4L8AA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l8aA00
2PQ8A 2REFA 2ZXVA 5J8FA 1S3ZA 1I12A 2BEIA 3VWDA 2PR8A 5KTDA 2QECA 4CS0B 5IB0A 2GANA 3BJ8A 4B5PA 2F5IA 1B6BA 3P2FA 4U9YA 4OAEA 3DDDA 1KUYA 3BLNA 4ORFA 5C82A 2K5TA 4Y49C 4IF5A 4JWPA 2IL4A 1WK4A 3TOBA 2D4PA 4OLLA 1VKCA 1MJ9A 1ON0A 3PZJA 3TTHA 2QIRA 4KLVA 3F0AA 2WPXA 5FVJA 4CRZB 1YREA 2FS5A 1IYLA 4RI1A 4JXRA 2AJ6A 3T9YA 1KZFA 2VEZA 2G0BA 4ZBGA 2I79A 2B4DB 4YGOA 1IB1E 2JDCA 5CNPA 3GKRA 1L0CA 5IV0A 1S60A 1Z9UA 1I1DA 4PK3A 1QSOA 4AVCA 5H84A 1XIXA 4HNXB 1YLEA 2HQYA 4CRYB 2NMTA 2HUZA 2ARHA 3TO7A 3IGRA 1LRZA 5DWNA 4KOVA 3R9GA 3SXOA 3TOAA 3TT2A 1SQHA 1S7LA 1MJAA 5HH1A 1M1DA 3G8WA 1YVOA 3DR6A 4PK2A 3DSBA 4FD6A 5I0CA 4LUAA 2PRBA 3RYOA 1PU9A 3H4QA 3LODA 2OB0A 4KUBA 4KOXA 1M4DA 2VXKA 4NCZA 1YX0A 4NF1A 3ZZIA 1QSMA 4CAXA 3GY9A 2ZW7A 4R3LA 1Q2DA 2VZYA 1KUVA 3PGPA 2JDDA 4KLWA 3CXPA 4NEXA 4KORA 4XNHC 3FB3A 2FE7A 4PV6A 1M4GA 1NMTA 4XNHB 2CNMA 4NSQA 4ONUA 1S7NA 3P2HA 5H86A 4KOUA 4E8OA 4IUSA 3G3SA 1J4JA 2FT0A 4MHDA 2B5GA 1RO5A 3LD2A 3B8GA 1I21A 4QUSA 5KTCA 2OZGA 1B87A 4YFJA 2D4OA 2BUEA 1S7KA 3MGDA 3TO9A 1QSTA 4F0YA 1Y7RA 1FY7A 1M4IA 3ZJ0A 4UBRA 1OZPA 4Y49B 3V8IA 2OZUA 5DWMA 4MI4A 3EFAA 2CNTA 4UWJA 1N71A 2R8VA 3FNCA 3JVNA 3EXNA 2G3AA 2Q4YA 3OWCA 5JPHA 3GYAA 2DXQA 4E2AA 3W91A 3E0KA 5EBVA 5EC4A 5JQ4A 2RC4A 4MBUA 2EVNA 1BOBA 2EUIA 1U6MA 2BL1A 3TO6A 4HNYB 3D8PA 2Q7BA 5IX3A 2GIVA 3TE4A 3FYNA 4KOSA 3JUWA 2Q44A 2O28A 2WPWA 2B58A 3FIXA 1UFHA 3R95A 4B5PB 4MY3A 1R57A 3R9EA 4H89A 1IICA 3BJ7A 3FXTA 3PP9A 3N7ZA 4AVAA 1XEBA 4KVXA 4XPKA 3W6SA 3KKWA 1V0CA 2C27A 3I3GA 2CY2A 2G3TA 2R7HA 2ATRA 2B4BA 2AE6A 4PSXA 1P4NA 2OU2A 4KUAA 1PUAA 4FD5A 1CM0A 2VI7A 1IIDA 3D2MA 2FCKA 4M85A 1IYKA 1GHEA 1MK4A 4MJ8A 4R57A 4KVME 4L8AA 2FSRA 4B5OA 4QVTA 4HKFA 4DNCA 4H6UA 2FIWA 4PSWA 4JD6A 3S6GA 4GS4A 2P6GA 1QSRA 2FIAA 4I49A 3FRMA 3S6HA 4AG7A 4R3KA 2R98A 3NE7A 4QB9A 1MJBA 1K4JA 2B4DA 1YGHA 4KOTA 2J8MA 5E96A 4BMHA 1XF8A 2CNSA 3VWEA 2FXFA 4EVYA 2A4NA 2P6FA 4UA3A 4H6ZA 4KOWA 2B3UA 2QMLA 2Q0YA 4AG9A 1YR0A 4K30A 3SXNA 3DR8A 4XPLA 3CXQA 3EC4A 1KUXA 1QSNA 5HMNA 4KVOE 1M44A 2KCWA 2Q04A 4LX9A 1NE9A 4F6AA 2R1IA 4R9MA 1Z4EA 3D3SA 2OH1A 2Z10A 4AB7A 1P0HA 1S5KA 4HNWB 4CAVA 5F48A 1Y9WA 2BSWA 3R9FA 4L89A 3UY5A 2Z0ZA 3QB8A 2VZZA 4OADA 4U9ZA 5C88A 1YK3A 2PC1A 4CAWA 4MY0A 5ISVA 4NXYA 1TIQA 2HV2A 2H5MA 3S6FA 4II9A 2B5GB 3TFYA 5GCNA 1Q2YA 3T90A 2J8NA 2VBQA 2J8RA 3TCVA 5J8CA 4YRHA 2PDOA 1NSLA 2JEVA 1Y9KA 3F8KA 5F49A 3S6KA 5KTAA 1Z4RA 3FBUA 2ZW4A 2Z11A 3D2PA 1VHSA 3F5BA 4JLYA 4AVBA 4XPDC 2ZW5A 3QAHA 4M3SA 1WWZA 1YVKA 4KOYA 3CXSA 3K9UA 4XPDB 3W6XA 2X7BA 5F47A 2ZW6A 4RS2A 3C26A 4X5KA 2FL4A 1Q2CA 4FD4A 2P6EA 2VQYA 4QBJA 4UWIA 4E0AA 2PSWA 2PR1A 3EY5A 5F46A 2Q4VA 3I9SA 4FD7A 2I00A 3R1KA 2JLMA 2REEA 3SHPA 3WR7A 2GE3A 4KZTA 3R96A 2Y0MA 1S7FA 3IWGA 2P0WA 1BO4A 4QC6A 2OZHA 4U5YA 4JXQA 4J3GA 3DNSA 4JJXA 1XE4A 1XMTA 1CJWA 2ZPAA 4R87A 1RXTA 3EO4A 2B3VA
chains in the Genus database with same CATH superfamily
1XFOA 2PQ8A 2REFA 4JZ0A 2ZXVA 4FWUA 3B3VA 1S3ZA 1ZG7A 5J8FA 1I12A 2BEIA 3VWDA 2PR8A 5KTDA 3IC1A 4A39A 1IU8A 2CF4A 2QECA 1CBXA 4OC0A 4CS0B 3RO0A 2CIJA 1VHEA 2GANA 5IB0A 2QYVA 3BJ8A 6CPAA 4B5PA 1OBRA 3GB0A 2AFWA 3KI9A 2F5IA 1B6BA 3P2FA 4NGMA 3JTKA 4BBHA 3NH4A 4U9YA 3PFOA 4A2ZA 4OAEA 3DDDA 1KUYA 3BLNA 1LFWA 3H8GA 4ORFA 5C82A 4LQ6A 2K5TA 4MCQA 4IF5A 4Y49C 3BXMA 4JWPA 1FNOA 1UWYA 2CTBA 2IL4A 4G1PA 1CP6A 1WK4A 2D4PA 2PJ0A 1VKCA 2PRQA 4OLLA 3TOBA 1MJ9A 1ON0A 3PZJA 3TTHA 2O53A 4P4BA 2QIRA 3B2YA 4KLVA 3FVLA 4RUHA 3JRUA 2GLJA 2ZEGA 1LAMA 3F0AA 1F57A 2QVPA 2WPXA 2OOTA 3V38A 1ZO0A 3D67A 1Y7EA 4CAFA 5IB9A 3PB6X 4A30A 4ZGYB 2PJ5A 5FVJA 5THWA 4CRZB 1YREA 2FS5A 4MFPA 4MHPA 1IYLA 5JM6A 2I3CA 4IHMA 4CGLA 2YNCA 4RI1A 4JXRA 2AJ6A 3T9YA 3WABA 3QNVA 2PJ3A 1ZG8A 4DYOA 1KZFA 2VEZA 2G0BA 4ZBGA 4MFQA 1RTQA 2I79A 3IWWA 4EFDA 4UEEA 2Z3LA 2B4DB 3D4UA 4NGQA 3K9TA 3T8WA 4CGOA 1DE4C 4PXDA 4M6HA 4YGOA 4BINA 2EK9A 1IB1E 2JDCA 5CNPA 3GKRA 1L0CA 3IIBA 4F8ZA 3H8FA 5IV0A 1M4LA 1S60A 1Z9UA 1I1DA 4MHNA 4PK3A 1QSOA 2PJ6A 1BAVA 5HVFA 5H84A 4AVCA 1XIXA 4HNXB 1YLEA 2HQYA 4CRYB 2NMTA 2HUZA 1X12A 2ARHA 5DS0A 3TO7A 3IGRA 4UCNA 1LRZA 2JBKA 5D8NA 5DWNA 4KOVA 4O23A 2GLFA 3R9GA 5D29A 3SXOA 3VATA 1ARMA 3TOAA 1VIXA 4R7MA 4C2YA 3TT2A 1SQHA 1S7LA 4R8FA 2ZEEA 1JQGA 4A33A 5K8PA 3SJGA 1MJAA 2ZEDA 4F9VA 5HH1A 4A37A 1M1DA 2EWBA 3G8WA 1YVOA 3DR6A 1R43A 4C68A 4PK2A 2PIZA 3DSBA 3CT9A 1XOVA 4FD6A 5I0CA 4LUAA 2PRBA 3FMCA 4RN7A 3RYOA 1PU9A 3H4QA 3LODA 2Q51A 4OMEA 2OB0A 4HPSA 4KUBA 5HVHA 4KOXA 1X10A 2XEFA 3KQXA 4UCMA 1M4DA 2VXKA 5BWAB 2YNCC 4NCZA 2O4HA 2GREA 3KGQA 5HVGA 2V8GA 3SI0A 1YX0A 4ZYQA 1NSAA 4NF1A 3ZZIA 1QSMA 4CAXA 5A27A 3S9LA 1TF8A 3GY9A 2NYQA 2ZW7A 4FBEA 3IJ3A 4R3LA 1Q2DA 4H2KA 3BHXA 2VZYA 4OC3A 3HLPA 3RAMA 3IU1A 4ZY1A 1KUVA 3KHXA 4JYWA 2ZOGA 3K2KA 2PE3A 3PGPA 2JDDA 4KLWA 2G9DA 2POKA 1QMUA 3RNZA 3CXPA 4Q7AA 4NEXA 4EMEA 7CPAA 1ELLP 4KORA 4P4EA 4XNHC 4CAEA 5G1ZA 4A94A 1F2OA 3FB3A 4MFKA 1CPSA 4B6ZA 2FE7A 1LAPA 2ZEFA 4OIWA 4PV6A 1M4GA 4UCPA 1NMTA 4XNHB 2CNMA 5G20A 4NSQA 1TKHA 4ONUA 1S7NA 3P2HA 5H86A 4KOUA 1HDUA 2CXAA 4GM5A 4NGPA 4E8OA 1KWMA 4IUSA 3G3SA 1J4JA 1YQEA 2BCOA 2FT0A 4MHDA 1XMBA 2QJ8A 4ONWA 1TF9A 3PBBA 2HB6A 1DTDA 1RO5A 2B5GA 3B8GA 3IEHA 3LD2A 1I21A 1XJOA 4QUSA 4C7IA 5KTCA 4W9YA 4A32A 2OZGA 1B87A 3CZXA 4P44A 4YFJA 3SJFA 2D4OA 1VGYA 2BUEA 2C1CA 1S7KA 4FAIA 3MGDA 2EK8A 4C7HA 4TWEA 3SJEA 3TO9A 5LRGA 1QSTA 4F0YA 1JWQA 1Y7RA 2ZELA 4X2TA 1FY7A 4MCSA 1Y0YA 1M4IA 3RBUA 3ZJ0A 4CPAA 4UBRA 1OZPA 4Y49B 3V8IA 4B12A 4CGNA 2OZUA 3KHZA 5DWMA 2WUUA 4MI4A 4P4IA 3EFAA 4MHZA 4MFLA 4AXVA 5K8MA 2CNTA 2AFOA 4UWJA 4WWVA 2YNEA 1N71A 2R8VA 3FNCA 2PJBA 1Y0RA 2EO8A 2Z3KA 3EXNA 3JVNA 5K8NA 5LRJA 2G3AA 2Q4YA 3OWCA 4B13A 2PIYA 2Z3OA 4NJRA 4F9UA 5JPHA 1FT7A 3GYAA 2NSMA 4Q38A 2DXQA 1Z8WA 4X3RA 2DPTA 4NFRA 4UFVA 4E2AA 3W91A 2ZENA 3E0KA 5JH9A 4KS9A 3I1UA 4NJQA 3FJUA 3D7GA 4NGNA 5EBVA 5EC4A 3H8EA 2Q43A 2Z3PA 5JQ4A 2RC4A 4MBUA 2EVNA 2DEAA 1PCAA 1BOBA 2AFXA 2C6GA 2EUIA 1U6MA 3KZWA 2BL1A 4R6TA 3TO6A 2YNDA 3NA6A 3B7IA 4HNYB 4UFXA 3D8PA 3FECA 3FH4A 2Q7BA 5IX3A 4ZX9A 3PB7X 2GIVA 3V7ZA 3FYNA 5A28A 2PVVA 3IWEA 4KOSA 4MMOA 3IO1A 3TE4A 3JUWA 2Q44A 3SI2A 2O28A 4PPZA 2WPWA 2IMOA 2B58A 3FIXA 3WC6A 1GYTA 1UFHA 2C6PA 3SI1A 3R95A 4B5PB 3B3WA 2RB7A 4MY3A 4TNUA 1R57A 3R9EA 1Q7LA 4H89A 4A38A 1IICA 2V8HA 3BJ7A 3FXTA 3FEEA 4NGSA 5EMIA 3PP9A 3N7ZA 3WC7A 4AVAA 2YGWA 1XEBA 3DLJA 1CG2A 2ODFA 4KVXA 1BLLE 4XPKA 3W6SA 3KKWA 1V0CA 2C27A 2WSAA 3D66A 3I3GA 4OC5A 1CPXA 2CY2A 2G3TA 3PRTA 1TKFA 2DF5A 2R7HA 3PB8X 4ZY0A 2AFMA 2ATRA 2B4BA 3MN8A 2PJ1A 2AE6A 2BOAA 1YSJA 4PSXA 4MHYA 3GLJA 1P4NA 2OU2A 3LACA 4KUAA 1PUAA 3KASA 4FD5A 2XEJA 4UF4A 5LYLA 1LCPA 2PJCA 3PEIA 3GUXA 4A95A 3BI1A 3RZAA 3NE8A 1CM0A 2VI7A 5J1QA 1IIDA 5AG6A 3NH5A 3D2MA 2JBJA 2FCKA 2VL1A 2Z3NA 3B3CA 4IK2A 4X8IA 4M85A 1IYKA 1GHEA 3ISZA 5LYDA 4EWTA 4KSAA 1MK4A 4MJ8A 4R57A 4A31A 1Z8XA 3NFZA 4KVME 4Q36A 4L8AA 4MCPA 2XEGA 3CPAA 3D7HA 3PB4X 1Z8TA 1LANA 4UFWA 2FSRA 4OC2A 4B5OA 4QVTA 4HKFA 5ELYA 3KL9A 4DNCA 1A2ZA 2Z3MA 5K8OA 4H6UA 2FIWA 3IFEA 4PSWA 4JD6A 3S6GA 4GS4A 2P6GA 1ZLHA 1QSRA 2FIAA 3B3SA 4I49A 4YWYA 3FRMA 2IQ6A 3S6HA 3SJXA 4AG7A 4R3KA 2PJ9A 2R98A 4MRIA 3NE7A 4QB9A 2RFHA 1MJBA 2PJ2A 4MFZA 1AMPA 2F8HA 1K4JA 2B4DA 1YGHA 3A9LA 4KOTA 2J8MA 3KR4A 3KR5A 2ABZA 5E96A 3PFEA 4BMHA 1XF8A 1CX8A 2CNSA 3VWEA 5LYFA 2FXFA 4EVYA 2A4NA 4OP4A 2P6FA 4MCRA 4NGTA 4UA3A 4H6ZA 4KOWA 2B3UA 5AG4A 2QMLA 2EBJA 2F7VA 2Q0YA 3LWUA 4AG9A 1H8LA 1YR0A 4K30A 3SXNA 1EE3P 3DR8A 2DPSA 4XPLA 5AG5A 2OR4A 3CXQA 4OIDA 3ISXA 3EC4A 4UIBA 1KUXA 1QSNA 1Z8LA 3FF3A 3FX6A 1IOIA 5HMNA 4KVOE 1M44A 2KCWA 2Q04A 3CPXA 4CYOA 4LX9A 1NE9A 4PXEA 4F6AA 2BO9A 4MFJA 2R1IA 4R9MA 1Z4EA 3S9NA 3D3SA 2OH1A 2Z10A 4AB7A 1IOFA 3N5FA 3WC5A 5LYIA 3B35A 5CBMA 1P0HA 1S5KA 2AFUA 1Z5RA 3TC8A 1IGBA 2PCUA 4HNWB 1ARLA 4UEZA 3QAYA 2J9AA 5F48A 4ZX8A 4CAVA 1Y9WA 2WYRA 2BSWA 5F09A 3IU2A 3R9FA 3LMSA 4F0XA 4C2XA 2ZEOA 4L89A 3UY5A 2GU2A 2V8DA 2Z0ZA 4UEFA 1PYTB 1ZLIA 2Q7SA 4OKOA 3NH8A 3QB8A 2VZZA 4OADA 4U9ZA 1ELMP 4PXCA 5C88A 4WJBA 4C2ZA 1YK3A 2PC1A 3HUVA 1XBUA 4CAWA 4MY0A 3WT4A 4OC1A 4CYNA 5ISVA 2HC9A 2ANPA 4NXYA 4B14A 1TIQA 2HV2A 5AG7A 5G22A 2H5MA 4P4FA 3B3TA 5JGFA 1HEEA 1YW6A 2PJ8A 2V77A 3S6FA 4CGMA 4DUKA 2B5GB 4II9A 4CGPA 1CP7A 5CPAA 3TFYA 5GCNA 4M6GA 1Q2YA 1QQ9A 3T90A 2J8NA 2Q4ZA 3VH9A 2VBQA 4P45A 2J8RA 1YLOA 2ZEMA 3TCVA 3PBEA 4ZI6A 5LRKA 5I4MA 5J8CA 4K3NA 2V8VA 4GXHA 4YRHA 2ZOFA 2PVWA 4OC4A 1IY7A 2PDOA 1NSLA 2JEVA 1AUGA 1Y9KA 1HDQA 3F8KA 5HXDA 2IJZA 1VHOA 5F49A 1LOKA 3S6KA 2PJ7A 3DGVA 4PQAA 5KTAA 1Z4RA 3FBUA 4FUUA 2ZW4A 2Z11A 4P4JA 2PJAA 3D2PA 4YU9A 1VHSA 3F5BA 4JLYA 1Z2LA 4AVBA 4XPDC 2ZEPA 2ZW5A 4M6IA 3QAHA 1AYEA 4M3SA 1WWZA 4P6YA 1YVKA 4KOYA 3BI0A 4R76A 1R3NA 3CXSA 3K9UA 4XPDB 3W6XA 4DJLA 1YW4A 1F2PA 2X7BA 2ZW6A 4P4DA 1YMEA 4RS2A 5F47A 4CYPA 3C26A 4X5KA 5AGEA 2FL4A 1Q2CA 4FD4A 4BD9A 2P6EA 2VQYA 4QBJA 4UWIA 4E0AA 2PSWA 2PR1A 3EY5A 2PJ4A 2Q4VA 3I9SA 4NGRA 4CYQA 5F46A 4FD7A 2I00A 3R1KA 8CPAA 3KQZA 2JLMA 2REEA 3SHPA 3D7FA 1BPMA 3WR7A 2GE3A 3VARA 4IAVA 5G21A 4P10A 4B10A 1TKJA 4KZTA 2WZNA 3R96A 3S9MA 2Y0MA 3CDXA 1S7FA 3D7DA 2JEWA 4B11A 3IWGA 2P0WA 2FVGA 4UIAA 4ZY2A 1BO4A 2CTCA 3D68A 3GIUA 4KSIA 2OZHA 4QC6A 4U5YA 2GFQA 3L2NA 3FEDA 4LQGA 3PB9X 4JXQA 4MXUA 4PXBA 2AFSA 4J3GA 4KSFA 3DNSA 4JJXA 1XE4A 1XRYA 1XMTA 1CJWA 2ZPAA 1TXRA 3H5ZA 4Z65A 2XEIA 2AFZA 2C6CA 4R87A 2ZEHA 1RXTA 3EO4A 3MRUA 3TX8A 1BPNA 2B3VA 1ZG9A
chains in the Genus database with same CATH topology
2PQ8A 2REFA 2ZXVA 5J8FA 1S3ZA 1I12A 2BEIA 3VWDA 2PR8A 5KTDA 2QECA 4CS0B 5IB0A 2GANA 3BJ8A 4B5PA 2F5IA 1B6BA 3P2FA 4BBHA 3JTKA 4U9YA 4A2ZA 4OAEA 3DDDA 1KUYA 3BLNA 4ORFA 5C82A 2K5TA 4Y49C 4IF5A 4JWPA 2IL4A 1WK4A 3TOBA 2D4PA 4OLLA 1VKCA 1MJ9A 1ON0A 3PZJA 3TTHA 2QIRA 4KLVA 3F0AA 2WPXA 1ZO0A 4CAFA 4A30A 4ZGYB 5FVJA 4CRZB 1YREA 2FS5A 4MFPA 1IYLA 4CGLA 2YNCA 4RI1A 4JXRA 2AJ6A 3T9YA 1KZFA 2VEZA 2G0BA 4ZBGA 4MFQA 2I79A 2Z3LA 2B4DB 4CGOA 4YGOA 1IB1E 2JDCA 5CNPA 3GKRA 1L0CA 5IV0A 1S60A 1Z9UA 1I1DA 4PK3A 1QSOA 4AVCA 5H84A 1XIXA 4HNXB 1YLEA 2HQYA 4CRYB 2NMTA 2HUZA 2ARHA 3TO7A 3IGRA 1LRZA 5DWNA 4KOVA 3R9GA 3SXOA 3TOAA 4C2YA 3TT2A 1SQHA 1S7LA 4A33A 1MJAA 5HH1A 1M1DA 3G8WA 1YVOA 3DR6A 4C68A 4PK2A 3DSBA 4FD6A 5I0CA 4LUAA 2PRBA 3RYOA 1PU9A 3H4QA 3LODA 2OB0A 4KUBA 4KOXA 4UCMA 1M4DA 2VXKA 5BWAB 2YNCC 4NCZA 1YX0A 4NF1A 3ZZIA 1QSMA 4CAXA 5A27A 3GY9A 2ZW7A 4R3LA 1Q2DA 2VZYA 3IU1A 1KUVA 3PGPA 2JDDA 4KLWA 3CXPA 4NEXA 4KORA 4XNHC 4CAEA 5G1ZA 3FB3A 4MFKA 2FE7A 4PV6A 1M4GA 4UCPA 1NMTA 4XNHB 2CNMA 5G20A 4NSQA 4ONUA 1S7NA 3P2HA 5H86A 4KOUA 2CXAA 4E8OA 4IUSA 3G3SA 1J4JA 2FT0A 4MHDA 2B5GA 1RO5A 3LD2A 3B8GA 1I21A 4QUSA 4C7IA 5KTCA 4A32A 2OZGA 1B87A 4YFJA 2D4OA 2BUEA 1S7KA 3MGDA 4C7HA 3TO9A 1QSTA 4F0YA 1Y7RA 1FY7A 1M4IA 3ZJ0A 4UBRA 1OZPA 4Y49B 3V8IA 4B12A 4CGNA 2OZUA 5DWMA 2WUUA 4MI4A 3EFAA 4MFLA 2CNTA 4UWJA 2YNEA 1N71A 2R8VA 3FNCA 3JVNA 2Z3KA 3EXNA 2G3AA 2Q4YA 3OWCA 4B13A 2Z3OA 5JPHA 3GYAA 4Q38A 2DXQA 2DPTA 4UFVA 4E2AA 3W91A 3E0KA 4KS9A 5EBVA 5EC4A 2Z3PA 5JQ4A 2RC4A 4MBUA 2EVNA 1BOBA 2EUIA 1U6MA 2BL1A 3TO6A 2YNDA 4HNYB 4UFXA 3D8PA 2Q7BA 5IX3A 2GIVA 5A28A 3FYNA 3TE4A 3IWEA 4KOSA 3JUWA 2Q44A 2O28A 2WPWA 2B58A 3FIXA 1UFHA 3R95A 4B5PB 4MY3A 1R57A 3R9EA 4H89A 1IICA 3BJ7A 3FXTA 3PP9A 3N7ZA 4AVAA 2YGWA 1XEBA 4KVXA 4XPKA 3W6SA 3KKWA 1V0CA 2C27A 2WSAA 3I3GA 2CY2A 2G3TA 2R7HA 2ATRA 2B4BA 2AE6A 4PSXA 1P4NA 2OU2A 4KUAA 1PUAA 4FD5A 4A95A 1CM0A 2VI7A 1IIDA 5AG6A 3D2MA 2Z3NA 2FCKA 4M85A 1IYKA 1GHEA 4KSAA 1MK4A 4MJ8A 4R57A 4A31A 4Q36A 4KVME 4L8AA 4UFWA 2FSRA 4B5OA 4QVTA 4HKFA 4DNCA 2Z3MA 4H6UA 2FIWA 4PSWA 4JD6A 3S6GA 4GS4A 2P6GA 1QSRA 2FIAA 4I49A 3FRMA 3S6HA 4AG7A 4R3KA 2R98A 3NE7A 4QB9A 1MJBA 4MFZA 1K4JA 2B4DA 1YGHA 3A9LA 4KOTA 2J8MA 5E96A 4BMHA 1XF8A 2CNSA 3VWEA 2FXFA 4EVYA 2A4NA 2P6FA 4UA3A 4H6ZA 4KOWA 2B3UA 5AG4A 2QMLA 2Q0YA 4AG9A 1YR0A 4K30A 3SXNA 3DR8A 2DPSA 4XPLA 5AG5A 3CXQA 3EC4A 1KUXA 1QSNA 5HMNA 4KVOE 1M44A 2KCWA 2Q04A 4CYOA 4LX9A 1NE9A 4F6AA 4MFJA 2R1IA 4R9MA 1Z4EA 3D3SA 2OH1A 2Z10A 4AB7A 1P0HA 1S5KA 4HNWB 4CAVA 5F48A 1Y9WA 2BSWA 3IU2A 3R9FA 4F0XA 4C2XA 4L89A 3UY5A 2Z0ZA 3QB8A 2VZZA 4OADA 4U9ZA 5C88A 4C2ZA 1YK3A 2PC1A 4CAWA 4MY0A 4CYNA 5ISVA 4NXYA 4B14A 1TIQA 2HV2A 5AG7A 5G22A 2H5MA 3S6FA 4CGMA 4II9A 2B5GB 4CGPA 3TFYA 5GCNA 1Q2YA 3T90A 2J8NA 2VBQA 2J8RA 3TCVA 5J8CA 4YRHA 2PDOA 1NSLA 2JEVA 1Y9KA 3F8KA 5F49A 3S6KA 5KTAA 1Z4RA 3FBUA 2ZW4A 2Z11A 3D2PA 1VHSA 3F5BA 4JLYA 4AVBA 4XPDC 2ZW5A 3QAHA 4M3SA 1WWZA 1YVKA 4KOYA 3CXSA 3K9UA 4XPDB 3W6XA 2X7BA 5F47A 2ZW6A 4CYPA 4RS2A 3C26A 4X5KA 5AGEA 2FL4A 1Q2CA 4FD4A 2P6EA 2VQYA 4QBJA 4UWIA 4E0AA 2PSWA 2PR1A 3EY5A 4CYQA 2Q4VA 3I9SA 5F46A 4FD7A 2I00A 3R1KA 2JLMA 2REEA 3SHPA 3WR7A 2GE3A 5G21A 4B10A 4KZTA 3R96A 2Y0MA 1S7FA 4B11A 3IWGA 2P0WA 1BO4A 4QC6A 2OZHA 4U5YA 4UCNA 4JXQA 4J3GA 4KSFA 3DNSA 4JJXA 1XE4A 1XMTA 1CJWA 2ZPAA 3H5ZA 4R87A 1RXTA 3EO4A 2B3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQ8 A;  2REF A;  2ZXV A;  5J8F A;  1S3Z A;  1I12 A;  2BEI A;  3VWD A;  2PR8 A;  5KTD A;  2QEC A;  4CS0 B;  5IB0 A;  2GAN A;  3BJ8 A;  4B5P A;  2F5I A;  1B6B A;  3P2F A;  4U9Y A;  4OAE A;  3DDD A;  1KUY A;  3BLN A;  4ORF A;  5C82 A;  2K5T A;  4Y49 C;  4IF5 A;  4JWP A;  2IL4 A;  1WK4 A;  3TOB A;  2D4P A;  4OLL A;  1VKC A;  1MJ9 A;  1ON0 A;  3PZJ A;  3TTH A;  2QIR A;  4KLV A;  3F0A A;  2WPX A;  5FVJ A;  4CRZ B;  1YRE A;  2FS5 A;  1IYL A;  4RI1 A;  4JXR A;  2AJ6 A;  3T9Y A;  1KZF A;  2VEZ A;  2G0B A;  4ZBG A;  2I79 A;  2B4D B;  4YGO A;  1IB1 E;  2JDC A;  5CNP A;  3GKR A;  1L0C A;  5IV0 A;  1S60 A;  1Z9U A;  1I1D A;  4PK3 A;  1QSO A;  4AVC A;  5H84 A;  1XIX A;  4HNX B;  1YLE A;  2HQY A;  4CRY B;  2NMT A;  2HUZ A;  2ARH A;  3TO7 A;  3IGR A;  1LRZ A;  5DWN A;  4KOV A;  3R9G A;  3SXO A;  3TOA A;  3TT2 A;  1SQH A;  1S7L A;  1MJA A;  5HH1 A;  1M1D A;  3G8W A;  1YVO A;  3DR6 A;  4PK2 A;  3DSB A;  4FD6 A;  5I0C A;  4LUA A;  2PRB A;  3RYO A;  1PU9 A;  3H4Q A;  3LOD A;  2OB0 A;  4KUB A;  4KOX A;  1M4D A;  2VXK A;  4NCZ A;  1YX0 A;  4NF1 A;  3ZZI A;  1QSM A;  4CAX A;  3GY9 A;  2ZW7 A;  4R3L A;  1Q2D A;  2VZY A;  1KUV A;  3PGP A;  2JDD A;  4KLW A;  3CXP A;  4NEX A;  4KOR A;  4XNH C;  3FB3 A;  2FE7 A;  4PV6 A;  1M4G A;  1NMT A;  4XNH B;  2CNM A;  4NSQ A;  4ONU A;  1S7N A;  3P2H A;  5H86 A;  4KOU A;  4E8O A;  4IUS A;  3G3S A;  1J4J A;  2FT0 A;  4MHD A;  2B5G A;  1RO5 A;  3LD2 A;  3B8G A;  1I21 A;  4QUS A;  5KTC A;  2OZG A;  1B87 A;  4YFJ A;  2D4O A;  2BUE A;  1S7K A;  3MGD A;  3TO9 A;  1QST A;  4F0Y A;  1Y7R A;  1FY7 A;  1M4I A;  3ZJ0 A;  4UBR A;  1OZP A;  4Y49 B;  3V8I A;  2OZU A;  5DWM A;  4MI4 A;  3EFA A;  2CNT A;  4UWJ A;  1N71 A;  2R8V A;  3FNC A;  3JVN A;  3EXN A;  2G3A A;  2Q4Y A;  3OWC A;  5JPH A;  3GYA A;  2DXQ A;  4E2A A;  3W91 A;  3E0K A;  5EBV A;  5EC4 A;  5JQ4 A;  2RC4 A;  4MBU A;  2EVN A;  1BOB A;  2EUI A;  1U6M A;  2BL1 A;  3TO6 A;  4HNY B;  3D8P A;  2Q7B A;  5IX3 A;  2GIV A;  3TE4 A;  3FYN A;  4KOS A;  3JUW A;  2Q44 A;  2O28 A;  2WPW A;  2B58 A;  3FIX A;  1UFH A;  3R95 A;  4B5P B;  4MY3 A;  1R57 A;  3R9E A;  4H89 A;  1IIC A;  3BJ7 A;  3FXT A;  3PP9 A;  3N7Z A;  4AVA A;  1XEB A;  4KVX A;  4XPK A;  3W6S A;  3KKW A;  1V0C A;  2C27 A;  3I3G A;  2CY2 A;  2G3T A;  2R7H A;  2ATR A;  2B4B A;  2AE6 A;  4PSX A;  1P4N A;  2OU2 A;  4KUA A;  1PUA A;  4FD5 A;  1CM0 A;  2VI7 A;  1IID A;  3D2M A;  2FCK A;  4M85 A;  1IYK A;  1GHE A;  1MK4 A;  4MJ8 A;  4R57 A;  4KVM E;  4L8A A;  2FSR A;  4B5O A;  4QVT A;  4HKF A;  4DNC A;  4H6U A;  2FIW A;  4PSW A;  4JD6 A;  3S6G A;  4GS4 A;  2P6G A;  1QSR A;  2FIA A;  4I49 A;  3FRM A;  3S6H A;  4AG7 A;  4R3K A;  2R98 A;  3NE7 A;  4QB9 A;  1MJB A;  1K4J A;  2B4D A;  1YGH A;  4KOT A;  2J8M A;  5E96 A;  4BMH A;  1XF8 A;  2CNS A;  3VWE A;  2FXF A;  4EVY A;  2A4N A;  2P6F A;  4UA3 A;  4H6Z A;  4KOW A;  2B3U A;  2QML A;  2Q0Y A;  4AG9 A;  1YR0 A;  4K30 A;  3SXN A;  3DR8 A;  4XPL A;  3CXQ A;  3EC4 A;  1KUX A;  1QSN A;  5HMN A;  4KVO E;  1M44 A;  2KCW A;  2Q04 A;  4LX9 A;  1NE9 A;  4F6A A;  2R1I A;  4R9M A;  1Z4E A;  3D3S A;  2OH1 A;  2Z10 A;  4AB7 A;  1P0H A;  1S5K A;  4HNW B;  4CAV A;  5F48 A;  1Y9W A;  2BSW A;  3R9F A;  4L89 A;  3UY5 A;  2Z0Z A;  3QB8 A;  2VZZ A;  4OAD A;  4U9Z A;  5C88 A;  1YK3 A;  2PC1 A;  4CAW A;  4MY0 A;  5ISV A;  4NXY A;  1TIQ A;  2HV2 A;  2H5M A;  3S6F A;  4II9 A;  2B5G B;  3TFY A;  5GCN A;  1Q2Y A;  3T90 A;  2J8N A;  2VBQ A;  2J8R A;  3TCV A;  5J8C A;  4YRH A;  2PDO A;  1NSL A;  2JEV A;  1Y9K A;  3F8K A;  5F49 A;  3S6K A;  5KTA A;  1Z4R A;  3FBU A;  2ZW4 A;  2Z11 A;  3D2P A;  1VHS A;  3F5B A;  4JLY A;  4AVB A;  4XPD C;  2ZW5 A;  3QAH A;  4M3S A;  1WWZ A;  1YVK A;  4KOY A;  3CXS A;  3K9U A;  4XPD B;  3W6X A;  2X7B A;  5F47 A;  2ZW6 A;  4RS2 A;  3C26 A;  4X5K A;  2FL4 A;  1Q2C A;  4FD4 A;  2P6E A;  2VQY A;  4QBJ A;  4UWI A;  4E0A A;  2PSW A;  2PR1 A;  3EY5 A;  5F46 A;  2Q4V A;  3I9S A;  4FD7 A;  2I00 A;  3R1K A;  2JLM A;  2REE A;  3SHP A;  3WR7 A;  2GE3 A;  4KZT A;  3R96 A;  2Y0M A;  1S7F A;  3IWG A;  2P0W A;  1BO4 A;  4QC6 A;  2OZH A;  4U5Y A;  4JXQ A;  4J3G A;  3DNS A;  4JJX A;  1XE4 A;  1XMT A;  1CJW A;  2ZPA A;  4R87 A;  1RXT A;  3EO4 A;  2B3V A; 
#chains in the Genus database with same CATH topology
 1XFO A;  2PQ8 A;  2REF A;  4JZ0 A;  2ZXV A;  4FWU A;  3B3V A;  1S3Z A;  1ZG7 A;  5J8F A;  1I12 A;  2BEI A;  3VWD A;  2PR8 A;  5KTD A;  3IC1 A;  4A39 A;  1IU8 A;  2CF4 A;  2QEC A;  1CBX A;  4OC0 A;  4CS0 B;  3RO0 A;  2CIJ A;  1VHE A;  2GAN A;  5IB0 A;  2QYV A;  3BJ8 A;  6CPA A;  4B5P A;  1OBR A;  3GB0 A;  2AFW A;  3KI9 A;  2F5I A;  1B6B A;  3P2F A;  4NGM A;  3JTK A;  4BBH A;  3NH4 A;  4U9Y A;  3PFO A;  4A2Z A;  4OAE A;  3DDD A;  1KUY A;  3BLN A;  1LFW A;  3H8G A;  4ORF A;  5C82 A;  4LQ6 A;  2K5T A;  4MCQ A;  4IF5 A;  4Y49 C;  3BXM A;  4JWP A;  1FNO A;  1UWY A;  2CTB A;  2IL4 A;  4G1P A;  1CP6 A;  1WK4 A;  2D4P A;  2PJ0 A;  1VKC A;  2PRQ A;  4OLL A;  3TOB A;  1MJ9 A;  1ON0 A;  3PZJ A;  3TTH A;  2O53 A;  4P4B A;  2QIR A;  3B2Y A;  4KLV A;  3FVL A;  4RUH A;  3JRU A;  2GLJ A;  2ZEG A;  1LAM A;  3F0A A;  1F57 A;  2QVP A;  2WPX A;  2OOT A;  3V38 A;  1ZO0 A;  3D67 A;  1Y7E A;  4CAF A;  5IB9 A;  3PB6 X;  4A30 A;  4ZGY B;  2PJ5 A;  5FVJ A;  5THW A;  4CRZ B;  1YRE A;  2FS5 A;  4MFP A;  4MHP A;  1IYL A;  5JM6 A;  2I3C A;  4IHM A;  4CGL A;  2YNC A;  4RI1 A;  4JXR A;  2AJ6 A;  3T9Y A;  3WAB A;  3QNV A;  2PJ3 A;  1ZG8 A;  4DYO A;  1KZF A;  2VEZ A;  2G0B A;  4ZBG A;  4MFQ A;  1RTQ A;  2I79 A;  3IWW A;  4EFD A;  4UEE A;  2Z3L A;  2B4D B;  3D4U A;  4NGQ A;  3K9T A;  3T8W A;  4CGO A;  1DE4 C;  4PXD A;  4M6H A;  4YGO A;  4BIN A;  2EK9 A;  1IB1 E;  2JDC A;  5CNP A;  3GKR A;  1L0C A;  3IIB A;  4F8Z A;  3H8F A;  5IV0 A;  1M4L A;  1S60 A;  1Z9U A;  1I1D A;  4MHN A;  4PK3 A;  1QSO A;  2PJ6 A;  1BAV A;  5HVF A;  5H84 A;  4AVC A;  1XIX A;  4HNX B;  1YLE A;  2HQY A;  4CRY B;  2NMT A;  2HUZ A;  1X12 A;  2ARH A;  5DS0 A;  3TO7 A;  3IGR A;  4UCN A;  1LRZ A;  2JBK A;  5D8N A;  5DWN A;  4KOV A;  4O23 A;  2GLF A;  3R9G A;  5D29 A;  3SXO A;  3VAT A;  1ARM A;  3TOA A;  1VIX A;  4R7M A;  4C2Y A;  3TT2 A;  1SQH A;  1S7L A;  4R8F A;  2ZEE A;  1JQG A;  4A33 A;  5K8P A;  3SJG A;  1MJA A;  2ZED A;  4F9V A;  5HH1 A;  4A37 A;  1M1D A;  2EWB A;  3G8W A;  1YVO A;  3DR6 A;  1R43 A;  4C68 A;  4PK2 A;  2PIZ A;  3DSB A;  3CT9 A;  1XOV A;  4FD6 A;  5I0C A;  4LUA A;  2PRB A;  3FMC A;  4RN7 A;  3RYO A;  1PU9 A;  3H4Q A;  3LOD A;  2Q51 A;  4OME A;  2OB0 A;  4HPS A;  4KUB A;  5HVH A;  4KOX A;  1X10 A;  2XEF A;  3KQX A;  4UCM A;  1M4D A;  2VXK A;  5BWA B;  2YNC C;  4NCZ A;  2O4H A;  2GRE A;  3KGQ A;  5HVG A;  2V8G A;  3SI0 A;  1YX0 A;  4ZYQ A;  1NSA A;  4NF1 A;  3ZZI A;  1QSM A;  4CAX A;  5A27 A;  3S9L A;  1TF8 A;  3GY9 A;  2NYQ A;  2ZW7 A;  4FBE A;  3IJ3 A;  4R3L A;  1Q2D A;  4H2K A;  3BHX A;  2VZY A;  4OC3 A;  3HLP A;  3RAM A;  3IU1 A;  4ZY1 A;  1KUV A;  3KHX A;  4JYW A;  2ZOG A;  3K2K A;  2PE3 A;  3PGP A;  2JDD A;  4KLW A;  2G9D A;  2POK A;  1QMU A;  3RNZ A;  3CXP A;  4Q7A A;  4NEX A;  4EME A;  7CPA A;  1ELL P;  4KOR A;  4P4E A;  4XNH C;  4CAE A;  5G1Z A;  4A94 A;  1F2O A;  3FB3 A;  4MFK A;  1CPS A;  4B6Z A;  2FE7 A;  1LAP A;  2ZEF A;  4OIW A;  4PV6 A;  1M4G A;  4UCP A;  1NMT A;  4XNH B;  2CNM A;  5G20 A;  4NSQ A;  1TKH A;  4ONU A;  1S7N A;  3P2H A;  5H86 A;  4KOU A;  1HDU A;  2CXA A;  4GM5 A;  4NGP A;  4E8O A;  1KWM A;  4IUS A;  3G3S A;  1J4J A;  1YQE A;  2BCO A;  2FT0 A;  4MHD A;  1XMB A;  2QJ8 A;  4ONW A;  1TF9 A;  3PBB A;  2HB6 A;  1DTD A;  1RO5 A;  2B5G A;  3B8G A;  3IEH A;  3LD2 A;  1I21 A;  1XJO A;  4QUS A;  4C7I A;  5KTC A;  4W9Y A;  4A32 A;  2OZG A;  1B87 A;  3CZX A;  4P44 A;  4YFJ A;  3SJF A;  2D4O A;  1VGY A;  2BUE A;  2C1C A;  1S7K A;  4FAI A;  3MGD A;  2EK8 A;  4C7H A;  4TWE A;  3SJE A;  3TO9 A;  5LRG A;  1QST A;  4F0Y A;  1JWQ A;  1Y7R A;  2ZEL A;  4X2T A;  1FY7 A;  4MCS A;  1Y0Y A;  1M4I A;  3RBU A;  3ZJ0 A;  4CPA A;  4UBR A;  1OZP A;  4Y49 B;  3V8I A;  4B12 A;  4CGN A;  2OZU A;  3KHZ A;  5DWM A;  2WUU A;  4MI4 A;  4P4I A;  3EFA A;  4MHZ A;  4MFL A;  4AXV A;  5K8M A;  2CNT A;  2AFO A;  4UWJ A;  4WWV A;  2YNE A;  1N71 A;  2R8V A;  3FNC A;  2PJB A;  1Y0R A;  2EO8 A;  2Z3K A;  3EXN A;  3JVN A;  5K8N A;  5LRJ A;  2G3A A;  2Q4Y A;  3OWC A;  4B13 A;  2PIY A;  2Z3O A;  4NJR A;  4F9U A;  5JPH A;  1FT7 A;  3GYA A;  2NSM A;  4Q38 A;  2DXQ A;  1Z8W A;  4X3R A;  2DPT A;  4NFR A;  4UFV A;  4E2A A;  3W91 A;  2ZEN A;  3E0K A;  5JH9 A;  4KS9 A;  3I1U A;  4NJQ A;  3FJU A;  3D7G A;  4NGN A;  5EBV A;  5EC4 A;  3H8E A;  2Q43 A;  2Z3P A;  5JQ4 A;  2RC4 A;  4MBU A;  2EVN A;  2DEA A;  1PCA A;  1BOB A;  2AFX A;  2C6G A;  2EUI A;  1U6M A;  3KZW A;  2BL1 A;  4R6T A;  3TO6 A;  2YND A;  3NA6 A;  3B7I A;  4HNY B;  4UFX A;  3D8P A;  3FEC A;  3FH4 A;  2Q7B A;  5IX3 A;  4ZX9 A;  3PB7 X;  2GIV A;  3V7Z A;  3FYN A;  5A28 A;  2PVV A;  3IWE A;  4KOS A;  4MMO A;  3IO1 A;  3TE4 A;  3JUW A;  2Q44 A;  3SI2 A;  2O28 A;  4PPZ A;  2WPW A;  2IMO A;  2B58 A;  3FIX A;  3WC6 A;  1GYT A;  1UFH A;  2C6P A;  3SI1 A;  3R95 A;  4B5P B;  3B3W A;  2RB7 A;  4MY3 A;  4TNU A;  1R57 A;  3R9E A;  1Q7L A;  4H89 A;  4A38 A;  1IIC A;  2V8H A;  3BJ7 A;  3FXT A;  3FEE A;  4NGS A;  5EMI A;  3PP9 A;  3N7Z A;  3WC7 A;  4AVA A;  2YGW A;  1XEB A;  3DLJ A;  1CG2 A;  2ODF A;  4KVX A;  1BLL E;  4XPK A;  3W6S A;  3KKW A;  1V0C A;  2C27 A;  2WSA A;  3D66 A;  3I3G A;  4OC5 A;  1CPX A;  2CY2 A;  2G3T A;  3PRT A;  1TKF A;  2DF5 A;  2R7H A;  3PB8 X;  4ZY0 A;  2AFM A;  2ATR A;  2B4B A;  3MN8 A;  2PJ1 A;  2AE6 A;  2BOA A;  1YSJ A;  4PSX A;  4MHY A;  3GLJ A;  1P4N A;  2OU2 A;  3LAC A;  4KUA A;  1PUA A;  3KAS A;  4FD5 A;  2XEJ A;  4UF4 A;  5LYL A;  1LCP A;  2PJC A;  3PEI A;  3GUX A;  4A95 A;  3BI1 A;  3RZA A;  3NE8 A;  1CM0 A;  2VI7 A;  5J1Q A;  1IID A;  5AG6 A;  3NH5 A;  3D2M A;  2JBJ A;  2FCK A;  2VL1 A;  2Z3N A;  3B3C A;  4IK2 A;  4X8I A;  4M85 A;  1IYK A;  1GHE A;  3ISZ A;  5LYD A;  4EWT A;  4KSA A;  1MK4 A;  4MJ8 A;  4R57 A;  4A31 A;  1Z8X A;  3NFZ A;  4KVM E;  4Q36 A;  4L8A A;  4MCP A;  2XEG A;  3CPA A;  3D7H A;  3PB4 X;  1Z8T A;  1LAN A;  4UFW A;  2FSR A;  4OC2 A;  4B5O A;  4QVT A;  4HKF A;  5ELY A;  3KL9 A;  4DNC A;  1A2Z A;  2Z3M A;  5K8O A;  4H6U A;  2FIW A;  3IFE A;  4PSW A;  4JD6 A;  3S6G A;  4GS4 A;  2P6G A;  1ZLH A;  1QSR A;  2FIA A;  3B3S A;  4I49 A;  4YWY A;  3FRM A;  2IQ6 A;  3S6H A;  3SJX A;  4AG7 A;  4R3K A;  2PJ9 A;  2R98 A;  4MRI A;  3NE7 A;  4QB9 A;  2RFH A;  1MJB A;  2PJ2 A;  4MFZ A;  1AMP A;  2F8H A;  1K4J A;  2B4D A;  1YGH A;  3A9L A;  4KOT A;  2J8M A;  3KR4 A;  3KR5 A;  2ABZ A;  5E96 A;  3PFE A;  4BMH A;  1XF8 A;  1CX8 A;  2CNS A;  3VWE A;  5LYF A;  2FXF A;  4EVY A;  2A4N A;  4OP4 A;  2P6F A;  4MCR A;  4NGT A;  4UA3 A;  4H6Z A;  4KOW A;  2B3U A;  5AG4 A;  2QML A;  2EBJ A;  2F7V A;  2Q0Y A;  3LWU A;  4AG9 A;  1H8L A;  1YR0 A;  4K30 A;  3SXN A;  1EE3 P;  3DR8 A;  2DPS A;  4XPL A;  5AG5 A;  2OR4 A;  3CXQ A;  4OID A;  3ISX A;  3EC4 A;  4UIB A;  1KUX A;  1QSN A;  1Z8L A;  3FF3 A;  3FX6 A;  1IOI A;  5HMN A;  4KVO E;  1M44 A;  2KCW A;  2Q04 A;  3CPX A;  4CYO A;  4LX9 A;  1NE9 A;  4PXE A;  4F6A A;  2BO9 A;  4MFJ A;  2R1I A;  4R9M A;  1Z4E A;  3S9N A;  3D3S A;  2OH1 A;  2Z10 A;  4AB7 A;  1IOF A;  3N5F A;  3WC5 A;  5LYI A;  3B35 A;  5CBM A;  1P0H A;  1S5K A;  2AFU A;  1Z5R A;  3TC8 A;  1IGB A;  2PCU A;  4HNW B;  1ARL A;  4UEZ A;  3QAY A;  2J9A A;  5F48 A;  4ZX8 A;  4CAV A;  1Y9W A;  2WYR A;  2BSW A;  5F09 A;  3IU2 A;  3R9F A;  3LMS A;  4F0X A;  4C2X A;  2ZEO A;  4L89 A;  3UY5 A;  2GU2 A;  2V8D A;  2Z0Z A;  4UEF A;  1PYT B;  1ZLI A;  2Q7S A;  4OKO A;  3NH8 A;  3QB8 A;  2VZZ A;  4OAD A;  4U9Z A;  1ELM P;  4PXC A;  5C88 A;  4WJB A;  4C2Z A;  1YK3 A;  2PC1 A;  3HUV A;  1XBU A;  4CAW A;  4MY0 A;  3WT4 A;  4OC1 A;  4CYN A;  5ISV A;  2HC9 A;  2ANP A;  4NXY A;  4B14 A;  1TIQ A;  2HV2 A;  5AG7 A;  5G22 A;  2H5M A;  4P4F A;  3B3T A;  5JGF A;  1HEE A;  1YW6 A;  2PJ8 A;  2V77 A;  3S6F A;  4CGM A;  4DUK A;  2B5G B;  4II9 A;  4CGP A;  1CP7 A;  5CPA A;  3TFY A;  5GCN A;  4M6G A;  1Q2Y A;  1QQ9 A;  3T90 A;  2J8N A;  2Q4Z A;  3VH9 A;  2VBQ A;  4P45 A;  2J8R A;  1YLO A;  2ZEM A;  3TCV A;  3PBE A;  4ZI6 A;  5LRK A;  5I4M A;  5J8C A;  4K3N A;  2V8V A;  4GXH A;  4YRH A;  2ZOF A;  2PVW A;  4OC4 A;  1IY7 A;  2PDO A;  1NSL A;  2JEV A;  1AUG A;  1Y9K A;  1HDQ A;  3F8K A;  5HXD A;  2IJZ A;  1VHO A;  5F49 A;  1LOK A;  3S6K A;  2PJ7 A;  3DGV A;  4PQA A;  5KTA A;  1Z4R A;  3FBU A;  4FUU A;  2ZW4 A;  2Z11 A;  4P4J A;  2PJA A;  3D2P A;  4YU9 A;  1VHS A;  3F5B A;  4JLY A;  1Z2L A;  4AVB A;  4XPD C;  2ZEP A;  2ZW5 A;  4M6I A;  3QAH A;  1AYE A;  4M3S A;  1WWZ A;  4P6Y A;  1YVK A;  4KOY A;  3BI0 A;  4R76 A;  1R3N A;  3CXS A;  3K9U A;  4XPD B;  3W6X A;  4DJL A;  1YW4 A;  1F2P A;  2X7B A;  2ZW6 A;  4P4D A;  1YME A;  4RS2 A;  5F47 A;  4CYP A;  3C26 A;  4X5K A;  5AGE A;  2FL4 A;  1Q2C A;  4FD4 A;  4BD9 A;  2P6E A;  2VQY A;  4QBJ A;  4UWI A;  4E0A A;  2PSW A;  2PR1 A;  3EY5 A;  2PJ4 A;  2Q4V A;  3I9S A;  4NGR A;  4CYQ A;  5F46 A;  4FD7 A;  2I00 A;  3R1K A;  8CPA A;  3KQZ A;  2JLM A;  2REE A;  3SHP A;  3D7F A;  1BPM A;  3WR7 A;  2GE3 A;  3VAR A;  4IAV A;  5G21 A;  4P10 A;  4B10 A;  1TKJ A;  4KZT A;  2WZN A;  3R96 A;  3S9M A;  2Y0M A;  3CDX A;  1S7F A;  3D7D A;  2JEW A;  4B11 A;  3IWG A;  2P0W A;  2FVG A;  4UIA A;  4ZY2 A;  1BO4 A;  2CTC A;  3D68 A;  3GIU A;  4KSI A;  2OZH A;  4QC6 A;  4U5Y A;  2GFQ A;  3L2N A;  3FED A;  4LQG A;  3PB9 X;  4JXQ A;  4MXU A;  4PXB A;  2AFS A;  4J3G A;  4KSF A;  3DNS A;  4JJX A;  1XE4 A;  1XRY A;  1XMT A;  1CJW A;  2ZPA A;  1TXR A;  3H5Z A;  4Z65 A;  2XEI A;  2AFZ A;  2C6C A;  4R87 A;  2ZEH A;  1RXT A;  3EO4 A;  3MRU A;  3TX8 A;  1BPN A;  2B3V A;  1ZG9 A; 
#chains in the Genus database with same CATH homology
 2PQ8 A;  2REF A;  2ZXV A;  5J8F A;  1S3Z A;  1I12 A;  2BEI A;  3VWD A;  2PR8 A;  5KTD A;  2QEC A;  4CS0 B;  5IB0 A;  2GAN A;  3BJ8 A;  4B5P A;  2F5I A;  1B6B A;  3P2F A;  4BBH A;  3JTK A;  4U9Y A;  4A2Z A;  4OAE A;  3DDD A;  1KUY A;  3BLN A;  4ORF A;  5C82 A;  2K5T A;  4Y49 C;  4IF5 A;  4JWP A;  2IL4 A;  1WK4 A;  3TOB A;  2D4P A;  4OLL A;  1VKC A;  1MJ9 A;  1ON0 A;  3PZJ A;  3TTH A;  2QIR A;  4KLV A;  3F0A A;  2WPX A;  1ZO0 A;  4CAF A;  4A30 A;  4ZGY B;  5FVJ A;  4CRZ B;  1YRE A;  2FS5 A;  4MFP A;  1IYL A;  4CGL A;  2YNC A;  4RI1 A;  4JXR A;  2AJ6 A;  3T9Y A;  1KZF A;  2VEZ A;  2G0B A;  4ZBG A;  4MFQ A;  2I79 A;  2Z3L A;  2B4D B;  4CGO A;  4YGO A;  1IB1 E;  2JDC A;  5CNP A;  3GKR A;  1L0C A;  5IV0 A;  1S60 A;  1Z9U A;  1I1D A;  4PK3 A;  1QSO A;  4AVC A;  5H84 A;  1XIX A;  4HNX B;  1YLE A;  2HQY A;  4CRY B;  2NMT A;  2HUZ A;  2ARH A;  3TO7 A;  3IGR A;  1LRZ A;  5DWN A;  4KOV A;  3R9G A;  3SXO A;  3TOA A;  4C2Y A;  3TT2 A;  1SQH A;  1S7L A;  4A33 A;  1MJA A;  5HH1 A;  1M1D A;  3G8W A;  1YVO A;  3DR6 A;  4C68 A;  4PK2 A;  3DSB A;  4FD6 A;  5I0C A;  4LUA A;  2PRB A;  3RYO A;  1PU9 A;  3H4Q A;  3LOD A;  2OB0 A;  4KUB A;  4KOX A;  4UCM A;  1M4D A;  2VXK A;  5BWA B;  2YNC C;  4NCZ A;  1YX0 A;  4NF1 A;  3ZZI A;  1QSM A;  4CAX A;  5A27 A;  3GY9 A;  2ZW7 A;  4R3L A;  1Q2D A;  2VZY A;  3IU1 A;  1KUV A;  3PGP A;  2JDD A;  4KLW A;  3CXP A;  4NEX A;  4KOR A;  4XNH C;  4CAE A;  5G1Z A;  3FB3 A;  4MFK A;  2FE7 A;  4PV6 A;  1M4G A;  4UCP A;  1NMT A;  4XNH B;  2CNM A;  5G20 A;  4NSQ A;  4ONU A;  1S7N A;  3P2H A;  5H86 A;  4KOU A;  2CXA A;  4E8O A;  4IUS A;  3G3S A;  1J4J A;  2FT0 A;  4MHD A;  2B5G A;  1RO5 A;  3LD2 A;  3B8G A;  1I21 A;  4QUS A;  4C7I A;  5KTC A;  4A32 A;  2OZG A;  1B87 A;  4YFJ A;  2D4O A;  2BUE A;  1S7K A;  3MGD A;  4C7H A;  3TO9 A;  1QST A;  4F0Y A;  1Y7R A;  1FY7 A;  1M4I A;  3ZJ0 A;  4UBR A;  1OZP A;  4Y49 B;  3V8I A;  4B12 A;  4CGN A;  2OZU A;  5DWM A;  2WUU A;  4MI4 A;  3EFA A;  4MFL A;  2CNT A;  4UWJ A;  2YNE A;  1N71 A;  2R8V A;  3FNC A;  3JVN A;  2Z3K A;  3EXN A;  2G3A A;  2Q4Y A;  3OWC A;  4B13 A;  2Z3O A;  5JPH A;  3GYA A;  4Q38 A;  2DXQ A;  2DPT A;  4UFV A;  4E2A A;  3W91 A;  3E0K A;  4KS9 A;  5EBV A;  5EC4 A;  2Z3P A;  5JQ4 A;  2RC4 A;  4MBU A;  2EVN A;  1BOB A;  2EUI A;  1U6M A;  2BL1 A;  3TO6 A;  2YND A;  4HNY B;  4UFX A;  3D8P A;  2Q7B A;  5IX3 A;  2GIV A;  5A28 A;  3FYN A;  3TE4 A;  3IWE A;  4KOS A;  3JUW A;  2Q44 A;  2O28 A;  2WPW A;  2B58 A;  3FIX A;  1UFH A;  3R95 A;  4B5P B;  4MY3 A;  1R57 A;  3R9E A;  4H89 A;  1IIC A;  3BJ7 A;  3FXT A;  3PP9 A;  3N7Z A;  4AVA A;  2YGW A;  1XEB A;  4KVX A;  4XPK A;  3W6S A;  3KKW A;  1V0C A;  2C27 A;  2WSA A;  3I3G A;  2CY2 A;  2G3T A;  2R7H A;  2ATR A;  2B4B A;  2AE6 A;  4PSX A;  1P4N A;  2OU2 A;  4KUA A;  1PUA A;  4FD5 A;  4A95 A;  1CM0 A;  2VI7 A;  1IID A;  5AG6 A;  3D2M A;  2Z3N A;  2FCK A;  4M85 A;  1IYK A;  1GHE A;  4KSA A;  1MK4 A;  4MJ8 A;  4R57 A;  4A31 A;  4Q36 A;  4KVM E;  4L8A A;  4UFW A;  2FSR A;  4B5O A;  4QVT A;  4HKF A;  4DNC A;  2Z3M A;  4H6U A;  2FIW A;  4PSW A;  4JD6 A;  3S6G A;  4GS4 A;  2P6G A;  1QSR A;  2FIA A;  4I49 A;  3FRM A;  3S6H A;  4AG7 A;  4R3K A;  2R98 A;  3NE7 A;  4QB9 A;  1MJB A;  4MFZ A;  1K4J A;  2B4D A;  1YGH A;  3A9L A;  4KOT A;  2J8M A;  5E96 A;  4BMH A;  1XF8 A;  2CNS A;  3VWE A;  2FXF A;  4EVY A;  2A4N A;  2P6F A;  4UA3 A;  4H6Z A;  4KOW A;  2B3U A;  5AG4 A;  2QML A;  2Q0Y A;  4AG9 A;  1YR0 A;  4K30 A;  3SXN A;  3DR8 A;  2DPS A;  4XPL A;  5AG5 A;  3CXQ A;  3EC4 A;  1KUX A;  1QSN A;  5HMN A;  4KVO E;  1M44 A;  2KCW A;  2Q04 A;  4CYO A;  4LX9 A;  1NE9 A;  4F6A A;  4MFJ A;  2R1I A;  4R9M A;  1Z4E A;  3D3S A;  2OH1 A;  2Z10 A;  4AB7 A;  1P0H A;  1S5K A;  4HNW B;  4CAV A;  5F48 A;  1Y9W A;  2BSW A;  3IU2 A;  3R9F A;  4F0X A;  4C2X A;  4L89 A;  3UY5 A;  2Z0Z A;  3QB8 A;  2VZZ A;  4OAD A;  4U9Z A;  5C88 A;  4C2Z A;  1YK3 A;  2PC1 A;  4CAW A;  4MY0 A;  4CYN A;  5ISV A;  4NXY A;  4B14 A;  1TIQ A;  2HV2 A;  5AG7 A;  5G22 A;  2H5M A;  3S6F A;  4CGM A;  4II9 A;  2B5G B;  4CGP A;  3TFY A;  5GCN A;  1Q2Y A;  3T90 A;  2J8N A;  2VBQ A;  2J8R A;  3TCV A;  5J8C A;  4YRH A;  2PDO A;  1NSL A;  2JEV A;  1Y9K A;  3F8K A;  5F49 A;  3S6K A;  5KTA A;  1Z4R A;  3FBU A;  2ZW4 A;  2Z11 A;  3D2P A;  1VHS A;  3F5B A;  4JLY A;  4AVB A;  4XPD C;  2ZW5 A;  3QAH A;  4M3S A;  1WWZ A;  1YVK A;  4KOY A;  3CXS A;  3K9U A;  4XPD B;  3W6X A;  2X7B A;  5F47 A;  2ZW6 A;  4CYP A;  4RS2 A;  3C26 A;  4X5K A;  5AGE A;  2FL4 A;  1Q2C A;  4FD4 A;  2P6E A;  2VQY A;  4QBJ A;  4UWI A;  4E0A A;  2PSW A;  2PR1 A;  3EY5 A;  4CYQ A;  2Q4V A;  3I9S A;  5F46 A;  4FD7 A;  2I00 A;  3R1K A;  2JLM A;  2REE A;  3SHP A;  3WR7 A;  2GE3 A;  5G21 A;  4B10 A;  4KZT A;  3R96 A;  2Y0M A;  1S7F A;  4B11 A;  3IWG A;  2P0W A;  1BO4 A;  4QC6 A;  2OZH A;  4U5Y A;  4UCN A;  4JXQ A;  4J3G A;  4KSF A;  3DNS A;  4JJX A;  1XE4 A;  1XMT A;  1CJW A;  2ZPA A;  3H5Z A;  4R87 A;  1RXT A;  3EO4 A;  2B3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...