4L8AA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l8aA00
2P0WA 1KZFA 1M1DA 3JUWA 4RI1A 2G3TA 4CAXA 2WPWA 4YFJA 2OH1A 4H6ZA 4UWJA 3I9SA 2H5MA 3VWEA 4OLLA 3R9EA 1IYKA 3S6HA 1M44A 2GIVA 3R96A 3QB8A 4KOYA 2PSWA 3DR6A 3EY5A 4DNCA 2BL1A 1YLEA 2FT0A 4KVXA 4PSWA 3S6FA 3BJ7A 3CXSA 4MI4A 3VWDA 4AVCA 2NMTA 4AG9A 4L89A 2FE7A 3H4QA 1S60A 2Q0YA 2R1IA 1M4GA 2X7BA 2Q7BA 3FXTA 2EVNA 1U6MA 2HV2A 4B5OA 1IIDA 2D4PA 3BJ8A 3BLNA 4E8OA 1J4JA 2VZYA 2G0BA 4PSXA 3WR7A 5ISVA 3TO6A 1YGHA 1S7KA 4UWIA 1K4JA 4J3GA 1P4NA 2B5GB 4KLVA 4KORA 4XPKA 3T90A 2FSRA 5IX3A 4XPLA 4XPDB 2FL4A 5KTAA 1XIXA 4OADA 3FYNA 1MJAA 2CNMA 2BEIA 4U9YA 3DR8A 4FD4A 4R9MA 1PUAA 3UY5A 2CNTA 4K30A 2R98A 3DDDA 1Y9KA 2BSWA 3GY9A 2FS5A 5H86A 1V0CA 2R7HA 3JVNA 3NE7A 2B58A 2BUEA 1M4IA 3B8GA 2D4OA 4Y49C 5E96A 4CRYB 2P6GA 3PGPA 4MBUA 1P0HA 4QC6A 1R57A 2J8MA 4JLYA 1VHSA 4ONUA 2QECA 1N71A 1PU9A 1XF8A 4KUBA 4AG7A 2B4BA 3F5BA 5DWNA 4LUAA 4NSQA 2VBQA 4PK3A 4YRHA 2I00A 4QVTA 2QIRA 3S6KA 3FRMA 4RS2A 1YVKA 4MY0A 3EO4A 4MY3A 2ZW4A 1S3ZA 4JJXA 5FVJA 3R1KA 2CNSA 2ZW5A 3N7ZA 1NE9A 1IB1E 4AVAA 3T9YA 2JLMA 3TCVA 1YX0A 3W6SA 1I12A 2K5TA 4HNXB 2P6FA 4JWPA 1S5KA 4NEXA 4X5KA 1FY7A 5IB0A 1YR0A 4E0AA 2B5GA 3K9UA 3CXPA 1XE4A 4JXRA 1S7FA 4FD5A 5F46A 1KUXA 2OB0A 3D2PA 4ZBGA 3I3GA 1GHEA 5JPHA 5HH1A 2EUIA 3C26A 2GE3A 5J8CA 2VXKA 1Y7RA 3PZJA 2RC4A 4KLWA 2AE6A 1YK3A 4R87A 2CY2A 1CJWA 2Q04A 2J8NA 3FIXA 1YREA 3D2MA 1NMTA 1XEBA 3GYAA 3MGDA 1LRZA 1XMTA 3V8IA 2G3AA 3DSBA 4NF1A 1OZPA 2PC1A 1IYLA 4KOSA 4R57A 1SQHA 4KVME 2OZGA 4R3KA 2FIAA 2ZPAA 4I49A 4GS4A 2ZW7A 4XNHC 2J8RA 1ON0A 1S7NA 4LX9A 5F49A 1YVOA 2AJ6A 4EVYA 2PR8A 1M4DA 2ARHA 4II9A 4KZTA 2JDDA 3TT2A 2IL4A 5JQ4A 4Y49B 2VEZA 4CS0B 4OAEA 4M3SA 4NXYA 2FXFA 1VKCA 5DWMA 5EBVA 2KCWA 3D8PA 4MHDA 2ATRA 1I1DA 2B4DB 3LD2A 5EC4A 4CAWA 3QAHA 2PQ8A 4F6AA 3PP9A 3IGRA 4XPDC 2PRBA 3FNCA 1B87A 3OWCA 4PK2A 2ZXVA 4B5PA 2B3UA 5F47A 1QSMA 4QB9A 3CXQA 4KOUA 2ZW6A 4QBJA 5GCNA 4NCZA 4KOTA 4UBRA 1Q2YA 2PR1A 4XNHB 3W91A 2O28A 2R8VA 4YGOA 3RYOA 3TFYA 2FCKA 4KUAA 2Q44A 3EC4A 3TOAA 4CRZB 1RXTA 2PDOA 4R3LA 2REEA 2Y0MA 5HMNA 2OZHA 2GANA 1QSTA 3S6GA 2B3VA 3FBUA 3GKRA 5J8FA 3TO9A 2HQYA 2QMLA 1Y9WA 4HKFA 2VQYA 1S7LA 2P6EA 3EFAA 4JXQA 4FD6A 3SXOA 3TE4A 4UA3A 3R9GA 4F0YA 1QSNA 1Z4RA 3D3SA 2Z0ZA 4B5PB 3IWGA 1Q2CA 3KKWA 2OZUA 2WPXA 4U9ZA 2HUZA 1MK4A 4U5YA 2JEVA 4CAVA 1UFHA 1KUVA 2B4DA 2VZZA 1B6BA 4KOXA 1QSRA 2Q4YA 4MJ8A 4KOVA 2DXQA 4ORFA 2FIWA 2F5IA 1KUYA 2OU2A 3R9FA 4M85A 2Z10A 3SXNA 3ZJ0A 4IUSA 1QSOA 1NSLA 1MJBA 4HNWB 2JDCA 2A4NA 5I0CA 1I21A 5H84A 3G8WA 3SHPA 3DNSA 3TOBA 3P2FA 4KVOE 4IF5A 3ZZIA 4E2AA 5C88A 1BO4A 3F0AA 1Q2DA 2REFA 4AVBA 1WK4A 4H89A 3W6XA 1RO5A 4KOWA 4PV6A 4QUSA 4FD7A 4H6UA 3P2HA 1Z9UA 3E0KA 3R95A 4HNYB 4AB7A 2Z11A 2VI7A 4BMHA 3TTHA 5C82A 1CM0A 3G3SA 1TIQA 1BOBA 3EXNA 5F48A 2Q4VA 5IV0A 2I79A 3F8KA 3TO7A 3FB3A 3LODA 1Z4EA 5CNPA 1L0CA 1MJ9A 4JD6A 5KTCA 1WWZA 4L8AA 2C27A 5KTDA 1IICA
chains in the Genus database with same CATH superfamily
2XEGA 2P0WA 4UFVA 5AG6A 5D29A 4OC2A 3PBBA 1BLLE 2V8GA 4PPZA 1KZFA 4P44A 3IEHA 3LACA 1M1DA 3JUWA 4UIBA 2EBJA 1DE4C 4RI1A 1A2ZA 4MCSA 2POKA 1CPXA 2G3TA 3WC6A 4CAXA 2WPWA 4YFJA 2OH1A 4H6ZA 1JWQA 1EE3P 4UWJA 5K8PA 2PJ9A 3I9SA 1HDUA 6CPAA 2H5MA 4RUHA 3VWEA 4OLLA 3R9EA 3SJGA 1IYKA 4CGNA 1BAVA 5JH9A 3D7HA 3S6HA 1M44A 3D7GA 2C6PA 2PJ4A 2GIVA 3R96A 3D67A 1TKFA 3PB8X 4X8IA 2PJ1A 3V7ZA 3QB8A 4UCNA 1Q7LA 4KOYA 4NGPA 4PQAA 4Q36A 5AG5A 2PSWA 3DR6A 3EY5A 4DNCA 2BL1A 1YLEA 2FT0A 4P10A 4KVXA 4CGMA 4PSWA 5LRJA 3S6FA 4PXDA 2PE3A 3FJUA 4CGPA 4CAEA 3BJ7A 3CXSA 3V38A 5HXDA 3RBUA 4TNUA 1LAPA 4MCQA 4MI4A 4JZ0A 3VWDA 4AVCA 1QQ9A 2CF4A 2NMTA 4AG9A 4FWUA 4C7IA 4L89A 3D7DA 2ANPA 2FE7A 3H4QA 1S60A 2Q0YA 2R1IA 3JTKA 4X2TA 4ZGYB 2RFHA 2DF5A 1M4GA 3KL9A 4F0XA 1IGBA 4BD9A 1XRYA 2X7BA 2IQ6A 2Q7BA 3FXTA 2EVNA 1U6MA 2GLFA 3VH9A 2HV2A 1PYTB 4B5OA 3MRUA 1IIDA 3VATA 2D4PA 2DPTA 3BJ8A 1ZG9A 2PJ3A 2ZEOA 4MMOA 4NGRA 3BLNA 4OC3A 4E8OA 4KS9A 1J4JA 2VZYA 2G0BA 4PSXA 2Z3PA 3WR7A 5ISVA 3TO6A 1YGHA 1S7KA 4UWIA 2GREA 2ODFA 4JYWA 2YNCA 1F57A 3TC8A 2Q43A 1K4JA 3FX6A 1P4NA 2ZENA 4J3GA 4P6YA 1IU8A 2B5GB 4KLVA 3KR5A 4KORA 4ONWA 4UEFA 4XPKA 2AFUA 2FSRA 3T90A 5IX3A 2WZNA 4XPLA 4XPDB 2FL4A 5I4MA 2PVVA 5KTAA 3PB7X 1XIXA 4OADA 4Q7AA 3GUXA 3HLPA 3IJ3A 4R8FA 4UEEA 3FYNA 1MJAA 3LMSA 2CNMA 2BEIA 4OP4A 4U9YA 3S9NA 1ZG8A 3DR8A 4FD4A 4R9MA 1PUAA 4B13A 3UY5A 2CNTA 2ZEEA 2R98A 3PBEA 4K30A 3DDDA 4HPSA 1Y9KA 4MHPA 4MRIA 3FEEA 4IK2A 2BSWA 3RO0A 3GY9A 2FS5A 5H86A 4OC1A 1TF8A 4H2KA 1V0CA 4P45A 2BOAA 2R7HA 3JVNA 3NE7A 3RAMA 2B58A 2BUEA 2PJ6A 1M4IA 3BXMA 1ZO0A 4R6TA 3B8GA 2D4OA 1ARLA 2PJ5A 4Y49C 5E96A 4CRYB 2P6GA 2Z3KA 3PGPA 4MBUA 1P0HA 3DLJA 1H8LA 2PCUA 4QC6A 2VL1A 1R57A 4R7MA 1QMUA 2J8MA 1BPMA 1NSAA 4P4BA 4ZX9A 4NJQA 3NH8A 4JLYA 1CX8A 3S9MA 4CGOA 1VHSA 4MFQA 3KASA 4IAVA 2QECA 3B3SA 2AFOA 4NGNA 4ONUA 1BPNA 2DPSA 1N71A 4CYPA 4NGQA 1PU9A 3FH4A 1JQGA 2PIYA 1XF8A 1LAMA 7CPAA 1Z5RA 4KUBA 1ARMA 4ZY0A 4AG7A 3IC1A 4CYNA 2B4BA 3FMCA 1KWMA 2FVGA 1XBUA 3KGQA 3F5BA 1Y0YA 4LUAA 4NSQA 5DWNA 4ZYQA 2VBQA 4PK3A 2O53A 2PJCA 4YRHA 2I00A 2ZOGA 4M6IA 4QVTA 2QIRA 2ZEFA 4O23A 3S6KA 4X3RA 3FRMA 3CT9A 4PXCA 4RS2A 1UWYA 1YVKA 1Z8LA 3D66A 4M6GA 1XOVA 4MY0A 3EO4A 4MY3A 2OOTA 2ZW4A 1S3ZA 5DS0A 4JJXA 3WC5A 3SJFA 5FVJA 3KHZA 4FAIA 3R1KA 2OR4A 2CNSA 2ZW5A 3N7ZA 1NE9A 4AXVA 1IB1E 4AVAA 4F8ZA 3T9YA 2JLMA 3TCVA 1YX0A 3W6SA 1I12A 2F7VA 2PJ7A 2K5TA 4OIWA 4OC5A 5D8NA 4G1PA 4A37A 3IFEA 4HNXB 1ZLHA 1YLOA 2QYVA 2P6FA 4JWPA 1S5KA 4KSIA 4NEXA 4X5KA 1CP6A 1Z8WA 3D68A 1FY7A 3MN8A 1YR0A 1X10A 4C2XA 4DUKA 4E0AA 2JEWA 1TKHA 2DEAA 4BINA 2B5GA 3PFOA 3K9UA 3CXPA 1XE4A 1ZLIA 4NGSA 4YU9A 4F9UA 4JXRA 1S7FA 3RZAA 5HVGA 4FD5A 2PRQA 2XEJA 1KUXA 2OB0A 3D2PA 3RNZA 4ZBGA 1X12A 5F46A 3I3GA 1GHEA 2ZOFA 5JPHA 2G9DA 2J9AA 5HH1A 1AYEA 2EUIA 3QNVA 2BCOA 5JM6A 3C26A 4YWYA 4B10A 2GE3A 5J8CA 2IMOA 2F8HA 2VXKA 5EMIA 1Y7RA 3PZJA 5LYLA 3ISXA 2RC4A 4KLWA 3VARA 2AE6A 2AFSA 1Z2LA 4A33A 4WJBA 1YK3A 4UFXA 1CBXA 4MXUA 4R87A 1LOKA 1CJWA 2CY2A 2Q04A 4NGMA 2J8NA 3KQZA 5CBMA 3FIXA 1YREA 3D2MA 1NMTA 1XEBA 3GYAA 3MGDA 3SJXA 1GYTA 3KZWA 2Z3OA 2PJ2A 1LRZA 1XMTA 4MHZA 3V8IA 2G3AA 3DSBA 4NJRA 4NF1A 2PC1A 1OZPA 1IYLA 1Z8TA 4KOSA 4R57A 1TKJA 1SQHA 4ZY2A 4KVME 4OMEA 2OZGA 4R3KA 2ZEDA 5BWAB 3BHXA 2FIAA 3NH5A 2ZPAA 4KSFA 1R3NA 4I49A 5K8NA 2YNCC 2CTCA 2ZEMA 2ZW7A 4GS4A 4MFPA 2I3CA 2BO9A 2J8RA 1ON0A 3K2KA 1S7NA 4LX9A 4CAFA 2QVPA 5F49A 2GLJA 4CYQA 8CPAA 3JRUA 3SI2A 1YVOA 2AJ6A 4EVYA 4K3NA 2PR8A 1M4DA 1YW4A 2ARHA 2YNEA 2CTBA 3H8GA 5F09A 4II9A 2V77A 4KZTA 5G21A 2JDDA 3ISZA 2IL4A 3TT2A 1VHEA 3B7IA 5JQ4A 2EK9A 4W9YA 3GB0A 5LYIA 4Y49B 4FUUA 5CPAA 2VEZA 2CXAA 4CS0B 4OAEA 4C7HA 5HVHA 3H8EA 1LFWA 4M3SA 4MFJA 4MFKA 4PXBA 5K8MA 4NFRA 4NXYA 2FXFA 1HDQA 1Z8XA 5AG7A 1VKCA 5DWMA 5EBVA 4F9VA 4WWVA 3N5FA 5J1QA 2KCWA 2YNDA 3D8PA 4MHDA 2ATRA 1I1DA 4LQGA 3IU2A 2B4DB 3LD2A 5EC4A 2GU2A 4AVBA 3QAHA 4CAWA 2EK8A 2PQ8A 4F6AA 4UF4A 2YGWA 3PP9A 5G22A 1FT7A 1ZG7A 2CIJA 3IGRA 1FNOA 1IY7A 3NH4A 4XPDC 3NFZA 2PRBA 1YQEA 1LANA 3FNCA 3WT4A 1B87A 2AFWA 3OWCA 4PK2A 4C2YA 3A9LA 4OC0A 4P4EA 2ZXVA 2V8VA 2Q7SA 3PB9X 2B3UA 4B5PA 2XEIA 3PB6X 3QAYA 5F47A 2PJAA 3LWUA 1QSMA 1VGYA 3CXQA 4QB9A 4KOUA 3BI1A 2ZW6A 1CPSA 4QBJA 5GCNA 4NCZA 4MHNA 3B3TA 4KOTA 4UBRA 4UCMA 1Q2YA 2NYQA 4IHMA 2PR1A 5G1ZA 4EFDA 4XNHB 4R76A 5IB0A 3W91A 2Z3LA 4A32A 4BBHA 3BI0A 4KSAA 1HEEA 2EWBA 2O28A 1LCPA 3KI9A 2R8VA 4MFZA 2WYRA 4YGOA 3RYOA 3TFYA 1DTDA 2FCKA 4P4DA 3SI0A 4KUAA 2Q44A 3EC4A 2HC9A 4MCPA 5HVFA 3TOAA 4ZY1A 3CPXA 3S9LA 4CRZB 3KR4A 2AFMA 1RXTA 3T8WA 2PDOA 4R3LA 2REEA 2Y0MA 4A94A 4B14A 5HMNA 2OZHA 4MFLA 2GANA 1QSTA 1Y0RA 3S6GA 2Z3MA 2B3VA 2AFXA 3D7FA 3FBUA 3GKRA 5J8FA 3TO9A 2Z3NA 2PVWA 3SI1A 2HQYA 2QMLA 1Y9WA 3K9TA 2VQYA 4HKFA 1S7LA 2P6EA 4Q38A 1XJOA 2ZEPA 3EFAA 4UEZA 4CGLA 5LRKA 4JXQA 4FD6A 3SXOA 3WC7A 3TE4A 4UA3A 3R9GA 3CDXA 4XNHC 4F0YA 1QSNA 1TXRA 1Z4RA 3D3SA 4B12A 2Z0ZA 4GXHA 5G20A 1F2PA 1VIXA 4CPAA 4B5PB 4DJLA 1TF9A 3B35A 3IWGA 3KQXA 1Q2CA 3KKWA 2ZELA 2OZUA 4OKOA 4A2ZA 4P4FA 2WPXA 3CPAA 5JGFA 4U9ZA 2HUZA 1MK4A 4U5YA 2IJZA 3WABA 5A28A 2JEVA 3GIUA 3PEIA 3H5ZA 4OIDA 4CYOA 4CAVA 1UFHA 1AMPA 1KUVA 2B4DA 2VZZA 1B6BA 4KOXA 2ZEGA 4C68A 3HUVA 1QSRA 2Q4YA 4MJ8A 5AGEA 2C1CA 3FECA 4C2ZA 4KOVA 3CZXA 1XMBA 5A27A 4MCRA 2DXQA 2ZEHA 4TWEA 3L2NA 2V8HA 4ORFA 2O4HA 2WUUA 1CP7A 1IOIA 1VHOA 1CG2A 2Q51A 2FIWA 2F5IA 1KUYA 2OU2A 3KHXA 3R9FA 4M85A 5K8OA 4ZX8A 2Z10A 3SXNA 5LRGA 3ZJ0A 4A95A 4IUSA 1QSOA 1NSLA 5IB9A 1MJBA 3B3VA 2C6GA 5LYFA 3NE8A 4HNWB 2JDCA 3IWWA 4UFWA 2A4NA 4ZI6A 4GM5A 1I21A 4P4IA 4FBEA 5H84A 5I0CA 1PCAA 2ABZA 3G8WA 3PB4X 3SHPA 5KTCA 2GFQA 1IOFA 2Q4ZA 2AFZA 3DNSA 3TOBA 3PRTA 4P4JA 4B6ZA 3P2FA 2JBKA 4B11A 2WSAA 2QJ8A 4KVOE 3FVLA 3FEDA 4IF5A 4M6HA 3ZZIA 4E2AA 2HB6A 4UCPA 5C88A 4A39A 3IIBA 1BO4A 3DGVA 3F0AA 4Z65A 1Q2DA 2REFA 3TX8A 3FF3A 3B3CA 1WK4A 4H89A 2C6CA 1F2OA 5THWA 2PJBA 4EWTA 3H8FA 1AUGA 3B3WA 1RTQA 4A30A 3W6XA 5AG4A 1RO5A 4KOWA 2PJ8A 4EMEA 4PV6A 3IU1A 1YMEA 3PFEA 4QUSA 4FD7A 3B2YA 4OC4A 4H6UA 1YW6A 3P2HA 1Z9UA 4MHYA 3D4UA 3E0KA 3R95A 2RB7A 1OBRA 4HNYB 4AB7A 2Z11A 3IO1A 2VI7A 1YSJA 3TTHA 4BMHA 2PIZA 5C82A 1CM0A 1M4LA 3G3SA 2EO8A 1R43A 2V8DA 4A31A 1TIQA 4LQ6A 1BOBA 3EXNA 5LYDA 5F48A 3SJEA 3GLJA 5ELYA 2Q4VA 5IV0A 2I79A 2JBJA 2PJ0A 3F8KA 4NGTA 3TO7A 3IWEA 3FB3A 3LODA 1Z4EA 1ELLP 4PXEA 4UIAA 5CNPA 1L0CA 1MJ9A 2XEFA 1ELMP 4JD6A 4RN7A 3NA6A 4A38A 1WWZA 3I1UA 2C27A 1Y7EA 2NSMA 4L8AA 1XFOA 4DYOA 5KTDA 1IICA
chains in the Genus database with same CATH topology
2P0WA 4UFVA 5AG6A 1KZFA 1M1DA 3JUWA 4RI1A 2G3TA 4CAXA 2WPWA 4YFJA 2OH1A 4H6ZA 4UWJA 3I9SA 2H5MA 3VWEA 4OLLA 3R9EA 1IYKA 4CGNA 3S6HA 1M44A 2GIVA 3R96A 3QB8A 4UCNA 4KOYA 4Q36A 5AG5A 2PSWA 3DR6A 3EY5A 4DNCA 2BL1A 1YLEA 2FT0A 4KVXA 4CGMA 4PSWA 3S6FA 4CGPA 4CAEA 3BJ7A 3CXSA 4MI4A 3VWDA 4AVCA 2NMTA 4AG9A 4C7IA 4L89A 2FE7A 3H4QA 1S60A 2Q0YA 2R1IA 3JTKA 4ZGYB 1M4GA 4F0XA 2X7BA 2Q7BA 3FXTA 2EVNA 1U6MA 2HV2A 4B5OA 1IIDA 2D4PA 2DPTA 3BJ8A 3BLNA 4E8OA 4KS9A 1J4JA 2VZYA 2G0BA 4PSXA 2Z3PA 3WR7A 5ISVA 3TO6A 1YGHA 1S7KA 4UWIA 2YNCA 1K4JA 4J3GA 1P4NA 2B5GB 4KLVA 4KORA 4XPKA 3T90A 2FSRA 5IX3A 4XPLA 4XPDB 2FL4A 5KTAA 1XIXA 4OADA 3FYNA 1MJAA 2CNMA 2BEIA 4U9YA 3DR8A 4FD4A 4R9MA 1PUAA 4B13A 3UY5A 2CNTA 4K30A 2R98A 3DDDA 1Y9KA 2BSWA 3GY9A 2FS5A 5H86A 1V0CA 2R7HA 3JVNA 3NE7A 2B58A 2BUEA 1M4IA 1ZO0A 3B8GA 2D4OA 4Y49C 5E96A 4CRYB 2P6GA 2Z3KA 3PGPA 4MBUA 1P0HA 4QC6A 1R57A 2J8MA 4JLYA 4CGOA 1VHSA 4MFQA 4ONUA 2QECA 2DPSA 1N71A 4CYPA 1PU9A 1XF8A 4KUBA 4AG7A 4CYNA 2B4BA 3F5BA 5DWNA 4LUAA 4NSQA 2VBQA 4PK3A 4YRHA 2I00A 4QVTA 2QIRA 3S6KA 3FRMA 4RS2A 1YVKA 4MY0A 3EO4A 4MY3A 2ZW4A 1S3ZA 4JJXA 5FVJA 3R1KA 2CNSA 2ZW5A 3N7ZA 1NE9A 1IB1E 4AVAA 3T9YA 2JLMA 3TCVA 1YX0A 3W6SA 1I12A 2K5TA 4HNXB 2P6FA 4JWPA 1S5KA 4NEXA 4X5KA 1FY7A 4C2XA 1YR0A 4E0AA 5IB0A 2B5GA 3K9UA 3CXPA 1XE4A 4JXRA 1S7FA 4FD5A 5F46A 1KUXA 2OB0A 3D2PA 4ZBGA 3I3GA 1GHEA 5JPHA 5HH1A 2EUIA 3C26A 4B10A 2GE3A 5J8CA 2VXKA 1Y7RA 3PZJA 2RC4A 4KLWA 2AE6A 4A33A 1YK3A 4UFXA 4R87A 2CY2A 1CJWA 2Q04A 2J8NA 3FIXA 1YREA 3D2MA 1NMTA 1XEBA 3MGDA 3GYAA 2Z3OA 1LRZA 1XMTA 3V8IA 2G3AA 3DSBA 4NF1A 1OZPA 2PC1A 1IYLA 4KOSA 4R57A 1SQHA 4KVME 2OZGA 4R3KA 5BWAB 2FIAA 4KSFA 2ZPAA 4I49A 2YNCC 4GS4A 2ZW7A 4MFPA 4XNHC 4CAFA 2J8RA 1ON0A 1S7NA 4LX9A 5F49A 4CYQA 1YVOA 2AJ6A 4EVYA 2PR8A 1M4DA 2ARHA 2YNEA 4II9A 5G21A 4KZTA 2JDDA 3TT2A 2IL4A 5JQ4A 4Y49B 2VEZA 2CXAA 4CS0B 4OAEA 4C7HA 4M3SA 4MFJA 4MFKA 4NXYA 2FXFA 5AG7A 1VKCA 5DWMA 5EBVA 2KCWA 2YNDA 3D8PA 4MHDA 2ATRA 1I1DA 3IU2A 2B4DB 3LD2A 5EC4A 4CAWA 3QAHA 2PQ8A 4F6AA 2YGWA 3PP9A 5G22A 3IGRA 4XPDC 2PRBA 3FNCA 1B87A 3OWCA 4PK2A 4C2YA 3A9LA 2ZXVA 4B5PA 2B3UA 5F47A 1QSMA 4QB9A 3CXQA 4KOUA 2ZW6A 4QBJA 5GCNA 4NCZA 4KOTA 4UBRA 4UCMA 1Q2YA 2PR1A 5G1ZA 4XNHB 3W91A 2Z3LA 4A32A 4BBHA 4KSAA 4MFZA 2O28A 2R8VA 4YGOA 3RYOA 3TFYA 2FCKA 4KUAA 2Q44A 3EC4A 3TOAA 4CRZB 1RXTA 2PDOA 4R3LA 2REEA 2Y0MA 4B14A 5HMNA 2OZHA 4MFLA 2GANA 1QSTA 3S6GA 2Z3MA 2B3VA 3FBUA 3GKRA 5J8FA 3TO9A 2Z3NA 2HQYA 2QMLA 1Y9WA 4HKFA 2VQYA 1S7LA 2P6EA 4Q38A 4CGLA 3EFAA 4JXQA 4FD6A 3SXOA 3TE4A 4UA3A 3R9GA 4F0YA 1QSNA 1Z4RA 3D3SA 4B12A 2Z0ZA 5G20A 4B5PB 3IWGA 1Q2CA 3KKWA 2OZUA 4A2ZA 2WPXA 4U9ZA 2HUZA 1MK4A 4U5YA 5A28A 2JEVA 3H5ZA 4CYOA 4CAVA 1UFHA 1KUVA 4C68A 2B4DA 2VZZA 1B6BA 4KOXA 5AGEA 1QSRA 2Q4YA 4MJ8A 4C2ZA 4KOVA 5A27A 2DXQA 4ORFA 2WUUA 2FIWA 2F5IA 1KUYA 2OU2A 3R9FA 4M85A 2Z10A 3SXNA 3ZJ0A 4A95A 4IUSA 1QSOA 1NSLA 1MJBA 4HNWB 2JDCA 4UFWA 2A4NA 5I0CA 1I21A 5H84A 3G8WA 3SHPA 3DNSA 3TOBA 3P2FA 4B11A 2WSAA 4KVOE 4IF5A 3ZZIA 4E2AA 4UCPA 5C88A 1BO4A 3F0AA 1Q2DA 2REFA 4AVBA 1WK4A 4H89A 4A30A 3W6XA 5AG4A 1RO5A 4KOWA 4PV6A 3IU1A 4QUSA 4FD7A 4H6UA 3P2HA 1Z9UA 3E0KA 3R95A 4HNYB 4AB7A 2Z11A 2VI7A 4BMHA 3TTHA 5C82A 1CM0A 3G3SA 4A31A 1TIQA 1BOBA 3EXNA 5F48A 2Q4VA 5IV0A 2I79A 3F8KA 3TO7A 3IWEA 3FB3A 3LODA 1Z4EA 5CNPA 1L0CA 1MJ9A 4JD6A 5KTCA 1WWZA 4L8AA 2C27A 5KTDA 1IICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0W A;  1KZF A;  1M1D A;  3JUW A;  4RI1 A;  2G3T A;  4CAX A;  2WPW A;  4YFJ A;  2OH1 A;  4H6Z A;  4UWJ A;  3I9S A;  2H5M A;  3VWE A;  4OLL A;  3R9E A;  1IYK A;  3S6H A;  1M44 A;  2GIV A;  3R96 A;  3QB8 A;  4KOY A;  2PSW A;  3DR6 A;  3EY5 A;  4DNC A;  2BL1 A;  1YLE A;  2FT0 A;  4KVX A;  4PSW A;  3S6F A;  3BJ7 A;  3CXS A;  4MI4 A;  3VWD A;  4AVC A;  2NMT A;  4AG9 A;  4L89 A;  2FE7 A;  3H4Q A;  1S60 A;  2Q0Y A;  2R1I A;  1M4G A;  2X7B A;  2Q7B A;  3FXT A;  2EVN A;  1U6M A;  2HV2 A;  4B5O A;  1IID A;  2D4P A;  3BJ8 A;  3BLN A;  4E8O A;  1J4J A;  2VZY A;  2G0B A;  4PSX A;  3WR7 A;  5ISV A;  3TO6 A;  1YGH A;  1S7K A;  4UWI A;  1K4J A;  4J3G A;  1P4N A;  2B5G B;  4KLV A;  4KOR A;  4XPK A;  3T90 A;  2FSR A;  5IX3 A;  4XPL A;  4XPD B;  2FL4 A;  5KTA A;  1XIX A;  4OAD A;  3FYN A;  1MJA A;  2CNM A;  2BEI A;  4U9Y A;  3DR8 A;  4FD4 A;  4R9M A;  1PUA A;  3UY5 A;  2CNT A;  4K30 A;  2R98 A;  3DDD A;  1Y9K A;  2BSW A;  3GY9 A;  2FS5 A;  5H86 A;  1V0C A;  2R7H A;  3JVN A;  3NE7 A;  2B58 A;  2BUE A;  1M4I A;  3B8G A;  2D4O A;  4Y49 C;  5E96 A;  4CRY B;  2P6G A;  3PGP A;  4MBU A;  1P0H A;  4QC6 A;  1R57 A;  2J8M A;  4JLY A;  1VHS A;  4ONU A;  2QEC A;  1N71 A;  1PU9 A;  1XF8 A;  4KUB A;  4AG7 A;  2B4B A;  3F5B A;  5DWN A;  4LUA A;  4NSQ A;  2VBQ A;  4PK3 A;  4YRH A;  2I00 A;  4QVT A;  2QIR A;  3S6K A;  3FRM A;  4RS2 A;  1YVK A;  4MY0 A;  3EO4 A;  4MY3 A;  2ZW4 A;  1S3Z A;  4JJX A;  5FVJ A;  3R1K A;  2CNS A;  2ZW5 A;  3N7Z A;  1NE9 A;  1IB1 E;  4AVA A;  3T9Y A;  2JLM A;  3TCV A;  1YX0 A;  3W6S A;  1I12 A;  2K5T A;  4HNX B;  2P6F A;  4JWP A;  1S5K A;  4NEX A;  4X5K A;  1FY7 A;  5IB0 A;  1YR0 A;  4E0A A;  2B5G A;  3K9U A;  3CXP A;  1XE4 A;  4JXR A;  1S7F A;  4FD5 A;  5F46 A;  1KUX A;  2OB0 A;  3D2P A;  4ZBG A;  3I3G A;  1GHE A;  5JPH A;  5HH1 A;  2EUI A;  3C26 A;  2GE3 A;  5J8C A;  2VXK A;  1Y7R A;  3PZJ A;  2RC4 A;  4KLW A;  2AE6 A;  1YK3 A;  4R87 A;  2CY2 A;  1CJW A;  2Q04 A;  2J8N A;  3FIX A;  1YRE A;  3D2M A;  1NMT A;  1XEB A;  3GYA A;  3MGD A;  1LRZ A;  1XMT A;  3V8I A;  2G3A A;  3DSB A;  4NF1 A;  1OZP A;  2PC1 A;  1IYL A;  4KOS A;  4R57 A;  1SQH A;  4KVM E;  2OZG A;  4R3K A;  2FIA A;  2ZPA A;  4I49 A;  4GS4 A;  2ZW7 A;  4XNH C;  2J8R A;  1ON0 A;  1S7N A;  4LX9 A;  5F49 A;  1YVO A;  2AJ6 A;  4EVY A;  2PR8 A;  1M4D A;  2ARH A;  4II9 A;  4KZT A;  2JDD A;  3TT2 A;  2IL4 A;  5JQ4 A;  4Y49 B;  2VEZ A;  4CS0 B;  4OAE A;  4M3S A;  4NXY A;  2FXF A;  1VKC A;  5DWM A;  5EBV A;  2KCW A;  3D8P A;  4MHD A;  2ATR A;  1I1D A;  2B4D B;  3LD2 A;  5EC4 A;  4CAW A;  3QAH A;  2PQ8 A;  4F6A A;  3PP9 A;  3IGR A;  4XPD C;  2PRB A;  3FNC A;  1B87 A;  3OWC A;  4PK2 A;  2ZXV A;  4B5P A;  2B3U A;  5F47 A;  1QSM A;  4QB9 A;  3CXQ A;  4KOU A;  2ZW6 A;  4QBJ A;  5GCN A;  4NCZ A;  4KOT A;  4UBR A;  1Q2Y A;  2PR1 A;  4XNH B;  3W91 A;  2O28 A;  2R8V A;  4YGO A;  3RYO A;  3TFY A;  2FCK A;  4KUA A;  2Q44 A;  3EC4 A;  3TOA A;  4CRZ B;  1RXT A;  2PDO A;  4R3L A;  2REE A;  2Y0M A;  5HMN A;  2OZH A;  2GAN A;  1QST A;  3S6G A;  2B3V A;  3FBU A;  3GKR A;  5J8F A;  3TO9 A;  2HQY A;  2QML A;  1Y9W A;  4HKF A;  2VQY A;  1S7L A;  2P6E A;  3EFA A;  4JXQ A;  4FD6 A;  3SXO A;  3TE4 A;  4UA3 A;  3R9G A;  4F0Y A;  1QSN A;  1Z4R A;  3D3S A;  2Z0Z A;  4B5P B;  3IWG A;  1Q2C A;  3KKW A;  2OZU A;  2WPX A;  4U9Z A;  2HUZ A;  1MK4 A;  4U5Y A;  2JEV A;  4CAV A;  1UFH A;  1KUV A;  2B4D A;  2VZZ A;  1B6B A;  4KOX A;  1QSR A;  2Q4Y A;  4MJ8 A;  4KOV A;  2DXQ A;  4ORF A;  2FIW A;  2F5I A;  1KUY A;  2OU2 A;  3R9F A;  4M85 A;  2Z10 A;  3SXN A;  3ZJ0 A;  4IUS A;  1QSO A;  1NSL A;  1MJB A;  4HNW B;  2JDC A;  2A4N A;  5I0C A;  1I21 A;  5H84 A;  3G8W A;  3SHP A;  3DNS A;  3TOB A;  3P2F A;  4KVO E;  4IF5 A;  3ZZI A;  4E2A A;  5C88 A;  1BO4 A;  3F0A A;  1Q2D A;  2REF A;  4AVB A;  1WK4 A;  4H89 A;  3W6X A;  1RO5 A;  4KOW A;  4PV6 A;  4QUS A;  4FD7 A;  4H6U A;  3P2H A;  1Z9U A;  3E0K A;  3R95 A;  4HNY B;  4AB7 A;  2Z11 A;  2VI7 A;  4BMH A;  3TTH A;  5C82 A;  1CM0 A;  3G3S A;  1TIQ A;  1BOB A;  3EXN A;  5F48 A;  2Q4V A;  5IV0 A;  2I79 A;  3F8K A;  3TO7 A;  3FB3 A;  3LOD A;  1Z4E A;  5CNP A;  1L0C A;  1MJ9 A;  4JD6 A;  5KTC A;  1WWZ A;  4L8A A;  2C27 A;  5KTD A;  1IIC A; 
#chains in the Genus database with same CATH topology
 2XEG A;  2P0W A;  4UFV A;  5AG6 A;  5D29 A;  4OC2 A;  3PBB A;  1BLL E;  2V8G A;  4PPZ A;  1KZF A;  4P44 A;  3IEH A;  3LAC A;  1M1D A;  3JUW A;  4UIB A;  2EBJ A;  1DE4 C;  4RI1 A;  1A2Z A;  4MCS A;  2POK A;  1CPX A;  2G3T A;  3WC6 A;  4CAX A;  2WPW A;  4YFJ A;  2OH1 A;  4H6Z A;  1JWQ A;  1EE3 P;  4UWJ A;  5K8P A;  2PJ9 A;  3I9S A;  1HDU A;  6CPA A;  2H5M A;  4RUH A;  3VWE A;  4OLL A;  3R9E A;  3SJG A;  1IYK A;  4CGN A;  1BAV A;  5JH9 A;  3D7H A;  3S6H A;  1M44 A;  3D7G A;  2C6P A;  2PJ4 A;  2GIV A;  3R96 A;  3D67 A;  1TKF A;  3PB8 X;  4X8I A;  2PJ1 A;  3V7Z A;  3QB8 A;  4UCN A;  1Q7L A;  4KOY A;  4NGP A;  4PQA A;  4Q36 A;  5AG5 A;  2PSW A;  3DR6 A;  3EY5 A;  4DNC A;  2BL1 A;  1YLE A;  2FT0 A;  4P10 A;  4KVX A;  4CGM A;  4PSW A;  5LRJ A;  3S6F A;  4PXD A;  2PE3 A;  3FJU A;  4CGP A;  4CAE A;  3BJ7 A;  3CXS A;  3V38 A;  5HXD A;  3RBU A;  4TNU A;  1LAP A;  4MCQ A;  4MI4 A;  4JZ0 A;  3VWD A;  4AVC A;  1QQ9 A;  2CF4 A;  2NMT A;  4AG9 A;  4FWU A;  4C7I A;  4L89 A;  3D7D A;  2ANP A;  2FE7 A;  3H4Q A;  1S60 A;  2Q0Y A;  2R1I A;  3JTK A;  4X2T A;  4ZGY B;  2RFH A;  2DF5 A;  1M4G A;  3KL9 A;  4F0X A;  1IGB A;  4BD9 A;  1XRY A;  2X7B A;  2IQ6 A;  2Q7B A;  3FXT A;  2EVN A;  1U6M A;  2GLF A;  3VH9 A;  2HV2 A;  1PYT B;  4B5O A;  3MRU A;  1IID A;  3VAT A;  2D4P A;  2DPT A;  3BJ8 A;  1ZG9 A;  2PJ3 A;  2ZEO A;  4MMO A;  4NGR A;  3BLN A;  4OC3 A;  4E8O A;  4KS9 A;  1J4J A;  2VZY A;  2G0B A;  4PSX A;  2Z3P A;  3WR7 A;  5ISV A;  3TO6 A;  1YGH A;  1S7K A;  4UWI A;  2GRE A;  2ODF A;  4JYW A;  2YNC A;  1F57 A;  3TC8 A;  2Q43 A;  1K4J A;  3FX6 A;  1P4N A;  2ZEN A;  4J3G A;  4P6Y A;  1IU8 A;  2B5G B;  4KLV A;  3KR5 A;  4KOR A;  4ONW A;  4UEF A;  4XPK A;  2AFU A;  2FSR A;  3T90 A;  5IX3 A;  2WZN A;  4XPL A;  4XPD B;  2FL4 A;  5I4M A;  2PVV A;  5KTA A;  3PB7 X;  1XIX A;  4OAD A;  4Q7A A;  3GUX A;  3HLP A;  3IJ3 A;  4R8F A;  4UEE A;  3FYN A;  1MJA A;  3LMS A;  2CNM A;  2BEI A;  4OP4 A;  4U9Y A;  3S9N A;  1ZG8 A;  3DR8 A;  4FD4 A;  4R9M A;  1PUA A;  4B13 A;  3UY5 A;  2CNT A;  2ZEE A;  2R98 A;  3PBE A;  4K30 A;  3DDD A;  4HPS A;  1Y9K A;  4MHP A;  4MRI A;  3FEE A;  4IK2 A;  2BSW A;  3RO0 A;  3GY9 A;  2FS5 A;  5H86 A;  4OC1 A;  1TF8 A;  4H2K A;  1V0C A;  4P45 A;  2BOA A;  2R7H A;  3JVN A;  3NE7 A;  3RAM A;  2B58 A;  2BUE A;  2PJ6 A;  1M4I A;  3BXM A;  1ZO0 A;  4R6T A;  3B8G A;  2D4O A;  1ARL A;  2PJ5 A;  4Y49 C;  5E96 A;  4CRY B;  2P6G A;  2Z3K A;  3PGP A;  4MBU A;  1P0H A;  3DLJ A;  1H8L A;  2PCU A;  4QC6 A;  2VL1 A;  1R57 A;  4R7M A;  1QMU A;  2J8M A;  1BPM A;  1NSA A;  4P4B A;  4ZX9 A;  4NJQ A;  3NH8 A;  4JLY A;  1CX8 A;  3S9M A;  4CGO A;  1VHS A;  4MFQ A;  3KAS A;  4IAV A;  2QEC A;  3B3S A;  2AFO A;  4NGN A;  4ONU A;  1BPN A;  2DPS A;  1N71 A;  4CYP A;  4NGQ A;  1PU9 A;  3FH4 A;  1JQG A;  2PIY A;  1XF8 A;  1LAM A;  7CPA A;  1Z5R A;  4KUB A;  1ARM A;  4ZY0 A;  4AG7 A;  3IC1 A;  4CYN A;  2B4B A;  3FMC A;  1KWM A;  2FVG A;  1XBU A;  3KGQ A;  3F5B A;  1Y0Y A;  4LUA A;  4NSQ A;  5DWN A;  4ZYQ A;  2VBQ A;  4PK3 A;  2O53 A;  2PJC A;  4YRH A;  2I00 A;  2ZOG A;  4M6I A;  4QVT A;  2QIR A;  2ZEF A;  4O23 A;  3S6K A;  4X3R A;  3FRM A;  3CT9 A;  4PXC A;  4RS2 A;  1UWY A;  1YVK A;  1Z8L A;  3D66 A;  4M6G A;  1XOV A;  4MY0 A;  3EO4 A;  4MY3 A;  2OOT A;  2ZW4 A;  1S3Z A;  5DS0 A;  4JJX A;  3WC5 A;  3SJF A;  5FVJ A;  3KHZ A;  4FAI A;  3R1K A;  2OR4 A;  2CNS A;  2ZW5 A;  3N7Z A;  1NE9 A;  4AXV A;  1IB1 E;  4AVA A;  4F8Z A;  3T9Y A;  2JLM A;  3TCV A;  1YX0 A;  3W6S A;  1I12 A;  2F7V A;  2PJ7 A;  2K5T A;  4OIW A;  4OC5 A;  5D8N A;  4G1P A;  4A37 A;  3IFE A;  4HNX B;  1ZLH A;  1YLO A;  2QYV A;  2P6F A;  4JWP A;  1S5K A;  4KSI A;  4NEX A;  4X5K A;  1CP6 A;  1Z8W A;  3D68 A;  1FY7 A;  3MN8 A;  1YR0 A;  1X10 A;  4C2X A;  4DUK A;  4E0A A;  2JEW A;  1TKH A;  2DEA A;  4BIN A;  2B5G A;  3PFO A;  3K9U A;  3CXP A;  1XE4 A;  1ZLI A;  4NGS A;  4YU9 A;  4F9U A;  4JXR A;  1S7F A;  3RZA A;  5HVG A;  4FD5 A;  2PRQ A;  2XEJ A;  1KUX A;  2OB0 A;  3D2P A;  3RNZ A;  4ZBG A;  1X12 A;  5F46 A;  3I3G A;  1GHE A;  2ZOF A;  5JPH A;  2G9D A;  2J9A A;  5HH1 A;  1AYE A;  2EUI A;  3QNV A;  2BCO A;  5JM6 A;  3C26 A;  4YWY A;  4B10 A;  2GE3 A;  5J8C A;  2IMO A;  2F8H A;  2VXK A;  5EMI A;  1Y7R A;  3PZJ A;  5LYL A;  3ISX A;  2RC4 A;  4KLW A;  3VAR A;  2AE6 A;  2AFS A;  1Z2L A;  4A33 A;  4WJB A;  1YK3 A;  4UFX A;  1CBX A;  4MXU A;  4R87 A;  1LOK A;  1CJW A;  2CY2 A;  2Q04 A;  4NGM A;  2J8N A;  3KQZ A;  5CBM A;  3FIX A;  1YRE A;  3D2M A;  1NMT A;  1XEB A;  3GYA A;  3MGD A;  3SJX A;  1GYT A;  3KZW A;  2Z3O A;  2PJ2 A;  1LRZ A;  1XMT A;  4MHZ A;  3V8I A;  2G3A A;  3DSB A;  4NJR A;  4NF1 A;  2PC1 A;  1OZP A;  1IYL A;  1Z8T A;  4KOS A;  4R57 A;  1TKJ A;  1SQH A;  4ZY2 A;  4KVM E;  4OME A;  2OZG A;  4R3K A;  2ZED A;  5BWA B;  3BHX A;  2FIA A;  3NH5 A;  2ZPA A;  4KSF A;  1R3N A;  4I49 A;  5K8N A;  2YNC C;  2CTC A;  2ZEM A;  2ZW7 A;  4GS4 A;  4MFP A;  2I3C A;  2BO9 A;  2J8R A;  1ON0 A;  3K2K A;  1S7N A;  4LX9 A;  4CAF A;  2QVP A;  5F49 A;  2GLJ A;  4CYQ A;  8CPA A;  3JRU A;  3SI2 A;  1YVO A;  2AJ6 A;  4EVY A;  4K3N A;  2PR8 A;  1M4D A;  1YW4 A;  2ARH A;  2YNE A;  2CTB A;  3H8G A;  5F09 A;  4II9 A;  2V77 A;  4KZT A;  5G21 A;  2JDD A;  3ISZ A;  2IL4 A;  3TT2 A;  1VHE A;  3B7I A;  5JQ4 A;  2EK9 A;  4W9Y A;  3GB0 A;  5LYI A;  4Y49 B;  4FUU A;  5CPA A;  2VEZ A;  2CXA A;  4CS0 B;  4OAE A;  4C7H A;  5HVH A;  3H8E A;  1LFW A;  4M3S A;  4MFJ A;  4MFK A;  4PXB A;  5K8M A;  4NFR A;  4NXY A;  2FXF A;  1HDQ A;  1Z8X A;  5AG7 A;  1VKC A;  5DWM A;  5EBV A;  4F9V A;  4WWV A;  3N5F A;  5J1Q A;  2KCW A;  2YND A;  3D8P A;  4MHD A;  2ATR A;  1I1D A;  4LQG A;  3IU2 A;  2B4D B;  3LD2 A;  5EC4 A;  2GU2 A;  4AVB A;  3QAH A;  4CAW A;  2EK8 A;  2PQ8 A;  4F6A A;  4UF4 A;  2YGW A;  3PP9 A;  5G22 A;  1FT7 A;  1ZG7 A;  2CIJ A;  3IGR A;  1FNO A;  1IY7 A;  3NH4 A;  4XPD C;  3NFZ A;  2PRB A;  1YQE A;  1LAN A;  3FNC A;  3WT4 A;  1B87 A;  2AFW A;  3OWC A;  4PK2 A;  4C2Y A;  3A9L A;  4OC0 A;  4P4E A;  2ZXV A;  2V8V A;  2Q7S A;  3PB9 X;  2B3U A;  4B5P A;  2XEI A;  3PB6 X;  3QAY A;  5F47 A;  2PJA A;  3LWU A;  1QSM A;  1VGY A;  3CXQ A;  4QB9 A;  4KOU A;  3BI1 A;  2ZW6 A;  1CPS A;  4QBJ A;  5GCN A;  4NCZ A;  4MHN A;  3B3T A;  4KOT A;  4UBR A;  4UCM A;  1Q2Y A;  2NYQ A;  4IHM A;  2PR1 A;  5G1Z A;  4EFD A;  4XNH B;  4R76 A;  5IB0 A;  3W91 A;  2Z3L A;  4A32 A;  4BBH A;  3BI0 A;  4KSA A;  1HEE A;  2EWB A;  2O28 A;  1LCP A;  3KI9 A;  2R8V A;  4MFZ A;  2WYR A;  4YGO A;  3RYO A;  3TFY A;  1DTD A;  2FCK A;  4P4D A;  3SI0 A;  4KUA A;  2Q44 A;  3EC4 A;  2HC9 A;  4MCP A;  5HVF A;  3TOA A;  4ZY1 A;  3CPX A;  3S9L A;  4CRZ B;  3KR4 A;  2AFM A;  1RXT A;  3T8W A;  2PDO A;  4R3L A;  2REE A;  2Y0M A;  4A94 A;  4B14 A;  5HMN A;  2OZH A;  4MFL A;  2GAN A;  1QST A;  1Y0R A;  3S6G A;  2Z3M A;  2B3V A;  2AFX A;  3D7F A;  3FBU A;  3GKR A;  5J8F A;  3TO9 A;  2Z3N A;  2PVW A;  3SI1 A;  2HQY A;  2QML A;  1Y9W A;  3K9T A;  2VQY A;  4HKF A;  1S7L A;  2P6E A;  4Q38 A;  1XJO A;  2ZEP A;  3EFA A;  4UEZ A;  4CGL A;  5LRK A;  4JXQ A;  4FD6 A;  3SXO A;  3WC7 A;  3TE4 A;  4UA3 A;  3R9G A;  3CDX A;  4XNH C;  4F0Y A;  1QSN A;  1TXR A;  1Z4R A;  3D3S A;  4B12 A;  2Z0Z A;  4GXH A;  5G20 A;  1F2P A;  1VIX A;  4CPA A;  4B5P B;  4DJL A;  1TF9 A;  3B35 A;  3IWG A;  3KQX A;  1Q2C A;  3KKW A;  2ZEL A;  2OZU A;  4OKO A;  4A2Z A;  4P4F A;  2WPX A;  3CPA A;  5JGF A;  4U9Z A;  2HUZ A;  1MK4 A;  4U5Y A;  2IJZ A;  3WAB A;  5A28 A;  2JEV A;  3GIU A;  3PEI A;  3H5Z A;  4OID A;  4CYO A;  4CAV A;  1UFH A;  1AMP A;  1KUV A;  2B4D A;  2VZZ A;  1B6B A;  4KOX A;  2ZEG A;  4C68 A;  3HUV A;  1QSR A;  2Q4Y A;  4MJ8 A;  5AGE A;  2C1C A;  3FEC A;  4C2Z A;  4KOV A;  3CZX A;  1XMB A;  5A27 A;  4MCR A;  2DXQ A;  2ZEH A;  4TWE A;  3L2N A;  2V8H A;  4ORF A;  2O4H A;  2WUU A;  1CP7 A;  1IOI A;  1VHO A;  1CG2 A;  2Q51 A;  2FIW A;  2F5I A;  1KUY A;  2OU2 A;  3KHX A;  3R9F A;  4M85 A;  5K8O A;  4ZX8 A;  2Z10 A;  3SXN A;  5LRG A;  3ZJ0 A;  4A95 A;  4IUS A;  1QSO A;  1NSL A;  5IB9 A;  1MJB A;  3B3V A;  2C6G A;  5LYF A;  3NE8 A;  4HNW B;  2JDC A;  3IWW A;  4UFW A;  2A4N A;  4ZI6 A;  4GM5 A;  1I21 A;  4P4I A;  4FBE A;  5H84 A;  5I0C A;  1PCA A;  2ABZ A;  3G8W A;  3PB4 X;  3SHP A;  5KTC A;  2GFQ A;  1IOF A;  2Q4Z A;  2AFZ A;  3DNS A;  3TOB A;  3PRT A;  4P4J A;  4B6Z A;  3P2F A;  2JBK A;  4B11 A;  2WSA A;  2QJ8 A;  4KVO E;  3FVL A;  3FED A;  4IF5 A;  4M6H A;  3ZZI A;  4E2A A;  2HB6 A;  4UCP A;  5C88 A;  4A39 A;  3IIB A;  1BO4 A;  3DGV A;  3F0A A;  4Z65 A;  1Q2D A;  2REF A;  3TX8 A;  3FF3 A;  3B3C A;  1WK4 A;  4H89 A;  2C6C A;  1F2O A;  5THW A;  2PJB A;  4EWT A;  3H8F A;  1AUG A;  3B3W A;  1RTQ A;  4A30 A;  3W6X A;  5AG4 A;  1RO5 A;  4KOW A;  2PJ8 A;  4EME A;  4PV6 A;  3IU1 A;  1YME A;  3PFE A;  4QUS A;  4FD7 A;  3B2Y A;  4OC4 A;  4H6U A;  1YW6 A;  3P2H A;  1Z9U A;  4MHY A;  3D4U A;  3E0K A;  3R95 A;  2RB7 A;  1OBR A;  4HNY B;  4AB7 A;  2Z11 A;  3IO1 A;  2VI7 A;  1YSJ A;  3TTH A;  4BMH A;  2PIZ A;  5C82 A;  1CM0 A;  1M4L A;  3G3S A;  2EO8 A;  1R43 A;  2V8D A;  4A31 A;  1TIQ A;  4LQ6 A;  1BOB A;  3EXN A;  5LYD A;  5F48 A;  3SJE A;  3GLJ A;  5ELY A;  2Q4V A;  5IV0 A;  2I79 A;  2JBJ A;  2PJ0 A;  3F8K A;  4NGT A;  3TO7 A;  3IWE A;  3FB3 A;  3LOD A;  1Z4E A;  1ELL P;  4PXE A;  4UIA A;  5CNP A;  1L0C A;  1MJ9 A;  2XEF A;  1ELM P;  4JD6 A;  4RN7 A;  3NA6 A;  4A38 A;  1WWZ A;  3I1U A;  2C27 A;  1Y7E A;  2NSM A;  4L8A A;  1XFO A;  4DYO A;  5KTD A;  1IIC A; 
#chains in the Genus database with same CATH homology
 2P0W A;  4UFV A;  5AG6 A;  1KZF A;  1M1D A;  3JUW A;  4RI1 A;  2G3T A;  4CAX A;  2WPW A;  4YFJ A;  2OH1 A;  4H6Z A;  4UWJ A;  3I9S A;  2H5M A;  3VWE A;  4OLL A;  3R9E A;  1IYK A;  4CGN A;  3S6H A;  1M44 A;  2GIV A;  3R96 A;  3QB8 A;  4UCN A;  4KOY A;  4Q36 A;  5AG5 A;  2PSW A;  3DR6 A;  3EY5 A;  4DNC A;  2BL1 A;  1YLE A;  2FT0 A;  4KVX A;  4CGM A;  4PSW A;  3S6F A;  4CGP A;  4CAE A;  3BJ7 A;  3CXS A;  4MI4 A;  3VWD A;  4AVC A;  2NMT A;  4AG9 A;  4C7I A;  4L89 A;  2FE7 A;  3H4Q A;  1S60 A;  2Q0Y A;  2R1I A;  3JTK A;  4ZGY B;  1M4G A;  4F0X A;  2X7B A;  2Q7B A;  3FXT A;  2EVN A;  1U6M A;  2HV2 A;  4B5O A;  1IID A;  2D4P A;  2DPT A;  3BJ8 A;  3BLN A;  4E8O A;  4KS9 A;  1J4J A;  2VZY A;  2G0B A;  4PSX A;  2Z3P A;  3WR7 A;  5ISV A;  3TO6 A;  1YGH A;  1S7K A;  4UWI A;  2YNC A;  1K4J A;  4J3G A;  1P4N A;  2B5G B;  4KLV A;  4KOR A;  4XPK A;  3T90 A;  2FSR A;  5IX3 A;  4XPL A;  4XPD B;  2FL4 A;  5KTA A;  1XIX A;  4OAD A;  3FYN A;  1MJA A;  2CNM A;  2BEI A;  4U9Y A;  3DR8 A;  4FD4 A;  4R9M A;  1PUA A;  4B13 A;  3UY5 A;  2CNT A;  4K30 A;  2R98 A;  3DDD A;  1Y9K A;  2BSW A;  3GY9 A;  2FS5 A;  5H86 A;  1V0C A;  2R7H A;  3JVN A;  3NE7 A;  2B58 A;  2BUE A;  1M4I A;  1ZO0 A;  3B8G A;  2D4O A;  4Y49 C;  5E96 A;  4CRY B;  2P6G A;  2Z3K A;  3PGP A;  4MBU A;  1P0H A;  4QC6 A;  1R57 A;  2J8M A;  4JLY A;  4CGO A;  1VHS A;  4MFQ A;  4ONU A;  2QEC A;  2DPS A;  1N71 A;  4CYP A;  1PU9 A;  1XF8 A;  4KUB A;  4AG7 A;  4CYN A;  2B4B A;  3F5B A;  5DWN A;  4LUA A;  4NSQ A;  2VBQ A;  4PK3 A;  4YRH A;  2I00 A;  4QVT A;  2QIR A;  3S6K A;  3FRM A;  4RS2 A;  1YVK A;  4MY0 A;  3EO4 A;  4MY3 A;  2ZW4 A;  1S3Z A;  4JJX A;  5FVJ A;  3R1K A;  2CNS A;  2ZW5 A;  3N7Z A;  1NE9 A;  1IB1 E;  4AVA A;  3T9Y A;  2JLM A;  3TCV A;  1YX0 A;  3W6S A;  1I12 A;  2K5T A;  4HNX B;  2P6F A;  4JWP A;  1S5K A;  4NEX A;  4X5K A;  1FY7 A;  4C2X A;  1YR0 A;  4E0A A;  5IB0 A;  2B5G A;  3K9U A;  3CXP A;  1XE4 A;  4JXR A;  1S7F A;  4FD5 A;  5F46 A;  1KUX A;  2OB0 A;  3D2P A;  4ZBG A;  3I3G A;  1GHE A;  5JPH A;  5HH1 A;  2EUI A;  3C26 A;  4B10 A;  2GE3 A;  5J8C A;  2VXK A;  1Y7R A;  3PZJ A;  2RC4 A;  4KLW A;  2AE6 A;  4A33 A;  1YK3 A;  4UFX A;  4R87 A;  2CY2 A;  1CJW A;  2Q04 A;  2J8N A;  3FIX A;  1YRE A;  3D2M A;  1NMT A;  1XEB A;  3MGD A;  3GYA A;  2Z3O A;  1LRZ A;  1XMT A;  3V8I A;  2G3A A;  3DSB A;  4NF1 A;  1OZP A;  2PC1 A;  1IYL A;  4KOS A;  4R57 A;  1SQH A;  4KVM E;  2OZG A;  4R3K A;  5BWA B;  2FIA A;  4KSF A;  2ZPA A;  4I49 A;  2YNC C;  4GS4 A;  2ZW7 A;  4MFP A;  4XNH C;  4CAF A;  2J8R A;  1ON0 A;  1S7N A;  4LX9 A;  5F49 A;  4CYQ A;  1YVO A;  2AJ6 A;  4EVY A;  2PR8 A;  1M4D A;  2ARH A;  2YNE A;  4II9 A;  5G21 A;  4KZT A;  2JDD A;  3TT2 A;  2IL4 A;  5JQ4 A;  4Y49 B;  2VEZ A;  2CXA A;  4CS0 B;  4OAE A;  4C7H A;  4M3S A;  4MFJ A;  4MFK A;  4NXY A;  2FXF A;  5AG7 A;  1VKC A;  5DWM A;  5EBV A;  2KCW A;  2YND A;  3D8P A;  4MHD A;  2ATR A;  1I1D A;  3IU2 A;  2B4D B;  3LD2 A;  5EC4 A;  4CAW A;  3QAH A;  2PQ8 A;  4F6A A;  2YGW A;  3PP9 A;  5G22 A;  3IGR A;  4XPD C;  2PRB A;  3FNC A;  1B87 A;  3OWC A;  4PK2 A;  4C2Y A;  3A9L A;  2ZXV A;  4B5P A;  2B3U A;  5F47 A;  1QSM A;  4QB9 A;  3CXQ A;  4KOU A;  2ZW6 A;  4QBJ A;  5GCN A;  4NCZ A;  4KOT A;  4UBR A;  4UCM A;  1Q2Y A;  2PR1 A;  5G1Z A;  4XNH B;  3W91 A;  2Z3L A;  4A32 A;  4BBH A;  4KSA A;  4MFZ A;  2O28 A;  2R8V A;  4YGO A;  3RYO A;  3TFY A;  2FCK A;  4KUA A;  2Q44 A;  3EC4 A;  3TOA A;  4CRZ B;  1RXT A;  2PDO A;  4R3L A;  2REE A;  2Y0M A;  4B14 A;  5HMN A;  2OZH A;  4MFL A;  2GAN A;  1QST A;  3S6G A;  2Z3M A;  2B3V A;  3FBU A;  3GKR A;  5J8F A;  3TO9 A;  2Z3N A;  2HQY A;  2QML A;  1Y9W A;  4HKF A;  2VQY A;  1S7L A;  2P6E A;  4Q38 A;  4CGL A;  3EFA A;  4JXQ A;  4FD6 A;  3SXO A;  3TE4 A;  4UA3 A;  3R9G A;  4F0Y A;  1QSN A;  1Z4R A;  3D3S A;  4B12 A;  2Z0Z A;  5G20 A;  4B5P B;  3IWG A;  1Q2C A;  3KKW A;  2OZU A;  4A2Z A;  2WPX A;  4U9Z A;  2HUZ A;  1MK4 A;  4U5Y A;  5A28 A;  2JEV A;  3H5Z A;  4CYO A;  4CAV A;  1UFH A;  1KUV A;  4C68 A;  2B4D A;  2VZZ A;  1B6B A;  4KOX A;  5AGE A;  1QSR A;  2Q4Y A;  4MJ8 A;  4C2Z A;  4KOV A;  5A27 A;  2DXQ A;  4ORF A;  2WUU A;  2FIW A;  2F5I A;  1KUY A;  2OU2 A;  3R9F A;  4M85 A;  2Z10 A;  3SXN A;  3ZJ0 A;  4A95 A;  4IUS A;  1QSO A;  1NSL A;  1MJB A;  4HNW B;  2JDC A;  4UFW A;  2A4N A;  5I0C A;  1I21 A;  5H84 A;  3G8W A;  3SHP A;  3DNS A;  3TOB A;  3P2F A;  4B11 A;  2WSA A;  4KVO E;  4IF5 A;  3ZZI A;  4E2A A;  4UCP A;  5C88 A;  1BO4 A;  3F0A A;  1Q2D A;  2REF A;  4AVB A;  1WK4 A;  4H89 A;  4A30 A;  3W6X A;  5AG4 A;  1RO5 A;  4KOW A;  4PV6 A;  3IU1 A;  4QUS A;  4FD7 A;  4H6U A;  3P2H A;  1Z9U A;  3E0K A;  3R95 A;  4HNY B;  4AB7 A;  2Z11 A;  2VI7 A;  4BMH A;  3TTH A;  5C82 A;  1CM0 A;  3G3S A;  4A31 A;  1TIQ A;  1BOB A;  3EXN A;  5F48 A;  2Q4V A;  5IV0 A;  2I79 A;  3F8K A;  3TO7 A;  3IWE A;  3FB3 A;  3LOD A;  1Z4E A;  5CNP A;  1L0C A;  1MJ9 A;  4JD6 A;  5KTC A;  1WWZ A;  4L8A A;  2C27 A;  5KTD A;  1IIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...