2HQYA

Crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
MIPFKDITLADRDTITAFTMKSDRRNCDLSFSNLCSWRFLYDTQFAVIDDFLVFKFWAGEQLAYMMPVGNGDLKAVLRKLIEDADKEKHNFCMLGVCSNMRADLEAILPERFIFTEDRAYADYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNFEALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLSYQPVTILEKYMACLKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09924 DUF2156 Uncharacterised conserved protein (DUF2156)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA01
2RC4A 1M1DA 2J8RA 3D2PA 3NE7A 2ARHA 4B5OA 2ZW4A 4KVXA 2OB0A 2VZZA 3JVNA 2P0WA 4OAEA 5H84A 1IIDA 1M4DA 2BL1A 4NCZA 2ZPAA 1OZPA 2PC1A 5IV0A 3B8GA 1I12A 5HMNA 4XPKA 1XE4A 4ORFA 3BJ7A 3PZJA 1SQHA 1J4JA 1IICA 1YGHA 3R96A 3R9FA 4R57A 4FD7A 2R1IA 4GS4A 3R9EA 2Q44A 4L8AA 2BEIA 2Z11A 4FD5A 4FD6A 2PR8A 2FS5A 2DXQA 1NSLA 3TO9A 4L89A 3BJ8A 3P2FA 1IYKA 1TIQA 2JDDA 1P0HA 4NEXA 2PR1A 3DSBA 3SXOA 3IWGA 1Z9UA 1M4GA 4ZBGA 4UA3A 3PGPA 4F6AA 4R87A 4QVTA 4KOUA 1IB1E 4E0AA 4IUSA 3G8WA 5KTDA 2Q7BA 3TO7A 4PK2A 3G3SA 2G3AA 2FIWA 4QB9A 3SXNA 1Y7RA 3I3GA 4R9MA 2NMTA 4KOXA 2VBQA 1YLEA 2AE6A 4MY0A 1QSRA 2OZGA 2Q0YA 2ZW7A 4M85A 4KLWA 1S7FA 2ZXVA 3IGRA 3QAHA 3D8PA 1Q2DA 2CY2A 4H6ZA 1Z4EA 2B58A 3S6HA 3V8IA 2B3VA 2FXFA 4M3SA 3R95A 5CNPA 3VWEA 4R3LA 1WWZA 3EC4A 3LD2A 3W6XA 5J8FA 3QB8A 2P6GA 4KOSA 4KLVA 4OLLA 3T9YA 2CNTA 2Q4VA 3DDDA 4UWIA 1XF8A 3FYNA 4AVBA 1XEBA 1B6BA 4OADA 2G0BA 2HUZA 4CAVA 1GHEA 2CNSA 4DNCA 1UFHA 1BO4A 2J8NA 4UBRA 1MJ9A 2FIAA 3GKRA 3CXQA 5E96A 3FXTA 5KTAA 3R9GA 1YX0A 2R98A 4MJ8A 2Z0ZA 2VI7A 2WPWA 1QSOA 4JJXA 4KVME 2R7HA 4IF5A 5C82A 1KUVA 4E2AA 2ZW5A 2I00A 2WPXA 4NXYA 4KOWA 3K9UA 4JXRA 4CAXA 5GCNA 4MI4A 4QUSA 3D2MA 5HH1A 3TE4A 1KUYA 4YRHA 3DR6A 5JPHA 2GIVA 2Q4YA 3TFYA 2B5GA 3JUWA 1XMTA 4KOYA 3T90A 1L0CA 4LUAA 2D4OA 1S5KA 3KKWA 5IB0A 1Q2CA 2B3UA 4AG9A 1S3ZA 2VZYA 4JLYA 3P2HA 3ZZIA 1P4NA 2QECA 4YFJA 4HNWB 4UWJA 2JLMA 3TO6A 2AJ6A 4KZTA 1I21A 3EO4A 4HKFA 5DWNA 4AVAA 1MJBA 1PU9A 1MJAA 3FIXA 4KOTA 4KOVA 5F49A 1CJWA 2O28A 4U9ZA 4JXQA 2HV2A 3R1KA 1U6MA 4Y49C 4B5PA 1S7NA 5J8CA 1QSTA 4PK3A 4K30A 1BOBA 4H6UA 1N71A 1K4JA 3F8KA 4AB7A 3D3SA 2KCWA 1VKCA 1S7LA 1KZFA 2QIRA 2OH1A 1Q2YA 1M44A 2I79A 2A4NA 4PSXA 4QC6A 3EFAA 4XPLA 4JD6A 4PV6A 2H5MA 3CXSA 2QMLA 2B4DA 4KUBA 4NF1A 3E0KA 4RI1A 1S60A 4CAWA 3OWCA 2Q04A 4E8OA 2P6FA 3EY5A 2JEVA 3S6GA 3TOAA 1YVOA 2JDCA 3TT2A 2ZW6A 2OZUA 2ATRA 1B87A 2VXKA 5ISVA 2R8VA 4EVYA 4MY3A 1NE9A 4R3KA 3VWDA 1I1DA 3MGDA 3W91A 1Y9WA 4U9YA 2B4BA 1XIXA 2Y0MA 3H4QA 3CXPA 4XPDB 1R57A 1KUXA 2BSWA 4NSQA 2P6EA 3DR8A 4XNHC 2FL4A 1PUAA 3GY9A 4II9A 5F46A 3GYAA 4X5KA 2HQYA 1QSNA 4Y49B 1ON0A 3TCVA 4YGOA 4CRYB 4HNYB 5FVJA 3TOBA 2REFA 5F48A 3C26A 3I9SA 2FT0A 3FRMA 2B5GB 2REEA 5DWMA 4JWPA 1MK4A 1V0CA 2VEZA 1YR0A 2PSWA 3EXNA 4MBUA 4XPDC 2EUIA 2CNMA 5EBVA 4RS2A 3FNCA 1M4IA 4BMHA 3RYOA 4QBJA 4PSWA 3FBUA 2X7BA 2Z10A 4J3GA 4AVCA 4H89A 4KUAA 3WR7A 3ZJ0A 3S6KA 1LRZA 3SHPA 3FB3A 2K5TA 5EC4A 5JQ4A 2OU2A 4ONUA 1Z4RA 4KORA 4CS0B 5I0CA 5C88A 2GANA 2GE3A 4FD4A 3DNSA 3UY5A 1S7KA 2EVNA 4LX9A 1RXTA 2IL4A 1VHSA 4HNXB 5H86A 3LODA 3F0AA 1QSMA 3W6SA 5KTCA 1NMTA 4B5PB 2FE7A 3BLNA 4MHDA 2PQ8A 1CM0A 2F5IA 2VQYA 1YK3A 4F0YA 1RO5A 1Y9KA 5IX3A 1WK4A 2FCKA 2PRBA 3S6FA 3F5BA 4KVOE 4I49A 3TTHA 4XNHB 1FY7A 2C27A 4CRZB 2G3TA 1YREA 4U5YA 2D4PA 1IYLA 1YVKA 3PP9A 4AG7A 5F47A 2OZHA 2BUEA 2FSRA 3N7ZA 2B4DB 2J8MA 2PDOA
chains in the Genus database with same CATH superfamily
2RC4A 1M1DA 2J8RA 3D2PA 3NE7A 5F09A 2ARHA 4B5OA 2EK8A 1LAPA 2PIZA 2ZW4A 3B3TA 3GIUA 4KVXA 2OB0A 3FEDA 4MFQA 4B14A 2I3CA 2VZZA 3B3CA 3JVNA 2P0WA 3KR5A 4OAEA 5H84A 4EFDA 4KSAA 1CBXA 2EWBA 1IIDA 1M4DA 2BL1A 2BO9A 4NCZA 2HC9A 4OIDA 1JWQA 4P4JA 2ZPAA 4PXDA 2Z3KA 1OZPA 3PB8X 2ZOFA 2PC1A 4GXHA 3B8GA 1CP6A 1I12A 4OIWA 5HMNA 5IV0A 3KHZA 4XPKA 3MN8A 1XE4A 5LYFA 4ORFA 4NJQA 4TWEA 4YWYA 2PJ4A 2ZEHA 3BJ7A 2DPSA 3CDXA 8CPAA 3PZJA 1RTQA 3LWUA 3D68A 4FWUA 1SQHA 4ONWA 4PQAA 1J4JA 5K8PA 5LYIA 1IICA 1YGHA 1EE3P 3R96A 4CAFA 4WWVA 5G21A 3R9FA 1CPSA 4R57A 4FD7A 1TF8A 4M6HA 2Z3OA 4EWTA 4NGRA 2R1IA 2PJ8A 4GS4A 3R9EA 2Q44A 4PXCA 4L8AA 2BEIA 3RAMA 2Z11A 4MFPA 4X8IA 4FBEA 5DS0A 2BOAA 2JBKA 4FD5A 3RZAA 2POKA 4P4EA 4C2YA 4FD6A 3QNVA 2PR8A 3FECA 3GUXA 3IU2A 2Q51A 2FS5A 2DXQA 4Z65A 1NSLA 3TO9A 4L89A 2ZEGA 3BJ8A 3SI0A 3S9MA 5CPAA 3P2FA 5LRGA 3RO0A 4P10A 4OC4A 1IYKA 3IIBA 3PBEA 3LACA 1TIQA 3IU1A 3IJ3A 2JDDA 3H8GA 1P0HA 4NEXA 2PR1A 3DSBA 4NGTA 1ZO0A 2PCUA 3SXOA 4CYPA 3CZXA 3IWGA 1Z9UA 2ZEFA 1M4GA 1Z8XA 4ZBGA 4UA3A 3PB9X 4UFVA 3PGPA 4F6AA 4R87A 4QVTA 4DYOA 2WUUA 4B11A 4CPAA 5A28A 4KOUA 1IB1E 4NGNA 2ZEMA 5D29A 4E0AA 3HLPA 4MHPA 4IUSA 4Q7AA 3G8WA 5KTDA 2C1CA 2Q7BA 3SI2A 4P4FA 3TO7A 4PK2A 3S9LA 2WZNA 2G3AA 3G3SA 1XBUA 2FIWA 4QB9A 3SXNA 1Y7RA 3D7DA 3I3GA 4R9MA 4B6ZA 4M6IA 1VHOA 2NMTA 2QJ8A 2VBQA 1QMUA 3DGVA 4KOXA 3NH4A 1YLEA 2AE6A 4JYWA 4A33A 4MY0A 1QSRA 4DJLA 1DE4C 2OZGA 1X10A 2PJ6A 4B13A 1CX8A 2Q0YA 2ZW7A 3BXMA 4M85A 3FMCA 4KLWA 1S7FA 4F9UA 2ZXVA 2BCOA 4UEZA 3IGRA 4OKOA 3QAHA 5JH9A 3D8PA 2F8HA 3FVLA 4CYQA 4MFJA 1Q2DA 2CY2A 3SJXA 2Q43A 1VHEA 4H6ZA 4R7MA 4EMEA 3PFOA 4UCMA 4UCNA 1ARLA 1BPNA 5BWAB 1Z4EA 3MRUA 1ZLHA 2B58A 1XOVA 1HEEA 3I1UA 3S6HA 2B3VA 2FXFA 3V8IA 3CPXA 4M3SA 3R95A 5D8NA 3IO1A 2AFUA 5CNPA 3VWEA 4CYOA 2IMOA 4R3LA 3K9TA 1WWZA 3EC4A 3LD2A 3W6XA 4CYNA 5J8FA 3QB8A 3PBBA 4CGOA 5K8NA 1UWYA 3VARA 2P6GA 2QVPA 4KOSA 4KLVA 4OLLA 3T9YA 2CNTA 4A31A 3NH8A 2Q4VA 2C6CA 3DDDA 4UWIA 3RBUA 1XF8A 3FYNA 4AVBA 2Z3NA 3H8FA 1XEBA 1B6BA 3BHXA 4OADA 2G0BA 2YNEA 2HUZA 2ANPA 4CAVA 1GYTA 2CNSA 4DNCA 3D4UA 1UFHA 1BO4A 2J8NA 2PJCA 4UBRA 4CGMA 1MJ9A 4FUUA 2FIAA 2GU2A 4P44A 5AG4A 1ZLIA 4OC0A 2PJBA 2PJ0A 2QYVA 3ISZA 3GKRA 3CXQA 3IWWA 3NH5A 5E96A 4IHMA 4R6TA 3FXTA 5KTAA 3R9GA 2GFQA 1YX0A 2R98A 4W9YA 3K2KA 3DLJA 4C7IA 2IQ6A 4ZGYB 4MJ8A 3HUVA 2Z0ZA 2VI7A 2WPWA 1BAVA 1QSOA 2XEGA 4JJXA 4ZI6A 1H8LA 4FAIA 4KVME 2R7HA 2ZEPA 3H5ZA 4IF5A 4F9VA 1IY7A 5C82A 4OC3A 2YGWA 1KUVA 4UIBA 5THWA 4E2AA 2PIYA 4TNUA 2ZW5A 3KL9A 3VH9A 2I00A 2WPXA 4NXYA 4KOWA 1Z2LA 3K9UA 3WABA 3KHXA 1IU8A 4JXRA 3FF3A 5GCNA 3PB6X 4CAXA 4MI4A 4QUSA 3D2MA 5HH1A 3TE4A 1KUYA 4C7HA 2PVVA 4BINA 2EO8A 4YRHA 3NA6A 1LCPA 3DR6A 5JPHA 1FNOA 2GIVA 2Q4YA 2V8DA 2C6PA 4DUKA 2Z3LA 1Z5RA 3NE8A 2ODFA 2XEIA 5JM6A 3TFYA 1Y0YA 2B5GA 3JUWA 4LQGA 1XMTA 1YLOA 4KOYA 4PPZA 3T90A 4M6GA 1L0CA 4LUAA 4A32A 2V8VA 1CPXA 2D4OA 1JQGA 1S5KA 3KKWA 4UFXA 5IB0A 3IEHA 2DEAA 1KWMA 1BPMA 2DPTA 3PB7X 5AG5A 7CPAA 1Q2CA 3KI9A 2B3UA 2JEWA 4AG9A 3PFEA 1S3ZA 5LYLA 2VZYA 4JLYA 4CGNA 3QAYA 4A2ZA 3P2HA 3ZZIA 2G9DA 4IAVA 3KQXA 1P4NA 1CG2A 2QECA 3RNZA 4F0XA 2GLFA 5HVGA 3B35A 4YFJA 4HNWB 4OC1A 4UWJA 2JLMA 3TO6A 4C2XA 2AJ6A 2DF5A 4OC5A 4KZTA 1I21A 3BI1A 3EO4A 4HKFA 4R8FA 5DWNA 3PEIA 4AVAA 1MJBA 3D67A 1PU9A 2GREA 4K3NA 1MJAA 3FIXA 4KOTA 2J9AA 4KOVA 4WJBA 4HPSA 5F49A 1CJWA 2O28A 4U9ZA 1AYEA 1TKJA 4JXQA 2HV2A 3R1KA 4BBHA 3GB0A 4A39A 1Q7LA 1U6MA 4Y49C 5J1QA 4ZYQA 3KR4A 3PB4X 3SJFA 4B5PA 3CPAA 5LRKA 1S7NA 5J8CA 1QSTA 2CIJA 4PK3A 1TKFA 3IWEA 2AFOA 4H2KA 4K30A 4CGLA 1BOBA 4H6UA 1HDQA 1N71A 1K4JA 1YMEA 2WSAA 3F8KA 4AB7A 2PJAA 3D3SA 4RUHA 2KCWA 2YNCC 1VKCA 4NJRA 1S7LA 4A95A 1KZFA 2QIRA 3B7IA 4GM5A 4Q36A 2AFMA 2CTCA 2OH1A 4MCPA 1Q2YA 1M44A 2AFWA 2CTBA 2I79A 2A4NA 1A2ZA 2Q4ZA 4PSXA 4QC6A 2RB7A 3EFAA 4XPLA 4JD6A 2XEFA 2V8HA 4PV6A 4BD9A 1LOKA 1YW4A 2Z3PA 2H5MA 3CXSA 2QMLA 2B4DA 4KUBA 2Z3MA 3IFEA 1YQEA 4NF1A 1XJOA 3E0KA 5LYDA 4RI1A 1S60A 3V7ZA 3WC6A 1YSJA 4P6YA 4CAWA 3OWCA 2Q04A 4A94A 3L2NA 4AXVA 5G20A 2ZENA 3FH4A 4E8OA 2ZOGA 3VATA 1OBRA 2P6FA 3TX8A 3B3SA 1TF9A 1LANA 1Z8WA 3EY5A 5I4MA 2JEVA 1FT7A 3S6GA 3TOAA 1YVOA 1PCAA 2JDCA 3TT2A 1VIXA 3TC8A 4MHYA 4C2ZA 1QQ9A 2ZW6A 2OZUA 3B3WA 1HDUA 2ATRA 2PRQA 3LMSA 1B87A 2VXKA 3KASA 4X2TA 4P45A 1IOFA 1IGBA 4MFKA 3KGQA 5ISVA 3CT9A 2R8VA 4B10A 4ZY2A 4EVYA 4X3RA 4MY3A 1NE9A 2PJ9A 4R3KA 3VWDA 1I1DA 2NYQA 5A27A 3MGDA 2PJ3A 4O23A 3W91A 3JRUA 1AMPA 5ELYA 1Y9WA 4U9YA 2B4BA 1XIXA 2Y0MA 3H4QA 3ISXA 1TKHA 2ZEEA 3CXPA 4XPDB 4UEEA 1R57A 4A30A 1KUXA 5HXDA 4CAEA 2BSWA 4ZX9A 4NSQA 2P6EA 3DR8A 4UEFA 4LQ6A 4XNHC 1ZG9A 4MXUA 2PVWA 2FL4A 1PUAA 1ARMA 2YNCA 3GY9A 4II9A 2ZEDA 5F46A 3GYAA 4MMOA 4X5KA 3SJGA 5K8MA 4MRIA 2VL1A 2HQYA 4P4BA 1QSNA 4Y49B 1XMBA 1ON0A 3TCVA 2O4HA 4NFRA 5G22A 4YGOA 1Y0RA 2O53A 4NGSA 4CRYB 3BI0A 4HNYB 1R43A 2PJ5A 5FVJA 1CP7A 5G1ZA 2IJZA 4OC2A 1XRYA 3FX6A 3B2YA 1Y7EA 2YNDA 4A38A 3TOBA 2PE3A 2REFA 5F48A 4ZX8A 3C26A 2ABZA 3I9SA 4KSIA 4CGPA 2FT0A 1Z8LA 2JBJA 3FRMA 2B5GB 4F8ZA 2REEA 5DWMA 4JWPA 1F2OA 1ELLP 1MK4A 3D7FA 3FJUA 4MFZA 4NGPA 3SJEA 4C68A 5IB9A 4PXEA 5K8OA 1V0CA 1NSAA 2VEZA 4MHNA 1ZG8A 4MFLA 4P4IA 2PJ1A 4ZY1A 2OR4A 1YR0A 2PSWA 3EXNA 2NSMA 2GLJA 4MBUA 4XPDC 2WYRA 2AFXA 2EUIA 2CNMA 5EBVA 4RS2A 3FNCA 1M4IA 4BMHA 4KS9A 2CF4A 3RYOA 2PJ7A 4QBJA 4OP4A 6CPAA 4PSWA 3S9NA 3FBUA 4UIAA 2X7BA 2Z10A 4J3GA 2C6GA 4AVCA 4H89A 4KUAA 3SI1A 3N5FA 5AGEA 3WR7A 3WC7A 3KQZA 3ZJ0A 4ZY0A 3S6KA 1LRZA 1YW6A 3SHPA 1XFOA 1F2PA 3FB3A 2K5TA 4RN7A 1LFWA 3B3VA 2OU2A 5EC4A 4ONUA 5JQ4A 1Z4RA 2F7VA 4KORA 4MCQA 4CS0B 5I0CA 2EBJA 5C88A 1Z8TA 3PRTA 2GANA 4A37A 2Q7SA 5EMIA 5LRJA 4IK2A 4YU9A 2CXAA 2GE3A 2HB6A 4FD4A 4PXBA 3T8WA 3DNSA 3UY5A 1S7KA 2XEJA 2EVNA 4LX9A 1VGYA 3WT4A 1RXTA 2IL4A 1VHSA 4HNXB 5H86A 2OOTA 3LODA 3F0AA 1QSMA 3W6SA 3GLJA 3KZWA 4R76A 5KTCA 1NMTA 4B5PB 2FE7A 5HVHA 3BLNA 3D7GA 3D7HA 4MHDA 4MCRA 1BLLE 2PQ8A 4B12A 1CM0A 2F5IA 2RFHA 1YK3A 2VQYA 4F0YA 1RO5A 1Y9KA 5IX3A 3V38A 2V8GA 4G1PA 4UCPA 5AG7A 1WK4A 1F57A 5HVFA 2FCKA 4MCSA 1PYTB 1ZG7A 2PRBA 3IC1A 3S6FA 4OMEA 3F5BA 1IOIA 4UF4A 4KVOE 4I49A 2ZEOA 1DTDA 3TTHA 4KSFA 3D66A 1R3NA 2PJ2A 4NGMA 4Q38A 4XNHB 2FVGA 1FY7A 2C27A 2ZELA 1LAMA 4CRZB 2G3TA 1YREA 2V77A 4U5YA 2D4PA 3A9LA 1IYLA 3NFZA 1YVKA 4UFWA 3PP9A 5CBMA 4AG7A 1ELMP 3FEEA 1AUGA 5F47A 2AFSA 2EK9A 4P4DA 2AFZA 3WC5A 5JGFA 1TXRA 4JZ0A 1M4LA 2OZHA 4NGQA 1X12A 3JTKA 2BUEA 2FSRA 3H8EA 3N7ZA 4MHZA 2PDOA 2B4DB 5AG6A 2J8MA 1GHEA
chains in the Genus database with same CATH topology
2RC4A 1M1DA 2J8RA 3D2PA 3NE7A 2ARHA 4B5OA 2ZW4A 4KVXA 2OB0A 4MFQA 4B14A 2VZZA 3JVNA 2P0WA 4OAEA 5H84A 4KSAA 1IIDA 1M4DA 2BL1A 4B13A 4NCZA 2ZPAA 2Z3KA 1OZPA 2PC1A 5IV0A 3B8GA 1I12A 5HMNA 4XPKA 1XE4A 4ORFA 3BJ7A 2DPSA 3PZJA 1SQHA 1J4JA 1IICA 1YGHA 4CAFA 3R96A 5G21A 3R9FA 4R57A 4FD7A 2Z3OA 2R1IA 4GS4A 3R9EA 2Q44A 4L8AA 2BEIA 2Z11A 4MFPA 4FD5A 4C2YA 4FD6A 2PR8A 3IU2A 2FS5A 2DXQA 1NSLA 3TO9A 4L89A 3BJ8A 3P2FA 1IYKA 1TIQA 3IU1A 2JDDA 1P0HA 4NEXA 2PR1A 3DSBA 1ZO0A 3SXOA 4CYPA 3IWGA 1Z9UA 1M4GA 4ZBGA 4UA3A 4UFVA 3PGPA 4F6AA 4R87A 4QVTA 2WUUA 4B11A 5A28A 4KOUA 1IB1E 4E0AA 4IUSA 3G8WA 5KTDA 2Q7BA 3TO7A 4PK2A 3G3SA 2G3AA 2FIWA 4QB9A 3SXNA 1Y7RA 3I3GA 4R9MA 2NMTA 2VBQA 4KOXA 4A33A 1YLEA 2AE6A 4MY0A 1QSRA 2OZGA 2Q0YA 2ZW7A 4M85A 4KLWA 1S7FA 2ZXVA 3IGRA 3QAHA 3D8PA 4CYQA 4MFJA 1Q2DA 2CY2A 4H6ZA 4UCMA 4UCNA 5BWAB 1Z4EA 2B58A 3S6HA 3V8IA 2B3VA 2FXFA 4M3SA 3R95A 4CYOA 5CNPA 3VWEA 4R3LA 1WWZA 3EC4A 3LD2A 3W6XA 4CYNA 5J8FA 3QB8A 4CGOA 2P6GA 4KOSA 4KLVA 4OLLA 3T9YA 2CNTA 4A31A 2Q4VA 3DDDA 4UWIA 1XF8A 3FYNA 4AVBA 2Z3NA 1XEBA 1B6BA 4OADA 2G0BA 2YNEA 2HUZA 4CAVA 1GHEA 2CNSA 4DNCA 1UFHA 1BO4A 2J8NA 4UBRA 4CGMA 1MJ9A 2FIAA 5AG4A 3GKRA 3CXQA 5E96A 3FXTA 5KTAA 3R9GA 1YX0A 2R98A 4C7IA 4ZGYB 4MJ8A 2Z0ZA 2VI7A 2WPWA 1QSOA 4JJXA 4KVME 2R7HA 3H5ZA 4IF5A 5C82A 2YGWA 1KUVA 4E2AA 2ZW5A 2I00A 2WPXA 4NXYA 4KOWA 3K9UA 4JXRA 4CAXA 5GCNA 4MI4A 4QUSA 3D2MA 5HH1A 3TE4A 1KUYA 4C7HA 4YRHA 3DR6A 5JPHA 2GIVA 2Q4YA 2Z3LA 3TFYA 2B5GA 3JUWA 1XMTA 4KOYA 3T90A 1L0CA 4LUAA 4A32A 2D4OA 1S5KA 3KKWA 4UFXA 5IB0A 2DPTA 1Q2CA 2B3UA 4AG9A 1S3ZA 2VZYA 4JLYA 4CGNA 4A2ZA 3P2HA 3ZZIA 1P4NA 2QECA 4F0XA 4YFJA 4HNWB 4UWJA 2JLMA 3TO6A 4C2XA 2AJ6A 4KZTA 1I21A 3EO4A 4HKFA 5DWNA 4AVAA 1MJBA 1PU9A 1MJAA 3FIXA 4KOTA 4KOVA 5F49A 1CJWA 2O28A 4U9ZA 4JXQA 2HV2A 3R1KA 4BBHA 1U6MA 4Y49C 4B5PA 1S7NA 5J8CA 1QSTA 4PK3A 3IWEA 4K30A 4CGLA 1BOBA 4H6UA 1N71A 1K4JA 3F8KA 2WSAA 4AB7A 3D3SA 2KCWA 2YNCC 1VKCA 1S7LA 4A95A 1KZFA 2QIRA 4Q36A 2OH1A 1Q2YA 1M44A 2I79A 2A4NA 4PSXA 4QC6A 3EFAA 4XPLA 4JD6A 4PV6A 2Z3PA 2H5MA 3CXSA 2QMLA 2B4DA 4KUBA 2Z3MA 4NF1A 3E0KA 4RI1A 1S60A 4CAWA 3OWCA 2Q04A 5G20A 4E8OA 2P6FA 3EY5A 2JEVA 3S6GA 3TOAA 1YVOA 2JDCA 3TT2A 4C2ZA 2ZW6A 2OZUA 2ATRA 1B87A 2VXKA 4MFKA 5ISVA 2R8VA 4B10A 4EVYA 4MY3A 1NE9A 4R3KA 3VWDA 1I1DA 5A27A 3MGDA 3W91A 1Y9WA 4U9YA 2B4BA 1XIXA 2Y0MA 3H4QA 3CXPA 4XPDB 1R57A 4A30A 1KUXA 4CAEA 2BSWA 4NSQA 2P6EA 3DR8A 4XNHC 2YNCA 2FL4A 1PUAA 3GY9A 4II9A 5F46A 3GYAA 4X5KA 2HQYA 1QSNA 4Y49B 1ON0A 3TCVA 5G22A 4YGOA 4CRYB 4HNYB 5FVJA 5G1ZA 2YNDA 3TOBA 2REFA 5F48A 3C26A 3I9SA 4CGPA 2FT0A 3FRMA 2B5GB 2REEA 5DWMA 4JWPA 1MK4A 4MFZA 4C68A 1V0CA 2VEZA 4MFLA 1YR0A 2PSWA 3EXNA 4MBUA 4XPDC 2EUIA 2CNMA 5EBVA 4RS2A 3FNCA 1M4IA 4BMHA 4KS9A 3RYOA 4QBJA 4PSWA 3FBUA 2X7BA 2Z10A 4J3GA 4AVCA 4H89A 4KUAA 5AGEA 3WR7A 3ZJ0A 3S6KA 1LRZA 3SHPA 3FB3A 2K5TA 5EC4A 5JQ4A 2OU2A 4ONUA 1Z4RA 4KORA 4CS0B 5I0CA 5C88A 2GANA 2CXAA 2GE3A 4FD4A 3DNSA 3UY5A 1S7KA 2EVNA 4LX9A 1RXTA 2IL4A 1VHSA 4HNXB 5H86A 3LODA 3F0AA 1QSMA 3W6SA 5KTCA 1NMTA 4B5PB 2FE7A 3BLNA 4MHDA 4B12A 2PQ8A 1CM0A 2F5IA 2VQYA 1YK3A 4F0YA 1RO5A 1Y9KA 5IX3A 4UCPA 5AG7A 1WK4A 2FCKA 2PRBA 3S6FA 3F5BA 4KVOE 4I49A 3TTHA 4KSFA 4Q38A 4XNHB 1FY7A 2C27A 4CRZB 2G3TA 1YREA 4U5YA 2D4PA 3A9LA 1IYLA 1YVKA 4UFWA 3PP9A 4AG7A 5F47A 2OZHA 3JTKA 2BUEA 2FSRA 3N7ZA 5AG5A 2B4DB 5AG6A 2J8MA 2PDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC4 A;  1M1D A;  2J8R A;  3D2P A;  3NE7 A;  2ARH A;  4B5O A;  2ZW4 A;  4KVX A;  2OB0 A;  2VZZ A;  3JVN A;  2P0W A;  4OAE A;  5H84 A;  1IID A;  1M4D A;  2BL1 A;  4NCZ A;  2ZPA A;  1OZP A;  2PC1 A;  5IV0 A;  3B8G A;  1I12 A;  5HMN A;  4XPK A;  1XE4 A;  4ORF A;  3BJ7 A;  3PZJ A;  1SQH A;  1J4J A;  1IIC A;  1YGH A;  3R96 A;  3R9F A;  4R57 A;  4FD7 A;  2R1I A;  4GS4 A;  3R9E A;  2Q44 A;  4L8A A;  2BEI A;  2Z11 A;  4FD5 A;  4FD6 A;  2PR8 A;  2FS5 A;  2DXQ A;  1NSL A;  3TO9 A;  4L89 A;  3BJ8 A;  3P2F A;  1IYK A;  1TIQ A;  2JDD A;  1P0H A;  4NEX A;  2PR1 A;  3DSB A;  3SXO A;  3IWG A;  1Z9U A;  1M4G A;  4ZBG A;  4UA3 A;  3PGP A;  4F6A A;  4R87 A;  4QVT A;  4KOU A;  1IB1 E;  4E0A A;  4IUS A;  3G8W A;  5KTD A;  2Q7B A;  3TO7 A;  4PK2 A;  3G3S A;  2G3A A;  2FIW A;  4QB9 A;  3SXN A;  1Y7R A;  3I3G A;  4R9M A;  2NMT A;  4KOX A;  2VBQ A;  1YLE A;  2AE6 A;  4MY0 A;  1QSR A;  2OZG A;  2Q0Y A;  2ZW7 A;  4M85 A;  4KLW A;  1S7F A;  2ZXV A;  3IGR A;  3QAH A;  3D8P A;  1Q2D A;  2CY2 A;  4H6Z A;  1Z4E A;  2B58 A;  3S6H A;  3V8I A;  2B3V A;  2FXF A;  4M3S A;  3R95 A;  5CNP A;  3VWE A;  4R3L A;  1WWZ A;  3EC4 A;  3LD2 A;  3W6X A;  5J8F A;  3QB8 A;  2P6G A;  4KOS A;  4KLV A;  4OLL A;  3T9Y A;  2CNT A;  2Q4V A;  3DDD A;  4UWI A;  1XF8 A;  3FYN A;  4AVB A;  1XEB A;  1B6B A;  4OAD A;  2G0B A;  2HUZ A;  4CAV A;  1GHE A;  2CNS A;  4DNC A;  1UFH A;  1BO4 A;  2J8N A;  4UBR A;  1MJ9 A;  2FIA A;  3GKR A;  3CXQ A;  5E96 A;  3FXT A;  5KTA A;  3R9G A;  1YX0 A;  2R98 A;  4MJ8 A;  2Z0Z A;  2VI7 A;  2WPW A;  1QSO A;  4JJX A;  4KVM E;  2R7H A;  4IF5 A;  5C82 A;  1KUV A;  4E2A A;  2ZW5 A;  2I00 A;  2WPX A;  4NXY A;  4KOW A;  3K9U A;  4JXR A;  4CAX A;  5GCN A;  4MI4 A;  4QUS A;  3D2M A;  5HH1 A;  3TE4 A;  1KUY A;  4YRH A;  3DR6 A;  5JPH A;  2GIV A;  2Q4Y A;  3TFY A;  2B5G A;  3JUW A;  1XMT A;  4KOY A;  3T90 A;  1L0C A;  4LUA A;  2D4O A;  1S5K A;  3KKW A;  5IB0 A;  1Q2C A;  2B3U A;  4AG9 A;  1S3Z A;  2VZY A;  4JLY A;  3P2H A;  3ZZI A;  1P4N A;  2QEC A;  4YFJ A;  4HNW B;  4UWJ A;  2JLM A;  3TO6 A;  2AJ6 A;  4KZT A;  1I21 A;  3EO4 A;  4HKF A;  5DWN A;  4AVA A;  1MJB A;  1PU9 A;  1MJA A;  3FIX A;  4KOT A;  4KOV A;  5F49 A;  1CJW A;  2O28 A;  4U9Z A;  4JXQ A;  2HV2 A;  3R1K A;  1U6M A;  4Y49 C;  4B5P A;  1S7N A;  5J8C A;  1QST A;  4PK3 A;  4K30 A;  1BOB A;  4H6U A;  1N71 A;  1K4J A;  3F8K A;  4AB7 A;  3D3S A;  2KCW A;  1VKC A;  1S7L A;  1KZF A;  2QIR A;  2OH1 A;  1Q2Y A;  1M44 A;  2I79 A;  2A4N A;  4PSX A;  4QC6 A;  3EFA A;  4XPL A;  4JD6 A;  4PV6 A;  2H5M A;  3CXS A;  2QML A;  2B4D A;  4KUB A;  4NF1 A;  3E0K A;  4RI1 A;  1S60 A;  4CAW A;  3OWC A;  2Q04 A;  4E8O A;  2P6F A;  3EY5 A;  2JEV A;  3S6G A;  3TOA A;  1YVO A;  2JDC A;  3TT2 A;  2ZW6 A;  2OZU A;  2ATR A;  1B87 A;  2VXK A;  5ISV A;  2R8V A;  4EVY A;  4MY3 A;  1NE9 A;  4R3K A;  3VWD A;  1I1D A;  3MGD A;  3W91 A;  1Y9W A;  4U9Y A;  2B4B A;  1XIX A;  2Y0M A;  3H4Q A;  3CXP A;  4XPD B;  1R57 A;  1KUX A;  2BSW A;  4NSQ A;  2P6E A;  3DR8 A;  4XNH C;  2FL4 A;  1PUA A;  3GY9 A;  4II9 A;  5F46 A;  3GYA A;  4X5K A;  2HQY A;  1QSN A;  4Y49 B;  1ON0 A;  3TCV A;  4YGO A;  4CRY B;  4HNY B;  5FVJ A;  3TOB A;  2REF A;  5F48 A;  3C26 A;  3I9S A;  2FT0 A;  3FRM A;  2B5G B;  2REE A;  5DWM A;  4JWP A;  1MK4 A;  1V0C A;  2VEZ A;  1YR0 A;  2PSW A;  3EXN A;  4MBU A;  4XPD C;  2EUI A;  2CNM A;  5EBV A;  4RS2 A;  3FNC A;  1M4I A;  4BMH A;  3RYO A;  4QBJ A;  4PSW A;  3FBU A;  2X7B A;  2Z10 A;  4J3G A;  4AVC A;  4H89 A;  4KUA A;  3WR7 A;  3ZJ0 A;  3S6K A;  1LRZ A;  3SHP A;  3FB3 A;  2K5T A;  5EC4 A;  5JQ4 A;  2OU2 A;  4ONU A;  1Z4R A;  4KOR A;  4CS0 B;  5I0C A;  5C88 A;  2GAN A;  2GE3 A;  4FD4 A;  3DNS A;  3UY5 A;  1S7K A;  2EVN A;  4LX9 A;  1RXT A;  2IL4 A;  1VHS A;  4HNX B;  5H86 A;  3LOD A;  3F0A A;  1QSM A;  3W6S A;  5KTC A;  1NMT A;  4B5P B;  2FE7 A;  3BLN A;  4MHD A;  2PQ8 A;  1CM0 A;  2F5I A;  2VQY A;  1YK3 A;  4F0Y A;  1RO5 A;  1Y9K A;  5IX3 A;  1WK4 A;  2FCK A;  2PRB A;  3S6F A;  3F5B A;  4KVO E;  4I49 A;  3TTH A;  4XNH B;  1FY7 A;  2C27 A;  4CRZ B;  2G3T A;  1YRE A;  4U5Y A;  2D4P A;  1IYL A;  1YVK A;  3PP9 A;  4AG7 A;  5F47 A;  2OZH A;  2BUE A;  2FSR A;  3N7Z A;  2B4D B;  2J8M A;  2PDO A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  1M1D A;  2J8R A;  3D2P A;  3NE7 A;  5F09 A;  2ARH A;  4B5O A;  2EK8 A;  1LAP A;  2PIZ A;  2ZW4 A;  3B3T A;  3GIU A;  4KVX A;  2OB0 A;  3FED A;  4MFQ A;  4B14 A;  2I3C A;  2VZZ A;  3B3C A;  3JVN A;  2P0W A;  3KR5 A;  4OAE A;  5H84 A;  4EFD A;  4KSA A;  1CBX A;  2EWB A;  1IID A;  1M4D A;  2BL1 A;  2BO9 A;  4NCZ A;  2HC9 A;  4OID A;  1JWQ A;  4P4J A;  2ZPA A;  4PXD A;  2Z3K A;  1OZP A;  3PB8 X;  2ZOF A;  2PC1 A;  4GXH A;  3B8G A;  1CP6 A;  1I12 A;  4OIW A;  5HMN A;  5IV0 A;  3KHZ A;  4XPK A;  3MN8 A;  1XE4 A;  5LYF A;  4ORF A;  4NJQ A;  4TWE A;  4YWY A;  2PJ4 A;  2ZEH A;  3BJ7 A;  2DPS A;  3CDX A;  8CPA A;  3PZJ A;  1RTQ A;  3LWU A;  3D68 A;  4FWU A;  1SQH A;  4ONW A;  4PQA A;  1J4J A;  5K8P A;  5LYI A;  1IIC A;  1YGH A;  1EE3 P;  3R96 A;  4CAF A;  4WWV A;  5G21 A;  3R9F A;  1CPS A;  4R57 A;  4FD7 A;  1TF8 A;  4M6H A;  2Z3O A;  4EWT A;  4NGR A;  2R1I A;  2PJ8 A;  4GS4 A;  3R9E A;  2Q44 A;  4PXC A;  4L8A A;  2BEI A;  3RAM A;  2Z11 A;  4MFP A;  4X8I A;  4FBE A;  5DS0 A;  2BOA A;  2JBK A;  4FD5 A;  3RZA A;  2POK A;  4P4E A;  4C2Y A;  4FD6 A;  3QNV A;  2PR8 A;  3FEC A;  3GUX A;  3IU2 A;  2Q51 A;  2FS5 A;  2DXQ A;  4Z65 A;  1NSL A;  3TO9 A;  4L89 A;  2ZEG A;  3BJ8 A;  3SI0 A;  3S9M A;  5CPA A;  3P2F A;  5LRG A;  3RO0 A;  4P10 A;  4OC4 A;  1IYK A;  3IIB A;  3PBE A;  3LAC A;  1TIQ A;  3IU1 A;  3IJ3 A;  2JDD A;  3H8G A;  1P0H A;  4NEX A;  2PR1 A;  3DSB A;  4NGT A;  1ZO0 A;  2PCU A;  3SXO A;  4CYP A;  3CZX A;  3IWG A;  1Z9U A;  2ZEF A;  1M4G A;  1Z8X A;  4ZBG A;  4UA3 A;  3PB9 X;  4UFV A;  3PGP A;  4F6A A;  4R87 A;  4QVT A;  4DYO A;  2WUU A;  4B11 A;  4CPA A;  5A28 A;  4KOU A;  1IB1 E;  4NGN A;  2ZEM A;  5D29 A;  4E0A A;  3HLP A;  4MHP A;  4IUS A;  4Q7A A;  3G8W A;  5KTD A;  2C1C A;  2Q7B A;  3SI2 A;  4P4F A;  3TO7 A;  4PK2 A;  3S9L A;  2WZN A;  2G3A A;  3G3S A;  1XBU A;  2FIW A;  4QB9 A;  3SXN A;  1Y7R A;  3D7D A;  3I3G A;  4R9M A;  4B6Z A;  4M6I A;  1VHO A;  2NMT A;  2QJ8 A;  2VBQ A;  1QMU A;  3DGV A;  4KOX A;  3NH4 A;  1YLE A;  2AE6 A;  4JYW A;  4A33 A;  4MY0 A;  1QSR A;  4DJL A;  1DE4 C;  2OZG A;  1X10 A;  2PJ6 A;  4B13 A;  1CX8 A;  2Q0Y A;  2ZW7 A;  3BXM A;  4M85 A;  3FMC A;  4KLW A;  1S7F A;  4F9U A;  2ZXV A;  2BCO A;  4UEZ A;  3IGR A;  4OKO A;  3QAH A;  5JH9 A;  3D8P A;  2F8H A;  3FVL A;  4CYQ A;  4MFJ A;  1Q2D A;  2CY2 A;  3SJX A;  2Q43 A;  1VHE A;  4H6Z A;  4R7M A;  4EME A;  3PFO A;  4UCM A;  4UCN A;  1ARL A;  1BPN A;  5BWA B;  1Z4E A;  3MRU A;  1ZLH A;  2B58 A;  1XOV A;  1HEE A;  3I1U A;  3S6H A;  2B3V A;  2FXF A;  3V8I A;  3CPX A;  4M3S A;  3R95 A;  5D8N A;  3IO1 A;  2AFU A;  5CNP A;  3VWE A;  4CYO A;  2IMO A;  4R3L A;  3K9T A;  1WWZ A;  3EC4 A;  3LD2 A;  3W6X A;  4CYN A;  5J8F A;  3QB8 A;  3PBB A;  4CGO A;  5K8N A;  1UWY A;  3VAR A;  2P6G A;  2QVP A;  4KOS A;  4KLV A;  4OLL A;  3T9Y A;  2CNT A;  4A31 A;  3NH8 A;  2Q4V A;  2C6C A;  3DDD A;  4UWI A;  3RBU A;  1XF8 A;  3FYN A;  4AVB A;  2Z3N A;  3H8F A;  1XEB A;  1B6B A;  3BHX A;  4OAD A;  2G0B A;  2YNE A;  2HUZ A;  2ANP A;  4CAV A;  1GYT A;  2CNS A;  4DNC A;  3D4U A;  1UFH A;  1BO4 A;  2J8N A;  2PJC A;  4UBR A;  4CGM A;  1MJ9 A;  4FUU A;  2FIA A;  2GU2 A;  4P44 A;  5AG4 A;  1ZLI A;  4OC0 A;  2PJB A;  2PJ0 A;  2QYV A;  3ISZ A;  3GKR A;  3CXQ A;  3IWW A;  3NH5 A;  5E96 A;  4IHM A;  4R6T A;  3FXT A;  5KTA A;  3R9G A;  2GFQ A;  1YX0 A;  2R98 A;  4W9Y A;  3K2K A;  3DLJ A;  4C7I A;  2IQ6 A;  4ZGY B;  4MJ8 A;  3HUV A;  2Z0Z A;  2VI7 A;  2WPW A;  1BAV A;  1QSO A;  2XEG A;  4JJX A;  4ZI6 A;  1H8L A;  4FAI A;  4KVM E;  2R7H A;  2ZEP A;  3H5Z A;  4IF5 A;  4F9V A;  1IY7 A;  5C82 A;  4OC3 A;  2YGW A;  1KUV A;  4UIB A;  5THW A;  4E2A A;  2PIY A;  4TNU A;  2ZW5 A;  3KL9 A;  3VH9 A;  2I00 A;  2WPX A;  4NXY A;  4KOW A;  1Z2L A;  3K9U A;  3WAB A;  3KHX A;  1IU8 A;  4JXR A;  3FF3 A;  5GCN A;  3PB6 X;  4CAX A;  4MI4 A;  4QUS A;  3D2M A;  5HH1 A;  3TE4 A;  1KUY A;  4C7H A;  2PVV A;  4BIN A;  2EO8 A;  4YRH A;  3NA6 A;  1LCP A;  3DR6 A;  5JPH A;  1FNO A;  2GIV A;  2Q4Y A;  2V8D A;  2C6P A;  4DUK A;  2Z3L A;  1Z5R A;  3NE8 A;  2ODF A;  2XEI A;  5JM6 A;  3TFY A;  1Y0Y A;  2B5G A;  3JUW A;  4LQG A;  1XMT A;  1YLO A;  4KOY A;  4PPZ A;  3T90 A;  4M6G A;  1L0C A;  4LUA A;  4A32 A;  2V8V A;  1CPX A;  2D4O A;  1JQG A;  1S5K A;  3KKW A;  4UFX A;  5IB0 A;  3IEH A;  2DEA A;  1KWM A;  1BPM A;  2DPT A;  3PB7 X;  5AG5 A;  7CPA A;  1Q2C A;  3KI9 A;  2B3U A;  2JEW A;  4AG9 A;  3PFE A;  1S3Z A;  5LYL A;  2VZY A;  4JLY A;  4CGN A;  3QAY A;  4A2Z A;  3P2H A;  3ZZI A;  2G9D A;  4IAV A;  3KQX A;  1P4N A;  1CG2 A;  2QEC A;  3RNZ A;  4F0X A;  2GLF A;  5HVG A;  3B35 A;  4YFJ A;  4HNW B;  4OC1 A;  4UWJ A;  2JLM A;  3TO6 A;  4C2X A;  2AJ6 A;  2DF5 A;  4OC5 A;  4KZT A;  1I21 A;  3BI1 A;  3EO4 A;  4HKF A;  4R8F A;  5DWN A;  3PEI A;  4AVA A;  1MJB A;  3D67 A;  1PU9 A;  2GRE A;  4K3N A;  1MJA A;  3FIX A;  4KOT A;  2J9A A;  4KOV A;  4WJB A;  4HPS A;  5F49 A;  1CJW A;  2O28 A;  4U9Z A;  1AYE A;  1TKJ A;  4JXQ A;  2HV2 A;  3R1K A;  4BBH A;  3GB0 A;  4A39 A;  1Q7L A;  1U6M A;  4Y49 C;  5J1Q A;  4ZYQ A;  3KR4 A;  3PB4 X;  3SJF A;  4B5P A;  3CPA A;  5LRK A;  1S7N A;  5J8C A;  1QST A;  2CIJ A;  4PK3 A;  1TKF A;  3IWE A;  2AFO A;  4H2K A;  4K30 A;  4CGL A;  1BOB A;  4H6U A;  1HDQ A;  1N71 A;  1K4J A;  1YME A;  2WSA A;  3F8K A;  4AB7 A;  2PJA A;  3D3S A;  4RUH A;  2KCW A;  2YNC C;  1VKC A;  4NJR A;  1S7L A;  4A95 A;  1KZF A;  2QIR A;  3B7I A;  4GM5 A;  4Q36 A;  2AFM A;  2CTC A;  2OH1 A;  4MCP A;  1Q2Y A;  1M44 A;  2AFW A;  2CTB A;  2I79 A;  2A4N A;  1A2Z A;  2Q4Z A;  4PSX A;  4QC6 A;  2RB7 A;  3EFA A;  4XPL A;  4JD6 A;  2XEF A;  2V8H A;  4PV6 A;  4BD9 A;  1LOK A;  1YW4 A;  2Z3P A;  2H5M A;  3CXS A;  2QML A;  2B4D A;  4KUB A;  2Z3M A;  3IFE A;  1YQE A;  4NF1 A;  1XJO A;  3E0K A;  5LYD A;  4RI1 A;  1S60 A;  3V7Z A;  3WC6 A;  1YSJ A;  4P6Y A;  4CAW A;  3OWC A;  2Q04 A;  4A94 A;  3L2N A;  4AXV A;  5G20 A;  2ZEN A;  3FH4 A;  4E8O A;  2ZOG A;  3VAT A;  1OBR A;  2P6F A;  3TX8 A;  3B3S A;  1TF9 A;  1LAN A;  1Z8W A;  3EY5 A;  5I4M A;  2JEV A;  1FT7 A;  3S6G A;  3TOA A;  1YVO A;  1PCA A;  2JDC A;  3TT2 A;  1VIX A;  3TC8 A;  4MHY A;  4C2Z A;  1QQ9 A;  2ZW6 A;  2OZU A;  3B3W A;  1HDU A;  2ATR A;  2PRQ A;  3LMS A;  1B87 A;  2VXK A;  3KAS A;  4X2T A;  4P45 A;  1IOF A;  1IGB A;  4MFK A;  3KGQ A;  5ISV A;  3CT9 A;  2R8V A;  4B10 A;  4ZY2 A;  4EVY A;  4X3R A;  4MY3 A;  1NE9 A;  2PJ9 A;  4R3K A;  3VWD A;  1I1D A;  2NYQ A;  5A27 A;  3MGD A;  2PJ3 A;  4O23 A;  3W91 A;  3JRU A;  1AMP A;  5ELY A;  1Y9W A;  4U9Y A;  2B4B A;  1XIX A;  2Y0M A;  3H4Q A;  3ISX A;  1TKH A;  2ZEE A;  3CXP A;  4XPD B;  4UEE A;  1R57 A;  4A30 A;  1KUX A;  5HXD A;  4CAE A;  2BSW A;  4ZX9 A;  4NSQ A;  2P6E A;  3DR8 A;  4UEF A;  4LQ6 A;  4XNH C;  1ZG9 A;  4MXU A;  2PVW A;  2FL4 A;  1PUA A;  1ARM A;  2YNC A;  3GY9 A;  4II9 A;  2ZED A;  5F46 A;  3GYA A;  4MMO A;  4X5K A;  3SJG A;  5K8M A;  4MRI A;  2VL1 A;  2HQY A;  4P4B A;  1QSN A;  4Y49 B;  1XMB A;  1ON0 A;  3TCV A;  2O4H A;  4NFR A;  5G22 A;  4YGO A;  1Y0R A;  2O53 A;  4NGS A;  4CRY B;  3BI0 A;  4HNY B;  1R43 A;  2PJ5 A;  5FVJ A;  1CP7 A;  5G1Z A;  2IJZ A;  4OC2 A;  1XRY A;  3FX6 A;  3B2Y A;  1Y7E A;  2YND A;  4A38 A;  3TOB A;  2PE3 A;  2REF A;  5F48 A;  4ZX8 A;  3C26 A;  2ABZ A;  3I9S A;  4KSI A;  4CGP A;  2FT0 A;  1Z8L A;  2JBJ A;  3FRM A;  2B5G B;  4F8Z A;  2REE A;  5DWM A;  4JWP A;  1F2O A;  1ELL P;  1MK4 A;  3D7F A;  3FJU A;  4MFZ A;  4NGP A;  3SJE A;  4C68 A;  5IB9 A;  4PXE A;  5K8O A;  1V0C A;  1NSA A;  2VEZ A;  4MHN A;  1ZG8 A;  4MFL A;  4P4I A;  2PJ1 A;  4ZY1 A;  2OR4 A;  1YR0 A;  2PSW A;  3EXN A;  2NSM A;  2GLJ A;  4MBU A;  4XPD C;  2WYR A;  2AFX A;  2EUI A;  2CNM A;  5EBV A;  4RS2 A;  3FNC A;  1M4I A;  4BMH A;  4KS9 A;  2CF4 A;  3RYO A;  2PJ7 A;  4QBJ A;  4OP4 A;  6CPA A;  4PSW A;  3S9N A;  3FBU A;  4UIA A;  2X7B A;  2Z10 A;  4J3G A;  2C6G A;  4AVC A;  4H89 A;  4KUA A;  3SI1 A;  3N5F A;  5AGE A;  3WR7 A;  3WC7 A;  3KQZ A;  3ZJ0 A;  4ZY0 A;  3S6K A;  1LRZ A;  1YW6 A;  3SHP A;  1XFO A;  1F2P A;  3FB3 A;  2K5T A;  4RN7 A;  1LFW A;  3B3V A;  2OU2 A;  5EC4 A;  4ONU A;  5JQ4 A;  1Z4R A;  2F7V A;  4KOR A;  4MCQ A;  4CS0 B;  5I0C A;  2EBJ A;  5C88 A;  1Z8T A;  3PRT A;  2GAN A;  4A37 A;  2Q7S A;  5EMI A;  5LRJ A;  4IK2 A;  4YU9 A;  2CXA A;  2GE3 A;  2HB6 A;  4FD4 A;  4PXB A;  3T8W A;  3DNS A;  3UY5 A;  1S7K A;  2XEJ A;  2EVN A;  4LX9 A;  1VGY A;  3WT4 A;  1RXT A;  2IL4 A;  1VHS A;  4HNX B;  5H86 A;  2OOT A;  3LOD A;  3F0A A;  1QSM A;  3W6S A;  3GLJ A;  3KZW A;  4R76 A;  5KTC A;  1NMT A;  4B5P B;  2FE7 A;  5HVH A;  3BLN A;  3D7G A;  3D7H A;  4MHD A;  4MCR A;  1BLL E;  2PQ8 A;  4B12 A;  1CM0 A;  2F5I A;  2RFH A;  1YK3 A;  2VQY A;  4F0Y A;  1RO5 A;  1Y9K A;  5IX3 A;  3V38 A;  2V8G A;  4G1P A;  4UCP A;  5AG7 A;  1WK4 A;  1F57 A;  5HVF A;  2FCK A;  4MCS A;  1PYT B;  1ZG7 A;  2PRB A;  3IC1 A;  3S6F A;  4OME A;  3F5B A;  1IOI A;  4UF4 A;  4KVO E;  4I49 A;  2ZEO A;  1DTD A;  3TTH A;  4KSF A;  3D66 A;  1R3N A;  2PJ2 A;  4NGM A;  4Q38 A;  4XNH B;  2FVG A;  1FY7 A;  2C27 A;  2ZEL A;  1LAM A;  4CRZ B;  2G3T A;  1YRE A;  2V77 A;  4U5Y A;  2D4P A;  3A9L A;  1IYL A;  3NFZ A;  1YVK A;  4UFW A;  3PP9 A;  5CBM A;  4AG7 A;  1ELM P;  3FEE A;  1AUG A;  5F47 A;  2AFS A;  2EK9 A;  4P4D A;  2AFZ A;  3WC5 A;  5JGF A;  1TXR A;  4JZ0 A;  1M4L A;  2OZH A;  4NGQ A;  1X12 A;  3JTK A;  2BUE A;  2FSR A;  3H8E A;  3N7Z A;  4MHZ A;  2PDO A;  2B4D B;  5AG6 A;  2J8M A;  1GHE A; 
#chains in the Genus database with same CATH homology
 2RC4 A;  1M1D A;  2J8R A;  3D2P A;  3NE7 A;  2ARH A;  4B5O A;  2ZW4 A;  4KVX A;  2OB0 A;  4MFQ A;  4B14 A;  2VZZ A;  3JVN A;  2P0W A;  4OAE A;  5H84 A;  4KSA A;  1IID A;  1M4D A;  2BL1 A;  4B13 A;  4NCZ A;  2ZPA A;  2Z3K A;  1OZP A;  2PC1 A;  5IV0 A;  3B8G A;  1I12 A;  5HMN A;  4XPK A;  1XE4 A;  4ORF A;  3BJ7 A;  2DPS A;  3PZJ A;  1SQH A;  1J4J A;  1IIC A;  1YGH A;  4CAF A;  3R96 A;  5G21 A;  3R9F A;  4R57 A;  4FD7 A;  2Z3O A;  2R1I A;  4GS4 A;  3R9E A;  2Q44 A;  4L8A A;  2BEI A;  2Z11 A;  4MFP A;  4FD5 A;  4C2Y A;  4FD6 A;  2PR8 A;  3IU2 A;  2FS5 A;  2DXQ A;  1NSL A;  3TO9 A;  4L89 A;  3BJ8 A;  3P2F A;  1IYK A;  1TIQ A;  3IU1 A;  2JDD A;  1P0H A;  4NEX A;  2PR1 A;  3DSB A;  1ZO0 A;  3SXO A;  4CYP A;  3IWG A;  1Z9U A;  1M4G A;  4ZBG A;  4UA3 A;  4UFV A;  3PGP A;  4F6A A;  4R87 A;  4QVT A;  2WUU A;  4B11 A;  5A28 A;  4KOU A;  1IB1 E;  4E0A A;  4IUS A;  3G8W A;  5KTD A;  2Q7B A;  3TO7 A;  4PK2 A;  3G3S A;  2G3A A;  2FIW A;  4QB9 A;  3SXN A;  1Y7R A;  3I3G A;  4R9M A;  2NMT A;  2VBQ A;  4KOX A;  4A33 A;  1YLE A;  2AE6 A;  4MY0 A;  1QSR A;  2OZG A;  2Q0Y A;  2ZW7 A;  4M85 A;  4KLW A;  1S7F A;  2ZXV A;  3IGR A;  3QAH A;  3D8P A;  4CYQ A;  4MFJ A;  1Q2D A;  2CY2 A;  4H6Z A;  4UCM A;  4UCN A;  5BWA B;  1Z4E A;  2B58 A;  3S6H A;  3V8I A;  2B3V A;  2FXF A;  4M3S A;  3R95 A;  4CYO A;  5CNP A;  3VWE A;  4R3L A;  1WWZ A;  3EC4 A;  3LD2 A;  3W6X A;  4CYN A;  5J8F A;  3QB8 A;  4CGO A;  2P6G A;  4KOS A;  4KLV A;  4OLL A;  3T9Y A;  2CNT A;  4A31 A;  2Q4V A;  3DDD A;  4UWI A;  1XF8 A;  3FYN A;  4AVB A;  2Z3N A;  1XEB A;  1B6B A;  4OAD A;  2G0B A;  2YNE A;  2HUZ A;  4CAV A;  1GHE A;  2CNS A;  4DNC A;  1UFH A;  1BO4 A;  2J8N A;  4UBR A;  4CGM A;  1MJ9 A;  2FIA A;  5AG4 A;  3GKR A;  3CXQ A;  5E96 A;  3FXT A;  5KTA A;  3R9G A;  1YX0 A;  2R98 A;  4C7I A;  4ZGY B;  4MJ8 A;  2Z0Z A;  2VI7 A;  2WPW A;  1QSO A;  4JJX A;  4KVM E;  2R7H A;  3H5Z A;  4IF5 A;  5C82 A;  2YGW A;  1KUV A;  4E2A A;  2ZW5 A;  2I00 A;  2WPX A;  4NXY A;  4KOW A;  3K9U A;  4JXR A;  4CAX A;  5GCN A;  4MI4 A;  4QUS A;  3D2M A;  5HH1 A;  3TE4 A;  1KUY A;  4C7H A;  4YRH A;  3DR6 A;  5JPH A;  2GIV A;  2Q4Y A;  2Z3L A;  3TFY A;  2B5G A;  3JUW A;  1XMT A;  4KOY A;  3T90 A;  1L0C A;  4LUA A;  4A32 A;  2D4O A;  1S5K A;  3KKW A;  4UFX A;  5IB0 A;  2DPT A;  1Q2C A;  2B3U A;  4AG9 A;  1S3Z A;  2VZY A;  4JLY A;  4CGN A;  4A2Z A;  3P2H A;  3ZZI A;  1P4N A;  2QEC A;  4F0X A;  4YFJ A;  4HNW B;  4UWJ A;  2JLM A;  3TO6 A;  4C2X A;  2AJ6 A;  4KZT A;  1I21 A;  3EO4 A;  4HKF A;  5DWN A;  4AVA A;  1MJB A;  1PU9 A;  1MJA A;  3FIX A;  4KOT A;  4KOV A;  5F49 A;  1CJW A;  2O28 A;  4U9Z A;  4JXQ A;  2HV2 A;  3R1K A;  4BBH A;  1U6M A;  4Y49 C;  4B5P A;  1S7N A;  5J8C A;  1QST A;  4PK3 A;  3IWE A;  4K30 A;  4CGL A;  1BOB A;  4H6U A;  1N71 A;  1K4J A;  3F8K A;  2WSA A;  4AB7 A;  3D3S A;  2KCW A;  2YNC C;  1VKC A;  1S7L A;  4A95 A;  1KZF A;  2QIR A;  4Q36 A;  2OH1 A;  1Q2Y A;  1M44 A;  2I79 A;  2A4N A;  4PSX A;  4QC6 A;  3EFA A;  4XPL A;  4JD6 A;  4PV6 A;  2Z3P A;  2H5M A;  3CXS A;  2QML A;  2B4D A;  4KUB A;  2Z3M A;  4NF1 A;  3E0K A;  4RI1 A;  1S60 A;  4CAW A;  3OWC A;  2Q04 A;  5G20 A;  4E8O A;  2P6F A;  3EY5 A;  2JEV A;  3S6G A;  3TOA A;  1YVO A;  2JDC A;  3TT2 A;  4C2Z A;  2ZW6 A;  2OZU A;  2ATR A;  1B87 A;  2VXK A;  4MFK A;  5ISV A;  2R8V A;  4B10 A;  4EVY A;  4MY3 A;  1NE9 A;  4R3K A;  3VWD A;  1I1D A;  5A27 A;  3MGD A;  3W91 A;  1Y9W A;  4U9Y A;  2B4B A;  1XIX A;  2Y0M A;  3H4Q A;  3CXP A;  4XPD B;  1R57 A;  4A30 A;  1KUX A;  4CAE A;  2BSW A;  4NSQ A;  2P6E A;  3DR8 A;  4XNH C;  2YNC A;  2FL4 A;  1PUA A;  3GY9 A;  4II9 A;  5F46 A;  3GYA A;  4X5K A;  2HQY A;  1QSN A;  4Y49 B;  1ON0 A;  3TCV A;  5G22 A;  4YGO A;  4CRY B;  4HNY B;  5FVJ A;  5G1Z A;  2YND A;  3TOB A;  2REF A;  5F48 A;  3C26 A;  3I9S A;  4CGP A;  2FT0 A;  3FRM A;  2B5G B;  2REE A;  5DWM A;  4JWP A;  1MK4 A;  4MFZ A;  4C68 A;  1V0C A;  2VEZ A;  4MFL A;  1YR0 A;  2PSW A;  3EXN A;  4MBU A;  4XPD C;  2EUI A;  2CNM A;  5EBV A;  4RS2 A;  3FNC A;  1M4I A;  4BMH A;  4KS9 A;  3RYO A;  4QBJ A;  4PSW A;  3FBU A;  2X7B A;  2Z10 A;  4J3G A;  4AVC A;  4H89 A;  4KUA A;  5AGE A;  3WR7 A;  3ZJ0 A;  3S6K A;  1LRZ A;  3SHP A;  3FB3 A;  2K5T A;  5EC4 A;  5JQ4 A;  2OU2 A;  4ONU A;  1Z4R A;  4KOR A;  4CS0 B;  5I0C A;  5C88 A;  2GAN A;  2CXA A;  2GE3 A;  4FD4 A;  3DNS A;  3UY5 A;  1S7K A;  2EVN A;  4LX9 A;  1RXT A;  2IL4 A;  1VHS A;  4HNX B;  5H86 A;  3LOD A;  3F0A A;  1QSM A;  3W6S A;  5KTC A;  1NMT A;  4B5P B;  2FE7 A;  3BLN A;  4MHD A;  4B12 A;  2PQ8 A;  1CM0 A;  2F5I A;  2VQY A;  1YK3 A;  4F0Y A;  1RO5 A;  1Y9K A;  5IX3 A;  4UCP A;  5AG7 A;  1WK4 A;  2FCK A;  2PRB A;  3S6F A;  3F5B A;  4KVO E;  4I49 A;  3TTH A;  4KSF A;  4Q38 A;  4XNH B;  1FY7 A;  2C27 A;  4CRZ B;  2G3T A;  1YRE A;  4U5Y A;  2D4P A;  3A9L A;  1IYL A;  1YVK A;  4UFW A;  3PP9 A;  4AG7 A;  5F47 A;  2OZH A;  3JTK A;  2BUE A;  2FSR A;  3N7Z A;  5AG5 A;  2B4D B;  5AG6 A;  2J8M A;  2PDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...