1S5KA

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
GLVPRGSHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
molecule tags Transferase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s5kA00
3SXOA 3ZZIA 5C88A 1NE9A 2EVNA 4MY0A 5DWMA 2PSWA 5GCNA 1M4DA 3TOAA 3TOBA 1S3ZA 3W6SA 5KTDA 1QSNA 1YVOA 1VHSA 5CNPA 1KUYA 3PZJA 4NXYA 3FNCA 2P6GA 4KZTA 3TT2A 4L89A 3T9YA 1VKCA 2Y0MA 5ISVA 1PU9A 4PSWA 3ZJ0A 4B5OA 1NSLA 2VEZA 4H6UA 5FVJA 5J8CA 2P0WA 2PR8A 3R1KA 4KOTA 1SQHA 4AVBA 1WK4A 3DNSA 4KVOE 4HNYB 2J8RA 2VZZA 2F5IA 3CXSA 1KUVA 2CNSA 4NSQA 2Q0YA 4YFJA 2HQYA 2J8NA 4KOUA 2R7HA 4E2AA 2D4PA 4X5KA 2CY2A 3R9FA 4M3SA 3GKRA 4KLWA 2ARHA 2FIWA 4QB9A 2Q7BA 4U9YA 4OLLA 2B3VA 4I49A 3BJ7A 2QMLA 1Y9KA 2ZPAA 2AJ6A 1MJAA 3LODA 2B4DB 3EO4A 4NEXA 5HH1A 5JQ4A 4B5PB 3SHPA 5E96A 3TO9A 2VZYA 5EBVA 2JDCA 1KZFA 4AVCA 2H5MA 3GYAA 1M4GA 3EXNA 4AG9A 1M4IA 2WPWA 5IX3A 4JJXA 4AB7A 2ZW5A 2C27A 3IGRA 1YK3A 4NCZA 1KUXA 2P6FA 1XEBA 3TCVA 1B6BA 4PV6A 2FS5A 3FBUA 1OZPA 1J4JA 1IIDA 2P6EA 1GHEA 3UY5A 3CXPA 4YGOA 4CAXA 3FXTA 2Q04A 4JD6A 4KLVA 2Z10A 3RYOA 2PC1A 1ON0A 3PP9A 2BSWA 4XPDB 5JPHA 3D2PA 4GS4A 5H84A 4QVTA 2OZGA 4XPDC 2R1IA 4XNHB 2R98A 1WWZA 1YX0A 3TO6A 2B5GB 3LD2A 4XNHC 1P0HA 2EUIA 5F47A 4R57A 1PUAA 4CAWA 4LUAA 1QSTA 4JXQA 4L8AA 3CXQA 3B8GA 1I1DA 5H86A 3JUWA 1I12A 4QUSA 1MK4A 1QSRA 4R3KA 2FL4A 1YGHA 1IICA 1I21A 4QC6A 5F49A 2FXFA 2GANA 1S7NA 4MY3A 2BEIA 1N71A 2JEVA 4R87A 1RO5A 3E0KA 3BJ8A 4ONUA 2ZXVA 4II9A 3W91A 1BO4A 2J8MA 3VWEA 1V0CA 3QB8A 1P4NA 4JXRA 5F48A 4R3LA 5IV0A 1B87A 2NMTA 4CS0B 2I79A 2OU2A 2WPXA 2RC4A 1Q2DA 3KKWA 3H4QA 2CNMA 3GY9A 1QSOA 1M1DA 4PSXA 2K5TA 5EC4A 2PRBA 3PGPA 2GE3A 1XE4A 4XPLA 5IB0A 3EFAA 3T90A 1MJBA 2FE7A 4FD5A 1M44A 2Q4YA 4KOWA 3TO7A 2G3TA 4KVXA 1FY7A 5KTAA 1LRZA 2ATRA 3FB3A 5J8FA 2OH1A 4HKFA 2G3AA 1QSMA 1MJ9A 4MHDA 1UFHA 2B3UA 2B58A 2GIVA 4KUBA 3DSBA 4U9ZA 1Q2CA 1S7FA 4KVME 2KCWA 3FYNA 2DXQA 4OADA 2ZW7A 3N7ZA 4U5YA 2Q4VA 2VQYA 3DR6A 1CM0A 1K4JA 4HNWB 2VI7A 4RS2A 4E8OA 4UBRA 3MGDA 2I00A 4KORA 2PQ8A 5DWNA 4MI4A 4HNXB 3EY5A 2CNTA 1S7LA 2D4OA 2JLMA 4LX9A 4H89A 1S60A 4JWPA 2QIRA 1IB1E 3I9SA 1IYLA 2BUEA 2X7BA 2REFA 2B4DA 3FIXA 4CRZB 4MBUA 4KUAA 2BL1A 2FT0A 4KOSA 4KOXA 4FD6A 4B5PA 5I0CA 1BOBA 2QECA 5HMNA 1TIQA 4YRHA 4F0YA 4ORFA 4PK2A 3K9UA 4IF5A 3TFYA 4H6ZA 3G3SA 3P2HA 4UWIA 2B4BA 4JLYA 4R9MA 3FRMA 3EC4A 3R9EA 1Y7RA 3G8WA 2OB0A 3TE4A 3F5BA 3QAHA 4NF1A 3SXNA 3BLNA 1Z4RA 2FCKA 3C26A 1U6MA 4E0AA 4UA3A 3NE7A 4RI1A 4OAEA 2OZHA 4CRYB 1S5KA 1Q2YA 4UWJA 2HV2A 3P2FA 2FSRA 5F46A 1YLEA 2Z0ZA 4M85A 3DR8A 1L0CA 1XMTA 2FIAA 1NMTA 2IL4A 2REEA 4AVAA 1IYKA 1S7KA 3R9GA 2B5GA 3R95A 4J3GA 3TTHA 4KOVA 2A4NA 5C82A 3D8PA 2PDOA 3R96A 3D2MA 4FD4A 5KTCA 4QBJA 2ZW6A 1XF8A 1YREA 4K30A 3VWDA 4IUSA 4XPKA 2OZUA 4F6AA 4CAVA 3IWGA 3JVNA 1CJWA 4DNCA 3S6KA 2PR1A 1YR0A 3I3GA 3WR7A 1YVKA 2HUZA 2AE6A 2JDDA 4Y49B 3S6GA 3W6XA 3OWCA 4MJ8A 1XIXA 4Y49C 4PK3A 1RXTA 3V8IA 3S6HA 1Z9UA 2R8VA 2ZW4A 1Y9WA 3F8KA 3S6FA 2Q44A 3F0AA 4BMHA 4AG7A 3DDDA 4ZBGA 4FD7A 3D3SA 2O28A 4KOYA 2G0BA 2VBQA 4EVYA 2Z11A 2VXKA 1Z4EA 1R57A
chains in the Genus database with same CATH superfamily
4UF4A 3SXOA 2ANPA 3ZZIA 4CPAA 5C88A 2POKA 1NE9A 2EVNA 2AFZA 1Z2LA 2PJ8A 1Y0YA 4MY0A 3CPAA 5DWMA 2PSWA 1AYEA 4CGNA 5GCNA 1M4DA 5JGFA 4MFPA 3IO1A 3TOAA 1ELLP 1QQ9A 3TOBA 1S3ZA 3W6SA 5KTDA 2YNEA 1QSNA 4TWEA 1YVOA 1VHSA 5LYFA 5CNPA 1KUYA 4MFZA 1JQGA 3K2KA 5K8PA 3PZJA 4NXYA 3PB8X 1IGBA 2P6GA 3FNCA 4KZTA 3TT2A 4L89A 3T9YA 1VKCA 2Y0MA 5ISVA 1PU9A 4PSWA 1TF9A 3ZJ0A 4B5OA 1NSLA 2VEZA 4H6UA 2XEIA 4P4DA 5FVJA 4ZY2A 5J8CA 4WJBA 2PVWA 4O23A 2PJ5A 2P0WA 2PR8A 3R1KA 4KOTA 1SQHA 2PE3A 4AVBA 1WK4A 2HC9A 4A32A 3D7DA 4NGMA 1RTQA 2Q7SA 2BOAA 3DNSA 1Y0RA 4KVOE 3FF3A 2RB7A 2Z3OA 4P4JA 1YW4A 1ZLIA 4HNYB 5AG5A 2GLJA 2J8RA 2VZZA 4M6IA 4UEZA 3B3SA 5HVFA 2F5IA 1JWQA 3B3VA 4MFLA 4P4IA 3CXSA 1KUVA 2CNSA 2C1CA 2Q0YA 4NSQA 4ONWA 2ZENA 4YFJA 2HQYA 4OC2A 4ZYQA 2J8NA 4KOUA 2R7HA 3NE8A 2D4PA 4X5KA 4CYOA 4E2AA 5BWAB 2CY2A 4JZ0A 4M3SA 3R9FA 1IOFA 3GKRA 4KLWA 4NGQA 2ARHA 2FIWA 4QB9A 2Q7BA 4P4EA 3L2NA 4U9YA 4OLLA 1ZG8A 2B3VA 4I49A 2CTBA 3BJ7A 1YSJA 2QMLA 1Y9KA 2ZPAA 2V8GA 2O53A 4UFXA 2Z3LA 2AJ6A 1MJAA 3LODA 4H2KA 2B4DB 4Q36A 4TNUA 4C2XA 4NGNA 2BO9A 4AXVA 4C2YA 3EO4A 4NEXA 1Z8WA 2EK8A 1BAVA 1LCPA 2PCUA 5HH1A 3H5ZA 3PBEA 5JQ4A 3KGQA 1DE4C 1LOKA 4ZY1A 4B5PB 3SHPA 5E96A 1X10A 3TO9A 2PJ3A 4CGMA 4A30A 2VZYA 4PPZA 3NFZA 2JDCA 1KZFA 5EBVA 2H5MA 4AVCA 3GYAA 1M4GA 3D7GA 3EXNA 5HVHA 4AG9A 4OIDA 1M4IA 2WPWA 3FH4A 4R8FA 5IX3A 4JJXA 4AB7A 4OMEA 2C6GA 3KHZA 4C68A 2ZW5A 2Z3NA 3CDXA 4PXCA 1R43A 2C27A 3IGRA 3BXMA 1VHOA 1YK3A 4NCZA 2PJ7A 2GU2A 1YLOA 1H8LA 3HLPA 4MCRA 1KUXA 2V8DA 4BD9A 2P6FA 4PXDA 1XEBA 3PFEA 3TCVA 1B6BA 5AGEA 3BHXA 4PV6A 3LACA 1F2PA 1IU8A 2FS5A 5EMIA 3A9LA 3VATA 3FBUA 2ZOFA 2DF5A 3KQXA 2ODFA 4P45A 1OZPA 4JYWA 1J4JA 2PJCA 3KZWA 4X3RA 1IIDA 2P6EA 1AUGA 1GHEA 3KR5A 3UY5A 3NH4A 4CAFA 3CXPA 3S9LA 4OC5A 4YGOA 4CAXA 3FXTA 2Q04A 4JD6A 2O4HA 2V77A 4OP4A 3RO0A 3GUXA 4KLVA 2Z10A 3RBUA 3FJUA 3RYOA 1IY7A 2PC1A 4B13A 2WSAA 1ON0A 3WC5A 3PP9A 2BSWA 2ZEOA 3S9MA 4XPDB 5JPHA 5D29A 4B11A 3D2PA 4GS4A 2IJZA 5G22A 4FUUA 1ZG9A 3CZXA 5H84A 4QVTA 2PJ9A 2OZGA 4XPDC 2R1IA 4XNHB 4EMEA 1EE3P 5DS0A 2R98A 1WWZA 1HDUA 1YX0A 3TO6A 3B3CA 2B5GB 3LD2A 4UCNA 4XNHC 4FBEA 1VIXA 4KS9A 1P0HA 3PFOA 2YNCC 2EUIA 2FVGA 2AFWA 1ZLHA 1PUAA 4R57A 5F47A 2F7VA 4LUAA 1QSTA 3KL9A 4JXQA 4L8AA 2F8HA 4M6HA 3CXQA 1HDQA 3B8GA 1I1DA 3LMSA 5H86A 3GB0A 2QVPA 4OC3A 3QNVA 2NYQA 5CBMA 3TC8A 3JUWA 1I12A 4QUSA 3SI1A 1MK4A 3PB6X 1QSRA 4R3KA 4CAEA 4MFKA 2AFOA 2FL4A 4UEEA 1A2ZA 2ABZA 1YGHA 1Z5RA 1IICA 2C6CA 2WUUA 2Z3PA 3B3TA 4KSFA 1I21A 4QC6A 4UCPA 5F49A 1HEEA 2FXFA 3IEHA 4K3NA 2GANA 3DGVA 5F09A 4MRIA 1S7NA 2YNDA 4EWTA 4MY3A 3K9TA 2BEIA 1N71A 2JEVA 4R87A 4OIWA 1RO5A 2ZEGA 3E0KA 5A27A 3BJ8A 4ONUA 4PQAA 2ZXVA 4MHNA 4II9A 3PRTA 2ZEDA 3FEDA 1BO4A 2J8MA 3W91A 4F9VA 3JRUA 2VL1A 3NH5A 3VWEA 1V0CA 3QB8A 1P4NA 4JXRA 5AG7A 3PB7X 5F48A 4B10A 4R3LA 2IQ6A 5IV0A 5K8MA 5K8NA 4F8ZA 1B87A 2NMTA 4CS0B 2CIJA 2I79A 2OU2A 2WPXA 2WZNA 2RC4A 3SJXA 1Q2DA 3IFEA 3KKWA 3QAYA 2ZEMA 3H4QA 2CNMA 3GY9A 4LQ6A 2AFMA 3CPXA 4MHPA 1QSOA 1M1DA 5CPAA 4PSXA 1BPNA 3RAMA 4P44A 1CP7A 2K5TA 2PRBA 3PGPA 2GE3A 1XE4A 2WYRA 4XPLA 2EBJA 5EC4A 1XOVA 2EK9A 3SI2A 5IB0A 3EFAA 3T90A 2IMOA 4A2ZA 4CAWA 1MJBA 2FE7A 4FD5A 1TKJA 1M44A 4RUHA 2Q4YA 1ELMP 4KOWA 5HXDA 3TO7A 4Q7AA 2G3TA 4BINA 2YNCA 1FY7A 3KASA 4KVXA 5KTAA 5J1QA 1LRZA 4ZX8A 2ATRA 3FB3A 3H8FA 4FWUA 4MHZA 5J8FA 2OH1A 4HKFA 2G3AA 4CGLA 1QSMA 1MJ9A 3KHXA 1UFHA 1R3NA 2GFQA 2B3UA 4MHDA 4MMOA 2JEWA 1GYTA 2B58A 2GIVA 1F2OA 5LRKA 1FT7A 3KQZA 5LRGA 2PJ6A 3GIUA 4KUBA 3DSBA 4CYNA 4U9ZA 1LANA 1OBRA 2ZEEA 1Q2CA 5ELYA 3SI0A 3SJFA 1S7FA 2AFSA 2XEJA 2KCWA 4KVME 3FYNA 2DXQA 4UIAA 2PJAA 4BBHA 4OADA 2ZW7A 3N7ZA 4U5YA 2DPTA 4B14A 4UCMA 4NGPA 2Q4VA 4Z65A 2VQYA 1CX8A 3DR6A 2PVVA 1CM0A 2AFUA 3PBBA 1K4JA 2V8HA 3D7HA 4IAVA 3RNZA 4HNWB 4Q38A 4CGPA 3WABA 5LYIA 2VI7A 4OC0A 4B6ZA 5LYDA 3S9NA 4RS2A 4GM5A 1BPMA 4E8OA 1TXRA 4UBRA 3MGDA 2I00A 4KORA 2PQ8A 3B3WA 3BI1A 5DWNA 4MI4A 1XRYA 2CF4A 4HNXB 3D66A 4MFJA 3EY5A 2ZEPA 1VGYA 2CNTA 5G1ZA 1F57A 4FAIA 1S7LA 1YQEA 4MHYA 2D4OA 4ZX9A 4KSIA 4YWYA 2JLMA 4LX9A 4MFQA 4W9YA 4UFWA 1ARLA 1AMPA 3IWEA 4H89A 1S60A 4JWPA 4C7HA 2QIRA 4PXEA 1LFWA 1X12A 1NSAA 3H8GA 2YGWA 1IB1E 2C6PA 1IYLA 3GLJA 2BUEA 2X7BA 3I9SA 3IU2A 4NGSA 5D8NA 2REFA 1TKFA 1CBXA 2ZEFA 1XBUA 4MCQA 4A31A 3MRUA 2B4DA 3I1UA 3FIXA 4A95A 4CRZB 1ZO0A 2DEAA 2Z3MA 3PB9X 1YMEA 4OKOA 1CPXA 4CYQA 2AFXA 5LRJA 4MBUA 4KUAA 3KR4A 2BL1A 2FT0A 2ZEHA 3FMCA 4KOSA 4LQGA 2BCOA 1PCAA 4KOXA 4FD6A 4B5PA 1LAMA 3B35A 5I4MA 3IU1A 5I0CA 2QJ8A 1BOBA 2QECA 3FECA 4C7IA 5HMNA 1Z8XA 4WWVA 4NJQA 2GREA 2PJ2A 1TIQA 5JH9A 4YRHA 4P4FA 2PIZA 4F0YA 4ORFA 4YU9A 4PK2A 3JTKA 1KWMA 2EWBA 2PJBA 3K9UA 4IF5A 3V38A 4A94A 4H6ZA 3G3SA 3TFYA 3P2HA 4UWIA 3SJEA 2B4BA 4JLYA 4R9MA 3FRMA 3LWUA 4F0XA 3H8EA 2XEFA 2RFHA 3B7IA 1VHEA 3EC4A 4PXBA 3R9EA 5HVGA 2PJ1A 3T8WA 3D68A 4ZGYB 4DUKA 1Y7RA 3G8WA 1XFOA 3ISXA 4G1PA 6CPAA 2ZOGA 2OB0A 4A38A 3NH8A 3D4UA 3DLJA 3TE4A 3ISZA 3F5BA 1CP6A 4NGRA 3V7ZA 3FVLA 3QAHA 4DYOA 2DPSA 4NF1A 3SXNA 1TF8A 3BLNA 1Z4RA 3HUVA 4R7MA 2FCKA 3NA6A 3BI0A 3C26A 2CTCA 1PYTB 1CG2A 1U6MA 4E0AA 3IJ3A 4UA3A 4IK2A 3NE7A 4RI1A 4OAEA 2OZHA 4CRYB 1QMUA 4P6YA 4B12A 2Z3KA 1S5KA 1Q2YA 4ZY0A 4UWJA 2HV2A 4NJRA 2JBJA 4X2TA 5K8OA 3P2FA 2I3CA 1IOIA 2FSRA 2JBKA 5F46A 3D67A 4A37A 1YLEA 1Z8LA 2Z0ZA 4M85A 3DR8A 4RN7A 5AG4A 3IC1A 5AG6A 2Q4ZA 1UWYA 1L0CA 1XMTA 2FIAA 1NMTA 2IL4A 2REEA 3FX6A 4AVAA 1IYKA 1S7KA 3R9GA 4C2ZA 5G21A 2B5GA 3R95A 1YW6A 4OC4A 3VH9A 3N5FA 8CPAA 2OOTA 4J3GA 5JM6A 4UEFA 3TTHA 4KOVA 2A4NA 5C82A 4KSAA 1LAPA 3D8PA 5LYLA 2Q43A 2PDOA 1Z8TA 5THWA 3R96A 5IB9A 4F9UA 3D2MA 4FD4A 1TKHA 3B2YA 3WC7A 2PRQA 5KTCA 4QBJA 2ZW6A 3D7FA 1XF8A 1YREA 4OC1A 5G20A 4CGOA 4K30A 3VWDA 4IUSA 4XPKA 1Y7EA 2OZUA 4P4BA 2Q51A 4MXUA 1BLLE 4R6TA 4F6AA 4P10A 4MCSA 3RZAA 4CAVA 2PJ0A 3IWGA 2CXAA 3JVNA 1CJWA 2PJ4A 4DNCA 3S6KA 2PR1A 3FEEA 2GLFA 3SJGA 3KI9A 2J9AA 1YR0A 2HB6A 3CT9A 3I3GA 3WR7A 1YVKA 2HUZA 4MCPA 2AE6A 4X8IA 4A33A 2JDDA 2NSMA 4Y49B 3S6GA 1XJOA 1XMBA 3W6XA 1CPSA 3OWCA 7CPAA 4MJ8A 4DJLA 3IIBA 3MN8A 4EFDA 1DTDA 1XIXA 2PIYA 2OR4A 4Y49C 4HPSA 3PB4X 2QYVA 4UIBA 3PEIA 4PK3A 4IHMA 1RXTA 4M6GA 3V8IA 2G9DA 3S6HA 1Z9UA 2R8VA 2ZW4A 2ZELA 1Y9WA 4R76A 3VARA 1ZG7A 3F8KA 3S6FA 2Q44A 3IWWA 2EO8A 3F0AA 3WT4A 4CYPA 4BMHA 4AG7A 1FNOA 3DDDA 4ZI6A 4A39A 4ZBGA 4NFRA 4FD7A 3D3SA 1M4LA 2O28A 2G0BA 2VBQA 1Q7LA 1ARMA 4KOYA 4EVYA 4UFVA 3TX8A 5A28A 2V8VA 4NGTA 2Z11A 2VXKA 3WC6A 1Z4EA 2XEGA 1R57A 4GXHA
chains in the Genus database with same CATH topology
3SXOA 3ZZIA 5C88A 1NE9A 2EVNA 4MY0A 5DWMA 2PSWA 4CGNA 5GCNA 1M4DA 4MFPA 3TOAA 3TOBA 1S3ZA 3W6SA 5KTDA 2YNEA 1QSNA 1YVOA 1VHSA 5CNPA 1KUYA 4MFZA 3PZJA 4NXYA 3FNCA 2P6GA 4KZTA 3TT2A 4L89A 3T9YA 1VKCA 2Y0MA 5ISVA 1PU9A 4PSWA 3ZJ0A 4B5OA 1NSLA 2VEZA 4H6UA 5FVJA 5J8CA 2P0WA 2PR8A 3R1KA 4KOTA 1SQHA 4AVBA 1WK4A 4A32A 3DNSA 4KVOE 2Z3OA 4HNYB 5AG5A 2J8RA 2VZZA 2F5IA 4MFLA 3CXSA 1KUVA 2CNSA 4NSQA 2Q0YA 4YFJA 2HQYA 2J8NA 4KOUA 2R7HA 4E2AA 2D4PA 4X5KA 4CYOA 5BWAB 2CY2A 3R9FA 4M3SA 3GKRA 4KLWA 2ARHA 2FIWA 4QB9A 2Q7BA 4U9YA 4OLLA 2B3VA 4I49A 3BJ7A 2QMLA 1Y9KA 2ZPAA 4UFXA 2Z3LA 2AJ6A 1MJAA 3LODA 4Q36A 2B4DB 4C2XA 4C2YA 3EO4A 4NEXA 5HH1A 3H5ZA 5JQ4A 4B5PB 3SHPA 5E96A 3TO9A 4CGMA 4A30A 2VZYA 5EBVA 2JDCA 1KZFA 4AVCA 2H5MA 3GYAA 1M4GA 3EXNA 4AG9A 1M4IA 2WPWA 5IX3A 4JJXA 4AB7A 4C68A 2ZW5A 2Z3NA 2C27A 3IGRA 1YK3A 4NCZA 1KUXA 2P6FA 1XEBA 3TCVA 1B6BA 5AGEA 4PV6A 2FS5A 3A9LA 3FBUA 1OZPA 1J4JA 1IIDA 2P6EA 1GHEA 3UY5A 4CAFA 3CXPA 4YGOA 4CAXA 3FXTA 2Q04A 4JD6A 4KLVA 2Z10A 3RYOA 4B13A 2PC1A 2WSAA 1ON0A 3PP9A 2BSWA 4XPDB 5JPHA 4B11A 3D2PA 4GS4A 5G22A 5H84A 4QVTA 2OZGA 4XPDC 2R1IA 4XNHB 2R98A 1WWZA 1YX0A 3TO6A 2B5GB 3LD2A 4UCNA 4XNHC 4KS9A 1P0HA 2YNCC 2EUIA 5F47A 4R57A 1PUAA 4CAWA 4LUAA 1QSTA 4JXQA 4L8AA 3CXQA 3B8GA 1I1DA 5H86A 3JUWA 1I12A 4QUSA 1MK4A 1QSRA 4R3KA 4CAEA 4MFKA 2FL4A 1YGHA 1IICA 4KSFA 2WUUA 2Z3PA 1I21A 4QC6A 4UCPA 5F49A 2FXFA 2GANA 1S7NA 2YNDA 4MY3A 2BEIA 1N71A 2JEVA 4R87A 1RO5A 3E0KA 3BJ8A 4ONUA 2ZXVA 4II9A 3W91A 1BO4A 2J8MA 3VWEA 1V0CA 3QB8A 1P4NA 4JXRA 5AG7A 5F48A 4B10A 4R3LA 5IV0A 1B87A 2NMTA 4CS0B 2I79A 2OU2A 2WPXA 2RC4A 1Q2DA 3KKWA 3H4QA 2CNMA 3GY9A 1QSOA 1M1DA 4PSXA 2K5TA 5EC4A 2PRBA 3PGPA 2GE3A 1XE4A 4XPLA 5A27A 5IB0A 3EFAA 3T90A 4A2ZA 1MJBA 2FE7A 4FD5A 1M44A 2Q4YA 4KOWA 3TO7A 2G3TA 2YNCA 1FY7A 4KVXA 5KTAA 1LRZA 2ATRA 3FB3A 5J8FA 2OH1A 4HKFA 2G3AA 4CGLA 1QSMA 1MJ9A 4MHDA 1UFHA 2B3UA 2B58A 2GIVA 4KUBA 3DSBA 4CYNA 4U9ZA 1Q2CA 1S7FA 4KVME 2KCWA 3FYNA 2DXQA 4BBHA 4OADA 2ZW7A 3N7ZA 4U5YA 2DPTA 4B14A 4UCMA 2Q4VA 2VQYA 3DR6A 1CM0A 1K4JA 4HNWB 4Q38A 4CGPA 2VI7A 4RS2A 4E8OA 4UBRA 3MGDA 2I00A 4KORA 2PQ8A 5DWNA 4MI4A 4HNXB 4MFJA 3EY5A 2CNTA 5G1ZA 1S7LA 2D4OA 2JLMA 4LX9A 4MFQA 4UFWA 4H89A 3IWEA 1S60A 4JWPA 4C7HA 2QIRA 2YGWA 1IB1E 3I9SA 1IYLA 3IU2A 2BUEA 2X7BA 2REFA 4A31A 2B4DA 3FIXA 4A95A 4CRZB 1ZO0A 2Z3MA 4CYQA 4MBUA 4KUAA 2BL1A 2FT0A 4KOSA 4KOXA 4FD6A 4B5PA 3IU1A 5I0CA 1BOBA 2QECA 4C7IA 5HMNA 1TIQA 4YRHA 4F0YA 4ORFA 4PK2A 3JTKA 3K9UA 4IF5A 3TFYA 4H6ZA 3G3SA 3P2HA 4UWIA 2B4BA 4JLYA 4R9MA 3FRMA 4F0XA 3EC4A 3R9EA 4ZGYB 1Y7RA 3G8WA 2OB0A 3TE4A 3F5BA 3QAHA 2DPSA 4NF1A 3SXNA 3BLNA 1Z4RA 2FCKA 3C26A 1U6MA 4E0AA 4UA3A 3NE7A 4RI1A 4OAEA 2OZHA 4CRYB 4B12A 2Z3KA 1S5KA 1Q2YA 4UWJA 2HV2A 3P2FA 2FSRA 5F46A 1YLEA 2Z0ZA 4M85A 3DR8A 5AG4A 5AG6A 1L0CA 1XMTA 2FIAA 1NMTA 2IL4A 2REEA 4AVAA 1IYKA 1S7KA 3R9GA 4C2ZA 5G21A 2B5GA 3R95A 4J3GA 3TTHA 4KOVA 2A4NA 5C82A 4KSAA 3D8PA 2PDOA 3R96A 3D2MA 4FD4A 5KTCA 4QBJA 2ZW6A 1XF8A 1YREA 5G20A 4CGOA 4K30A 3VWDA 4IUSA 4XPKA 2OZUA 4F6AA 4CAVA 3IWGA 2CXAA 3JVNA 1CJWA 4DNCA 3S6KA 2PR1A 1YR0A 3I3GA 3WR7A 1YVKA 2HUZA 2AE6A 4A33A 2JDDA 4Y49B 3S6GA 3W6XA 3OWCA 4MJ8A 1XIXA 4Y49C 4PK3A 1RXTA 3V8IA 3S6HA 1Z9UA 2R8VA 2ZW4A 1Y9WA 3F8KA 3S6FA 2Q44A 3F0AA 4CYPA 4BMHA 4AG7A 3DDDA 4ZBGA 4FD7A 3D3SA 2O28A 4KOYA 2G0BA 2VBQA 4EVYA 4UFVA 5A28A 2Z11A 2VXKA 1Z4EA 1R57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXO A;  3ZZI A;  5C88 A;  1NE9 A;  2EVN A;  4MY0 A;  5DWM A;  2PSW A;  5GCN A;  1M4D A;  3TOA A;  3TOB A;  1S3Z A;  3W6S A;  5KTD A;  1QSN A;  1YVO A;  1VHS A;  5CNP A;  1KUY A;  3PZJ A;  4NXY A;  3FNC A;  2P6G A;  4KZT A;  3TT2 A;  4L89 A;  3T9Y A;  1VKC A;  2Y0M A;  5ISV A;  1PU9 A;  4PSW A;  3ZJ0 A;  4B5O A;  1NSL A;  2VEZ A;  4H6U A;  5FVJ A;  5J8C A;  2P0W A;  2PR8 A;  3R1K A;  4KOT A;  1SQH A;  4AVB A;  1WK4 A;  3DNS A;  4KVO E;  4HNY B;  2J8R A;  2VZZ A;  2F5I A;  3CXS A;  1KUV A;  2CNS A;  4NSQ A;  2Q0Y A;  4YFJ A;  2HQY A;  2J8N A;  4KOU A;  2R7H A;  4E2A A;  2D4P A;  4X5K A;  2CY2 A;  3R9F A;  4M3S A;  3GKR A;  4KLW A;  2ARH A;  2FIW A;  4QB9 A;  2Q7B A;  4U9Y A;  4OLL A;  2B3V A;  4I49 A;  3BJ7 A;  2QML A;  1Y9K A;  2ZPA A;  2AJ6 A;  1MJA A;  3LOD A;  2B4D B;  3EO4 A;  4NEX A;  5HH1 A;  5JQ4 A;  4B5P B;  3SHP A;  5E96 A;  3TO9 A;  2VZY A;  5EBV A;  2JDC A;  1KZF A;  4AVC A;  2H5M A;  3GYA A;  1M4G A;  3EXN A;  4AG9 A;  1M4I A;  2WPW A;  5IX3 A;  4JJX A;  4AB7 A;  2ZW5 A;  2C27 A;  3IGR A;  1YK3 A;  4NCZ A;  1KUX A;  2P6F A;  1XEB A;  3TCV A;  1B6B A;  4PV6 A;  2FS5 A;  3FBU A;  1OZP A;  1J4J A;  1IID A;  2P6E A;  1GHE A;  3UY5 A;  3CXP A;  4YGO A;  4CAX A;  3FXT A;  2Q04 A;  4JD6 A;  4KLV A;  2Z10 A;  3RYO A;  2PC1 A;  1ON0 A;  3PP9 A;  2BSW A;  4XPD B;  5JPH A;  3D2P A;  4GS4 A;  5H84 A;  4QVT A;  2OZG A;  4XPD C;  2R1I A;  4XNH B;  2R98 A;  1WWZ A;  1YX0 A;  3TO6 A;  2B5G B;  3LD2 A;  4XNH C;  1P0H A;  2EUI A;  5F47 A;  4R57 A;  1PUA A;  4CAW A;  4LUA A;  1QST A;  4JXQ A;  4L8A A;  3CXQ A;  3B8G A;  1I1D A;  5H86 A;  3JUW A;  1I12 A;  4QUS A;  1MK4 A;  1QSR A;  4R3K A;  2FL4 A;  1YGH A;  1IIC A;  1I21 A;  4QC6 A;  5F49 A;  2FXF A;  2GAN A;  1S7N A;  4MY3 A;  2BEI A;  1N71 A;  2JEV A;  4R87 A;  1RO5 A;  3E0K A;  3BJ8 A;  4ONU A;  2ZXV A;  4II9 A;  3W91 A;  1BO4 A;  2J8M A;  3VWE A;  1V0C A;  3QB8 A;  1P4N A;  4JXR A;  5F48 A;  4R3L A;  5IV0 A;  1B87 A;  2NMT A;  4CS0 B;  2I79 A;  2OU2 A;  2WPX A;  2RC4 A;  1Q2D A;  3KKW A;  3H4Q A;  2CNM A;  3GY9 A;  1QSO A;  1M1D A;  4PSX A;  2K5T A;  5EC4 A;  2PRB A;  3PGP A;  2GE3 A;  1XE4 A;  4XPL A;  5IB0 A;  3EFA A;  3T90 A;  1MJB A;  2FE7 A;  4FD5 A;  1M44 A;  2Q4Y A;  4KOW A;  3TO7 A;  2G3T A;  4KVX A;  1FY7 A;  5KTA A;  1LRZ A;  2ATR A;  3FB3 A;  5J8F A;  2OH1 A;  4HKF A;  2G3A A;  1QSM A;  1MJ9 A;  4MHD A;  1UFH A;  2B3U A;  2B58 A;  2GIV A;  4KUB A;  3DSB A;  4U9Z A;  1Q2C A;  1S7F A;  4KVM E;  2KCW A;  3FYN A;  2DXQ A;  4OAD A;  2ZW7 A;  3N7Z A;  4U5Y A;  2Q4V A;  2VQY A;  3DR6 A;  1CM0 A;  1K4J A;  4HNW B;  2VI7 A;  4RS2 A;  4E8O A;  4UBR A;  3MGD A;  2I00 A;  4KOR A;  2PQ8 A;  5DWN A;  4MI4 A;  4HNX B;  3EY5 A;  2CNT A;  1S7L A;  2D4O A;  2JLM A;  4LX9 A;  4H89 A;  1S60 A;  4JWP A;  2QIR A;  1IB1 E;  3I9S A;  1IYL A;  2BUE A;  2X7B A;  2REF A;  2B4D A;  3FIX A;  4CRZ B;  4MBU A;  4KUA A;  2BL1 A;  2FT0 A;  4KOS A;  4KOX A;  4FD6 A;  4B5P A;  5I0C A;  1BOB A;  2QEC A;  5HMN A;  1TIQ A;  4YRH A;  4F0Y A;  4ORF A;  4PK2 A;  3K9U A;  4IF5 A;  3TFY A;  4H6Z A;  3G3S A;  3P2H A;  4UWI A;  2B4B A;  4JLY A;  4R9M A;  3FRM A;  3EC4 A;  3R9E A;  1Y7R A;  3G8W A;  2OB0 A;  3TE4 A;  3F5B A;  3QAH A;  4NF1 A;  3SXN A;  3BLN A;  1Z4R A;  2FCK A;  3C26 A;  1U6M A;  4E0A A;  4UA3 A;  3NE7 A;  4RI1 A;  4OAE A;  2OZH A;  4CRY B;  1S5K A;  1Q2Y A;  4UWJ A;  2HV2 A;  3P2F A;  2FSR A;  5F46 A;  1YLE A;  2Z0Z A;  4M85 A;  3DR8 A;  1L0C A;  1XMT A;  2FIA A;  1NMT A;  2IL4 A;  2REE A;  4AVA A;  1IYK A;  1S7K A;  3R9G A;  2B5G A;  3R95 A;  4J3G A;  3TTH A;  4KOV A;  2A4N A;  5C82 A;  3D8P A;  2PDO A;  3R96 A;  3D2M A;  4FD4 A;  5KTC A;  4QBJ A;  2ZW6 A;  1XF8 A;  1YRE A;  4K30 A;  3VWD A;  4IUS A;  4XPK A;  2OZU A;  4F6A A;  4CAV A;  3IWG A;  3JVN A;  1CJW A;  4DNC A;  3S6K A;  2PR1 A;  1YR0 A;  3I3G A;  3WR7 A;  1YVK A;  2HUZ A;  2AE6 A;  2JDD A;  4Y49 B;  3S6G A;  3W6X A;  3OWC A;  4MJ8 A;  1XIX A;  4Y49 C;  4PK3 A;  1RXT A;  3V8I A;  3S6H A;  1Z9U A;  2R8V A;  2ZW4 A;  1Y9W A;  3F8K A;  3S6F A;  2Q44 A;  3F0A A;  4BMH A;  4AG7 A;  3DDD A;  4ZBG A;  4FD7 A;  3D3S A;  2O28 A;  4KOY A;  2G0B A;  2VBQ A;  4EVY A;  2Z11 A;  2VXK A;  1Z4E A;  1R57 A; 
#chains in the Genus database with same CATH topology
 4UF4 A;  3SXO A;  2ANP A;  3ZZI A;  4CPA A;  5C88 A;  2POK A;  1NE9 A;  2EVN A;  2AFZ A;  1Z2L A;  2PJ8 A;  1Y0Y A;  4MY0 A;  3CPA A;  5DWM A;  2PSW A;  1AYE A;  4CGN A;  5GCN A;  1M4D A;  5JGF A;  4MFP A;  3IO1 A;  3TOA A;  1ELL P;  1QQ9 A;  3TOB A;  1S3Z A;  3W6S A;  5KTD A;  2YNE A;  1QSN A;  4TWE A;  1YVO A;  1VHS A;  5LYF A;  5CNP A;  1KUY A;  4MFZ A;  1JQG A;  3K2K A;  5K8P A;  3PZJ A;  4NXY A;  3PB8 X;  1IGB A;  2P6G A;  3FNC A;  4KZT A;  3TT2 A;  4L89 A;  3T9Y A;  1VKC A;  2Y0M A;  5ISV A;  1PU9 A;  4PSW A;  1TF9 A;  3ZJ0 A;  4B5O A;  1NSL A;  2VEZ A;  4H6U A;  2XEI A;  4P4D A;  5FVJ A;  4ZY2 A;  5J8C A;  4WJB A;  2PVW A;  4O23 A;  2PJ5 A;  2P0W A;  2PR8 A;  3R1K A;  4KOT A;  1SQH A;  2PE3 A;  4AVB A;  1WK4 A;  2HC9 A;  4A32 A;  3D7D A;  4NGM A;  1RTQ A;  2Q7S A;  2BOA A;  3DNS A;  1Y0R A;  4KVO E;  3FF3 A;  2RB7 A;  2Z3O A;  4P4J A;  1YW4 A;  1ZLI A;  4HNY B;  5AG5 A;  2GLJ A;  2J8R A;  2VZZ A;  4M6I A;  4UEZ A;  3B3S A;  5HVF A;  2F5I A;  1JWQ A;  3B3V A;  4MFL A;  4P4I A;  3CXS A;  1KUV A;  2CNS A;  2C1C A;  2Q0Y A;  4NSQ A;  4ONW A;  2ZEN A;  4YFJ A;  2HQY A;  4OC2 A;  4ZYQ A;  2J8N A;  4KOU A;  2R7H A;  3NE8 A;  2D4P A;  4X5K A;  4CYO A;  4E2A A;  5BWA B;  2CY2 A;  4JZ0 A;  4M3S A;  3R9F A;  1IOF A;  3GKR A;  4KLW A;  4NGQ A;  2ARH A;  2FIW A;  4QB9 A;  2Q7B A;  4P4E A;  3L2N A;  4U9Y A;  4OLL A;  1ZG8 A;  2B3V A;  4I49 A;  2CTB A;  3BJ7 A;  1YSJ A;  2QML A;  1Y9K A;  2ZPA A;  2V8G A;  2O53 A;  4UFX A;  2Z3L A;  2AJ6 A;  1MJA A;  3LOD A;  4H2K A;  2B4D B;  4Q36 A;  4TNU A;  4C2X A;  4NGN A;  2BO9 A;  4AXV A;  4C2Y A;  3EO4 A;  4NEX A;  1Z8W A;  2EK8 A;  1BAV A;  1LCP A;  2PCU A;  5HH1 A;  3H5Z A;  3PBE A;  5JQ4 A;  3KGQ A;  1DE4 C;  1LOK A;  4ZY1 A;  4B5P B;  3SHP A;  5E96 A;  1X10 A;  3TO9 A;  2PJ3 A;  4CGM A;  4A30 A;  2VZY A;  4PPZ A;  3NFZ A;  2JDC A;  1KZF A;  5EBV A;  2H5M A;  4AVC A;  3GYA A;  1M4G A;  3D7G A;  3EXN A;  5HVH A;  4AG9 A;  4OID A;  1M4I A;  2WPW A;  3FH4 A;  4R8F A;  5IX3 A;  4JJX A;  4AB7 A;  4OME A;  2C6G A;  3KHZ A;  4C68 A;  2ZW5 A;  2Z3N A;  3CDX A;  4PXC A;  1R43 A;  2C27 A;  3IGR A;  3BXM A;  1VHO A;  1YK3 A;  4NCZ A;  2PJ7 A;  2GU2 A;  1YLO A;  1H8L A;  3HLP A;  4MCR A;  1KUX A;  2V8D A;  4BD9 A;  2P6F A;  4PXD A;  1XEB A;  3PFE A;  3TCV A;  1B6B A;  5AGE A;  3BHX A;  4PV6 A;  3LAC A;  1F2P A;  1IU8 A;  2FS5 A;  5EMI A;  3A9L A;  3VAT A;  3FBU A;  2ZOF A;  2DF5 A;  3KQX A;  2ODF A;  4P45 A;  1OZP A;  4JYW A;  1J4J A;  2PJC A;  3KZW A;  4X3R A;  1IID A;  2P6E A;  1AUG A;  1GHE A;  3KR5 A;  3UY5 A;  3NH4 A;  4CAF A;  3CXP A;  3S9L A;  4OC5 A;  4YGO A;  4CAX A;  3FXT A;  2Q04 A;  4JD6 A;  2O4H A;  2V77 A;  4OP4 A;  3RO0 A;  3GUX A;  4KLV A;  2Z10 A;  3RBU A;  3FJU A;  3RYO A;  1IY7 A;  2PC1 A;  4B13 A;  2WSA A;  1ON0 A;  3WC5 A;  3PP9 A;  2BSW A;  2ZEO A;  3S9M A;  4XPD B;  5JPH A;  5D29 A;  4B11 A;  3D2P A;  4GS4 A;  2IJZ A;  5G22 A;  4FUU A;  1ZG9 A;  3CZX A;  5H84 A;  4QVT A;  2PJ9 A;  2OZG A;  4XPD C;  2R1I A;  4XNH B;  4EME A;  1EE3 P;  5DS0 A;  2R98 A;  1WWZ A;  1HDU A;  1YX0 A;  3TO6 A;  3B3C A;  2B5G B;  3LD2 A;  4UCN A;  4XNH C;  4FBE A;  1VIX A;  4KS9 A;  1P0H A;  3PFO A;  2YNC C;  2EUI A;  2FVG A;  2AFW A;  1ZLH A;  1PUA A;  4R57 A;  5F47 A;  2F7V A;  4LUA A;  1QST A;  3KL9 A;  4JXQ A;  4L8A A;  2F8H A;  4M6H A;  3CXQ A;  1HDQ A;  3B8G A;  1I1D A;  3LMS A;  5H86 A;  3GB0 A;  2QVP A;  4OC3 A;  3QNV A;  2NYQ A;  5CBM A;  3TC8 A;  3JUW A;  1I12 A;  4QUS A;  3SI1 A;  1MK4 A;  3PB6 X;  1QSR A;  4R3K A;  4CAE A;  4MFK A;  2AFO A;  2FL4 A;  4UEE A;  1A2Z A;  2ABZ A;  1YGH A;  1Z5R A;  1IIC A;  2C6C A;  2WUU A;  2Z3P A;  3B3T A;  4KSF A;  1I21 A;  4QC6 A;  4UCP A;  5F49 A;  1HEE A;  2FXF A;  3IEH A;  4K3N A;  2GAN A;  3DGV A;  5F09 A;  4MRI A;  1S7N A;  2YND A;  4EWT A;  4MY3 A;  3K9T A;  2BEI A;  1N71 A;  2JEV A;  4R87 A;  4OIW A;  1RO5 A;  2ZEG A;  3E0K A;  5A27 A;  3BJ8 A;  4ONU A;  4PQA A;  2ZXV A;  4MHN A;  4II9 A;  3PRT A;  2ZED A;  3FED A;  1BO4 A;  2J8M A;  3W91 A;  4F9V A;  3JRU A;  2VL1 A;  3NH5 A;  3VWE A;  1V0C A;  3QB8 A;  1P4N A;  4JXR A;  5AG7 A;  3PB7 X;  5F48 A;  4B10 A;  4R3L A;  2IQ6 A;  5IV0 A;  5K8M A;  5K8N A;  4F8Z A;  1B87 A;  2NMT A;  4CS0 B;  2CIJ A;  2I79 A;  2OU2 A;  2WPX A;  2WZN A;  2RC4 A;  3SJX A;  1Q2D A;  3IFE A;  3KKW A;  3QAY A;  2ZEM A;  3H4Q A;  2CNM A;  3GY9 A;  4LQ6 A;  2AFM A;  3CPX A;  4MHP A;  1QSO A;  1M1D A;  5CPA A;  4PSX A;  1BPN A;  3RAM A;  4P44 A;  1CP7 A;  2K5T A;  2PRB A;  3PGP A;  2GE3 A;  1XE4 A;  2WYR A;  4XPL A;  2EBJ A;  5EC4 A;  1XOV A;  2EK9 A;  3SI2 A;  5IB0 A;  3EFA A;  3T90 A;  2IMO A;  4A2Z A;  4CAW A;  1MJB A;  2FE7 A;  4FD5 A;  1TKJ A;  1M44 A;  4RUH A;  2Q4Y A;  1ELM P;  4KOW A;  5HXD A;  3TO7 A;  4Q7A A;  2G3T A;  4BIN A;  2YNC A;  1FY7 A;  3KAS A;  4KVX A;  5KTA A;  5J1Q A;  1LRZ A;  4ZX8 A;  2ATR A;  3FB3 A;  3H8F A;  4FWU A;  4MHZ A;  5J8F A;  2OH1 A;  4HKF A;  2G3A A;  4CGL A;  1QSM A;  1MJ9 A;  3KHX A;  1UFH A;  1R3N A;  2GFQ A;  2B3U A;  4MHD A;  4MMO A;  2JEW A;  1GYT A;  2B58 A;  2GIV A;  1F2O A;  5LRK A;  1FT7 A;  3KQZ A;  5LRG A;  2PJ6 A;  3GIU A;  4KUB A;  3DSB A;  4CYN A;  4U9Z A;  1LAN A;  1OBR A;  2ZEE A;  1Q2C A;  5ELY A;  3SI0 A;  3SJF A;  1S7F A;  2AFS A;  2XEJ A;  2KCW A;  4KVM E;  3FYN A;  2DXQ A;  4UIA A;  2PJA A;  4BBH A;  4OAD A;  2ZW7 A;  3N7Z A;  4U5Y A;  2DPT A;  4B14 A;  4UCM A;  4NGP A;  2Q4V A;  4Z65 A;  2VQY A;  1CX8 A;  3DR6 A;  2PVV A;  1CM0 A;  2AFU A;  3PBB A;  1K4J A;  2V8H A;  3D7H A;  4IAV A;  3RNZ A;  4HNW B;  4Q38 A;  4CGP A;  3WAB A;  5LYI A;  2VI7 A;  4OC0 A;  4B6Z A;  5LYD A;  3S9N A;  4RS2 A;  4GM5 A;  1BPM A;  4E8O A;  1TXR A;  4UBR A;  3MGD A;  2I00 A;  4KOR A;  2PQ8 A;  3B3W A;  3BI1 A;  5DWN A;  4MI4 A;  1XRY A;  2CF4 A;  4HNX B;  3D66 A;  4MFJ A;  3EY5 A;  2ZEP A;  1VGY A;  2CNT A;  5G1Z A;  1F57 A;  4FAI A;  1S7L A;  1YQE A;  4MHY A;  2D4O A;  4ZX9 A;  4KSI A;  4YWY A;  2JLM A;  4LX9 A;  4MFQ A;  4W9Y A;  4UFW A;  1ARL A;  1AMP A;  3IWE A;  4H89 A;  1S60 A;  4JWP A;  4C7H A;  2QIR A;  4PXE A;  1LFW A;  1X12 A;  1NSA A;  3H8G A;  2YGW A;  1IB1 E;  2C6P A;  1IYL A;  3GLJ A;  2BUE A;  2X7B A;  3I9S A;  3IU2 A;  4NGS A;  5D8N A;  2REF A;  1TKF A;  1CBX A;  2ZEF A;  1XBU A;  4MCQ A;  4A31 A;  3MRU A;  2B4D A;  3I1U A;  3FIX A;  4A95 A;  4CRZ B;  1ZO0 A;  2DEA A;  2Z3M A;  3PB9 X;  1YME A;  4OKO A;  1CPX A;  4CYQ A;  2AFX A;  5LRJ A;  4MBU A;  4KUA A;  3KR4 A;  2BL1 A;  2FT0 A;  2ZEH A;  3FMC A;  4KOS A;  4LQG A;  2BCO A;  1PCA A;  4KOX A;  4FD6 A;  4B5P A;  1LAM A;  3B35 A;  5I4M A;  3IU1 A;  5I0C A;  2QJ8 A;  1BOB A;  2QEC A;  3FEC A;  4C7I A;  5HMN A;  1Z8X A;  4WWV A;  4NJQ A;  2GRE A;  2PJ2 A;  1TIQ A;  5JH9 A;  4YRH A;  4P4F A;  2PIZ A;  4F0Y A;  4ORF A;  4YU9 A;  4PK2 A;  3JTK A;  1KWM A;  2EWB A;  2PJB A;  3K9U A;  4IF5 A;  3V38 A;  4A94 A;  4H6Z A;  3G3S A;  3TFY A;  3P2H A;  4UWI A;  3SJE A;  2B4B A;  4JLY A;  4R9M A;  3FRM A;  3LWU A;  4F0X A;  3H8E A;  2XEF A;  2RFH A;  3B7I A;  1VHE A;  3EC4 A;  4PXB A;  3R9E A;  5HVG A;  2PJ1 A;  3T8W A;  3D68 A;  4ZGY B;  4DUK A;  1Y7R A;  3G8W A;  1XFO A;  3ISX A;  4G1P A;  6CPA A;  2ZOG A;  2OB0 A;  4A38 A;  3NH8 A;  3D4U A;  3DLJ A;  3TE4 A;  3ISZ A;  3F5B A;  1CP6 A;  4NGR A;  3V7Z A;  3FVL A;  3QAH A;  4DYO A;  2DPS A;  4NF1 A;  3SXN A;  1TF8 A;  3BLN A;  1Z4R A;  3HUV A;  4R7M A;  2FCK A;  3NA6 A;  3BI0 A;  3C26 A;  2CTC A;  1PYT B;  1CG2 A;  1U6M A;  4E0A A;  3IJ3 A;  4UA3 A;  4IK2 A;  3NE7 A;  4RI1 A;  4OAE A;  2OZH A;  4CRY B;  1QMU A;  4P6Y A;  4B12 A;  2Z3K A;  1S5K A;  1Q2Y A;  4ZY0 A;  4UWJ A;  2HV2 A;  4NJR A;  2JBJ A;  4X2T A;  5K8O A;  3P2F A;  2I3C A;  1IOI A;  2FSR A;  2JBK A;  5F46 A;  3D67 A;  4A37 A;  1YLE A;  1Z8L A;  2Z0Z A;  4M85 A;  3DR8 A;  4RN7 A;  5AG4 A;  3IC1 A;  5AG6 A;  2Q4Z A;  1UWY A;  1L0C A;  1XMT A;  2FIA A;  1NMT A;  2IL4 A;  2REE A;  3FX6 A;  4AVA A;  1IYK A;  1S7K A;  3R9G A;  4C2Z A;  5G21 A;  2B5G A;  3R95 A;  1YW6 A;  4OC4 A;  3VH9 A;  3N5F A;  8CPA A;  2OOT A;  4J3G A;  5JM6 A;  4UEF A;  3TTH A;  4KOV A;  2A4N A;  5C82 A;  4KSA A;  1LAP A;  3D8P A;  5LYL A;  2Q43 A;  2PDO A;  1Z8T A;  5THW A;  3R96 A;  5IB9 A;  4F9U A;  3D2M A;  4FD4 A;  1TKH A;  3B2Y A;  3WC7 A;  2PRQ A;  5KTC A;  4QBJ A;  2ZW6 A;  3D7F A;  1XF8 A;  1YRE A;  4OC1 A;  5G20 A;  4CGO A;  4K30 A;  3VWD A;  4IUS A;  4XPK A;  1Y7E A;  2OZU A;  4P4B A;  2Q51 A;  4MXU A;  1BLL E;  4R6T A;  4F6A A;  4P10 A;  4MCS A;  3RZA A;  4CAV A;  2PJ0 A;  3IWG A;  2CXA A;  3JVN A;  1CJW A;  2PJ4 A;  4DNC A;  3S6K A;  2PR1 A;  3FEE A;  2GLF A;  3SJG A;  3KI9 A;  2J9A A;  1YR0 A;  2HB6 A;  3CT9 A;  3I3G A;  3WR7 A;  1YVK A;  2HUZ A;  4MCP A;  2AE6 A;  4X8I A;  4A33 A;  2JDD A;  2NSM A;  4Y49 B;  3S6G A;  1XJO A;  1XMB A;  3W6X A;  1CPS A;  3OWC A;  7CPA A;  4MJ8 A;  4DJL A;  3IIB A;  3MN8 A;  4EFD A;  1DTD A;  1XIX A;  2PIY A;  2OR4 A;  4Y49 C;  4HPS A;  3PB4 X;  2QYV A;  4UIB A;  3PEI A;  4PK3 A;  4IHM A;  1RXT A;  4M6G A;  3V8I A;  2G9D A;  3S6H A;  1Z9U A;  2R8V A;  2ZW4 A;  2ZEL A;  1Y9W A;  4R76 A;  3VAR A;  1ZG7 A;  3F8K A;  3S6F A;  2Q44 A;  3IWW A;  2EO8 A;  3F0A A;  3WT4 A;  4CYP A;  4BMH A;  4AG7 A;  1FNO A;  3DDD A;  4ZI6 A;  4A39 A;  4ZBG A;  4NFR A;  4FD7 A;  3D3S A;  1M4L A;  2O28 A;  2G0B A;  2VBQ A;  1Q7L A;  1ARM A;  4KOY A;  4EVY A;  4UFV A;  3TX8 A;  5A28 A;  2V8V A;  4NGT A;  2Z11 A;  2VXK A;  3WC6 A;  1Z4E A;  2XEG A;  1R57 A;  4GXH A; 
#chains in the Genus database with same CATH homology
 3SXO A;  3ZZI A;  5C88 A;  1NE9 A;  2EVN A;  4MY0 A;  5DWM A;  2PSW A;  4CGN A;  5GCN A;  1M4D A;  4MFP A;  3TOA A;  3TOB A;  1S3Z A;  3W6S A;  5KTD A;  2YNE A;  1QSN A;  1YVO A;  1VHS A;  5CNP A;  1KUY A;  4MFZ A;  3PZJ A;  4NXY A;  3FNC A;  2P6G A;  4KZT A;  3TT2 A;  4L89 A;  3T9Y A;  1VKC A;  2Y0M A;  5ISV A;  1PU9 A;  4PSW A;  3ZJ0 A;  4B5O A;  1NSL A;  2VEZ A;  4H6U A;  5FVJ A;  5J8C A;  2P0W A;  2PR8 A;  3R1K A;  4KOT A;  1SQH A;  4AVB A;  1WK4 A;  4A32 A;  3DNS A;  4KVO E;  2Z3O A;  4HNY B;  5AG5 A;  2J8R A;  2VZZ A;  2F5I A;  4MFL A;  3CXS A;  1KUV A;  2CNS A;  4NSQ A;  2Q0Y A;  4YFJ A;  2HQY A;  2J8N A;  4KOU A;  2R7H A;  4E2A A;  2D4P A;  4X5K A;  4CYO A;  5BWA B;  2CY2 A;  3R9F A;  4M3S A;  3GKR A;  4KLW A;  2ARH A;  2FIW A;  4QB9 A;  2Q7B A;  4U9Y A;  4OLL A;  2B3V A;  4I49 A;  3BJ7 A;  2QML A;  1Y9K A;  2ZPA A;  4UFX A;  2Z3L A;  2AJ6 A;  1MJA A;  3LOD A;  4Q36 A;  2B4D B;  4C2X A;  4C2Y A;  3EO4 A;  4NEX A;  5HH1 A;  3H5Z A;  5JQ4 A;  4B5P B;  3SHP A;  5E96 A;  3TO9 A;  4CGM A;  4A30 A;  2VZY A;  5EBV A;  2JDC A;  1KZF A;  4AVC A;  2H5M A;  3GYA A;  1M4G A;  3EXN A;  4AG9 A;  1M4I A;  2WPW A;  5IX3 A;  4JJX A;  4AB7 A;  4C68 A;  2ZW5 A;  2Z3N A;  2C27 A;  3IGR A;  1YK3 A;  4NCZ A;  1KUX A;  2P6F A;  1XEB A;  3TCV A;  1B6B A;  5AGE A;  4PV6 A;  2FS5 A;  3A9L A;  3FBU A;  1OZP A;  1J4J A;  1IID A;  2P6E A;  1GHE A;  3UY5 A;  4CAF A;  3CXP A;  4YGO A;  4CAX A;  3FXT A;  2Q04 A;  4JD6 A;  4KLV A;  2Z10 A;  3RYO A;  4B13 A;  2PC1 A;  2WSA A;  1ON0 A;  3PP9 A;  2BSW A;  4XPD B;  5JPH A;  4B11 A;  3D2P A;  4GS4 A;  5G22 A;  5H84 A;  4QVT A;  2OZG A;  4XPD C;  2R1I A;  4XNH B;  2R98 A;  1WWZ A;  1YX0 A;  3TO6 A;  2B5G B;  3LD2 A;  4UCN A;  4XNH C;  4KS9 A;  1P0H A;  2YNC C;  2EUI A;  5F47 A;  4R57 A;  1PUA A;  4CAW A;  4LUA A;  1QST A;  4JXQ A;  4L8A A;  3CXQ A;  3B8G A;  1I1D A;  5H86 A;  3JUW A;  1I12 A;  4QUS A;  1MK4 A;  1QSR A;  4R3K A;  4CAE A;  4MFK A;  2FL4 A;  1YGH A;  1IIC A;  4KSF A;  2WUU A;  2Z3P A;  1I21 A;  4QC6 A;  4UCP A;  5F49 A;  2FXF A;  2GAN A;  1S7N A;  2YND A;  4MY3 A;  2BEI A;  1N71 A;  2JEV A;  4R87 A;  1RO5 A;  3E0K A;  3BJ8 A;  4ONU A;  2ZXV A;  4II9 A;  3W91 A;  1BO4 A;  2J8M A;  3VWE A;  1V0C A;  3QB8 A;  1P4N A;  4JXR A;  5AG7 A;  5F48 A;  4B10 A;  4R3L A;  5IV0 A;  1B87 A;  2NMT A;  4CS0 B;  2I79 A;  2OU2 A;  2WPX A;  2RC4 A;  1Q2D A;  3KKW A;  3H4Q A;  2CNM A;  3GY9 A;  1QSO A;  1M1D A;  4PSX A;  2K5T A;  5EC4 A;  2PRB A;  3PGP A;  2GE3 A;  1XE4 A;  4XPL A;  5A27 A;  5IB0 A;  3EFA A;  3T90 A;  4A2Z A;  1MJB A;  2FE7 A;  4FD5 A;  1M44 A;  2Q4Y A;  4KOW A;  3TO7 A;  2G3T A;  2YNC A;  1FY7 A;  4KVX A;  5KTA A;  1LRZ A;  2ATR A;  3FB3 A;  5J8F A;  2OH1 A;  4HKF A;  2G3A A;  4CGL A;  1QSM A;  1MJ9 A;  4MHD A;  1UFH A;  2B3U A;  2B58 A;  2GIV A;  4KUB A;  3DSB A;  4CYN A;  4U9Z A;  1Q2C A;  1S7F A;  4KVM E;  2KCW A;  3FYN A;  2DXQ A;  4BBH A;  4OAD A;  2ZW7 A;  3N7Z A;  4U5Y A;  2DPT A;  4B14 A;  4UCM A;  2Q4V A;  2VQY A;  3DR6 A;  1CM0 A;  1K4J A;  4HNW B;  4Q38 A;  4CGP A;  2VI7 A;  4RS2 A;  4E8O A;  4UBR A;  3MGD A;  2I00 A;  4KOR A;  2PQ8 A;  5DWN A;  4MI4 A;  4HNX B;  4MFJ A;  3EY5 A;  2CNT A;  5G1Z A;  1S7L A;  2D4O A;  2JLM A;  4LX9 A;  4MFQ A;  4UFW A;  4H89 A;  3IWE A;  1S60 A;  4JWP A;  4C7H A;  2QIR A;  2YGW A;  1IB1 E;  3I9S A;  1IYL A;  3IU2 A;  2BUE A;  2X7B A;  2REF A;  4A31 A;  2B4D A;  3FIX A;  4A95 A;  4CRZ B;  1ZO0 A;  2Z3M A;  4CYQ A;  4MBU A;  4KUA A;  2BL1 A;  2FT0 A;  4KOS A;  4KOX A;  4FD6 A;  4B5P A;  3IU1 A;  5I0C A;  1BOB A;  2QEC A;  4C7I A;  5HMN A;  1TIQ A;  4YRH A;  4F0Y A;  4ORF A;  4PK2 A;  3JTK A;  3K9U A;  4IF5 A;  3TFY A;  4H6Z A;  3G3S A;  3P2H A;  4UWI A;  2B4B A;  4JLY A;  4R9M A;  3FRM A;  4F0X A;  3EC4 A;  3R9E A;  4ZGY B;  1Y7R A;  3G8W A;  2OB0 A;  3TE4 A;  3F5B A;  3QAH A;  2DPS A;  4NF1 A;  3SXN A;  3BLN A;  1Z4R A;  2FCK A;  3C26 A;  1U6M A;  4E0A A;  4UA3 A;  3NE7 A;  4RI1 A;  4OAE A;  2OZH A;  4CRY B;  4B12 A;  2Z3K A;  1S5K A;  1Q2Y A;  4UWJ A;  2HV2 A;  3P2F A;  2FSR A;  5F46 A;  1YLE A;  2Z0Z A;  4M85 A;  3DR8 A;  5AG4 A;  5AG6 A;  1L0C A;  1XMT A;  2FIA A;  1NMT A;  2IL4 A;  2REE A;  4AVA A;  1IYK A;  1S7K A;  3R9G A;  4C2Z A;  5G21 A;  2B5G A;  3R95 A;  4J3G A;  3TTH A;  4KOV A;  2A4N A;  5C82 A;  4KSA A;  3D8P A;  2PDO A;  3R96 A;  3D2M A;  4FD4 A;  5KTC A;  4QBJ A;  2ZW6 A;  1XF8 A;  1YRE A;  5G20 A;  4CGO A;  4K30 A;  3VWD A;  4IUS A;  4XPK A;  2OZU A;  4F6A A;  4CAV A;  3IWG A;  2CXA A;  3JVN A;  1CJW A;  4DNC A;  3S6K A;  2PR1 A;  1YR0 A;  3I3G A;  3WR7 A;  1YVK A;  2HUZ A;  2AE6 A;  4A33 A;  2JDD A;  4Y49 B;  3S6G A;  3W6X A;  3OWC A;  4MJ8 A;  1XIX A;  4Y49 C;  4PK3 A;  1RXT A;  3V8I A;  3S6H A;  1Z9U A;  2R8V A;  2ZW4 A;  1Y9W A;  3F8K A;  3S6F A;  2Q44 A;  3F0A A;  4CYP A;  4BMH A;  4AG7 A;  3DDD A;  4ZBG A;  4FD7 A;  3D3S A;  2O28 A;  4KOY A;  2G0B A;  2VBQ A;  4EVY A;  4UFV A;  5A28 A;  2Z11 A;  2VXK A;  1Z4E A;  1R57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...