;  2PVV A;  4NJQ A;  5K8N A;  3HUV A;  4DJL A;  4IHM A;  3L2N A;  3V38 A;  2PIZ A;  1TKJ A;  1ZLI A;  3BI0 A;  4NGS A;  3SI0 A;  1R3N A;  3WC5 A;  4PXB A;  2V8G A;  4OID A;  3PB7 X;  1JQG A;  3IC1 A;  1Y0R A;  1VHE A;  2F7V A;  4F8Z A;  5HVG A;  4LQG A;  4PXC A;  3PFE A;  2EK8 A;  3B35 A;  3FEE A;  2ZEN A;  3FEC A;  1XMB A;  5D29 A;  4PPZ A;  2ZEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...