4CGNA

Leishmania major n-myristoyltransferase in complex with a piperidinylindole inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgnA00
4UFWA 3IWEA 4C7HA 2YNDA 4A32A 5AG5A 5G1ZA 4BBHA 5G21A 3H5ZA 4A30A 4CYNA 5AG4A 4A31A 4CGOA 5G20A 4CGNA 5AGEA 5A28A 4UCNA 4CYPA 4C7IA 2YNEA 4CYOA 2WSAA 5AG6A 3JTKA 4A95A 4CGPA 2YNCC 3IU1A 2WUUA 4UFXA 4B11A 4A33A 4B12A 4B13A 4B10A 4B14A 4C68A 4CAEA 4CGMA 4UCPA 4C2YA 5A27A 2YNCA 4CAFA 5G22A 5AG7A 4C2XA 4CGLA 4C2ZA 4UFVA 3IU2A 4CYQA 4A2ZA 4UCMA
chains in the Genus database with same CATH superfamily
3G3SA 4NGNA 4M6IA 4P44A 1Y9KA 1Y0RA 4MFPA 4YWYA 3VWDA 1TF8A 1S7NA 3DDDA 3F0AA 4NGMA 2PIZA 2C6CA 2QECA 3PB6X 2AFZA 3RZAA 4FAIA 4UWJA 3FECA 2OZGA 3W6SA 3W6XA 1R43A 1XEBA 3RO0A 5CPAA 4NGQA 1QQ9A 4CGPA 1Q7LA 1Q2CA 2WZNA 3BJ8A 4KOYA 4OP4A 3UY5A 4KUAA 4LUAA 2Q4VA 3DR8A 4P4EA 4NFRA 3TO6A 4R9MA 2JEVA 5LRJA 3ZZIA 4G1PA 4AXVA 4A38A 2OR4A 1IB1E 3BI0A 4YGOA 5HVHA 3B2YA 1YR0A 4NGSA 4CPAA 4IHMA 1DTDA 4KOXA 3JRUA 4AVAA 3D7HA 3E0KA 3GUXA 4MHYA 3EFAA 5IB0A 1AUGA 2RFHA 2R8VA 3RAMA 2F8HA 3HUVA 2ZW7A 1BPMA 1IY7A 2WPWA 1GYTA 2VL1A 4OC5A 4B5OA 2PJ6A 2VBQA 2BO9A 2NSMA 4IK2A 1FY7A 1QMUA 4F8ZA 1P0HA 3D8PA 3K2KA 5I4MA 2FSRA 3N7ZA 2Q04A 2CTCA 2GANA 2GE3A 1YGHA 1JWQA 2HB6A 1P4NA 1YSJA 2EVNA 3IWEA 2I3CA 4P4DA 4RS2A 1M1DA 4H89A 4CS0B 2BSWA 2ZPAA 3TCVA 4DNCA 3CZXA 3SJEA 2C1CA 1SQHA 2H5MA 1YMEA 3F8KA 4M85A 4A31A 4E2AA 3B3WA 4Y49C 1XE4A 1YLOA 1KZFA 1R3NA 2YNEA 4NJQA 1PUAA 4KSAA 4LX9A 2ZELA 4KORA 2Z0ZA 4MHPA 5LRGA 1Y7RA 2PR8A 3I9SA 1QSMA 3P2FA 4UFXA 4PXCA 1OZPA 3D4UA 2OOTA 1TXRA 1A2ZA 3B3SA 4K30A 1ZG7A 3EC4A 2PC1A 2Y0MA 3GYAA 4UFVA 4MCQA 1X12A 2QVPA 4JXQA 5K8NA 2YGWA 1F57A 4ZX8A 3D2PA 4FBEA 1Q2YA 2C6GA 3B35A 3PRTA 1IICA 3R1KA 4X5KA 3IFEA 4PXEA 5F46A 2DEAA 3NE7A 5J8CA 2P6EA 3PFOA 4PQAA 2P0WA 4KOVA 4OC4A 1MK4A 3SI0A 4LQGA 4FWUA 2IL4A 1TF9A 2IMOA 2EK8A 2WSAA 1VHEA 3DGVA 2BCOA 3SI1A 5AG6A 4E8OA 5EMIA 4KSIA 3R95A 4QUSA 1BOBA 2HC9A 4B14A 2PJ8A 4R57A 4CAXA 5KTCA 2ABZA 4AVBA 3NH4A 4BMHA 4C2YA 2C6PA 2ZEDA 5H86A 4H6ZA 4NSQA 5G22A 4CAWA 8CPAA 2JDDA 1Z8LA 4KLWA 3VARA 2NMTA 1VHSA 1NSAA 1HEEA 2PSWA 3I3GA 3LODA 5JGFA 2DPSA 4Q7AA 3SJFA 4HPSA 2VI7A 4K3NA 2V8VA 4F9UA 4MJ8A 2AE6A 3GIUA 3VWEA 3OWCA 2FT0A 1PYTB 4JWPA 4A30A 2FXFA 2JEWA 5JM6A 4CGNA 4RUHA 3BHXA 1XRYA 1IIDA 1XMBA 3PB8X 4OAEA 4CYPA 1VKCA 3CPAA 3H8GA 3PBBA 4QVTA 4JJXA 4B12A 2AFXA 5A27A 1R57A 4M6GA 1RXTA 3FRMA 4MFLA 5HXDA 1YLEA 1Z9UA 4OIDA 2F5IA 3IC1A 4AG9A 2KCWA 2Z11A 3D2MA 2Z3OA 3CXSA 3LACA 2Q43A 4P10A 4XNHB 4R76A 2EO8A 4P4IA 3I1UA 2AJ6A 2DF5A 1VIXA 1Z8XA 2PJ9A 1TIQA 5AG5A 3SHPA 3H5ZA 4P4BA 4FD7A 4PSWA 2PJ2A 3EO4A 4GS4A 4OC0A 2Z3KA 4XPLA 4KSFA 2XEIA 3CDXA 2DXQA 3S6KA 1CJWA 4XPDB 2PE3A 3QB8A 4DUKA 3B8GA 4UIBA 3TO9A 4A95A 4PK2A 4OIWA 4OLLA 3FEDA 2PJCA 1S60A 3N5FA 3SXNA 1LCPA 3GKRA 4FD6A 5K8OA 2CXAA 2GFQA 5K8MA 2J8NA 1MJAA 2ZEMA 3FNCA 4MFZA 4KOTA 4PXDA 3H8FA 3PGPA 4P4JA 3K9TA 2Q4YA 2D4OA 1KUYA 1Q2DA 1RO5A 2CNSA 2O53A 1B87A 3IO1A 1CP6A 4NEXA 5G1ZA 3S6FA 4BBHA 5F49A 1DE4C 5K8PA 2CIJA 3G8WA 4HKFA 2CTBA 2VXKA 5HVFA 4UBRA 5G20A 5AG4A 4W9YA 4L89A 4GM5A 3FX6A 2QIRA 5A28A 1VHOA 1L0CA 1VGYA 3FIXA 2G9DA 2PIYA 3HLPA 4P6YA 4C7IA 4QB9A 3S6HA 1YVOA 1ZLIA 4CAVA 5I0CA 2PDOA 3V7ZA 2PJBA 3SXOA 2ZXVA 4ZY0A 1Y9WA 1KWMA 3MRUA 4UEEA 2VEZA 4P4FA 5F09A 3JUWA 3BXMA 4F9VA 4CAFA 2AFWA 4UA3A 4QBJA 1UWYA 4EVYA 1H8LA 3D68A 3FYNA 4H2KA 4PSXA 2K5TA 4U5YA 5FVJA 4OADA 4HNXB 3FVLA 3EY5A 2Q4ZA 2YNDA 2D4PA 2PCUA 2R98A 4KVME 4R3KA 3W91A 1Y7EA 2FS5A 5C82A 2ZOFA 4CGOA 2JBJA 1PCAA 1ZG8A 4P45A 4AB7A 1MJBA 1U6MA 2Z10A 4ZYQA 3JTKA 4GXHA 4HNWB 3RYOA 4B11A 4A33A 1CG2A 4B10A 1IYLA 3B3TA 3EXNA 2FIAA 2IJZA 4OMEA 1JQGA 3NH5A 4TNUA 5J8FA 3FB3A 3V8IA 3TTHA 2REFA 3MGDA 4Q36A 3TOAA 1IYKA 2FE7A 3FXTA 4PXBA 4A39A 4MY3A 2ZEGA 4MBUA 3R9GA 5IB9A 3DSBA 1QSOA 2QYVA 4F6AA 1ARMA 3QAYA 4MY0A 1M44A 3LWUA 2B4BA 1AYEA 2PJ3A 2PJ0A 3KHXA 4NGTA 3VH9A 1LAPA 4KOSA 3WABA 4R87A 1FNOA 5ELYA 4UCNA 6CPAA 3QAHA 4PV6A 5JH9A 4PK3A 1MJ9A 2JBKA 2ZEHA 4XPKA 4CRZB 4L8AA 1YVKA 3D7DA 3NH8A 4FUUA 2ZW6A 5KTDA 4HNYB 1LFWA 2PJAA 5DWMA 1NSLA 2ARHA 3R9FA 1XBUA 3RBUA 1XMTA 3IJ3A 3ISXA 5AG7A 1HDQA 3TOBA 4C2XA 4CGLA 3PFEA 1F2OA 3V38A 4B6ZA 1M4LA 4Y49B 3R96A 4F0XA 3D7FA 2PJ5A 5ISVA 4ZY2A 2VZZA 5DWNA 5CNPA 4EWTA 4O23A 5G21A 3T90A 1RTQA 4UIAA 4B5PA 2EBJA 1XF8A 3JVNA 2ATRA 1IOIA 4BINA 4F0YA 1X10A 1ELMP 2Z3NA 3TE4A 2PVVA 3SJXA 3BLNA 2XEGA 3GY9A 5IV0A 4MI4A 1ELLP 3BI1A 4RN7A 5LYIA 2WUUA 4KUBA 4ZI6A 5JQ4A 2WYRA 3SJGA 1GHEA 1PU9A 1YK3A 2ZW4A 3PEIA 3FBUA 2XEJA 4KOWA 3PB4X 4KS9A 4NF1A 5F47A 5EBVA 5HMNA 3S9MA 4WJBA 2FIWA 2EWBA 2J8RA 2P6FA 4AG7A 4CYOA 4A2ZA 2PJ1A 4UCMA 2C27A 5J1QA 3A9LA 2PJ4A 4ONUA 3KI9A 2ZOGA 3FH4A 4KVXA 4JYWA 1Z4EA 2GU2A 2BL1A 4E0AA 3RNZA 3DR6A 1M4DA 4DJLA 2B3VA 4Q38A 2CNMA 1QSTA 1KUVA 1KUXA 2R7HA 4CYNA 3KZWA 1Y0YA 2FCKA 3QNVA 5AGEA 1YX0A 2REEA 3TT2A 4UEFA 4R8FA 5LYDA 1TKJA 2CF4A 2J9AA 4NCZA 1TKHA 3DLJA 3PP9A 4ZGYB 1CM0A 2HV2A 4MFQA 2ODFA 5E96A 1J4JA 3TC8A 4JD6A 4IF5A 4KZTA 3H4QA 4KOUA 4UCPA 1I1DA 1XJOA 5IX3A 3NFZA 4MXUA 2AFMA 3KR4A 4NXYA 5C88A 4R7MA 2ZENA 3P2HA 3B7IA 2EK9A 2B5GA 3PB9X 2AFOA 1IU8A 3FEEA 4C7HA 2A4NA 2BEIA 5GCNA 2HQYA 4YFJA 2OZHA 1YW4A 1Z8TA 3WC6A 2FL4A 3WT4A 4FD4A 1AMPA 3C26A 3PB7X 3WR7A 4UEZA 5D8NA 1CPXA 2YNCC 1ARLA 4ZBGA 4M3SA 3ZJ0A 3KGQA 4OKOA 4B13A 2PRBA 4II9A 4JXRA 1CBXA 4QC6A 1BLLE 4OC3A 4B5PB 4CRYB 4MCRA 4A37A 1OBRA 4JLYA 5F48A 2QJ8A 3IU2A 3D67A 2HUZA 3FF3A 3IWGA 4RI1A 3PBEA 1ZLHA 2OU2A 5HVGA 5LYLA 4UFWA 3H8EA 4OC2A 1BAVA 2I00A 3TFYA 3MN8A 2OB0A 1S5KA 2V8HA 2AFUA 1UFHA 3S9NA 2B3UA 2RC4A 4NJRA 1Z4RA 4JZ0A 5D29A 1M4GA 2ZEOA 3B3CA 2GREA 2O4HA 2FVGA 4TWEA 4YRHA 1M4IA 3T9YA 1S3ZA 2B58A 4MMOA 4U9YA 2B4DA 3BJ7A 3NE8A 1QSRA 2BOAA 1S7FA 2Q51A 3IU1A 2Z3PA 1IGBA 4CAEA 1WWZA 4NGPA 2I79A 1EE3P 1Z2LA 3IIBA 1CX8A 5BWAB 5LRKA 3TX8A 2GLFA 5HH1A 3KHZA 3DNSA 4CYQA 4MHDA 2QMLA 3K9UA 3CT9A 3KQZA 2IQ6A 4NGRA 3KR5A 2GLJA 2ANPA 2G3AA 1LRZA 3PZJA 3IGRA 1YREA 4FD5A 3T8WA 2O28A 4J3GA 3FMCA 1CPSA 1XIXA 4LQ6A 3S9LA 1CP7A 1NMTA 3CXPA 4PPZA 1N71A 4ZX9A 2Q7BA 1ON0A 3TO7A 4X2TA 2B5GB 2WPXA 2ZEEA 4KVOE 1F2PA 3B3VA 3VATA 1HDUA 4CGMA 1B6BA 3IWWA 3NA6A 2F7VA 2Q0YA 3SI2A 4UWIA 3GLJA 4A94A 3KL9A 1IOFA 2CNTA 2Z3LA 2CY2A 2EUIA 4OC1A 7CPAA 2VQYA 1LANA 3WC5A 2ZW5A 4A32A 2BUEA 4ONWA 4EFDA 2OZUA 3IEHA 2RB7A 4R6TA 4H6UA 1QSNA 1ZG9A 5THWA 4MCPA 4Z65A 2J8MA 2DPTA 1TKFA 1LOKA 1WK4A 2PR1A 2XEFA 3CXQA 1BPNA 1Z8WA 4XNHC 5EC4A 5CBMA 5JPHA 2X7BA 2PRQA 1Z5RA 2POKA 2V8DA 3KASA 4M6HA 4I49A 5H84A 5KTAA 3F5BA 4EMEA 1I21A 3L2NA 2JLMA 1V0CA 2AFSA 2NYQA 2Q7SA 1K4JA 2Q44A 4XPDC 3LMSA 4DYOA 2Z3MA 4MFJA 4ORFA 4C2ZA 2PVWA 4U9ZA 2B4DB 3LD2A 1XOVA 4MFKA 4MHNA 4IUSA 2ZEFA 1S7KA 3ISZA 2OH1A 2PQ8A 1FT7A 1LAMA 2JDCA 3D7GA 4BD9A 1I12A 4MHZA 2V77A 1NE9A 2P6GA 4YU9A 1YW6A 4MCSA 1BO4A 5DS0A 2ZEPA 2G3TA 3CPXA 4ZY1A 2GIVA 4WWVA 3GB0A 1YQEA 1ZO0A 4X3RA 3KQXA 3S6GA 4IAVA 3D3SA 3D66A 2PJ7A 4R3LA 4KLVA 4C68A 4AVCA 1XFOA 4UF4A 3WC7A 2VZYA 3FJUA 2YNCA 3R9EA 2V8GA 2G0BA 5LYFA 2R1IA 3KKWA 1S7LA 4MRIA 4X8IA
chains in the Genus database with same CATH topology
3G3SA 1Y9KA 4MFPA 3VWDA 1S7NA 3DDDA 3F0AA 2QECA 4UWJA 2OZGA 3W6SA 3W6XA 1XEBA 4CGPA 1Q2CA 3BJ8A 4KOYA 3UY5A 4KUAA 4LUAA 2Q4VA 3DR8A 3TO6A 4R9MA 2JEVA 3ZZIA 1IB1E 4YGOA 1YR0A 4KOXA 4AVAA 3E0KA 3EFAA 5IB0A 2R8VA 2ZW7A 2WPWA 4B5OA 2VBQA 1FY7A 1P0HA 3D8PA 2FSRA 3N7ZA 2Q04A 2GANA 2GE3A 1YGHA 1P4NA 2EVNA 3IWEA 4RS2A 1M1DA 4H89A 4CS0B 2BSWA 2ZPAA 3TCVA 4DNCA 1SQHA 2H5MA 3F8KA 4M85A 4A31A 4E2AA 4Y49C 1XE4A 1KZFA 2YNEA 1PUAA 4KSAA 4LX9A 4KORA 2Z0ZA 1Y7RA 2PR8A 3I9SA 1QSMA 3P2FA 4UFXA 1OZPA 4K30A 3EC4A 2PC1A 2Y0MA 3GYAA 4UFVA 4JXQA 2YGWA 3D2PA 1Q2YA 1IICA 3R1KA 4X5KA 5F46A 3NE7A 5J8CA 2P6EA 2P0WA 4KOVA 1MK4A 2IL4A 2WSAA 5AG6A 4E8OA 3R95A 4QUSA 1BOBA 4CAXA 4B14A 4R57A 5KTCA 4AVBA 4BMHA 4C2YA 5H86A 4H6ZA 4NSQA 5G22A 4CAWA 2JDDA 4KLWA 2NMTA 1VHSA 2PSWA 3I3GA 3LODA 2DPSA 2VI7A 4MJ8A 2AE6A 3VWEA 3OWCA 2FT0A 4JWPA 4A30A 2FXFA 4CGNA 1IIDA 4OAEA 4CYPA 1VKCA 4QVTA 4JJXA 4B12A 5A27A 1R57A 1RXTA 3FRMA 4MFLA 1YLEA 1Z9UA 2F5IA 4AG9A 2KCWA 2Z11A 3D2MA 2Z3OA 3CXSA 4XNHB 2AJ6A 5AG5A 1TIQA 3SHPA 3H5ZA 4FD7A 4PSWA 3EO4A 4GS4A 2Z3KA 4XPLA 4KSFA 2DXQA 3S6KA 1CJWA 4XPDB 3QB8A 3B8GA 3TO9A 4A95A 4PK2A 4OLLA 1S60A 3SXNA 3GKRA 4FD6A 2CXAA 2J8NA 1MJAA 3FNCA 4MFZA 4KOTA 3PGPA 2Q4YA 1KUYA 1Q2DA 1RO5A 2CNSA 2D4OA 1B87A 4NEXA 5G1ZA 3S6FA 4BBHA 5F49A 3G8WA 4HKFA 5AG4A 2VXKA 4UBRA 5G20A 4L89A 5A28A 2QIRA 3FIXA 1L0CA 4C7IA 4QB9A 3S6HA 1YVOA 4CAVA 5I0CA 2PDOA 3SXOA 2ZXVA 1Y9WA 2VEZA 3JUWA 4CAFA 4UA3A 4QBJA 4EVYA 3FYNA 4PSXA 2K5TA 4U5YA 5FVJA 4OADA 4HNXB 3EY5A 2YNDA 2D4PA 4KVME 2R98A 4R3KA 3W91A 2FS5A 5C82A 4CGOA 4AB7A 1MJBA 1U6MA 2Z10A 3JTKA 4HNWB 3RYOA 4B11A 4A33A 4B10A 1IYLA 3EXNA 2FIAA 5J8FA 3FB3A 3V8IA 3TTHA 2REFA 3MGDA 4Q36A 3TOAA 1IYKA 2FE7A 3FXTA 4MY3A 4MBUA 3R9GA 3DSBA 1QSOA 4F6AA 4MY0A 1M44A 2B4BA 4KOSA 4R87A 4UCNA 3QAHA 4PV6A 4PK3A 1MJ9A 4XPKA 4CRZB 4L8AA 1YVKA 2ZW6A 5KTDA 4HNYB 5DWMA 1NSLA 2ARHA 3R9FA 1XMTA 5AG7A 4C2XA 4CGLA 3TOBA 4Y49B 3R96A 4F0XA 5ISVA 2VZZA 5DWNA 5CNPA 5G21A 3T90A 4B5PA 1XF8A 3JVNA 2ATRA 4F0YA 3TE4A 2Z3NA 3BLNA 3GY9A 5IV0A 4MI4A 2WUUA 4KUBA 5JQ4A 1GHEA 1PU9A 1YK3A 2ZW4A 3FBUA 4KOWA 4KS9A 4NF1A 5F47A 5EBVA 5HMNA 4AG7A 2FIWA 2J8RA 2P6FA 4CYOA 4A2ZA 4UCMA 2C27A 3A9LA 4ONUA 4KVXA 1Z4EA 2BL1A 4E0AA 3DR6A 1M4DA 2B3VA 4Q38A 2CNMA 1QSTA 1KUVA 1KUXA 2R7HA 4CYNA 2FCKA 5AGEA 1YX0A 2REEA 3TT2A 4NCZA 4ZGYB 3PP9A 1CM0A 2HV2A 4MFQA 5E96A 1J4JA 4JD6A 4IF5A 4KZTA 3H4QA 4KOUA 4UCPA 1I1DA 5IX3A 4NXYA 5C88A 3P2HA 4C7HA 2B5GA 2A4NA 2BEIA 5GCNA 2HQYA 4YFJA 2OZHA 2FL4A 4FD4A 3C26A 3WR7A 2YNCC 4ZBGA 4M3SA 3ZJ0A 4B13A 2PRBA 4II9A 4JXRA 4QC6A 4B5PB 4CRYB 4JLYA 5F48A 3IU2A 2HUZA 4RI1A 3IWGA 2OU2A 4UFWA 2I00A 3TFYA 2OB0A 1S5KA 1UFHA 2B3UA 2RC4A 1Z4RA 1M4GA 4YRHA 1M4IA 3T9YA 1S3ZA 2B58A 4U9YA 2B4DA 3BJ7A 1QSRA 1S7FA 3IU1A 2Z3PA 4CAEA 1WWZA 2I79A 5BWAB 5HH1A 3DNSA 4CYQA 4MHDA 2QMLA 3K9UA 2G3AA 3PZJA 1LRZA 3IGRA 1YREA 4FD5A 2O28A 4J3GA 1XIXA 1NMTA 3CXPA 1N71A 2Q7BA 1ON0A 3TO7A 2B5GB 2WPXA 4KVOE 4CGMA 1B6BA 2Q0YA 4UWIA 2CNTA 2Z3LA 2CY2A 2EUIA 2VQYA 2ZW5A 4A32A 2BUEA 2OZUA 4H6UA 1QSNA 2J8MA 2DPTA 2PR1A 4XNHC 1WK4A 3CXQA 5JPHA 5EC4A 2X7BA 4I49A 5H84A 5KTAA 3F5BA 1I21A 2JLMA 1V0CA 1K4JA 2Q44A 4XPDC 2Z3MA 4MFJA 4ORFA 4C2ZA 4U9ZA 2B4DB 3LD2A 4MFKA 4IUSA 1S7KA 2OH1A 2PQ8A 2JDCA 1I12A 1NE9A 2P6GA 1BO4A 2G3TA 2GIVA 1ZO0A 3S6GA 3D3SA 4R3LA 4KLVA 4C68A 4AVCA 2VZYA 3R9EA 2YNCA 2G0BA 2R1IA 3KKWA 1S7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFW A;  3IWE A;  4C7H A;  2YND A;  4A32 A;  5AG5 A;  5G1Z A;  4BBH A;  5G21 A;  3H5Z A;  4A30 A;  4CYN A;  5AG4 A;  4A31 A;  4CGO A;  5G20 A;  4CGN A;  5AGE A;  5A28 A;  4UCN A;  4CYP A;  4C7I A;  2YNE A;  4CYO A;  2WSA A;  5AG6 A;  3JTK A;  4A95 A;  4CGP A;  2YNC C;  3IU1 A;  2WUU A;  4UFX A;  4B11 A;  4A33 A;  4B12 A;  4B13 A;  4B10 A;  4B14 A;  4C68 A;  4CAE A;  4CGM A;  4UCP A;  4C2Y A;  5A27 A;  2YNC A;  4CAF A;  5G22 A;  5AG7 A;  4C2X A;  4CGL A;  4C2Z A;  4UFV A;  3IU2 A;  4CYQ A;  4A2Z A;  4UCM A; 
#chains in the Genus database with same CATH topology
 3G3S A;  4NGN A;  4M6I A;  4P44 A;  1Y9K A;  1Y0R A;  4MFP A;  4YWY A;  3VWD A;  1TF8 A;  1S7N A;  3DDD A;  3F0A A;  4NGM A;  2PIZ A;  2C6C A;  2QEC A;  3PB6 X;  2AFZ A;  3RZA A;  4FAI A;  4UWJ A;  3FEC A;  2OZG A;  3W6S A;  3W6X A;  1R43 A;  1XEB A;  3RO0 A;  5CPA A;  4NGQ A;  1QQ9 A;  4CGP A;  1Q7L A;  1Q2C A;  2WZN A;  3BJ8 A;  4KOY A;  4OP4 A;  3UY5 A;  4KUA A;  4LUA A;  2Q4V A;  3DR8 A;  4P4E A;  4NFR A;  3TO6 A;  4R9M A;  2JEV A;  5LRJ A;  3ZZI A;  4G1P A;  4AXV A;  4A38 A;  2OR4 A;  1IB1 E;  3BI0 A;  4YGO A;  5HVH A;  3B2Y A;  1YR0 A;  4NGS A;  4CPA A;  4IHM A;  1DTD A;  4KOX A;  3JRU A;  4AVA A;  3D7H A;  3E0K A;  3GUX A;  4MHY A;  3EFA A;  5IB0 A;  1AUG A;  2RFH A;  2R8V A;  3RAM A;  2F8H A;  3HUV A;  2ZW7 A;  1BPM A;  1IY7 A;  2WPW A;  1GYT A;  2VL1 A;  4OC5 A;  4B5O A;  2PJ6 A;  2VBQ A;  2BO9 A;  2NSM A;  4IK2 A;  1FY7 A;  1QMU A;  4F8Z A;  1P0H A;  3D8P A;  3K2K A;  5I4M A;  2FSR A;  3N7Z A;  2Q04 A;  2CTC A;  2GAN A;  2GE3 A;  1YGH A;  1JWQ A;  2HB6 A;  1P4N A;  1YSJ A;  2EVN A;  3IWE A;  2I3C A;  4P4D A;  4RS2 A;  1M1D A;  4H89 A;  4CS0 B;  2BSW A;  2ZPA A;  3TCV A;  4DNC A;  3CZX A;  3SJE A;  2C1C A;  1SQH A;  2H5M A;  1YME A;  3F8K A;  4M85 A;  4A31 A;  4E2A A;  3B3W A;  4Y49 C;  1XE4 A;  1YLO A;  1KZF A;  1R3N A;  2YNE A;  4NJQ A;  1PUA A;  4KSA A;  4LX9 A;  2ZEL A;  4KOR A;  2Z0Z A;  4MHP A;  5LRG A;  1Y7R A;  2PR8 A;  3I9S A;  1QSM A;  3P2F A;  4UFX A;  4PXC A;  1OZP A;  3D4U A;  2OOT A;  1TXR A;  1A2Z A;  3B3S A;  4K30 A;  1ZG7 A;  3EC4 A;  2PC1 A;  2Y0M A;  3GYA A;  4UFV A;  4MCQ A;  1X12 A;  2QVP A;  4JXQ A;  5K8N A;  2YGW A;  1F57 A;  4ZX8 A;  3D2P A;  4FBE A;  1Q2Y A;  2C6G A;  3B35 A;  3PRT A;  1IIC A;  3R1K A;  4X5K A;  3IFE A;  4PXE A;  5F46 A;  2DEA A;  3NE7 A;  5J8C A;  2P6E A;  3PFO A;  4PQA A;  2P0W A;  4KOV A;  4OC4 A;  1MK4 A;  3SI0 A;  4LQG A;  4FWU A;  2IL4 A;  1TF9 A;  2IMO A;  2EK8 A;  2WSA A;  1VHE A;  3DGV A;  2BCO A;  3SI1 A;  5AG6 A;  4E8O A;  5EMI A;  4KSI A;  3R95 A;  4QUS A;  1BOB A;  2HC9 A;  4B14 A;  2PJ8 A;  4R57 A;  4CAX A;  5KTC A;  2ABZ A;  4AVB A;  3NH4 A;  4BMH A;  4C2Y A;  2C6P A;  2ZED A;  5H86 A;  4H6Z A;  4NSQ A;  5G22 A;  4CAW A;  8CPA A;  2JDD A;  1Z8L A;  4KLW A;  3VAR A;  2NMT A;  1VHS A;  1NSA A;  1HEE A;  2PSW A;  3I3G A;  3LOD A;  5JGF A;  2DPS A;  4Q7A A;  3SJF A;  4HPS A;  2VI7 A;  4K3N A;  2V8V A;  4F9U A;  4MJ8 A;  2AE6 A;  3GIU A;  3VWE A;  3OWC A;  2FT0 A;  1PYT B;  4JWP A;  4A30 A;  2FXF A;  2JEW A;  5JM6 A;  4CGN A;  4RUH A;  3BHX A;  1XRY A;  1IID A;  1XMB A;  3PB8 X;  4OAE A;  4CYP A;  1VKC A;  3CPA A;  3H8G A;  3PBB A;  4QVT A;  4JJX A;  4B12 A;  2AFX A;  5A27 A;  1R57 A;  4M6G A;  1RXT A;  3FRM A;  4MFL A;  5HXD A;  1YLE A;  1Z9U A;  4OID A;  2F5I A;  3IC1 A;  4AG9 A;  2KCW A;  2Z11 A;  3D2M A;  2Z3O A;  3CXS A;  3LAC A;  2Q43 A;  4P10 A;  4XNH B;  4R76 A;  2EO8 A;  4P4I A;  3I1U A;  2AJ6 A;  2DF5 A;  1VIX A;  1Z8X A;  2PJ9 A;  1TIQ A;  5AG5 A;  3SHP A;  3H5Z A;  4P4B A;  4FD7 A;  4PSW A;  2PJ2 A;  3EO4 A;  4GS4 A;  4OC0 A;  2Z3K A;  4XPL A;  4KSF A;  2XEI A;  3CDX A;  2DXQ A;  3S6K A;  1CJW A;  4XPD B;  2PE3 A;  3QB8 A;  4DUK A;  3B8G A;  4UIB A;  3TO9 A;  4A95 A;  4PK2 A;  4OIW A;  4OLL A;  3FED A;  2PJC A;  1S60 A;  3N5F A;  3SXN A;  1LCP A;  3GKR A;  4FD6 A;  5K8O A;  2CXA A;  2GFQ A;  5K8M A;  2J8N A;  1MJA A;  2ZEM A;  3FNC A;  4MFZ A;  4KOT A;  4PXD A;  3H8F A;  3PGP A;  4P4J A;  3K9T A;  2Q4Y A;  2D4O A;  1KUY A;  1Q2D A;  1RO5 A;  2CNS A;  2O53 A;  1B87 A;  3IO1 A;  1CP6 A;  4NEX A;  5G1Z A;  3S6F A;  4BBH A;  5F49 A;  1DE4 C;  5K8P A;  2CIJ A;  3G8W A;  4HKF A;  2CTB A;  2VXK A;  5HVF A;  4UBR A;  5G20 A;  5AG4 A;  4W9Y A;  4L89 A;  4GM5 A;  3FX6 A;  2QIR A;  5A28 A;  1VHO A;  1L0C A;  1VGY A;  3FIX A;  2G9D A;  2PIY A;  3HLP A;  4P6Y A;  4C7I A;  4QB9 A;  3S6H A;  1YVO A;  1ZLI A;  4CAV A;  5I0C A;  2PDO A;  3V7Z A;  2PJB A;  3SXO A;  2ZXV A;  4ZY0 A;  1Y9W A;  1KWM A;  3MRU A;  4UEE A;  2VEZ A;  4P4F A;  5F09 A;  3JUW A;  3BXM A;  4F9V A;  4CAF A;  2AFW A;  4UA3 A;  4QBJ A;  1UWY A;  4EVY A;  1H8L A;  3D68 A;  3FYN A;  4H2K A;  4PSX A;  2K5T A;  4U5Y A;  5FVJ A;  4OAD A;  4HNX B;  3FVL A;  3EY5 A;  2Q4Z A;  2YND A;  2D4P A;  2PCU A;  2R98 A;  4KVM E;  4R3K A;  3W91 A;  1Y7E A;  2FS5 A;  5C82 A;  2ZOF A;  4CGO A;  2JBJ A;  1PCA A;  1ZG8 A;  4P45 A;  4AB7 A;  1MJB A;  1U6M A;  2Z10 A;  4ZYQ A;  3JTK A;  4GXH A;  4HNW B;  3RYO A;  4B11 A;  4A33 A;  1CG2 A;  4B10 A;  1IYL A;  3B3T A;  3EXN A;  2FIA A;  2IJZ A;  4OME A;  1JQG A;  3NH5 A;  4TNU A;  5J8F A;  3FB3 A;  3V8I A;  3TTH A;  2REF A;  3MGD A;  4Q36 A;  3TOA A;  1IYK A;  2FE7 A;  3FXT A;  4PXB A;  4A39 A;  4MY3 A;  2ZEG A;  4MBU A;  3R9G A;  5IB9 A;  3DSB A;  1QSO A;  2QYV A;  4F6A A;  1ARM A;  3QAY A;  4MY0 A;  1M44 A;  3LWU A;  2B4B A;  1AYE A;  2PJ3 A;  2PJ0 A;  3KHX A;  4NGT A;  3VH9 A;  1LAP A;  4KOS A;  3WAB A;  4R87 A;  1FNO A;  5ELY A;  4UCN A;  6CPA A;  3QAH A;  4PV6 A;  5JH9 A;  4PK3 A;  1MJ9 A;  2JBK A;  2ZEH A;  4XPK A;  4CRZ B;  4L8A A;  1YVK A;  3D7D A;  3NH8 A;  4FUU A;  2ZW6 A;  5KTD A;  4HNY B;  1LFW A;  2PJA A;  5DWM A;  1NSL A;  2ARH A;  3R9F A;  1XBU A;  3RBU A;  1XMT A;  3IJ3 A;  3ISX A;  5AG7 A;  1HDQ A;  3TOB A;  4C2X A;  4CGL A;  3PFE A;  1F2O A;  3V38 A;  4B6Z A;  1M4L A;  4Y49 B;  3R96 A;  4F0X A;  3D7F A;  2PJ5 A;  5ISV A;  4ZY2 A;  2VZZ A;  5DWN A;  5CNP A;  4EWT A;  4O23 A;  5G21 A;  3T90 A;  1RTQ A;  4UIA A;  4B5P A;  2EBJ A;  1XF8 A;  3JVN A;  2ATR A;  1IOI A;  4BIN A;  4F0Y A;  1X10 A;  1ELM P;  2Z3N A;  3TE4 A;  2PVV A;  3SJX A;  3BLN A;  2XEG A;  3GY9 A;  5IV0 A;  4MI4 A;  1ELL P;  3BI1 A;  4RN7 A;  5LYI A;  2WUU A;  4KUB A;  4ZI6 A;  5JQ4 A;  2WYR A;  3SJG A;  1GHE A;  1PU9 A;  1YK3 A;  2ZW4 A;  3PEI A;  3FBU A;  2XEJ A;  4KOW A;  3PB4 X;  4KS9 A;  4NF1 A;  5F47 A;  5EBV A;  5HMN A;  3S9M A;  4WJB A;  2FIW A;  2EWB A;  2J8R A;  2P6F A;  4AG7 A;  4CYO A;  4A2Z A;  2PJ1 A;  4UCM A;  2C27 A;  5J1Q A;  3A9L A;  2PJ4 A;  4ONU A;  3KI9 A;  2ZOG A;  3FH4 A;  4KVX A;  4JYW A;  1Z4E A;  2GU2 A;  2BL1 A;  4E0A A;  3RNZ A;  3DR6 A;  1M4D A;  4DJL A;  2B3V A;  4Q38 A;  2CNM A;  1QST A;  1KUV A;  1KUX A;  2R7H A;  4CYN A;  3KZW A;  1Y0Y A;  2FCK A;  3QNV A;  5AGE A;  1YX0 A;  2REE A;  3TT2 A;  4UEF A;  4R8F A;  5LYD A;  1TKJ A;  2CF4 A;  2J9A A;  4NCZ A;  1TKH A;  3DLJ A;  3PP9 A;  4ZGY B;  1CM0 A;  2HV2 A;  4MFQ A;  2ODF A;  5E96 A;  1J4J A;  3TC8 A;  4JD6 A;  4IF5 A;  4KZT A;  3H4Q A;  4KOU A;  4UCP A;  1I1D A;  1XJO A;  5IX3 A;  3NFZ A;  4MXU A;  2AFM A;  3KR4 A;  4NXY A;  5C88 A;  4R7M A;  2ZEN A;  3P2H A;  3B7I A;  2EK9 A;  2B5G A;  3PB9 X;  2AFO A;  1IU8 A;  3FEE A;  4C7H A;  2A4N A;  2BEI A;  5GCN A;  2HQY A;  4YFJ A;  2OZH A;  1YW4 A;  1Z8T A;  3WC6 A;  2FL4 A;  3WT4 A;  4FD4 A;  1AMP A;  3C26 A;  3PB7 X;  3WR7 A;  4UEZ A;  5D8N A;  1CPX A;  2YNC C;  1ARL A;  4ZBG A;  4M3S A;  3ZJ0 A;  3KGQ A;  4OKO A;  4B13 A;  2PRB A;  4II9 A;  4JXR A;  1CBX A;  4QC6 A;  1BLL E;  4OC3 A;  4B5P B;  4CRY B;  4MCR A;  4A37 A;  1OBR A;  4JLY A;  5F48 A;  2QJ8 A;  3IU2 A;  3D67 A;  2HUZ A;  3FF3 A;  3IWG A;  4RI1 A;  3PBE A;  1ZLH A;  2OU2 A;  5HVG A;  5LYL A;  4UFW A;  3H8E A;  4OC2 A;  1BAV A;  2I00 A;  3TFY A;  3MN8 A;  2OB0 A;  1S5K A;  2V8H A;  2AFU A;  1UFH A;  3S9N A;  2B3U A;  2RC4 A;  4NJR A;  1Z4R A;  4JZ0 A;  5D29 A;  1M4G A;  2ZEO A;  3B3C A;  2GRE A;  2O4H A;  2FVG A;  4TWE A;  4YRH A;  1M4I A;  3T9Y A;  1S3Z A;  2B58 A;  4MMO A;  4U9Y A;  2B4D A;  3BJ7 A;  3NE8 A;  1QSR A;  2BOA A;  1S7F A;  2Q51 A;  3IU1 A;  2Z3P A;  1IGB A;  4CAE A;  1WWZ A;  4NGP A;  2I79 A;  1EE3 P;  1Z2L A;  3IIB A;  1CX8 A;  5BWA B;  5LRK A;  3TX8 A;  2GLF A;  5HH1 A;  3KHZ A;  3DNS A;  4CYQ A;  4MHD A;  2QML A;  3K9U A;  3CT9 A;  3KQZ A;  2IQ6 A;  4NGR A;  3KR5 A;  2GLJ A;  2ANP A;  2G3A A;  1LRZ A;  3PZJ A;  3IGR A;  1YRE A;  4FD5 A;  3T8W A;  2O28 A;  4J3G A;  3FMC A;  1CPS A;  1XIX A;  4LQ6 A;  3S9L A;  1CP7 A;  1NMT A;  3CXP A;  4PPZ A;  1N71 A;  4ZX9 A;  2Q7B A;  1ON0 A;  3TO7 A;  4X2T A;  2B5G B;  2WPX A;  2ZEE A;  4KVO E;  1F2P A;  3B3V A;  3VAT A;  1HDU A;  4CGM A;  1B6B A;  3IWW A;  3NA6 A;  2F7V A;  2Q0Y A;  3SI2 A;  4UWI A;  3GLJ A;  4A94 A;  3KL9 A;  1IOF A;  2CNT A;  2Z3L A;  2CY2 A;  2EUI A;  4OC1 A;  7CPA A;  2VQY A;  1LAN A;  3WC5 A;  2ZW5 A;  4A32 A;  2BUE A;  4ONW A;  4EFD A;  2OZU A;  3IEH A;  2RB7 A;  4R6T A;  4H6U A;  1QSN A;  1ZG9 A;  5THW A;  4MCP A;  4Z65 A;  2J8M A;  2DPT A;  1TKF A;  1LOK A;  1WK4 A;  2PR1 A;  2XEF A;  3CXQ A;  1BPN A;  1Z8W A;  4XNH C;  5EC4 A;  5CBM A;  5JPH A;  2X7B A;  2PRQ A;  1Z5R A;  2POK A;  2V8D A;  3KAS A;  4M6H A;  4I49 A;  5H84 A;  5KTA A;  3F5B A;  4EME A;  1I21 A;  3L2N A;  2JLM A;  1V0C A;  2AFS A;  2NYQ A;  2Q7S A;  1K4J A;  2Q44 A;  4XPD C;  3LMS A;  4DYO A;  2Z3M A;  4MFJ A;  4ORF A;  4C2Z A;  2PVW A;  4U9Z A;  2B4D B;  3LD2 A;  1XOV A;  4MFK A;  4MHN A;  4IUS A;  2ZEF A;  1S7K A;  3ISZ A;  2OH1 A;  2PQ8 A;  1FT7 A;  1LAM A;  2JDC A;  3D7G A;  4BD9 A;  1I12 A;  4MHZ A;  2V77 A;  1NE9 A;  2P6G A;  4YU9 A;  1YW6 A;  4MCS A;  1BO4 A;  5DS0 A;  2ZEP A;  2G3T A;  3CPX A;  4ZY1 A;  2GIV A;  4WWV A;  3GB0 A;  1YQE A;  1ZO0 A;  4X3R A;  3KQX A;  3S6G A;  4IAV A;  3D3S A;  3D66 A;  2PJ7 A;  4R3L A;  4KLV A;  4C68 A;  4AVC A;  1XFO A;  4UF4 A;  3WC7 A;  2VZY A;  3FJU A;  2YNC A;  3R9E A;  2V8G A;  2G0B A;  5LYF A;  2R1I A;  3KKW A;  1S7L A;  4MRI A;  4X8I A; 
#chains in the Genus database with same CATH homology
 3G3S A;  1Y9K A;  4MFP A;  3VWD A;  1S7N A;  3DDD A;  3F0A A;  2QEC A;  4UWJ A;  2OZG A;  3W6S A;  3W6X A;  1XEB A;  4CGP A;  1Q2C A;  3BJ8 A;  4KOY A;  3UY5 A;  4KUA A;  4LUA A;  2Q4V A;  3DR8 A;  3TO6 A;  4R9M A;  2JEV A;  3ZZI A;  1IB1 E;  4YGO A;  1YR0 A;  4KOX A;  4AVA A;  3E0K A;  3EFA A;  5IB0 A;  2R8V A;  2ZW7 A;  2WPW A;  4B5O A;  2VBQ A;  1FY7 A;  1P0H A;  3D8P A;  2FSR A;  3N7Z A;  2Q04 A;  2GAN A;  2GE3 A;  1YGH A;  1P4N A;  2EVN A;  3IWE A;  4RS2 A;  1M1D A;  4H89 A;  4CS0 B;  2BSW A;  2ZPA A;  3TCV A;  4DNC A;  1SQH A;  2H5M A;  3F8K A;  4M85 A;  4A31 A;  4E2A A;  4Y49 C;  1XE4 A;  1KZF A;  2YNE A;  1PUA A;  4KSA A;  4LX9 A;  4KOR A;  2Z0Z A;  1Y7R A;  2PR8 A;  3I9S A;  1QSM A;  3P2F A;  4UFX A;  1OZP A;  4K30 A;  3EC4 A;  2PC1 A;  2Y0M A;  3GYA A;  4UFV A;  4JXQ A;  2YGW A;  3D2P A;  1Q2Y A;  1IIC A;  3R1K A;  4X5K A;  5F46 A;  3NE7 A;  5J8C A;  2P6E A;  2P0W A;  4KOV A;  1MK4 A;  2IL4 A;  2WSA A;  5AG6 A;  4E8O A;  3R95 A;  4QUS A;  1BOB A;  4CAX A;  4B14 A;  4R57 A;  5KTC A;  4AVB A;  4BMH A;  4C2Y A;  5H86 A;  4H6Z A;  4NSQ A;  5G22 A;  4CAW A;  2JDD A;  4KLW A;  2NMT A;  1VHS A;  2PSW A;  3I3G A;  3LOD A;  2DPS A;  2VI7 A;  4MJ8 A;  2AE6 A;  3VWE A;  3OWC A;  2FT0 A;  4JWP A;  4A30 A;  2FXF A;  4CGN A;  1IID A;  4OAE A;  4CYP A;  1VKC A;  4QVT A;  4JJX A;  4B12 A;  5A27 A;  1R57 A;  1RXT A;  3FRM A;  4MFL A;  1YLE A;  1Z9U A;  2F5I A;  4AG9 A;  2KCW A;  2Z11 A;  3D2M A;  2Z3O A;  3CXS A;  4XNH B;  2AJ6 A;  5AG5 A;  1TIQ A;  3SHP A;  3H5Z A;  4FD7 A;  4PSW A;  3EO4 A;  4GS4 A;  2Z3K A;  4XPL A;  4KSF A;  2DXQ A;  3S6K A;  1CJW A;  4XPD B;  3QB8 A;  3B8G A;  3TO9 A;  4A95 A;  4PK2 A;  4OLL A;  1S60 A;  3SXN A;  3GKR A;  4FD6 A;  2CXA A;  2J8N A;  1MJA A;  3FNC A;  4MFZ A;  4KOT A;  3PGP A;  2Q4Y A;  1KUY A;  1Q2D A;  1RO5 A;  2CNS A;  2D4O A;  1B87 A;  4NEX A;  5G1Z A;  3S6F A;  4BBH A;  5F49 A;  3G8W A;  4HKF A;  5AG4 A;  2VXK A;  4UBR A;  5G20 A;  4L89 A;  5A28 A;  2QIR A;  3FIX A;  1L0C A;  4C7I A;  4QB9 A;  3S6H A;  1YVO A;  4CAV A;  5I0C A;  2PDO A;  3SXO A;  2ZXV A;  1Y9W A;  2VEZ A;  3JUW A;  4CAF A;  4UA3 A;  4QBJ A;  4EVY A;  3FYN A;  4PSX A;  2K5T A;  4U5Y A;  5FVJ A;  4OAD A;  4HNX B;  3EY5 A;  2YND A;  2D4P A;  4KVM E;  2R98 A;  4R3K A;  3W91 A;  2FS5 A;  5C82 A;  4CGO A;  4AB7 A;  1MJB A;  1U6M A;  2Z10 A;  3JTK A;  4HNW B;  3RYO A;  4B11 A;  4A33 A;  4B10 A;  1IYL A;  3EXN A;  2FIA A;  5J8F A;  3FB3 A;  3V8I A;  3TTH A;  2REF A;  3MGD A;  4Q36 A;  3TOA A;  1IYK A;  2FE7 A;  3FXT A;  4MY3 A;  4MBU A;  3R9G A;  3DSB A;  1QSO A;  4F6A A;  4MY0 A;  1M44 A;  2B4B A;  4KOS A;  4R87 A;  4UCN A;  3QAH A;  4PV6 A;  4PK3 A;  1MJ9 A;  4XPK A;  4CRZ B;  4L8A A;  1YVK A;  2ZW6 A;  5KTD A;  4HNY B;  5DWM A;  1NSL A;  2ARH A;  3R9F A;  1XMT A;  5AG7 A;  4C2X A;  4CGL A;  3TOB A;  4Y49 B;  3R96 A;  4F0X A;  5ISV A;  2VZZ A;  5DWN A;  5CNP A;  5G21 A;  3T90 A;  4B5P A;  1XF8 A;  3JVN A;  2ATR A;  4F0Y A;  3TE4 A;  2Z3N A;  3BLN A;  3GY9 A;  5IV0 A;  4MI4 A;  2WUU A;  4KUB A;  5JQ4 A;  1GHE A;  1PU9 A;  1YK3 A;  2ZW4 A;  3FBU A;  4KOW A;  4KS9 A;  4NF1 A;  5F47 A;  5EBV A;  5HMN A;  4AG7 A;  2FIW A;  2J8R A;  2P6F A;  4CYO A;  4A2Z A;  4UCM A;  2C27 A;  3A9L A;  4ONU A;  4KVX A;  1Z4E A;  2BL1 A;  4E0A A;  3DR6 A;  1M4D A;  2B3V A;  4Q38 A;  2CNM A;  1QST A;  1KUV A;  1KUX A;  2R7H A;  4CYN A;  2FCK A;  5AGE A;  1YX0 A;  2REE A;  3TT2 A;  4NCZ A;  4ZGY B;  3PP9 A;  1CM0 A;  2HV2 A;  4MFQ A;  5E96 A;  1J4J A;  4JD6 A;  4IF5 A;  4KZT A;  3H4Q A;  4KOU A;  4UCP A;  1I1D A;  5IX3 A;  4NXY A;  5C88 A;  3P2H A;  4C7H A;  2B5G A;  2A4N A;  2BEI A;  5GCN A;  2HQY A;  4YFJ A;  2OZH A;  2FL4 A;  4FD4 A;  3C26 A;  3WR7 A;  2YNC C;  4ZBG A;  4M3S A;  3ZJ0 A;  4B13 A;  2PRB A;  4II9 A;  4JXR A;  4QC6 A;  4B5P B;  4CRY B;  4JLY A;  5F48 A;  3IU2 A;  2HUZ A;  4RI1 A;  3IWG A;  2OU2 A;  4UFW A;  2I00 A;  3TFY A;  2OB0 A;  1S5K A;  1UFH A;  2B3U A;  2RC4 A;  1Z4R A;  1M4G A;  4YRH A;  1M4I A;  3T9Y A;  1S3Z A;  2B58 A;  4U9Y A;  2B4D A;  3BJ7 A;  1QSR A;  1S7F A;  3IU1 A;  2Z3P A;  4CAE A;  1WWZ A;  2I79 A;  5BWA B;  5HH1 A;  3DNS A;  4CYQ A;  4MHD A;  2QML A;  3K9U A;  2G3A A;  3PZJ A;  1LRZ A;  3IGR A;  1YRE A;  4FD5 A;  2O28 A;  4J3G A;  1XIX A;  1NMT A;  3CXP A;  1N71 A;  2Q7B A;  1ON0 A;  3TO7 A;  2B5G B;  2WPX A;  4KVO E;  4CGM A;  1B6B A;  2Q0Y A;  4UWI A;  2CNT A;  2Z3L A;  2CY2 A;  2EUI A;  2VQY A;  2ZW5 A;  4A32 A;  2BUE A;  2OZU A;  4H6U A;  1QSN A;  2J8M A;  2DPT A;  2PR1 A;  4XNH C;  1WK4 A;  3CXQ A;  5JPH A;  5EC4 A;  2X7B A;  4I49 A;  5H84 A;  5KTA A;  3F5B A;  1I21 A;  2JLM A;  1V0C A;  1K4J A;  2Q44 A;  4XPD C;  2Z3M A;  4MFJ A;  4ORF A;  4C2Z A;  4U9Z A;  2B4D B;  3LD2 A;  4MFK A;  4IUS A;  1S7K A;  2OH1 A;  2PQ8 A;  2JDC A;  1I12 A;  1NE9 A;  2P6G A;  1BO4 A;  2G3T A;  2GIV A;  1ZO0 A;  3S6G A;  3D3S A;  4R3L A;  4KLV A;  4C68 A;  4AVC A;  2VZY A;  3R9E A;  2YNC A;  2G0B A;  2R1I A;  3KKW A;  1S7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...