4L8AA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l8aA00
2R98A 4AB7A 3F5BA 2B4BA 2O28A 2Q04A 2Z10A 3FIXA 2PSWA 4CAVA 4EVYA 2JDDA 4E8OA 2VBQA 2GIVA 2OH1A 2BL1A 1MJAA 1YR0A 1S3ZA 1I12A 3TO7A 1YK3A 5CNPA 3R96A 2BUEA 3UY5A 5DWMA 4F6AA 1BOBA 5H84A 3TCVA 2REEA 1WK4A 3GYAA 2X7BA 4R3LA 3I9SA 3D3SA 1RO5A 1QSOA 1Y7RA 4HKFA 3G3SA 2B4DA 4H6ZA 3QAHA 3EC4A 4R9MA 3FB3A 4KLWA 3SXNA 4Y49C 3IGRA 1S7NA 4IF5A 1M4GA 1BO4A 3LODA 3R9GA 2PR1A 1R57A 1MJ9A 1YVOA 4KLVA 4RS2A 4YRHA 5H86A 3ZJ0A 1YLEA 2D4PA 3FXTA 2FIAA 3MGDA 4MY0A 2VZZA 2CNMA 4KVOE 4CAWA 3CXQA 5ISVA 4LX9A 4KORA 4AVBA 4KVME 5JPHA 2PRBA 1Z4EA 3OWCA 1I21A 3JUWA 1MK4A 1S7LA 2BSWA 2I79A 4I49A 1P0HA 2HV2A 4XPDC 4FD5A 1XE4A 4M85A 2OZUA 3S6FA 3JVNA 1FY7A 1VKCA 3R9FA 2PC1A 3F0AA 4MHDA 1GHEA 3I3GA 2KCWA 1J4JA 2FIWA 2RC4A 4KOUA 4XPDB 2CNSA 5I0CA 2B5GB 1S60A 4OAEA 2ZW5A 4NSQA 1IYKA 4JXRA 2REFA 1S5KA 2B3UA 3TTHA 2P0WA 3RYOA 1Y9KA 4AVCA 1PUAA 4FD6A 1IIDA 2Z11A 2B4DB 2P6FA 3LD2A 3R9EA 4MBUA 4KUAA 4HNXB 1ON0A 4PK2A 2Q7BA 2OZHA 3VWEA 3TOAA 4E2AA 1RXTA 4FD7A 4HNWB 4QUSA 3F8KA 1S7FA 4UWJA 3NE7A 1PU9A 2FSRA 4B5OA 1IICA 2FS5A 2HUZA 3IWGA 1Q2CA 2ZXVA 3QB8A 2QMLA 1XIXA 2Y0MA 2JDCA 2PR8A 1P4NA 2B5GA 3FBUA 4KOXA 4ORFA 1M4DA 4KOTA 4QC6A 3CXPA 3SHPA 3BJ8A 2GE3A 3W6XA 4K30A 2HQYA 5GCNA 3K9UA 5IB0A 1Q2DA 2J8NA 3E0KA 2FT0A 4E0AA 1NSLA 5F48A 5EBVA 4NXYA 4R3KA 4YGOA 5J8CA 2ZPAA 2H5MA 1CJWA 1Z4RA 2R1IA 4B5PA 3WR7A 3D8PA 1L0CA 3KKWA 1UFHA 2G0BA 2G3TA 4Y49B 2Q0YA 2QIRA 1M4IA 2R8VA 1OZPA 4AG7A 4PSWA 3TFYA 2WPWA 2OB0A 3TOBA 2VI7A 3DDDA 4UBRA 3FNCA 2A4NA 1YGHA 3VWDA 2ZW7A 4R87A 3DR6A 4CAXA 1KZFA 2ZW6A 4R57A 4ONUA 3R95A 4IUSA 1KUYA 2G3AA 2EUIA 4JXQA 2J8MA 3B8GA 2GANA 3EFAA 3G8WA 1IYLA 2J8RA 3FYNA 4KUBA 2VEZA 5KTAA 2VQYA 3T9YA 4MJ8A 1QSTA 4MY3A 2OU2A 4QVTA 4MI4A 4NF1A 3ZZIA 4H89A 4PV6A 2AJ6A 5E96A 1NMTA 2PQ8A 4NEXA 3W6SA 4LUAA 5HH1A 4OADA 2FE7A 4RI1A 2VXKA 1YVKA 4L89A 1WWZA 4X5KA 2Z0ZA 3DNSA 3S6HA 1CM0A 1LRZA 4JLYA 4B5PB 1YX0A 4CRYB 3TE4A 4GS4A 1Z9UA 4PSXA 4J3GA 1XEBA 4H6UA 2PDOA 1B6BA 3BLNA 4F0YA 2WPXA 3H4QA 4KZTA 4KOWA 4KVXA 1S7KA 3FRMA 4QB9A 5C82A 3N7ZA 4U5YA 4ZBGA 4AVAA 5KTDA 3P2FA 4KOVA 1V0CA 2DXQA 4II9A 5IV0A 2Q4VA 2CY2A 2CNTA 3PZJA 1M44A 3EXNA 5DWNA 4JD6A 4XPLA 1M1DA 1IB1E 2R7HA 1VHSA 4CS0B 2P6GA 3EO4A 3DSBA 3TO9A 3PP9A 5FVJA 1NE9A 1XF8A 2BEIA 3D2PA 3EY5A 4XPKA 3V8IA 1Q2YA 2C27A 5EC4A 2IL4A 2ATRA 5F49A 2P6EA 3C26A 5HMNA 4DNCA 5IX3A 1QSNA 3GKRA 2Q44A 1KUXA 4NCZA 4UWIA 2EVNA 4OLLA 3D2MA 3T90A 4L8AA 4JJXA 4JWPA 1Y9WA 3TO6A 3DR8A 2FXFA 2Q4YA 4U9YA 3CXSA 4AG9A 4YFJA 4HNYB 5F46A 1QSRA 1YREA 4M3SA 3S6GA 2D4OA 2K5TA 2JEVA 4XNHC 2I00A 1B87A 2VZYA 1N71A 4KOYA 1XMTA 2QECA 3GY9A 4FD4A 1K4JA 5F47A 3R1KA 5KTCA 3W91A 2B3VA 2AE6A 2FCKA 4KOSA 5C88A 1I1DA 1SQHA 2JLMA 3P2HA 2OZGA 4XNHB 1U6MA 4QBJA 4BMHA 2FL4A 4U9ZA 2ARHA 1QSMA 2F5IA 5JQ4A 3TT2A 3BJ7A 5J8FA 2NMTA 4PK3A 2ZW4A 3PGPA 1KUVA 4CRZB 3SXOA 2B58A 4UA3A 1MJBA 3S6KA 1TIQA
chains in the Genus database with same CATH superfamily
2R98A 4AB7A 3F5BA 2B4BA 2O28A 2Q04A 3WC6A 4P6YA 4X8IA 4B13A 2Z10A 3FIXA 2PSWA 3SJFA 1X12A 3I1UA 4CAVA 4EVYA 2JDDA 4E8OA 4ZY0A 4YWYA 4K3NA 2C6CA 4DYOA 2VBQA 2AFZA 2GIVA 2BL1A 2OH1A 1MJAA 1YR0A 5AG5A 3KR5A 1S3ZA 3NFZA 2ANPA 1I12A 2DEAA 3TO7A 1YK3A 2BCOA 3IWWA 4Q38A 5CNPA 2BUEA 3R96A 3UY5A 3ISXA 5DWMA 3KQZA 4F6AA 1BOBA 1UWYA 5H84A 1LANA 2WYRA 3TCVA 2REEA 1WK4A 4C68A 3GYAA 2X7BA 4FUUA 4R3LA 3I9SA 4A30A 2ZEEA 2PIZA 5ELYA 3H8EA 3D3SA 1AYEA 1RO5A 1QSOA 1ARLA 1Y7RA 1EE3P 4HKFA 3G3SA 2B4DA 4H6ZA 3QAHA 1LAMA 4OKOA 3EC4A 3PRTA 4CGMA 4R9MA 3FB3A 4KLWA 3SXNA 4Y49C 3IGRA 1S7NA 4IF5A 3H5ZA 1M4GA 3D4UA 3KI9A 3D66A 4FAIA 1BO4A 3LODA 4IHMA 3R9GA 3NH4A 4PXBA 4ZYQA 2PR1A 4DJLA 1R57A 4HPSA 3T8WA 1XFOA 1MJ9A 1YVOA 4KLVA 4RS2A 4NGPA 4GXHA 3LWUA 4P4EA 3FJUA 4YRHA 5H86A 3ZJ0A 1CPSA 1YLEA 2D4PA 3FXTA 1AUGA 2FIAA 3CT9A 3GLJA 3MGDA 4MY0A 4R76A 3D7HA 2PRQA 5LYFA 4WJBA 4A32A 2VZZA 2CNMA 4KVOE 4P44A 4CAWA 2ZEDA 1RTQA 2PCUA 2WZNA 3CXQA 5AG7A 5ISVA 4NGTA 4LX9A 2Q4ZA 2PJCA 4KORA 4CGPA 4M6HA 4AVBA 5AGEA 3FMCA 3IO1A 4KVME 3PB8X 5JPHA 4M6IA 2PRBA 1Z4EA 2PVVA 3OWCA 4NJRA 1I21A 1VGYA 3K2KA 2GFQA 3PB9X 3JUWA 4OIWA 3WT4A 1MK4A 2V8DA 4PXCA 4MFZA 5F09A 2V8GA 3PBEA 1S7LA 3BXMA 2BSWA 2G9DA 2I79A 3WC5A 2Q7SA 3KZWA 4I49A 1P0HA 4OC0A 2HV2A 2JBKA 4XPDC 4BBHA 1Z5RA 4MFJA 4FD5A 5J1QA 2XEIA 1XE4A 3GIUA 2HB6A 4M85A 2OZUA 3S6FA 5HVGA 4A31A 4GM5A 3BI1A 2OOTA 4ZX9A 2QVPA 3JVNA 1FY7A 1VKCA 3R9FA 2PC1A 3F0AA 1BAVA 3ISZA 3QAYA 4MHDA 3CZXA 3D67A 1GHEA 1ZG9A 3I3GA 4JZ0A 2KCWA 1Y0RA 1R3NA 2ABZA 2RB7A 1J4JA 2FIWA 2RC4A 4KOUA 4RN7A 2O53A 2CNSA 4XPDB 5A27A 1Z8TA 2B5GB 5I0CA 1S60A 4OAEA 2PJBA 2ZW5A 5G21A 3V7ZA 4NSQA 4TNUA 3RO0A 5I4MA 1IYKA 2PJ2A 4JXRA 1CX8A 2REFA 4KSIA 1S5KA 2B3UA 2PJ7A 1VHEA 4OC5A 2P0WA 2IQ6A 3TTHA 4PXDA 3RYOA 1Y9KA 3S9LA 4AVCA 4PPZA 2PJ9A 1PUAA 4FD6A 1IIDA 2Z11A 4Q36A 4MHPA 3KHZA 2B4DB 2P6FA 4P4DA 3LD2A 2Q51A 3R9EA 3KL9A 3IIBA 4KUAA 4MBUA 4NGRA 3CDXA 2PJ3A 4P4JA 1PCAA 4HNXB 1ON0A 1PYTB 4PK2A 4ZX8A 3D7DA 1Z2LA 4PQAA 2IJZA 4KSFA 2OZHA 1TKFA 2Q7BA 3VWEA 2Z3PA 2PJ5A 3A9LA 3TOAA 4UF4A 4FWUA 4E2AA 4CPAA 1RXTA 2JBJA 2EO8A 2ZEHA 1CG2A 4FD7A 4H2KA 3KQXA 4HNWB 4QUSA 3F8KA 3NH8A 3RNZA 4KSAA 4MMOA 1S7FA 4UWJA 2O4HA 1PU9A 2FSRA 3NE7A 4B5OA 1IICA 2FS5A 2HUZA 1Y0YA 3FECA 4MCRA 1LAPA 5CPAA 3IWGA 5HXDA 3V38A 1Q2CA 1XOVA 2PJ0A 2ZXVA 3PB4X 3QB8A 2QMLA 1IY7A 1VIXA 1XIXA 2JDCA 2Y0MA 4NGQA 4BINA 2PR8A 2GREA 4C7IA 4F0XA 1P4NA 2B5GA 1Z8WA 4UFXA 1ZLHA 3FBUA 4KOXA 2GU2A 3PB7X 4ORFA 2YNDA 1HEEA 1JQGA 3DGVA 5HVHA 1M4DA 4KOTA 4NFRA 4QC6A 2ZOFA 3CXPA 3SHPA 3BJ8A 2C6GA 1XJOA 2GE3A 4NGNA 4P4IA 4K30A 5LRGA 3W6XA 3JRUA 4UEFA 2HQYA 3JTKA 5GCNA 5JM6A 3LMSA 5HVFA 4LQGA 3SI1A 3K9UA 3IEHA 2J9AA 3QNVA 5IB0A 2AFWA 1Q2DA 4WWVA 1BLLE 1AMPA 2Z3KA 4RUHA 2J8NA 5LYLA 2PJ6A 3E0KA 2FT0A 1X10A 5G1ZA 4E0AA 1NSLA 1LOKA 5F48A 5EBVA 2ZEGA 4NXYA 4R3KA 3S9MA 4A39A 3DLJA 3IFEA 4YGOA 2PJ1A 1ZG7A 2ZPAA 4MFQA 2H5MA 3B7IA 5J8CA 1CJWA 1Z4RA 5EMIA 2R1IA 4B5PA 2YNEA 3WR7A 3D8PA 1L0CA 3RBUA 3KKWA 3IU2A 1UFHA 4NJQA 4B12A 2WSAA 1GYTA 2V8VA 2G0BA 2G3TA 4Y49B 2Q0YA 2QIRA 3LACA 4MHYA 1M4LA 2CXAA 1F2PA 1M4IA 2R8VA 1HDQA 1OZPA 4AG7A 4PSWA 3TFYA 2WPWA 5AG6A 3PEIA 4MFKA 1TKHA 3SI0A 2OB0A 3TOBA 2ZEFA 2VI7A 3DDDA 4UBRA 4B14A 3FNCA 2A4NA 3RAMA 1Z8XA 1YGHA 2V8HA 2IMOA 2Z3OA 2ZW7A 3VWDA 4R87A 3DR6A 4CAXA 4OMEA 4UIBA 3WABA 1CBXA 1KZFA 2ZW6A 3H8FA 3SJEA 4CYOA 4R57A 3MRUA 1KWMA 4ZY2A 4OIDA 4A95A 4MFLA 4CAEA 2F7VA 3KHXA 1DTDA 4ONUA 4MFPA 3HUVA 3R95A 4IUSA 2FVGA 2ZOGA 1KUYA 1LCPA 2G3AA 5K8OA 1FT7A 2XEGA 2EUIA 4M6GA 2PJAA 4JXQA 5THWA 5D8NA 2J8MA 2YNCA 3B3VA 2GANA 3B8GA 3EFAA 1TXRA 3S9NA 3G8WA 1IYLA 4OC3A 2J8RA 3MN8A 5G22A 2EK8A 2RFHA 1R43A 3FYNA 4C7HA 4KUBA 2VEZA 5KTAA 1IOIA 2VQYA 3T9YA 4CGOA 1VHOA 4MJ8A 4A94A 2HC9A 1QSTA 4MY3A 2OU2A 4ZGYB 1IGBA 4QVTA 4MI4A 4NF1A 3ZZIA 4MCSA 4H89A 4O23A 1ELMP 4PV6A 2AJ6A 4B11A 1NSAA 4R7MA 5E96A 2Z3NA 3K9TA 2JEWA 2ZEPA 1NMTA 2PQ8A 2ZEMA 4NEXA 3W6SA 5K8MA 4X2TA 4LUAA 2PIYA 3B3TA 4OADA 4UCNA 5HH1A 4MHZA 2FE7A 3TX8A 4RI1A 4EFDA 2VXKA 4MHNA 4F8ZA 4ZI6A 1YVKA 4CYQA 1FNOA 1DE4C 2AFXA 4L89A 2PE3A 2Z3LA 1WWZA 2Z3MA 4UFWA 4X5KA 3CPAA 2Z0ZA 3DNSA 4DUKA 1IU8A 3S6HA 1CM0A 1LRZA 4JLYA 4MXUA 1TKJA 1YX0A 4B5PB 2CTBA 2GLJA 4CRYB 3IJ3A 7CPAA 1F2OA 4CYNA 3TE4A 2C6PA 4GS4A 1Z9UA 4PSXA 3WC7A 4MCQA 4J3GA 1XEBA 4A2ZA 4H6UA 1QQ9A 2PDOA 1B6BA 4CYPA 2WUUA 4MCPA 4R8FA 4AXVA 3KASA 3BLNA 1YW6A 3GB0A 4F0YA 2C1CA 2ZEOA 4EWTA 2WPXA 3H4QA 2DPTA 1XMBA 4KZTA 4A37A 3SJGA 4KOWA 5G20A 4B6ZA 1YSJA 2PJ8A 1S7KA 3FRMA 4KVXA 4QB9A 5C82A 5LRKA 5CBMA 3NA6A 3N7ZA 4U5YA 4ZY1A 2EK9A 1TF8A 4ZBGA 4AVAA 6CPAA 2YNCC 2VL1A 5KTDA 2NSMA 2PVWA 5AG4A 3FH4A 3P2FA 4UCMA 4KOVA 1Q7LA 4F9UA 3FX6A 5LRJA 5JH9A 1V0CA 2DXQA 4II9A 4MRIA 2DF5A 5IV0A 1BPMA 2Q4VA 4R6TA 2CY2A 2CNTA 3PZJA 1M44A 2CF4A 3EXNA 4P4BA 4TWEA 3SJXA 1HDUA 4UCPA 2OR4A 3NH5A 3TC8A 5DWNA 4C2XA 3H8GA 4JD6A 4XPLA 1M1DA 1IB1E 2R7HA 1VHSA 3FF3A 4CS0B 2P6GA 3EO4A 5K8NA 1ZO0A 3DSBA 4X3RA 3PFOA 4F9VA 2CTCA 3PP9A 2PJ4A 1NE9A 1XF8A 1A2ZA 1ZG8A 5FVJA 3TO9A 2BEIA 2V77A 3D2PA 3EY5A 3B35A 4XPKA 1Q2YA 3V8IA 3FVLA 1ELLP 2C27A 5EC4A 2IL4A 1CP7A 2ATRA 5F49A 2P6EA 1F57A 1ARMA 2ODFA 3C26A 1XRYA 4OC2A 4DNCA 5HMNA 3CPXA 3B3SA 5IX3A 1QSNA 4C2YA 1LFWA 3KR4A 5DS0A 4CGNA 1H8LA 3GKRA 2Q44A 1KUXA 4NCZA 4UEEA 8CPAA 5K8PA 4UWIA 4P4FA 2EVNA 2F8HA 4OLLA 3D2MA 3T90A 4OP4A 3RZAA 4L8AA 4NGSA 1Z8LA 4JJXA 4Z65A 4JWPA 2I3CA 4IK2A 1Y9WA 3N5FA 2EBJA 3NE8A 4KS9A 4LQ6A 4PXEA 3B3CA 2YGWA 5LYDA 3TO6A 3D7FA 4P10A 3VARA 1QMUA 5JGFA 3DR8A 4UIAA 3BHXA 2QJ8A 1XBUA 2ZELA 2FXFA 1BPNA 3PBBA 1TF9A 1YMEA 2Q4YA 4U9YA 1CP6A 3CXSA 4AG9A 4YFJA 2BOAA 4UFVA 4HNYB 3FEEA 2QYVA 2AFMA 5A28A 3L2NA 3PB6X 5F46A 1QSRA 3PFEA 1YREA 4M3SA 2GLFA 4P45A 5LYIA 3S6GA 2D4OA 4Q7AA 4C2ZA 2K5TA 1YLOA 2JEVA 2XEFA 4ONWA 4XNHC 2I00A 1B87A 2VZYA 4A38A 4IAVA 3GUXA 1N71A 4KOYA 3FEDA 2AFUA 3VH9A 1XMTA 2QECA 1YQEA 3GY9A 4A33A 4FD4A 1K4JA 4W9YA 5F47A 1ZLIA 3R1KA 5KTCA 4EMEA 3B3WA 3W91A 2B3VA 1JWQA 2AE6A 2POKA 2FCKA 4KOSA 5C88A 3B2YA 2XEJA 1I1DA 1SQHA 2JLMA 4B10A 2AFOA 3IWEA 2Q43A 3P2HA 1Y7EA 2OZGA 4G1PA 4YU9A 4XNHB 5BWAB 1U6MA 3VATA 4QBJA 4BMHA 2BO9A 2FL4A 4U9ZA 2ARHA 4OC1A 1QSMA 2F5IA 3D68A 2DPSA 5JQ4A 3BI0A 3SI2A 3TT2A 1OBRA 2CIJA 1CPXA 3BJ7A 1YW4A 1IOFA 3IC1A 5J8FA 5D29A 2NMTA 3HLPA 4PK3A 2ZW4A 5IB9A 3PGPA 4UEZA 1KUVA 4CRZB 4JYWA 3SXOA 3KGQA 4NGMA 2NYQA 4BD9A 3D7GA 2B58A 4UA3A 2ZENA 2EWBA 4CGLA 4OC4A 3IU1A 1MJBA 2AFSA 3S6KA 1TIQA 4CAFA 4FBEA
chains in the Genus database with same CATH topology
2R98A 4AB7A 3F5BA 2B4BA 2O28A 2Q04A 4B13A 2Z10A 3FIXA 2PSWA 4CAVA 4EVYA 2JDDA 4E8OA 2VBQA 2GIVA 2OH1A 2BL1A 1MJAA 1YR0A 5AG5A 1S3ZA 1I12A 3TO7A 1YK3A 4Q38A 5CNPA 3R96A 2BUEA 3UY5A 5DWMA 4F6AA 1BOBA 5H84A 3TCVA 2REEA 1WK4A 4C68A 3GYAA 2X7BA 4R3LA 3I9SA 4A30A 3D3SA 1RO5A 1QSOA 1Y7RA 4HKFA 3G3SA 2B4DA 4H6ZA 3QAHA 3EC4A 4CGMA 4R9MA 3FB3A 4KLWA 3SXNA 4Y49C 3IGRA 1S7NA 4IF5A 3H5ZA 1M4GA 1BO4A 3LODA 3R9GA 2PR1A 1R57A 1MJ9A 1YVOA 4KLVA 4RS2A 4YRHA 5H86A 3ZJ0A 1YLEA 2D4PA 3FXTA 2FIAA 3MGDA 4MY0A 4A32A 2VZZA 2CNMA 4KVOE 4CAWA 3CXQA 5AG7A 5ISVA 4LX9A 4KORA 4CGPA 4AVBA 5AGEA 4KVME 5JPHA 2PRBA 1Z4EA 3OWCA 1I21A 3JUWA 1MK4A 4MFZA 1S7LA 2BSWA 2I79A 4I49A 1P0HA 2HV2A 4XPDC 4BBHA 4MFJA 4FD5A 1XE4A 4M85A 2OZUA 3S6FA 4A31A 3JVNA 1FY7A 1VKCA 3R9FA 2PC1A 3F0AA 4MHDA 1GHEA 3I3GA 2KCWA 1J4JA 2FIWA 2RC4A 4KOUA 4XPDB 5A27A 2CNSA 5I0CA 2B5GB 1S60A 4OAEA 2ZW5A 5G21A 4NSQA 1IYKA 4JXRA 2REFA 1S5KA 2B3UA 3TTHA 2P0WA 3RYOA 1Y9KA 4AVCA 1PUAA 4FD6A 1IIDA 2Z11A 4Q36A 2B4DB 2P6FA 3LD2A 3R9EA 4MBUA 4KUAA 4HNXB 1ON0A 4PK2A 4KSFA 2Q7BA 2OZHA 3VWEA 2Z3PA 3A9LA 3TOAA 4E2AA 1RXTA 4FD7A 4HNWB 4QUSA 3F8KA 4KSAA 1S7FA 4UWJA 3NE7A 1PU9A 2FSRA 4B5OA 1IICA 2FS5A 2HUZA 3IWGA 1Q2CA 2ZXVA 3QB8A 2QMLA 1XIXA 2Y0MA 2JDCA 4F0XA 4C7IA 2PR8A 1P4NA 2B5GA 4UFXA 3FBUA 4KOXA 4ORFA 2YNDA 1M4DA 4KOTA 4QC6A 3CXPA 3SHPA 3BJ8A 2GE3A 3W6XA 4K30A 2HQYA 3JTKA 5GCNA 3K9UA 5IB0A 1Q2DA 2Z3KA 2J8NA 3E0KA 2FT0A 5G1ZA 4E0AA 1NSLA 5F48A 5EBVA 4NXYA 4R3KA 4YGOA 4MFQA 2ZPAA 5J8CA 2H5MA 1CJWA 1Z4RA 2R1IA 4B5PA 2YNEA 3WR7A 3D8PA 1L0CA 3KKWA 3IU2A 1UFHA 4B12A 2WSAA 2G0BA 2G3TA 4Y49B 2Q0YA 2QIRA 2CXAA 1M4IA 2R8VA 1OZPA 4AG7A 4PSWA 3TFYA 2WPWA 5AG6A 4MFKA 2OB0A 3TOBA 2VI7A 3DDDA 4UBRA 4B14A 3FNCA 2A4NA 1YGHA 2Z3OA 3VWDA 2ZW7A 4R87A 3DR6A 4CAXA 1KZFA 2ZW6A 4CYOA 4R57A 4CAEA 4A95A 4MFLA 4ONUA 4MFPA 3R95A 4IUSA 1KUYA 2G3AA 2EUIA 4JXQA 2J8MA 2YNCA 3B8GA 2GANA 3EFAA 3G8WA 1IYLA 2J8RA 5G22A 3FYNA 4C7HA 4KUBA 2VEZA 5KTAA 2VQYA 3T9YA 4CGOA 4MJ8A 1QSTA 4MY3A 2OU2A 4ZGYB 4QVTA 4MI4A 4NF1A 3ZZIA 4H89A 4PV6A 2AJ6A 4B11A 5E96A 2Z3NA 1NMTA 2PQ8A 4NEXA 3W6SA 4LUAA 5HH1A 4OADA 4UCNA 2FE7A 4RI1A 2VXKA 1YVKA 4CYQA 4L89A 2Z3LA 1WWZA 2Z3MA 4UFWA 4X5KA 2Z0ZA 3DNSA 3S6HA 1CM0A 1LRZA 4JLYA 4B5PB 1YX0A 4CRYB 3TE4A 4CYNA 4GS4A 1Z9UA 4PSXA 4J3GA 1XEBA 4A2ZA 4H6UA 2PDOA 1B6BA 4CYPA 2WUUA 3BLNA 4F0YA 2WPXA 3H4QA 2DPTA 4KZTA 4KOWA 5G20A 3FRMA 1S7KA 4KVXA 4QB9A 5C82A 3N7ZA 4U5YA 4ZBGA 4AVAA 2YNCC 5KTDA 5AG4A 3P2FA 4UCMA 4KOVA 1V0CA 2DXQA 4II9A 5IV0A 2Q4VA 2CY2A 2CNTA 3PZJA 1M44A 3EXNA 4UCPA 5DWNA 4C2XA 4JD6A 4XPLA 1M1DA 1IB1E 2R7HA 1VHSA 4CS0B 2P6GA 3EO4A 1ZO0A 3DSBA 3TO9A 3PP9A 5FVJA 1NE9A 1XF8A 2BEIA 3D2PA 3EY5A 4XPKA 3V8IA 1Q2YA 2C27A 5EC4A 2IL4A 2ATRA 5F49A 2P6EA 3C26A 5HMNA 4DNCA 5IX3A 1QSNA 4C2YA 4CGNA 3GKRA 2Q44A 1KUXA 4NCZA 4UWIA 2EVNA 4OLLA 3D2MA 3T90A 4L8AA 4JJXA 4JWPA 1Y9WA 4KS9A 2YGWA 3TO6A 3DR8A 2FXFA 2Q4YA 4U9YA 3CXSA 4AG9A 4YFJA 4UFVA 4HNYB 5A28A 5F46A 1QSRA 1YREA 4M3SA 3S6GA 2D4OA 4C2ZA 2K5TA 2JEVA 4XNHC 2I00A 1B87A 2VZYA 1N71A 4KOYA 1XMTA 2QECA 3GY9A 4A33A 4FD4A 1K4JA 5F47A 3R1KA 5KTCA 3W91A 2B3VA 2AE6A 2FCKA 4KOSA 5C88A 1I1DA 1SQHA 2JLMA 4B10A 3IWEA 3P2HA 2OZGA 4XNHB 5BWAB 1U6MA 4QBJA 4BMHA 2FL4A 4U9ZA 2ARHA 1QSMA 2F5IA 2DPSA 5JQ4A 3TT2A 3BJ7A 5J8FA 2NMTA 4PK3A 2ZW4A 3PGPA 1KUVA 4CRZB 3SXOA 4CGLA 2B58A 4UA3A 3IU1A 1MJBA 3S6KA 1TIQA 4CAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R98 A;  4AB7 A;  3F5B A;  2B4B A;  2O28 A;  2Q04 A;  2Z10 A;  3FIX A;  2PSW A;  4CAV A;  4EVY A;  2JDD A;  4E8O A;  2VBQ A;  2GIV A;  2OH1 A;  2BL1 A;  1MJA A;  1YR0 A;  1S3Z A;  1I12 A;  3TO7 A;  1YK3 A;  5CNP A;  3R96 A;  2BUE A;  3UY5 A;  5DWM A;  4F6A A;  1BOB A;  5H84 A;  3TCV A;  2REE A;  1WK4 A;  3GYA A;  2X7B A;  4R3L A;  3I9S A;  3D3S A;  1RO5 A;  1QSO A;  1Y7R A;  4HKF A;  3G3S A;  2B4D A;  4H6Z A;  3QAH A;  3EC4 A;  4R9M A;  3FB3 A;  4KLW A;  3SXN A;  4Y49 C;  3IGR A;  1S7N A;  4IF5 A;  1M4G A;  1BO4 A;  3LOD A;  3R9G A;  2PR1 A;  1R57 A;  1MJ9 A;  1YVO A;  4KLV A;  4RS2 A;  4YRH A;  5H86 A;  3ZJ0 A;  1YLE A;  2D4P A;  3FXT A;  2FIA A;  3MGD A;  4MY0 A;  2VZZ A;  2CNM A;  4KVO E;  4CAW A;  3CXQ A;  5ISV A;  4LX9 A;  4KOR A;  4AVB A;  4KVM E;  5JPH A;  2PRB A;  1Z4E A;  3OWC A;  1I21 A;  3JUW A;  1MK4 A;  1S7L A;  2BSW A;  2I79 A;  4I49 A;  1P0H A;  2HV2 A;  4XPD C;  4FD5 A;  1XE4 A;  4M85 A;  2OZU A;  3S6F A;  3JVN A;  1FY7 A;  1VKC A;  3R9F A;  2PC1 A;  3F0A A;  4MHD A;  1GHE A;  3I3G A;  2KCW A;  1J4J A;  2FIW A;  2RC4 A;  4KOU A;  4XPD B;  2CNS A;  5I0C A;  2B5G B;  1S60 A;  4OAE A;  2ZW5 A;  4NSQ A;  1IYK A;  4JXR A;  2REF A;  1S5K A;  2B3U A;  3TTH A;  2P0W A;  3RYO A;  1Y9K A;  4AVC A;  1PUA A;  4FD6 A;  1IID A;  2Z11 A;  2B4D B;  2P6F A;  3LD2 A;  3R9E A;  4MBU A;  4KUA A;  4HNX B;  1ON0 A;  4PK2 A;  2Q7B A;  2OZH A;  3VWE A;  3TOA A;  4E2A A;  1RXT A;  4FD7 A;  4HNW B;  4QUS A;  3F8K A;  1S7F A;  4UWJ A;  3NE7 A;  1PU9 A;  2FSR A;  4B5O A;  1IIC A;  2FS5 A;  2HUZ A;  3IWG A;  1Q2C A;  2ZXV A;  3QB8 A;  2QML A;  1XIX A;  2Y0M A;  2JDC A;  2PR8 A;  1P4N A;  2B5G A;  3FBU A;  4KOX A;  4ORF A;  1M4D A;  4KOT A;  4QC6 A;  3CXP A;  3SHP A;  3BJ8 A;  2GE3 A;  3W6X A;  4K30 A;  2HQY A;  5GCN A;  3K9U A;  5IB0 A;  1Q2D A;  2J8N A;  3E0K A;  2FT0 A;  4E0A A;  1NSL A;  5F48 A;  5EBV A;  4NXY A;  4R3K A;  4YGO A;  5J8C A;  2ZPA A;  2H5M A;  1CJW A;  1Z4R A;  2R1I A;  4B5P A;  3WR7 A;  3D8P A;  1L0C A;  3KKW A;  1UFH A;  2G0B A;  2G3T A;  4Y49 B;  2Q0Y A;  2QIR A;  1M4I A;  2R8V A;  1OZP A;  4AG7 A;  4PSW A;  3TFY A;  2WPW A;  2OB0 A;  3TOB A;  2VI7 A;  3DDD A;  4UBR A;  3FNC A;  2A4N A;  1YGH A;  3VWD A;  2ZW7 A;  4R87 A;  3DR6 A;  4CAX A;  1KZF A;  2ZW6 A;  4R57 A;  4ONU A;  3R95 A;  4IUS A;  1KUY A;  2G3A A;  2EUI A;  4JXQ A;  2J8M A;  3B8G A;  2GAN A;  3EFA A;  3G8W A;  1IYL A;  2J8R A;  3FYN A;  4KUB A;  2VEZ A;  5KTA A;  2VQY A;  3T9Y A;  4MJ8 A;  1QST A;  4MY3 A;  2OU2 A;  4QVT A;  4MI4 A;  4NF1 A;  3ZZI A;  4H89 A;  4PV6 A;  2AJ6 A;  5E96 A;  1NMT A;  2PQ8 A;  4NEX A;  3W6S A;  4LUA A;  5HH1 A;  4OAD A;  2FE7 A;  4RI1 A;  2VXK A;  1YVK A;  4L89 A;  1WWZ A;  4X5K A;  2Z0Z A;  3DNS A;  3S6H A;  1CM0 A;  1LRZ A;  4JLY A;  4B5P B;  1YX0 A;  4CRY B;  3TE4 A;  4GS4 A;  1Z9U A;  4PSX A;  4J3G A;  1XEB A;  4H6U A;  2PDO A;  1B6B A;  3BLN A;  4F0Y A;  2WPX A;  3H4Q A;  4KZT A;  4KOW A;  4KVX A;  1S7K A;  3FRM A;  4QB9 A;  5C82 A;  3N7Z A;  4U5Y A;  4ZBG A;  4AVA A;  5KTD A;  3P2F A;  4KOV A;  1V0C A;  2DXQ A;  4II9 A;  5IV0 A;  2Q4V A;  2CY2 A;  2CNT A;  3PZJ A;  1M44 A;  3EXN A;  5DWN A;  4JD6 A;  4XPL A;  1M1D A;  1IB1 E;  2R7H A;  1VHS A;  4CS0 B;  2P6G A;  3EO4 A;  3DSB A;  3TO9 A;  3PP9 A;  5FVJ A;  1NE9 A;  1XF8 A;  2BEI A;  3D2P A;  3EY5 A;  4XPK A;  3V8I A;  1Q2Y A;  2C27 A;  5EC4 A;  2IL4 A;  2ATR A;  5F49 A;  2P6E A;  3C26 A;  5HMN A;  4DNC A;  5IX3 A;  1QSN A;  3GKR A;  2Q44 A;  1KUX A;  4NCZ A;  4UWI A;  2EVN A;  4OLL A;  3D2M A;  3T90 A;  4L8A A;  4JJX A;  4JWP A;  1Y9W A;  3TO6 A;  3DR8 A;  2FXF A;  2Q4Y A;  4U9Y A;  3CXS A;  4AG9 A;  4YFJ A;  4HNY B;  5F46 A;  1QSR A;  1YRE A;  4M3S A;  3S6G A;  2D4O A;  2K5T A;  2JEV A;  4XNH C;  2I00 A;  1B87 A;  2VZY A;  1N71 A;  4KOY A;  1XMT A;  2QEC A;  3GY9 A;  4FD4 A;  1K4J A;  5F47 A;  3R1K A;  5KTC A;  3W91 A;  2B3V A;  2AE6 A;  2FCK A;  4KOS A;  5C88 A;  1I1D A;  1SQH A;  2JLM A;  3P2H A;  2OZG A;  4XNH B;  1U6M A;  4QBJ A;  4BMH A;  2FL4 A;  4U9Z A;  2ARH A;  1QSM A;  2F5I A;  5JQ4 A;  3TT2 A;  3BJ7 A;  5J8F A;  2NMT A;  4PK3 A;  2ZW4 A;  3PGP A;  1KUV A;  4CRZ B;  3SXO A;  2B58 A;  4UA3 A;  1MJB A;  3S6K A;  1TIQ A; 
#chains in the Genus database with same CATH topology
 2R98 A;  4AB7 A;  3F5B A;  2B4B A;  2O28 A;  2Q04 A;  3WC6 A;  4P6Y A;  4X8I A;  4B13 A;  2Z10 A;  3FIX A;  2PSW A;  3SJF A;  1X12 A;  3I1U A;  4CAV A;  4EVY A;  2JDD A;  4E8O A;  4ZY0 A;  4YWY A;  4K3N A;  2C6C A;  4DYO A;  2VBQ A;  2AFZ A;  2GIV A;  2BL1 A;  2OH1 A;  1MJA A;  1YR0 A;  5AG5 A;  3KR5 A;  1S3Z A;  3NFZ A;  2ANP A;  1I12 A;  2DEA A;  3TO7 A;  1YK3 A;  2BCO A;  3IWW A;  4Q38 A;  5CNP A;  2BUE A;  3R96 A;  3UY5 A;  3ISX A;  5DWM A;  3KQZ A;  4F6A A;  1BOB A;  1UWY A;  5H84 A;  1LAN A;  2WYR A;  3TCV A;  2REE A;  1WK4 A;  4C68 A;  3GYA A;  2X7B A;  4FUU A;  4R3L A;  3I9S A;  4A30 A;  2ZEE A;  2PIZ A;  5ELY A;  3H8E A;  3D3S A;  1AYE A;  1RO5 A;  1QSO A;  1ARL A;  1Y7R A;  1EE3 P;  4HKF A;  3G3S A;  2B4D A;  4H6Z A;  3QAH A;  1LAM A;  4OKO A;  3EC4 A;  3PRT A;  4CGM A;  4R9M A;  3FB3 A;  4KLW A;  3SXN A;  4Y49 C;  3IGR A;  1S7N A;  4IF5 A;  3H5Z A;  1M4G A;  3D4U A;  3KI9 A;  3D66 A;  4FAI A;  1BO4 A;  3LOD A;  4IHM A;  3R9G A;  3NH4 A;  4PXB A;  4ZYQ A;  2PR1 A;  4DJL A;  1R57 A;  4HPS A;  3T8W A;  1XFO A;  1MJ9 A;  1YVO A;  4KLV A;  4RS2 A;  4NGP A;  4GXH A;  3LWU A;  4P4E A;  3FJU A;  4YRH A;  5H86 A;  3ZJ0 A;  1CPS A;  1YLE A;  2D4P A;  3FXT A;  1AUG A;  2FIA A;  3CT9 A;  3GLJ A;  3MGD A;  4MY0 A;  4R76 A;  3D7H A;  2PRQ A;  5LYF A;  4WJB A;  4A32 A;  2VZZ A;  2CNM A;  4KVO E;  4P44 A;  4CAW A;  2ZED A;  1RTQ A;  2PCU A;  2WZN A;  3CXQ A;  5AG7 A;  5ISV A;  4NGT A;  4LX9 A;  2Q4Z A;  2PJC A;  4KOR A;  4CGP A;  4M6H A;  4AVB A;  5AGE A;  3FMC A;  3IO1 A;  4KVM E;  3PB8 X;  5JPH A;  4M6I A;  2PRB A;  1Z4E A;  2PVV A;  3OWC A;  4NJR A;  1I21 A;  1VGY A;  3K2K A;  2GFQ A;  3PB9 X;  3JUW A;  4OIW A;  3WT4 A;  1MK4 A;  2V8D A;  4PXC A;  4MFZ A;  5F09 A;  2V8G A;  3PBE A;  1S7L A;  3BXM A;  2BSW A;  2G9D A;  2I79 A;  3WC5 A;  2Q7S A;  3KZW A;  4I49 A;  1P0H A;  4OC0 A;  2HV2 A;  2JBK A;  4XPD C;  4BBH A;  1Z5R A;  4MFJ A;  4FD5 A;  5J1Q A;  2XEI A;  1XE4 A;  3GIU A;  2HB6 A;  4M85 A;  2OZU A;  3S6F A;  5HVG A;  4A31 A;  4GM5 A;  3BI1 A;  2OOT A;  4ZX9 A;  2QVP A;  3JVN A;  1FY7 A;  1VKC A;  3R9F A;  2PC1 A;  3F0A A;  1BAV A;  3ISZ A;  3QAY A;  4MHD A;  3CZX A;  3D67 A;  1GHE A;  1ZG9 A;  3I3G A;  4JZ0 A;  2KCW A;  1Y0R A;  1R3N A;  2ABZ A;  2RB7 A;  1J4J A;  2FIW A;  2RC4 A;  4KOU A;  4RN7 A;  2O53 A;  2CNS A;  4XPD B;  5A27 A;  1Z8T A;  2B5G B;  5I0C A;  1S60 A;  4OAE A;  2PJB A;  2ZW5 A;  5G21 A;  3V7Z A;  4NSQ A;  4TNU A;  3RO0 A;  5I4M A;  1IYK A;  2PJ2 A;  4JXR A;  1CX8 A;  2REF A;  4KSI A;  1S5K A;  2B3U A;  2PJ7 A;  1VHE A;  4OC5 A;  2P0W A;  2IQ6 A;  3TTH A;  4PXD A;  3RYO A;  1Y9K A;  3S9L A;  4AVC A;  4PPZ A;  2PJ9 A;  1PUA A;  4FD6 A;  1IID A;  2Z11 A;  4Q36 A;  4MHP A;  3KHZ A;  2B4D B;  2P6F A;  4P4D A;  3LD2 A;  2Q51 A;  3R9E A;  3KL9 A;  3IIB A;  4KUA A;  4MBU A;  4NGR A;  3CDX A;  2PJ3 A;  4P4J A;  1PCA A;  4HNX B;  1ON0 A;  1PYT B;  4PK2 A;  4ZX8 A;  3D7D A;  1Z2L A;  4PQA A;  2IJZ A;  4KSF A;  2OZH A;  1TKF A;  2Q7B A;  3VWE A;  2Z3P A;  2PJ5 A;  3A9L A;  3TOA A;  4UF4 A;  4FWU A;  4E2A A;  4CPA A;  1RXT A;  2JBJ A;  2EO8 A;  2ZEH A;  1CG2 A;  4FD7 A;  4H2K A;  3KQX A;  4HNW B;  4QUS A;  3F8K A;  3NH8 A;  3RNZ A;  4KSA A;  4MMO A;  1S7F A;  4UWJ A;  2O4H A;  1PU9 A;  2FSR A;  3NE7 A;  4B5O A;  1IIC A;  2FS5 A;  2HUZ A;  1Y0Y A;  3FEC A;  4MCR A;  1LAP A;  5CPA A;  3IWG A;  5HXD A;  3V38 A;  1Q2C A;  1XOV A;  2PJ0 A;  2ZXV A;  3PB4 X;  3QB8 A;  2QML A;  1IY7 A;  1VIX A;  1XIX A;  2JDC A;  2Y0M A;  4NGQ A;  4BIN A;  2PR8 A;  2GRE A;  4C7I A;  4F0X A;  1P4N A;  2B5G A;  1Z8W A;  4UFX A;  1ZLH A;  3FBU A;  4KOX A;  2GU2 A;  3PB7 X;  4ORF A;  2YND A;  1HEE A;  1JQG A;  3DGV A;  5HVH A;  1M4D A;  4KOT A;  4NFR A;  4QC6 A;  2ZOF A;  3CXP A;  3SHP A;  3BJ8 A;  2C6G A;  1XJO A;  2GE3 A;  4NGN A;  4P4I A;  4K30 A;  5LRG A;  3W6X A;  3JRU A;  4UEF A;  2HQY A;  3JTK A;  5GCN A;  5JM6 A;  3LMS A;  5HVF A;  4LQG A;  3SI1 A;  3K9U A;  3IEH A;  2J9A A;  3QNV A;  5IB0 A;  2AFW A;  1Q2D A;  4WWV A;  1BLL E;  1AMP A;  2Z3K A;  4RUH A;  2J8N A;  5LYL A;  2PJ6 A;  3E0K A;  2FT0 A;  1X10 A;  5G1Z A;  4E0A A;  1NSL A;  1LOK A;  5F48 A;  5EBV A;  2ZEG A;  4NXY A;  4R3K A;  3S9M A;  4A39 A;  3DLJ A;  3IFE A;  4YGO A;  2PJ1 A;  1ZG7 A;  2ZPA A;  4MFQ A;  2H5M A;  3B7I A;  5J8C A;  1CJW A;  1Z4R A;  5EMI A;  2R1I A;  4B5P A;  2YNE A;  3WR7 A;  3D8P A;  1L0C A;  3RBU A;  3KKW A;  3IU2 A;  1UFH A;  4NJQ A;  4B12 A;  2WSA A;  1GYT A;  2V8V A;  2G0B A;  2G3T A;  4Y49 B;  2Q0Y A;  2QIR A;  3LAC A;  4MHY A;  1M4L A;  2CXA A;  1F2P A;  1M4I A;  2R8V A;  1HDQ A;  1OZP A;  4AG7 A;  4PSW A;  3TFY A;  2WPW A;  5AG6 A;  3PEI A;  4MFK A;  1TKH A;  3SI0 A;  2OB0 A;  3TOB A;  2ZEF A;  2VI7 A;  3DDD A;  4UBR A;  4B14 A;  3FNC A;  2A4N A;  3RAM A;  1Z8X A;  1YGH A;  2V8H A;  2IMO A;  2Z3O A;  2ZW7 A;  3VWD A;  4R87 A;  3DR6 A;  4CAX A;  4OME A;  4UIB A;  3WAB A;  1CBX A;  1KZF A;  2ZW6 A;  3H8F A;  3SJE A;  4CYO A;  4R57 A;  3MRU A;  1KWM A;  4ZY2 A;  4OID A;  4A95 A;  4MFL A;  4CAE A;  2F7V A;  3KHX A;  1DTD A;  4ONU A;  4MFP A;  3HUV A;  3R95 A;  4IUS A;  2FVG A;  2ZOG A;  1KUY A;  1LCP A;  2G3A A;  5K8O A;  1FT7 A;  2XEG A;  2EUI A;  4M6G A;  2PJA A;  4JXQ A;  5THW A;  5D8N A;  2J8M A;  2YNC A;  3B3V A;  2GAN A;  3B8G A;  3EFA A;  1TXR A;  3S9N A;  3G8W A;  1IYL A;  4OC3 A;  2J8R A;  3MN8 A;  5G22 A;  2EK8 A;  2RFH A;  1R43 A;  3FYN A;  4C7H A;  4KUB A;  2VEZ A;  5KTA A;  1IOI A;  2VQY A;  3T9Y A;  4CGO A;  1VHO A;  4MJ8 A;  4A94 A;  2HC9 A;  1QST A;  4MY3 A;  2OU2 A;  4ZGY B;  1IGB A;  4QVT A;  4MI4 A;  4NF1 A;  3ZZI A;  4MCS A;  4H89 A;  4O23 A;  1ELM P;  4PV6 A;  2AJ6 A;  4B11 A;  1NSA A;  4R7M A;  5E96 A;  2Z3N A;  3K9T A;  2JEW A;  2ZEP A;  1NMT A;  2PQ8 A;  2ZEM A;  4NEX A;  3W6S A;  5K8M A;  4X2T A;  4LUA A;  2PIY A;  3B3T A;  4OAD A;  4UCN A;  5HH1 A;  4MHZ A;  2FE7 A;  3TX8 A;  4RI1 A;  4EFD A;  2VXK A;  4MHN A;  4F8Z A;  4ZI6 A;  1YVK A;  4CYQ A;  1FNO A;  1DE4 C;  2AFX A;  4L89 A;  2PE3 A;  2Z3L A;  1WWZ A;  2Z3M A;  4UFW A;  4X5K A;  3CPA A;  2Z0Z A;  3DNS A;  4DUK A;  1IU8 A;  3S6H A;  1CM0 A;  1LRZ A;  4JLY A;  4MXU A;  1TKJ A;  1YX0 A;  4B5P B;  2CTB A;  2GLJ A;  4CRY B;  3IJ3 A;  7CPA A;  1F2O A;  4CYN A;  3TE4 A;  2C6P A;  4GS4 A;  1Z9U A;  4PSX A;  3WC7 A;  4MCQ A;  4J3G A;  1XEB A;  4A2Z A;  4H6U A;  1QQ9 A;  2PDO A;  1B6B A;  4CYP A;  2WUU A;  4MCP A;  4R8F A;  4AXV A;  3KAS A;  3BLN A;  1YW6 A;  3GB0 A;  4F0Y A;  2C1C A;  2ZEO A;  4EWT A;  2WPX A;  3H4Q A;  2DPT A;  1XMB A;  4KZT A;  4A37 A;  3SJG A;  4KOW A;  5G20 A;  4B6Z A;  1YSJ A;  2PJ8 A;  1S7K A;  3FRM A;  4KVX A;  4QB9 A;  5C82 A;  5LRK A;  5CBM A;  3NA6 A;  3N7Z A;  4U5Y A;  4ZY1 A;  2EK9 A;  1TF8 A;  4ZBG A;  4AVA A;  6CPA A;  2YNC C;  2VL1 A;  5KTD A;  2NSM A;  2PVW A;  5AG4 A;  3FH4 A;  3P2F A;  4UCM A;  4KOV A;  1Q7L A;  4F9U A;  3FX6 A;  5LRJ A;  5JH9 A;  1V0C A;  2DXQ A;  4II9 A;  4MRI A;  2DF5 A;  5IV0 A;  1BPM A;  2Q4V A;  4R6T A;  2CY2 A;  2CNT A;  3PZJ A;  1M44 A;  2CF4 A;  3EXN A;  4P4B A;  4TWE A;  3SJX A;  1HDU A;  4UCP A;  2OR4 A;  3NH5 A;  3TC8 A;  5DWN A;  4C2X A;  3H8G A;  4JD6 A;  4XPL A;  1M1D A;  1IB1 E;  2R7H A;  1VHS A;  3FF3 A;  4CS0 B;  2P6G A;  3EO4 A;  5K8N A;  1ZO0 A;  3DSB A;  4X3R A;  3PFO A;  4F9V A;  2CTC A;  3PP9 A;  2PJ4 A;  1NE9 A;  1XF8 A;  1A2Z A;  1ZG8 A;  5FVJ A;  3TO9 A;  2BEI A;  2V77 A;  3D2P A;  3EY5 A;  3B35 A;  4XPK A;  1Q2Y A;  3V8I A;  3FVL A;  1ELL P;  2C27 A;  5EC4 A;  2IL4 A;  1CP7 A;  2ATR A;  5F49 A;  2P6E A;  1F57 A;  1ARM A;  2ODF A;  3C26 A;  1XRY A;  4OC2 A;  4DNC A;  5HMN A;  3CPX A;  3B3S A;  5IX3 A;  1QSN A;  4C2Y A;  1LFW A;  3KR4 A;  5DS0 A;  4CGN A;  1H8L A;  3GKR A;  2Q44 A;  1KUX A;  4NCZ A;  4UEE A;  8CPA A;  5K8P A;  4UWI A;  4P4F A;  2EVN A;  2F8H A;  4OLL A;  3D2M A;  3T90 A;  4OP4 A;  3RZA A;  4L8A A;  4NGS A;  1Z8L A;  4JJX A;  4Z65 A;  4JWP A;  2I3C A;  4IK2 A;  1Y9W A;  3N5F A;  2EBJ A;  3NE8 A;  4KS9 A;  4LQ6 A;  4PXE A;  3B3C A;  2YGW A;  5LYD A;  3TO6 A;  3D7F A;  4P10 A;  3VAR A;  1QMU A;  5JGF A;  3DR8 A;  4UIA A;  3BHX A;  2QJ8 A;  1XBU A;  2ZEL A;  2FXF A;  1BPN A;  3PBB A;  1TF9 A;  1YME A;  2Q4Y A;  4U9Y A;  1CP6 A;  3CXS A;  4AG9 A;  4YFJ A;  2BOA A;  4UFV A;  4HNY B;  3FEE A;  2QYV A;  2AFM A;  5A28 A;  3L2N A;  3PB6 X;  5F46 A;  1QSR A;  3PFE A;  1YRE A;  4M3S A;  2GLF A;  4P45 A;  5LYI A;  3S6G A;  2D4O A;  4Q7A A;  4C2Z A;  2K5T A;  1YLO A;  2JEV A;  2XEF A;  4ONW A;  4XNH C;  2I00 A;  1B87 A;  2VZY A;  4A38 A;  4IAV A;  3GUX A;  1N71 A;  4KOY A;  3FED A;  2AFU A;  3VH9 A;  1XMT A;  2QEC A;  1YQE A;  3GY9 A;  4A33 A;  4FD4 A;  1K4J A;  4W9Y A;  5F47 A;  1ZLI A;  3R1K A;  5KTC A;  4EME A;  3B3W A;  3W91 A;  2B3V A;  1JWQ A;  2AE6 A;  2POK A;  2FCK A;  4KOS A;  5C88 A;  3B2Y A;  2XEJ A;  1I1D A;  1SQH A;  2JLM A;  4B10 A;  2AFO A;  3IWE A;  2Q43 A;  3P2H A;  1Y7E A;  2OZG A;  4G1P A;  4YU9 A;  4XNH B;  5BWA B;  1U6M A;  3VAT A;  4QBJ A;  4BMH A;  2BO9 A;  2FL4 A;  4U9Z A;  2ARH A;  4OC1 A;  1QSM A;  2F5I A;  3D68 A;  2DPS A;  5JQ4 A;  3BI0 A;  3SI2 A;  3TT2 A;  1OBR A;  2CIJ A;  1CPX A;  3BJ7 A;  1YW4 A;  1IOF A;  3IC1 A;  5J8F A;  5D29 A;  2NMT A;  3HLP A;  4PK3 A;  2ZW4 A;  5IB9 A;  3PGP A;  4UEZ A;  1KUV A;  4CRZ B;  4JYW A;  3SXO A;  3KGQ A;  4NGM A;  2NYQ A;  4BD9 A;  3D7G A;  2B58 A;  4UA3 A;  2ZEN A;  2EWB A;  4CGL A;  4OC4 A;  3IU1 A;  1MJB A;  2AFS A;  3S6K A;  1TIQ A;  4CAF A;  4FBE A; 
#chains in the Genus database with same CATH homology
 2R98 A;  4AB7 A;  3F5B A;  2B4B A;  2O28 A;  2Q04 A;  4B13 A;  2Z10 A;  3FIX A;  2PSW A;  4CAV A;  4EVY A;  2JDD A;  4E8O A;  2VBQ A;  2GIV A;  2OH1 A;  2BL1 A;  1MJA A;  1YR0 A;  5AG5 A;  1S3Z A;  1I12 A;  3TO7 A;  1YK3 A;  4Q38 A;  5CNP A;  3R96 A;  2BUE A;  3UY5 A;  5DWM A;  4F6A A;  1BOB A;  5H84 A;  3TCV A;  2REE A;  1WK4 A;  4C68 A;  3GYA A;  2X7B A;  4R3L A;  3I9S A;  4A30 A;  3D3S A;  1RO5 A;  1QSO A;  1Y7R A;  4HKF A;  3G3S A;  2B4D A;  4H6Z A;  3QAH A;  3EC4 A;  4CGM A;  4R9M A;  3FB3 A;  4KLW A;  3SXN A;  4Y49 C;  3IGR A;  1S7N A;  4IF5 A;  3H5Z A;  1M4G A;  1BO4 A;  3LOD A;  3R9G A;  2PR1 A;  1R57 A;  1MJ9 A;  1YVO A;  4KLV A;  4RS2 A;  4YRH A;  5H86 A;  3ZJ0 A;  1YLE A;  2D4P A;  3FXT A;  2FIA A;  3MGD A;  4MY0 A;  4A32 A;  2VZZ A;  2CNM A;  4KVO E;  4CAW A;  3CXQ A;  5AG7 A;  5ISV A;  4LX9 A;  4KOR A;  4CGP A;  4AVB A;  5AGE A;  4KVM E;  5JPH A;  2PRB A;  1Z4E A;  3OWC A;  1I21 A;  3JUW A;  1MK4 A;  4MFZ A;  1S7L A;  2BSW A;  2I79 A;  4I49 A;  1P0H A;  2HV2 A;  4XPD C;  4BBH A;  4MFJ A;  4FD5 A;  1XE4 A;  4M85 A;  2OZU A;  3S6F A;  4A31 A;  3JVN A;  1FY7 A;  1VKC A;  3R9F A;  2PC1 A;  3F0A A;  4MHD A;  1GHE A;  3I3G A;  2KCW A;  1J4J A;  2FIW A;  2RC4 A;  4KOU A;  4XPD B;  5A27 A;  2CNS A;  5I0C A;  2B5G B;  1S60 A;  4OAE A;  2ZW5 A;  5G21 A;  4NSQ A;  1IYK A;  4JXR A;  2REF A;  1S5K A;  2B3U A;  3TTH A;  2P0W A;  3RYO A;  1Y9K A;  4AVC A;  1PUA A;  4FD6 A;  1IID A;  2Z11 A;  4Q36 A;  2B4D B;  2P6F A;  3LD2 A;  3R9E A;  4MBU A;  4KUA A;  4HNX B;  1ON0 A;  4PK2 A;  4KSF A;  2Q7B A;  2OZH A;  3VWE A;  2Z3P A;  3A9L A;  3TOA A;  4E2A A;  1RXT A;  4FD7 A;  4HNW B;  4QUS A;  3F8K A;  4KSA A;  1S7F A;  4UWJ A;  3NE7 A;  1PU9 A;  2FSR A;  4B5O A;  1IIC A;  2FS5 A;  2HUZ A;  3IWG A;  1Q2C A;  2ZXV A;  3QB8 A;  2QML A;  1XIX A;  2Y0M A;  2JDC A;  4F0X A;  4C7I A;  2PR8 A;  1P4N A;  2B5G A;  4UFX A;  3FBU A;  4KOX A;  4ORF A;  2YND A;  1M4D A;  4KOT A;  4QC6 A;  3CXP A;  3SHP A;  3BJ8 A;  2GE3 A;  3W6X A;  4K30 A;  2HQY A;  3JTK A;  5GCN A;  3K9U A;  5IB0 A;  1Q2D A;  2Z3K A;  2J8N A;  3E0K A;  2FT0 A;  5G1Z A;  4E0A A;  1NSL A;  5F48 A;  5EBV A;  4NXY A;  4R3K A;  4YGO A;  4MFQ A;  2ZPA A;  5J8C A;  2H5M A;  1CJW A;  1Z4R A;  2R1I A;  4B5P A;  2YNE A;  3WR7 A;  3D8P A;  1L0C A;  3KKW A;  3IU2 A;  1UFH A;  4B12 A;  2WSA A;  2G0B A;  2G3T A;  4Y49 B;  2Q0Y A;  2QIR A;  2CXA A;  1M4I A;  2R8V A;  1OZP A;  4AG7 A;  4PSW A;  3TFY A;  2WPW A;  5AG6 A;  4MFK A;  2OB0 A;  3TOB A;  2VI7 A;  3DDD A;  4UBR A;  4B14 A;  3FNC A;  2A4N A;  1YGH A;  2Z3O A;  3VWD A;  2ZW7 A;  4R87 A;  3DR6 A;  4CAX A;  1KZF A;  2ZW6 A;  4CYO A;  4R57 A;  4CAE A;  4A95 A;  4MFL A;  4ONU A;  4MFP A;  3R95 A;  4IUS A;  1KUY A;  2G3A A;  2EUI A;  4JXQ A;  2J8M A;  2YNC A;  3B8G A;  2GAN A;  3EFA A;  3G8W A;  1IYL A;  2J8R A;  5G22 A;  3FYN A;  4C7H A;  4KUB A;  2VEZ A;  5KTA A;  2VQY A;  3T9Y A;  4CGO A;  4MJ8 A;  1QST A;  4MY3 A;  2OU2 A;  4ZGY B;  4QVT A;  4MI4 A;  4NF1 A;  3ZZI A;  4H89 A;  4PV6 A;  2AJ6 A;  4B11 A;  5E96 A;  2Z3N A;  1NMT A;  2PQ8 A;  4NEX A;  3W6S A;  4LUA A;  5HH1 A;  4OAD A;  4UCN A;  2FE7 A;  4RI1 A;  2VXK A;  1YVK A;  4CYQ A;  4L89 A;  2Z3L A;  1WWZ A;  2Z3M A;  4UFW A;  4X5K A;  2Z0Z A;  3DNS A;  3S6H A;  1CM0 A;  1LRZ A;  4JLY A;  4B5P B;  1YX0 A;  4CRY B;  3TE4 A;  4CYN A;  4GS4 A;  1Z9U A;  4PSX A;  4J3G A;  1XEB A;  4A2Z A;  4H6U A;  2PDO A;  1B6B A;  4CYP A;  2WUU A;  3BLN A;  4F0Y A;  2WPX A;  3H4Q A;  2DPT A;  4KZT A;  4KOW A;  5G20 A;  3FRM A;  1S7K A;  4KVX A;  4QB9 A;  5C82 A;  3N7Z A;  4U5Y A;  4ZBG A;  4AVA A;  2YNC C;  5KTD A;  5AG4 A;  3P2F A;  4UCM A;  4KOV A;  1V0C A;  2DXQ A;  4II9 A;  5IV0 A;  2Q4V A;  2CY2 A;  2CNT A;  3PZJ A;  1M44 A;  3EXN A;  4UCP A;  5DWN A;  4C2X A;  4JD6 A;  4XPL A;  1M1D A;  1IB1 E;  2R7H A;  1VHS A;  4CS0 B;  2P6G A;  3EO4 A;  1ZO0 A;  3DSB A;  3TO9 A;  3PP9 A;  5FVJ A;  1NE9 A;  1XF8 A;  2BEI A;  3D2P A;  3EY5 A;  4XPK A;  3V8I A;  1Q2Y A;  2C27 A;  5EC4 A;  2IL4 A;  2ATR A;  5F49 A;  2P6E A;  3C26 A;  5HMN A;  4DNC A;  5IX3 A;  1QSN A;  4C2Y A;  4CGN A;  3GKR A;  2Q44 A;  1KUX A;  4NCZ A;  4UWI A;  2EVN A;  4OLL A;  3D2M A;  3T90 A;  4L8A A;  4JJX A;  4JWP A;  1Y9W A;  4KS9 A;  2YGW A;  3TO6 A;  3DR8 A;  2FXF A;  2Q4Y A;  4U9Y A;  3CXS A;  4AG9 A;  4YFJ A;  4UFV A;  4HNY B;  5A28 A;  5F46 A;  1QSR A;  1YRE A;  4M3S A;  3S6G A;  2D4O A;  4C2Z A;  2K5T A;  2JEV A;  4XNH C;  2I00 A;  1B87 A;  2VZY A;  1N71 A;  4KOY A;  1XMT A;  2QEC A;  3GY9 A;  4A33 A;  4FD4 A;  1K4J A;  5F47 A;  3R1K A;  5KTC A;  3W91 A;  2B3V A;  2AE6 A;  2FCK A;  4KOS A;  5C88 A;  1I1D A;  1SQH A;  2JLM A;  4B10 A;  3IWE A;  3P2H A;  2OZG A;  4XNH B;  5BWA B;  1U6M A;  4QBJ A;  4BMH A;  2FL4 A;  4U9Z A;  2ARH A;  1QSM A;  2F5I A;  2DPS A;  5JQ4 A;  3TT2 A;  3BJ7 A;  5J8F A;  2NMT A;  4PK3 A;  2ZW4 A;  3PGP A;  1KUV A;  4CRZ B;  3SXO A;  4CGL A;  2B58 A;  4UA3 A;  3IU1 A;  1MJB A;  3S6K A;  1TIQ A;  4CAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...