1S5KA

Aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 1)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
GLVPRGSHMDIRQMNKTHLEHWRGLRKQLWPGHPDDAHLADGEEILQADHLASFIAMADGVAIGFADASIRHDYVNGCDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVHQALGFEETERVIFYRKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aminoglycoside 6'-N-acetyltransferase
publication title A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
pubmed doi rcsb
source organism Salmonella enteritidis
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s5kA00
4KLVA 1YGHA 4H6ZA 2B4DA 2PQ8A 4CAVA 3ZJ0A 1QSRA 4CS0B 4EVYA 4CAXA 3GYAA 2JLMA 2F5IA 4PK3A 3TFYA 4GS4A 3DDDA 3G8WA 2VI7A 4NXYA 2J8RA 1K4JA 3F8KA 1CM0A 4L89A 2P6GA 3EFAA 2AJ6A 4PV6A 2B3VA 4QB9A 4KVXA 1OZPA 3BLNA 1M4IA 4E8OA 2K5TA 3H4QA 4J3GA 4OAEA 5C88A 2CNSA 2CNMA 2REFA 5H86A 2ARHA 2ZXVA 1L0CA 1Y9KA 2VQYA 4UA3A 3TTHA 1LRZA 4KVOE 5F48A 2P0WA 4F0YA 1NSLA 4E2AA 4KOXA 4FD4A 1ON0A 2ATRA 1B87A 4MY0A 5EBVA 1I1DA 4FD5A 4K30A 4ONUA 3SXOA 4YFJA 2P6FA 1QSOA 2O28A 4KOTA 1R57A 1V0CA 1YVKA 3PZJA 1Z9UA 3D8PA 2FSRA 3VWDA 3EXNA 4U5YA 1YVOA 4MBUA 4IUSA 4PK2A 3W6XA 4ZBGA 2FIAA 4KLWA 2IL4A 1KZFA 2CNTA 4X5KA 3D3SA 1PUAA 4JWPA 3D2PA 2C27A 2VZZA 4QC6A 4KOSA 4BMHA 3GKRA 4JXQA 1WK4A 2FE7A 1PU9A 2X7BA 2DXQA 2PRBA 4XPDC 1SQHA 4M85A 2Q4VA 2I00A 2J8MA 4MI4A 4NCZA 1XIXA 1I21A 4CRZB 3RYOA 4JJXA 4KOWA 5IX3A 4IF5A 4MHDA 5C82A 3BJ8A 4PSWA 3TO7A 2B3UA 2QECA 3F0AA 5IB0A 1QSTA 4FD6A 2PSWA 4KVME 2FT0A 3BJ7A 3FXTA 2OH1A 4AG9A 4F6AA 3N7ZA 3E0KA 3EO4A 4H6UA 4KOYA 1N71A 1S7NA 2B5GB 2D4PA 2BL1A 2PDOA 4PSXA 3TOAA 3TE4A 2Q7BA 3TO9A 3FB3A 5J8FA 4RS2A 4LX9A 4II9A 2D4OA 2ZW4A 2RC4A 5E96A 3QAHA 1Y9WA 2QIRA 1Q2YA 3R9GA 1S5KA 5JQ4A 2GE3A 3W91A 2ZW5A 5ISVA 2HUZA 2GIVA 2OB0A 3S6KA 3FRMA 1KUXA 3K9UA 3IWGA 4NEXA 2FS5A 4R87A 1S60A 2HV2A 4KOVA 1S7LA 1FY7A 4YGOA 2OZUA 2Z11A 3FYNA 1P0HA 3ZZIA 1IB1E 4U9ZA 4UWIA 3P2HA 3CXSA 2CY2A 4OADA 5DWNA 1S7KA 3SXNA 3R95A 4OLLA 5EC4A 1I12A 3FIXA 3OWCA 1VHSA 3DR8A 3I9SA 3KKWA 4HNXB 5H84A 3TOBA 4M3SA 3W6SA 5GCNA 4XPDB 4CRYB 2PR8A 1BO4A 2B4BA 3CXPA 4KZTA 1B6BA 3T90A 4R57A 1MJAA 1QSMA 1VKCA 1J4JA 1Q2DA 5KTAA 1M44A 1NE9A 2EUIA 4Y49B 2FL4A 2FIWA 4HKFA 3CXQA 5FVJA 3R9EA 3B8GA 2BEIA 1S3ZA 2R98A 4H89A 4MY3A 1BOBA 5KTDA 1KUYA 4AVBA 4QVTA 4L8AA 1YR0A 1YLEA 3SHPA 4Y49C 1NMTA 1S7FA 3EC4A 3R1KA 2FCKA 3GY9A 4QBJA 2Y0MA 4NSQA 2JDCA 4XPLA 4FD7A 4DNCA 1Z4RA 4JXRA 3R96A 4AVAA 4JLYA 4RI1A 4I49A 2OZHA 2H5MA 4R3LA 2JEVA 5KTCA 2ZW6A 4XPKA 2HQYA 2G3AA 1TIQA 1XF8A 1KUVA 1MK4A 2GANA 2R7HA 1IYLA 3S6HA 2Z0ZA 1XEBA 2VEZA 2Q04A 1P4NA 5JPHA 4U9YA 1M4GA 4KUBA 4QUSA 4LUAA 3NE7A 1CJWA 2EVNA 3I3GA 3V8IA 3D2MA 5J8CA 3DR6A 2VBQA 4KOUA 2REEA 4KUAA 3R9FA 4B5PB 5CNPA 1YK3A 2G0BA 1Y7RA 1M4DA 3G3SA 4E0AA 2I79A 5I0CA 2P6EA 4ORFA 5IV0A 1UFHA 4AVCA 3DNSA 4UBRA 2Z10A 2OU2A 3JUWA 5F49A 1M1DA 2KCWA 1U6MA 5HH1A 3S6FA 3QB8A 2A4NA 4HNYB 2ZPAA 2BSWA 5F46A 3UY5A 3LODA 3PP9A 1Z4EA 4XNHB 1Q2CA 2B5GA 4KORA 1QSNA 2J8NA 2Q44A 2VZYA 1YX0A 3TT2A 3WR7A 2B4DB 3IGRA 3JVNA 1IYKA 4UWJA 4XNHC 2Q4YA 5HMNA 3VWEA 4JD6A 1YREA 4B5PA 2NMTA 1RXTA 3PGPA 3DSBA 3TO6A 3MGDA 4R3KA 2R8VA 5F47A 2VXKA 3EY5A 2WPWA 1MJ9A 2ZW7A 1XMTA 5DWMA 1XE4A 3LD2A 2AE6A 3T9YA 4NF1A 1GHEA 1IICA 2PR1A 2Q0YA 3TCVA 4AB7A 3F5BA 2BUEA 1WWZA 2OZGA 2WPXA 4B5OA 1MJBA 2G3TA 2PC1A 3FNCA 4AG7A 2QMLA 2JDDA 2FXFA 3P2FA 2B58A 3C26A 1RO5A 3FBUA 2R1IA 4HNWB 4YRHA 3S6GA 4CAWA 4R9MA 4MJ8A 1IIDA
chains in the Genus database with same CATH superfamily
4KLVA 3IWWA 1YGHA 4B13A 2Q7SA 1TKHA 4H6ZA 2B4DA 2PQ8A 3CZXA 3ZJ0A 4CAVA 4UEFA 4R7MA 2QJ8A 3QAYA 1QSRA 4CAEA 4CS0B 4EVYA 3WC6A 4CAXA 4ZX8A 3GYAA 2JLMA 2Z3MA 3S9MA 2PIYA 2F5IA 4PK3A 3TFYA 4GS4A 3DDDA 2HC9A 2VI7A 3G8WA 4M6GA 3PRTA 4NXYA 1ZG7A 2ZEGA 2I3CA 2J8RA 4PQAA 1K4JA 3BHXA 1CM0A 3F8KA 2JBJA 4L89A 1IY7A 1FT7A 2P6GA 3EFAA 4NFRA 2AJ6A 4PV6A 4P45A 2B3VA 4QB9A 4RUHA 3N5FA 1OZPA 3BLNA 4KVXA 4LQGA 4MHYA 1M4IA 3IJ3A 4E8OA 2K5TA 3BI0A 3NH4A 2NSMA 3H4QA 2XEGA 4O23A 4OC3A 4A95A 1HDQA 1X12A 3LACA 4J3GA 4MFZA 4OAEA 3PFEA 4F9UA 3KQZA 5C88A 4PPZA 2CNSA 4K3NA 2CNMA 4IAVA 4B10A 2REFA 4B14A 5H86A 2ARHA 2ZXVA 1L0CA 4NGRA 2ZEFA 1Y9KA 2VQYA 4UA3A 3TTHA 1LRZA 4KVOE 5F48A 4MHPA 2P0WA 4OKOA 4F0YA 1CBXA 1NSAA 1NSLA 2PJ0A 2CIJA 4KOXA 2CF4A 4FD4A 4ZX9A 4E2AA 4F0XA 1ON0A 2ATRA 2PJ2A 1B87A 4MY0A 5EBVA 3VARA 1I1DA 3B3TA 4FD5A 4K30A 4OIDA 3S9LA 1CG2A 2C1CA 4FUUA 4ONUA 1AMPA 3SJXA 4BINA 4P44A 3D67A 2V8HA 3SXOA 4YFJA 3PBEA 2ZEDA 3B2YA 5G1ZA 4C2ZA 2P6FA 3IO1A 4UFVA 2V8DA 3B3SA 4ZY2A 4F9VA 4R8FA 1QSOA 3B3CA 3SJFA 6CPAA 1TXRA 2O28A 4KOTA 5JM6A 3KR4A 5HVFA 1R57A 1V0CA 1YVKA 3PZJA 1Z9UA 3D8PA 2FSRA 3VWDA 4CGMA 4FBEA 3NFZA 2V8VA 3EXNA 4U5YA 2C6CA 4MFLA 1YVOA 4MBUA 4CYPA 4IUSA 4JZ0A 4UCMA 3JTKA 4PK2A 4P10A 5DS0A 3W6XA 3D4UA 4CGOA 2AFZA 4ZBGA 2PJ8A 2FIAA 4IK2A 4KLWA 2AFSA 2IL4A 1KZFA 2OR4A 2CNTA 3LMSA 3IU1A 5K8MA 4OP4A 4MCPA 2PJ9A 2OOTA 4X5KA 3D3SA 1PUAA 4JWPA 5HVGA 3D2PA 2C27A 1XJOA 5LYLA 2VZZA 2PRQA 3GLJA 4QC6A 1CPSA 4A39A 1VHEA 3KI9A 4R6TA 5LRGA 3T8WA 3KR5A 2AFWA 4A33A 1M4LA 4KOSA 4BMHA 4CGNA 3GKRA 1DE4C 1Y7EA 3PEIA 4JXQA 1Y0YA 4KS9A 4P4FA 1WK4A 2FE7A 2QVPA 2EK8A 1PU9A 3SI1A 2X7BA 4OC0A 2DXQA 2ABZA 2PRBA 2WSAA 4XPDC 3GIUA 3IC1A 3HLPA 4EWTA 1SQHA 3PBBA 4A2ZA 4M85A 2EBJA 2Q4VA 3RNZA 4ZI6A 2I00A 2J8MA 4MI4A 3KGQA 1F57A 4NCZA 3SJEA 1IU8A 4A94A 2ZOFA 5LYIA 2ZEOA 1XIXA 4P4IA 4MHNA 5G20A 1I21A 2F8HA 4CRZB 1PCAA 5D29A 3RYOA 4JJXA 5IB0A 4KOWA 1Z2LA 5IX3A 3K9TA 1ZG8A 4B11A 2PJ6A 3CPXA 1AUGA 3NH8A 4IF5A 3CDXA 4GXHA 4OC4A 1OBRA 1Z8LA 4MHDA 4PXBA 5C82A 3BJ8A 1XMBA 1ELLP 1XRYA 4MCSA 4PSWA 3TO7A 2B3UA 2HB6A 2QECA 3F0AA 2CXAA 1CP7A 1QSTA 4FD6A 4NGTA 1Z8TA 2PSWA 4KVME 4NGQA 4CGPA 2FT0A 3BJ7A 3FXTA 2ZELA 2OH1A 4AG9A 5ELYA 2ZEMA 3KQXA 4F6AA 2DF5A 3N7ZA 1XBUA 2YNDA 4OC2A 3E0KA 3EO4A 4H6UA 4KOYA 1N71A 4MHZA 1S7NA 2B5GB 2O53A 2V77A 2D4PA 4MFQA 4LQ6A 1Y0RA 4P4BA 4A30A 2NYQA 2BL1A 2PDOA 4OC5A 3SJGA 5EMIA 1IGBA 4PSXA 3TOAA 3WC7A 3TE4A 2Q7BA 3TO9A 3FB3A 5J8FA 4RS2A 3BI1A 2PJ3A 4LX9A 2Q43A 2DPTA 1BAVA 4II9A 2ZEEA 2D4OA 4Z65A 3MN8A 4NGSA 2BO9A 4KSAA 4BBHA 5F09A 2ZW4A 2RC4A 5E96A 5JGFA 2GFQA 5K8OA 2AFOA 3B35A 3H8FA 1Z8WA 2AFXA 3V7ZA 3QAHA 1QMUA 3B7IA 5AG7A 1Y9WA 1CPXA 2QIRA 3V38A 4FWUA 4MFJA 1Q2YA 2ZOGA 1VGYA 2ZENA 3R9GA 4C7HA 4PXEA 3PB8X 1S5KA 2XEJA 5JQ4A 4MRIA 1UWYA 2GE3A 4C7IA 4CYNA 2G9DA 2GU2A 2ZW5A 3W91A 4C68A 5ISVA 2HUZA 2PVWA 2GIVA 2OB0A 1CP6A 1ELMP 4Q36A 2WUUA 3FRMA 3S6KA 5JH9A 1KUXA 2EO8A 1AYEA 3K9UA 8CPAA 2ZEHA 3IWGA 4NEXA 4MFKA 3D66A 2FS5A 2XEFA 4R87A 1S60A 2HV2A 4KOVA 1S7LA 5LRJA 1CX8A 1FY7A 4YGOA 5D8NA 4B12A 4NGNA 2AFUA 2OZUA 2Z11A 4C2XA 3FYNA 4UIBA 3CPAA 4EFDA 1P0HA 3TX8A 5HXDA 3FMCA 3ZZIA 3MRUA 1LANA 1IB1E 4U9ZA 4UWIA 3P2HA 3CXSA 5A28A 2CY2A 2C6PA 4OADA 1X10A 5DWNA 1S7KA 3B3WA 3SXNA 3R95A 4OLLA 4MCRA 4ONWA 4OMEA 1I12A 3FIXA 2DPSA 3OWCA 1VHSA 4GM5A 4TNUA 5AGEA 3DR8A 3I9SA 3SI2A 3KKWA 4HNXB 5H84A 3TOBA 5HVHA 4M3SA 3W6SA 5GCNA 1YQEA 4XPDB 2PR8A 4CRYB 1BO4A 2B4BA 2FVGA 3B3VA 3CXPA 4KZTA 1B6BA 3T90A 3KHXA 3A9LA 4R57A 5IB9A 1MJAA 1QSMA 1VKCA 1ZG9A 3NH5A 4NJRA 4P6YA 1J4JA 1Q2DA 4X8IA 5KTAA 3FVLA 4CPAA 2RB7A 1M44A 1NE9A 2O4HA 4OIWA 1YW6A 4CYQA 4ZGYB 1YMEA 2EUIA 3CT9A 4Y49B 5LYDA 4A37A 5BWAB 3IU2A 4MCQA 2FL4A 2Z3LA 4MMOA 3SI0A 2FIWA 4HKFA 3CXQA 5FVJA 1RTQA 4ZYQA 3R9EA 3WABA 2YNEA 3B8GA 4DJLA 3D68A 2BEIA 2IQ6A 1S3ZA 1YLOA 1H8LA 2YNCC 2R98A 4H89A 4MY3A 1XFOA 2PJ5A 2WZNA 3IEHA 1BOBA 4DYOA 5KTDA 4NJQA 1KUYA 4AVBA 4QVTA 4L8AA 1YR0A 1YLEA 4X2TA 4Y49C 5AG6A 3SHPA 1NMTA 1S7FA 1HEEA 1Q7LA 3EC4A 3R1KA 3KL9A 2FCKA 3GY9A 3PFOA 2Q51A 2Y0MA 4QBJA 5I4MA 4NSQA 3FEEA 2JDCA 4XPLA 1LOKA 1LAMA 5K8NA 1TF8A 4FD7A 4DNCA 1Z4RA 4EMEA 2ANPA 4JXRA 4M6HA 2GLJA 3R96A 3RBUA 4AVAA 4RN7A 4YU9A 4JLYA 2BCOA 4RI1A 4I49A 3NE8A 5G22A 2DEAA 3FEDA 4R76A 2OZHA 1F2PA 2H5MA 1LCPA 4KSIA 2JEVA 4R3LA 3KASA 2ZW6A 4UFWA 5KTCA 4YWYA 4XPKA 1IOFA 2HQYA 2G3AA 2RFHA 5A27A 1TIQA 1XF8A 3DLJA 2VL1A 1KUVA 2PE3A 1MK4A 2GANA 3S9NA 2V8GA 3HUVA 2R7HA 3RAMA 3H8EA 2QYVA 3D7DA 1IYLA 3I1UA 2ODFA 1LFWA 3S6HA 4UCPA 2EK9A 5AG5A 2Z0ZA 1XEBA 4NGPA 1QQ9A 2VEZA 2Q04A 3FJUA 1P4NA 4OC1A 7CPAA 1Z8XA 5JPHA 4U9YA 1M4GA 2YNCA 4KUBA 4HPSA 4QUSA 3KHZA 4LUAA 1LAPA 2GREA 3L2NA 2CTBA 3NE7A 1CJWA 2EVNA 3I3GA 4UEZA 3V8IA 3D2MA 4UF4A 3FX6A 2JBKA 3H8GA 2ZEPA 3DR6A 5J8CA 2IMOA 2VBQA 4KOUA 1GYTA 2REEA 3VATA 4KUAA 3R9FA 4TWEA 5LRKA 4B5PB 4NGMA 4C2YA 5CNPA 1ARMA 1YK3A 2F7VA 2Z3PA 2G0BA 5G21A 2EWBA 2YGWA 2XEIA 5K8PA 1Y7RA 1YSJA 1M4DA 3G3SA 5AG4A 2PJAA 3K2KA 4AXVA 4DUKA 2PVVA 4E0AA 3WC5A 2CTCA 2I79A 5I0CA 2P6EA 4ORFA 5IV0A 1UFHA 4AVCA 1Z5RA 3DNSA 4UBRA 3D7FA 1EE3P 2Z10A 2AFMA 3FECA 1F2OA 5J1QA 2OU2A 4Q38A 2Z3OA 3JUWA 5F49A 1M1DA 2PJBA 3ISZA 4UEEA 2Z3NA 1VIXA 4MXUA 2KCWA 1U6MA 5HH1A 3S6FA 2PJCA 2C6GA 3LWUA 3QB8A 2A4NA 4HNYB 5EC4A 1DTDA 3PB9X 2ZPAA 2BSWA 5F46A 3UY5A 2PCUA 3LODA 3GUXA 1JQGA 3PP9A 1Z4EA 3RO0A 4XNHB 1Q2CA 3GB0A 2B5GA 4MFPA 4KORA 3RZAA 1QSNA 2J8NA 2Q44A 2VZYA 1YX0A 3DGVA 3D7HA 3TT2A 2PJ1A 3WR7A 2POKA 2B4DB 1JWQA 3IGRA 1VHOA 3JVNA 4M6IA 4X3RA 1IYKA 5CBMA 4UWJA 2J9AA 4H2KA 4XNHC 3PB6X 4P4JA 1R3NA 1YW4A 2Q4YA 4BD9A 1BLLE 4FAIA 3IFEA 3TC8A 5HMNA 3VWEA 4JD6A 3IWEA 1YREA 3PB7X 4B5PA 4F8ZA 2NMTA 3BXMA 4WJBA 1RXTA 4ZY0A 3PGPA 3DSBA 4W9YA 3TO6A 4ZY1A 3MGDA 4R3KA 4CYOA 1ARLA 1ZO0A 2R8VA 3NA6A 3FF3A 4P4DA 2GLFA 5F47A 4CAFA 4UFXA 2VXKA 3EY5A 2Q4ZA 2WYRA 2PIZA 3IIBA 2WPWA 1MJ9A 2ZW7A 3QNVA 1XMTA 5DWMA 4IHMA 2PJ4A 1R43A 4A38A 3WT4A 1XE4A 1XOVA 4PXCA 3VH9A 3KZWA 3LD2A 5THWA 4JYWA 4UIAA 2AE6A 2PJ7A 3T9YA 3JRUA 1GHEA 4KSFA 1ZLHA 4NF1A 1KWMA 1IICA 4UCNA 3D7GA 1TKJA 2PR1A 1PYTB 5LYFA 2Q0YA 3TCVA 1HDUA 4AB7A 3F5BA 2BUEA 3H5ZA 5CPAA 1WWZA 2OZGA 1A2ZA 2WPXA 4B6ZA 3ISXA 4B5OA 1TKFA 1MJBA 4Q7AA 2BOAA 2IJZA 2G3TA 1FNOA 2PC1A 1ZLIA 1BPMA 2JEWA 1IOIA 1TF9A 3FNCA 4CGLA 1BPNA 4AG7A 4P4EA 2Z3KA 4G1PA 2QMLA 2JDDA 2FXFA 4PXDA 4A31A 3P2FA 3PB4X 4A32A 4WWVA 2B58A 3C26A 1RO5A 3FBUA 2R1IA 3FH4A 4HNWB 4YRHA 3S6GA 4CAWA 4R9MA 4MJ8A 1IIDA
chains in the Genus database with same CATH topology
4KLVA 1YGHA 4B13A 4H6ZA 2B4DA 2PQ8A 4CAVA 3ZJ0A 1QSRA 4CAEA 4CS0B 4EVYA 4CAXA 3GYAA 2JLMA 2Z3MA 2F5IA 4PK3A 3TFYA 4GS4A 3DDDA 3G8WA 2VI7A 4NXYA 2J8RA 1K4JA 3F8KA 1CM0A 4L89A 2P6GA 3EFAA 2AJ6A 4PV6A 2B3VA 4QB9A 4KVXA 1OZPA 3BLNA 1M4IA 4E8OA 2K5TA 4A95A 3H4QA 4J3GA 4MFZA 4OAEA 5C88A 2CNSA 2CNMA 4B10A 4B14A 2REFA 5H86A 2ARHA 2ZXVA 1L0CA 1Y9KA 2VQYA 4UA3A 3TTHA 1LRZA 4KVOE 5F48A 2P0WA 4F0YA 1NSLA 4E2AA 4KOXA 4FD4A 4F0XA 1ON0A 2ATRA 1B87A 4MY0A 5EBVA 1I1DA 4FD5A 4K30A 4ONUA 3SXOA 4YFJA 5G1ZA 4C2ZA 2P6FA 4UFVA 1QSOA 2O28A 4KOTA 1R57A 1V0CA 1YVKA 3PZJA 1Z9UA 3D8PA 2FSRA 3VWDA 4CGMA 3EXNA 4U5YA 4MFLA 1YVOA 4MBUA 4CYPA 4IUSA 4UCMA 3JTKA 4PK2A 3W6XA 4CGOA 4ZBGA 2FIAA 4KLWA 2IL4A 1KZFA 2CNTA 3IU1A 4X5KA 3D3SA 1PUAA 4JWPA 3D2PA 2C27A 2VZZA 4QC6A 4A33A 4KOSA 4BMHA 4CGNA 3GKRA 4KS9A 4JXQA 1WK4A 2FE7A 1PU9A 2X7BA 2DXQA 2PRBA 2WSAA 4XPDC 1SQHA 4A2ZA 4M85A 2Q4VA 2I00A 2J8MA 4MI4A 4NCZA 1XIXA 5G20A 1I21A 4CRZB 3RYOA 4JJXA 4KOWA 5IX3A 4B11A 4IF5A 4MHDA 5C82A 3BJ8A 4PSWA 3TO7A 2B3UA 2QECA 3F0AA 5IB0A 2CXAA 1QSTA 4FD6A 4CGPA 2PSWA 4KVME 2FT0A 3BJ7A 3FXTA 2OH1A 4AG9A 4F6AA 3N7ZA 2YNDA 3E0KA 3EO4A 4H6UA 4KOYA 1N71A 1S7NA 2B5GB 2D4PA 4MFQA 4A30A 2BL1A 2PDOA 4PSXA 3TOAA 3TE4A 2Q7BA 3TO9A 3FB3A 5J8FA 4RS2A 4LX9A 2DPTA 4II9A 2D4OA 4KSAA 4BBHA 2ZW4A 2RC4A 5E96A 3QAHA 5AG7A 1Y9WA 2QIRA 4MFJA 1Q2YA 4C7HA 3R9GA 1S5KA 5JQ4A 2GE3A 4C7IA 4CYNA 3W91A 2ZW5A 4C68A 5ISVA 2HUZA 2GIVA 2OB0A 4Q36A 3S6KA 2WUUA 3FRMA 1KUXA 3K9UA 3IWGA 4NEXA 4MFKA 2FS5A 4R87A 1S60A 2HV2A 4KOVA 1S7LA 1FY7A 4YGOA 4B12A 2OZUA 2Z11A 4C2XA 3FYNA 1P0HA 3ZZIA 1IB1E 4U9ZA 4UWIA 3P2HA 3CXSA 5A28A 2CY2A 4OADA 5DWNA 1S7KA 3SXNA 3R95A 4OLLA 5EC4A 1I12A 3FIXA 2DPSA 3OWCA 1VHSA 5AGEA 3DR8A 3I9SA 3KKWA 4HNXB 5H84A 3TOBA 4M3SA 3W6SA 5GCNA 4XPDB 4CRYB 2PR8A 1BO4A 2B4BA 3CXPA 4KZTA 1B6BA 3T90A 4R57A 3A9LA 1MJAA 1QSMA 1VKCA 1J4JA 1Q2DA 5KTAA 1M44A 1NE9A 4CYQA 4ZGYB 2EUIA 4Y49B 5BWAB 3IU2A 2FL4A 2Z3LA 2FIWA 4HKFA 3CXQA 5FVJA 3R9EA 2YNEA 3B8GA 2BEIA 2YNCC 1S3ZA 2R98A 4H89A 4MY3A 1BOBA 5KTDA 1KUYA 4AVBA 4QVTA 4L8AA 1YR0A 1YLEA 5AG6A 4Y49C 3SHPA 1NMTA 1S7FA 3EC4A 3R1KA 2FCKA 3GY9A 4QBJA 2Y0MA 4NSQA 2JDCA 4XPLA 4FD7A 4DNCA 1Z4RA 4JXRA 3R96A 4AVAA 4JLYA 4RI1A 4I49A 5G22A 2OZHA 2H5MA 4R3LA 2JEVA 5KTCA 2ZW6A 4UFWA 4XPKA 5A27A 2HQYA 2G3AA 1TIQA 1XF8A 1KUVA 1MK4A 2GANA 2R7HA 1IYLA 3S6HA 4UCPA 5AG5A 2Z0ZA 1XEBA 2VEZA 2Q04A 1P4NA 5JPHA 4U9YA 1M4GA 2YNCA 4KUBA 4QUSA 4LUAA 3NE7A 1CJWA 2EVNA 3I3GA 3V8IA 3D2MA 5J8CA 3DR6A 2VBQA 4KOUA 2REEA 4KUAA 3R9FA 4B5PB 4C2YA 5CNPA 1YK3A 2Z3PA 2G0BA 5G21A 2YGWA 1Y7RA 1M4DA 3G3SA 5AG4A 4E0AA 2I79A 5I0CA 2P6EA 4ORFA 5IV0A 1UFHA 4AVCA 3DNSA 4UBRA 2Z10A 2OU2A 4Q38A 2Z3OA 3JUWA 5F49A 1M1DA 2Z3NA 2KCWA 1U6MA 5HH1A 3S6FA 3QB8A 2A4NA 4HNYB 2ZPAA 2BSWA 5F46A 3UY5A 3LODA 3PP9A 1Z4EA 4XNHB 1Q2CA 2B5GA 4MFPA 4KORA 1QSNA 2J8NA 2Q44A 2VZYA 1YX0A 3TT2A 3WR7A 2B4DB 3IGRA 3JVNA 1IYKA 4UWJA 4XNHC 2Q4YA 5HMNA 3VWEA 4JD6A 3IWEA 1YREA 4B5PA 2NMTA 1RXTA 3PGPA 3DSBA 3TO6A 3MGDA 4R3KA 4CYOA 1ZO0A 2R8VA 5F47A 4CAFA 4UFXA 2VXKA 3EY5A 2WPWA 1MJ9A 2ZW7A 1XMTA 5DWMA 1XE4A 3LD2A 2AE6A 3T9YA 4NF1A 1GHEA 4KSFA 1IICA 4UCNA 2PR1A 2Q0YA 3TCVA 4AB7A 3F5BA 2BUEA 3H5ZA 1WWZA 2OZGA 2WPXA 4B5OA 1MJBA 2G3TA 2PC1A 4CGLA 3FNCA 4AG7A 2Z3KA 2QMLA 2JDDA 2FXFA 4A31A 3P2FA 4A32A 2B58A 3C26A 1RO5A 3FBUA 2R1IA 4HNWB 4YRHA 3S6GA 4CAWA 4R9MA 4MJ8A 1IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLV A;  1YGH A;  4H6Z A;  2B4D A;  2PQ8 A;  4CAV A;  3ZJ0 A;  1QSR A;  4CS0 B;  4EVY A;  4CAX A;  3GYA A;  2JLM A;  2F5I A;  4PK3 A;  3TFY A;  4GS4 A;  3DDD A;  3G8W A;  2VI7 A;  4NXY A;  2J8R A;  1K4J A;  3F8K A;  1CM0 A;  4L89 A;  2P6G A;  3EFA A;  2AJ6 A;  4PV6 A;  2B3V A;  4QB9 A;  4KVX A;  1OZP A;  3BLN A;  1M4I A;  4E8O A;  2K5T A;  3H4Q A;  4J3G A;  4OAE A;  5C88 A;  2CNS A;  2CNM A;  2REF A;  5H86 A;  2ARH A;  2ZXV A;  1L0C A;  1Y9K A;  2VQY A;  4UA3 A;  3TTH A;  1LRZ A;  4KVO E;  5F48 A;  2P0W A;  4F0Y A;  1NSL A;  4E2A A;  4KOX A;  4FD4 A;  1ON0 A;  2ATR A;  1B87 A;  4MY0 A;  5EBV A;  1I1D A;  4FD5 A;  4K30 A;  4ONU A;  3SXO A;  4YFJ A;  2P6F A;  1QSO A;  2O28 A;  4KOT A;  1R57 A;  1V0C A;  1YVK A;  3PZJ A;  1Z9U A;  3D8P A;  2FSR A;  3VWD A;  3EXN A;  4U5Y A;  1YVO A;  4MBU A;  4IUS A;  4PK2 A;  3W6X A;  4ZBG A;  2FIA A;  4KLW A;  2IL4 A;  1KZF A;  2CNT A;  4X5K A;  3D3S A;  1PUA A;  4JWP A;  3D2P A;  2C27 A;  2VZZ A;  4QC6 A;  4KOS A;  4BMH A;  3GKR A;  4JXQ A;  1WK4 A;  2FE7 A;  1PU9 A;  2X7B A;  2DXQ A;  2PRB A;  4XPD C;  1SQH A;  4M85 A;  2Q4V A;  2I00 A;  2J8M A;  4MI4 A;  4NCZ A;  1XIX A;  1I21 A;  4CRZ B;  3RYO A;  4JJX A;  4KOW A;  5IX3 A;  4IF5 A;  4MHD A;  5C82 A;  3BJ8 A;  4PSW A;  3TO7 A;  2B3U A;  2QEC A;  3F0A A;  5IB0 A;  1QST A;  4FD6 A;  2PSW A;  4KVM E;  2FT0 A;  3BJ7 A;  3FXT A;  2OH1 A;  4AG9 A;  4F6A A;  3N7Z A;  3E0K A;  3EO4 A;  4H6U A;  4KOY A;  1N71 A;  1S7N A;  2B5G B;  2D4P A;  2BL1 A;  2PDO A;  4PSX A;  3TOA A;  3TE4 A;  2Q7B A;  3TO9 A;  3FB3 A;  5J8F A;  4RS2 A;  4LX9 A;  4II9 A;  2D4O A;  2ZW4 A;  2RC4 A;  5E96 A;  3QAH A;  1Y9W A;  2QIR A;  1Q2Y A;  3R9G A;  1S5K A;  5JQ4 A;  2GE3 A;  3W91 A;  2ZW5 A;  5ISV A;  2HUZ A;  2GIV A;  2OB0 A;  3S6K A;  3FRM A;  1KUX A;  3K9U A;  3IWG A;  4NEX A;  2FS5 A;  4R87 A;  1S60 A;  2HV2 A;  4KOV A;  1S7L A;  1FY7 A;  4YGO A;  2OZU A;  2Z11 A;  3FYN A;  1P0H A;  3ZZI A;  1IB1 E;  4U9Z A;  4UWI A;  3P2H A;  3CXS A;  2CY2 A;  4OAD A;  5DWN A;  1S7K A;  3SXN A;  3R95 A;  4OLL A;  5EC4 A;  1I12 A;  3FIX A;  3OWC A;  1VHS A;  3DR8 A;  3I9S A;  3KKW A;  4HNX B;  5H84 A;  3TOB A;  4M3S A;  3W6S A;  5GCN A;  4XPD B;  4CRY B;  2PR8 A;  1BO4 A;  2B4B A;  3CXP A;  4KZT A;  1B6B A;  3T90 A;  4R57 A;  1MJA A;  1QSM A;  1VKC A;  1J4J A;  1Q2D A;  5KTA A;  1M44 A;  1NE9 A;  2EUI A;  4Y49 B;  2FL4 A;  2FIW A;  4HKF A;  3CXQ A;  5FVJ A;  3R9E A;  3B8G A;  2BEI A;  1S3Z A;  2R98 A;  4H89 A;  4MY3 A;  1BOB A;  5KTD A;  1KUY A;  4AVB A;  4QVT A;  4L8A A;  1YR0 A;  1YLE A;  3SHP A;  4Y49 C;  1NMT A;  1S7F A;  3EC4 A;  3R1K A;  2FCK A;  3GY9 A;  4QBJ A;  2Y0M A;  4NSQ A;  2JDC A;  4XPL A;  4FD7 A;  4DNC A;  1Z4R A;  4JXR A;  3R96 A;  4AVA A;  4JLY A;  4RI1 A;  4I49 A;  2OZH A;  2H5M A;  4R3L A;  2JEV A;  5KTC A;  2ZW6 A;  4XPK A;  2HQY A;  2G3A A;  1TIQ A;  1XF8 A;  1KUV A;  1MK4 A;  2GAN A;  2R7H A;  1IYL A;  3S6H A;  2Z0Z A;  1XEB A;  2VEZ A;  2Q04 A;  1P4N A;  5JPH A;  4U9Y A;  1M4G A;  4KUB A;  4QUS A;  4LUA A;  3NE7 A;  1CJW A;  2EVN A;  3I3G A;  3V8I A;  3D2M A;  5J8C A;  3DR6 A;  2VBQ A;  4KOU A;  2REE A;  4KUA A;  3R9F A;  4B5P B;  5CNP A;  1YK3 A;  2G0B A;  1Y7R A;  1M4D A;  3G3S A;  4E0A A;  2I79 A;  5I0C A;  2P6E A;  4ORF A;  5IV0 A;  1UFH A;  4AVC A;  3DNS A;  4UBR A;  2Z10 A;  2OU2 A;  3JUW A;  5F49 A;  1M1D A;  2KCW A;  1U6M A;  5HH1 A;  3S6F A;  3QB8 A;  2A4N A;  4HNY B;  2ZPA A;  2BSW A;  5F46 A;  3UY5 A;  3LOD A;  3PP9 A;  1Z4E A;  4XNH B;  1Q2C A;  2B5G A;  4KOR A;  1QSN A;  2J8N A;  2Q44 A;  2VZY A;  1YX0 A;  3TT2 A;  3WR7 A;  2B4D B;  3IGR A;  3JVN A;  1IYK A;  4UWJ A;  4XNH C;  2Q4Y A;  5HMN A;  3VWE A;  4JD6 A;  1YRE A;  4B5P A;  2NMT A;  1RXT A;  3PGP A;  3DSB A;  3TO6 A;  3MGD A;  4R3K A;  2R8V A;  5F47 A;  2VXK A;  3EY5 A;  2WPW A;  1MJ9 A;  2ZW7 A;  1XMT A;  5DWM A;  1XE4 A;  3LD2 A;  2AE6 A;  3T9Y A;  4NF1 A;  1GHE A;  1IIC A;  2PR1 A;  2Q0Y A;  3TCV A;  4AB7 A;  3F5B A;  2BUE A;  1WWZ A;  2OZG A;  2WPX A;  4B5O A;  1MJB A;  2G3T A;  2PC1 A;  3FNC A;  4AG7 A;  2QML A;  2JDD A;  2FXF A;  3P2F A;  2B58 A;  3C26 A;  1RO5 A;  3FBU A;  2R1I A;  4HNW B;  4YRH A;  3S6G A;  4CAW A;  4R9M A;  4MJ8 A;  1IID A; 
#chains in the Genus database with same CATH topology
 4KLV A;  3IWW A;  1YGH A;  4B13 A;  2Q7S A;  1TKH A;  4H6Z A;  2B4D A;  2PQ8 A;  3CZX A;  3ZJ0 A;  4CAV A;  4UEF A;  4R7M A;  2QJ8 A;  3QAY A;  1QSR A;  4CAE A;  4CS0 B;  4EVY A;  3WC6 A;  4CAX A;  4ZX8 A;  3GYA A;  2JLM A;  2Z3M A;  3S9M A;  2PIY A;  2F5I A;  4PK3 A;  3TFY A;  4GS4 A;  3DDD A;  2HC9 A;  2VI7 A;  3G8W A;  4M6G A;  3PRT A;  4NXY A;  1ZG7 A;  2ZEG A;  2I3C A;  2J8R A;  4PQA A;  1K4J A;  3BHX A;  1CM0 A;  3F8K A;  2JBJ A;  4L89 A;  1IY7 A;  1FT7 A;  2P6G A;  3EFA A;  4NFR A;  2AJ6 A;  4PV6 A;  4P45 A;  2B3V A;  4QB9 A;  4RUH A;  3N5F A;  1OZP A;  3BLN A;  4KVX A;  4LQG A;  4MHY A;  1M4I A;  3IJ3 A;  4E8O A;  2K5T A;  3BI0 A;  3NH4 A;  2NSM A;  3H4Q A;  2XEG A;  4O23 A;  4OC3 A;  4A95 A;  1HDQ A;  1X12 A;  3LAC A;  4J3G A;  4MFZ A;  4OAE A;  3PFE A;  4F9U A;  3KQZ A;  5C88 A;  4PPZ A;  2CNS A;  4K3N A;  2CNM A;  4IAV A;  4B10 A;  2REF A;  4B14 A;  5H86 A;  2ARH A;  2ZXV A;  1L0C A;  4NGR A;  2ZEF A;  1Y9K A;  2VQY A;  4UA3 A;  3TTH A;  1LRZ A;  4KVO E;  5F48 A;  4MHP A;  2P0W A;  4OKO A;  4F0Y A;  1CBX A;  1NSA A;  1NSL A;  2PJ0 A;  2CIJ A;  4KOX A;  2CF4 A;  4FD4 A;  4ZX9 A;  4E2A A;  4F0X A;  1ON0 A;  2ATR A;  2PJ2 A;  1B87 A;  4MY0 A;  5EBV A;  3VAR A;  1I1D A;  3B3T A;  4FD5 A;  4K30 A;  4OID A;  3S9L A;  1CG2 A;  2C1C A;  4FUU A;  4ONU A;  1AMP A;  3SJX A;  4BIN A;  4P44 A;  3D67 A;  2V8H A;  3SXO A;  4YFJ A;  3PBE A;  2ZED A;  3B2Y A;  5G1Z A;  4C2Z A;  2P6F A;  3IO1 A;  4UFV A;  2V8D A;  3B3S A;  4ZY2 A;  4F9V A;  4R8F A;  1QSO A;  3B3C A;  3SJF A;  6CPA A;  1TXR A;  2O28 A;  4KOT A;  5JM6 A;  3KR4 A;  5HVF A;  1R57 A;  1V0C A;  1YVK A;  3PZJ A;  1Z9U A;  3D8P A;  2FSR A;  3VWD A;  4CGM A;  4FBE A;  3NFZ A;  2V8V A;  3EXN A;  4U5Y A;  2C6C A;  4MFL A;  1YVO A;  4MBU A;  4CYP A;  4IUS A;  4JZ0 A;  4UCM A;  3JTK A;  4PK2 A;  4P10 A;  5DS0 A;  3W6X A;  3D4U A;  4CGO A;  2AFZ A;  4ZBG A;  2PJ8 A;  2FIA A;  4IK2 A;  4KLW A;  2AFS A;  2IL4 A;  1KZF A;  2OR4 A;  2CNT A;  3LMS A;  3IU1 A;  5K8M A;  4OP4 A;  4MCP A;  2PJ9 A;  2OOT A;  4X5K A;  3D3S A;  1PUA A;  4JWP A;  5HVG A;  3D2P A;  2C27 A;  1XJO A;  5LYL A;  2VZZ A;  2PRQ A;  3GLJ A;  4QC6 A;  1CPS A;  4A39 A;  1VHE A;  3KI9 A;  4R6T A;  5LRG A;  3T8W A;  3KR5 A;  2AFW A;  4A33 A;  1M4L A;  4KOS A;  4BMH A;  4CGN A;  3GKR A;  1DE4 C;  1Y7E A;  3PEI A;  4JXQ A;  1Y0Y A;  4KS9 A;  4P4F A;  1WK4 A;  2FE7 A;  2QVP A;  2EK8 A;  1PU9 A;  3SI1 A;  2X7B A;  4OC0 A;  2DXQ A;  2ABZ A;  2PRB A;  2WSA A;  4XPD C;  3GIU A;  3IC1 A;  3HLP A;  4EWT A;  1SQH A;  3PBB A;  4A2Z A;  4M85 A;  2EBJ A;  2Q4V A;  3RNZ A;  4ZI6 A;  2I00 A;  2J8M A;  4MI4 A;  3KGQ A;  1F57 A;  4NCZ A;  3SJE A;  1IU8 A;  4A94 A;  2ZOF A;  5LYI A;  2ZEO A;  1XIX A;  4P4I A;  4MHN A;  5G20 A;  1I21 A;  2F8H A;  4CRZ B;  1PCA A;  5D29 A;  3RYO A;  4JJX A;  5IB0 A;  4KOW A;  1Z2L A;  5IX3 A;  3K9T A;  1ZG8 A;  4B11 A;  2PJ6 A;  3CPX A;  1AUG A;  3NH8 A;  4IF5 A;  3CDX A;  4GXH A;  4OC4 A;  1OBR A;  1Z8L A;  4MHD A;  4PXB A;  5C82 A;  3BJ8 A;  1XMB A;  1ELL P;  1XRY A;  4MCS A;  4PSW A;  3TO7 A;  2B3U A;  2HB6 A;  2QEC A;  3F0A A;  2CXA A;  1CP7 A;  1QST A;  4FD6 A;  4NGT A;  1Z8T A;  2PSW A;  4KVM E;  4NGQ A;  4CGP A;  2FT0 A;  3BJ7 A;  3FXT A;  2ZEL A;  2OH1 A;  4AG9 A;  5ELY A;  2ZEM A;  3KQX A;  4F6A A;  2DF5 A;  3N7Z A;  1XBU A;  2YND A;  4OC2 A;  3E0K A;  3EO4 A;  4H6U A;  4KOY A;  1N71 A;  4MHZ A;  1S7N A;  2B5G B;  2O53 A;  2V77 A;  2D4P A;  4MFQ A;  4LQ6 A;  1Y0R A;  4P4B A;  4A30 A;  2NYQ A;  2BL1 A;  2PDO A;  4OC5 A;  3SJG A;  5EMI A;  1IGB A;  4PSX A;  3TOA A;  3WC7 A;  3TE4 A;  2Q7B A;  3TO9 A;  3FB3 A;  5J8F A;  4RS2 A;  3BI1 A;  2PJ3 A;  4LX9 A;  2Q43 A;  2DPT A;  1BAV A;  4II9 A;  2ZEE A;  2D4O A;  4Z65 A;  3MN8 A;  4NGS A;  2BO9 A;  4KSA A;  4BBH A;  5F09 A;  2ZW4 A;  2RC4 A;  5E96 A;  5JGF A;  2GFQ A;  5K8O A;  2AFO A;  3B35 A;  3H8F A;  1Z8W A;  2AFX A;  3V7Z A;  3QAH A;  1QMU A;  3B7I A;  5AG7 A;  1Y9W A;  1CPX A;  2QIR A;  3V38 A;  4FWU A;  4MFJ A;  1Q2Y A;  2ZOG A;  1VGY A;  2ZEN A;  3R9G A;  4C7H A;  4PXE A;  3PB8 X;  1S5K A;  2XEJ A;  5JQ4 A;  4MRI A;  1UWY A;  2GE3 A;  4C7I A;  4CYN A;  2G9D A;  2GU2 A;  2ZW5 A;  3W91 A;  4C68 A;  5ISV A;  2HUZ A;  2PVW A;  2GIV A;  2OB0 A;  1CP6 A;  1ELM P;  4Q36 A;  2WUU A;  3FRM A;  3S6K A;  5JH9 A;  1KUX A;  2EO8 A;  1AYE A;  3K9U A;  8CPA A;  2ZEH A;  3IWG A;  4NEX A;  4MFK A;  3D66 A;  2FS5 A;  2XEF A;  4R87 A;  1S60 A;  2HV2 A;  4KOV A;  1S7L A;  5LRJ A;  1CX8 A;  1FY7 A;  4YGO A;  5D8N A;  4B12 A;  4NGN A;  2AFU A;  2OZU A;  2Z11 A;  4C2X A;  3FYN A;  4UIB A;  3CPA A;  4EFD A;  1P0H A;  3TX8 A;  5HXD A;  3FMC A;  3ZZI A;  3MRU A;  1LAN A;  1IB1 E;  4U9Z A;  4UWI A;  3P2H A;  3CXS A;  5A28 A;  2CY2 A;  2C6P A;  4OAD A;  1X10 A;  5DWN A;  1S7K A;  3B3W A;  3SXN A;  3R95 A;  4OLL A;  4MCR A;  4ONW A;  4OME A;  1I12 A;  3FIX A;  2DPS A;  3OWC A;  1VHS A;  4GM5 A;  4TNU A;  5AGE A;  3DR8 A;  3I9S A;  3SI2 A;  3KKW A;  4HNX B;  5H84 A;  3TOB A;  5HVH A;  4M3S A;  3W6S A;  5GCN A;  1YQE A;  4XPD B;  2PR8 A;  4CRY B;  1BO4 A;  2B4B A;  2FVG A;  3B3V A;  3CXP A;  4KZT A;  1B6B A;  3T90 A;  3KHX A;  3A9L A;  4R57 A;  5IB9 A;  1MJA A;  1QSM A;  1VKC A;  1ZG9 A;  3NH5 A;  4NJR A;  4P6Y A;  1J4J A;  1Q2D A;  4X8I A;  5KTA A;  3FVL A;  4CPA A;  2RB7 A;  1M44 A;  1NE9 A;  2O4H A;  4OIW A;  1YW6 A;  4CYQ A;  4ZGY B;  1YME A;  2EUI A;  3CT9 A;  4Y49 B;  5LYD A;  4A37 A;  5BWA B;  3IU2 A;  4MCQ A;  2FL4 A;  2Z3L A;  4MMO A;  3SI0 A;  2FIW A;  4HKF A;  3CXQ A;  5FVJ A;  1RTQ A;  4ZYQ A;  3R9E A;  3WAB A;  2YNE A;  3B8G A;  4DJL A;  3D68 A;  2BEI A;  2IQ6 A;  1S3Z A;  1YLO A;  1H8L A;  2YNC C;  2R98 A;  4H89 A;  4MY3 A;  1XFO A;  2PJ5 A;  2WZN A;  3IEH A;  1BOB A;  4DYO A;  5KTD A;  4NJQ A;  1KUY A;  4AVB A;  4QVT A;  4L8A A;  1YR0 A;  1YLE A;  4X2T A;  4Y49 C;  5AG6 A;  3SHP A;  1NMT A;  1S7F A;  1HEE A;  1Q7L A;  3EC4 A;  3R1K A;  3KL9 A;  2FCK A;  3GY9 A;  3PFO A;  2Q51 A;  2Y0M A;  4QBJ A;  5I4M A;  4NSQ A;  3FEE A;  2JDC A;  4XPL A;  1LOK A;  1LAM A;  5K8N A;  1TF8 A;  4FD7 A;  4DNC A;  1Z4R A;  4EME A;  2ANP A;  4JXR A;  4M6H A;  2GLJ A;  3R96 A;  3RBU A;  4AVA A;  4RN7 A;  4YU9 A;  4JLY A;  2BCO A;  4RI1 A;  4I49 A;  3NE8 A;  5G22 A;  2DEA A;  3FED A;  4R76 A;  2OZH A;  1F2P A;  2H5M A;  1LCP A;  4KSI A;  2JEV A;  4R3L A;  3KAS A;  2ZW6 A;  4UFW A;  5KTC A;  4YWY A;  4XPK A;  1IOF A;  2HQY A;  2G3A A;  2RFH A;  5A27 A;  1TIQ A;  1XF8 A;  3DLJ A;  2VL1 A;  1KUV A;  2PE3 A;  1MK4 A;  2GAN A;  3S9N A;  2V8G A;  3HUV A;  2R7H A;  3RAM A;  3H8E A;  2QYV A;  3D7D A;  1IYL A;  3I1U A;  2ODF A;  1LFW A;  3S6H A;  4UCP A;  2EK9 A;  5AG5 A;  2Z0Z A;  1XEB A;  4NGP A;  1QQ9 A;  2VEZ A;  2Q04 A;  3FJU A;  1P4N A;  4OC1 A;  7CPA A;  1Z8X A;  5JPH A;  4U9Y A;  1M4G A;  2YNC A;  4KUB A;  4HPS A;  4QUS A;  3KHZ A;  4LUA A;  1LAP A;  2GRE A;  3L2N A;  2CTB A;  3NE7 A;  1CJW A;  2EVN A;  3I3G A;  4UEZ A;  3V8I A;  3D2M A;  4UF4 A;  3FX6 A;  2JBK A;  3H8G A;  2ZEP A;  3DR6 A;  5J8C A;  2IMO A;  2VBQ A;  4KOU A;  1GYT A;  2REE A;  3VAT A;  4KUA A;  3R9F A;  4TWE A;  5LRK A;  4B5P B;  4NGM A;  4C2Y A;  5CNP A;  1ARM A;  1YK3 A;  2F7V A;  2Z3P A;  2G0B A;  5G21 A;  2EWB A;  2YGW A;  2XEI A;  5K8P A;  1Y7R A;  1YSJ A;  1M4D A;  3G3S A;  5AG4 A;  2PJA A;  3K2K A;  4AXV A;  4DUK A;  2PVV A;  4E0A A;  3WC5 A;  2CTC A;  2I79 A;  5I0C A;  2P6E A;  4ORF A;  5IV0 A;  1UFH A;  4AVC A;  1Z5R A;  3DNS A;  4UBR A;  3D7F A;  1EE3 P;  2Z10 A;  2AFM A;  3FEC A;  1F2O A;  5J1Q A;  2OU2 A;  4Q38 A;  2Z3O A;  3JUW A;  5F49 A;  1M1D A;  2PJB A;  3ISZ A;  4UEE A;  2Z3N A;  1VIX A;  4MXU A;  2KCW A;  1U6M A;  5HH1 A;  3S6F A;  2PJC A;  2C6G A;  3LWU A;  3QB8 A;  2A4N A;  4HNY B;  5EC4 A;  1DTD A;  3PB9 X;  2ZPA A;  2BSW A;  5F46 A;  3UY5 A;  2PCU A;  3LOD A;  3GUX A;  1JQG A;  3PP9 A;  1Z4E A;  3RO0 A;  4XNH B;  1Q2C A;  3GB0 A;  2B5G A;  4MFP A;  4KOR A;  3RZA A;  1QSN A;  2J8N A;  2Q44 A;  2VZY A;  1YX0 A;  3DGV A;  3D7H A;  3TT2 A;  2PJ1 A;  3WR7 A;  2POK A;  2B4D B;  1JWQ A;  3IGR A;  1VHO A;  3JVN A;  4M6I A;  4X3R A;  1IYK A;  5CBM A;  4UWJ A;  2J9A A;  4H2K A;  4XNH C;  3PB6 X;  4P4J A;  1R3N A;  1YW4 A;  2Q4Y A;  4BD9 A;  1BLL E;  4FAI A;  3IFE A;  3TC8 A;  5HMN A;  3VWE A;  4JD6 A;  3IWE A;  1YRE A;  3PB7 X;  4B5P A;  4F8Z A;  2NMT A;  3BXM A;  4WJB A;  1RXT A;  4ZY0 A;  3PGP A;  3DSB A;  4W9Y A;  3TO6 A;  4ZY1 A;  3MGD A;  4R3K A;  4CYO A;  1ARL A;  1ZO0 A;  2R8V A;  3NA6 A;  3FF3 A;  4P4D A;  2GLF A;  5F47 A;  4CAF A;  4UFX A;  2VXK A;  3EY5 A;  2Q4Z A;  2WYR A;  2PIZ A;  3IIB A;  2WPW A;  1MJ9 A;  2ZW7 A;  3QNV A;  1XMT A;  5DWM A;  4IHM A;  2PJ4 A;  1R43 A;  4A38 A;  3WT4 A;  1XE4 A;  1XOV A;  4PXC A;  3VH9 A;  3KZW A;  3LD2 A;  5THW A;  4JYW A;  4UIA A;  2AE6 A;  2PJ7 A;  3T9Y A;  3JRU A;  1GHE A;  4KSF A;  1ZLH A;  4NF1 A;  1KWM A;  1IIC A;  4UCN A;  3D7G A;  1TKJ A;  2PR1 A;  1PYT B;  5LYF A;  2Q0Y A;  3TCV A;  1HDU A;  4AB7 A;  3F5B A;  2BUE A;  3H5Z A;  5CPA A;  1WWZ A;  2OZG A;  1A2Z A;  2WPX A;  4B6Z A;  3ISX A;  4B5O A;  1TKF A;  1MJB A;  4Q7A A;  2BOA A;  2IJZ A;  2G3T A;  1FNO A;  2PC1 A;  1ZLI A;  1BPM A;  2JEW A;  1IOI A;  1TF9 A;  3FNC A;  4CGL A;  1BPN A;  4AG7 A;  4P4E A;  2Z3K A;  4G1P A;  2QML A;  2JDD A;  2FXF A;  4PXD A;  4A31 A;  3P2F A;  3PB4 X;  4A32 A;  4WWV A;  2B58 A;  3C26 A;  1RO5 A;  3FBU A;  2R1I A;  3FH4 A;  4HNW B;  4YRH A;  3S6G A;  4CAW A;  4R9M A;  4MJ8 A;  1IID A; 
#chains in the Genus database with same CATH homology
 4KLV A;  1YGH A;  4B13 A;  4H6Z A;  2B4D A;  2PQ8 A;  4CAV A;  3ZJ0 A;  1QSR A;  4CAE A;  4CS0 B;  4EVY A;  4CAX A;  3GYA A;  2JLM A;  2Z3M A;  2F5I A;  4PK3 A;  3TFY A;  4GS4 A;  3DDD A;  3G8W A;  2VI7 A;  4NXY A;  2J8R A;  1K4J A;  3F8K A;  1CM0 A;  4L89 A;  2P6G A;  3EFA A;  2AJ6 A;  4PV6 A;  2B3V A;  4QB9 A;  4KVX A;  1OZP A;  3BLN A;  1M4I A;  4E8O A;  2K5T A;  4A95 A;  3H4Q A;  4J3G A;  4MFZ A;  4OAE A;  5C88 A;  2CNS A;  2CNM A;  4B10 A;  4B14 A;  2REF A;  5H86 A;  2ARH A;  2ZXV A;  1L0C A;  1Y9K A;  2VQY A;  4UA3 A;  3TTH A;  1LRZ A;  4KVO E;  5F48 A;  2P0W A;  4F0Y A;  1NSL A;  4E2A A;  4KOX A;  4FD4 A;  4F0X A;  1ON0 A;  2ATR A;  1B87 A;  4MY0 A;  5EBV A;  1I1D A;  4FD5 A;  4K30 A;  4ONU A;  3SXO A;  4YFJ A;  5G1Z A;  4C2Z A;  2P6F A;  4UFV A;  1QSO A;  2O28 A;  4KOT A;  1R57 A;  1V0C A;  1YVK A;  3PZJ A;  1Z9U A;  3D8P A;  2FSR A;  3VWD A;  4CGM A;  3EXN A;  4U5Y A;  4MFL A;  1YVO A;  4MBU A;  4CYP A;  4IUS A;  4UCM A;  3JTK A;  4PK2 A;  3W6X A;  4CGO A;  4ZBG A;  2FIA A;  4KLW A;  2IL4 A;  1KZF A;  2CNT A;  3IU1 A;  4X5K A;  3D3S A;  1PUA A;  4JWP A;  3D2P A;  2C27 A;  2VZZ A;  4QC6 A;  4A33 A;  4KOS A;  4BMH A;  4CGN A;  3GKR A;  4KS9 A;  4JXQ A;  1WK4 A;  2FE7 A;  1PU9 A;  2X7B A;  2DXQ A;  2PRB A;  2WSA A;  4XPD C;  1SQH A;  4A2Z A;  4M85 A;  2Q4V A;  2I00 A;  2J8M A;  4MI4 A;  4NCZ A;  1XIX A;  5G20 A;  1I21 A;  4CRZ B;  3RYO A;  4JJX A;  4KOW A;  5IX3 A;  4B11 A;  4IF5 A;  4MHD A;  5C82 A;  3BJ8 A;  4PSW A;  3TO7 A;  2B3U A;  2QEC A;  3F0A A;  5IB0 A;  2CXA A;  1QST A;  4FD6 A;  4CGP A;  2PSW A;  4KVM E;  2FT0 A;  3BJ7 A;  3FXT A;  2OH1 A;  4AG9 A;  4F6A A;  3N7Z A;  2YND A;  3E0K A;  3EO4 A;  4H6U A;  4KOY A;  1N71 A;  1S7N A;  2B5G B;  2D4P A;  4MFQ A;  4A30 A;  2BL1 A;  2PDO A;  4PSX A;  3TOA A;  3TE4 A;  2Q7B A;  3TO9 A;  3FB3 A;  5J8F A;  4RS2 A;  4LX9 A;  2DPT A;  4II9 A;  2D4O A;  4KSA A;  4BBH A;  2ZW4 A;  2RC4 A;  5E96 A;  3QAH A;  5AG7 A;  1Y9W A;  2QIR A;  4MFJ A;  1Q2Y A;  4C7H A;  3R9G A;  1S5K A;  5JQ4 A;  2GE3 A;  4C7I A;  4CYN A;  3W91 A;  2ZW5 A;  4C68 A;  5ISV A;  2HUZ A;  2GIV A;  2OB0 A;  4Q36 A;  3S6K A;  2WUU A;  3FRM A;  1KUX A;  3K9U A;  3IWG A;  4NEX A;  4MFK A;  2FS5 A;  4R87 A;  1S60 A;  2HV2 A;  4KOV A;  1S7L A;  1FY7 A;  4YGO A;  4B12 A;  2OZU A;  2Z11 A;  4C2X A;  3FYN A;  1P0H A;  3ZZI A;  1IB1 E;  4U9Z A;  4UWI A;  3P2H A;  3CXS A;  5A28 A;  2CY2 A;  4OAD A;  5DWN A;  1S7K A;  3SXN A;  3R95 A;  4OLL A;  5EC4 A;  1I12 A;  3FIX A;  2DPS A;  3OWC A;  1VHS A;  5AGE A;  3DR8 A;  3I9S A;  3KKW A;  4HNX B;  5H84 A;  3TOB A;  4M3S A;  3W6S A;  5GCN A;  4XPD B;  4CRY B;  2PR8 A;  1BO4 A;  2B4B A;  3CXP A;  4KZT A;  1B6B A;  3T90 A;  4R57 A;  3A9L A;  1MJA A;  1QSM A;  1VKC A;  1J4J A;  1Q2D A;  5KTA A;  1M44 A;  1NE9 A;  4CYQ A;  4ZGY B;  2EUI A;  4Y49 B;  5BWA B;  3IU2 A;  2FL4 A;  2Z3L A;  2FIW A;  4HKF A;  3CXQ A;  5FVJ A;  3R9E A;  2YNE A;  3B8G A;  2BEI A;  2YNC C;  1S3Z A;  2R98 A;  4H89 A;  4MY3 A;  1BOB A;  5KTD A;  1KUY A;  4AVB A;  4QVT A;  4L8A A;  1YR0 A;  1YLE A;  5AG6 A;  4Y49 C;  3SHP A;  1NMT A;  1S7F A;  3EC4 A;  3R1K A;  2FCK A;  3GY9 A;  4QBJ A;  2Y0M A;  4NSQ A;  2JDC A;  4XPL A;  4FD7 A;  4DNC A;  1Z4R A;  4JXR A;  3R96 A;  4AVA A;  4JLY A;  4RI1 A;  4I49 A;  5G22 A;  2OZH A;  2H5M A;  4R3L A;  2JEV A;  5KTC A;  2ZW6 A;  4UFW A;  4XPK A;  5A27 A;  2HQY A;  2G3A A;  1TIQ A;  1XF8 A;  1KUV A;  1MK4 A;  2GAN A;  2R7H A;  1IYL A;  3S6H A;  4UCP A;  5AG5 A;  2Z0Z A;  1XEB A;  2VEZ A;  2Q04 A;  1P4N A;  5JPH A;  4U9Y A;  1M4G A;  2YNC A;  4KUB A;  4QUS A;  4LUA A;  3NE7 A;  1CJW A;  2EVN A;  3I3G A;  3V8I A;  3D2M A;  5J8C A;  3DR6 A;  2VBQ A;  4KOU A;  2REE A;  4KUA A;  3R9F A;  4B5P B;  4C2Y A;  5CNP A;  1YK3 A;  2Z3P A;  2G0B A;  5G21 A;  2YGW A;  1Y7R A;  1M4D A;  3G3S A;  5AG4 A;  4E0A A;  2I79 A;  5I0C A;  2P6E A;  4ORF A;  5IV0 A;  1UFH A;  4AVC A;  3DNS A;  4UBR A;  2Z10 A;  2OU2 A;  4Q38 A;  2Z3O A;  3JUW A;  5F49 A;  1M1D A;  2Z3N A;  2KCW A;  1U6M A;  5HH1 A;  3S6F A;  3QB8 A;  2A4N A;  4HNY B;  2ZPA A;  2BSW A;  5F46 A;  3UY5 A;  3LOD A;  3PP9 A;  1Z4E A;  4XNH B;  1Q2C A;  2B5G A;  4MFP A;  4KOR A;  1QSN A;  2J8N A;  2Q44 A;  2VZY A;  1YX0 A;  3TT2 A;  3WR7 A;  2B4D B;  3IGR A;  3JVN A;  1IYK A;  4UWJ A;  4XNH C;  2Q4Y A;  5HMN A;  3VWE A;  4JD6 A;  3IWE A;  1YRE A;  4B5P A;  2NMT A;  1RXT A;  3PGP A;  3DSB A;  3TO6 A;  3MGD A;  4R3K A;  4CYO A;  1ZO0 A;  2R8V A;  5F47 A;  4CAF A;  4UFX A;  2VXK A;  3EY5 A;  2WPW A;  1MJ9 A;  2ZW7 A;  1XMT A;  5DWM A;  1XE4 A;  3LD2 A;  2AE6 A;  3T9Y A;  4NF1 A;  1GHE A;  4KSF A;  1IIC A;  4UCN A;  2PR1 A;  2Q0Y A;  3TCV A;  4AB7 A;  3F5B A;  2BUE A;  3H5Z A;  1WWZ A;  2OZG A;  2WPX A;  4B5O A;  1MJB A;  2G3T A;  2PC1 A;  4CGL A;  3FNC A;  4AG7 A;  2Z3K A;  2QML A;  2JDD A;  2FXF A;  4A31 A;  3P2F A;  4A32 A;  2B58 A;  3C26 A;  1RO5 A;  3FBU A;  2R1I A;  4HNW B;  4YRH A;  3S6G A;  4CAW A;  4R9M A;  4MJ8 A;  1IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...