4CGNA

Leishmania major n-myristoyltransferase in complex with a piperidinylindole inhibitor
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Diverse Modes of Binding in Structures of Leishmania Major N-Myristoyltransferase with Selective Inhibitors
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4cgnA00
4CAFA 5AG4A 4CYOA 2WSAA 2YNDA 4B12A 2WUUA 4B14A 4CGNA 4CYPA 4UCNA 5AGEA 4CGLA 5AG5A 5G22A 4A31A 5AG6A 5A28A 4CGOA 4A32A 4A95A 4A30A 4UFWA 5AG7A 2YNEA 4UCMA 4UFXA 4CYNA 4UCPA 4A2ZA 3IU1A 4C2ZA 4C7HA 3IU2A 4CAEA 4C2XA 4CYQA 4C7IA 2YNCC 4C68A 4B10A 5G20A 4CGPA 3H5ZA 5G1ZA 4BBHA 3JTKA 4A33A 4B11A 3IWEA 5A27A 4UFVA 5G21A 4CGMA 2YNCA 4B13A 4C2YA
chains in the Genus database with same CATH superfamily
3BLNA 3D4UA 1S7NA 2CTBA 3FRMA 1V0CA 4UCNA 2PJAA 5CNPA 4A31A 1DE4C 3IWWA 3VARA 2JDCA 3SXOA 5AG7A 4KVME 2B3UA 3PB7X 3TO7A 3CDXA 4U9YA 2POKA 4EVYA 2DXQA 2YGWA 1YQEA 1AUGA 1LFWA 4U9ZA 4EMEA 5JH9A 5K8MA 4KOUA 3PBBA 2B58A 2PVWA 4OLLA 3VH9A 1AMPA 4B5OA 5CBMA 5LYIA 4HPSA 2OR4A 3FBUA 5K8NA 4MFKA 2ATRA 5HVGA 5JM6A 4K30A 1BPNA 1Y7EA 3GUXA 4P4IA 3KR5A 4UF4A 1YR0A 3KASA 2OZGA 2ZEHA 4H2KA 4K3NA 4NSQA 4M3SA 4UIBA 3CPAA 3EXNA 4B14A 3B3WA 4YRHA 1IICA 3LMSA 5AG5A 4QBJA 5IB0A 5C88A 3W91A 2P6EA 2PJCA 3PFEA 1ELLP 4CRZB 4X2TA 1RO5A 4CRYB 4JXQA 1M4GA 5J1QA 2HQYA 3G8WA 4P44A 4KS9A 3FNCA 2JEWA 3H4QA 4P4JA 4YU9A 2CY2A 4CYQA 4F0YA 1IOFA 1I21A 4R3LA 2R98A 4ZI6A 3D7GA 1YLEA 3B3TA 1YX0A 3FEDA 1U6MA 4F0XA 2Z3KA 5FVJA 3BJ7A 4KOYA 4Q7AA 4FWUA 4CPAA 2WZNA 5EMIA 4JXRA 3UY5A 4H6ZA 2F7VA 4ZYQA 3E0KA 3R9GA 4F9UA 2RC4A 5JQ4A 3FECA 4IHMA 1BOBA 4O23A 3QB8A 4QUSA 4KSAA 4YWYA 5LRGA 3R9FA 3VWDA 2GE3A 1YW4A 1YGHA 2R8VA 1F2PA 2ZW7A 4X5KA 2R7HA 5F47A 2ZEOA 1Q7LA 4A2ZA 2DPTA 2FSRA 1NE9A 1IY7A 4AG9A 4KOTA 3VWEA 2HC9A 2CNTA 3DNSA 2Z3NA 1Y7RA 2A4NA 1FT7A 3RO0A 3SI1A 2PR1A 1ZLHA 4FD4A 3GB0A 2P0WA 4R76A 4PK3A 2Z3MA 4C2YA 1Z8TA 1YLOA 3W6SA 3PEIA 1XEBA 3LACA 2WSAA 2AFUA 2WUUA 4CGNA 4CGLA 4ZGYB 3NFZA 4R8FA 4TNUA 1CP7A 3BHXA 3FJUA 1AYEA 2REFA 2YNEA 4MHYA 1X10A 4I49A 2RB7A 2ZEGA 3I9SA 3ISZA 1Q2YA 2R1IA 1CPSA 4HNWB 4U5YA 4RI1A 2PDOA 5HVHA 4CYNA 2GFQA 3IU1A 4F6AA 3ISXA 4ORFA 4YFJA 1YREA 2QECA 3IWGA 3I3GA 3SXNA 2BSWA 1YK3A 3FYNA 3KI9A 3N7ZA 3PB9X 1H8LA 2Q4YA 2VQYA 4B10A 4CGPA 3GY9A 4BINA 4NGQA 1PCAA 4BBHA 5A27A 3EY5A 5DWNA 4CGMA 2OZHA 2Q7BA 4IAVA 4P10A 4CYOA 2JEVA 2F5IA 4R57A 4B6ZA 3ZJ0A 3C26A 3KHXA 4KOSA 3DDDA 2IJZA 5IB9A 1Z5RA 4MHPA 4OC4A 2PQ8A 2XEIA 4A38A 4W9YA 1IU8A 1Z8LA 2EO8A 2FIAA 2CXAA 3WC6A 4JJXA 1KWMA 4R3KA 4KOWA 2VEZA 2O53A 2AFOA 3BXMA 2VL1A 2FXFA 1XRYA 5LYLA 3JTKA 3FH4A 3V38A 5EC4A 3RZAA 1YSJA 4P4BA 3DGVA 3K9UA 5C82A 3D67A 1OZPA 4CAFA 3RAMA 5AG4A 1ELMP 5ISVA 4L89A 1ARMA 5DWMA 5THWA 5BWAB 1M4LA 4OIWA 1J4JA 1PU9A 4AB7A 4E2AA 2PE3A 3PP9A 1FNOA 2WYRA 3HUVA 5K8OA 1IOIA 2C6CA 2VZYA 4NGSA 1BPMA 4RN7A 5EBVA 3LODA 3TT2A 3T8WA 4GXHA 1HDUA 1LAMA 4JLYA 4MI4A 2WPXA 3D7FA 1SQHA 1PYTB 2O4HA 2GIVA 3HLPA 4H6UA 4OKOA 3S6FA 3H5ZA 4QB9A 1KUYA 3NH8A 1XF8A 2EVNA 1LAPA 4II9A 4UFVA 1LCPA 2YNCA 4UBRA 3SI2A 3KQXA 4KZTA 5KTDA 3MN8A 1CJWA 1QSNA 2Z3PA 1Z2LA 2PC1A 2YNDA 4PXEA 4X8IA 4B12A 1JWQA 1S3ZA 2ZPAA 1ZG7A 2CTCA 2JLMA 3DLJA 4MY3A 5G22A 1S5KA 2Z10A 4AG7A 1XOVA 3TO6A 3BI0A 2PJ7A 1I12A 1R3NA 2F8HA 2EWBA 2V8GA 3JRUA 3K2KA 3F5BA 3KZWA 5J8CA 5F49A 3GIUA 3TOBA 2B5GB 3KR4A 2FT0A 1YMEA 2YNCC 4OP4A 4WJBA 1XFOA 2IMOA 4KUAA 1XJOA 1XMBA 2PJ3A 4G1PA 4XNHC 2QYVA 1XE4A 5HH1A 4LQ6A 2ANPA 4JYWA 1XMTA 3CZXA 4Y49C 3S6GA 2J8MA 4AVCA 3PZJA 4KVOE 3WR7A 2B4BA 2CF4A 1WWZA 4FD5A 3DR6A 1M44A 2I00A 2ZOFA 4HNYB 3IEHA 2P6FA 5AGEA 5CPAA 3GKRA 2AFXA 4JWPA 1QSRA 2PSWA 3PB8X 4KVXA 4A30A 4FBEA 1XIXA 1IGBA 1Y0RA 1XBUA 2G3AA 4KORA 4MCSA 4UCMA 1L0CA 1TKHA 4NGRA 1Z4RA 4JD6A 1TF8A 4UCPA 5LRKA 3FF3A 2XEGA 3SJGA 3D68A 4M6IA 2PJ4A 2J8RA 2OOTA 3WC5A 2ZW5A 3MGDA 4MXUA 1S7LA 4NEXA 1TKJA 2REEA 2ZOGA 3KL9A 4KLWA 4ONWA 2PJ1A 3KKWA 5JPHA 1F2OA 1B87A 3NH4A 3LWUA 2ARHA 2GREA 2AFWA 1RTQA 2PIZA 3IO1A 5A28A 4UWIA 3V7ZA 4XPKA 3EFAA 4RS2A 4E8OA 3K9TA 3SHPA 3B3VA 1YW6A 3CT9A 4NJQA 1X12A 2GU2A 1QSMA 4P45A 5H86A 3B7IA 4CAWA 1M4DA 4R7MA 4CAEA 1UWYA 2X7BA 2B3VA 5D29A 1MJ9A 3D66A 2AFMA 2PJ5A 4OADA 1NSAA 2VXKA 2HB6A 1Z9UA 1CPXA 5G21A 3P2FA 4GM5A 1ZG8A 4FAIA 1CP6A 1CM0A 1GYTA 1P0HA 1VGYA 2PRBA 3T9YA 6CPAA 3CPXA 4BMHA 3F0AA 2GANA 4R87A 1IYKA 5I4MA 3A9LA 2FL4A 3S6KA 4IK2A 3H8FA 4DYOA 2V8DA 3B3SA 4XPLA 3B35A 4CGOA 3F8KA 4A32A 2Q0YA 1S7FA 4Q36A 4ONUA 1VHOA 1Q2DA 3P2HA 1VHEA 1IYLA 1UFHA 1TF9A 3B8GA 3SI0A 4ZY0A 3ZZIA 3IU2A 4C2XA 2FCKA 4QC6A 2Z3LA 4NCZA 3QNVA 2ODFA 3G3SA 4DNCA 5F09A 4IF5A 1I1DA 5G1ZA 4UEEA 3JUWA 3FXTA 4RUHA 2ZEDA 1VHSA 5HMNA 5F46A 2AFSA 2EBJA 3GYAA 3PRTA 3QAYA 2ZEMA 3N5FA 4MFZA 5F48A 3S6HA 1WK4A 2C27A 2NMTA 4JZ0A 4EFDA 2BL1A 4PPZA 4KSFA 4MCPA 3TTHA 3RYOA 2OU2A 8CPAA 4DUKA 4NF1A 5H84A 3KQZA 4A95A 4YGOA 4OMEA 4NGNA 2NSMA 4MBUA 5J8FA 4WWVA 2BUEA 3FB3A 4LQGA 1A2ZA 2ZELA 1M4IA 4R9MA 4F9VA 4ZY1A 1LANA 5KTCA 2HUZA 2IQ6A 2PJBA 1Y9KA 2VZZA 3IJ3A 3H8GA 2JBKA 3TX8A 4C7IA 1IB1E 3R95A 2QMLA 3OWCA 3TO9A 2V77A 1IIDA 4ZY2A 3FIXA 1CG2A 2BOAA 4TWEA 3IFEA 1BLLE 2ZEEA 3MRUA 5GCNA 2OZUA 4CAXA 1YVOA 2JDDA 2D4PA 4MMOA 3TOAA 4AVBA 3TFYA 2Z11A 2EK9A 4X3RA 2IL4A 4MHDA 4PXBA 4UEZA 2PRQA 1R43A 3D8PA 1YVKA 3KHZA 2PVVA 4NGTA 2ZENA 2QVPA 2V8HA 3NA6A 3I1UA 1BAVA 3D3SA 4C2ZA 2VBQA 4MRIA 1NMTA 3PGPA 3R9EA 3T90A 2V8VA 2I79A 3FX6A 3BJ8A 2JBJA 4MCRA 1QMUA 2Q04A 3D7DA 4PK2A 4M6GA 4CS0B 4IUSA 4UA3A 2FE7A 1Q2CA 5HVFA 4A37A 1VKCA 4MHNA 4M6HA 4MFJA 4P6YA 1LRZA 4KOVA 4B5PA 4PXCA 1RXTA 2DF5A 5AG6A 4OIDA 5IX3A 3WABA 1MJBA 3W6XA 1KUXA 2BCOA 2XEJA 1MJAA 4NJRA 4OAEA 2Q4ZA 4XPDC 3QAHA 3RNZA 4FD6A 3S9NA 3R96A 2J9AA 2DEAA 2FIWA 3PFOA 1FY7A 2Q44A 4HNXB 4Q38A 4R6TA 4ZBGA 2AE6A 4C7HA 3LD2A 4KUBA 4NGMA 2Z3OA 1ZO0A 4PSWA 4XNHB 2PJ9A 2OB0A 4Y49B 2CNSA 3V8IA 2PJ6A 4PSXA 2K5TA 2PIYA 4B13A 2BO9A 1Y0YA 3D2PA 3NE8A 1EE3P 2J8NA 4OC0A 4CYPA 3TCVA 1ZLIA 4LUAA 4MFLA 4XPDB 1OBRA 3FMCA 3IIBA 1Y9WA 4LX9A 1Z4EA 2PJ8A 3S9LA 1KZFA 3WT4A 5KTAA 3B2YA 3D7HA 4OC3A 4P4DA 4PQAA 3PB4X 3B3CA 3CXSA 2XEFA 4AVAA 4P4FA 4L8AA 4UWJA 3TE4A 5JGFA 1KUVA 4OC5A 3DR8A 2QJ8A 2H5MA 2CIJA 2B4DA 4M85A 2CNMA 2QIRA 3WC7A 4C68A 5I0CA 2ABZA 5K8PA 2P6GA 3IC1A 1MK4A 2KCWA 2PJ2A 1DTDA 4MY0A 5LYDA 4B5PB 4P4EA 4FD7A 5DS0A 1K4JA 4F8ZA 1PUAA 4H89A 4KOXA 3L2NA 4UEFA 3PBEA 3RBUA 2G9DA 3BI1A 4PXDA 2C6GA 5ELYA 4MFQA 4NFRA 3NE7A 4MHZA 4OC1A 4UIAA 1VIXA 1S7KA 4MCQA 1NSLA 2C1CA 2PJ0A 3JVNA 2VI7A 1P4NA 2FS5A 2AFZA 2PCUA 1TXRA 7CPAA 2O28A 4UFWA 1BO4A 3KGQA 2DPSA 5D8NA 2BEIA 2Q43A 3PB6X 3VATA 2Y0MA 1QQ9A 1JQGA 1LOKA 4KSIA 4QVTA 3CXPA 1ARLA 1F57A 3TC8A 4ZX8A 2PR8A 1R57A 2G3TA 1Z8WA 5G20A 4EWTA 3IGRA 1M1DA 3FEEA 3R1KA 3EC4A 4OC2A 3GLJA 2WPWA 3IWEA 3S9MA 1ON0A 4A94A 4NGPA 1B6BA 4PV6A 3SJFA 3D2MA 3NH5A 1CX8A 2NYQA 1TIQA 1CBXA 2ZW4A 2GLJA 2Q4VA 3DSBA 3FVLA 5LYFA 2HV2A 2Z0ZA 1QSOA 4ZX9A 1N71A 2D4OA 2B4DB 4CAVA 4AXVA 2EK8A 3CXQA 4KLVA 2C6PA 4A39A 1TKFA 4GS4A 4HKFA 4UFXA 5HXDA 2EUIA 2ZEPA 3H8EA 2FVGA 2GLFA 4BD9A 1S60A 1HDQA 2AJ6A 2I3CA 2Q7SA 4MJ8A 3SJXA 1HEEA 2ZEFA 3EO4A 4DJLA 2RFHA 2ZW6A 2Q51A 1QSTA 1ZG9A 5LRJA 3SJEA 2OH1A 4MFPA 2ZXVA 4A33A 4Z65A 2G0BA 1GHEA 4NXYA 4FUUA 4B11A 1Z8XA 5IV0A 5E96A 2B5GA 4E0AA 4J3GA
chains in the Genus database with same CATH topology
3BLNA 1S7NA 3FRMA 1V0CA 4UCNA 5CNPA 4A31A 2JDCA 3SXOA 5AG7A 4KVME 2B3UA 3TO7A 4U9YA 4EVYA 2DXQA 2YGWA 4U9ZA 4KOUA 2B58A 4OLLA 4B5OA 3FBUA 4MFKA 2ATRA 4K30A 1YR0A 2OZGA 4NSQA 4M3SA 3EXNA 4B14A 4YRHA 1IICA 5AG5A 4QBJA 5IB0A 5C88A 3W91A 2P6EA 4CRZB 1RO5A 4CRYB 4JXQA 1M4GA 2HQYA 3G8WA 4KS9A 3FNCA 4F0YA 3H4QA 4CYQA 2CY2A 1I21A 4R3LA 2R98A 1YLEA 1YX0A 4F0XA 1U6MA 2Z3KA 5FVJA 3BJ7A 4KOYA 4JXRA 3UY5A 4H6ZA 3E0KA 3R9GA 5JQ4A 2RC4A 4QUSA 1BOBA 3QB8A 4KSAA 3R9FA 3VWDA 2GE3A 1YGHA 2R8VA 2ZW7A 4X5KA 2R7HA 5F47A 4A2ZA 2DPTA 2FSRA 1NE9A 4AG9A 4KOTA 3VWEA 2CNTA 3DNSA 2Z3NA 1Y7RA 2A4NA 2PR1A 4FD4A 2P0WA 4PK3A 2Z3MA 4C2YA 3W6SA 1XEBA 2WSAA 2WUUA 4CGNA 4CGLA 4ZGYB 2REFA 2YNEA 4I49A 3I9SA 4HNWB 4U5YA 1Q2YA 2R1IA 4RI1A 2PDOA 4CYNA 3IU1A 4F6AA 4ORFA 4YFJA 1YREA 2QECA 3IWGA 3I3GA 3SXNA 3N7ZA 2BSWA 1YK3A 3FYNA 4B10A 4CGPA 2Q4YA 2VQYA 3GY9A 4BBHA 5A27A 3EY5A 5DWNA 4CGMA 2OZHA 2Q7BA 4CYOA 2JEVA 2F5IA 4R57A 3ZJ0A 3C26A 4KOSA 3DDDA 2PQ8A 2FIAA 2CXAA 4JJXA 4R3KA 4KOWA 2VEZA 2FXFA 3JTKA 5EC4A 3K9UA 5C82A 1OZPA 4CAFA 5AG4A 5ISVA 4L89A 5DWMA 5BWAB 1J4JA 1PU9A 4AB7A 4E2AA 3PP9A 2VZYA 5EBVA 3LODA 3TT2A 4JLYA 4MI4A 4AVBA 2WPXA 1SQHA 4H6UA 2GIVA 3S6FA 3H5ZA 4QB9A 1KUYA 1XF8A 2EVNA 4II9A 4UFVA 2YNCA 4UBRA 4KZTA 5KTDA 1CJWA 1QSNA 2Z3PA 2PC1A 2YNDA 4B12A 1S3ZA 2ZPAA 4MY3A 5G22A 2JLMA 4AG7A 1S5KA 2Z10A 3TO6A 1I12A 3F5BA 5J8CA 5F49A 3TOBA 2B5GB 2FT0A 2YNCC 4KUAA 5HH1A 4XNHC 1XE4A 1XMTA 4Y49C 3S6GA 2J8MA 4AVCA 3PZJA 4KVOE 3WR7A 2B4BA 1WWZA 4FD5A 3DR6A 1M44A 4HNYB 2I00A 2P6FA 5AGEA 3GKRA 4JWPA 1QSRA 2PSWA 4KVXA 4A30A 1XIXA 4KORA 2G3AA 4UCMA 1L0CA 4UCPA 1Z4RA 4JD6A 2J8RA 2ZW5A 3MGDA 1S7LA 4NEXA 2REEA 4KLWA 3KKWA 5JPHA 1B87A 2ARHA 5A28A 4UWIA 4XPKA 3EFAA 4RS2A 4E8OA 3SHPA 1QSMA 5H86A 4CAWA 1M4DA 4CAEA 2X7BA 2B3VA 1MJ9A 4OADA 2VXKA 1Z9UA 5G21A 3P2FA 1P0HA 1CM0A 2PRBA 3T9YA 4BMHA 3F0AA 2GANA 4R87A 1IYKA 3A9LA 2FL4A 3S6KA 4XPLA 4CGOA 3F8KA 4A32A 2Q0YA 1S7FA 4Q36A 4ONUA 1Q2DA 3P2HA 1IYLA 1UFHA 3B8GA 3ZZIA 3IU2A 4C2XA 2FCKA 4QC6A 2Z3LA 4NCZA 3G3SA 4DNCA 4IF5A 1I1DA 5G1ZA 3JUWA 3FXTA 5HMNA 1VHSA 5F46A 3GYAA 4MFZA 5F48A 3S6HA 1WK4A 2C27A 2NMTA 2BL1A 4KSFA 3TTHA 3RYOA 2OU2A 4NF1A 5H84A 4A95A 4YGOA 5J8FA 4MBUA 2BUEA 3FB3A 1M4IA 4R9MA 5KTCA 2HUZA 1Y9KA 2VZZA 4C7IA 1IB1E 3R95A 2QMLA 3OWCA 3TO9A 1IIDA 3FIXA 5GCNA 2OZUA 4CAXA 1YVOA 2JDDA 2D4PA 3TOAA 3TFYA 2Z11A 2IL4A 4MHDA 3D8PA 1YVKA 3D3SA 4C2ZA 2VBQA 1NMTA 3PGPA 3R9EA 3T90A 2I79A 3BJ8A 2Q04A 4PK2A 4CS0B 4IUSA 4UA3A 2FE7A 1Q2CA 1VKCA 4MFJA 1LRZA 4KOVA 4B5PA 1RXTA 5AG6A 5IX3A 1MJBA 3W6XA 1KUXA 4XPDC 1MJAA 4OAEA 3QAHA 4FD6A 3R96A 2FIWA 1FY7A 2Q44A 4HNXB 4Q38A 4ZBGA 2AE6A 4C7HA 3LD2A 4KUBA 2Z3OA 1ZO0A 4PSWA 4XNHB 2OB0A 4Y49B 2CNSA 3V8IA 4PSXA 2K5TA 4B13A 3D2PA 2J8NA 4CYPA 3TCVA 4LUAA 4MFLA 4XPDB 1Y9WA 4LX9A 1Z4EA 1KZFA 5KTAA 3CXSA 4AVAA 4L8AA 4UWJA 3TE4A 1KUVA 3DR8A 2H5MA 2B4DA 4M85A 2CNMA 2QIRA 5I0CA 4C68A 2P6GA 1MK4A 2KCWA 4MY0A 4B5PB 4FD7A 1K4JA 1PUAA 4H89A 4KOXA 4MFQA 3NE7A 1S7KA 1NSLA 3JVNA 2VI7A 1P4NA 2FS5A 2O28A 4UFWA 1BO4A 2DPSA 2BEIA 2Y0MA 4QVTA 3CXPA 2PR8A 1R57A 2G3TA 5G20A 3IGRA 1M1DA 3R1KA 3EC4A 3IWEA 2WPWA 1ON0A 4PV6A 1B6BA 3D2MA 1TIQA 2ZW4A 2Q4VA 3DSBA 2HV2A 2Z0ZA 1QSOA 1N71A 2D4OA 2B4DB 4CAVA 3CXQA 4KLVA 4GS4A 4HKFA 4UFXA 2EUIA 1S60A 2AJ6A 4MJ8A 3EO4A 2ZW6A 1QSTA 2OH1A 4MFPA 2ZXVA 4A33A 2G0BA 1GHEA 4NXYA 4B11A 5IV0A 5E96A 2B5GA 4E0AA 4J3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAF A;  5AG4 A;  4CYO A;  2WSA A;  2YND A;  4B12 A;  2WUU A;  4B14 A;  4CGN A;  4CYP A;  4UCN A;  5AGE A;  4CGL A;  5AG5 A;  5G22 A;  4A31 A;  5AG6 A;  5A28 A;  4CGO A;  4A32 A;  4A95 A;  4A30 A;  4UFW A;  5AG7 A;  2YNE A;  4UCM A;  4UFX A;  4CYN A;  4UCP A;  4A2Z A;  3IU1 A;  4C2Z A;  4C7H A;  3IU2 A;  4CAE A;  4C2X A;  4CYQ A;  4C7I A;  2YNC C;  4C68 A;  4B10 A;  5G20 A;  4CGP A;  3H5Z A;  5G1Z A;  4BBH A;  3JTK A;  4A33 A;  4B11 A;  3IWE A;  5A27 A;  4UFV A;  5G21 A;  4CGM A;  2YNC A;  4B13 A;  4C2Y A; 
#chains in the Genus database with same CATH topology
 3BLN A;  3D4U A;  1S7N A;  2CTB A;  3FRM A;  1V0C A;  4UCN A;  2PJA A;  5CNP A;  4A31 A;  1DE4 C;  3IWW A;  3VAR A;  2JDC A;  3SXO A;  5AG7 A;  4KVM E;  2B3U A;  3PB7 X;  3TO7 A;  3CDX A;  4U9Y A;  2POK A;  4EVY A;  2DXQ A;  2YGW A;  1YQE A;  1AUG A;  1LFW A;  4U9Z A;  4EME A;  5JH9 A;  5K8M A;  4KOU A;  3PBB A;  2B58 A;  2PVW A;  4OLL A;  3VH9 A;  1AMP A;  4B5O A;  5CBM A;  5LYI A;  4HPS A;  2OR4 A;  3FBU A;  5K8N A;  4MFK A;  2ATR A;  5HVG A;  5JM6 A;  4K30 A;  1BPN A;  1Y7E A;  3GUX A;  4P4I A;  3KR5 A;  4UF4 A;  1YR0 A;  3KAS A;  2OZG A;  2ZEH A;  4H2K A;  4K3N A;  4NSQ A;  4M3S A;  4UIB A;  3CPA A;  3EXN A;  4B14 A;  3B3W A;  4YRH A;  1IIC A;  3LMS A;  5AG5 A;  4QBJ A;  5IB0 A;  5C88 A;  3W91 A;  2P6E A;  2PJC A;  3PFE A;  1ELL P;  4CRZ B;  4X2T A;  1RO5 A;  4CRY B;  4JXQ A;  1M4G A;  5J1Q A;  2HQY A;  3G8W A;  4P44 A;  4KS9 A;  3FNC A;  2JEW A;  3H4Q A;  4P4J A;  4YU9 A;  2CY2 A;  4CYQ A;  4F0Y A;  1IOF A;  1I21 A;  4R3L A;  2R98 A;  4ZI6 A;  3D7G A;  1YLE A;  3B3T A;  1YX0 A;  3FED A;  1U6M A;  4F0X A;  2Z3K A;  5FVJ A;  3BJ7 A;  4KOY A;  4Q7A A;  4FWU A;  4CPA A;  2WZN A;  5EMI A;  4JXR A;  3UY5 A;  4H6Z A;  2F7V A;  4ZYQ A;  3E0K A;  3R9G A;  4F9U A;  2RC4 A;  5JQ4 A;  3FEC A;  4IHM A;  1BOB A;  4O23 A;  3QB8 A;  4QUS A;  4KSA A;  4YWY A;  5LRG A;  3R9F A;  3VWD A;  2GE3 A;  1YW4 A;  1YGH A;  2R8V A;  1F2P A;  2ZW7 A;  4X5K A;  2R7H A;  5F47 A;  2ZEO A;  1Q7L A;  4A2Z A;  2DPT A;  2FSR A;  1NE9 A;  1IY7 A;  4AG9 A;  4KOT A;  3VWE A;  2HC9 A;  2CNT A;  3DNS A;  2Z3N A;  1Y7R A;  2A4N A;  1FT7 A;  3RO0 A;  3SI1 A;  2PR1 A;  1ZLH A;  4FD4 A;  3GB0 A;  2P0W A;  4R76 A;  4PK3 A;  2Z3M A;  4C2Y A;  1Z8T A;  1YLO A;  3W6S A;  3PEI A;  1XEB A;  3LAC A;  2WSA A;  2AFU A;  2WUU A;  4CGN A;  4CGL A;  4ZGY B;  3NFZ A;  4R8F A;  4TNU A;  1CP7 A;  3BHX A;  3FJU A;  1AYE A;  2REF A;  2YNE A;  4MHY A;  1X10 A;  4I49 A;  2RB7 A;  2ZEG A;  3I9S A;  3ISZ A;  1Q2Y A;  2R1I A;  1CPS A;  4HNW B;  4U5Y A;  4RI1 A;  2PDO A;  5HVH A;  4CYN A;  2GFQ A;  3IU1 A;  4F6A A;  3ISX A;  4ORF A;  4YFJ A;  1YRE A;  2QEC A;  3IWG A;  3I3G A;  3SXN A;  2BSW A;  1YK3 A;  3FYN A;  3KI9 A;  3N7Z A;  3PB9 X;  1H8L A;  2Q4Y A;  2VQY A;  4B10 A;  4CGP A;  3GY9 A;  4BIN A;  4NGQ A;  1PCA A;  4BBH A;  5A27 A;  3EY5 A;  5DWN A;  4CGM A;  2OZH A;  2Q7B A;  4IAV A;  4P10 A;  4CYO A;  2JEV A;  2F5I A;  4R57 A;  4B6Z A;  3ZJ0 A;  3C26 A;  3KHX A;  4KOS A;  3DDD A;  2IJZ A;  5IB9 A;  1Z5R A;  4MHP A;  4OC4 A;  2PQ8 A;  2XEI A;  4A38 A;  4W9Y A;  1IU8 A;  1Z8L A;  2EO8 A;  2FIA A;  2CXA A;  3WC6 A;  4JJX A;  1KWM A;  4R3K A;  4KOW A;  2VEZ A;  2O53 A;  2AFO A;  3BXM A;  2VL1 A;  2FXF A;  1XRY A;  5LYL A;  3JTK A;  3FH4 A;  3V38 A;  5EC4 A;  3RZA A;  1YSJ A;  4P4B A;  3DGV A;  3K9U A;  5C82 A;  3D67 A;  1OZP A;  4CAF A;  3RAM A;  5AG4 A;  1ELM P;  5ISV A;  4L89 A;  1ARM A;  5DWM A;  5THW A;  5BWA B;  1M4L A;  4OIW A;  1J4J A;  1PU9 A;  4AB7 A;  4E2A A;  2PE3 A;  3PP9 A;  1FNO A;  2WYR A;  3HUV A;  5K8O A;  1IOI A;  2C6C A;  2VZY A;  4NGS A;  1BPM A;  4RN7 A;  5EBV A;  3LOD A;  3TT2 A;  3T8W A;  4GXH A;  1HDU A;  1LAM A;  4JLY A;  4MI4 A;  2WPX A;  3D7F A;  1SQH A;  1PYT B;  2O4H A;  2GIV A;  3HLP A;  4H6U A;  4OKO A;  3S6F A;  3H5Z A;  4QB9 A;  1KUY A;  3NH8 A;  1XF8 A;  2EVN A;  1LAP A;  4II9 A;  4UFV A;  1LCP A;  2YNC A;  4UBR A;  3SI2 A;  3KQX A;  4KZT A;  5KTD A;  3MN8 A;  1CJW A;  1QSN A;  2Z3P A;  1Z2L A;  2PC1 A;  2YND A;  4PXE A;  4X8I A;  4B12 A;  1JWQ A;  1S3Z A;  2ZPA A;  1ZG7 A;  2CTC A;  2JLM A;  3DLJ A;  4MY3 A;  5G22 A;  1S5K A;  2Z10 A;  4AG7 A;  1XOV A;  3TO6 A;  3BI0 A;  2PJ7 A;  1I12 A;  1R3N A;  2F8H A;  2EWB A;  2V8G A;  3JRU A;  3K2K A;  3F5B A;  3KZW A;  5J8C A;  5F49 A;  3GIU A;  3TOB A;  2B5G B;  3KR4 A;  2FT0 A;  1YME A;  2YNC C;  4OP4 A;  4WJB A;  1XFO A;  2IMO A;  4KUA A;  1XJO A;  1XMB A;  2PJ3 A;  4G1P A;  4XNH C;  2QYV A;  1XE4 A;  5HH1 A;  4LQ6 A;  2ANP A;  4JYW A;  1XMT A;  3CZX A;  4Y49 C;  3S6G A;  2J8M A;  4AVC A;  3PZJ A;  4KVO E;  3WR7 A;  2B4B A;  2CF4 A;  1WWZ A;  4FD5 A;  3DR6 A;  1M44 A;  2I00 A;  2ZOF A;  4HNY B;  3IEH A;  2P6F A;  5AGE A;  5CPA A;  3GKR A;  2AFX A;  4JWP A;  1QSR A;  2PSW A;  3PB8 X;  4KVX A;  4A30 A;  4FBE A;  1XIX A;  1IGB A;  1Y0R A;  1XBU A;  2G3A A;  4KOR A;  4MCS A;  4UCM A;  1L0C A;  1TKH A;  4NGR A;  1Z4R A;  4JD6 A;  1TF8 A;  4UCP A;  5LRK A;  3FF3 A;  2XEG A;  3SJG A;  3D68 A;  4M6I A;  2PJ4 A;  2J8R A;  2OOT A;  3WC5 A;  2ZW5 A;  3MGD A;  4MXU A;  1S7L A;  4NEX A;  1TKJ A;  2REE A;  2ZOG A;  3KL9 A;  4KLW A;  4ONW A;  2PJ1 A;  3KKW A;  5JPH A;  1F2O A;  1B87 A;  3NH4 A;  3LWU A;  2ARH A;  2GRE A;  2AFW A;  1RTQ A;  2PIZ A;  3IO1 A;  5A28 A;  4UWI A;  3V7Z A;  4XPK A;  3EFA A;  4RS2 A;  4E8O A;  3K9T A;  3SHP A;  3B3V A;  1YW6 A;  3CT9 A;  4NJQ A;  1X12 A;  2GU2 A;  1QSM A;  4P45 A;  5H86 A;  3B7I A;  4CAW A;  1M4D A;  4R7M A;  4CAE A;  1UWY A;  2X7B A;  2B3V A;  5D29 A;  1MJ9 A;  3D66 A;  2AFM A;  2PJ5 A;  4OAD A;  1NSA A;  2VXK A;  2HB6 A;  1Z9U A;  1CPX A;  5G21 A;  3P2F A;  4GM5 A;  1ZG8 A;  4FAI A;  1CP6 A;  1CM0 A;  1GYT A;  1P0H A;  1VGY A;  2PRB A;  3T9Y A;  6CPA A;  3CPX A;  4BMH A;  3F0A A;  2GAN A;  4R87 A;  1IYK A;  5I4M A;  3A9L A;  2FL4 A;  3S6K A;  4IK2 A;  3H8F A;  4DYO A;  2V8D A;  3B3S A;  4XPL A;  3B35 A;  4CGO A;  3F8K A;  4A32 A;  2Q0Y A;  1S7F A;  4Q36 A;  4ONU A;  1VHO A;  1Q2D A;  3P2H A;  1VHE A;  1IYL A;  1UFH A;  1TF9 A;  3B8G A;  3SI0 A;  4ZY0 A;  3ZZI A;  3IU2 A;  4C2X A;  2FCK A;  4QC6 A;  2Z3L A;  4NCZ A;  3QNV A;  2ODF A;  3G3S A;  4DNC A;  5F09 A;  4IF5 A;  1I1D A;  5G1Z A;  4UEE A;  3JUW A;  3FXT A;  4RUH A;  2ZED A;  1VHS A;  5HMN A;  5F46 A;  2AFS A;  2EBJ A;  3GYA A;  3PRT A;  3QAY A;  2ZEM A;  3N5F A;  4MFZ A;  5F48 A;  3S6H A;  1WK4 A;  2C27 A;  2NMT A;  4JZ0 A;  4EFD A;  2BL1 A;  4PPZ A;  4KSF A;  4MCP A;  3TTH A;  3RYO A;  2OU2 A;  8CPA A;  4DUK A;  4NF1 A;  5H84 A;  3KQZ A;  4A95 A;  4YGO A;  4OME A;  4NGN A;  2NSM A;  4MBU A;  5J8F A;  4WWV A;  2BUE A;  3FB3 A;  4LQG A;  1A2Z A;  2ZEL A;  1M4I A;  4R9M A;  4F9V A;  4ZY1 A;  1LAN A;  5KTC A;  2HUZ A;  2IQ6 A;  2PJB A;  1Y9K A;  2VZZ A;  3IJ3 A;  3H8G A;  2JBK A;  3TX8 A;  4C7I A;  1IB1 E;  3R95 A;  2QML A;  3OWC A;  3TO9 A;  2V77 A;  1IID A;  4ZY2 A;  3FIX A;  1CG2 A;  2BOA A;  4TWE A;  3IFE A;  1BLL E;  2ZEE A;  3MRU A;  5GCN A;  2OZU A;  4CAX A;  1YVO A;  2JDD A;  2D4P A;  4MMO A;  3TOA A;  4AVB A;  3TFY A;  2Z11 A;  2EK9 A;  4X3R A;  2IL4 A;  4MHD A;  4PXB A;  4UEZ A;  2PRQ A;  1R43 A;  3D8P A;  1YVK A;  3KHZ A;  2PVV A;  4NGT A;  2ZEN A;  2QVP A;  2V8H A;  3NA6 A;  3I1U A;  1BAV A;  3D3S A;  4C2Z A;  2VBQ A;  4MRI A;  1NMT A;  3PGP A;  3R9E A;  3T90 A;  2V8V A;  2I79 A;  3FX6 A;  3BJ8 A;  2JBJ A;  4MCR A;  1QMU A;  2Q04 A;  3D7D A;  4PK2 A;  4M6G A;  4CS0 B;  4IUS A;  4UA3 A;  2FE7 A;  1Q2C A;  5HVF A;  4A37 A;  1VKC A;  4MHN A;  4M6H A;  4MFJ A;  4P6Y A;  1LRZ A;  4KOV A;  4B5P A;  4PXC A;  1RXT A;  2DF5 A;  5AG6 A;  4OID A;  5IX3 A;  3WAB A;  1MJB A;  3W6X A;  1KUX A;  2BCO A;  2XEJ A;  1MJA A;  4NJR A;  4OAE A;  2Q4Z A;  4XPD C;  3QAH A;  3RNZ A;  4FD6 A;  3S9N A;  3R96 A;  2J9A A;  2DEA A;  2FIW A;  3PFO A;  1FY7 A;  2Q44 A;  4HNX B;  4Q38 A;  4R6T A;  4ZBG A;  2AE6 A;  4C7H A;  3LD2 A;  4KUB A;  4NGM A;  2Z3O A;  1ZO0 A;  4PSW A;  4XNH B;  2PJ9 A;  2OB0 A;  4Y49 B;  2CNS A;  3V8I A;  2PJ6 A;  4PSX A;  2K5T A;  2PIY A;  4B13 A;  2BO9 A;  1Y0Y A;  3D2P A;  3NE8 A;  1EE3 P;  2J8N A;  4OC0 A;  4CYP A;  3TCV A;  1ZLI A;  4LUA A;  4MFL A;  4XPD B;  1OBR A;  3FMC A;  3IIB A;  1Y9W A;  4LX9 A;  1Z4E A;  2PJ8 A;  3S9L A;  1KZF A;  3WT4 A;  5KTA A;  3B2Y A;  3D7H A;  4OC3 A;  4P4D A;  4PQA A;  3PB4 X;  3B3C A;  3CXS A;  2XEF A;  4AVA A;  4P4F A;  4L8A A;  4UWJ A;  3TE4 A;  5JGF A;  1KUV A;  4OC5 A;  3DR8 A;  2QJ8 A;  2H5M A;  2CIJ A;  2B4D A;  4M85 A;  2CNM A;  2QIR A;  3WC7 A;  4C68 A;  5I0C A;  2ABZ A;  5K8P A;  2P6G A;  3IC1 A;  1MK4 A;  2KCW A;  2PJ2 A;  1DTD A;  4MY0 A;  5LYD A;  4B5P B;  4P4E A;  4FD7 A;  5DS0 A;  1K4J A;  4F8Z A;  1PUA A;  4H89 A;  4KOX A;  3L2N A;  4UEF A;  3PBE A;  3RBU A;  2G9D A;  3BI1 A;  4PXD A;  2C6G A;  5ELY A;  4MFQ A;  4NFR A;  3NE7 A;  4MHZ A;  4OC1 A;  4UIA A;  1VIX A;  1S7K A;  4MCQ A;  1NSL A;  2C1C A;  2PJ0 A;  3JVN A;  2VI7 A;  1P4N A;  2FS5 A;  2AFZ A;  2PCU A;  1TXR A;  7CPA A;  2O28 A;  4UFW A;  1BO4 A;  3KGQ A;  2DPS A;  5D8N A;  2BEI A;  2Q43 A;  3PB6 X;  3VAT A;  2Y0M A;  1QQ9 A;  1JQG A;  1LOK A;  4KSI A;  4QVT A;  3CXP A;  1ARL A;  1F57 A;  3TC8 A;  4ZX8 A;  2PR8 A;  1R57 A;  2G3T A;  1Z8W A;  5G20 A;  4EWT A;  3IGR A;  1M1D A;  3FEE A;  3R1K A;  3EC4 A;  4OC2 A;  3GLJ A;  2WPW A;  3IWE A;  3S9M A;  1ON0 A;  4A94 A;  4NGP A;  1B6B A;  4PV6 A;  3SJF A;  3D2M A;  3NH5 A;  1CX8 A;  2NYQ A;  1TIQ A;  1CBX A;  2ZW4 A;  2GLJ A;  2Q4V A;  3DSB A;  3FVL A;  5LYF A;  2HV2 A;  2Z0Z A;  1QSO A;  4ZX9 A;  1N71 A;  2D4O A;  2B4D B;  4CAV A;  4AXV A;  2EK8 A;  3CXQ A;  4KLV A;  2C6P A;  4A39 A;  1TKF A;  4GS4 A;  4HKF A;  4UFX A;  5HXD A;  2EUI A;  2ZEP A;  3H8E A;  2FVG A;  2GLF A;  4BD9 A;  1S60 A;  1HDQ A;  2AJ6 A;  2I3C A;  2Q7S A;  4MJ8 A;  3SJX A;  1HEE A;  2ZEF A;  3EO4 A;  4DJL A;  2RFH A;  2ZW6 A;  2Q51 A;  1QST A;  1ZG9 A;  5LRJ A;  3SJE A;  2OH1 A;  4MFP A;  2ZXV A;  4A33 A;  4Z65 A;  2G0B A;  1GHE A;  4NXY A;  4FUU A;  4B11 A;  1Z8X A;  5IV0 A;  5E96 A;  2B5G A;  4E0A A;  4J3G A; 
#chains in the Genus database with same CATH homology
 3BLN A;  1S7N A;  3FRM A;  1V0C A;  4UCN A;  5CNP A;  4A31 A;  2JDC A;  3SXO A;  5AG7 A;  4KVM E;  2B3U A;  3TO7 A;  4U9Y A;  4EVY A;  2DXQ A;  2YGW A;  4U9Z A;  4KOU A;  2B58 A;  4OLL A;  4B5O A;  3FBU A;  4MFK A;  2ATR A;  4K30 A;  1YR0 A;  2OZG A;  4NSQ A;  4M3S A;  3EXN A;  4B14 A;  4YRH A;  1IIC A;  5AG5 A;  4QBJ A;  5IB0 A;  5C88 A;  3W91 A;  2P6E A;  4CRZ B;  1RO5 A;  4CRY B;  4JXQ A;  1M4G A;  2HQY A;  3G8W A;  4KS9 A;  3FNC A;  4F0Y A;  3H4Q A;  4CYQ A;  2CY2 A;  1I21 A;  4R3L A;  2R98 A;  1YLE A;  1YX0 A;  4F0X A;  1U6M A;  2Z3K A;  5FVJ A;  3BJ7 A;  4KOY A;  4JXR A;  3UY5 A;  4H6Z A;  3E0K A;  3R9G A;  5JQ4 A;  2RC4 A;  4QUS A;  1BOB A;  3QB8 A;  4KSA A;  3R9F A;  3VWD A;  2GE3 A;  1YGH A;  2R8V A;  2ZW7 A;  4X5K A;  2R7H A;  5F47 A;  4A2Z A;  2DPT A;  2FSR A;  1NE9 A;  4AG9 A;  4KOT A;  3VWE A;  2CNT A;  3DNS A;  2Z3N A;  1Y7R A;  2A4N A;  2PR1 A;  4FD4 A;  2P0W A;  4PK3 A;  2Z3M A;  4C2Y A;  3W6S A;  1XEB A;  2WSA A;  2WUU A;  4CGN A;  4CGL A;  4ZGY B;  2REF A;  2YNE A;  4I49 A;  3I9S A;  4HNW B;  4U5Y A;  1Q2Y A;  2R1I A;  4RI1 A;  2PDO A;  4CYN A;  3IU1 A;  4F6A A;  4ORF A;  4YFJ A;  1YRE A;  2QEC A;  3IWG A;  3I3G A;  3SXN A;  3N7Z A;  2BSW A;  1YK3 A;  3FYN A;  4B10 A;  4CGP A;  2Q4Y A;  2VQY A;  3GY9 A;  4BBH A;  5A27 A;  3EY5 A;  5DWN A;  4CGM A;  2OZH A;  2Q7B A;  4CYO A;  2JEV A;  2F5I A;  4R57 A;  3ZJ0 A;  3C26 A;  4KOS A;  3DDD A;  2PQ8 A;  2FIA A;  2CXA A;  4JJX A;  4R3K A;  4KOW A;  2VEZ A;  2FXF A;  3JTK A;  5EC4 A;  3K9U A;  5C82 A;  1OZP A;  4CAF A;  5AG4 A;  5ISV A;  4L89 A;  5DWM A;  5BWA B;  1J4J A;  1PU9 A;  4AB7 A;  4E2A A;  3PP9 A;  2VZY A;  5EBV A;  3LOD A;  3TT2 A;  4JLY A;  4MI4 A;  4AVB A;  2WPX A;  1SQH A;  4H6U A;  2GIV A;  3S6F A;  3H5Z A;  4QB9 A;  1KUY A;  1XF8 A;  2EVN A;  4II9 A;  4UFV A;  2YNC A;  4UBR A;  4KZT A;  5KTD A;  1CJW A;  1QSN A;  2Z3P A;  2PC1 A;  2YND A;  4B12 A;  1S3Z A;  2ZPA A;  4MY3 A;  5G22 A;  2JLM A;  4AG7 A;  1S5K A;  2Z10 A;  3TO6 A;  1I12 A;  3F5B A;  5J8C A;  5F49 A;  3TOB A;  2B5G B;  2FT0 A;  2YNC C;  4KUA A;  5HH1 A;  4XNH C;  1XE4 A;  1XMT A;  4Y49 C;  3S6G A;  2J8M A;  4AVC A;  3PZJ A;  4KVO E;  3WR7 A;  2B4B A;  1WWZ A;  4FD5 A;  3DR6 A;  1M44 A;  4HNY B;  2I00 A;  2P6F A;  5AGE A;  3GKR A;  4JWP A;  1QSR A;  2PSW A;  4KVX A;  4A30 A;  1XIX A;  4KOR A;  2G3A A;  4UCM A;  1L0C A;  4UCP A;  1Z4R A;  4JD6 A;  2J8R A;  2ZW5 A;  3MGD A;  1S7L A;  4NEX A;  2REE A;  4KLW A;  3KKW A;  5JPH A;  1B87 A;  2ARH A;  5A28 A;  4UWI A;  4XPK A;  3EFA A;  4RS2 A;  4E8O A;  3SHP A;  1QSM A;  5H86 A;  4CAW A;  1M4D A;  4CAE A;  2X7B A;  2B3V A;  1MJ9 A;  4OAD A;  2VXK A;  1Z9U A;  5G21 A;  3P2F A;  1P0H A;  1CM0 A;  2PRB A;  3T9Y A;  4BMH A;  3F0A A;  2GAN A;  4R87 A;  1IYK A;  3A9L A;  2FL4 A;  3S6K A;  4XPL A;  4CGO A;  3F8K A;  4A32 A;  2Q0Y A;  1S7F A;  4Q36 A;  4ONU A;  1Q2D A;  3P2H A;  1IYL A;  1UFH A;  3B8G A;  3ZZI A;  3IU2 A;  4C2X A;  2FCK A;  4QC6 A;  2Z3L A;  4NCZ A;  3G3S A;  4DNC A;  4IF5 A;  1I1D A;  5G1Z A;  3JUW A;  3FXT A;  5HMN A;  1VHS A;  5F46 A;  3GYA A;  4MFZ A;  5F48 A;  3S6H A;  1WK4 A;  2C27 A;  2NMT A;  2BL1 A;  4KSF A;  3TTH A;  3RYO A;  2OU2 A;  4NF1 A;  5H84 A;  4A95 A;  4YGO A;  5J8F A;  4MBU A;  2BUE A;  3FB3 A;  1M4I A;  4R9M A;  5KTC A;  2HUZ A;  1Y9K A;  2VZZ A;  4C7I A;  1IB1 E;  3R95 A;  2QML A;  3OWC A;  3TO9 A;  1IID A;  3FIX A;  5GCN A;  2OZU A;  4CAX A;  1YVO A;  2JDD A;  2D4P A;  3TOA A;  3TFY A;  2Z11 A;  2IL4 A;  4MHD A;  3D8P A;  1YVK A;  3D3S A;  4C2Z A;  2VBQ A;  1NMT A;  3PGP A;  3R9E A;  3T90 A;  2I79 A;  3BJ8 A;  2Q04 A;  4PK2 A;  4CS0 B;  4IUS A;  4UA3 A;  2FE7 A;  1Q2C A;  1VKC A;  4MFJ A;  1LRZ A;  4KOV A;  4B5P A;  1RXT A;  5AG6 A;  5IX3 A;  1MJB A;  3W6X A;  1KUX A;  4XPD C;  1MJA A;  4OAE A;  3QAH A;  4FD6 A;  3R96 A;  2FIW A;  1FY7 A;  2Q44 A;  4HNX B;  4Q38 A;  4ZBG A;  2AE6 A;  4C7H A;  3LD2 A;  4KUB A;  2Z3O A;  1ZO0 A;  4PSW A;  4XNH B;  2OB0 A;  4Y49 B;  2CNS A;  3V8I A;  4PSX A;  2K5T A;  4B13 A;  3D2P A;  2J8N A;  4CYP A;  3TCV A;  4LUA A;  4MFL A;  4XPD B;  1Y9W A;  4LX9 A;  1Z4E A;  1KZF A;  5KTA A;  3CXS A;  4AVA A;  4L8A A;  4UWJ A;  3TE4 A;  1KUV A;  3DR8 A;  2H5M A;  2B4D A;  4M85 A;  2CNM A;  2QIR A;  5I0C A;  4C68 A;  2P6G A;  1MK4 A;  2KCW A;  4MY0 A;  4B5P B;  4FD7 A;  1K4J A;  1PUA A;  4H89 A;  4KOX A;  4MFQ A;  3NE7 A;  1S7K A;  1NSL A;  3JVN A;  2VI7 A;  1P4N A;  2FS5 A;  2O28 A;  4UFW A;  1BO4 A;  2DPS A;  2BEI A;  2Y0M A;  4QVT A;  3CXP A;  2PR8 A;  1R57 A;  2G3T A;  5G20 A;  3IGR A;  1M1D A;  3R1K A;  3EC4 A;  3IWE A;  2WPW A;  1ON0 A;  4PV6 A;  1B6B A;  3D2M A;  1TIQ A;  2ZW4 A;  2Q4V A;  3DSB A;  2HV2 A;  2Z0Z A;  1QSO A;  1N71 A;  2D4O A;  2B4D B;  4CAV A;  3CXQ A;  4KLV A;  4GS4 A;  4HKF A;  4UFX A;  2EUI A;  1S60 A;  2AJ6 A;  4MJ8 A;  3EO4 A;  2ZW6 A;  1QST A;  2OH1 A;  4MFP A;  2ZXV A;  4A33 A;  2G0B A;  1GHE A;  4NXY A;  4B11 A;  5IV0 A;  5E96 A;  2B5G A;  4E0A A;  4J3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...