4L8AA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in ternary complex with n-phenylacetyl-gly-aclys and coa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
159
structure length
159
Chain Sequence
b'MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 45
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4l8aA00
2QMLA 4KUBA 2OZGA 4R87A 4FD5A 2PRBA 2ZW5A 4KOYA 2J8MA 4KLWA 2G3AA 3SXOA 1S7NA 4JJXA 3R9GA 3GKRA 4HNWB 3W6XA 1YVOA 1XIXA 3UY5A 4AVAA 5HH1A 3WR7A 1V0CA 4R57A 4AB7A 2R7HA 2GE3A 2ZW7A 2FSRA 1YK3A 1PU9A 4GS4A 1YREA 5C88A 4R3LA 2FS5A 3DR6A 3F5BA 2I00A 3EFAA 5F48A 4CAVA 3EO4A 2P6EA 4QUSA 1P4NA 1IICA 3TCVA 3FIXA 2FCKA 4UWIA 3S6KA 3FB3A 3ZZIA 1OZPA 5KTAA 1MK4A 2B4DB 4NEXA 2Q7BA 3C26A 4AVBA 3I3GA 3CXSA 4YGOA 3TFYA 2O28A 1L0CA 1LRZA 1I21A 2RC4A 4QB9A 4HNYB 2BSWA 4B5OA 2FT0A 3W6SA 1I1DA 3TTHA 1Y7RA 1M4GA 4Y49C 2R98A 4AG9A 5E96A 2ARHA 3SXNA 3B8GA 1NE9A 1RO5A 4KORA 4KVXA 4XPDC 4ORFA 5FVJA 4H6UA 1Y9WA 1PUAA 2JEVA 2BUEA 3TO9A 2G0BA 4EVYA 3NE7A 1QSOA 1P0HA 2VXKA 4CAXA 4BMHA 2B5GA 4IUSA 3QB8A 4OAEA 3G3SA 2ZW4A 4LX9A 3DDDA 4H89A 1XEBA 2CY2A 2JLMA 4Y49B 1B6BA 4KVOE 2I79A 5IV0A 5F49A 2AJ6A 4KUAA 1S7LA 5J8FA 2ZPAA 4FD4A 2WPXA 2F5IA 4MBUA 1Y9KA 4XPDB 2CNMA 4NCZA 3S6HA 4X5KA 1XE4A 4KZTA 2OU2A 4KOUA 3EC4A 1Z4RA 3LODA 2EUIA 4F6AA 1J4JA 3IWGA 4MI4A 2DXQA 3TO6A 2Q0YA 2Z11A 3H4QA 1MJAA 1WWZA 5EBVA 1KZFA 1RXTA 1S7KA 4KOSA 5I0CA 3V8IA 1YLEA 1S5KA 3DSBA 1S3ZA 2VBQA 4MY0A 4RS2A 2REEA 4H6ZA 1N71A 4CRZB 4II9A 2OZHA 3PZJA 5ISVA 4UBRA 3R95A 2HUZA 2C27A 2QECA 3R96A 1Z4EA 2JDCA 1M4DA 1YVKA 2BEIA 3T90A 3GY9A 2VZYA 2B3UA 2Q04A 1MJ9A 4AG7A 2PR8A 4KVME 1MJBA 2B58A 4MJ8A 3DNSA 3BJ7A 4NSQA 1CJWA 2A4NA 3JUWA 4E2AA 5EC4A 1I12A 5DWMA 2VQYA 4QC6A 4B5PA 4KOXA 5F46A 4KOWA 1NSLA 2Y0MA 3R9FA 4U9YA 2PQ8A 1IYLA 3RYOA 3I9SA 5HMNA 5JPHA 4LUAA 3D8PA 4JLYA 5KTDA 2VZZA 1BO4A 2FXFA 3TT2A 4XPKA 1QSTA 3FBUA 4F0YA 1TIQA 2OH1A 5H84A 1S60A 2D4PA 3CXPA 2FIAA 4PK3A 4PSXA 2HV2A 1KUXA 2KCWA 4M3SA 2Q4YA 4FD7A 3W91A 2D4OA 1K4JA 3S6FA 4CS0B 4YRHA 3D3SA 3TE4A 3CXQA 4U9ZA 1B87A 2Z0ZA 3T9YA 4OADA 3TO7A 4JD6A 1M44A 1YX0A 3E0KA 4PV6A 4U5YA 2J8RA 3N7ZA 2OZUA 4PSWA 2Z10A 4M85A 2IL4A 5F47A 2B3VA 2X7BA 2FL4A 2B4BA 4J3GA 4XNHC 4AVCA 2J8NA 2PC1A 1YGHA 3IGRA 5CNPA 3PGPA 3TOBA 3ZJ0A 4R9MA 1VKCA 3FXTA 2B4DA 2P6FA 1WK4A 2B5GB 4IF5A 1SQHA 4ZBGA 1Q2YA 4PK2A 2EVNA 3VWDA 4YFJA 2OB0A 3F8KA 2H5MA 1CM0A 4MY3A 4ONUA 4KOTA 3PP9A 3QAHA 3G8WA 4CRYB 2VI7A 4UA3A 1IB1E 2GANA 4XNHB 4NF1A 5IB0A 4FD6A 4XPLA 4CAWA 4NXYA 1Q2CA 3EXNA 3KKWA 2R8VA 2CNSA 4K30A 4DNCA 4HNXB 3S6GA 4I49A 3JVNA 1ON0A 2HQYA 2FE7A 4OLLA 5IX3A 1QSRA 2ZW6A 2JDDA 1U6MA 3FYNA 1IYKA 2PSWA 3SHPA 4E8OA 2K5TA 3K9UA 3BJ8A 1IIDA 4KLVA 2WPWA 1UFHA 3EY5A 1Q2DA 1KUVA 1QSMA 2BL1A 2PDOA 3R1KA 4JXRA 4MHDA 3P2HA 4KOVA 3FNCA 2AE6A 1GHEA 2G3TA 4UWJA 1YR0A 2CNTA 1BOBA 5J8CA 5DWNA 4L89A 1XMTA 2ATRA 3F0AA 3GYAA 1FY7A 3MGDA 4B5PB 2NMTA 3R9EA 3D2PA 4RI1A 3DR8A 2VEZA 3VWEA 5JQ4A 2P0WA 2GIVA 4R3KA 4QVTA 5KTCA 1Z9UA 2PR1A 1NMTA 5H86A 2Q44A 3FRMA 2FIWA 3P2FA 4E0AA 3OWCA 2ZXVA 4L8AA 3D2MA 4HKFA 1KUYA 1M4IA 4QBJA 1S7FA 4JXQA 2Q4VA 3BLNA 1QSNA 2R1IA 1R57A 1XF8A 2QIRA 4JWPA 2P6GA 1VHSA 1M1DA 2REFA 3LD2A 5GCNA 5C82A 3TOAA
chains in the Genus database with same CATH superfamily
2QMLA 4KUBA 1KWMA 1AUGA 1DTDA 1YW6A 4NGQA 1XMBA 2OZGA 4PPZA 2RFHA 4R87A 4FD5A 2PRBA 2ZW5A 4KOYA 2J8MA 4KLWA 3B3CA 4R8FA 4A33A 3KQXA 2G3AA 3SXOA 1S7NA 5K8PA 4B14A 2GLJA 4JJXA 3R9GA 3GKRA 4HNWB 4MCSA 4M6HA 5G21A 1TF8A 3W6XA 5LYIA 1YVOA 4OP4A 4P4DA 4B13A 5HVHA 1XIXA 5JH9A 3UY5A 4AVAA 5HH1A 2FVGA 2PRQA 3WR7A 1V0CA 4R57A 4AB7A 1IU8A 2R7HA 2GE3A 4BD9A 2ZW7A 2FSRA 1YK3A 1PU9A 4CYQA 4GS4A 1YREA 4B12A 5C88A 4R3LA 2ABZA 2FS5A 1HDQA 4NGNA 3WT4A 3DR6A 3F5BA 4MCRA 4O23A 2AFXA 3B3SA 2AFUA 2I00A 3EFAA 2Z3OA 5F48A 4CAVA 3EO4A 2P6EA 4QUSA 4LQGA 3KQZA 3PBEA 2YGWA 2F8HA 1P4NA 1IICA 1XRYA 4CAFA 3TCVA 4IK2A 3FIXA 2FCKA 4DYOA 3FH4A 4UWIA 4FBEA 3S6KA 4MRIA 4PXDA 3FB3A 3BHXA 2C6CA 4KS9A 5G1ZA 3ZZIA 1OZPA 3D4UA 4W9YA 1MK4A 3BI0A 5KTAA 3B3VA 2B4DB 1HDUA 1CX8A 4ONWA 2ANPA 3JRUA 4P4IA 4PXEA 3PBBA 5DS0A 4NEXA 2Q7BA 3C26A 4OC3A 2V8HA 4UFWA 5G20A 2OOTA 3KHXA 2Q4ZA 4GXHA 4LQ6A 4Q36A 4AVBA 1VHOA 3IWEA 3WC6A 3I3GA 3CXSA 4UCMA 4YGOA 1Q7LA 2O28A 3TFYA 1L0CA 3HLPA 1LRZA 1I21A 2RC4A 4MCPA 5D29A 4QB9A 4A38A 1VIXA 1Y7EA 2I3CA 3FVLA 3TX8A 4HNYB 4P44A 2C1CA 2HB6A 2BSWA 4B5OA 3DGVA 3PFOA 4P4BA 1TF9A 2FT0A 2QJ8A 2ZOFA 3W6SA 4A39A 2GU2A 3B35A 2Q51A 4ZY2A 5IB9A 1Z8WA 2PVWA 4CYNA 1I1DA 3D67A 2ZEFA 1VHEA 3B3TA 3NE8A 3TTHA 1Y7RA 1M4GA 5HVFA 4Z65A 1YSJA 2JEWA 4Y49C 2R98A 2AFZA 4AG9A 1QMUA 5E96A 4A95A 2ARHA 3KL9A 3KZWA 3SXNA 1FT7A 1CBXA 4CGOA 4MFQA 2EK9A 3B8GA 1NE9A 1RO5A 2Z3LA 3QAYA 4KORA 4NGTA 3IWWA 4KVXA 4XPDC 4UCNA 8CPAA 4ORFA 2CF4A 5FVJA 1TKHA 2XEJA 2PJAA 4H6UA 1UWYA 1Y9WA 5K8MA 3FECA 1PUAA 1ZLIA 2JEVA 2BUEA 3TO9A 2G0BA 1PCAA 2DF5A 4EVYA 3D68A 3NE7A 4P45A 3FJUA 1QSOA 2Z3NA 3KASA 4KSAA 1P0HA 2VXKA 4CAXA 4HPSA 1JQGA 3IU2A 4BMHA 2B5GA 4FAIA 2V77A 3GLJA 2PJ7A 4IUSA 5AGEA 2GREA 3QB8A 4RN7A 4OAEA 3G3SA 3D7FA 4NGPA 4ZY1A 2NYQA 3WABA 1XBUA 2ZW4A 3PFEA 4NJRA 2YNCA 4LX9A 4CYOA 3DDDA 4H89A 1XEBA 1M4LA 2CY2A 1GYTA 4F0XA 2JLMA 3GUXA 4Y49B 1B6BA 4KVOE 4R7MA 2I79A 5IV0A 3FMCA 3VATA 5F49A 2G9DA 2AJ6A 2HC9A 4KUAA 3SJEA 3RBUA 1S7LA 5J8FA 2ZPAA 4FD4A 2WPXA 2F5IA 4MBUA 1Y9KA 4CGLA 4PQAA 2CNMA 4NCZA 4XPDB 4X5KA 3S6HA 4A2ZA 1TKJA 1XE4A 2PJ0A 4KZTA 5AG5A 1R43A 4R6TA 4K3NA 1ZG9A 3SI2A 3KI9A 2QVPA 2OU2A 2WZNA 4KOUA 3EC4A 4MHNA 4A37A 4ZYQA 1F57A 4MFLA 4F9UA 1Y0RA 3K9TA 2PIYA 3MRUA 3CZXA 1Z4RA 3D66A 3LODA 4MXUA 2EUIA 4NJQA 2PJBA 2Z3MA 3TC8A 4F6AA 2GLFA 3CPAA 2OR4A 1J4JA 1XFOA 3IWGA 4P4EA 1LAPA 4MI4A 4OC0A 2DXQA 3TO6A 1Z8LA 2Q0YA 2Z11A 3H4QA 4X8IA 2PCUA 1MJAA 1WWZA 4NGMA 5EBVA 1KZFA 3IJ3A 4AVCA 1RXTA 1S7KA 4KOSA 5I0CA 3V8IA 1YLEA 1S5KA 3DSBA 1S3ZA 1TKFA 1Z8XA 2EO8A 1CG2A 2IJZA 2VBQA 2ZEOA 3D7HA 4Q7AA 4MY0A 1HEEA 4C7HA 1IGBA 4F9VA 4RS2A 2PJ6A 2REEA 4H6ZA 1N71A 2ZOGA 4CRZB 3PB4X 4UFVA 3BI1A 4II9A 2EK8A 4G1PA 2OZHA 2V8VA 3PZJA 5ISVA 4UBRA 3R95A 2HUZA 2AFOA 2C27A 1Z8TA 2QECA 3R96A 4BBHA 4B10A 1Z4EA 2JDCA 4OMEA 1LFWA 1M4DA 4ZGYB 1YVKA 1Y0YA 1Z2LA 2BEIA 3GIUA 3T90A 1BPNA 2VZYA 3GY9A 2B3UA 4CAEA 5HXDA 2IMOA 2WSAA 2Q04A 2XEGA 4MFJA 3ISZA 1MJ9A 4AG7A 1DE4C 2PR8A 4KVME 4PXCA 2PJ1A 2CIJA 1MJBA 2Z3KA 3LMSA 4F8ZA 2B58A 4MJ8A 1X12A 3DNSA 3BJ7A 4NSQA 4B11A 1CJWA 2A4NA 1YQEA 1XJOA 3FX6A 3JUWA 3RNZA 4E2AA 5EC4A 1I12A 5DWMA 1CPXA 2VQYA 4QC6A 4UEEA 4OIDA 4B5PA 4KOXA 5AG4A 5F46A 2AFWA 4KOWA 1NSLA 2RB7A 3IU1A 4M6GA 4Q38A 3NA6A 4TWEA 2XEFA 3K2KA 2Y0MA 3NFZA 3R9FA 4U9YA 2PQ8A 5LRGA 1IYLA 3RYOA 4CGMA 3I9SA 2ZENA 1ZO0A 5HMNA 3KR5A 4LUAA 5JPHA 3IFEA 4C68A 4OC4A 3HUVA 3D8PA 4JLYA 5KTDA 4CGNA 2VZZA 5F09A 1BO4A 2FXFA 2GFQA 4UEFA 3TT2A 4XPKA 1QSTA 3FBUA 4UIAA 4F0YA 1TIQA 2OH1A 5AG7A 2PJ4A 5H84A 1S60A 2D4PA 4EWTA 3H8FA 4IAVA 3CXPA 2VL1A 2FIAA 1A2ZA 4JYWA 1ARMA 4PK3A 4PSXA 2HV2A 3BXMA 3RZAA 1ELLP 1KUXA 2KCWA 3SJFA 3WC7A 3PB9X 3SI0A 4A31A 2C6GA 2QYVA 2Q4YA 4M3SA 2BO9A 4OC2A 2XEIA 4FD7A 4GM5A 2WUUA 3W91A 5I4MA 2D4OA 3PRTA 1K4JA 3S6FA 2ZEPA 3D7DA 3FEEA 4CS0B 2PJ2A 4YRHA 1CPSA 3D3SA 3TE4A 4RUHA 3ISXA 3CXQA 3N5FA 4U9ZA 5K8OA 1B87A 4YWYA 2Z0ZA 5EMIA 4C2ZA 3T9YA 4OADA 3TO7A 2YNCC 1YLOA 4JD6A 4P6YA 3JTKA 1M44A 1R3NA 3SI1A 4CGPA 5AG6A 1YX0A 2PIZA 3SJGA 3PB7X 3E0KA 2F7VA 3NH5A 3NH4A 4PV6A 4U5YA 2J8RA 3N7ZA 2OZUA 4PSWA 4UF4A 2YNDA 5LYDA 2Z10A 3A9LA 4M85A 4C7IA 3S9LA 4A94A 4EMEA 1NSAA 2IL4A 5F47A 2B3VA 4P4JA 4AXVA 2X7BA 2FL4A 2B4BA 1X10A 2BOAA 4J3GA 2J8NA 2PC1A 1YGHA 3GB0A 4OC5A 3IGRA 2JBJA 3PB8X 5CNPA 3PGPA 5A28A 4UCPA 3KR4A 4CYPA 3TOBA 3ZJ0A 4R9MA 5CPAA 1H8LA 5LRKA 1VKCA 3FXTA 4ZY0A 5BWAB 1BLLE 2B4DA 2P6FA 1WK4A 2B5GB 2PJ8A 1LANA 3H8GA 3V7ZA 2DPTA 4IF5A 4ZI6A 4M6IA 5HVGA 2PJ9A 1OBRA 1SQHA 4ZBGA 1Q2YA 4PK2A 4DUKA 2EVNA 3VWDA 4YFJA 2OB0A 3F8KA 4X2TA 2H5MA 1VGYA 1CM0A 4MY3A 4ONUA 4MFZA 4PXBA 4OKOA 4KOTA 3PP9A 4UEZA 3QAHA 3LWUA 3G8WA 4CRYB 2VI7A 3QNVA 2IQ6A 5LYFA 2ODFA 2J9AA 4FWUA 1IOFA 4UA3A 1IB1E 2GANA 1LAMA 4XNHB 2Z3PA 4NF1A 5IB0A 5A27A 4FD6A 4MCQA 4XPLA 4CAWA 2V8GA 1Q2CA 3MN8A 4NXYA 3B3WA 2ZEGA 3EXNA 3KKWA 2R8VA 1CP6A 2CNSA 4K30A 4DNCA 3CPXA 1AYEA 1F2PA 4HNXB 5G22A 3S6GA 4MFPA 2AFMA 2DPSA 3JVNA 4I49A 4XNHC 2PJ3A 1QQ9A 1ON0A 2HQYA 2FE7A 1XOVA 3LACA 4KSIA 3FEDA 1IOIA 4OLLA 4P10A 5D8NA 5IX3A 4OIWA 1QSRA 2ZW6A 4MHZA 2JDDA 1U6MA 3FYNA 2Q7SA 1IYKA 4MMOA 2PSWA 3SHPA 4E8OA 3RAMA 3L2NA 1LCPA 2BCOA 2K5TA 3B2YA 1RTQA 3K9UA 4ZX9A 2V8DA 4C2XA 3SJXA 3KGQA 3B7IA 2Q43A 1BPMA 3BJ8A 4IHMA 2ZEDA 1IIDA 4KLVA 2WPWA 1UFHA 3EY5A 3NH8A 2CTBA 1Q2DA 3RO0A 1KUVA 4FUUA 1QSMA 2BL1A 3DLJA 2PDOA 1ELMP 3R1KA 4JXRA 2CXAA 2O53A 4MHDA 4NFRA 2EBJA 3P2HA 4CPAA 4KOVA 3S9NA 3FNCA 2G3TA 2DEAA 2AE6A 1GHEA 1ZG7A 4JZ0A 4UWJA 6CPAA 7CPAA 1YR0A 1PYTB 2ZEEA 5LYLA 4WWVA 4OC1A 4DJLA 5JM6A 2CNTA 1BOBA 4R76A 4NGSA 3V38A 2JBKA 3IC1A 2YNEA 5ELYA 5J8CA 5JGFA 1BAVA 2AFSA 4C2YA 4X3RA 1FNOA 4UFXA 4BINA 1LOKA 5DWNA 5K8NA 3IIBA 4L89A 2PJCA 1XMTA 2ATRA 4EFDA 3F0AA 3GYAA 3H5ZA 1FY7A 4NGRA 4MFKA 3MGDA 1YW4A 4B5PB 1Z5RA 2NMTA 3R9EA 3D2PA 1F2OA 1TXRA 3DR8A 4RI1A 2ZEMA 2O4HA 2ZELA 3T8WA 1EE3P 4A32A 3VARA 3IEHA 3KHZA 4WJBA 1YMEA 2VEZA 3D7GA 3IO1A 3PB6X 3VWEA 5JQ4A 2NSMA 2P0WA 2GIVA 4R3KA 4QVTA 5KTCA 1Z9UA 2CTCA 3WC5A 2PR1A 5CBMA 2PVVA 1NMTA 4MHPA 5H86A 3H8EA 2Q44A 2ZEHA 3PEIA 3CT9A 4B6ZA 2PE3A 3FRMA 2FIWA 3P2FA 4H2KA 5THWA 4E0AA 1AMPA 2WYRA 3OWCA 3S9MA 2ZXVA 4L8AA 2EWBA 3D2MA 1KUYA 1ZLHA 4HKFA 4UIBA 4ZX8A 4YU9A 1M4IA 1IY7A 4QBJA 1S7FA 1ZG8A 4JXQA 2Q4VA 3BLNA 1JWQA 1CP7A 1ARLA 5J1QA 2POKA 4KSFA 1QSNA 2R1IA 5LRJA 1R57A 1XF8A 4A30A 3FF3A 2QIRA 4JWPA 2P6GA 3VH9A 1VHSA 1M1DA 2C6PA 2REFA 3CDXA 3LD2A 4P4FA 3I1UA 4TNUA 5GCNA 4MHYA 5C82A 3TOAA 2PJ5A
chains in the Genus database with same CATH topology
2QMLA 4KUBA 2OZGA 4R87A 4FD5A 2PRBA 2ZW5A 4KOYA 2J8MA 4KLWA 4A33A 2G3AA 3SXOA 1S7NA 4B14A 4JJXA 3R9GA 3GKRA 4HNWB 5G21A 3W6XA 4B13A 1YVOA 1XIXA 3UY5A 4AVAA 5HH1A 3WR7A 1V0CA 4R57A 4AB7A 2R7HA 2GE3A 2ZW7A 2FSRA 1YK3A 1PU9A 4CYQA 4GS4A 1YREA 4B12A 5C88A 4R3LA 2FS5A 3DR6A 3F5BA 2I00A 3EFAA 5F48A 2Z3OA 4CAVA 3EO4A 2P6EA 4QUSA 2YGWA 4CAFA 1P4NA 1IICA 3TCVA 3FIXA 2FCKA 4UWIA 3S6KA 3FB3A 4KS9A 5G1ZA 3ZZIA 1OZPA 5KTAA 1MK4A 2B4DB 4NEXA 2Q7BA 3C26A 4UFWA 5G20A 4Q36A 4AVBA 3IWEA 3I3GA 3CXSA 4UCMA 4YGOA 2O28A 3TFYA 1L0CA 1LRZA 1I21A 2RC4A 4QB9A 4HNYB 2BSWA 4B5OA 2FT0A 3W6SA 4CYNA 1I1DA 3TTHA 1Y7RA 1M4GA 4Y49C 2R98A 4AG9A 5E96A 4A95A 2ARHA 3SXNA 4CGOA 4MFQA 3B8GA 1NE9A 1RO5A 2Z3LA 4KORA 4KVXA 4XPDC 4UCNA 4ORFA 5FVJA 4H6UA 1Y9WA 1PUAA 2JEVA 2BUEA 3TO9A 2G0BA 4EVYA 3NE7A 1QSOA 2Z3NA 4KSAA 1P0HA 2VXKA 4CAXA 3IU2A 4BMHA 2B5GA 4IUSA 5AGEA 3QB8A 4OAEA 3G3SA 2ZW4A 2YNCA 4LX9A 4CYOA 3DDDA 4H89A 1XEBA 2CY2A 4F0XA 2JLMA 4Y49B 1B6BA 4KVOE 2I79A 5IV0A 5F49A 2AJ6A 4KUAA 1S7LA 5J8FA 2ZPAA 4FD4A 2WPXA 2F5IA 4MBUA 1Y9KA 4CGLA 4XPDB 2CNMA 4NCZA 3S6HA 4X5KA 4A2ZA 1XE4A 4KZTA 5AG5A 2OU2A 4KOUA 3EC4A 4MFLA 1Z4RA 3LODA 2EUIA 2Z3MA 4F6AA 1J4JA 3IWGA 4MI4A 2DXQA 3TO6A 2Q0YA 2Z11A 3H4QA 1MJAA 1WWZA 5EBVA 1KZFA 1RXTA 1S7KA 4KOSA 5I0CA 3V8IA 1YLEA 1S5KA 3DSBA 1S3ZA 2VBQA 4MY0A 4C7HA 4RS2A 2REEA 4H6ZA 1N71A 4CRZB 4UFVA 4II9A 2OZHA 3PZJA 5ISVA 4UBRA 3R95A 2HUZA 2C27A 2QECA 3R96A 4BBHA 4B10A 1Z4EA 2JDCA 1M4DA 4ZGYB 1YVKA 2BEIA 3T90A 3GY9A 2VZYA 4CAEA 2B3UA 2WSAA 2Q04A 4MFJA 1MJ9A 4AG7A 2PR8A 4KVME 1MJBA 2Z3KA 2B58A 4MJ8A 3DNSA 3BJ7A 4NSQA 4B11A 1CJWA 2A4NA 3JUWA 4E2AA 5EC4A 1I12A 5DWMA 2VQYA 4QC6A 4B5PA 4KOXA 5AG4A 5F46A 4KOWA 1NSLA 3IU1A 4Q38A 2Y0MA 3R9FA 4U9YA 2PQ8A 1IYLA 3RYOA 3I9SA 5HMNA 1ZO0A 5JPHA 4LUAA 4C68A 3D8PA 4JLYA 5KTDA 4CGNA 2VZZA 1BO4A 2FXFA 3TT2A 4XPKA 1QSTA 3FBUA 4F0YA 1TIQA 2OH1A 5AG7A 5H84A 1S60A 2D4PA 3CXPA 2FIAA 4PK3A 4PSXA 2HV2A 1KUXA 2KCWA 4A31A 4M3SA 2Q4YA 4FD7A 3W91A 2WUUA 2D4OA 1K4JA 3S6FA 4CS0B 4YRHA 3D3SA 3TE4A 3CXQA 4U9ZA 1B87A 2Z0ZA 4C2ZA 3T9YA 4OADA 3TO7A 2YNCC 4JD6A 3JTKA 1M44A 4CGPA 5AG6A 1YX0A 3E0KA 4PV6A 4U5YA 2J8RA 3N7ZA 2OZUA 4PSWA 2YNDA 2Z10A 3A9LA 4M85A 4C7IA 2IL4A 5F47A 2B3VA 2X7BA 2FL4A 2B4BA 4J3GA 4XNHC 4AVCA 2J8NA 2PC1A 1YGHA 4CGMA 3IGRA 5A28A 5CNPA 3PGPA 4UCPA 4CYPA 3TOBA 3ZJ0A 4R9MA 1VKCA 3FXTA 5BWAB 2B4DA 2P6FA 1WK4A 2B5GB 2DPTA 4IF5A 1SQHA 4ZBGA 1Q2YA 4PK2A 2EVNA 3VWDA 4YFJA 2OB0A 3F8KA 2H5MA 1CM0A 4MY3A 4ONUA 4MFZA 4KOTA 3PP9A 3QAHA 3G8WA 4CRYB 2VI7A 4UA3A 1IB1E 2GANA 4XNHB 2Z3PA 4NF1A 5IB0A 5A27A 4FD6A 4XPLA 4CAWA 4NXYA 1Q2CA 3EXNA 3KKWA 2R8VA 2CNSA 4K30A 4DNCA 4HNXB 5G22A 3S6GA 4MFPA 2DPSA 3JVNA 4I49A 1ON0A 2HQYA 2FE7A 4OLLA 5IX3A 1QSRA 2ZW6A 2JDDA 1U6MA 3FYNA 1IYKA 2PSWA 3SHPA 4E8OA 2K5TA 3K9UA 4C2XA 3BJ8A 1IIDA 4KLVA 2WPWA 1UFHA 3EY5A 1Q2DA 1KUVA 1QSMA 2BL1A 2PDOA 3R1KA 4JXRA 2CXAA 4MHDA 3P2HA 4KOVA 3FNCA 2AE6A 1GHEA 2G3TA 4UWJA 1YR0A 2CNTA 1BOBA 5J8CA 2YNEA 4C2YA 4UFXA 5DWNA 4L89A 1XMTA 2ATRA 3F0AA 3GYAA 3H5ZA 1FY7A 4MFKA 3MGDA 4B5PB 2NMTA 3R9EA 3D2PA 4RI1A 3DR8A 4A32A 2VEZA 3VWEA 5JQ4A 2P0WA 2GIVA 4R3KA 4QVTA 5KTCA 1Z9UA 2PR1A 1NMTA 5H86A 2Q44A 3FRMA 2FIWA 3P2FA 4E0AA 3OWCA 2ZXVA 4L8AA 3D2MA 4HKFA 1KUYA 1M4IA 4QBJA 1S7FA 4JXQA 2Q4VA 3BLNA 4KSFA 1QSNA 2R1IA 1R57A 1XF8A 4A30A 2QIRA 4JWPA 2P6GA 1VHSA 1M1DA 2REFA 3LD2A 5GCNA 5C82A 3TOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QML A;  4KUB A;  2OZG A;  4R87 A;  4FD5 A;  2PRB A;  2ZW5 A;  4KOY A;  2J8M A;  4KLW A;  2G3A A;  3SXO A;  1S7N A;  4JJX A;  3R9G A;  3GKR A;  4HNW B;  3W6X A;  1YVO A;  1XIX A;  3UY5 A;  4AVA A;  5HH1 A;  3WR7 A;  1V0C A;  4R57 A;  4AB7 A;  2R7H A;  2GE3 A;  2ZW7 A;  2FSR A;  1YK3 A;  1PU9 A;  4GS4 A;  1YRE A;  5C88 A;  4R3L A;  2FS5 A;  3DR6 A;  3F5B A;  2I00 A;  3EFA A;  5F48 A;  4CAV A;  3EO4 A;  2P6E A;  4QUS A;  1P4N A;  1IIC A;  3TCV A;  3FIX A;  2FCK A;  4UWI A;  3S6K A;  3FB3 A;  3ZZI A;  1OZP A;  5KTA A;  1MK4 A;  2B4D B;  4NEX A;  2Q7B A;  3C26 A;  4AVB A;  3I3G A;  3CXS A;  4YGO A;  3TFY A;  2O28 A;  1L0C A;  1LRZ A;  1I21 A;  2RC4 A;  4QB9 A;  4HNY B;  2BSW A;  4B5O A;  2FT0 A;  3W6S A;  1I1D A;  3TTH A;  1Y7R A;  1M4G A;  4Y49 C;  2R98 A;  4AG9 A;  5E96 A;  2ARH A;  3SXN A;  3B8G A;  1NE9 A;  1RO5 A;  4KOR A;  4KVX A;  4XPD C;  4ORF A;  5FVJ A;  4H6U A;  1Y9W A;  1PUA A;  2JEV A;  2BUE A;  3TO9 A;  2G0B A;  4EVY A;  3NE7 A;  1QSO A;  1P0H A;  2VXK A;  4CAX A;  4BMH A;  2B5G A;  4IUS A;  3QB8 A;  4OAE A;  3G3S A;  2ZW4 A;  4LX9 A;  3DDD A;  4H89 A;  1XEB A;  2CY2 A;  2JLM A;  4Y49 B;  1B6B A;  4KVO E;  2I79 A;  5IV0 A;  5F49 A;  2AJ6 A;  4KUA A;  1S7L A;  5J8F A;  2ZPA A;  4FD4 A;  2WPX A;  2F5I A;  4MBU A;  1Y9K A;  4XPD B;  2CNM A;  4NCZ A;  3S6H A;  4X5K A;  1XE4 A;  4KZT A;  2OU2 A;  4KOU A;  3EC4 A;  1Z4R A;  3LOD A;  2EUI A;  4F6A A;  1J4J A;  3IWG A;  4MI4 A;  2DXQ A;  3TO6 A;  2Q0Y A;  2Z11 A;  3H4Q A;  1MJA A;  1WWZ A;  5EBV A;  1KZF A;  1RXT A;  1S7K A;  4KOS A;  5I0C A;  3V8I A;  1YLE A;  1S5K A;  3DSB A;  1S3Z A;  2VBQ A;  4MY0 A;  4RS2 A;  2REE A;  4H6Z A;  1N71 A;  4CRZ B;  4II9 A;  2OZH A;  3PZJ A;  5ISV A;  4UBR A;  3R95 A;  2HUZ A;  2C27 A;  2QEC A;  3R96 A;  1Z4E A;  2JDC A;  1M4D A;  1YVK A;  2BEI A;  3T90 A;  3GY9 A;  2VZY A;  2B3U A;  2Q04 A;  1MJ9 A;  4AG7 A;  2PR8 A;  4KVM E;  1MJB A;  2B58 A;  4MJ8 A;  3DNS A;  3BJ7 A;  4NSQ A;  1CJW A;  2A4N A;  3JUW A;  4E2A A;  5EC4 A;  1I12 A;  5DWM A;  2VQY A;  4QC6 A;  4B5P A;  4KOX A;  5F46 A;  4KOW A;  1NSL A;  2Y0M A;  3R9F A;  4U9Y A;  2PQ8 A;  1IYL A;  3RYO A;  3I9S A;  5HMN A;  5JPH A;  4LUA A;  3D8P A;  4JLY A;  5KTD A;  2VZZ A;  1BO4 A;  2FXF A;  3TT2 A;  4XPK A;  1QST A;  3FBU A;  4F0Y A;  1TIQ A;  2OH1 A;  5H84 A;  1S60 A;  2D4P A;  3CXP A;  2FIA A;  4PK3 A;  4PSX A;  2HV2 A;  1KUX A;  2KCW A;  4M3S A;  2Q4Y A;  4FD7 A;  3W91 A;  2D4O A;  1K4J A;  3S6F A;  4CS0 B;  4YRH A;  3D3S A;  3TE4 A;  3CXQ A;  4U9Z A;  1B87 A;  2Z0Z A;  3T9Y A;  4OAD A;  3TO7 A;  4JD6 A;  1M44 A;  1YX0 A;  3E0K A;  4PV6 A;  4U5Y A;  2J8R A;  3N7Z A;  2OZU A;  4PSW A;  2Z10 A;  4M85 A;  2IL4 A;  5F47 A;  2B3V A;  2X7B A;  2FL4 A;  2B4B A;  4J3G A;  4XNH C;  4AVC A;  2J8N A;  2PC1 A;  1YGH A;  3IGR A;  5CNP A;  3PGP A;  3TOB A;  3ZJ0 A;  4R9M A;  1VKC A;  3FXT A;  2B4D A;  2P6F A;  1WK4 A;  2B5G B;  4IF5 A;  1SQH A;  4ZBG A;  1Q2Y A;  4PK2 A;  2EVN A;  3VWD A;  4YFJ A;  2OB0 A;  3F8K A;  2H5M A;  1CM0 A;  4MY3 A;  4ONU A;  4KOT A;  3PP9 A;  3QAH A;  3G8W A;  4CRY B;  2VI7 A;  4UA3 A;  1IB1 E;  2GAN A;  4XNH B;  4NF1 A;  5IB0 A;  4FD6 A;  4XPL A;  4CAW A;  4NXY A;  1Q2C A;  3EXN A;  3KKW A;  2R8V A;  2CNS A;  4K30 A;  4DNC A;  4HNX B;  3S6G A;  4I49 A;  3JVN A;  1ON0 A;  2HQY A;  2FE7 A;  4OLL A;  5IX3 A;  1QSR A;  2ZW6 A;  2JDD A;  1U6M A;  3FYN A;  1IYK A;  2PSW A;  3SHP A;  4E8O A;  2K5T A;  3K9U A;  3BJ8 A;  1IID A;  4KLV A;  2WPW A;  1UFH A;  3EY5 A;  1Q2D A;  1KUV A;  1QSM A;  2BL1 A;  2PDO A;  3R1K A;  4JXR A;  4MHD A;  3P2H A;  4KOV A;  3FNC A;  2AE6 A;  1GHE A;  2G3T A;  4UWJ A;  1YR0 A;  2CNT A;  1BOB A;  5J8C A;  5DWN A;  4L89 A;  1XMT A;  2ATR A;  3F0A A;  3GYA A;  1FY7 A;  3MGD A;  4B5P B;  2NMT A;  3R9E A;  3D2P A;  4RI1 A;  3DR8 A;  2VEZ A;  3VWE A;  5JQ4 A;  2P0W A;  2GIV A;  4R3K A;  4QVT A;  5KTC A;  1Z9U A;  2PR1 A;  1NMT A;  5H86 A;  2Q44 A;  3FRM A;  2FIW A;  3P2F A;  4E0A A;  3OWC A;  2ZXV A;  4L8A A;  3D2M A;  4HKF A;  1KUY A;  1M4I A;  4QBJ A;  1S7F A;  4JXQ A;  2Q4V A;  3BLN A;  1QSN A;  2R1I A;  1R57 A;  1XF8 A;  2QIR A;  4JWP A;  2P6G A;  1VHS A;  1M1D A;  2REF A;  3LD2 A;  5GCN A;  5C82 A;  3TOA A; 
#chains in the Genus database with same CATH topology
 2QML A;  4KUB A;  1KWM A;  1AUG A;  1DTD A;  1YW6 A;  4NGQ A;  1XMB A;  2OZG A;  4PPZ A;  2RFH A;  4R87 A;  4FD5 A;  2PRB A;  2ZW5 A;  4KOY A;  2J8M A;  4KLW A;  3B3C A;  4R8F A;  4A33 A;  3KQX A;  2G3A A;  3SXO A;  1S7N A;  5K8P A;  4B14 A;  2GLJ A;  4JJX A;  3R9G A;  3GKR A;  4HNW B;  4MCS A;  4M6H A;  5G21 A;  1TF8 A;  3W6X A;  5LYI A;  1YVO A;  4OP4 A;  4P4D A;  4B13 A;  5HVH A;  1XIX A;  5JH9 A;  3UY5 A;  4AVA A;  5HH1 A;  2FVG A;  2PRQ A;  3WR7 A;  1V0C A;  4R57 A;  4AB7 A;  1IU8 A;  2R7H A;  2GE3 A;  4BD9 A;  2ZW7 A;  2FSR A;  1YK3 A;  1PU9 A;  4CYQ A;  4GS4 A;  1YRE A;  4B12 A;  5C88 A;  4R3L A;  2ABZ A;  2FS5 A;  1HDQ A;  4NGN A;  3WT4 A;  3DR6 A;  3F5B A;  4MCR A;  4O23 A;  2AFX A;  3B3S A;  2AFU A;  2I00 A;  3EFA A;  2Z3O A;  5F48 A;  4CAV A;  3EO4 A;  2P6E A;  4QUS A;  4LQG A;  3KQZ A;  3PBE A;  2YGW A;  2F8H A;  1P4N A;  1IIC A;  1XRY A;  4CAF A;  3TCV A;  4IK2 A;  3FIX A;  2FCK A;  4DYO A;  3FH4 A;  4UWI A;  4FBE A;  3S6K A;  4MRI A;  4PXD A;  3FB3 A;  3BHX A;  2C6C A;  4KS9 A;  5G1Z A;  3ZZI A;  1OZP A;  3D4U A;  4W9Y A;  1MK4 A;  3BI0 A;  5KTA A;  3B3V A;  2B4D B;  1HDU A;  1CX8 A;  4ONW A;  2ANP A;  3JRU A;  4P4I A;  4PXE A;  3PBB A;  5DS0 A;  4NEX A;  2Q7B A;  3C26 A;  4OC3 A;  2V8H A;  4UFW A;  5G20 A;  2OOT A;  3KHX A;  2Q4Z A;  4GXH A;  4LQ6 A;  4Q36 A;  4AVB A;  1VHO A;  3IWE A;  3WC6 A;  3I3G A;  3CXS A;  4UCM A;  4YGO A;  1Q7L A;  2O28 A;  3TFY A;  1L0C A;  3HLP A;  1LRZ A;  1I21 A;  2RC4 A;  4MCP A;  5D29 A;  4QB9 A;  4A38 A;  1VIX A;  1Y7E A;  2I3C A;  3FVL A;  3TX8 A;  4HNY B;  4P44 A;  2C1C A;  2HB6 A;  2BSW A;  4B5O A;  3DGV A;  3PFO A;  4P4B A;  1TF9 A;  2FT0 A;  2QJ8 A;  2ZOF A;  3W6S A;  4A39 A;  2GU2 A;  3B35 A;  2Q51 A;  4ZY2 A;  5IB9 A;  1Z8W A;  2PVW A;  4CYN A;  1I1D A;  3D67 A;  2ZEF A;  1VHE A;  3B3T A;  3NE8 A;  3TTH A;  1Y7R A;  1M4G A;  5HVF A;  4Z65 A;  1YSJ A;  2JEW A;  4Y49 C;  2R98 A;  2AFZ A;  4AG9 A;  1QMU A;  5E96 A;  4A95 A;  2ARH A;  3KL9 A;  3KZW A;  3SXN A;  1FT7 A;  1CBX A;  4CGO A;  4MFQ A;  2EK9 A;  3B8G A;  1NE9 A;  1RO5 A;  2Z3L A;  3QAY A;  4KOR A;  4NGT A;  3IWW A;  4KVX A;  4XPD C;  4UCN A;  8CPA A;  4ORF A;  2CF4 A;  5FVJ A;  1TKH A;  2XEJ A;  2PJA A;  4H6U A;  1UWY A;  1Y9W A;  5K8M A;  3FEC A;  1PUA A;  1ZLI A;  2JEV A;  2BUE A;  3TO9 A;  2G0B A;  1PCA A;  2DF5 A;  4EVY A;  3D68 A;  3NE7 A;  4P45 A;  3FJU A;  1QSO A;  2Z3N A;  3KAS A;  4KSA A;  1P0H A;  2VXK A;  4CAX A;  4HPS A;  1JQG A;  3IU2 A;  4BMH A;  2B5G A;  4FAI A;  2V77 A;  3GLJ A;  2PJ7 A;  4IUS A;  5AGE A;  2GRE A;  3QB8 A;  4RN7 A;  4OAE A;  3G3S A;  3D7F A;  4NGP A;  4ZY1 A;  2NYQ A;  3WAB A;  1XBU A;  2ZW4 A;  3PFE A;  4NJR A;  2YNC A;  4LX9 A;  4CYO A;  3DDD A;  4H89 A;  1XEB A;  1M4L A;  2CY2 A;  1GYT A;  4F0X A;  2JLM A;  3GUX A;  4Y49 B;  1B6B A;  4KVO E;  4R7M A;  2I79 A;  5IV0 A;  3FMC A;  3VAT A;  5F49 A;  2G9D A;  2AJ6 A;  2HC9 A;  4KUA A;  3SJE A;  3RBU A;  1S7L A;  5J8F A;  2ZPA A;  4FD4 A;  2WPX A;  2F5I A;  4MBU A;  1Y9K A;  4CGL A;  4PQA A;  2CNM A;  4NCZ A;  4XPD B;  4X5K A;  3S6H A;  4A2Z A;  1TKJ A;  1XE4 A;  2PJ0 A;  4KZT A;  5AG5 A;  1R43 A;  4R6T A;  4K3N A;  1ZG9 A;  3SI2 A;  3KI9 A;  2QVP A;  2OU2 A;  2WZN A;  4KOU A;  3EC4 A;  4MHN A;  4A37 A;  4ZYQ A;  1F57 A;  4MFL A;  4F9U A;  1Y0R A;  3K9T A;  2PIY A;  3MRU A;  3CZX A;  1Z4R A;  3D66 A;  3LOD A;  4MXU A;  2EUI A;  4NJQ A;  2PJB A;  2Z3M A;  3TC8 A;  4F6A A;  2GLF A;  3CPA A;  2OR4 A;  1J4J A;  1XFO A;  3IWG A;  4P4E A;  1LAP A;  4MI4 A;  4OC0 A;  2DXQ A;  3TO6 A;  1Z8L A;  2Q0Y A;  2Z11 A;  3H4Q A;  4X8I A;  2PCU A;  1MJA A;  1WWZ A;  4NGM A;  5EBV A;  1KZF A;  3IJ3 A;  4AVC A;  1RXT A;  1S7K A;  4KOS A;  5I0C A;  3V8I A;  1YLE A;  1S5K A;  3DSB A;  1S3Z A;  1TKF A;  1Z8X A;  2EO8 A;  1CG2 A;  2IJZ A;  2VBQ A;  2ZEO A;  3D7H A;  4Q7A A;  4MY0 A;  1HEE A;  4C7H A;  1IGB A;  4F9V A;  4RS2 A;  2PJ6 A;  2REE A;  4H6Z A;  1N71 A;  2ZOG A;  4CRZ B;  3PB4 X;  4UFV A;  3BI1 A;  4II9 A;  2EK8 A;  4G1P A;  2OZH A;  2V8V A;  3PZJ A;  5ISV A;  4UBR A;  3R95 A;  2HUZ A;  2AFO A;  2C27 A;  1Z8T A;  2QEC A;  3R96 A;  4BBH A;  4B10 A;  1Z4E A;  2JDC A;  4OME A;  1LFW A;  1M4D A;  4ZGY B;  1YVK A;  1Y0Y A;  1Z2L A;  2BEI A;  3GIU A;  3T90 A;  1BPN A;  2VZY A;  3GY9 A;  2B3U A;  4CAE A;  5HXD A;  2IMO A;  2WSA A;  2Q04 A;  2XEG A;  4MFJ A;  3ISZ A;  1MJ9 A;  4AG7 A;  1DE4 C;  2PR8 A;  4KVM E;  4PXC A;  2PJ1 A;  2CIJ A;  1MJB A;  2Z3K A;  3LMS A;  4F8Z A;  2B58 A;  4MJ8 A;  1X12 A;  3DNS A;  3BJ7 A;  4NSQ A;  4B11 A;  1CJW A;  2A4N A;  1YQE A;  1XJO A;  3FX6 A;  3JUW A;  3RNZ A;  4E2A A;  5EC4 A;  1I12 A;  5DWM A;  1CPX A;  2VQY A;  4QC6 A;  4UEE A;  4OID A;  4B5P A;  4KOX A;  5AG4 A;  5F46 A;  2AFW A;  4KOW A;  1NSL A;  2RB7 A;  3IU1 A;  4M6G A;  4Q38 A;  3NA6 A;  4TWE A;  2XEF A;  3K2K A;  2Y0M A;  3NFZ A;  3R9F A;  4U9Y A;  2PQ8 A;  5LRG A;  1IYL A;  3RYO A;  4CGM A;  3I9S A;  2ZEN A;  1ZO0 A;  5HMN A;  3KR5 A;  4LUA A;  5JPH A;  3IFE A;  4C68 A;  4OC4 A;  3HUV A;  3D8P A;  4JLY A;  5KTD A;  4CGN A;  2VZZ A;  5F09 A;  1BO4 A;  2FXF A;  2GFQ A;  4UEF A;  3TT2 A;  4XPK A;  1QST A;  3FBU A;  4UIA A;  4F0Y A;  1TIQ A;  2OH1 A;  5AG7 A;  2PJ4 A;  5H84 A;  1S60 A;  2D4P A;  4EWT A;  3H8F A;  4IAV A;  3CXP A;  2VL1 A;  2FIA A;  1A2Z A;  4JYW A;  1ARM A;  4PK3 A;  4PSX A;  2HV2 A;  3BXM A;  3RZA A;  1ELL P;  1KUX A;  2KCW A;  3SJF A;  3WC7 A;  3PB9 X;  3SI0 A;  4A31 A;  2C6G A;  2QYV A;  2Q4Y A;  4M3S A;  2BO9 A;  4OC2 A;  2XEI A;  4FD7 A;  4GM5 A;  2WUU A;  3W91 A;  5I4M A;  2D4O A;  3PRT A;  1K4J A;  3S6F A;  2ZEP A;  3D7D A;  3FEE A;  4CS0 B;  2PJ2 A;  4YRH A;  1CPS A;  3D3S A;  3TE4 A;  4RUH A;  3ISX A;  3CXQ A;  3N5F A;  4U9Z A;  5K8O A;  1B87 A;  4YWY A;  2Z0Z A;  5EMI A;  4C2Z A;  3T9Y A;  4OAD A;  3TO7 A;  2YNC C;  1YLO A;  4JD6 A;  4P6Y A;  3JTK A;  1M44 A;  1R3N A;  3SI1 A;  4CGP A;  5AG6 A;  1YX0 A;  2PIZ A;  3SJG A;  3PB7 X;  3E0K A;  2F7V A;  3NH5 A;  3NH4 A;  4PV6 A;  4U5Y A;  2J8R A;  3N7Z A;  2OZU A;  4PSW A;  4UF4 A;  2YND A;  5LYD A;  2Z10 A;  3A9L A;  4M85 A;  4C7I A;  3S9L A;  4A94 A;  4EME A;  1NSA A;  2IL4 A;  5F47 A;  2B3V A;  4P4J A;  4AXV A;  2X7B A;  2FL4 A;  2B4B A;  1X10 A;  2BOA A;  4J3G A;  2J8N A;  2PC1 A;  1YGH A;  3GB0 A;  4OC5 A;  3IGR A;  2JBJ A;  3PB8 X;  5CNP A;  3PGP A;  5A28 A;  4UCP A;  3KR4 A;  4CYP A;  3TOB A;  3ZJ0 A;  4R9M A;  5CPA A;  1H8L A;  5LRK A;  1VKC A;  3FXT A;  4ZY0 A;  5BWA B;  1BLL E;  2B4D A;  2P6F A;  1WK4 A;  2B5G B;  2PJ8 A;  1LAN A;  3H8G A;  3V7Z A;  2DPT A;  4IF5 A;  4ZI6 A;  4M6I A;  5HVG A;  2PJ9 A;  1OBR A;  1SQH A;  4ZBG A;  1Q2Y A;  4PK2 A;  4DUK A;  2EVN A;  3VWD A;  4YFJ A;  2OB0 A;  3F8K A;  4X2T A;  2H5M A;  1VGY A;  1CM0 A;  4MY3 A;  4ONU A;  4MFZ A;  4PXB A;  4OKO A;  4KOT A;  3PP9 A;  4UEZ A;  3QAH A;  3LWU A;  3G8W A;  4CRY B;  2VI7 A;  3QNV A;  2IQ6 A;  5LYF A;  2ODF A;  2J9A A;  4FWU A;  1IOF A;  4UA3 A;  1IB1 E;  2GAN A;  1LAM A;  4XNH B;  2Z3P A;  4NF1 A;  5IB0 A;  5A27 A;  4FD6 A;  4MCQ A;  4XPL A;  4CAW A;  2V8G A;  1Q2C A;  3MN8 A;  4NXY A;  3B3W A;  2ZEG A;  3EXN A;  3KKW A;  2R8V A;  1CP6 A;  2CNS A;  4K30 A;  4DNC A;  3CPX A;  1AYE A;  1F2P A;  4HNX B;  5G22 A;  3S6G A;  4MFP A;  2AFM A;  2DPS A;  3JVN A;  4I49 A;  4XNH C;  2PJ3 A;  1QQ9 A;  1ON0 A;  2HQY A;  2FE7 A;  1XOV A;  3LAC A;  4KSI A;  3FED A;  1IOI A;  4OLL A;  4P10 A;  5D8N A;  5IX3 A;  4OIW A;  1QSR A;  2ZW6 A;  4MHZ A;  2JDD A;  1U6M A;  3FYN A;  2Q7S A;  1IYK A;  4MMO A;  2PSW A;  3SHP A;  4E8O A;  3RAM A;  3L2N A;  1LCP A;  2BCO A;  2K5T A;  3B2Y A;  1RTQ A;  3K9U A;  4ZX9 A;  2V8D A;  4C2X A;  3SJX A;  3KGQ A;  3B7I A;  2Q43 A;  1BPM A;  3BJ8 A;  4IHM A;  2ZED A;  1IID A;  4KLV A;  2WPW A;  1UFH A;  3EY5 A;  3NH8 A;  2CTB A;  1Q2D A;  3RO0 A;  1KUV A;  4FUU A;  1QSM A;  2BL1 A;  3DLJ A;  2PDO A;  1ELM P;  3R1K A;  4JXR A;  2CXA A;  2O53 A;  4MHD A;  4NFR A;  2EBJ A;  3P2H A;  4CPA A;  4KOV A;  3S9N A;  3FNC A;  2G3T A;  2DEA A;  2AE6 A;  1GHE A;  1ZG7 A;  4JZ0 A;  4UWJ A;  6CPA A;  7CPA A;  1YR0 A;  1PYT B;  2ZEE A;  5LYL A;  4WWV A;  4OC1 A;  4DJL A;  5JM6 A;  2CNT A;  1BOB A;  4R76 A;  4NGS A;  3V38 A;  2JBK A;  3IC1 A;  2YNE A;  5ELY A;  5J8C A;  5JGF A;  1BAV A;  2AFS A;  4C2Y A;  4X3R A;  1FNO A;  4UFX A;  4BIN A;  1LOK A;  5DWN A;  5K8N A;  3IIB A;  4L89 A;  2PJC A;  1XMT A;  2ATR A;  4EFD A;  3F0A A;  3GYA A;  3H5Z A;  1FY7 A;  4NGR A;  4MFK A;  3MGD A;  1YW4 A;  4B5P B;  1Z5R A;  2NMT A;  3R9E A;  3D2P A;  1F2O A;  1TXR A;  3DR8 A;  4RI1 A;  2ZEM A;  2O4H A;  2ZEL A;  3T8W A;  1EE3 P;  4A32 A;  3VAR A;  3IEH A;  3KHZ A;  4WJB A;  1YME A;  2VEZ A;  3D7G A;  3IO1 A;  3PB6 X;  3VWE A;  5JQ4 A;  2NSM A;  2P0W A;  2GIV A;  4R3K A;  4QVT A;  5KTC A;  1Z9U A;  2CTC A;  3WC5 A;  2PR1 A;  5CBM A;  2PVV A;  1NMT A;  4MHP A;  5H86 A;  3H8E A;  2Q44 A;  2ZEH A;  3PEI A;  3CT9 A;  4B6Z A;  2PE3 A;  3FRM A;  2FIW A;  3P2F A;  4H2K A;  5THW A;  4E0A A;  1AMP A;  2WYR A;  3OWC A;  3S9M A;  2ZXV A;  4L8A A;  2EWB A;  3D2M A;  1KUY A;  1ZLH A;  4HKF A;  4UIB A;  4ZX8 A;  4YU9 A;  1M4I A;  1IY7 A;  4QBJ A;  1S7F A;  1ZG8 A;  4JXQ A;  2Q4V A;  3BLN A;  1JWQ A;  1CP7 A;  1ARL A;  5J1Q A;  2POK A;  4KSF A;  1QSN A;  2R1I A;  5LRJ A;  1R57 A;  1XF8 A;  4A30 A;  3FF3 A;  2QIR A;  4JWP A;  2P6G A;  3VH9 A;  1VHS A;  1M1D A;  2C6P A;  2REF A;  3CDX A;  3LD2 A;  4P4F A;  3I1U A;  4TNU A;  5GCN A;  4MHY A;  5C82 A;  3TOA A;  2PJ5 A; 
#chains in the Genus database with same CATH homology
 2QML A;  4KUB A;  2OZG A;  4R87 A;  4FD5 A;  2PRB A;  2ZW5 A;  4KOY A;  2J8M A;  4KLW A;  4A33 A;  2G3A A;  3SXO A;  1S7N A;  4B14 A;  4JJX A;  3R9G A;  3GKR A;  4HNW B;  5G21 A;  3W6X A;  4B13 A;  1YVO A;  1XIX A;  3UY5 A;  4AVA A;  5HH1 A;  3WR7 A;  1V0C A;  4R57 A;  4AB7 A;  2R7H A;  2GE3 A;  2ZW7 A;  2FSR A;  1YK3 A;  1PU9 A;  4CYQ A;  4GS4 A;  1YRE A;  4B12 A;  5C88 A;  4R3L A;  2FS5 A;  3DR6 A;  3F5B A;  2I00 A;  3EFA A;  5F48 A;  2Z3O A;  4CAV A;  3EO4 A;  2P6E A;  4QUS A;  2YGW A;  4CAF A;  1P4N A;  1IIC A;  3TCV A;  3FIX A;  2FCK A;  4UWI A;  3S6K A;  3FB3 A;  4KS9 A;  5G1Z A;  3ZZI A;  1OZP A;  5KTA A;  1MK4 A;  2B4D B;  4NEX A;  2Q7B A;  3C26 A;  4UFW A;  5G20 A;  4Q36 A;  4AVB A;  3IWE A;  3I3G A;  3CXS A;  4UCM A;  4YGO A;  2O28 A;  3TFY A;  1L0C A;  1LRZ A;  1I21 A;  2RC4 A;  4QB9 A;  4HNY B;  2BSW A;  4B5O A;  2FT0 A;  3W6S A;  4CYN A;  1I1D A;  3TTH A;  1Y7R A;  1M4G A;  4Y49 C;  2R98 A;  4AG9 A;  5E96 A;  4A95 A;  2ARH A;  3SXN A;  4CGO A;  4MFQ A;  3B8G A;  1NE9 A;  1RO5 A;  2Z3L A;  4KOR A;  4KVX A;  4XPD C;  4UCN A;  4ORF A;  5FVJ A;  4H6U A;  1Y9W A;  1PUA A;  2JEV A;  2BUE A;  3TO9 A;  2G0B A;  4EVY A;  3NE7 A;  1QSO A;  2Z3N A;  4KSA A;  1P0H A;  2VXK A;  4CAX A;  3IU2 A;  4BMH A;  2B5G A;  4IUS A;  5AGE A;  3QB8 A;  4OAE A;  3G3S A;  2ZW4 A;  2YNC A;  4LX9 A;  4CYO A;  3DDD A;  4H89 A;  1XEB A;  2CY2 A;  4F0X A;  2JLM A;  4Y49 B;  1B6B A;  4KVO E;  2I79 A;  5IV0 A;  5F49 A;  2AJ6 A;  4KUA A;  1S7L A;  5J8F A;  2ZPA A;  4FD4 A;  2WPX A;  2F5I A;  4MBU A;  1Y9K A;  4CGL A;  4XPD B;  2CNM A;  4NCZ A;  3S6H A;  4X5K A;  4A2Z A;  1XE4 A;  4KZT A;  5AG5 A;  2OU2 A;  4KOU A;  3EC4 A;  4MFL A;  1Z4R A;  3LOD A;  2EUI A;  2Z3M A;  4F6A A;  1J4J A;  3IWG A;  4MI4 A;  2DXQ A;  3TO6 A;  2Q0Y A;  2Z11 A;  3H4Q A;  1MJA A;  1WWZ A;  5EBV A;  1KZF A;  1RXT A;  1S7K A;  4KOS A;  5I0C A;  3V8I A;  1YLE A;  1S5K A;  3DSB A;  1S3Z A;  2VBQ A;  4MY0 A;  4C7H A;  4RS2 A;  2REE A;  4H6Z A;  1N71 A;  4CRZ B;  4UFV A;  4II9 A;  2OZH A;  3PZJ A;  5ISV A;  4UBR A;  3R95 A;  2HUZ A;  2C27 A;  2QEC A;  3R96 A;  4BBH A;  4B10 A;  1Z4E A;  2JDC A;  1M4D A;  4ZGY B;  1YVK A;  2BEI A;  3T90 A;  3GY9 A;  2VZY A;  4CAE A;  2B3U A;  2WSA A;  2Q04 A;  4MFJ A;  1MJ9 A;  4AG7 A;  2PR8 A;  4KVM E;  1MJB A;  2Z3K A;  2B58 A;  4MJ8 A;  3DNS A;  3BJ7 A;  4NSQ A;  4B11 A;  1CJW A;  2A4N A;  3JUW A;  4E2A A;  5EC4 A;  1I12 A;  5DWM A;  2VQY A;  4QC6 A;  4B5P A;  4KOX A;  5AG4 A;  5F46 A;  4KOW A;  1NSL A;  3IU1 A;  4Q38 A;  2Y0M A;  3R9F A;  4U9Y A;  2PQ8 A;  1IYL A;  3RYO A;  3I9S A;  5HMN A;  1ZO0 A;  5JPH A;  4LUA A;  4C68 A;  3D8P A;  4JLY A;  5KTD A;  4CGN A;  2VZZ A;  1BO4 A;  2FXF A;  3TT2 A;  4XPK A;  1QST A;  3FBU A;  4F0Y A;  1TIQ A;  2OH1 A;  5AG7 A;  5H84 A;  1S60 A;  2D4P A;  3CXP A;  2FIA A;  4PK3 A;  4PSX A;  2HV2 A;  1KUX A;  2KCW A;  4A31 A;  4M3S A;  2Q4Y A;  4FD7 A;  3W91 A;  2WUU A;  2D4O A;  1K4J A;  3S6F A;  4CS0 B;  4YRH A;  3D3S A;  3TE4 A;  3CXQ A;  4U9Z A;  1B87 A;  2Z0Z A;  4C2Z A;  3T9Y A;  4OAD A;  3TO7 A;  2YNC C;  4JD6 A;  3JTK A;  1M44 A;  4CGP A;  5AG6 A;  1YX0 A;  3E0K A;  4PV6 A;  4U5Y A;  2J8R A;  3N7Z A;  2OZU A;  4PSW A;  2YND A;  2Z10 A;  3A9L A;  4M85 A;  4C7I A;  2IL4 A;  5F47 A;  2B3V A;  2X7B A;  2FL4 A;  2B4B A;  4J3G A;  4XNH C;  4AVC A;  2J8N A;  2PC1 A;  1YGH A;  4CGM A;  3IGR A;  5A28 A;  5CNP A;  3PGP A;  4UCP A;  4CYP A;  3TOB A;  3ZJ0 A;  4R9M A;  1VKC A;  3FXT A;  5BWA B;  2B4D A;  2P6F A;  1WK4 A;  2B5G B;  2DPT A;  4IF5 A;  1SQH A;  4ZBG A;  1Q2Y A;  4PK2 A;  2EVN A;  3VWD A;  4YFJ A;  2OB0 A;  3F8K A;  2H5M A;  1CM0 A;  4MY3 A;  4ONU A;  4MFZ A;  4KOT A;  3PP9 A;  3QAH A;  3G8W A;  4CRY B;  2VI7 A;  4UA3 A;  1IB1 E;  2GAN A;  4XNH B;  2Z3P A;  4NF1 A;  5IB0 A;  5A27 A;  4FD6 A;  4XPL A;  4CAW A;  4NXY A;  1Q2C A;  3EXN A;  3KKW A;  2R8V A;  2CNS A;  4K30 A;  4DNC A;  4HNX B;  5G22 A;  3S6G A;  4MFP A;  2DPS A;  3JVN A;  4I49 A;  1ON0 A;  2HQY A;  2FE7 A;  4OLL A;  5IX3 A;  1QSR A;  2ZW6 A;  2JDD A;  1U6M A;  3FYN A;  1IYK A;  2PSW A;  3SHP A;  4E8O A;  2K5T A;  3K9U A;  4C2X A;  3BJ8 A;  1IID A;  4KLV A;  2WPW A;  1UFH A;  3EY5 A;  1Q2D A;  1KUV A;  1QSM A;  2BL1 A;  2PDO A;  3R1K A;  4JXR A;  2CXA A;  4MHD A;  3P2H A;  4KOV A;  3FNC A;  2AE6 A;  1GHE A;  2G3T A;  4UWJ A;  1YR0 A;  2CNT A;  1BOB A;  5J8C A;  2YNE A;  4C2Y A;  4UFX A;  5DWN A;  4L89 A;  1XMT A;  2ATR A;  3F0A A;  3GYA A;  3H5Z A;  1FY7 A;  4MFK A;  3MGD A;  4B5P B;  2NMT A;  3R9E A;  3D2P A;  4RI1 A;  3DR8 A;  4A32 A;  2VEZ A;  3VWE A;  5JQ4 A;  2P0W A;  2GIV A;  4R3K A;  4QVT A;  5KTC A;  1Z9U A;  2PR1 A;  1NMT A;  5H86 A;  2Q44 A;  3FRM A;  2FIW A;  3P2F A;  4E0A A;  3OWC A;  2ZXV A;  4L8A A;  3D2M A;  4HKF A;  1KUY A;  1M4I A;  4QBJ A;  1S7F A;  4JXQ A;  2Q4V A;  3BLN A;  4KSF A;  1QSN A;  2R1I A;  1R57 A;  1XF8 A;  4A30 A;  2QIR A;  4JWP A;  2P6G A;  1VHS A;  1M1D A;  2REF A;  3LD2 A;  5GCN A;  5C82 A;  3TOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...