4L8AA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l8aA00
4YFJA 4M3SA 5FVJA 2IL4A 3TO6A 5KTDA 3QAHA 3DR6A 1IYLA 2R98A 2JDDA 2R7HA 1M4GA 4AVCA 1YREA 3WR7A 2RC4A 3R9FA 4UBRA 2G0BA 2X7BA 2I00A 1YR0A 3EFAA 2QMLA 2R1IA 3BLNA 1S3ZA 1S7LA 3CXPA 4UA3A 1QSRA 4KLVA 1S7FA 3GY9A 5J8FA 1LRZA 4KOSA 4KOUA 2B4DB 4R87A 3LODA 2FXFA 3F5BA 1QSMA 4B5OA 4AVAA 5C82A 1MJAA 1KUYA 2REEA 3PP9A 2OZUA 2FE7A 4QBJA 2B5GB 3FIXA 4QB9A 3ZJ0A 2PSWA 4KOTA 5HMNA 4KVXA 1S60A 5H86A 3RYOA 1PUAA 1KZFA 4PSXA 4KZTA 4LX9A 2FSRA 3TOBA 4HKFA 4J3GA 2WPXA 1P4NA 2OH1A 1KUVA 2B58A 2ZW5A 1OZPA 2AJ6A 1FY7A 3D2MA 4R3KA 3BJ8A 3DSBA 2VXKA 3D2PA 4HNXB 3KKWA 3N7ZA 5EBVA 2PRBA 4PSWA 3IWGA 2GE3A 2Z0ZA 5JQ4A 2ZW7A 4MI4A 4L8AA 2Q44A 1B6BA 4CAWA 2J8RA 1V0CA 2P6FA 4KOWA 2JEVA 4CAVA 3JUWA 3OWCA 4Y49B 2ZXVA 5E96A 1BO4A 2P6EA 3IGRA 4ZBGA 2PR8A 3EY5A 3PGPA 3S6KA 2PR1A 3JVNA 3FBUA 3ZZIA 1Q2DA 2FIAA 5H84A 1U6MA 3TCVA 1L0CA 1WK4A 4MHDA 1B87A 4KVME 1RXTA 3S6FA 1QSOA 5ISVA 1M4DA 5KTCA 4AG7A 2C27A 3CXQA 4FD4A 2BSWA 1XEBA 2ZW4A 4NCZA 1YK3A 4NEXA 4QC6A 3W91A 4PV6A 2B3UA 1M1DA 3TO7A 1XMTA 2WPWA 4MY3A 2JDCA 3D8PA 4NSQA 2VI7A 4B5PA 4UWIA 4YRHA 2EUIA 5JPHA 5J8CA 2VQYA 3FRMA 1XIXA 1Y7RA 5IV0A 1VHSA 2FS5A 4E8OA 5IX3A 3GYAA 2JLMA 3K9UA 2BEIA 5F48A 2B3VA 4KLWA 2CNMA 4XPDB 4XNHB 2VBQA 2Z10A 3PZJA 4JD6A 3FB3A 1VKCA 1YX0A 4FD7A 2REFA 4FD6A 4KOYA 1I21A 1QSTA 4LUAA 4KORA 1QSNA 4KUAA 2B4DA 2OZGA 1ON0A 3W6XA 4OLLA 4E2AA 3V8IA 2OB0A 2J8NA 1Y9KA 4MJ8A 4CRZB 2H5MA 4HNWB 2PQ8A 3T9YA 1TIQA 2DXQA 1NE9A 1XF8A 3S6GA 1YGHA 1M4IA 2B5GA 1Z4RA 1J4JA 2O28A 4RS2A 1YVKA 2FL4A 1SQHA 2AE6A 4R9MA 1S5KA 2A4NA 2B4BA 4KUBA 4IUSA 3P2FA 5EC4A 2Q4YA 1GHEA 3SXOA 1CJWA 1I1DA 4M85A 1I12A 2KCWA 2ZW6A 2Q0YA 2CNTA 1IIDA 4BMHA 5HH1A 2BUEA 3FXTA 2FT0A 3B8GA 2VEZA 1YVOA 3FNCA 3BJ7A 4K30A 4U9ZA 1Q2CA 1MJBA 3EC4A 1XE4A 2CY2A 4JXRA 2HUZA 4DNCA 4R57A 5F47A 3G8WA 2P0WA 4H6UA 1K4JA 4JXQA 5F49A 3SHPA 4JWPA 3EO4A 5DWMA 1M44A 2QECA 4CAXA 1RO5A 4CRYB 3TTHA 5C88A 4U5YA 3R1KA 3MGDA 2OZHA 3I3GA 3W6SA 4XNHC 2CNSA 2Q4VA 4NXYA 2GANA 4E0AA 1NSLA 1UFHA 4F0YA 2HV2A 4I49A 4MBUA 4QUSA 4EVYA 2PC1A 3QB8A 4HNYB 3F0AA 1MJ9A 3FYNA 4QVTA 1Z9UA 4OADA 4ORFA 3DNSA 1Z4EA 5IB0A 2QIRA 2PDOA 4OAEA 2EVNA 2K5TA 2J8MA 3TO9A 2F5IA 4U9YA 1N71A 3TE4A 4KVOE 2Q04A 5DWNA 1YLEA 4II9A 3S6HA 3F8KA 5GCNA 2I79A 4JJXA 1KUXA 2OU2A 1R57A 3VWEA 3NE7A 1IICA 2P6GA 4AB7A 4KOXA 4R3LA 2D4PA 4H6ZA 3TT2A 4IF5A 3R95A 1BOBA 4Y49C 4JLYA 3LD2A 3D3SA 2HQYA 1NMTA 1S7KA 2ATRA 2FIWA 2ARHA 3SXNA 4GS4A 3DDDA 4AVBA 3EXNA 2Z11A 3H4QA 3E0KA 4F6AA 1MK4A 5KTAA 1Y9WA 4XPLA 3TOAA 4FD5A 4UWJA 4RI1A 1PU9A 2VZYA 4NF1A 3VWDA 4ONUA 4YGOA 4MY0A 2GIVA 2Q7BA 3DR8A 3R9GA 3P2HA 2G3AA 4PK2A 4PK3A 3R96A 1IYKA 1CM0A 2Y0MA 3T90A 3CXSA 2VZZA 2ZPAA 3C26A 2D4OA 1S7NA 1Q2YA 4B5PB 3R9EA 4H89A 4XPKA 1WWZA 5I0CA 3UY5A 2BL1A 3I9SA 4L89A 4X5KA 3TFYA 5CNPA 4AG9A 4KOVA 2R8VA 1P0HA 3GKRA 1IB1E 4CS0B 4XPDC 3G3SA 2G3TA 2NMTA 5F46A 2FCKA
chains in the Genus database with same CATH superfamily
4YFJA 4Q38A 1CX8A 5LYFA 1M4LA 4M3SA 3D67A 4C68A 1X12A 2PJ7A 3JTKA 2IL4A 5FVJA 3TO6A 4C7IA 1BPNA 3QAHA 4MCPA 5KTDA 3DR6A 1IYLA 2R98A 2JDDA 1GYTA 3RBUA 4FAIA 2R7HA 1BAVA 1M4GA 6CPAA 2YNCC 4FUUA 1R43A 2G9DA 2BO9A 2Z3LA 4AVCA 1H8LA 1YREA 4Q7AA 3WR7A 2RC4A 3R9FA 4UBRA 2G0BA 2X7BA 1Z5RA 2I00A 1YR0A 3EFAA 2QMLA 2R1IA 3JRUA 3BLNA 1S3ZA 3KZWA 4R6TA 1S7LA 3CXPA 4UA3A 1QSRA 4KLVA 1S7FA 2FVGA 2PJ6A 5CPAA 1PYTB 2AFXA 3GY9A 2WYRA 5J8FA 1LRZA 2HC9A 3D7GA 4KOSA 4KOUA 1AMPA 1ARLA 2B4DB 2PVVA 3BI1A 4MHNA 3A9LA 4R87A 3GLJA 2FXFA 3LODA 3F5BA 5K8NA 1QSMA 2Q7SA 4B5OA 3RYOA 4AVAA 3PB7X 1TKJA 3IC1A 3SI0A 3KR5A 4DJLA 4A95A 4AXVA 2PJ3A 1MJAA 5D8NA 5C82A 2QJ8A 3PBEA 1Y0YA 3L2NA 4UIBA 1KUYA 2REEA 3PP9A 4OP4A 3I1UA 4B6ZA 2OZUA 2FE7A 3TX8A 4QBJA 7CPAA 2DPTA 2B5GB 3IU2A 3FIXA 4PXCA 4QB9A 3ZJ0A 2AFUA 1VGYA 2ZEPA 2PSWA 4KOTA 1Z8LA 1YMEA 4KVXA 1S60A 4OC1A 4UF4A 1PUAA 1JQGA 1KZFA 2ZEFA 1IOIA 4LQ6A 4PSXA 4KZTA 2ZEGA 4LX9A 5K8PA 5HMNA 2FSRA 3TOBA 4HKFA 4P44A 4B10A 2J9AA 2PJCA 4J3GA 2WPXA 3ISZA 1P4NA 2OH1A 4OKOA 4R8FA 1ZG7A 1KUVA 2Z3KA 2B58A 2ZW5A 1OZPA 2AJ6A 4M6HA 1FY7A 3D2MA 1TKFA 4R3KA 4B14A 4UEEA 3BJ8A 3KQZA 4PPZA 3DSBA 4ZGYB 2HB6A 2VXKA 3D2PA 3NH5A 2XEIA 2O53A 3KL9A 4HNXB 3KKWA 3N7ZA 5EBVA 4P6YA 1Z2LA 4G1PA 2EBJA 2PRBA 4PSWA 1IU8A 3IWGA 2GE3A 2GLJA 2Z0ZA 3IEHA 4MHYA 5CBMA 5JQ4A 2ZW7A 4MI4A 4A31A 4L8AA 3H5ZA 1OBRA 2Q51A 4Z65A 2Q44A 1B6BA 2V8GA 3D4UA 4A33A 4ZY1A 4CAWA 2J8RA 4A30A 2PJ5A 3WABA 1V0CA 2P6FA 3KHZA 4HPSA 2JEVA 4KOWA 4NGTA 3PRTA 3JUWA 2JBJA 3OWCA 4Y49B 4CAVA 2ZXVA 5E96A 4B12A 2C6GA 4CAEA 1BO4A 2P6EA 4KS9A 3IGRA 4OC0A 4ZBGA 1QMUA 1A2ZA 3IO1A 3RAMA 3GIUA 4CGNA 8CPAA 2PR8A 4MFKA 1IGBA 1IY7A 2EK8A 3LWUA 3EY5A 3PGPA 3S6KA 4IAVA 2PR1A 4UCMA 4B13A 3JVNA 3FBUA 4OC3A 3ZZIA 1Q2DA 2ABZA 2FIAA 3CPXA 5H84A 5HXDA 1LAMA 2YNDA 4CPAA 5EMIA 2ZENA 3B3CA 1U6MA 2GFQA 1L0CA 2PIYA 1WK4A 4ONWA 1YLOA 3SJFA 4MHDA 4P4FA 5JGFA 4OIWA 1B87A 4GM5A 1CPSA 1RXTA 4KVME 4PXDA 2YGWA 1Q7LA 4P10A 3S6FA 4UFXA 4KSFA 4A37A 1QSOA 4NGSA 4A94A 4NJQA 5ISVA 1M4DA 5KTCA 1JWQA 4AG7A 2C27A 3CXQA 4FD4A 5LYIA 2ODFA 2BSWA 1XEBA 2ZW4A 1YW6A 4A38A 2Z3PA 5G20A 4OIDA 1Z8XA 5LRJA 4NCZA 2EK9A 1YK3A 4NEXA 3NH8A 4QC6A 3W91A 5I4MA 3H8FA 4IK2A 4A39A 4PV6A 2RB7A 2B3UA 1AUGA 4MFQA 1M1DA 3DGVA 3N5FA 3TO7A 3MN8A 4C7HA 1XMTA 2CIJA 2WPWA 1HDQA 4EFDA 4MY3A 2JDCA 3PB9X 5BWAB 3D8PA 4PQAA 4NSQA 2VI7A 4ZY2A 4B5PA 4UEZA 4UWIA 2I3CA 2EUIA 2XEFA 3D66A 4MFPA 4OMEA 4WWVA 4YRHA 5THWA 2CF4A 4RUHA 5J8CA 5JPHA 4X2TA 2VQYA 3B2YA 4H2KA 3FRMA 1ZG8A 1BPMA 3S9MA 5AG6A 1CP7A 1UWYA 4UFVA 1XIXA 1Y7RA 2BOAA 5IV0A 3D7FA 4MCSA 1VHSA 1EE3P 2ZOFA 4DUKA 2FS5A 4E8OA 5LRGA 5IX3A 3GYAA 3FECA 2JLMA 3K9UA 2BEIA 5F48A 2B3VA 4KLWA 4P4JA 2CNMA 4XPDB 5G1ZA 4YWYA 3LMSA 4XNHB 2AFWA 1VIXA 2VBQA 2QYVA 2PJAA 2Z10A 4MRIA 3B35A 5F09A 3D7HA 2Z3MA 4CAFA 3FJUA 1F57A 4R76A 3PZJA 1HDUA 3FB3A 1VKCA 3IIBA 4JD6A 4X8IA 1YX0A 4FD7A 4NFRA 1F2PA 3B3TA 4CGLA 2REFA 2DF5A 5HVFA 3MRUA 4FD6A 4M6GA 4ZX9A 4MMOA 4KOYA 1I21A 2IMOA 4TNUA 1QSTA 4LUAA 4CYOA 1CPXA 4KORA 1QSNA 2JBKA 3VH9A 2BCOA 1BLLE 3WC6A 4KUAA 1CBXA 2B4DA 4NGQA 2OZGA 1ON0A 1Y0RA 3CZXA 4UIAA 3W6XA 4OLLA 4E2AA 3PB6X 3V8IA 4F9VA 2OB0A 2J8NA 1Y9KA 4MJ8A 4CRZB 1LAPA 2H5MA 2WZNA 4NGMA 4ZYQA 4HNWB 3K2KA 1ZLIA 4PXBA 5LRKA 4ZY0A 2PQ8A 3T9YA 1TIQA 2DXQA 1NE9A 1XF8A 5AG5A 3S6GA 1YGHA 2POKA 3CT9A 1M4IA 1FT7A 2V8VA 2PCUA 3RNZA 2XEGA 3NE8A 4BBHA 2B5GA 2V77A 1Z4RA 3CPAA 2ZEMA 1QQ9A 4MCQA 3VATA 3SJXA 1J4JA 2O28A 4RS2A 1YVKA 2EO8A 2FL4A 1SQHA 2AE6A 4JYWA 2GU2A 3SJGA 4R9MA 3NA6A 3TC8A 4ZI6A 1S5KA 2A4NA 2B4BA 2IQ6A 1NSAA 4KUBA 4IUSA 3P2FA 5EC4A 4TWEA 3T8WA 2Q4YA 2PJBA 4W9YA 3SI1A 1GHEA 3SXOA 3WT4A 1CJWA 2GLFA 2PJ1A 4X3RA 1I1DA 4M85A 4MHPA 3RO0A 1I12A 2C6PA 2KCWA 4UCPA 3KR4A 2Q4ZA 2ZW6A 3V38A 4Q36A 1Z8WA 4C2XA 2Q0YA 1XBUA 3D68A 2CNTA 5JH9A 1XRYA 1IIDA 2JEWA 4CYPA 3PBBA 4BMHA 4JZ0A 4K3NA 3BHXA 3WC7A 5HH1A 1XMBA 2BUEA 3FF3A 4F0XA 3FXTA 3NFZA 4IHMA 2FT0A 3B8GA 1YSJA 2VEZA 4CGMA 2ZOGA 1YW4A 1YVOA 3FNCA 2ZEDA 3BJ7A 4K30A 4U9ZA 4A2ZA 1Q2CA 4ZX8A 1MJBA 1XFOA 3EC4A 4C2ZA 3IWEA 4CGPA 1XE4A 2CY2A 1XJOA 2HUZA 2NSMA 4JXRA 4M6IA 3FMCA 4R57A 4CYNA 4DNCA 5F47A 3G8WA 2P0WA 4H6UA 3QAYA 1K4JA 4NGPA 4JXQA 4OC2A 2VL1A 5F49A 3SHPA 4JWPA 3EO4A 5DWMA 3GB0A 1M44A 4UCNA 2PIZA 2QECA 3KQXA 4P4DA 3BI0A 3D7DA 4BD9A 4CAXA 1RO5A 4CRYB 3H8EA 1ELLP 2PVWA 3TTHA 5C88A 2Z3OA 4U5YA 1ZLHA 3CDXA 3R1KA 3MGDA 5D29A 2OZHA 1CG2A 3I3GA 4NGRA 1HEEA 3W6SA 3FVLA 4KSIA 5H86A 2CXAA 4XNHC 2CNSA 2Q4VA 2CTBA 4R7MA 2V8HA 5K8MA 4KSAA 5G21A 4NXYA 2GANA 4E0AA 1NSLA 2ZELA 4C2YA 1UFHA 2ANPA 4F0YA 2HV2A 4I49A 4OC4A 3KHXA 1LCPA 2OR4A 1LFWA 3H8GA 4MBUA 3FEDA 4QUSA 4EVYA 2PC1A 3S9NA 3QB8A 4HNYB 4EWTA 3F0AA 5AG4A 1MJ9A 3FEEA 5K8OA 2C6CA 2RFHA 3FYNA 4QVTA 1Z9UA 4OADA 3IJ3A 4FBEA 4ORFA 3IU1A 3DNSA 1Z4EA 5DS0A 5IB0A 2QIRA 1DE4C 2PDOA 4OAEA 5A28A 1AYEA 2EVNA 2K5TA 2J8MA 2ZEHA 4MXUA 3TO9A 2PJ0A 2F5IA 3B7IA 4U9YA 1N71A 3TE4A 3KASA 4KVOE 2Q04A 1DTDA 1YLEA 4WJBA 5DWNA 4II9A 3PB4X 1TKHA 2O4HA 2WUUA 5G22A 1PCAA 3S6HA 4GXHA 1TF9A 4P4BA 3KI9A 3F8KA 2NYQA 5GCNA 2I79A 4JJXA 1KUXA 2OU2A 1LANA 1R57A 5IB9A 5AGEA 3VWEA 4BINA 2AFMA 3KGQA 4O23A 4YU9A 3NE7A 1KWMA 4LQGA 4MCRA 4NJRA 4OC5A 4P4IA 3B3SA 1IICA 5ELYA 3S9LA 3ISXA 2P6GA 2AFSA 4AB7A 3BXMA 3B3VA 4KOXA 4R3LA 2D4PA 3B3WA 4EMEA 4H6ZA 3TT2A 4IF5A 1TXRA 2PRQA 1F2OA 2YNEA 3FH4A 4MFLA 3R95A 5HVGA 1BOBA 2XEJA 4Y49C 4JLYA 2OOTA 3LD2A 3D3SA 3PB8X 4RN7A 3TCVA 2AFOA 2HQYA 1NMTA 3DLJA 1TF8A 2YNCA 3VARA 1S7KA 2ATRA 2FIWA 2ARHA 2EWBA 3SXNA 1VHEA 2PJ2A 3K9TA 4GS4A 3DDDA 4AVBA 3EXNA 5HVHA 1ARMA 2QVPA 2Z11A 2Z3NA 3H4QA 2F8HA 3E0KA 2PJ4A 3IWWA 4F8ZA 4F6AA 1MK4A 5KTAA 4B11A 2WSAA 1Y9WA 4XPLA 5AG7A 1FNOA 3HLPA 3TOAA 2GREA 2ZEEA 4FD5A 4FWUA 3QNVA 3NH4A 4UWJA 4RI1A 1PU9A 2VZYA 2C1CA 1ZG9A 2AFZA 4NF1A 5JM6A 1Z8TA 2F7VA 2V8DA 3WC5A 4NGNA 5LYDA 4UFWA 3LACA 4P4EA 1IOFA 3VWDA 4MHZA 1YQEA 2ZEOA 4ONUA 2DPSA 3RZAA 2PJ9A 4YGOA 4MY0A 3PEIA 2GIVA 2IJZA 2Q7BA 5F46A 1R3NA 3DR8A 3R9GA 3P2HA 2G3AA 4PK2A 5J1QA 5A27A 4A32A 4PK3A 2DEAA 3R96A 3V7ZA 1IYKA 1CM0A 2Y0MA 3T90A 3PFOA 3CXSA 1XOVA 2VZZA 2ZPAA 3C26A 5LYLA 1CP6A 2D4OA 1S7NA 3SI2A 1Q2YA 3FX6A 1ELMP 4MFJA 4MFZA 3R9EA 4H89A 2CTCA 4XPKA 4B5PB 1WWZA 1Y7EA 1RTQA 1ZO0A 3IFEA 5I0CA 4CYQA 3UY5A 2Q43A 2BL1A 3I9SA 4L89A 4DYOA 4X5KA 3TFYA 5CNPA 4AG9A 4KOVA 4F9UA 2R8VA 3PFEA 1P0HA 1X10A 2PJ8A 4UEFA 3GKRA 3HUVA 4CGOA 1VHOA 1IB1E 4CS0B 3GUXA 4XPDC 3G3SA 2G3TA 2NMTA 3SJEA 4PXEA 1LOKA 2PE3A 4P45A 2FCKA
chains in the Genus database with same CATH topology
4YFJA 4Q38A 4M3SA 4C68A 3JTKA 5FVJA 2IL4A 3TO6A 4C7IA 3QAHA 5KTDA 3DR6A 1IYLA 2R98A 2JDDA 2R7HA 1M4GA 2YNCC 4AVCA 2Z3LA 1YREA 3WR7A 2RC4A 3R9FA 4UBRA 2G0BA 2X7BA 2I00A 1YR0A 3EFAA 2QMLA 2R1IA 3BLNA 1S3ZA 1S7LA 3CXPA 4UA3A 1QSRA 4KLVA 1S7FA 3GY9A 5J8FA 1LRZA 4KOSA 4KOUA 2B4DB 3A9LA 4R87A 3LODA 2FXFA 3F5BA 1QSMA 4B5OA 4AVAA 4A95A 5C82A 1MJAA 1KUYA 2REEA 3PP9A 2OZUA 2FE7A 4QBJA 2DPTA 2B5GB 3IU2A 3FIXA 4QB9A 3ZJ0A 2PSWA 4KOTA 5HMNA 4KVXA 1S60A 5H86A 3RYOA 1PUAA 1KZFA 4PSXA 4KZTA 4LX9A 2FSRA 3TOBA 4HKFA 4B10A 4J3GA 2WPXA 1P4NA 2OH1A 1KUVA 2Z3KA 2B58A 2ZW5A 1OZPA 2AJ6A 1FY7A 3D2MA 4R3KA 4B14A 3BJ8A 3DSBA 4ZGYB 2VXKA 3D2PA 4HNXB 3KKWA 3N7ZA 5EBVA 2PRBA 4PSWA 3IWGA 2GE3A 2Z0ZA 5JQ4A 2ZW7A 4MI4A 4A31A 4L8AA 3H5ZA 2Q44A 1B6BA 4A33A 4CAWA 2J8RA 4A30A 1V0CA 2P6FA 4KOWA 2JEVA 4CAVA 3JUWA 3OWCA 4Y49B 2ZXVA 5E96A 4B12A 4CAEA 1BO4A 2P6EA 4KS9A 3IGRA 4ZBGA 4CGNA 2PR8A 4MFKA 3EY5A 3PGPA 3S6KA 2PR1A 4UCMA 4B13A 3JVNA 3FBUA 3ZZIA 1Q2DA 2FIAA 5H84A 2YNDA 1U6MA 3TCVA 1L0CA 1WK4A 4MHDA 1B87A 4KVME 1RXTA 2YGWA 3S6FA 4UFXA 4KSFA 1QSOA 5ISVA 1M4DA 5KTCA 4AG7A 2C27A 3CXQA 4FD4A 2BSWA 1XEBA 2ZW4A 2Z3PA 5G20A 4NCZA 1YK3A 4NEXA 4QC6A 3W91A 4PV6A 2B3UA 4MFQA 1M1DA 3TO7A 4C7HA 1XMTA 2WPWA 4MY3A 2JDCA 5BWAB 3D8PA 4NSQA 2VI7A 4B5PA 4UWIA 4YRHA 2EUIA 4MFPA 5JPHA 5J8CA 2VQYA 3FRMA 5AG6A 4UFVA 1XIXA 1Y7RA 5IV0A 1VHSA 2FS5A 4E8OA 5IX3A 3GYAA 2JLMA 3K9UA 2BEIA 5F48A 2B3VA 4KLWA 2CNMA 4XPDB 5G1ZA 4XNHB 2VBQA 2Z10A 2Z3MA 4CAFA 3PZJA 4JD6A 3FB3A 1VKCA 1YX0A 4FD7A 4CGLA 2REFA 4FD6A 4KOYA 1I21A 1QSTA 4LUAA 4CYOA 4KORA 1QSNA 4KUAA 2B4DA 2OZGA 1ON0A 3W6XA 4OLLA 4E2AA 3V8IA 2OB0A 2J8NA 1Y9KA 4MJ8A 4CRZB 2H5MA 4HNWB 2PQ8A 3T9YA 1TIQA 2DXQA 1NE9A 1XF8A 5AG5A 3S6GA 1YGHA 1M4IA 4BBHA 2B5GA 1Z4RA 1J4JA 2O28A 4RS2A 1YVKA 2FL4A 1SQHA 2AE6A 4R9MA 1S5KA 2A4NA 2B4BA 4KUBA 4IUSA 3P2FA 5EC4A 2Q4YA 1GHEA 3SXOA 1CJWA 1I1DA 4M85A 1I12A 2KCWA 4UCPA 2ZW6A 4Q36A 4C2XA 2Q0YA 2CNTA 1IIDA 4CYPA 4BMHA 5HH1A 2BUEA 4F0XA 3FXTA 2FT0A 3B8GA 2VEZA 4CGMA 1YVOA 3FNCA 3BJ7A 4K30A 4U9ZA 4A2ZA 1Q2CA 1MJBA 3EC4A 4C2ZA 3IWEA 4CGPA 1XE4A 2CY2A 4JXRA 2HUZA 4CYNA 4DNCA 4R57A 5F47A 3G8WA 2P0WA 4H6UA 1K4JA 4JXQA 5F49A 3SHPA 4JWPA 3EO4A 5DWMA 1M44A 4UCNA 2QECA 4CAXA 1RO5A 4CRYB 3TTHA 5C88A 2Z3OA 4U5YA 3R1KA 3MGDA 2OZHA 3I3GA 3W6SA 2CXAA 4XNHC 2CNSA 2Q4VA 4KSAA 5G21A 4NXYA 2GANA 4E0AA 1NSLA 4C2YA 1UFHA 4F0YA 2HV2A 4I49A 4MBUA 4QUSA 4EVYA 2PC1A 3QB8A 4HNYB 3F0AA 5AG4A 1MJ9A 3FYNA 4QVTA 1Z9UA 4OADA 4ORFA 3IU1A 3DNSA 1Z4EA 5IB0A 2QIRA 2PDOA 4OAEA 5A28A 2EVNA 2K5TA 2J8MA 3TO9A 2F5IA 4U9YA 1N71A 3TE4A 4KVOE 2Q04A 5DWNA 1YLEA 4II9A 2WUUA 5G22A 3S6HA 3F8KA 5GCNA 2I79A 4JJXA 1KUXA 2OU2A 1R57A 5AGEA 3VWEA 3NE7A 1IICA 2P6GA 4AB7A 4KOXA 4R3LA 2D4PA 4H6ZA 3TT2A 4IF5A 2YNEA 4MFLA 3R95A 1BOBA 4Y49C 4JLYA 3LD2A 3D3SA 2HQYA 1NMTA 2YNCA 1S7KA 2ATRA 2FIWA 2ARHA 3SXNA 4GS4A 3DDDA 4AVBA 3EXNA 2Z11A 2Z3NA 3H4QA 3E0KA 4F6AA 1MK4A 5KTAA 4B11A 2WSAA 1Y9WA 4XPLA 5AG7A 3TOAA 4FD5A 4UWJA 4RI1A 1PU9A 2VZYA 4NF1A 4UFWA 3VWDA 4ONUA 2DPSA 4YGOA 4MY0A 2GIVA 2Q7BA 3DR8A 3R9GA 3P2HA 2G3AA 4PK2A 5A27A 4A32A 4PK3A 3R96A 1IYKA 1CM0A 2Y0MA 3T90A 3CXSA 2VZZA 2ZPAA 3C26A 2D4OA 1S7NA 1Q2YA 4MFJA 4MFZA 3R9EA 4H89A 4B5PB 4XPKA 1WWZA 1ZO0A 5I0CA 4CYQA 3UY5A 2BL1A 3I9SA 4L89A 4X5KA 3TFYA 5CNPA 4AG9A 4KOVA 2R8VA 1P0HA 3GKRA 4CGOA 1IB1E 4CS0B 4XPDC 3G3SA 2G3TA 2NMTA 5F46A 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFJ A;  4M3S A;  5FVJ A;  2IL4 A;  3TO6 A;  5KTD A;  3QAH A;  3DR6 A;  1IYL A;  2R98 A;  2JDD A;  2R7H A;  1M4G A;  4AVC A;  1YRE A;  3WR7 A;  2RC4 A;  3R9F A;  4UBR A;  2G0B A;  2X7B A;  2I00 A;  1YR0 A;  3EFA A;  2QML A;  2R1I A;  3BLN A;  1S3Z A;  1S7L A;  3CXP A;  4UA3 A;  1QSR A;  4KLV A;  1S7F A;  3GY9 A;  5J8F A;  1LRZ A;  4KOS A;  4KOU A;  2B4D B;  4R87 A;  3LOD A;  2FXF A;  3F5B A;  1QSM A;  4B5O A;  4AVA A;  5C82 A;  1MJA A;  1KUY A;  2REE A;  3PP9 A;  2OZU A;  2FE7 A;  4QBJ A;  2B5G B;  3FIX A;  4QB9 A;  3ZJ0 A;  2PSW A;  4KOT A;  5HMN A;  4KVX A;  1S60 A;  5H86 A;  3RYO A;  1PUA A;  1KZF A;  4PSX A;  4KZT A;  4LX9 A;  2FSR A;  3TOB A;  4HKF A;  4J3G A;  2WPX A;  1P4N A;  2OH1 A;  1KUV A;  2B58 A;  2ZW5 A;  1OZP A;  2AJ6 A;  1FY7 A;  3D2M A;  4R3K A;  3BJ8 A;  3DSB A;  2VXK A;  3D2P A;  4HNX B;  3KKW A;  3N7Z A;  5EBV A;  2PRB A;  4PSW A;  3IWG A;  2GE3 A;  2Z0Z A;  5JQ4 A;  2ZW7 A;  4MI4 A;  4L8A A;  2Q44 A;  1B6B A;  4CAW A;  2J8R A;  1V0C A;  2P6F A;  4KOW A;  2JEV A;  4CAV A;  3JUW A;  3OWC A;  4Y49 B;  2ZXV A;  5E96 A;  1BO4 A;  2P6E A;  3IGR A;  4ZBG A;  2PR8 A;  3EY5 A;  3PGP A;  3S6K A;  2PR1 A;  3JVN A;  3FBU A;  3ZZI A;  1Q2D A;  2FIA A;  5H84 A;  1U6M A;  3TCV A;  1L0C A;  1WK4 A;  4MHD A;  1B87 A;  4KVM E;  1RXT A;  3S6F A;  1QSO A;  5ISV A;  1M4D A;  5KTC A;  4AG7 A;  2C27 A;  3CXQ A;  4FD4 A;  2BSW A;  1XEB A;  2ZW4 A;  4NCZ A;  1YK3 A;  4NEX A;  4QC6 A;  3W91 A;  4PV6 A;  2B3U A;  1M1D A;  3TO7 A;  1XMT A;  2WPW A;  4MY3 A;  2JDC A;  3D8P A;  4NSQ A;  2VI7 A;  4B5P A;  4UWI A;  4YRH A;  2EUI A;  5JPH A;  5J8C A;  2VQY A;  3FRM A;  1XIX A;  1Y7R A;  5IV0 A;  1VHS A;  2FS5 A;  4E8O A;  5IX3 A;  3GYA A;  2JLM A;  3K9U A;  2BEI A;  5F48 A;  2B3V A;  4KLW A;  2CNM A;  4XPD B;  4XNH B;  2VBQ A;  2Z10 A;  3PZJ A;  4JD6 A;  3FB3 A;  1VKC A;  1YX0 A;  4FD7 A;  2REF A;  4FD6 A;  4KOY A;  1I21 A;  1QST A;  4LUA A;  4KOR A;  1QSN A;  4KUA A;  2B4D A;  2OZG A;  1ON0 A;  3W6X A;  4OLL A;  4E2A A;  3V8I A;  2OB0 A;  2J8N A;  1Y9K A;  4MJ8 A;  4CRZ B;  2H5M A;  4HNW B;  2PQ8 A;  3T9Y A;  1TIQ A;  2DXQ A;  1NE9 A;  1XF8 A;  3S6G A;  1YGH A;  1M4I A;  2B5G A;  1Z4R A;  1J4J A;  2O28 A;  4RS2 A;  1YVK A;  2FL4 A;  1SQH A;  2AE6 A;  4R9M A;  1S5K A;  2A4N A;  2B4B A;  4KUB A;  4IUS A;  3P2F A;  5EC4 A;  2Q4Y A;  1GHE A;  3SXO A;  1CJW A;  1I1D A;  4M85 A;  1I12 A;  2KCW A;  2ZW6 A;  2Q0Y A;  2CNT A;  1IID A;  4BMH A;  5HH1 A;  2BUE A;  3FXT A;  2FT0 A;  3B8G A;  2VEZ A;  1YVO A;  3FNC A;  3BJ7 A;  4K30 A;  4U9Z A;  1Q2C A;  1MJB A;  3EC4 A;  1XE4 A;  2CY2 A;  4JXR A;  2HUZ A;  4DNC A;  4R57 A;  5F47 A;  3G8W A;  2P0W A;  4H6U A;  1K4J A;  4JXQ A;  5F49 A;  3SHP A;  4JWP A;  3EO4 A;  5DWM A;  1M44 A;  2QEC A;  4CAX A;  1RO5 A;  4CRY B;  3TTH A;  5C88 A;  4U5Y A;  3R1K A;  3MGD A;  2OZH A;  3I3G A;  3W6S A;  4XNH C;  2CNS A;  2Q4V A;  4NXY A;  2GAN A;  4E0A A;  1NSL A;  1UFH A;  4F0Y A;  2HV2 A;  4I49 A;  4MBU A;  4QUS A;  4EVY A;  2PC1 A;  3QB8 A;  4HNY B;  3F0A A;  1MJ9 A;  3FYN A;  4QVT A;  1Z9U A;  4OAD A;  4ORF A;  3DNS A;  1Z4E A;  5IB0 A;  2QIR A;  2PDO A;  4OAE A;  2EVN A;  2K5T A;  2J8M A;  3TO9 A;  2F5I A;  4U9Y A;  1N71 A;  3TE4 A;  4KVO E;  2Q04 A;  5DWN A;  1YLE A;  4II9 A;  3S6H A;  3F8K A;  5GCN A;  2I79 A;  4JJX A;  1KUX A;  2OU2 A;  1R57 A;  3VWE A;  3NE7 A;  1IIC A;  2P6G A;  4AB7 A;  4KOX A;  4R3L A;  2D4P A;  4H6Z A;  3TT2 A;  4IF5 A;  3R95 A;  1BOB A;  4Y49 C;  4JLY A;  3LD2 A;  3D3S A;  2HQY A;  1NMT A;  1S7K A;  2ATR A;  2FIW A;  2ARH A;  3SXN A;  4GS4 A;  3DDD A;  4AVB A;  3EXN A;  2Z11 A;  3H4Q A;  3E0K A;  4F6A A;  1MK4 A;  5KTA A;  1Y9W A;  4XPL A;  3TOA A;  4FD5 A;  4UWJ A;  4RI1 A;  1PU9 A;  2VZY A;  4NF1 A;  3VWD A;  4ONU A;  4YGO A;  4MY0 A;  2GIV A;  2Q7B A;  3DR8 A;  3R9G A;  3P2H A;  2G3A A;  4PK2 A;  4PK3 A;  3R96 A;  1IYK A;  1CM0 A;  2Y0M A;  3T90 A;  3CXS A;  2VZZ A;  2ZPA A;  3C26 A;  2D4O A;  1S7N A;  1Q2Y A;  4B5P B;  3R9E A;  4H89 A;  4XPK A;  1WWZ A;  5I0C A;  3UY5 A;  2BL1 A;  3I9S A;  4L89 A;  4X5K A;  3TFY A;  5CNP A;  4AG9 A;  4KOV A;  2R8V A;  1P0H A;  3GKR A;  1IB1 E;  4CS0 B;  4XPD C;  3G3S A;  2G3T A;  2NMT A;  5F46 A;  2FCK A; 
#chains in the Genus database with same CATH topology
 4YFJ A;  4Q38 A;  1CX8 A;  5LYF A;  1M4L A;  4M3S A;  3D67 A;  4C68 A;  1X12 A;  2PJ7 A;  3JTK A;  2IL4 A;  5FVJ A;  3TO6 A;  4C7I A;  1BPN A;  3QAH A;  4MCP A;  5KTD A;  3DR6 A;  1IYL A;  2R98 A;  2JDD A;  1GYT A;  3RBU A;  4FAI A;  2R7H A;  1BAV A;  1M4G A;  6CPA A;  2YNC C;  4FUU A;  1R43 A;  2G9D A;  2BO9 A;  2Z3L A;  4AVC A;  1H8L A;  1YRE A;  4Q7A A;  3WR7 A;  2RC4 A;  3R9F A;  4UBR A;  2G0B A;  2X7B A;  1Z5R A;  2I00 A;  1YR0 A;  3EFA A;  2QML A;  2R1I A;  3JRU A;  3BLN A;  1S3Z A;  3KZW A;  4R6T A;  1S7L A;  3CXP A;  4UA3 A;  1QSR A;  4KLV A;  1S7F A;  2FVG A;  2PJ6 A;  5CPA A;  1PYT B;  2AFX A;  3GY9 A;  2WYR A;  5J8F A;  1LRZ A;  2HC9 A;  3D7G A;  4KOS A;  4KOU A;  1AMP A;  1ARL A;  2B4D B;  2PVV A;  3BI1 A;  4MHN A;  3A9L A;  4R87 A;  3GLJ A;  2FXF A;  3LOD A;  3F5B A;  5K8N A;  1QSM A;  2Q7S A;  4B5O A;  3RYO A;  4AVA A;  3PB7 X;  1TKJ A;  3IC1 A;  3SI0 A;  3KR5 A;  4DJL A;  4A95 A;  4AXV A;  2PJ3 A;  1MJA A;  5D8N A;  5C82 A;  2QJ8 A;  3PBE A;  1Y0Y A;  3L2N A;  4UIB A;  1KUY A;  2REE A;  3PP9 A;  4OP4 A;  3I1U A;  4B6Z A;  2OZU A;  2FE7 A;  3TX8 A;  4QBJ A;  7CPA A;  2DPT A;  2B5G B;  3IU2 A;  3FIX A;  4PXC A;  4QB9 A;  3ZJ0 A;  2AFU A;  1VGY A;  2ZEP A;  2PSW A;  4KOT A;  1Z8L A;  1YME A;  4KVX A;  1S60 A;  4OC1 A;  4UF4 A;  1PUA A;  1JQG A;  1KZF A;  2ZEF A;  1IOI A;  4LQ6 A;  4PSX A;  4KZT A;  2ZEG A;  4LX9 A;  5K8P A;  5HMN A;  2FSR A;  3TOB A;  4HKF A;  4P44 A;  4B10 A;  2J9A A;  2PJC A;  4J3G A;  2WPX A;  3ISZ A;  1P4N A;  2OH1 A;  4OKO A;  4R8F A;  1ZG7 A;  1KUV A;  2Z3K A;  2B58 A;  2ZW5 A;  1OZP A;  2AJ6 A;  4M6H A;  1FY7 A;  3D2M A;  1TKF A;  4R3K A;  4B14 A;  4UEE A;  3BJ8 A;  3KQZ A;  4PPZ A;  3DSB A;  4ZGY B;  2HB6 A;  2VXK A;  3D2P A;  3NH5 A;  2XEI A;  2O53 A;  3KL9 A;  4HNX B;  3KKW A;  3N7Z A;  5EBV A;  4P6Y A;  1Z2L A;  4G1P A;  2EBJ A;  2PRB A;  4PSW A;  1IU8 A;  3IWG A;  2GE3 A;  2GLJ A;  2Z0Z A;  3IEH A;  4MHY A;  5CBM A;  5JQ4 A;  2ZW7 A;  4MI4 A;  4A31 A;  4L8A A;  3H5Z A;  1OBR A;  2Q51 A;  4Z65 A;  2Q44 A;  1B6B A;  2V8G A;  3D4U A;  4A33 A;  4ZY1 A;  4CAW A;  2J8R A;  4A30 A;  2PJ5 A;  3WAB A;  1V0C A;  2P6F A;  3KHZ A;  4HPS A;  2JEV A;  4KOW A;  4NGT A;  3PRT A;  3JUW A;  2JBJ A;  3OWC A;  4Y49 B;  4CAV A;  2ZXV A;  5E96 A;  4B12 A;  2C6G A;  4CAE A;  1BO4 A;  2P6E A;  4KS9 A;  3IGR A;  4OC0 A;  4ZBG A;  1QMU A;  1A2Z A;  3IO1 A;  3RAM A;  3GIU A;  4CGN A;  8CPA A;  2PR8 A;  4MFK A;  1IGB A;  1IY7 A;  2EK8 A;  3LWU A;  3EY5 A;  3PGP A;  3S6K A;  4IAV A;  2PR1 A;  4UCM A;  4B13 A;  3JVN A;  3FBU A;  4OC3 A;  3ZZI A;  1Q2D A;  2ABZ A;  2FIA A;  3CPX A;  5H84 A;  5HXD A;  1LAM A;  2YND A;  4CPA A;  5EMI A;  2ZEN A;  3B3C A;  1U6M A;  2GFQ A;  1L0C A;  2PIY A;  1WK4 A;  4ONW A;  1YLO A;  3SJF A;  4MHD A;  4P4F A;  5JGF A;  4OIW A;  1B87 A;  4GM5 A;  1CPS A;  1RXT A;  4KVM E;  4PXD A;  2YGW A;  1Q7L A;  4P10 A;  3S6F A;  4UFX A;  4KSF A;  4A37 A;  1QSO A;  4NGS A;  4A94 A;  4NJQ A;  5ISV A;  1M4D A;  5KTC A;  1JWQ A;  4AG7 A;  2C27 A;  3CXQ A;  4FD4 A;  5LYI A;  2ODF A;  2BSW A;  1XEB A;  2ZW4 A;  1YW6 A;  4A38 A;  2Z3P A;  5G20 A;  4OID A;  1Z8X A;  5LRJ A;  4NCZ A;  2EK9 A;  1YK3 A;  4NEX A;  3NH8 A;  4QC6 A;  3W91 A;  5I4M A;  3H8F A;  4IK2 A;  4A39 A;  4PV6 A;  2RB7 A;  2B3U A;  1AUG A;  4MFQ A;  1M1D A;  3DGV A;  3N5F A;  3TO7 A;  3MN8 A;  4C7H A;  1XMT A;  2CIJ A;  2WPW A;  1HDQ A;  4EFD A;  4MY3 A;  2JDC A;  3PB9 X;  5BWA B;  3D8P A;  4PQA A;  4NSQ A;  2VI7 A;  4ZY2 A;  4B5P A;  4UEZ A;  4UWI A;  2I3C A;  2EUI A;  2XEF A;  3D66 A;  4MFP A;  4OME A;  4WWV A;  4YRH A;  5THW A;  2CF4 A;  4RUH A;  5J8C A;  5JPH A;  4X2T A;  2VQY A;  3B2Y A;  4H2K A;  3FRM A;  1ZG8 A;  1BPM A;  3S9M A;  5AG6 A;  1CP7 A;  1UWY A;  4UFV A;  1XIX A;  1Y7R A;  2BOA A;  5IV0 A;  3D7F A;  4MCS A;  1VHS A;  1EE3 P;  2ZOF A;  4DUK A;  2FS5 A;  4E8O A;  5LRG A;  5IX3 A;  3GYA A;  3FEC A;  2JLM A;  3K9U A;  2BEI A;  5F48 A;  2B3V A;  4KLW A;  4P4J A;  2CNM A;  4XPD B;  5G1Z A;  4YWY A;  3LMS A;  4XNH B;  2AFW A;  1VIX A;  2VBQ A;  2QYV A;  2PJA A;  2Z10 A;  4MRI A;  3B35 A;  5F09 A;  3D7H A;  2Z3M A;  4CAF A;  3FJU A;  1F57 A;  4R76 A;  3PZJ A;  1HDU A;  3FB3 A;  1VKC A;  3IIB A;  4JD6 A;  4X8I A;  1YX0 A;  4FD7 A;  4NFR A;  1F2P A;  3B3T A;  4CGL A;  2REF A;  2DF5 A;  5HVF A;  3MRU A;  4FD6 A;  4M6G A;  4ZX9 A;  4MMO A;  4KOY A;  1I21 A;  2IMO A;  4TNU A;  1QST A;  4LUA A;  4CYO A;  1CPX A;  4KOR A;  1QSN A;  2JBK A;  3VH9 A;  2BCO A;  1BLL E;  3WC6 A;  4KUA A;  1CBX A;  2B4D A;  4NGQ A;  2OZG A;  1ON0 A;  1Y0R A;  3CZX A;  4UIA A;  3W6X A;  4OLL A;  4E2A A;  3PB6 X;  3V8I A;  4F9V A;  2OB0 A;  2J8N A;  1Y9K A;  4MJ8 A;  4CRZ B;  1LAP A;  2H5M A;  2WZN A;  4NGM A;  4ZYQ A;  4HNW B;  3K2K A;  1ZLI A;  4PXB A;  5LRK A;  4ZY0 A;  2PQ8 A;  3T9Y A;  1TIQ A;  2DXQ A;  1NE9 A;  1XF8 A;  5AG5 A;  3S6G A;  1YGH A;  2POK A;  3CT9 A;  1M4I A;  1FT7 A;  2V8V A;  2PCU A;  3RNZ A;  2XEG A;  3NE8 A;  4BBH A;  2B5G A;  2V77 A;  1Z4R A;  3CPA A;  2ZEM A;  1QQ9 A;  4MCQ A;  3VAT A;  3SJX A;  1J4J A;  2O28 A;  4RS2 A;  1YVK A;  2EO8 A;  2FL4 A;  1SQH A;  2AE6 A;  4JYW A;  2GU2 A;  3SJG A;  4R9M A;  3NA6 A;  3TC8 A;  4ZI6 A;  1S5K A;  2A4N A;  2B4B A;  2IQ6 A;  1NSA A;  4KUB A;  4IUS A;  3P2F A;  5EC4 A;  4TWE A;  3T8W A;  2Q4Y A;  2PJB A;  4W9Y A;  3SI1 A;  1GHE A;  3SXO A;  3WT4 A;  1CJW A;  2GLF A;  2PJ1 A;  4X3R A;  1I1D A;  4M85 A;  4MHP A;  3RO0 A;  1I12 A;  2C6P A;  2KCW A;  4UCP A;  3KR4 A;  2Q4Z A;  2ZW6 A;  3V38 A;  4Q36 A;  1Z8W A;  4C2X A;  2Q0Y A;  1XBU A;  3D68 A;  2CNT A;  5JH9 A;  1XRY A;  1IID A;  2JEW A;  4CYP A;  3PBB A;  4BMH A;  4JZ0 A;  4K3N A;  3BHX A;  3WC7 A;  5HH1 A;  1XMB A;  2BUE A;  3FF3 A;  4F0X A;  3FXT A;  3NFZ A;  4IHM A;  2FT0 A;  3B8G A;  1YSJ A;  2VEZ A;  4CGM A;  2ZOG A;  1YW4 A;  1YVO A;  3FNC A;  2ZED A;  3BJ7 A;  4K30 A;  4U9Z A;  4A2Z A;  1Q2C A;  4ZX8 A;  1MJB A;  1XFO A;  3EC4 A;  4C2Z A;  3IWE A;  4CGP A;  1XE4 A;  2CY2 A;  1XJO A;  2HUZ A;  2NSM A;  4JXR A;  4M6I A;  3FMC A;  4R57 A;  4CYN A;  4DNC A;  5F47 A;  3G8W A;  2P0W A;  4H6U A;  3QAY A;  1K4J A;  4NGP A;  4JXQ A;  4OC2 A;  2VL1 A;  5F49 A;  3SHP A;  4JWP A;  3EO4 A;  5DWM A;  3GB0 A;  1M44 A;  4UCN A;  2PIZ A;  2QEC A;  3KQX A;  4P4D A;  3BI0 A;  3D7D A;  4BD9 A;  4CAX A;  1RO5 A;  4CRY B;  3H8E A;  1ELL P;  2PVW A;  3TTH A;  5C88 A;  2Z3O A;  4U5Y A;  1ZLH A;  3CDX A;  3R1K A;  3MGD A;  5D29 A;  2OZH A;  1CG2 A;  3I3G A;  4NGR A;  1HEE A;  3W6S A;  3FVL A;  4KSI A;  5H86 A;  2CXA A;  4XNH C;  2CNS A;  2Q4V A;  2CTB A;  4R7M A;  2V8H A;  5K8M A;  4KSA A;  5G21 A;  4NXY A;  2GAN A;  4E0A A;  1NSL A;  2ZEL A;  4C2Y A;  1UFH A;  2ANP A;  4F0Y A;  2HV2 A;  4I49 A;  4OC4 A;  3KHX A;  1LCP A;  2OR4 A;  1LFW A;  3H8G A;  4MBU A;  3FED A;  4QUS A;  4EVY A;  2PC1 A;  3S9N A;  3QB8 A;  4HNY B;  4EWT A;  3F0A A;  5AG4 A;  1MJ9 A;  3FEE A;  5K8O A;  2C6C A;  2RFH A;  3FYN A;  4QVT A;  1Z9U A;  4OAD A;  3IJ3 A;  4FBE A;  4ORF A;  3IU1 A;  3DNS A;  1Z4E A;  5DS0 A;  5IB0 A;  2QIR A;  1DE4 C;  2PDO A;  4OAE A;  5A28 A;  1AYE A;  2EVN A;  2K5T A;  2J8M A;  2ZEH A;  4MXU A;  3TO9 A;  2PJ0 A;  2F5I A;  3B7I A;  4U9Y A;  1N71 A;  3TE4 A;  3KAS A;  4KVO E;  2Q04 A;  1DTD A;  1YLE A;  4WJB A;  5DWN A;  4II9 A;  3PB4 X;  1TKH A;  2O4H A;  2WUU A;  5G22 A;  1PCA A;  3S6H A;  4GXH A;  1TF9 A;  4P4B A;  3KI9 A;  3F8K A;  2NYQ A;  5GCN A;  2I79 A;  4JJX A;  1KUX A;  2OU2 A;  1LAN A;  1R57 A;  5IB9 A;  5AGE A;  3VWE A;  4BIN A;  2AFM A;  3KGQ A;  4O23 A;  4YU9 A;  3NE7 A;  1KWM A;  4LQG A;  4MCR A;  4NJR A;  4OC5 A;  4P4I A;  3B3S A;  1IIC A;  5ELY A;  3S9L A;  3ISX A;  2P6G A;  2AFS A;  4AB7 A;  3BXM A;  3B3V A;  4KOX A;  4R3L A;  2D4P A;  3B3W A;  4EME A;  4H6Z A;  3TT2 A;  4IF5 A;  1TXR A;  2PRQ A;  1F2O A;  2YNE A;  3FH4 A;  4MFL A;  3R95 A;  5HVG A;  1BOB A;  2XEJ A;  4Y49 C;  4JLY A;  2OOT A;  3LD2 A;  3D3S A;  3PB8 X;  4RN7 A;  3TCV A;  2AFO A;  2HQY A;  1NMT A;  3DLJ A;  1TF8 A;  2YNC A;  3VAR A;  1S7K A;  2ATR A;  2FIW A;  2ARH A;  2EWB A;  3SXN A;  1VHE A;  2PJ2 A;  3K9T A;  4GS4 A;  3DDD A;  4AVB A;  3EXN A;  5HVH A;  1ARM A;  2QVP A;  2Z11 A;  2Z3N A;  3H4Q A;  2F8H A;  3E0K A;  2PJ4 A;  3IWW A;  4F8Z A;  4F6A A;  1MK4 A;  5KTA A;  4B11 A;  2WSA A;  1Y9W A;  4XPL A;  5AG7 A;  1FNO A;  3HLP A;  3TOA A;  2GRE A;  2ZEE A;  4FD5 A;  4FWU A;  3QNV A;  3NH4 A;  4UWJ A;  4RI1 A;  1PU9 A;  2VZY A;  2C1C A;  1ZG9 A;  2AFZ A;  4NF1 A;  5JM6 A;  1Z8T A;  2F7V A;  2V8D A;  3WC5 A;  4NGN A;  5LYD A;  4UFW A;  3LAC A;  4P4E A;  1IOF A;  3VWD A;  4MHZ A;  1YQE A;  2ZEO A;  4ONU A;  2DPS A;  3RZA A;  2PJ9 A;  4YGO A;  4MY0 A;  3PEI A;  2GIV A;  2IJZ A;  2Q7B A;  5F46 A;  1R3N A;  3DR8 A;  3R9G A;  3P2H A;  2G3A A;  4PK2 A;  5J1Q A;  5A27 A;  4A32 A;  4PK3 A;  2DEA A;  3R96 A;  3V7Z A;  1IYK A;  1CM0 A;  2Y0M A;  3T90 A;  3PFO A;  3CXS A;  1XOV A;  2VZZ A;  2ZPA A;  3C26 A;  5LYL A;  1CP6 A;  2D4O A;  1S7N A;  3SI2 A;  1Q2Y A;  3FX6 A;  1ELM P;  4MFJ A;  4MFZ A;  3R9E A;  4H89 A;  2CTC A;  4XPK A;  4B5P B;  1WWZ A;  1Y7E A;  1RTQ A;  1ZO0 A;  3IFE A;  5I0C A;  4CYQ A;  3UY5 A;  2Q43 A;  2BL1 A;  3I9S A;  4L89 A;  4DYO A;  4X5K A;  3TFY A;  5CNP A;  4AG9 A;  4KOV A;  4F9U A;  2R8V A;  3PFE A;  1P0H A;  1X10 A;  2PJ8 A;  4UEF A;  3GKR A;  3HUV A;  4CGO A;  1VHO A;  1IB1 E;  4CS0 B;  3GUX A;  4XPD C;  3G3S A;  2G3T A;  2NMT A;  3SJE A;  4PXE A;  1LOK A;  2PE3 A;  4P45 A;  2FCK A; 
#chains in the Genus database with same CATH homology
 4YFJ A;  4Q38 A;  4M3S A;  4C68 A;  3JTK A;  5FVJ A;  2IL4 A;  3TO6 A;  4C7I A;  3QAH A;  5KTD A;  3DR6 A;  1IYL A;  2R98 A;  2JDD A;  2R7H A;  1M4G A;  2YNC C;  4AVC A;  2Z3L A;  1YRE A;  3WR7 A;  2RC4 A;  3R9F A;  4UBR A;  2G0B A;  2X7B A;  2I00 A;  1YR0 A;  3EFA A;  2QML A;  2R1I A;  3BLN A;  1S3Z A;  1S7L A;  3CXP A;  4UA3 A;  1QSR A;  4KLV A;  1S7F A;  3GY9 A;  5J8F A;  1LRZ A;  4KOS A;  4KOU A;  2B4D B;  3A9L A;  4R87 A;  3LOD A;  2FXF A;  3F5B A;  1QSM A;  4B5O A;  4AVA A;  4A95 A;  5C82 A;  1MJA A;  1KUY A;  2REE A;  3PP9 A;  2OZU A;  2FE7 A;  4QBJ A;  2DPT A;  2B5G B;  3IU2 A;  3FIX A;  4QB9 A;  3ZJ0 A;  2PSW A;  4KOT A;  5HMN A;  4KVX A;  1S60 A;  5H86 A;  3RYO A;  1PUA A;  1KZF A;  4PSX A;  4KZT A;  4LX9 A;  2FSR A;  3TOB A;  4HKF A;  4B10 A;  4J3G A;  2WPX A;  1P4N A;  2OH1 A;  1KUV A;  2Z3K A;  2B58 A;  2ZW5 A;  1OZP A;  2AJ6 A;  1FY7 A;  3D2M A;  4R3K A;  4B14 A;  3BJ8 A;  3DSB A;  4ZGY B;  2VXK A;  3D2P A;  4HNX B;  3KKW A;  3N7Z A;  5EBV A;  2PRB A;  4PSW A;  3IWG A;  2GE3 A;  2Z0Z A;  5JQ4 A;  2ZW7 A;  4MI4 A;  4A31 A;  4L8A A;  3H5Z A;  2Q44 A;  1B6B A;  4A33 A;  4CAW A;  2J8R A;  4A30 A;  1V0C A;  2P6F A;  4KOW A;  2JEV A;  4CAV A;  3JUW A;  3OWC A;  4Y49 B;  2ZXV A;  5E96 A;  4B12 A;  4CAE A;  1BO4 A;  2P6E A;  4KS9 A;  3IGR A;  4ZBG A;  4CGN A;  2PR8 A;  4MFK A;  3EY5 A;  3PGP A;  3S6K A;  2PR1 A;  4UCM A;  4B13 A;  3JVN A;  3FBU A;  3ZZI A;  1Q2D A;  2FIA A;  5H84 A;  2YND A;  1U6M A;  3TCV A;  1L0C A;  1WK4 A;  4MHD A;  1B87 A;  4KVM E;  1RXT A;  2YGW A;  3S6F A;  4UFX A;  4KSF A;  1QSO A;  5ISV A;  1M4D A;  5KTC A;  4AG7 A;  2C27 A;  3CXQ A;  4FD4 A;  2BSW A;  1XEB A;  2ZW4 A;  2Z3P A;  5G20 A;  4NCZ A;  1YK3 A;  4NEX A;  4QC6 A;  3W91 A;  4PV6 A;  2B3U A;  4MFQ A;  1M1D A;  3TO7 A;  4C7H A;  1XMT A;  2WPW A;  4MY3 A;  2JDC A;  5BWA B;  3D8P A;  4NSQ A;  2VI7 A;  4B5P A;  4UWI A;  4YRH A;  2EUI A;  4MFP A;  5JPH A;  5J8C A;  2VQY A;  3FRM A;  5AG6 A;  4UFV A;  1XIX A;  1Y7R A;  5IV0 A;  1VHS A;  2FS5 A;  4E8O A;  5IX3 A;  3GYA A;  2JLM A;  3K9U A;  2BEI A;  5F48 A;  2B3V A;  4KLW A;  2CNM A;  4XPD B;  5G1Z A;  4XNH B;  2VBQ A;  2Z10 A;  2Z3M A;  4CAF A;  3PZJ A;  4JD6 A;  3FB3 A;  1VKC A;  1YX0 A;  4FD7 A;  4CGL A;  2REF A;  4FD6 A;  4KOY A;  1I21 A;  1QST A;  4LUA A;  4CYO A;  4KOR A;  1QSN A;  4KUA A;  2B4D A;  2OZG A;  1ON0 A;  3W6X A;  4OLL A;  4E2A A;  3V8I A;  2OB0 A;  2J8N A;  1Y9K A;  4MJ8 A;  4CRZ B;  2H5M A;  4HNW B;  2PQ8 A;  3T9Y A;  1TIQ A;  2DXQ A;  1NE9 A;  1XF8 A;  5AG5 A;  3S6G A;  1YGH A;  1M4I A;  4BBH A;  2B5G A;  1Z4R A;  1J4J A;  2O28 A;  4RS2 A;  1YVK A;  2FL4 A;  1SQH A;  2AE6 A;  4R9M A;  1S5K A;  2A4N A;  2B4B A;  4KUB A;  4IUS A;  3P2F A;  5EC4 A;  2Q4Y A;  1GHE A;  3SXO A;  1CJW A;  1I1D A;  4M85 A;  1I12 A;  2KCW A;  4UCP A;  2ZW6 A;  4Q36 A;  4C2X A;  2Q0Y A;  2CNT A;  1IID A;  4CYP A;  4BMH A;  5HH1 A;  2BUE A;  4F0X A;  3FXT A;  2FT0 A;  3B8G A;  2VEZ A;  4CGM A;  1YVO A;  3FNC A;  3BJ7 A;  4K30 A;  4U9Z A;  4A2Z A;  1Q2C A;  1MJB A;  3EC4 A;  4C2Z A;  3IWE A;  4CGP A;  1XE4 A;  2CY2 A;  4JXR A;  2HUZ A;  4CYN A;  4DNC A;  4R57 A;  5F47 A;  3G8W A;  2P0W A;  4H6U A;  1K4J A;  4JXQ A;  5F49 A;  3SHP A;  4JWP A;  3EO4 A;  5DWM A;  1M44 A;  4UCN A;  2QEC A;  4CAX A;  1RO5 A;  4CRY B;  3TTH A;  5C88 A;  2Z3O A;  4U5Y A;  3R1K A;  3MGD A;  2OZH A;  3I3G A;  3W6S A;  2CXA A;  4XNH C;  2CNS A;  2Q4V A;  4KSA A;  5G21 A;  4NXY A;  2GAN A;  4E0A A;  1NSL A;  4C2Y A;  1UFH A;  4F0Y A;  2HV2 A;  4I49 A;  4MBU A;  4QUS A;  4EVY A;  2PC1 A;  3QB8 A;  4HNY B;  3F0A A;  5AG4 A;  1MJ9 A;  3FYN A;  4QVT A;  1Z9U A;  4OAD A;  4ORF A;  3IU1 A;  3DNS A;  1Z4E A;  5IB0 A;  2QIR A;  2PDO A;  4OAE A;  5A28 A;  2EVN A;  2K5T A;  2J8M A;  3TO9 A;  2F5I A;  4U9Y A;  1N71 A;  3TE4 A;  4KVO E;  2Q04 A;  5DWN A;  1YLE A;  4II9 A;  2WUU A;  5G22 A;  3S6H A;  3F8K A;  5GCN A;  2I79 A;  4JJX A;  1KUX A;  2OU2 A;  1R57 A;  5AGE A;  3VWE A;  3NE7 A;  1IIC A;  2P6G A;  4AB7 A;  4KOX A;  4R3L A;  2D4P A;  4H6Z A;  3TT2 A;  4IF5 A;  2YNE A;  4MFL A;  3R95 A;  1BOB A;  4Y49 C;  4JLY A;  3LD2 A;  3D3S A;  2HQY A;  1NMT A;  2YNC A;  1S7K A;  2ATR A;  2FIW A;  2ARH A;  3SXN A;  4GS4 A;  3DDD A;  4AVB A;  3EXN A;  2Z11 A;  2Z3N A;  3H4Q A;  3E0K A;  4F6A A;  1MK4 A;  5KTA A;  4B11 A;  2WSA A;  1Y9W A;  4XPL A;  5AG7 A;  3TOA A;  4FD5 A;  4UWJ A;  4RI1 A;  1PU9 A;  2VZY A;  4NF1 A;  4UFW A;  3VWD A;  4ONU A;  2DPS A;  4YGO A;  4MY0 A;  2GIV A;  2Q7B A;  3DR8 A;  3R9G A;  3P2H A;  2G3A A;  4PK2 A;  5A27 A;  4A32 A;  4PK3 A;  3R96 A;  1IYK A;  1CM0 A;  2Y0M A;  3T90 A;  3CXS A;  2VZZ A;  2ZPA A;  3C26 A;  2D4O A;  1S7N A;  1Q2Y A;  4MFJ A;  4MFZ A;  3R9E A;  4H89 A;  4B5P B;  4XPK A;  1WWZ A;  1ZO0 A;  5I0C A;  4CYQ A;  3UY5 A;  2BL1 A;  3I9S A;  4L89 A;  4X5K A;  3TFY A;  5CNP A;  4AG9 A;  4KOV A;  2R8V A;  1P0H A;  3GKR A;  4CGO A;  1IB1 E;  4CS0 B;  4XPD C;  3G3S A;  2G3T A;  2NMT A;  5F46 A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...