2HQYA

Crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
MIPFKDITLADRDTITAFTMKSDRRNCDLSFSNLCSWRFLYDTQFAVIDDFLVFKFWAGEQLAYMMPVGNGDLKAVLRKLIEDADKEKHNFCMLGVCSNMRADLEAILPERFIFTEDRAYADYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNFEALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLSYQPVTILEKYMACLKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482
rcsb
source organism Bacteroides thetaiotaomicron
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09924 DUF2156 Uncharacterised conserved protein (DUF2156)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA01
2RC4A 1M44A 2ZW5A 2PQ8A 4MY0A 4AG7A 5J8CA 4KLVA 1IIDA 3CXQA 2REFA 4E2AA 1M4GA 2KCWA 2PDOA 3FIXA 3JUWA 3R1KA 3G8WA 2G3TA 2VXKA 4B5PB 4MBUA 4KOVA 4U9ZA 4BMHA 1U6MA 2WPWA 4AVBA 3EY5A 1L0CA 4Y49C 2VQYA 2Z0ZA 3N7ZA 4UWIA 4KVXA 4PK2A 1QSRA 3D8PA 1I21A 1UFHA 2Y0MA 2Q4VA 1S7LA 3F0AA 4DNCA 4QBJA 2Q4YA 4QB9A 1B6BA 1OZPA 2H5MA 3BJ8A 5KTCA 4LX9A 3S6FA 3EFAA 4YFJA 4YRHA 3R9GA 1M4IA 2EUIA 4MI4A 2ZPAA 1QSNA 3TFYA 4B5OA 4HNYB 3T9YA 4K30A 3JVNA 4R3LA 5F47A 2REEA 2FSRA 2VI7A 4KZTA 5H86A 5EC4A 2JDCA 3WR7A 3TOAA 3DDDA 2D4PA 3TO9A 5JPHA 3B8GA 2G0BA 2BL1A 1S7NA 2BEIA 3GKRA 3P2FA 5KTDA 1NMTA 2VBQA 3FB3A 3DSBA 3DNSA 4GS4A 4U9YA 4FD5A 3FBUA 1RO5A 5GCNA 4OADA 2OZUA 1P0HA 1Y9WA 3V8IA 1IB1E 4XNHC 3FRMA 1XE4A 5H84A 4E0AA 4FD6A 2HV2A 1P4NA 4FD7A 4H6UA 4EVYA 3VWEA 4M3SA 4AG9A 3CXSA 3MGDA 1WWZA 4CAWA 1XEBA 2R7HA 2P0WA 1Q2YA 2R1IA 5KTAA 2FT0A 3TTHA 4NXYA 5J8FA 4IUSA 3W6SA 5F46A 5I0CA 3I9SA 5HMNA 2P6GA 4AVAA 4CRYB 1CJWA 3LODA 1M4DA 5EBVA 4NSQA 4JXRA 2R8VA 2PSWA 4I49A 4KOTA 4IF5A 2ARHA 4XPDC 1QSOA 2B4DA 1SQHA 1WK4A 4J3GA 3W6XA 1YX0A 3IGRA 1Q2DA 1GHEA 4E8OA 4JD6A 1I1DA 3KKWA 1XF8A 4PSWA 2CNMA 4MHDA 4KVME 2JLMA 1M1DA 4KUBA 3BJ7A 3FNCA 4OLLA 4X5KA 2B4DB 2OZHA 4HNWB 4R57A 3S6KA 1YVOA 1QSMA 2B5GA 3R9EA 3TE4A 2JEVA 4PV6A 2Z11A 1YVKA 2Z10A 1YREA 4KOUA 2I00A 2PR1A 1I12A 3SXNA 3RYOA 4ZBGA 4XPLA 2P6FA 4RI1A 1KUXA 2ZXVA 4QVTA 2QMLA 2J8NA 1S7KA 1IYLA 4OAEA 2OU2A 4L89A 5C82A 2PC1A 1J4JA 2GE3A 1Y7RA 1MJBA 5CNPA 2VEZA 1YLEA 2FS5A 4JLYA 2AE6A 2B4BA 3DR8A 2VZZA 3SXOA 1K4JA 4HNXB 1Q2CA 4LUAA 5HH1A 1S3ZA 1R57A 3D3SA 1YGHA 2A4NA 1KUVA 3T90A 3S6GA 2FE7A 4UBRA 3LD2A 2GANA 2AJ6A 4PK3A 3I3GA 2F5IA 4KLWA 4NEXA 1CM0A 1YK3A 1S60A 1Z4EA 2O28A 4ORFA 4MY3A 4KUAA 3SHPA 4AB7A 2FXFA 4KOSA 3ZJ0A 2K5TA 3QAHA 3TO6A 3OWCA 1BO4A 2Q04A 5F49A 4UA3A 1TIQA 3FXTA 2WPXA 3NE7A 2C27A 2HUZA 2D4OA 1Y9KA 1N71A 4R87A 2J8RA 1IYKA 4II9A 2BUEA 4JXQA 3W91A 1IICA 4PSXA 4XPKA 2B3VA 1BOBA 1PUAA 4MJ8A 3EXNA 3BLNA 2Q0YA 3R96A 4B5PA 3ZZIA 2X7BA 2OH1A 3TOBA 5IX3A 3GY9A 1VHSA 1V0CA 5DWMA 2NMTA 3P2HA 4ONUA 4AVCA 2PRBA 4H89A 3F5BA 1MK4A 4H6ZA 5JQ4A 5E96A 3CXPA 2EVNA 5FVJA 2GIVA 3VWDA 3S6HA 2JDDA 2I79A 2OZGA 2G3AA 3E0KA 1RXTA 1QSTA 2OB0A 1MJAA 5IB0A 4CRZB 4YGOA 2B5GB 3TT2A 4CAXA 4R9MA 2CNTA 2IL4A 2CNSA 4L8AA 2FIAA 4F6AA 1S5KA 1XMTA 3EC4A 1NE9A 4CAVA 1LRZA 2FL4A 5ISVA 2HQYA 4F0YA 4XNHB 3DR6A 4NCZA 2Q44A 5F48A 2CY2A 4FD4A 1XIXA 3PGPA 4JWPA 1FY7A 3H4QA 5DWNA 3IWGA 1Z4RA 2QECA 1S7FA 1YR0A 2P6EA 1ON0A 3D2PA 2VZYA 3PP9A 3TO7A 5C88A 3R9FA 4RS2A 4HKFA 4KVOE 4UWJA 1KZFA 4U5YA 3EO4A 2ZW4A 2B3UA 4NF1A 4CS0B 2FCKA 3GYAA 4KORA 4KOXA 1B87A 2Q7BA 3C26A 3R95A 4XPDB 4KOYA 3D2MA 1PU9A 4M85A 1Z9UA 3QB8A 1KUYA 4R3KA 4Y49B 5IV0A 3F8KA 3K9UA 2ZW6A 3UY5A 1MJ9A 2ZW7A 2R98A 2QIRA 4QUSA 1VKCA 2BSWA 3G3SA 2J8MA 4JJXA 4KOWA 2DXQA 2PR8A 1NSLA 3TCVA 3FYNA 3PZJA 2ATRA 2FIWA 4QC6A 2B58A
chains in the Genus database with same CATH superfamily
2RC4A 2Z3PA 4IAVA 5CPAA 1OBRA 1M44A 1ARLA 4NFRA 1JQGA 2ZW5A 2PQ8A 2PJ2A 4JYWA 4MY0A 2CF4A 5JGFA 4P6YA 2XEGA 3IU1A 4AG7A 5J8CA 4CYPA 4KLVA 1XBUA 4GM5A 1IIDA 1KWMA 2JEWA 4F0XA 3CXQA 3QNVA 1QQ9A 3SJFA 1LOKA 4CGMA 3N5FA 2REFA 3FH4A 4E2AA 1M4GA 2KCWA 2PDOA 3BI0A 3FIXA 2IMOA 3PB7X 4MFJA 3TC8A 4A32A 3JUWA 3R1KA 3G8WA 3GB0A 1TF9A 2G3TA 3DGVA 3IFEA 4MCQA 4ZX9A 4F9VA 2VXKA 4B5PB 4MBUA 4KOVA 4U9ZA 4BMHA 3RBUA 4DYOA 1U6MA 4C68A 2WPWA 4AVBA 3EY5A 1L0CA 4Y49C 2VQYA 5HVFA 2BO9A 5I4MA 2Z0ZA 3N7ZA 4UFXA 4UWIA 4KVXA 4EWTA 4CYOA 4PK2A 1YW6A 4A31A 4A95A 1QSRA 3D8PA 1I21A 1UFHA 2Y0MA 4CPAA 5IB9A 2VL1A 4C7IA 2Q4VA 1S7LA 3F0AA 4DNCA 5AG6A 2I3CA 4QBJA 3PB6X 2GREA 2Q4YA 4P4IA 4QB9A 1CG2A 1B6BA 1OZPA 3KGQA 2H5MA 5DS0A 4MFLA 3BJ8A 1H8LA 1BPMA 1XRYA 5KTCA 4P45A 4LX9A 3S6FA 2IQ6A 3SJXA 3EFAA 3D66A 4PXEA 4YRHA 3R9GA 4YFJA 1M4IA 4DUKA 3NFZA 2EUIA 4MI4A 2ZPAA 1QSNA 3LWUA 3TFYA 3FEEA 3D7FA 3S9LA 4B5OA 6CPAA 1RTQA 2V8HA 3FJUA 1TKFA 4HNYB 4MFPA 4PXCA 3T9YA 2DPTA 2DF5A 4MCRA 4CGPA 4NGMA 2C6CA 3IWWA 3JVNA 4K30A 4R3LA 5F47A 2PVWA 2REEA 4OC4A 2FSRA 2VI7A 4KZTA 5H86A 5EC4A 1Z5RA 1HDUA 2JDCA 2YNEA 1ZG8A 3WR7A 2QYVA 3TOAA 2C6PA 3DDDA 2D4PA 3IWEA 4TWEA 4CYNA 3TO9A 2PJ1A 5JPHA 5AG4A 3B8GA 2PJ6A 1AYEA 2G0BA 2BL1A 1S7NA 2BEIA 2JBJA 3GKRA 3P2FA 3B3SA 1NMTA 5KTDA 2HC9A 2VBQA 4MCPA 3FB3A 1LAMA 3DSBA 4OIWA 3DNSA 2PJCA 4GS4A 4WJBA 2WUUA 4OC5A 4P4JA 4U9YA 4FD5A 3KL9A 3WABA 2YNCC 2HB6A 4ZGYB 3FBUA 1RO5A 1VHOA 3KHZA 2BCOA 5GCNA 2OOTA 4OADA 2OZUA 1P0HA 3FEDA 1Y9WA 4P4FA 3NA6A 2XEIA 2GFQA 1CBXA 3V8IA 5LYDA 1TKHA 2PJ0A 1HEEA 1Z8TA 1IB1E 4XNHC 4B14A 3FRMA 1XE4A 2DEAA 2ZEDA 5H84A 4E0AA 1F2PA 1LANA 2DPSA 4FD6A 2HV2A 1FT7A 1P4NA 2PJ5A 4NGRA 4CYQA 4FD7A 4H6UA 4EVYA 3VWEA 4M3SA 4AG9A 4ZYQA 4ZY1A 3CXSA 3MGDA 1WWZA 3V38A 4CAWA 1XEBA 2WYRA 2V8VA 3SI0A 2R7HA 2P0WA 1Q2YA 3JRUA 3KZWA 4PXDA 1IOFA 2R1IA 1XMBA 4KSIA 4RUHA 5KTAA 4FAIA 2FT0A 2O53A 4IK2A 4NXYA 4UFVA 3TTHA 3D68A 4C2ZA 5J8FA 5JM6A 4IUSA 3ISXA 3W6SA 4UEFA 5F46A 1LAPA 5I0CA 4UIAA 5D29A 4C2YA 3I9SA 5HMNA 3FVLA 3NH5A 4UCMA 5LRGA 3D7DA 4Z65A 3BXMA 1HDQA 4GXHA 1ELMP 2AFMA 2P6GA 4AVAA 1FNOA 4CRYB 1F2OA 1CJWA 3LODA 1M4DA 5HVHA 4MMOA 1X12A 4MFZA 5AG5A 5EBVA 4NSQA 3NE8A 2R8VA 4JXRA 2NYQA 2PIZA 2PSWA 4A33A 3VH9A 4P44A 4I49A 1Z2LA 2OR4A 2V77A 3PB8X 3D67A 3MN8A 4KOTA 4IF5A 2ARHA 4XPDC 1VHEA 1QSOA 2ABZA 2B4DA 3FMCA 5ELYA 3B2YA 1IOIA 1SQHA 1WK4A 3SI1A 2G9DA 4J3GA 4ZY2A 1YX0A 3W6XA 1GYTA 5J1QA 1YLOA 3IGRA 3LACA 1EE3P 1GHEA 1Q2DA 1JWQA 2Q51A 4JD6A 1I1DA 4A94A 4E8OA 4R7MA 3KKWA 2ZOFA 4PPZA 1XF8A 4PSWA 4CGNA 2CNMA 2AFUA 4MHDA 1YW4A 3KR5A 4KVME 3VWDA 2JLMA 1M1DA 1X10A 4KUBA 3BJ7A 3FNCA 4BD9A 4FBEA 4OLLA 4X5KA 2Z3OA 3LMSA 2B4DB 2OZHA 4HNWB 4R57A 4LQGA 3S6KA 1YVOA 1QSMA 1DTDA 2B5GA 2ODFA 2GLFA 3R9EA 3TE4A 2JEVA 1Y7EA 2GLJA 2Z11A 1YVKA 4PV6A 2Z10A 1YREA 4KOUA 2I00A 2IJZA 5THWA 2PR1A 1I12A 3SXNA 4M6IA 2JBKA 4UCPA 4YU9A 3QAYA 4EFDA 4UFWA 4UIBA 4M6HA 4ZBGA 3RYOA 4B13A 4XPLA 2AFZA 4UCNA 2P6FA 4M6GA 3RNZA 5HVGA 1PYTB 4RI1A 1KUXA 2ZXVA 1Y0RA 4QVTA 2QMLA 4UEZA 2J8NA 1S7KA 2ZELA 4OP4A 3IEHA 1ELLP 1IYLA 4OAEA 2OU2A 2PJ9A 4L89A 5C82A 2PC1A 5K8OA 4NJQA 1J4JA 2PJ8A 2GE3A 5BWAB 1Y7RA 1MJBA 5LYFA 1CX8A 4CAEA 1PCAA 5CNPA 4IHMA 2PIYA 2VEZA 2EBJA 4BINA 4HPSA 5CBMA 1YLEA 2FS5A 4JLYA 3S9MA 5K8NA 2AE6A 2B4BA 2Z3NA 4H2KA 3DR8A 1XFOA 4OC1A 2ZEOA 2VZZA 3FF3A 3SXOA 1K4JA 1ZO0A 4HNXB 1Q2CA 4LUAA 3RZAA 5HH1A 2Z3LA 1S3ZA 3CT9A 1R57A 3D3SA 3PFOA 1YGHA 4F8ZA 3IU2A 2A4NA 1KUVA 2V8GA 3B35A 1Z8LA 3D7HA 4KS9A 1VIXA 3T90A 4OC2A 3TX8A 2EWBA 2GU2A 3S6GA 1TF8A 2ANPA 2FE7A 2QJ8A 4UBRA 1CP7A 2YGWA 2WZNA 3K9TA 5AG7A 2BOAA 3LD2A 3KASA 3ISZA 1ZG7A 2GANA 2AJ6A 2PJ4A 2PJBA 4R6TA 4PK3A 5LRJA 4OKOA 2O4HA 3KHXA 1AUGA 4B12A 5K8MA 3I3GA 3B3WA 2F5IA 4KLWA 4NEXA 1CM0A 4NGSA 4A2ZA 1R43A 4ZX8A 5F09A 1YK3A 2ZOGA 4MRIA 2NSMA 4F9UA 1S60A 4NGPA 4C7HA 5A27A 2J9AA 1Z4EA 2O28A 4ORFA 4MY3A 4KUAA 3SHPA 4AB7A 2FXFA 4KOSA 4X2TA 4NJRA 4UEEA 2PRQA 4AXVA 4OC3A 3WC6A 3ZJ0A 2K5TA 1R3NA 3IO1A 3QAHA 2CTBA 3TO6A 3OWCA 1BO4A 2Q04A 3PBBA 5F49A 3VARA 4UA3A 1TIQA 3FXTA 2WPXA 3IIBA 2ZEPA 3NE7A 4ZY0A 2C27A 2HUZA 2D4OA 1Y9KA 1N71A 2V8DA 4R87A 2J8RA 4NGTA 1IYKA 2C1CA 4II9A 4CAFA 3IJ3A 2BUEA 4JXQA 4MFKA 3GUXA 1IICA 4PSXA 3W91A 4A30A 4XPKA 4R76A 2B3VA 3PFEA 3H8GA 4CGLA 1BOBA 4RN7A 2PJAA 1PUAA 1ZG9A 4MJ8A 3EXNA 1ARMA 1TKJA 3BLNA 2Q0YA 3R96A 3DLJA 2Q43A 2C6GA 3SJGA 3A9LA 4B11A 4B5PA 2CXAA 3ZZIA 2X7BA 3S9NA 1IY7A 2OH1A 3TOBA 5JH9A 5IX3A 4DJLA 3K2KA 2ZENA 3BI1A 1CP6A 3GY9A 3GLJA 3WC7A 3SJEA 1VHSA 1V0CA 3FECA 1Y0YA 2FVGA 4P10A 4CGOA 1ZLHA 3IC1A 3JTKA 5G1ZA 3PRTA 3L2NA 2NMTA 3P2HA 2AFOA 4NGNA 5DWMA 4ONUA 2YNCA 1CPXA 4AVCA 5A28A 2PJ7A 2PRBA 3F5BA 1MK4A 4H6ZA 4H89A 5D8NA 3B7IA 3SI2A 5JQ4A 5E96A 4PXBA 5HXDA 3CXPA 2EVNA 5FVJA 2CTCA 2GIVA 2EK8A 3KQZA 4W9YA 4MCSA 3S6HA 2JDDA 2I79A 2ZEGA 2OZGA 3B3TA 2G3AA 3E0KA 1RXTA 1NSAA 4R8FA 1QSTA 2OB0A 2PE3A 3FX6A 1MJAA 5IB0A 2EO8A 4CRZB 4YGOA 2B5GB 3TT2A 3KR4A 2AFSA 1DE4C 4R9MA 4CAXA 1TXRA 2CNTA 1QMUA 3CDXA 4ZI6A 2IL4A 2CNSA 4L8AA 3VATA 4A39A 2FIAA 4F6AA 1S5KA 4Q7AA 4MHNA 1LCPA 1XMTA 3EC4A 1NE9A 3H8FA 1LRZA 3I1UA 4CAVA 2FL4A 5ISVA 1BAVA 2HQYA 3PB9X 4K3NA 2RFHA 3PBEA 4JZ0A 1M4LA 4MXUA 1Z8XA 3DR6A 4XNHB 4F0YA 4NCZA 2Q44A 4P4BA 5F48A 1YMEA 4BBHA 2CY2A 4FD4A 5EMIA 3KQXA 1XIXA 2CIJA 3PGPA 4JWPA 4P4EA 1FY7A 1IU8A 3V7ZA 8CPAA 3H4QA 3WT4A 5DWNA 5G20A 1AMPA 5LYLA 3IWGA 5AGEA 3HUVA 3NH4A 1Z4RA 3PB4X 2QECA 4PQAA 4UF4A 3WC5A 1S7FA 1YR0A 4WWVA 2P6EA 1ON0A 3D2PA 4MHPA 4X8IA 3BHXA 4B10A 2AFWA 2POKA 2VZYA 3PP9A 4FWUA 5G21A 2WSAA 3TO7A 3RO0A 3H5ZA 4NGQA 1BPNA 1YQEA 4RS2A 4HKFA 4KVOE 4KSAA 4X3RA 3R9FA 5C88A 2RB7A 4UWJA 4G1PA 2ZEMA 5LYIA 1KZFA 4U5YA 1Q7LA 3EO4A 4OMEA 4EMEA 2ZW4A 2B3UA 1F57A 2XEFA 4NF1A 4O23A 4ONWA 4CS0B 2FCKA 4A37A 3CZXA 2PCUA 4OC0A 2XEJA 3GYAA 2YNDA 4P4DA 3H8EA 2PVVA 2Z3MA 4KORA 1ZLIA 4KOXA 1B87A 2Q7BA 3HLPA 1XOVA 3C26A 3KI9A 2Q7SA 2F8HA 2PJ3A 3D7GA 3R95A 4XPDB 5LRKA 3GIUA 4KOYA 2ZEEA 3D4UA 4KSFA 4MFQA 4TNUA 2Q4ZA 3RAMA 3CPXA 3B3CA 3D2MA 1PU9A 4M85A 1UWYA 3B3VA 5G22A 3T8WA 4C2XA 1Z9UA 3QB8A 1IGBA 1KUYA 4R3KA 4FUUA 1LFWA 4OIDA 4Y49B 7CPAA 2Z3KA 4Q38A 1YSJA 2ZEHA 2AFXA 3F8KA 3K9UA 5IV0A 2ZW6A 4LQ6A 2EK9A 2ZEFA 3UY5A 3CPAA 4B6ZA 1MJ9A 1XJOA 2ZW7A 2R98A 2QIRA 3MRUA 4YWYA 4QUSA 2QVPA 1VKCA 2BSWA 1VGYA 3G3SA 4A38A 2J8MA 3PEIA 4JJXA 1Z8WA 2DXQA 3NH8A 4KOWA 4MHZA 1A2ZA 4Q36A 5K8PA 2PR8A 4MHYA 1NSLA 1CPSA 2F7VA 3FYNA 3PZJA 2ATRA 3TCVA 2FIWA 4QC6A 2B58A 1BLLE
chains in the Genus database with same CATH topology
2RC4A 2Z3PA 1M44A 2ZW5A 2PQ8A 4MY0A 3IU1A 4AG7A 5J8CA 4CYPA 4KLVA 1IIDA 4F0XA 3CXQA 4CGMA 2REFA 4E2AA 1M4GA 2KCWA 2PDOA 3FIXA 4MFJA 4A32A 3JUWA 3R1KA 3G8WA 2G3TA 2VXKA 4B5PB 4MBUA 4KOVA 4U9ZA 4BMHA 1U6MA 4C68A 2WPWA 4AVBA 3EY5A 1L0CA 4Y49C 2VQYA 2Z0ZA 3N7ZA 4UFXA 4UWIA 4KVXA 4CYOA 4PK2A 4A31A 4A95A 1QSRA 3D8PA 1I21A 1UFHA 2Y0MA 4C7IA 2Q4VA 1S7LA 3F0AA 4DNCA 5AG6A 4QBJA 2Q4YA 4QB9A 1B6BA 1OZPA 2H5MA 4MFLA 3BJ8A 5KTCA 4LX9A 3S6FA 3EFAA 4YFJA 4YRHA 3R9GA 1M4IA 2EUIA 4MI4A 2ZPAA 1QSNA 3TFYA 4B5OA 4HNYB 4MFPA 3T9YA 2DPTA 4CGPA 4K30A 3JVNA 4R3LA 5F47A 2REEA 2FSRA 2VI7A 4KZTA 5H86A 5EC4A 2JDCA 2YNEA 3WR7A 3TOAA 3DDDA 2D4PA 3IWEA 4CYNA 3TO9A 5JPHA 5AG4A 3B8GA 2G0BA 2BL1A 1S7NA 2BEIA 3GKRA 3P2FA 5KTDA 1NMTA 2VBQA 3FB3A 3DSBA 3DNSA 4GS4A 2WUUA 4U9YA 4FD5A 2YNCC 4ZGYB 3FBUA 1RO5A 5GCNA 4OADA 2OZUA 1P0HA 1Y9WA 3V8IA 4B14A 1IB1E 4XNHC 3FRMA 1XE4A 5H84A 4E0AA 4FD6A 2DPSA 2HV2A 1P4NA 4CYQA 4FD7A 4H6UA 4EVYA 3VWEA 4M3SA 4AG9A 3CXSA 3MGDA 1WWZA 4CAWA 1XEBA 2R7HA 2P0WA 1Q2YA 2R1IA 5KTAA 2FT0A 4UFVA 3TTHA 4NXYA 5J8FA 4C2ZA 4IUSA 3W6SA 5F46A 5I0CA 4C2YA 3I9SA 5HMNA 4UCMA 2P6GA 4AVAA 4CRYB 1CJWA 3LODA 1M4DA 4MFZA 5AG5A 5EBVA 4NSQA 4JXRA 2R8VA 2PSWA 4A33A 4I49A 4KOTA 4IF5A 2ARHA 4XPDC 1QSOA 2B4DA 1SQHA 1WK4A 4J3GA 3W6XA 1YX0A 3IGRA 1Q2DA 1GHEA 4E8OA 4JD6A 1I1DA 3KKWA 1XF8A 4PSWA 4CGNA 2CNMA 4MHDA 4KVME 2JLMA 1M1DA 4KUBA 3BJ7A 3FNCA 4OLLA 4X5KA 2Z3OA 2B4DB 2OZHA 4HNWB 4R57A 3S6KA 1YVOA 1QSMA 2B5GA 3R9EA 3TE4A 2JEVA 4PV6A 2Z11A 1YVKA 2Z10A 1YREA 4KOUA 2I00A 2PR1A 1I12A 3SXNA 4UCPA 4UFWA 3RYOA 4ZBGA 4B13A 4XPLA 4UCNA 2P6FA 4RI1A 1KUXA 2ZXVA 4QVTA 2QMLA 2J8NA 1S7KA 1IYLA 4OAEA 2OU2A 4L89A 5C82A 2PC1A 1J4JA 2GE3A 5BWAB 1Y7RA 1MJBA 4CAEA 5CNPA 2VEZA 1YLEA 2FS5A 4JLYA 2AE6A 2B4BA 2Z3NA 3DR8A 2VZZA 3SXOA 1K4JA 1ZO0A 4HNXB 1Q2CA 4LUAA 5HH1A 2Z3LA 1S3ZA 1R57A 3D3SA 1YGHA 3IU2A 2A4NA 1KUVA 4KS9A 3T90A 3S6GA 2FE7A 4UBRA 2YGWA 5AG7A 3LD2A 2GANA 2AJ6A 4PK3A 4B12A 3I3GA 2F5IA 4KLWA 4NEXA 1CM0A 4A2ZA 1YK3A 1S60A 4C7HA 5A27A 1Z4EA 2O28A 4ORFA 4MY3A 4KUAA 3SHPA 4AB7A 2FXFA 4KOSA 3ZJ0A 2K5TA 3QAHA 3TO6A 3OWCA 1BO4A 2Q04A 5F49A 4UA3A 1TIQA 3FXTA 2WPXA 3NE7A 2C27A 2HUZA 2D4OA 1Y9KA 1N71A 4R87A 2J8RA 1IYKA 4II9A 4CAFA 2BUEA 4JXQA 4MFKA 3W91A 1IICA 4PSXA 4A30A 4XPKA 2B3VA 4CGLA 1BOBA 1PUAA 4MJ8A 3EXNA 3BLNA 2Q0YA 3R96A 4B11A 4B5PA 3A9LA 2CXAA 3ZZIA 2X7BA 2OH1A 3TOBA 5IX3A 3GY9A 1VHSA 1V0CA 4CGOA 3JTKA 5G1ZA 5DWMA 2NMTA 3P2HA 4ONUA 2YNCA 4AVCA 5A28A 2PRBA 4H89A 3F5BA 1MK4A 4H6ZA 5JQ4A 5E96A 3CXPA 2EVNA 5FVJA 2GIVA 3VWDA 3S6HA 2JDDA 2I79A 2OZGA 2G3AA 3E0KA 1RXTA 1QSTA 2OB0A 1MJAA 5IB0A 4CRZB 4YGOA 2B5GB 3TT2A 4CAXA 4R9MA 2CNTA 2IL4A 2CNSA 4L8AA 2FIAA 4F6AA 1S5KA 1XMTA 3EC4A 1NE9A 4CAVA 1LRZA 2FL4A 5ISVA 2HQYA 4F0YA 4XNHB 3DR6A 4NCZA 2Q44A 5F48A 4BBHA 2CY2A 4FD4A 1XIXA 3PGPA 4JWPA 1FY7A 3H4QA 5DWNA 5G20A 3IWGA 5AGEA 1Z4RA 2QECA 1S7FA 1YR0A 2P6EA 1ON0A 3D2PA 4B10A 2VZYA 3PP9A 5G21A 2WSAA 3TO7A 3H5ZA 5C88A 3R9FA 4RS2A 4HKFA 4KVOE 4KSAA 4UWJA 1KZFA 4U5YA 3EO4A 2ZW4A 2B3UA 4NF1A 4CS0B 2FCKA 3GYAA 2YNDA 2Z3MA 4KORA 4KOXA 1B87A 2Q7BA 3C26A 3R95A 4XPDB 4KOYA 4MFQA 4KSFA 3D2MA 1PU9A 4M85A 5G22A 4C2XA 1Z9UA 3QB8A 1KUYA 4R3KA 4Y49B 2Z3KA 4Q38A 5IV0A 3F8KA 3K9UA 2ZW6A 3UY5A 1MJ9A 2ZW7A 2R98A 2QIRA 4QUSA 1VKCA 2BSWA 3G3SA 2J8MA 4JJXA 4KOWA 2DXQA 4Q36A 2PR8A 1NSLA 3TCVA 3FYNA 3PZJA 2ATRA 2FIWA 4QC6A 2B58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC4 A;  1M44 A;  2ZW5 A;  2PQ8 A;  4MY0 A;  4AG7 A;  5J8C A;  4KLV A;  1IID A;  3CXQ A;  2REF A;  4E2A A;  1M4G A;  2KCW A;  2PDO A;  3FIX A;  3JUW A;  3R1K A;  3G8W A;  2G3T A;  2VXK A;  4B5P B;  4MBU A;  4KOV A;  4U9Z A;  4BMH A;  1U6M A;  2WPW A;  4AVB A;  3EY5 A;  1L0C A;  4Y49 C;  2VQY A;  2Z0Z A;  3N7Z A;  4UWI A;  4KVX A;  4PK2 A;  1QSR A;  3D8P A;  1I21 A;  1UFH A;  2Y0M A;  2Q4V A;  1S7L A;  3F0A A;  4DNC A;  4QBJ A;  2Q4Y A;  4QB9 A;  1B6B A;  1OZP A;  2H5M A;  3BJ8 A;  5KTC A;  4LX9 A;  3S6F A;  3EFA A;  4YFJ A;  4YRH A;  3R9G A;  1M4I A;  2EUI A;  4MI4 A;  2ZPA A;  1QSN A;  3TFY A;  4B5O A;  4HNY B;  3T9Y A;  4K30 A;  3JVN A;  4R3L A;  5F47 A;  2REE A;  2FSR A;  2VI7 A;  4KZT A;  5H86 A;  5EC4 A;  2JDC A;  3WR7 A;  3TOA A;  3DDD A;  2D4P A;  3TO9 A;  5JPH A;  3B8G A;  2G0B A;  2BL1 A;  1S7N A;  2BEI A;  3GKR A;  3P2F A;  5KTD A;  1NMT A;  2VBQ A;  3FB3 A;  3DSB A;  3DNS A;  4GS4 A;  4U9Y A;  4FD5 A;  3FBU A;  1RO5 A;  5GCN A;  4OAD A;  2OZU A;  1P0H A;  1Y9W A;  3V8I A;  1IB1 E;  4XNH C;  3FRM A;  1XE4 A;  5H84 A;  4E0A A;  4FD6 A;  2HV2 A;  1P4N A;  4FD7 A;  4H6U A;  4EVY A;  3VWE A;  4M3S A;  4AG9 A;  3CXS A;  3MGD A;  1WWZ A;  4CAW A;  1XEB A;  2R7H A;  2P0W A;  1Q2Y A;  2R1I A;  5KTA A;  2FT0 A;  3TTH A;  4NXY A;  5J8F A;  4IUS A;  3W6S A;  5F46 A;  5I0C A;  3I9S A;  5HMN A;  2P6G A;  4AVA A;  4CRY B;  1CJW A;  3LOD A;  1M4D A;  5EBV A;  4NSQ A;  4JXR A;  2R8V A;  2PSW A;  4I49 A;  4KOT A;  4IF5 A;  2ARH A;  4XPD C;  1QSO A;  2B4D A;  1SQH A;  1WK4 A;  4J3G A;  3W6X A;  1YX0 A;  3IGR A;  1Q2D A;  1GHE A;  4E8O A;  4JD6 A;  1I1D A;  3KKW A;  1XF8 A;  4PSW A;  2CNM A;  4MHD A;  4KVM E;  2JLM A;  1M1D A;  4KUB A;  3BJ7 A;  3FNC A;  4OLL A;  4X5K A;  2B4D B;  2OZH A;  4HNW B;  4R57 A;  3S6K A;  1YVO A;  1QSM A;  2B5G A;  3R9E A;  3TE4 A;  2JEV A;  4PV6 A;  2Z11 A;  1YVK A;  2Z10 A;  1YRE A;  4KOU A;  2I00 A;  2PR1 A;  1I12 A;  3SXN A;  3RYO A;  4ZBG A;  4XPL A;  2P6F A;  4RI1 A;  1KUX A;  2ZXV A;  4QVT A;  2QML A;  2J8N A;  1S7K A;  1IYL A;  4OAE A;  2OU2 A;  4L89 A;  5C82 A;  2PC1 A;  1J4J A;  2GE3 A;  1Y7R A;  1MJB A;  5CNP A;  2VEZ A;  1YLE A;  2FS5 A;  4JLY A;  2AE6 A;  2B4B A;  3DR8 A;  2VZZ A;  3SXO A;  1K4J A;  4HNX B;  1Q2C A;  4LUA A;  5HH1 A;  1S3Z A;  1R57 A;  3D3S A;  1YGH A;  2A4N A;  1KUV A;  3T90 A;  3S6G A;  2FE7 A;  4UBR A;  3LD2 A;  2GAN A;  2AJ6 A;  4PK3 A;  3I3G A;  2F5I A;  4KLW A;  4NEX A;  1CM0 A;  1YK3 A;  1S60 A;  1Z4E A;  2O28 A;  4ORF A;  4MY3 A;  4KUA A;  3SHP A;  4AB7 A;  2FXF A;  4KOS A;  3ZJ0 A;  2K5T A;  3QAH A;  3TO6 A;  3OWC A;  1BO4 A;  2Q04 A;  5F49 A;  4UA3 A;  1TIQ A;  3FXT A;  2WPX A;  3NE7 A;  2C27 A;  2HUZ A;  2D4O A;  1Y9K A;  1N71 A;  4R87 A;  2J8R A;  1IYK A;  4II9 A;  2BUE A;  4JXQ A;  3W91 A;  1IIC A;  4PSX A;  4XPK A;  2B3V A;  1BOB A;  1PUA A;  4MJ8 A;  3EXN A;  3BLN A;  2Q0Y A;  3R96 A;  4B5P A;  3ZZI A;  2X7B A;  2OH1 A;  3TOB A;  5IX3 A;  3GY9 A;  1VHS A;  1V0C A;  5DWM A;  2NMT A;  3P2H A;  4ONU A;  4AVC A;  2PRB A;  4H89 A;  3F5B A;  1MK4 A;  4H6Z A;  5JQ4 A;  5E96 A;  3CXP A;  2EVN A;  5FVJ A;  2GIV A;  3VWD A;  3S6H A;  2JDD A;  2I79 A;  2OZG A;  2G3A A;  3E0K A;  1RXT A;  1QST A;  2OB0 A;  1MJA A;  5IB0 A;  4CRZ B;  4YGO A;  2B5G B;  3TT2 A;  4CAX A;  4R9M A;  2CNT A;  2IL4 A;  2CNS A;  4L8A A;  2FIA A;  4F6A A;  1S5K A;  1XMT A;  3EC4 A;  1NE9 A;  4CAV A;  1LRZ A;  2FL4 A;  5ISV A;  2HQY A;  4F0Y A;  4XNH B;  3DR6 A;  4NCZ A;  2Q44 A;  5F48 A;  2CY2 A;  4FD4 A;  1XIX A;  3PGP A;  4JWP A;  1FY7 A;  3H4Q A;  5DWN A;  3IWG A;  1Z4R A;  2QEC A;  1S7F A;  1YR0 A;  2P6E A;  1ON0 A;  3D2P A;  2VZY A;  3PP9 A;  3TO7 A;  5C88 A;  3R9F A;  4RS2 A;  4HKF A;  4KVO E;  4UWJ A;  1KZF A;  4U5Y A;  3EO4 A;  2ZW4 A;  2B3U A;  4NF1 A;  4CS0 B;  2FCK A;  3GYA A;  4KOR A;  4KOX A;  1B87 A;  2Q7B A;  3C26 A;  3R95 A;  4XPD B;  4KOY A;  3D2M A;  1PU9 A;  4M85 A;  1Z9U A;  3QB8 A;  1KUY A;  4R3K A;  4Y49 B;  5IV0 A;  3F8K A;  3K9U A;  2ZW6 A;  3UY5 A;  1MJ9 A;  2ZW7 A;  2R98 A;  2QIR A;  4QUS A;  1VKC A;  2BSW A;  3G3S A;  2J8M A;  4JJX A;  4KOW A;  2DXQ A;  2PR8 A;  1NSL A;  3TCV A;  3FYN A;  3PZJ A;  2ATR A;  2FIW A;  4QC6 A;  2B58 A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  2Z3P A;  4IAV A;  5CPA A;  1OBR A;  1M44 A;  1ARL A;  4NFR A;  1JQG A;  2ZW5 A;  2PQ8 A;  2PJ2 A;  4JYW A;  4MY0 A;  2CF4 A;  5JGF A;  4P6Y A;  2XEG A;  3IU1 A;  4AG7 A;  5J8C A;  4CYP A;  4KLV A;  1XBU A;  4GM5 A;  1IID A;  1KWM A;  2JEW A;  4F0X A;  3CXQ A;  3QNV A;  1QQ9 A;  3SJF A;  1LOK A;  4CGM A;  3N5F A;  2REF A;  3FH4 A;  4E2A A;  1M4G A;  2KCW A;  2PDO A;  3BI0 A;  3FIX A;  2IMO A;  3PB7 X;  4MFJ A;  3TC8 A;  4A32 A;  3JUW A;  3R1K A;  3G8W A;  3GB0 A;  1TF9 A;  2G3T A;  3DGV A;  3IFE A;  4MCQ A;  4ZX9 A;  4F9V A;  2VXK A;  4B5P B;  4MBU A;  4KOV A;  4U9Z A;  4BMH A;  3RBU A;  4DYO A;  1U6M A;  4C68 A;  2WPW A;  4AVB A;  3EY5 A;  1L0C A;  4Y49 C;  2VQY A;  5HVF A;  2BO9 A;  5I4M A;  2Z0Z A;  3N7Z A;  4UFX A;  4UWI A;  4KVX A;  4EWT A;  4CYO A;  4PK2 A;  1YW6 A;  4A31 A;  4A95 A;  1QSR A;  3D8P A;  1I21 A;  1UFH A;  2Y0M A;  4CPA A;  5IB9 A;  2VL1 A;  4C7I A;  2Q4V A;  1S7L A;  3F0A A;  4DNC A;  5AG6 A;  2I3C A;  4QBJ A;  3PB6 X;  2GRE A;  2Q4Y A;  4P4I A;  4QB9 A;  1CG2 A;  1B6B A;  1OZP A;  3KGQ A;  2H5M A;  5DS0 A;  4MFL A;  3BJ8 A;  1H8L A;  1BPM A;  1XRY A;  5KTC A;  4P45 A;  4LX9 A;  3S6F A;  2IQ6 A;  3SJX A;  3EFA A;  3D66 A;  4PXE A;  4YRH A;  3R9G A;  4YFJ A;  1M4I A;  4DUK A;  3NFZ A;  2EUI A;  4MI4 A;  2ZPA A;  1QSN A;  3LWU A;  3TFY A;  3FEE A;  3D7F A;  3S9L A;  4B5O A;  6CPA A;  1RTQ A;  2V8H A;  3FJU A;  1TKF A;  4HNY B;  4MFP A;  4PXC A;  3T9Y A;  2DPT A;  2DF5 A;  4MCR A;  4CGP A;  4NGM A;  2C6C A;  3IWW A;  3JVN A;  4K30 A;  4R3L A;  5F47 A;  2PVW A;  2REE A;  4OC4 A;  2FSR A;  2VI7 A;  4KZT A;  5H86 A;  5EC4 A;  1Z5R A;  1HDU A;  2JDC A;  2YNE A;  1ZG8 A;  3WR7 A;  2QYV A;  3TOA A;  2C6P A;  3DDD A;  2D4P A;  3IWE A;  4TWE A;  4CYN A;  3TO9 A;  2PJ1 A;  5JPH A;  5AG4 A;  3B8G A;  2PJ6 A;  1AYE A;  2G0B A;  2BL1 A;  1S7N A;  2BEI A;  2JBJ A;  3GKR A;  3P2F A;  3B3S A;  1NMT A;  5KTD A;  2HC9 A;  2VBQ A;  4MCP A;  3FB3 A;  1LAM A;  3DSB A;  4OIW A;  3DNS A;  2PJC A;  4GS4 A;  4WJB A;  2WUU A;  4OC5 A;  4P4J A;  4U9Y A;  4FD5 A;  3KL9 A;  3WAB A;  2YNC C;  2HB6 A;  4ZGY B;  3FBU A;  1RO5 A;  1VHO A;  3KHZ A;  2BCO A;  5GCN A;  2OOT A;  4OAD A;  2OZU A;  1P0H A;  3FED A;  1Y9W A;  4P4F A;  3NA6 A;  2XEI A;  2GFQ A;  1CBX A;  3V8I A;  5LYD A;  1TKH A;  2PJ0 A;  1HEE A;  1Z8T A;  1IB1 E;  4XNH C;  4B14 A;  3FRM A;  1XE4 A;  2DEA A;  2ZED A;  5H84 A;  4E0A A;  1F2P A;  1LAN A;  2DPS A;  4FD6 A;  2HV2 A;  1FT7 A;  1P4N A;  2PJ5 A;  4NGR A;  4CYQ A;  4FD7 A;  4H6U A;  4EVY A;  3VWE A;  4M3S A;  4AG9 A;  4ZYQ A;  4ZY1 A;  3CXS A;  3MGD A;  1WWZ A;  3V38 A;  4CAW A;  1XEB A;  2WYR A;  2V8V A;  3SI0 A;  2R7H A;  2P0W A;  1Q2Y A;  3JRU A;  3KZW A;  4PXD A;  1IOF A;  2R1I A;  1XMB A;  4KSI A;  4RUH A;  5KTA A;  4FAI A;  2FT0 A;  2O53 A;  4IK2 A;  4NXY A;  4UFV A;  3TTH A;  3D68 A;  4C2Z A;  5J8F A;  5JM6 A;  4IUS A;  3ISX A;  3W6S A;  4UEF A;  5F46 A;  1LAP A;  5I0C A;  4UIA A;  5D29 A;  4C2Y A;  3I9S A;  5HMN A;  3FVL A;  3NH5 A;  4UCM A;  5LRG A;  3D7D A;  4Z65 A;  3BXM A;  1HDQ A;  4GXH A;  1ELM P;  2AFM A;  2P6G A;  4AVA A;  1FNO A;  4CRY B;  1F2O A;  1CJW A;  3LOD A;  1M4D A;  5HVH A;  4MMO A;  1X12 A;  4MFZ A;  5AG5 A;  5EBV A;  4NSQ A;  3NE8 A;  2R8V A;  4JXR A;  2NYQ A;  2PIZ A;  2PSW A;  4A33 A;  3VH9 A;  4P44 A;  4I49 A;  1Z2L A;  2OR4 A;  2V77 A;  3PB8 X;  3D67 A;  3MN8 A;  4KOT A;  4IF5 A;  2ARH A;  4XPD C;  1VHE A;  1QSO A;  2ABZ A;  2B4D A;  3FMC A;  5ELY A;  3B2Y A;  1IOI A;  1SQH A;  1WK4 A;  3SI1 A;  2G9D A;  4J3G A;  4ZY2 A;  1YX0 A;  3W6X A;  1GYT A;  5J1Q A;  1YLO A;  3IGR A;  3LAC A;  1EE3 P;  1GHE A;  1Q2D A;  1JWQ A;  2Q51 A;  4JD6 A;  1I1D A;  4A94 A;  4E8O A;  4R7M A;  3KKW A;  2ZOF A;  4PPZ A;  1XF8 A;  4PSW A;  4CGN A;  2CNM A;  2AFU A;  4MHD A;  1YW4 A;  3KR5 A;  4KVM E;  3VWD A;  2JLM A;  1M1D A;  1X10 A;  4KUB A;  3BJ7 A;  3FNC A;  4BD9 A;  4FBE A;  4OLL A;  4X5K A;  2Z3O A;  3LMS A;  2B4D B;  2OZH A;  4HNW B;  4R57 A;  4LQG A;  3S6K A;  1YVO A;  1QSM A;  1DTD A;  2B5G A;  2ODF A;  2GLF A;  3R9E A;  3TE4 A;  2JEV A;  1Y7E A;  2GLJ A;  2Z11 A;  1YVK A;  4PV6 A;  2Z10 A;  1YRE A;  4KOU A;  2I00 A;  2IJZ A;  5THW A;  2PR1 A;  1I12 A;  3SXN A;  4M6I A;  2JBK A;  4UCP A;  4YU9 A;  3QAY A;  4EFD A;  4UFW A;  4UIB A;  4M6H A;  4ZBG A;  3RYO A;  4B13 A;  4XPL A;  2AFZ A;  4UCN A;  2P6F A;  4M6G A;  3RNZ A;  5HVG A;  1PYT B;  4RI1 A;  1KUX A;  2ZXV A;  1Y0R A;  4QVT A;  2QML A;  4UEZ A;  2J8N A;  1S7K A;  2ZEL A;  4OP4 A;  3IEH A;  1ELL P;  1IYL A;  4OAE A;  2OU2 A;  2PJ9 A;  4L89 A;  5C82 A;  2PC1 A;  5K8O A;  4NJQ A;  1J4J A;  2PJ8 A;  2GE3 A;  5BWA B;  1Y7R A;  1MJB A;  5LYF A;  1CX8 A;  4CAE A;  1PCA A;  5CNP A;  4IHM A;  2PIY A;  2VEZ A;  2EBJ A;  4BIN A;  4HPS A;  5CBM A;  1YLE A;  2FS5 A;  4JLY A;  3S9M A;  5K8N A;  2AE6 A;  2B4B A;  2Z3N A;  4H2K A;  3DR8 A;  1XFO A;  4OC1 A;  2ZEO A;  2VZZ A;  3FF3 A;  3SXO A;  1K4J A;  1ZO0 A;  4HNX B;  1Q2C A;  4LUA A;  3RZA A;  5HH1 A;  2Z3L A;  1S3Z A;  3CT9 A;  1R57 A;  3D3S A;  3PFO A;  1YGH A;  4F8Z A;  3IU2 A;  2A4N A;  1KUV A;  2V8G A;  3B35 A;  1Z8L A;  3D7H A;  4KS9 A;  1VIX A;  3T90 A;  4OC2 A;  3TX8 A;  2EWB A;  2GU2 A;  3S6G A;  1TF8 A;  2ANP A;  2FE7 A;  2QJ8 A;  4UBR A;  1CP7 A;  2YGW A;  2WZN A;  3K9T A;  5AG7 A;  2BOA A;  3LD2 A;  3KAS A;  3ISZ A;  1ZG7 A;  2GAN A;  2AJ6 A;  2PJ4 A;  2PJB A;  4R6T A;  4PK3 A;  5LRJ A;  4OKO A;  2O4H A;  3KHX A;  1AUG A;  4B12 A;  5K8M A;  3I3G A;  3B3W A;  2F5I A;  4KLW A;  4NEX A;  1CM0 A;  4NGS A;  4A2Z A;  1R43 A;  4ZX8 A;  5F09 A;  1YK3 A;  2ZOG A;  4MRI A;  2NSM A;  4F9U A;  1S60 A;  4NGP A;  4C7H A;  5A27 A;  2J9A A;  1Z4E A;  2O28 A;  4ORF A;  4MY3 A;  4KUA A;  3SHP A;  4AB7 A;  2FXF A;  4KOS A;  4X2T A;  4NJR A;  4UEE A;  2PRQ A;  4AXV A;  4OC3 A;  3WC6 A;  3ZJ0 A;  2K5T A;  1R3N A;  3IO1 A;  3QAH A;  2CTB A;  3TO6 A;  3OWC A;  1BO4 A;  2Q04 A;  3PBB A;  5F49 A;  3VAR A;  4UA3 A;  1TIQ A;  3FXT A;  2WPX A;  3IIB A;  2ZEP A;  3NE7 A;  4ZY0 A;  2C27 A;  2HUZ A;  2D4O A;  1Y9K A;  1N71 A;  2V8D A;  4R87 A;  2J8R A;  4NGT A;  1IYK A;  2C1C A;  4II9 A;  4CAF A;  3IJ3 A;  2BUE A;  4JXQ A;  4MFK A;  3GUX A;  1IIC A;  4PSX A;  3W91 A;  4A30 A;  4XPK A;  4R76 A;  2B3V A;  3PFE A;  3H8G A;  4CGL A;  1BOB A;  4RN7 A;  2PJA A;  1PUA A;  1ZG9 A;  4MJ8 A;  3EXN A;  1ARM A;  1TKJ A;  3BLN A;  2Q0Y A;  3R96 A;  3DLJ A;  2Q43 A;  2C6G A;  3SJG A;  3A9L A;  4B11 A;  4B5P A;  2CXA A;  3ZZI A;  2X7B A;  3S9N A;  1IY7 A;  2OH1 A;  3TOB A;  5JH9 A;  5IX3 A;  4DJL A;  3K2K A;  2ZEN A;  3BI1 A;  1CP6 A;  3GY9 A;  3GLJ A;  3WC7 A;  3SJE A;  1VHS A;  1V0C A;  3FEC A;  1Y0Y A;  2FVG A;  4P10 A;  4CGO A;  1ZLH A;  3IC1 A;  3JTK A;  5G1Z A;  3PRT A;  3L2N A;  2NMT A;  3P2H A;  2AFO A;  4NGN A;  5DWM A;  4ONU A;  2YNC A;  1CPX A;  4AVC A;  5A28 A;  2PJ7 A;  2PRB A;  3F5B A;  1MK4 A;  4H6Z A;  4H89 A;  5D8N A;  3B7I A;  3SI2 A;  5JQ4 A;  5E96 A;  4PXB A;  5HXD A;  3CXP A;  2EVN A;  5FVJ A;  2CTC A;  2GIV A;  2EK8 A;  3KQZ A;  4W9Y A;  4MCS A;  3S6H A;  2JDD A;  2I79 A;  2ZEG A;  2OZG A;  3B3T A;  2G3A A;  3E0K A;  1RXT A;  1NSA A;  4R8F A;  1QST A;  2OB0 A;  2PE3 A;  3FX6 A;  1MJA A;  5IB0 A;  2EO8 A;  4CRZ B;  4YGO A;  2B5G B;  3TT2 A;  3KR4 A;  2AFS A;  1DE4 C;  4R9M A;  4CAX A;  1TXR A;  2CNT A;  1QMU A;  3CDX A;  4ZI6 A;  2IL4 A;  2CNS A;  4L8A A;  3VAT A;  4A39 A;  2FIA A;  4F6A A;  1S5K A;  4Q7A A;  4MHN A;  1LCP A;  1XMT A;  3EC4 A;  1NE9 A;  3H8F A;  1LRZ A;  3I1U A;  4CAV A;  2FL4 A;  5ISV A;  1BAV A;  2HQY A;  3PB9 X;  4K3N A;  2RFH A;  3PBE A;  4JZ0 A;  1M4L A;  4MXU A;  1Z8X A;  3DR6 A;  4XNH B;  4F0Y A;  4NCZ A;  2Q44 A;  4P4B A;  5F48 A;  1YME A;  4BBH A;  2CY2 A;  4FD4 A;  5EMI A;  3KQX A;  1XIX A;  2CIJ A;  3PGP A;  4JWP A;  4P4E A;  1FY7 A;  1IU8 A;  3V7Z A;  8CPA A;  3H4Q A;  3WT4 A;  5DWN A;  5G20 A;  1AMP A;  5LYL A;  3IWG A;  5AGE A;  3HUV A;  3NH4 A;  1Z4R A;  3PB4 X;  2QEC A;  4PQA A;  4UF4 A;  3WC5 A;  1S7F A;  1YR0 A;  4WWV A;  2P6E A;  1ON0 A;  3D2P A;  4MHP A;  4X8I A;  3BHX A;  4B10 A;  2AFW A;  2POK A;  2VZY A;  3PP9 A;  4FWU A;  5G21 A;  2WSA A;  3TO7 A;  3RO0 A;  3H5Z A;  4NGQ A;  1BPN A;  1YQE A;  4RS2 A;  4HKF A;  4KVO E;  4KSA A;  4X3R A;  3R9F A;  5C88 A;  2RB7 A;  4UWJ A;  4G1P A;  2ZEM A;  5LYI A;  1KZF A;  4U5Y A;  1Q7L A;  3EO4 A;  4OME A;  4EME A;  2ZW4 A;  2B3U A;  1F57 A;  2XEF A;  4NF1 A;  4O23 A;  4ONW A;  4CS0 B;  2FCK A;  4A37 A;  3CZX A;  2PCU A;  4OC0 A;  2XEJ A;  3GYA A;  2YND A;  4P4D A;  3H8E A;  2PVV A;  2Z3M A;  4KOR A;  1ZLI A;  4KOX A;  1B87 A;  2Q7B A;  3HLP A;  1XOV A;  3C26 A;  3KI9 A;  2Q7S A;  2F8H A;  2PJ3 A;  3D7G A;  3R95 A;  4XPD B;  5LRK A;  3GIU A;  4KOY A;  2ZEE A;  3D4U A;  4KSF A;  4MFQ A;  4TNU A;  2Q4Z A;  3RAM A;  3CPX A;  3B3C A;  3D2M A;  1PU9 A;  4M85 A;  1UWY A;  3B3V A;  5G22 A;  3T8W A;  4C2X A;  1Z9U A;  3QB8 A;  1IGB A;  1KUY A;  4R3K A;  4FUU A;  1LFW A;  4OID A;  4Y49 B;  7CPA A;  2Z3K A;  4Q38 A;  1YSJ A;  2ZEH A;  2AFX A;  3F8K A;  3K9U A;  5IV0 A;  2ZW6 A;  4LQ6 A;  2EK9 A;  2ZEF A;  3UY5 A;  3CPA A;  4B6Z A;  1MJ9 A;  1XJO A;  2ZW7 A;  2R98 A;  2QIR A;  3MRU A;  4YWY A;  4QUS A;  2QVP A;  1VKC A;  2BSW A;  1VGY A;  3G3S A;  4A38 A;  2J8M A;  3PEI A;  4JJX A;  1Z8W A;  2DXQ A;  3NH8 A;  4KOW A;  4MHZ A;  1A2Z A;  4Q36 A;  5K8P A;  2PR8 A;  4MHY A;  1NSL A;  1CPS A;  2F7V A;  3FYN A;  3PZJ A;  2ATR A;  3TCV A;  2FIW A;  4QC6 A;  2B58 A;  1BLL E; 
#chains in the Genus database with same CATH homology
 2RC4 A;  2Z3P A;  1M44 A;  2ZW5 A;  2PQ8 A;  4MY0 A;  3IU1 A;  4AG7 A;  5J8C A;  4CYP A;  4KLV A;  1IID A;  4F0X A;  3CXQ A;  4CGM A;  2REF A;  4E2A A;  1M4G A;  2KCW A;  2PDO A;  3FIX A;  4MFJ A;  4A32 A;  3JUW A;  3R1K A;  3G8W A;  2G3T A;  2VXK A;  4B5P B;  4MBU A;  4KOV A;  4U9Z A;  4BMH A;  1U6M A;  4C68 A;  2WPW A;  4AVB A;  3EY5 A;  1L0C A;  4Y49 C;  2VQY A;  2Z0Z A;  3N7Z A;  4UFX A;  4UWI A;  4KVX A;  4CYO A;  4PK2 A;  4A31 A;  4A95 A;  1QSR A;  3D8P A;  1I21 A;  1UFH A;  2Y0M A;  4C7I A;  2Q4V A;  1S7L A;  3F0A A;  4DNC A;  5AG6 A;  4QBJ A;  2Q4Y A;  4QB9 A;  1B6B A;  1OZP A;  2H5M A;  4MFL A;  3BJ8 A;  5KTC A;  4LX9 A;  3S6F A;  3EFA A;  4YFJ A;  4YRH A;  3R9G A;  1M4I A;  2EUI A;  4MI4 A;  2ZPA A;  1QSN A;  3TFY A;  4B5O A;  4HNY B;  4MFP A;  3T9Y A;  2DPT A;  4CGP A;  4K30 A;  3JVN A;  4R3L A;  5F47 A;  2REE A;  2FSR A;  2VI7 A;  4KZT A;  5H86 A;  5EC4 A;  2JDC A;  2YNE A;  3WR7 A;  3TOA A;  3DDD A;  2D4P A;  3IWE A;  4CYN A;  3TO9 A;  5JPH A;  5AG4 A;  3B8G A;  2G0B A;  2BL1 A;  1S7N A;  2BEI A;  3GKR A;  3P2F A;  5KTD A;  1NMT A;  2VBQ A;  3FB3 A;  3DSB A;  3DNS A;  4GS4 A;  2WUU A;  4U9Y A;  4FD5 A;  2YNC C;  4ZGY B;  3FBU A;  1RO5 A;  5GCN A;  4OAD A;  2OZU A;  1P0H A;  1Y9W A;  3V8I A;  4B14 A;  1IB1 E;  4XNH C;  3FRM A;  1XE4 A;  5H84 A;  4E0A A;  4FD6 A;  2DPS A;  2HV2 A;  1P4N A;  4CYQ A;  4FD7 A;  4H6U A;  4EVY A;  3VWE A;  4M3S A;  4AG9 A;  3CXS A;  3MGD A;  1WWZ A;  4CAW A;  1XEB A;  2R7H A;  2P0W A;  1Q2Y A;  2R1I A;  5KTA A;  2FT0 A;  4UFV A;  3TTH A;  4NXY A;  5J8F A;  4C2Z A;  4IUS A;  3W6S A;  5F46 A;  5I0C A;  4C2Y A;  3I9S A;  5HMN A;  4UCM A;  2P6G A;  4AVA A;  4CRY B;  1CJW A;  3LOD A;  1M4D A;  4MFZ A;  5AG5 A;  5EBV A;  4NSQ A;  4JXR A;  2R8V A;  2PSW A;  4A33 A;  4I49 A;  4KOT A;  4IF5 A;  2ARH A;  4XPD C;  1QSO A;  2B4D A;  1SQH A;  1WK4 A;  4J3G A;  3W6X A;  1YX0 A;  3IGR A;  1Q2D A;  1GHE A;  4E8O A;  4JD6 A;  1I1D A;  3KKW A;  1XF8 A;  4PSW A;  4CGN A;  2CNM A;  4MHD A;  4KVM E;  2JLM A;  1M1D A;  4KUB A;  3BJ7 A;  3FNC A;  4OLL A;  4X5K A;  2Z3O A;  2B4D B;  2OZH A;  4HNW B;  4R57 A;  3S6K A;  1YVO A;  1QSM A;  2B5G A;  3R9E A;  3TE4 A;  2JEV A;  4PV6 A;  2Z11 A;  1YVK A;  2Z10 A;  1YRE A;  4KOU A;  2I00 A;  2PR1 A;  1I12 A;  3SXN A;  4UCP A;  4UFW A;  3RYO A;  4ZBG A;  4B13 A;  4XPL A;  4UCN A;  2P6F A;  4RI1 A;  1KUX A;  2ZXV A;  4QVT A;  2QML A;  2J8N A;  1S7K A;  1IYL A;  4OAE A;  2OU2 A;  4L89 A;  5C82 A;  2PC1 A;  1J4J A;  2GE3 A;  5BWA B;  1Y7R A;  1MJB A;  4CAE A;  5CNP A;  2VEZ A;  1YLE A;  2FS5 A;  4JLY A;  2AE6 A;  2B4B A;  2Z3N A;  3DR8 A;  2VZZ A;  3SXO A;  1K4J A;  1ZO0 A;  4HNX B;  1Q2C A;  4LUA A;  5HH1 A;  2Z3L A;  1S3Z A;  1R57 A;  3D3S A;  1YGH A;  3IU2 A;  2A4N A;  1KUV A;  4KS9 A;  3T90 A;  3S6G A;  2FE7 A;  4UBR A;  2YGW A;  5AG7 A;  3LD2 A;  2GAN A;  2AJ6 A;  4PK3 A;  4B12 A;  3I3G A;  2F5I A;  4KLW A;  4NEX A;  1CM0 A;  4A2Z A;  1YK3 A;  1S60 A;  4C7H A;  5A27 A;  1Z4E A;  2O28 A;  4ORF A;  4MY3 A;  4KUA A;  3SHP A;  4AB7 A;  2FXF A;  4KOS A;  3ZJ0 A;  2K5T A;  3QAH A;  3TO6 A;  3OWC A;  1BO4 A;  2Q04 A;  5F49 A;  4UA3 A;  1TIQ A;  3FXT A;  2WPX A;  3NE7 A;  2C27 A;  2HUZ A;  2D4O A;  1Y9K A;  1N71 A;  4R87 A;  2J8R A;  1IYK A;  4II9 A;  4CAF A;  2BUE A;  4JXQ A;  4MFK A;  3W91 A;  1IIC A;  4PSX A;  4A30 A;  4XPK A;  2B3V A;  4CGL A;  1BOB A;  1PUA A;  4MJ8 A;  3EXN A;  3BLN A;  2Q0Y A;  3R96 A;  4B11 A;  4B5P A;  3A9L A;  2CXA A;  3ZZI A;  2X7B A;  2OH1 A;  3TOB A;  5IX3 A;  3GY9 A;  1VHS A;  1V0C A;  4CGO A;  3JTK A;  5G1Z A;  5DWM A;  2NMT A;  3P2H A;  4ONU A;  2YNC A;  4AVC A;  5A28 A;  2PRB A;  4H89 A;  3F5B A;  1MK4 A;  4H6Z A;  5JQ4 A;  5E96 A;  3CXP A;  2EVN A;  5FVJ A;  2GIV A;  3VWD A;  3S6H A;  2JDD A;  2I79 A;  2OZG A;  2G3A A;  3E0K A;  1RXT A;  1QST A;  2OB0 A;  1MJA A;  5IB0 A;  4CRZ B;  4YGO A;  2B5G B;  3TT2 A;  4CAX A;  4R9M A;  2CNT A;  2IL4 A;  2CNS A;  4L8A A;  2FIA A;  4F6A A;  1S5K A;  1XMT A;  3EC4 A;  1NE9 A;  4CAV A;  1LRZ A;  2FL4 A;  5ISV A;  2HQY A;  4F0Y A;  4XNH B;  3DR6 A;  4NCZ A;  2Q44 A;  5F48 A;  4BBH A;  2CY2 A;  4FD4 A;  1XIX A;  3PGP A;  4JWP A;  1FY7 A;  3H4Q A;  5DWN A;  5G20 A;  3IWG A;  5AGE A;  1Z4R A;  2QEC A;  1S7F A;  1YR0 A;  2P6E A;  1ON0 A;  3D2P A;  4B10 A;  2VZY A;  3PP9 A;  5G21 A;  2WSA A;  3TO7 A;  3H5Z A;  5C88 A;  3R9F A;  4RS2 A;  4HKF A;  4KVO E;  4KSA A;  4UWJ A;  1KZF A;  4U5Y A;  3EO4 A;  2ZW4 A;  2B3U A;  4NF1 A;  4CS0 B;  2FCK A;  3GYA A;  2YND A;  2Z3M A;  4KOR A;  4KOX A;  1B87 A;  2Q7B A;  3C26 A;  3R95 A;  4XPD B;  4KOY A;  4MFQ A;  4KSF A;  3D2M A;  1PU9 A;  4M85 A;  5G22 A;  4C2X A;  1Z9U A;  3QB8 A;  1KUY A;  4R3K A;  4Y49 B;  2Z3K A;  4Q38 A;  5IV0 A;  3F8K A;  3K9U A;  2ZW6 A;  3UY5 A;  1MJ9 A;  2ZW7 A;  2R98 A;  2QIR A;  4QUS A;  1VKC A;  2BSW A;  3G3S A;  2J8M A;  4JJX A;  4KOW A;  2DXQ A;  4Q36 A;  2PR8 A;  1NSL A;  3TCV A;  3FYN A;  3PZJ A;  2ATR A;  2FIW A;  4QC6 A;  2B58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...