2HQYA

Crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
298
structure length
298
Chain Sequence
MIPFKDITLADRDTITAFTMKSDRRNCDLSFSNLCSWRFLYDTQFAVIDDFLVFKFWAGEQLAYMMPVGNGDLKAVLRKLIEDADKEKHNFCMLGVCSNMRADLEAILPERFIFTEDRAYADYIYLRSDLATLKGKKFQAKRNHINRFRNTYPDYEYTPITPDRIQECLDLEAEWCKVNNCDQQEGTGNERRALIYALHNFEALGLTGGILHVNGKIVAFTFGMPINHETFGVHVEKADTSIDGAYAMINYEFANRIPEQYIYINREEDLGIEGLRKAKLSYQPVTILEKYMACLKDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 97
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09924 DUF2156 Uncharacterised conserved protein (DUF2156)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2hqyA01
4XPDB 3EFAA 3FBUA 4I49A 5KTCA 5J8FA 2BUEA 4KOTA 1WK4A 1S5KA 2Q44A 3JVNA 2FCKA 1YX0A 4FD5A 1IYLA 4NCZA 4B5PA 3V8IA 2ZPAA 3SXOA 5J8CA 3ZJ0A 3QAHA 3R1KA 3TFYA 2QMLA 4R3LA 2CNSA 2I79A 3D3SA 2Q04A 3VWEA 1I12A 4JLYA 5I0CA 2ZW7A 4MBUA 5FVJA 4CAVA 4R9MA 2OH1A 4KVME 4XPLA 1QSNA 3D8PA 2R8VA 5F47A 1QSMA 4LX9A 4UWIA 1L0CA 5F48A 4IUSA 3EC4A 2CNTA 2ARHA 1Y9KA 3F8KA 2HV2A 3PP9A 4CAWA 4KVXA 1Z4RA 4L89A 1Q2CA 2ZW6A 5F49A 5IV0A 3D2PA 4OAEA 1J4JA 4E0AA 4JWPA 3T9YA 5GCNA 2FT0A 1BO4A 3IWGA 5DWMA 2Q0YA 4HKFA 1CJWA 1PUAA 2B4DB 3TO6A 3GKRA 4PK2A 2ATRA 1N71A 3CXQA 3DSBA 1S7NA 1NE9A 4NF1A 2KCWA 4R57A 4AB7A 2P6GA 2IL4A 4H89A 1IYKA 2F5IA 3R9FA 1S7FA 2B3UA 1Q2DA 3G8WA 3KKWA 3E0KA 3JUWA 2NMTA 2VI7A 4XNHB 3IGRA 3TO9A 3CXSA 4NEXA 1Z4EA 4UWJA 2DXQA 4HNYB 2B5GA 3RYOA 3SXNA 5KTAA 2R98A 1QSOA 3TCVA 3N7ZA 1IIDA 2JLMA 3LD2A 4KOSA 4X5KA 2QIRA 1K4JA 4ORFA 3EO4A 2G3TA 2GIVA 5DWNA 1MJBA 1YVOA 2Z10A 4JJXA 2D4PA 1NSLA 2FS5A 3T90A 2H5MA 4K30A 1M4DA 4YRHA 1M4GA 4JXRA 1ON0A 4II9A 4U9YA 2B3VA 1KZFA 4EVYA 3B8GA 5C88A 5JQ4A 4OLLA 1UFHA 3OWCA 2PDOA 4YGOA 4CRYB 4KOXA 5JPHA 1TIQA 2Y0MA 4XPKA 1VKCA 3K9UA 4F0YA 3P2HA 4Y49C 2J8RA 3CXPA 3EY5A 1YR0A 5HH1A 2AE6A 2OB0A 1M4IA 2ZW4A 4KORA 4QC6A 3F5BA 3S6FA 3FB3A 4NXYA 2VBQA 2PR8A 4GS4A 1Y7RA 1YREA 3C26A 4CS0B 4FD4A 3PGPA 2B58A 2EUIA 1SQHA 2RC4A 2JDDA 4PK3A 5IB0A 1PU9A 3NE7A 2Z11A 3SHPA 3FYNA 1I21A 1M1DA 2Q4VA 1XMTA 4KLWA 1B6BA 3LODA 4ZBGA 1I1DA 2EVNA 2VQYA 1S7KA 3S6GA 1KUVA 3TO7A 1OZPA 1IB1E 3BLNA 2PRBA 1U6MA 4MJ8A 4E2AA 1S60A 1S7LA 4AVCA 4MY0A 2D4OA 1KUXA 4QVTA 4AG7A 4XPDC 4R87A 4KVOE 5IX3A 4DNCA 4KUBA 2CNMA 4H6ZA 2Q7BA 1XE4A 1S3ZA 4B5PB 1QSRA 3DDDA 2VZZA 1YVKA 1MJ9A 2GE3A 2PSWA 2CY2A 3TT2A 3TOBA 2BEIA 3FXTA 1B87A 2HUZA 5C82A 1BOBA 2AJ6A 3MGDA 1WWZA 5EC4A 3R9GA 3WR7A 4R3KA 4BMHA 2B4BA 4U9ZA 4AG9A 4L8AA 5E96A 2PC1A 2REFA 2OZHA 4B5OA 2GANA 4KOVA 4CRZB 3FIXA 1KUYA 3S6HA 1R57A 2JDCA 1VHSA 4JXQA 2BL1A 3ZZIA 1P4NA 3R95A 3DR6A 3W91A 2B4DA 3DNSA 1M44A 2PQ8A 2PR1A 1RXTA 2X7BA 3G3SA 3GYAA 2I00A 3S6KA 4RI1A 3TE4A 2Z0ZA 4HNWB 5CNPA 4UA3A 1RO5A 2BSWA 2HQYA 2OU2A 4LUAA 4H6UA 2R1IA 2K5TA 2WPWA 3FNCA 3TTHA 3VWDA 1QSTA 2G3AA 1MK4A 2JEVA 1Z9UA 3PZJA 4OADA 1NMTA 2REEA 2FIAA 2VXKA 4KUAA 4QB9A 3I9SA 2R7HA 2J8MA 4FD7A 4ONUA 4M85A 1P0HA 3GY9A 4MY3A 2G0BA 3BJ8A 1Q2YA 5H86A 2B5GB 4NSQA 1XF8A 3QB8A 4XNHC 1CM0A 2Q4YA 2FXFA 3F0AA 4M3SA 2P0WA 4PV6A 1LRZA 4KZTA 1YLEA 3R96A 4KLVA 1XEBA 2WPXA 4Y49B 2FL4A 4J3GA 4IF5A 2J8NA 4QUSA 2P6FA 4KOUA 4YFJA 2OZGA 3W6XA 4AVAA 5H84A 4F6AA 4E8OA 3H4QA 4CAXA 4KOYA 3P2FA 4UBRA 4MI4A 3BJ7A 5KTDA 4PSWA 3W6SA 2O28A 4MHDA 4PSXA 5EBVA 1MJAA 1YK3A 1GHEA 4FD6A 2A4NA 2FSRA 2VEZA 3UY5A 4JD6A 4HNXB 5F46A 3EXNA 1XIXA 3TOAA 3R9EA 2C27A 2QECA 2OZUA 2FE7A 2P6EA 2ZW5A 2ZXVA 3FRMA 5ISVA 1YGHA 5HMNA 1Y9WA 1V0CA 4KOWA 3DR8A 2FIWA 4QBJA 3I3GA 4AVBA 4RS2A 1IICA 2VZYA 4U5YA 3D2MA 1FY7A
chains in the Genus database with same CATH superfamily
4XPDB 2YNCC 3EFAA 3KI9A 1Y7EA 3FBUA 4I49A 3GUXA 2BCOA 4KS9A 5KTCA 4IAVA 4NFRA 2PJ8A 5J8FA 1ZG8A 1Z2LA 2ZEHA 4FUUA 3B3WA 3S9MA 2BUEA 4MFQA 3JRUA 4OC3A 4KOTA 2Z3MA 2C6CA 1WK4A 5LRJA 1CG2A 1S5KA 2Q44A 3JVNA 2FCKA 2NYQA 4JZ0A 1LAPA 1YX0A 3FEEA 3MN8A 1IYLA 3MRUA 4FD5A 4CGLA 2ZEDA 2CIJA 3DGVA 4NCZA 3V8IA 4B5PA 2ZPAA 2EK8A 3SXOA 3PB7X 4A30A 4M6IA 3VH9A 4G1PA 1VHEA 4ZYQA 1AUGA 5J8CA 3ZJ0A 3QAHA 2V8DA 3R1KA 3TFYA 1ZO0A 2JBJA 2QMLA 4R3LA 2PIYA 2CNSA 2I79A 4WJBA 3D3SA 2Q04A 4MFLA 3VWEA 1I12A 4JLYA 4C7IA 5I0CA 4EMEA 5IB9A 4NGMA 5A27A 2ZW7A 4MBUA 2AFUA 2PJAA 2F8HA 1AYEA 5FVJA 4CAVA 4A95A 3WC7A 4R9MA 4R76A 3ISZA 4NGTA 1TXRA 1GYTA 2OH1A 1Q7LA 4KVME 4A39A 4P4IA 2JEWA 4XPLA 5K8MA 3GLJA 3KR5A 4P4JA 1QSNA 3D8PA 2C1CA 2R8VA 5F47A 5J1QA 1QSMA 2O53A 4LX9A 4P6YA 1L0CA 4UWIA 4IUSA 5F48A 3EC4A 2POKA 2CNTA 2ARHA 1Y9KA 4P4FA 4H2KA 5F09A 3F8KA 2HV2A 3PP9A 2PCUA 4CAWA 4KVXA 4F8ZA 3K2KA 1Z4RA 4L89A 3VATA 1Q2CA 2ZW6A 4X3RA 5F49A 1R3NA 5IV0A 1YW4A 1CBXA 3D2PA 4OAEA 1XMBA 4C2ZA 3SI1A 1J4JA 4UFWA 3SJEA 4JWPA 3T9YA 4E0AA 4ZY0A 5GCNA 4YU9A 2FT0A 4F9VA 1BO4A 1Z8XA 4MFPA 3IWGA 1H8LA 5DWMA 1XRYA 2Q0YA 4HKFA 4WWVA 1CJWA 4KSFA 1PUAA 2PJ2A 2B4DB 4PXCA 4CPAA 3TO6A 3GKRA 4PK2A 2ATRA 3KHXA 3PBBA 1N71A 3CXQA 3DSBA 4MCQA 2FVGA 3JTKA 1S7NA 2PJ7A 4MHNA 1NE9A 1OBRA 3FH4A 4FBEA 2QYVA 4NF1A 4DUKA 4F0XA 1CPSA 1ARLA 1IGBA 2Z3OA 3N5FA 2KCWA 2C6GA 4R57A 4AB7A 2P6GA 2IL4A 4H89A 2XEJA 1IYKA 1Z5RA 2F5IA 1R43A 3KR4A 2HC9A 3R9FA 1LCPA 1S7FA 2B3UA 2GU2A 1TKFA 1LANA 1Q2DA 1X10A 3G8WA 3IU1A 3KKWA 3E0KA 3JUWA 3SI2A 3S9NA 2NMTA 2VI7A 4OKOA 5JH9A 4XNHB 2YNEA 3IGRA 3T8WA 3TO9A 3CXSA 4NEXA 4P4EA 4OP4A 1Z4EA 4P4DA 1CPXA 4UWJA 2DXQA 4BINA 4CGNA 3IJ3A 2B5GA 4HNYB 1F2PA 1TKHA 4PPZA 3RYOA 3SXNA 4CGMA 5K8OA 5KTAA 2R98A 1QSOA 3TCVA 4P44A 3KL9A 1IIDA 3N7ZA 5LRKA 1F57A 2ZENA 3WABA 2JLMA 3LD2A 2EWBA 2ZEPA 3B3VA 4KOSA 4MRIA 4X5KA 1F2OA 2QIRA 1K4JA 4TWEA 4MCPA 2PJ0A 4ORFA 3PB8X 3CPXA 2G3TA 3EO4A 2GIVA 4OIDA 5DWNA 1MJBA 2CTBA 1YVOA 1ZLHA 2Z10A 4FWUA 5HXDA 3WC5A 4JJXA 7CPAA 2D4PA 1NSLA 2J9AA 1TF9A 2FS5A 2WYRA 1CP7A 2ZELA 4MCSA 3T90A 2H5MA 4K30A 4Q38A 1M4DA 2EBJA 4YRHA 1M4GA 4JXRA 1ON0A 4II9A 4UIAA 2G9DA 2PJ4A 1HDUA 4U9YA 2B3VA 1KZFA 4EVYA 1ZG7A 1DE4C 2AFMA 3B8GA 5C88A 5JQ4A 3FEDA 4OLLA 2V8VA 1UFHA 3OWCA 4GM5A 4P45A 3B3SA 2PDOA 4YGOA 4CRYB 5K8NA 4BD9A 4DJLA 4KOXA 4ZGYB 2PRQA 5JPHA 1TIQA 2Y0MA 4XPKA 1VKCA 2AFZA 3K9UA 4F0YA 3P2HA 5G1ZA 4Y49C 2J8RA 2NSMA 3CXPA 1YR0A 3EY5A 5HH1A 4BBHA 5AG4A 2AE6A 2OB0A 1M4IA 2PJ9A 2PJCA 2ZW4A 4KORA 4QC6A 4B11A 1LOKA 1YMEA 3F5BA 4GXHA 3H8EA 3S6FA 4B6ZA 3FB3A 4NXYA 2VBQA 2PR8A 2IQ6A 1TKJA 1JQGA 1ELMP 4GS4A 1Y7RA 1YREA 3FVLA 3FX6A 3VARA 4CAFA 3B2YA 5D29A 3C26A 3WC6A 4CS0B 1BPMA 4K3NA 4A33A 4UCNA 2GLJA 3D68A 4OC5A 4FD4A 3PGPA 2B58A 2EUIA 2GLFA 1SQHA 2RC4A 2JDDA 4CGOA 4PK3A 3RO0A 5IB0A 4RUHA 1PU9A 3BHXA 3QNVA 2V77A 3B3CA 3NE7A 4X2TA 2Z11A 4IHMA 3SHPA 4A94A 3B7IA 3IEHA 4HPSA 5K8PA 3V38A 3FYNA 4OMEA 2IMOA 3D66A 4UEFA 1I21A 4CYQA 3V7ZA 4NJRA 5A28A 1M1DA 2Q4VA 1XMTA 2RFHA 1ELLP 3IC1A 4KLWA 3FECA 2EO8A 4C68A 3BI1A 1B6BA 1ZLIA 4MFKA 3LODA 3PFOA 3FMCA 4OIWA 4ZBGA 1I1DA 2EVNA 3CZXA 4A2ZA 2VQYA 1S7KA 4ZY2A 3S6GA 2IJZA 1KUVA 3TO7A 3PB9X 4A38A 2ZOGA 2Z3PA 2DF5A 4B13A 4CYNA 1OZPA 1IB1E 3BLNA 4UCMA 5AG6A 5AG5A 4C2XA 2PRBA 1U6MA 4A31A 2BOAA 4EWTA 4P4BA 4MJ8A 3CT9A 4E2AA 3SJFA 1S60A 1S7LA 1YQEA 4R6TA 4AVCA 1FT7A 1NSAA 4MY0A 4AXVA 4CAEA 4F9UA 3HLPA 2D4OA 3PEIA 4OC2A 1KUXA 3DLJA 3IWWA 1QMUA 1Z8TA 3IO1A 4QVTA 4AG7A 3H8FA 2Q43A 4XPDC 4R87A 3SJXA 2V8GA 4KVOE 5IX3A 2Z3KA 2YGWA 3QAYA 4KUBA 4R8FA 2CNMA 4DNCA 3PB6X 4H6ZA 2Q7BA 3A9LA 1XE4A 1S3ZA 4B5PB 2V8HA 1IY7A 3RNZA 3TC8A 4PQAA 1QSRA 3DDDA 2ODFA 2VZZA 1YVKA 4O23A 4ZX8A 1MJ9A 1ARMA 2GE3A 2CY2A 2PJBA 2PSWA 3HUVA 3TT2A 3TOBA 2PJ6A 2BEIA 4ZI6A 1HDQA 1B87A 2HUZA 2ZOFA 2CTCA 3FXTA 3GB0A 5C82A 3IWEA 2ZEEA 2PVVA 4PXDA 3LMSA 4UEZA 5CBMA 1BOBA 4ZY1A 2AJ6A 1DTDA 3KHZA 1LAMA 2AFSA 3MGDA 1WWZA 2HB6A 5EC4A 1EE3P 4PXBA 3R9GA 4W9YA 1UWYA 3WR7A 3H5ZA 3NH4A 4R3KA 4R7MA 2OR4A 4MCRA 4BMHA 2B4BA 3D7FA 3NH5A 4U9ZA 4NJQA 2AFWA 5DS0A 3WT4A 3LACA 5G22A 4AG9A 1VIXA 1KWMA 4L8AA 5E96A 4M6HA 1LFWA 3SI0A 2XEIA 2PC1A 2REFA 4KSIA 2OZHA 2ANPA 4B5OA 2GANA 1BLLE 4KOVA 4C2YA 4CRZB 3GIUA 1HEEA 3FIXA 4IK2A 4MHYA 1KUYA 3S6HA 4Z65A 1R57A 2JDCA 1AMPA 1VHSA 4JXQA 1A2ZA 4PXEA 4A32A 2BL1A 2XEGA 1P4NA 3ZZIA 3R95A 3DR6A 3KQZA 3RBUA 2B4DA 3IFEA 3W91A 3DNSA 3I1UA 5AGEA 1Z8LA 2QJ8A 1M44A 2PQ8A 3D4UA 2PR1A 4LQGA 1RXTA 2ZEMA 3B35A 3KGQA 4NGPA 5D8NA 2X7BA 3G3SA 1XOVA 4NGSA 3GYAA 1CP6A 2I00A 4MHPA 3PBEA 3S6KA 4RI1A 5JGFA 2AFXA 3TE4A 2Z0ZA 4HNWB 5CNPA 4UA3A 1RO5A 4UFVA 2BSWA 2C6PA 2HQYA 2OU2A 2Z3NA 3FJUA 4MMOA 4OC0A 2OOTA 4LUAA 3RZAA 4H6UA 2R1IA 2K5TA 2WPWA 3FNCA 3IIBA 4NGNA 1YLOA 2ZEOA 2GREA 3TTHA 3VWDA 1QSTA 5HVGA 2G3AA 1MK4A 2JEVA 1Z9UA 1Y0RA 1XJOA 3PFEA 2DEAA 4JYWA 4TNUA 3PZJA 4OADA 1NMTA 3LWUA 2REEA 4P10A 2FIAA 2VXKA 4KUAA 3ISXA 4QB9A 3I9SA 4MFZA 2R7HA 4MXUA 4RN7A 2J8MA 2Q7SA 4FD7A 4MFJA 4M85A 4ONUA 4UFXA 3BI0A 1IU8A 1P0HA 1Z8WA 3GY9A 4MY3A 3NE8A 2G0BA 3BJ8A 1Q2YA 2DPTA 5H86A 5THWA 5G21A 3IU2A 2B5GB 4NSQA 5AG7A 1XF8A 1XFOA 2AFOA 3QB8A 3PB4X 4UF4A 4XNHC 1YW6A 1CM0A 4OC1A 2DPSA 2Q4YA 2FXFA 3D7HA 3F0AA 4ONWA 3NH8A 4M3SA 2P0WA 2O4HA 4PV6A 5HVFA 1LRZA 3CDXA 1YLEA 4KZTA 5LYFA 3R96A 3KQXA 4UCPA 2PJ5A 2Q4ZA 3BXMA 4OC4A 4A37A 2Z3LA 4KLVA 1XEBA 4EFDA 2WPXA 4Y49B 5LYIA 3KZWA 2FL4A 4C7HA 4KSAA 4J3GA 2F7VA 3D7GA 4IF5A 2J8NA 4QUSA 2P6FA 4KOUA 2CF4A 2WUUA 3NFZA 4YFJA 2OZGA 3W6XA 4AVAA 5EMIA 1FNOA 5H84A 4F6AA 4E8OA 1JWQA 4CYPA 1BPNA 3H4QA 5LRGA 4CAXA 4Q36A 4KOYA 3NA6A 3P2FA 4UBRA 4LQ6A 2RB7A 2ZEGA 1M4LA 2I3CA 4MI4A 3K9TA 1TF8A 5G20A 3BJ7A 1CX8A 2QVPA 3L2NA 2VL1A 3KASA 1X12A 5KTDA 4PSWA 5CPAA 3B3TA 3W6SA 4B14A 2O28A 4DYOA 4MHDA 4PSXA 5EBVA 1MJAA 3RAMA 2PE3A 1YK3A 2JBKA 4CGPA 1VGYA 2PJ1A 3PRTA 1GHEA 1RTQA 4FD6A 2A4NA 2FSRA 2VEZA 4M6GA 2Q51A 3UY5A 4B10A 1Y0YA 2PVWA 3S9LA 2ZEFA 3D7DA 4JD6A 2GFQA 4HNXB 4MHZA 5F46A 3EXNA 1XIXA 8CPAA 2WSAA 4ZX9A 3TOAA 1IOIA 4UIBA 3R9EA 3FF3A 4YWYA 5LYLA 2C27A 4UEEA 2QECA 2YNCA 2OZUA 5ELYA 2BO9A 2FE7A 2P6EA 1BAVA 4NGQA 5BWAB 2ZW5A 2ZXVA 3FRMA 5ISVA 1YGHA 1IOFA 3H8GA 4B12A 5HMNA 2XEFA 4NGRA 1QQ9A 1Y9WA 2PIZA 2EK9A 6CPAA 2WZNA 4FAIA 1V0CA 4KOWA 5LYDA 3DR8A 4Q7AA 2PJ3A 1PCAA 2FIWA 3CPAA 1VHOA 5HVHA 4QBJA 4X8IA 1ZG9A 3I3GA 4CYOA 4AVBA 1YSJA 4RS2A 5I4MA 3SJGA 2CXAA 1IICA 2YNDA 1PYTB 1XBUA 3D67A 2VZYA 3TX8A 2ABZA 5JM6A 4U5YA 3D2MA 1FY7A
chains in the Genus database with same CATH topology
4XPDB 2YNCC 3EFAA 3FBUA 4I49A 4KS9A 5KTCA 5J8FA 2BUEA 4MFQA 4KOTA 2Z3MA 1WK4A 1S5KA 2Q44A 3JVNA 2FCKA 1YX0A 4FD5A 1IYLA 4CGLA 4NCZA 4B5PA 3V8IA 2ZPAA 3SXOA 4A30A 5J8CA 3ZJ0A 3QAHA 3R1KA 3TFYA 1ZO0A 2QMLA 4R3LA 2CNSA 2I79A 3D3SA 2Q04A 4MFLA 3VWEA 1I12A 4JLYA 4C7IA 5I0CA 5A27A 2ZW7A 4MBUA 5FVJA 4CAVA 4A95A 4R9MA 2OH1A 4KVME 4XPLA 1QSNA 3D8PA 2R8VA 5F47A 1QSMA 4LX9A 4UWIA 1L0CA 5F48A 4IUSA 3EC4A 2CNTA 2ARHA 1Y9KA 3F8KA 2HV2A 3PP9A 4CAWA 4KVXA 1Z4RA 4L89A 1Q2CA 2ZW6A 5F49A 5IV0A 3D2PA 4OAEA 4C2ZA 1J4JA 4UFWA 4E0AA 4JWPA 3T9YA 5GCNA 2FT0A 1BO4A 4MFPA 3IWGA 5DWMA 2Q0YA 4HKFA 1CJWA 4KSFA 1PUAA 2B4DB 3TO6A 3GKRA 4PK2A 2ATRA 1N71A 3CXQA 3DSBA 3JTKA 1S7NA 1NE9A 4NF1A 4F0XA 2Z3OA 2KCWA 4R57A 4AB7A 2P6GA 2IL4A 4H89A 1IYKA 2F5IA 3R9FA 1S7FA 2B3UA 1Q2DA 3IU1A 3G8WA 3KKWA 3E0KA 3JUWA 2NMTA 2VI7A 4XNHB 2YNEA 3IGRA 3TO9A 3CXSA 4NEXA 1Z4EA 4UWJA 2DXQA 4CGNA 4HNYB 2B5GA 3RYOA 3SXNA 5KTAA 4CGMA 2R98A 1QSOA 3TCVA 3N7ZA 1IIDA 2JLMA 3LD2A 4KOSA 4X5KA 2QIRA 1K4JA 4ORFA 3EO4A 2G3TA 2GIVA 5DWNA 1MJBA 1YVOA 2Z10A 4JJXA 2D4PA 1NSLA 4C68A 2FS5A 3T90A 2H5MA 4K30A 4Q38A 1M4DA 4YRHA 1M4GA 4JXRA 1ON0A 4II9A 4U9YA 2B3VA 1KZFA 4EVYA 3B8GA 5C88A 5JQ4A 4OLLA 1UFHA 3OWCA 2PDOA 4YGOA 4CRYB 4KOXA 4ZGYB 5JPHA 1TIQA 2Y0MA 4XPKA 1VKCA 3K9UA 4F0YA 3P2HA 5G1ZA 4Y49C 2J8RA 3CXPA 3EY5A 1YR0A 5HH1A 4BBHA 5AG4A 2AE6A 2OB0A 1M4IA 2ZW4A 4B11A 4KORA 4QC6A 3F5BA 3S6FA 3FB3A 4NXYA 2VBQA 2PR8A 4GS4A 1Y7RA 1YREA 4CAFA 3C26A 4CS0B 4A33A 4UCNA 4FD4A 3PGPA 2B58A 2EUIA 1SQHA 2RC4A 2JDDA 4CGOA 4PK3A 5IB0A 1PU9A 3NE7A 2Z11A 3SHPA 3FYNA 1I21A 4CYQA 5A28A 1M1DA 2Q4VA 1XMTA 4KLWA 1B6BA 4MFKA 3LODA 4ZBGA 1I1DA 2EVNA 4A2ZA 2VQYA 1S7KA 3S6GA 1KUVA 3TO7A 2Z3PA 4B13A 4CYNA 1OZPA 1IB1E 3BLNA 4UCMA 5AG6A 5AG5A 4C2XA 2PRBA 1U6MA 4A31A 4MJ8A 4E2AA 1S60A 1S7LA 4AVCA 4MY0A 4CAEA 2D4OA 1KUXA 4QVTA 4AG7A 4XPDC 4R87A 4KVOE 5IX3A 2Z3KA 2YGWA 4KUBA 4DNCA 2CNMA 4H6ZA 2Q7BA 3A9LA 1XE4A 1S3ZA 4B5PB 1QSRA 3DDDA 2VZZA 1YVKA 1MJ9A 2GE3A 2PSWA 2CY2A 3TT2A 3TOBA 2BEIA 3FXTA 1B87A 2HUZA 5C82A 3IWEA 1BOBA 2AJ6A 3MGDA 1WWZA 5EC4A 3R9GA 3WR7A 3H5ZA 4R3KA 4BMHA 2B4BA 4U9ZA 4AG9A 5G22A 4L8AA 5E96A 2PC1A 2REFA 2OZHA 4B5OA 2GANA 4KOVA 4C2YA 4CRZB 3FIXA 1KUYA 3S6HA 1R57A 2JDCA 1VHSA 4JXQA 4A32A 2BL1A 3ZZIA 1P4NA 3R95A 3DR6A 3W91A 2B4DA 3DNSA 5AGEA 1M44A 2PQ8A 2PR1A 1RXTA 2X7BA 3G3SA 3GYAA 2I00A 3S6KA 4RI1A 3TE4A 2Z0ZA 4HNWB 5CNPA 4UA3A 1RO5A 4UFVA 2BSWA 2HQYA 2OU2A 2Z3NA 4LUAA 4H6UA 2R1IA 2K5TA 2WPWA 3FNCA 3TTHA 3VWDA 1QSTA 2G3AA 1MK4A 2JEVA 1Z9UA 3PZJA 4OADA 1NMTA 2REEA 2FIAA 2VXKA 4KUAA 4QB9A 3I9SA 4MFZA 2R7HA 2J8MA 4FD7A 4MFJA 4M85A 4ONUA 4UFXA 1P0HA 3GY9A 4MY3A 2G0BA 3BJ8A 1Q2YA 2DPTA 5H86A 5G21A 3IU2A 2B5GB 4NSQA 5AG7A 1XF8A 3QB8A 4XNHC 1CM0A 2DPSA 2Q4YA 2FXFA 3F0AA 4M3SA 2P0WA 4PV6A 1LRZA 4KZTA 1YLEA 3R96A 4UCPA 2Z3LA 4KLVA 1XEBA 2WPXA 4Y49B 2FL4A 4C7HA 4KSAA 4J3GA 4IF5A 2J8NA 4QUSA 2P6FA 4KOUA 2WUUA 4YFJA 2OZGA 3W6XA 4AVAA 5H84A 4F6AA 4E8OA 4CYPA 3H4QA 4CAXA 4Q36A 4KOYA 3P2FA 4UBRA 4MI4A 5G20A 3BJ7A 5KTDA 4PSWA 3W6SA 4B14A 2O28A 4MHDA 4PSXA 5EBVA 1MJAA 1YK3A 4CGPA 1GHEA 4FD6A 2A4NA 2FSRA 2VEZA 3UY5A 4B10A 4JD6A 4HNXB 5F46A 3EXNA 1XIXA 2WSAA 3TOAA 3R9EA 2C27A 2QECA 2YNCA 2OZUA 2FE7A 2P6EA 5BWAB 2ZW5A 2ZXVA 3FRMA 5ISVA 1YGHA 4B12A 5HMNA 1Y9WA 1V0CA 4KOWA 3DR8A 2FIWA 4QBJA 3I3GA 4CYOA 4AVBA 4RS2A 2CXAA 1IICA 2YNDA 2VZYA 4U5YA 3D2MA 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPD B;  3EFA A;  3FBU A;  4I49 A;  5KTC A;  5J8F A;  2BUE A;  4KOT A;  1WK4 A;  1S5K A;  2Q44 A;  3JVN A;  2FCK A;  1YX0 A;  4FD5 A;  1IYL A;  4NCZ A;  4B5P A;  3V8I A;  2ZPA A;  3SXO A;  5J8C A;  3ZJ0 A;  3QAH A;  3R1K A;  3TFY A;  2QML A;  4R3L A;  2CNS A;  2I79 A;  3D3S A;  2Q04 A;  3VWE A;  1I12 A;  4JLY A;  5I0C A;  2ZW7 A;  4MBU A;  5FVJ A;  4CAV A;  4R9M A;  2OH1 A;  4KVM E;  4XPL A;  1QSN A;  3D8P A;  2R8V A;  5F47 A;  1QSM A;  4LX9 A;  4UWI A;  1L0C A;  5F48 A;  4IUS A;  3EC4 A;  2CNT A;  2ARH A;  1Y9K A;  3F8K A;  2HV2 A;  3PP9 A;  4CAW A;  4KVX A;  1Z4R A;  4L89 A;  1Q2C A;  2ZW6 A;  5F49 A;  5IV0 A;  3D2P A;  4OAE A;  1J4J A;  4E0A A;  4JWP A;  3T9Y A;  5GCN A;  2FT0 A;  1BO4 A;  3IWG A;  5DWM A;  2Q0Y A;  4HKF A;  1CJW A;  1PUA A;  2B4D B;  3TO6 A;  3GKR A;  4PK2 A;  2ATR A;  1N71 A;  3CXQ A;  3DSB A;  1S7N A;  1NE9 A;  4NF1 A;  2KCW A;  4R57 A;  4AB7 A;  2P6G A;  2IL4 A;  4H89 A;  1IYK A;  2F5I A;  3R9F A;  1S7F A;  2B3U A;  1Q2D A;  3G8W A;  3KKW A;  3E0K A;  3JUW A;  2NMT A;  2VI7 A;  4XNH B;  3IGR A;  3TO9 A;  3CXS A;  4NEX A;  1Z4E A;  4UWJ A;  2DXQ A;  4HNY B;  2B5G A;  3RYO A;  3SXN A;  5KTA A;  2R98 A;  1QSO A;  3TCV A;  3N7Z A;  1IID A;  2JLM A;  3LD2 A;  4KOS A;  4X5K A;  2QIR A;  1K4J A;  4ORF A;  3EO4 A;  2G3T A;  2GIV A;  5DWN A;  1MJB A;  1YVO A;  2Z10 A;  4JJX A;  2D4P A;  1NSL A;  2FS5 A;  3T90 A;  2H5M A;  4K30 A;  1M4D A;  4YRH A;  1M4G A;  4JXR A;  1ON0 A;  4II9 A;  4U9Y A;  2B3V A;  1KZF A;  4EVY A;  3B8G A;  5C88 A;  5JQ4 A;  4OLL A;  1UFH A;  3OWC A;  2PDO A;  4YGO A;  4CRY B;  4KOX A;  5JPH A;  1TIQ A;  2Y0M A;  4XPK A;  1VKC A;  3K9U A;  4F0Y A;  3P2H A;  4Y49 C;  2J8R A;  3CXP A;  3EY5 A;  1YR0 A;  5HH1 A;  2AE6 A;  2OB0 A;  1M4I A;  2ZW4 A;  4KOR A;  4QC6 A;  3F5B A;  3S6F A;  3FB3 A;  4NXY A;  2VBQ A;  2PR8 A;  4GS4 A;  1Y7R A;  1YRE A;  3C26 A;  4CS0 B;  4FD4 A;  3PGP A;  2B58 A;  2EUI A;  1SQH A;  2RC4 A;  2JDD A;  4PK3 A;  5IB0 A;  1PU9 A;  3NE7 A;  2Z11 A;  3SHP A;  3FYN A;  1I21 A;  1M1D A;  2Q4V A;  1XMT A;  4KLW A;  1B6B A;  3LOD A;  4ZBG A;  1I1D A;  2EVN A;  2VQY A;  1S7K A;  3S6G A;  1KUV A;  3TO7 A;  1OZP A;  1IB1 E;  3BLN A;  2PRB A;  1U6M A;  4MJ8 A;  4E2A A;  1S60 A;  1S7L A;  4AVC A;  4MY0 A;  2D4O A;  1KUX A;  4QVT A;  4AG7 A;  4XPD C;  4R87 A;  4KVO E;  5IX3 A;  4DNC A;  4KUB A;  2CNM A;  4H6Z A;  2Q7B A;  1XE4 A;  1S3Z A;  4B5P B;  1QSR A;  3DDD A;  2VZZ A;  1YVK A;  1MJ9 A;  2GE3 A;  2PSW A;  2CY2 A;  3TT2 A;  3TOB A;  2BEI A;  3FXT A;  1B87 A;  2HUZ A;  5C82 A;  1BOB A;  2AJ6 A;  3MGD A;  1WWZ A;  5EC4 A;  3R9G A;  3WR7 A;  4R3K A;  4BMH A;  2B4B A;  4U9Z A;  4AG9 A;  4L8A A;  5E96 A;  2PC1 A;  2REF A;  2OZH A;  4B5O A;  2GAN A;  4KOV A;  4CRZ B;  3FIX A;  1KUY A;  3S6H A;  1R57 A;  2JDC A;  1VHS A;  4JXQ A;  2BL1 A;  3ZZI A;  1P4N A;  3R95 A;  3DR6 A;  3W91 A;  2B4D A;  3DNS A;  1M44 A;  2PQ8 A;  2PR1 A;  1RXT A;  2X7B A;  3G3S A;  3GYA A;  2I00 A;  3S6K A;  4RI1 A;  3TE4 A;  2Z0Z A;  4HNW B;  5CNP A;  4UA3 A;  1RO5 A;  2BSW A;  2HQY A;  2OU2 A;  4LUA A;  4H6U A;  2R1I A;  2K5T A;  2WPW A;  3FNC A;  3TTH A;  3VWD A;  1QST A;  2G3A A;  1MK4 A;  2JEV A;  1Z9U A;  3PZJ A;  4OAD A;  1NMT A;  2REE A;  2FIA A;  2VXK A;  4KUA A;  4QB9 A;  3I9S A;  2R7H A;  2J8M A;  4FD7 A;  4ONU A;  4M85 A;  1P0H A;  3GY9 A;  4MY3 A;  2G0B A;  3BJ8 A;  1Q2Y A;  5H86 A;  2B5G B;  4NSQ A;  1XF8 A;  3QB8 A;  4XNH C;  1CM0 A;  2Q4Y A;  2FXF A;  3F0A A;  4M3S A;  2P0W A;  4PV6 A;  1LRZ A;  4KZT A;  1YLE A;  3R96 A;  4KLV A;  1XEB A;  2WPX A;  4Y49 B;  2FL4 A;  4J3G A;  4IF5 A;  2J8N A;  4QUS A;  2P6F A;  4KOU A;  4YFJ A;  2OZG A;  3W6X A;  4AVA A;  5H84 A;  4F6A A;  4E8O A;  3H4Q A;  4CAX A;  4KOY A;  3P2F A;  4UBR A;  4MI4 A;  3BJ7 A;  5KTD A;  4PSW A;  3W6S A;  2O28 A;  4MHD A;  4PSX A;  5EBV A;  1MJA A;  1YK3 A;  1GHE A;  4FD6 A;  2A4N A;  2FSR A;  2VEZ A;  3UY5 A;  4JD6 A;  4HNX B;  5F46 A;  3EXN A;  1XIX A;  3TOA A;  3R9E A;  2C27 A;  2QEC A;  2OZU A;  2FE7 A;  2P6E A;  2ZW5 A;  2ZXV A;  3FRM A;  5ISV A;  1YGH A;  5HMN A;  1Y9W A;  1V0C A;  4KOW A;  3DR8 A;  2FIW A;  4QBJ A;  3I3G A;  4AVB A;  4RS2 A;  1IIC A;  2VZY A;  4U5Y A;  3D2M A;  1FY7 A; 
#chains in the Genus database with same CATH topology
 4XPD B;  2YNC C;  3EFA A;  3KI9 A;  1Y7E A;  3FBU A;  4I49 A;  3GUX A;  2BCO A;  4KS9 A;  5KTC A;  4IAV A;  4NFR A;  2PJ8 A;  5J8F A;  1ZG8 A;  1Z2L A;  2ZEH A;  4FUU A;  3B3W A;  3S9M A;  2BUE A;  4MFQ A;  3JRU A;  4OC3 A;  4KOT A;  2Z3M A;  2C6C A;  1WK4 A;  5LRJ A;  1CG2 A;  1S5K A;  2Q44 A;  3JVN A;  2FCK A;  2NYQ A;  4JZ0 A;  1LAP A;  1YX0 A;  3FEE A;  3MN8 A;  1IYL A;  3MRU A;  4FD5 A;  4CGL A;  2ZED A;  2CIJ A;  3DGV A;  4NCZ A;  3V8I A;  4B5P A;  2ZPA A;  2EK8 A;  3SXO A;  3PB7 X;  4A30 A;  4M6I A;  3VH9 A;  4G1P A;  1VHE A;  4ZYQ A;  1AUG A;  5J8C A;  3ZJ0 A;  3QAH A;  2V8D A;  3R1K A;  3TFY A;  1ZO0 A;  2JBJ A;  2QML A;  4R3L A;  2PIY A;  2CNS A;  2I79 A;  4WJB A;  3D3S A;  2Q04 A;  4MFL A;  3VWE A;  1I12 A;  4JLY A;  4C7I A;  5I0C A;  4EME A;  5IB9 A;  4NGM A;  5A27 A;  2ZW7 A;  4MBU A;  2AFU A;  2PJA A;  2F8H A;  1AYE A;  5FVJ A;  4CAV A;  4A95 A;  3WC7 A;  4R9M A;  4R76 A;  3ISZ A;  4NGT A;  1TXR A;  1GYT A;  2OH1 A;  1Q7L A;  4KVM E;  4A39 A;  4P4I A;  2JEW A;  4XPL A;  5K8M A;  3GLJ A;  3KR5 A;  4P4J A;  1QSN A;  3D8P A;  2C1C A;  2R8V A;  5F47 A;  5J1Q A;  1QSM A;  2O53 A;  4LX9 A;  4P6Y A;  1L0C A;  4UWI A;  4IUS A;  5F48 A;  3EC4 A;  2POK A;  2CNT A;  2ARH A;  1Y9K A;  4P4F A;  4H2K A;  5F09 A;  3F8K A;  2HV2 A;  3PP9 A;  2PCU A;  4CAW A;  4KVX A;  4F8Z A;  3K2K A;  1Z4R A;  4L89 A;  3VAT A;  1Q2C A;  2ZW6 A;  4X3R A;  5F49 A;  1R3N A;  5IV0 A;  1YW4 A;  1CBX A;  3D2P A;  4OAE A;  1XMB A;  4C2Z A;  3SI1 A;  1J4J A;  4UFW A;  3SJE A;  4JWP A;  3T9Y A;  4E0A A;  4ZY0 A;  5GCN A;  4YU9 A;  2FT0 A;  4F9V A;  1BO4 A;  1Z8X A;  4MFP A;  3IWG A;  1H8L A;  5DWM A;  1XRY A;  2Q0Y A;  4HKF A;  4WWV A;  1CJW A;  4KSF A;  1PUA A;  2PJ2 A;  2B4D B;  4PXC A;  4CPA A;  3TO6 A;  3GKR A;  4PK2 A;  2ATR A;  3KHX A;  3PBB A;  1N71 A;  3CXQ A;  3DSB A;  4MCQ A;  2FVG A;  3JTK A;  1S7N A;  2PJ7 A;  4MHN A;  1NE9 A;  1OBR A;  3FH4 A;  4FBE A;  2QYV A;  4NF1 A;  4DUK A;  4F0X A;  1CPS A;  1ARL A;  1IGB A;  2Z3O A;  3N5F A;  2KCW A;  2C6G A;  4R57 A;  4AB7 A;  2P6G A;  2IL4 A;  4H89 A;  2XEJ A;  1IYK A;  1Z5R A;  2F5I A;  1R43 A;  3KR4 A;  2HC9 A;  3R9F A;  1LCP A;  1S7F A;  2B3U A;  2GU2 A;  1TKF A;  1LAN A;  1Q2D A;  1X10 A;  3G8W A;  3IU1 A;  3KKW A;  3E0K A;  3JUW A;  3SI2 A;  3S9N A;  2NMT A;  2VI7 A;  4OKO A;  5JH9 A;  4XNH B;  2YNE A;  3IGR A;  3T8W A;  3TO9 A;  3CXS A;  4NEX A;  4P4E A;  4OP4 A;  1Z4E A;  4P4D A;  1CPX A;  4UWJ A;  2DXQ A;  4BIN A;  4CGN A;  3IJ3 A;  2B5G A;  4HNY B;  1F2P A;  1TKH A;  4PPZ A;  3RYO A;  3SXN A;  4CGM A;  5K8O A;  5KTA A;  2R98 A;  1QSO A;  3TCV A;  4P44 A;  3KL9 A;  1IID A;  3N7Z A;  5LRK A;  1F57 A;  2ZEN A;  3WAB A;  2JLM A;  3LD2 A;  2EWB A;  2ZEP A;  3B3V A;  4KOS A;  4MRI A;  4X5K A;  1F2O A;  2QIR A;  1K4J A;  4TWE A;  4MCP A;  2PJ0 A;  4ORF A;  3PB8 X;  3CPX A;  2G3T A;  3EO4 A;  2GIV A;  4OID A;  5DWN A;  1MJB A;  2CTB A;  1YVO A;  1ZLH A;  2Z10 A;  4FWU A;  5HXD A;  3WC5 A;  4JJX A;  7CPA A;  2D4P A;  1NSL A;  2J9A A;  1TF9 A;  2FS5 A;  2WYR A;  1CP7 A;  2ZEL A;  4MCS A;  3T90 A;  2H5M A;  4K30 A;  4Q38 A;  1M4D A;  2EBJ A;  4YRH A;  1M4G A;  4JXR A;  1ON0 A;  4II9 A;  4UIA A;  2G9D A;  2PJ4 A;  1HDU A;  4U9Y A;  2B3V A;  1KZF A;  4EVY A;  1ZG7 A;  1DE4 C;  2AFM A;  3B8G A;  5C88 A;  5JQ4 A;  3FED A;  4OLL A;  2V8V A;  1UFH A;  3OWC A;  4GM5 A;  4P45 A;  3B3S A;  2PDO A;  4YGO A;  4CRY B;  5K8N A;  4BD9 A;  4DJL A;  4KOX A;  4ZGY B;  2PRQ A;  5JPH A;  1TIQ A;  2Y0M A;  4XPK A;  1VKC A;  2AFZ A;  3K9U A;  4F0Y A;  3P2H A;  5G1Z A;  4Y49 C;  2J8R A;  2NSM A;  3CXP A;  1YR0 A;  3EY5 A;  5HH1 A;  4BBH A;  5AG4 A;  2AE6 A;  2OB0 A;  1M4I A;  2PJ9 A;  2PJC A;  2ZW4 A;  4KOR A;  4QC6 A;  4B11 A;  1LOK A;  1YME A;  3F5B A;  4GXH A;  3H8E A;  3S6F A;  4B6Z A;  3FB3 A;  4NXY A;  2VBQ A;  2PR8 A;  2IQ6 A;  1TKJ A;  1JQG A;  1ELM P;  4GS4 A;  1Y7R A;  1YRE A;  3FVL A;  3FX6 A;  3VAR A;  4CAF A;  3B2Y A;  5D29 A;  3C26 A;  3WC6 A;  4CS0 B;  1BPM A;  4K3N A;  4A33 A;  4UCN A;  2GLJ A;  3D68 A;  4OC5 A;  4FD4 A;  3PGP A;  2B58 A;  2EUI A;  2GLF A;  1SQH A;  2RC4 A;  2JDD A;  4CGO A;  4PK3 A;  3RO0 A;  5IB0 A;  4RUH A;  1PU9 A;  3BHX A;  3QNV A;  2V77 A;  3B3C A;  3NE7 A;  4X2T A;  2Z11 A;  4IHM A;  3SHP A;  4A94 A;  3B7I A;  3IEH A;  4HPS A;  5K8P A;  3V38 A;  3FYN A;  4OME A;  2IMO A;  3D66 A;  4UEF A;  1I21 A;  4CYQ A;  3V7Z A;  4NJR A;  5A28 A;  1M1D A;  2Q4V A;  1XMT A;  2RFH A;  1ELL P;  3IC1 A;  4KLW A;  3FEC A;  2EO8 A;  4C68 A;  3BI1 A;  1B6B A;  1ZLI A;  4MFK A;  3LOD A;  3PFO A;  3FMC A;  4OIW A;  4ZBG A;  1I1D A;  2EVN A;  3CZX A;  4A2Z A;  2VQY A;  1S7K A;  4ZY2 A;  3S6G A;  2IJZ A;  1KUV A;  3TO7 A;  3PB9 X;  4A38 A;  2ZOG A;  2Z3P A;  2DF5 A;  4B13 A;  4CYN A;  1OZP A;  1IB1 E;  3BLN A;  4UCM A;  5AG6 A;  5AG5 A;  4C2X A;  2PRB A;  1U6M A;  4A31 A;  2BOA A;  4EWT A;  4P4B A;  4MJ8 A;  3CT9 A;  4E2A A;  3SJF A;  1S60 A;  1S7L A;  1YQE A;  4R6T A;  4AVC A;  1FT7 A;  1NSA A;  4MY0 A;  4AXV A;  4CAE A;  4F9U A;  3HLP A;  2D4O A;  3PEI A;  4OC2 A;  1KUX A;  3DLJ A;  3IWW A;  1QMU A;  1Z8T A;  3IO1 A;  4QVT A;  4AG7 A;  3H8F A;  2Q43 A;  4XPD C;  4R87 A;  3SJX A;  2V8G A;  4KVO E;  5IX3 A;  2Z3K A;  2YGW A;  3QAY A;  4KUB A;  4R8F A;  2CNM A;  4DNC A;  3PB6 X;  4H6Z A;  2Q7B A;  3A9L A;  1XE4 A;  1S3Z A;  4B5P B;  2V8H A;  1IY7 A;  3RNZ A;  3TC8 A;  4PQA A;  1QSR A;  3DDD A;  2ODF A;  2VZZ A;  1YVK A;  4O23 A;  4ZX8 A;  1MJ9 A;  1ARM A;  2GE3 A;  2CY2 A;  2PJB A;  2PSW A;  3HUV A;  3TT2 A;  3TOB A;  2PJ6 A;  2BEI A;  4ZI6 A;  1HDQ A;  1B87 A;  2HUZ A;  2ZOF A;  2CTC A;  3FXT A;  3GB0 A;  5C82 A;  3IWE A;  2ZEE A;  2PVV A;  4PXD A;  3LMS A;  4UEZ A;  5CBM A;  1BOB A;  4ZY1 A;  2AJ6 A;  1DTD A;  3KHZ A;  1LAM A;  2AFS A;  3MGD A;  1WWZ A;  2HB6 A;  5EC4 A;  1EE3 P;  4PXB A;  3R9G A;  4W9Y A;  1UWY A;  3WR7 A;  3H5Z A;  3NH4 A;  4R3K A;  4R7M A;  2OR4 A;  4MCR A;  4BMH A;  2B4B A;  3D7F A;  3NH5 A;  4U9Z A;  4NJQ A;  2AFW A;  5DS0 A;  3WT4 A;  3LAC A;  5G22 A;  4AG9 A;  1VIX A;  1KWM A;  4L8A A;  5E96 A;  4M6H A;  1LFW A;  3SI0 A;  2XEI A;  2PC1 A;  2REF A;  4KSI A;  2OZH A;  2ANP A;  4B5O A;  2GAN A;  1BLL E;  4KOV A;  4C2Y A;  4CRZ B;  3GIU A;  1HEE A;  3FIX A;  4IK2 A;  4MHY A;  1KUY A;  3S6H A;  4Z65 A;  1R57 A;  2JDC A;  1AMP A;  1VHS A;  4JXQ A;  1A2Z A;  4PXE A;  4A32 A;  2BL1 A;  2XEG A;  1P4N A;  3ZZI A;  3R95 A;  3DR6 A;  3KQZ A;  3RBU A;  2B4D A;  3IFE A;  3W91 A;  3DNS A;  3I1U A;  5AGE A;  1Z8L A;  2QJ8 A;  1M44 A;  2PQ8 A;  3D4U A;  2PR1 A;  4LQG A;  1RXT A;  2ZEM A;  3B35 A;  3KGQ A;  4NGP A;  5D8N A;  2X7B A;  3G3S A;  1XOV A;  4NGS A;  3GYA A;  1CP6 A;  2I00 A;  4MHP A;  3PBE A;  3S6K A;  4RI1 A;  5JGF A;  2AFX A;  3TE4 A;  2Z0Z A;  4HNW B;  5CNP A;  4UA3 A;  1RO5 A;  4UFV A;  2BSW A;  2C6P A;  2HQY A;  2OU2 A;  2Z3N A;  3FJU A;  4MMO A;  4OC0 A;  2OOT A;  4LUA A;  3RZA A;  4H6U A;  2R1I A;  2K5T A;  2WPW A;  3FNC A;  3IIB A;  4NGN A;  1YLO A;  2ZEO A;  2GRE A;  3TTH A;  3VWD A;  1QST A;  5HVG A;  2G3A A;  1MK4 A;  2JEV A;  1Z9U A;  1Y0R A;  1XJO A;  3PFE A;  2DEA A;  4JYW A;  4TNU A;  3PZJ A;  4OAD A;  1NMT A;  3LWU A;  2REE A;  4P10 A;  2FIA A;  2VXK A;  4KUA A;  3ISX A;  4QB9 A;  3I9S A;  4MFZ A;  2R7H A;  4MXU A;  4RN7 A;  2J8M A;  2Q7S A;  4FD7 A;  4MFJ A;  4M85 A;  4ONU A;  4UFX A;  3BI0 A;  1IU8 A;  1P0H A;  1Z8W A;  3GY9 A;  4MY3 A;  3NE8 A;  2G0B A;  3BJ8 A;  1Q2Y A;  2DPT A;  5H86 A;  5THW A;  5G21 A;  3IU2 A;  2B5G B;  4NSQ A;  5AG7 A;  1XF8 A;  1XFO A;  2AFO A;  3QB8 A;  3PB4 X;  4UF4 A;  4XNH C;  1YW6 A;  1CM0 A;  4OC1 A;  2DPS A;  2Q4Y A;  2FXF A;  3D7H A;  3F0A A;  4ONW A;  3NH8 A;  4M3S A;  2P0W A;  2O4H A;  4PV6 A;  5HVF A;  1LRZ A;  3CDX A;  1YLE A;  4KZT A;  5LYF A;  3R96 A;  3KQX A;  4UCP A;  2PJ5 A;  2Q4Z A;  3BXM A;  4OC4 A;  4A37 A;  2Z3L A;  4KLV A;  1XEB A;  4EFD A;  2WPX A;  4Y49 B;  5LYI A;  3KZW A;  2FL4 A;  4C7H A;  4KSA A;  4J3G A;  2F7V A;  3D7G A;  4IF5 A;  2J8N A;  4QUS A;  2P6F A;  4KOU A;  2CF4 A;  2WUU A;  3NFZ A;  4YFJ A;  2OZG A;  3W6X A;  4AVA A;  5EMI A;  1FNO A;  5H84 A;  4F6A A;  4E8O A;  1JWQ A;  4CYP A;  1BPN A;  3H4Q A;  5LRG A;  4CAX A;  4Q36 A;  4KOY A;  3NA6 A;  3P2F A;  4UBR A;  4LQ6 A;  2RB7 A;  2ZEG A;  1M4L A;  2I3C A;  4MI4 A;  3K9T A;  1TF8 A;  5G20 A;  3BJ7 A;  1CX8 A;  2QVP A;  3L2N A;  2VL1 A;  3KAS A;  1X12 A;  5KTD A;  4PSW A;  5CPA A;  3B3T A;  3W6S A;  4B14 A;  2O28 A;  4DYO A;  4MHD A;  4PSX A;  5EBV A;  1MJA A;  3RAM A;  2PE3 A;  1YK3 A;  2JBK A;  4CGP A;  1VGY A;  2PJ1 A;  3PRT A;  1GHE A;  1RTQ A;  4FD6 A;  2A4N A;  2FSR A;  2VEZ A;  4M6G A;  2Q51 A;  3UY5 A;  4B10 A;  1Y0Y A;  2PVW A;  3S9L A;  2ZEF A;  3D7D A;  4JD6 A;  2GFQ A;  4HNX B;  4MHZ A;  5F46 A;  3EXN A;  1XIX A;  8CPA A;  2WSA A;  4ZX9 A;  3TOA A;  1IOI A;  4UIB A;  3R9E A;  3FF3 A;  4YWY A;  5LYL A;  2C27 A;  4UEE A;  2QEC A;  2YNC A;  2OZU A;  5ELY A;  2BO9 A;  2FE7 A;  2P6E A;  1BAV A;  4NGQ A;  5BWA B;  2ZW5 A;  2ZXV A;  3FRM A;  5ISV A;  1YGH A;  1IOF A;  3H8G A;  4B12 A;  5HMN A;  2XEF A;  4NGR A;  1QQ9 A;  1Y9W A;  2PIZ A;  2EK9 A;  6CPA A;  2WZN A;  4FAI A;  1V0C A;  4KOW A;  5LYD A;  3DR8 A;  4Q7A A;  2PJ3 A;  1PCA A;  2FIW A;  3CPA A;  1VHO A;  5HVH A;  4QBJ A;  4X8I A;  1ZG9 A;  3I3G A;  4CYO A;  4AVB A;  1YSJ A;  4RS2 A;  5I4M A;  3SJG A;  2CXA A;  1IIC A;  2YND A;  1PYT B;  1XBU A;  3D67 A;  2VZY A;  3TX8 A;  2ABZ A;  5JM6 A;  4U5Y A;  3D2M A;  1FY7 A; 
#chains in the Genus database with same CATH homology
 4XPD B;  2YNC C;  3EFA A;  3FBU A;  4I49 A;  4KS9 A;  5KTC A;  5J8F A;  2BUE A;  4MFQ A;  4KOT A;  2Z3M A;  1WK4 A;  1S5K A;  2Q44 A;  3JVN A;  2FCK A;  1YX0 A;  4FD5 A;  1IYL A;  4CGL A;  4NCZ A;  4B5P A;  3V8I A;  2ZPA A;  3SXO A;  4A30 A;  5J8C A;  3ZJ0 A;  3QAH A;  3R1K A;  3TFY A;  1ZO0 A;  2QML A;  4R3L A;  2CNS A;  2I79 A;  3D3S A;  2Q04 A;  4MFL A;  3VWE A;  1I12 A;  4JLY A;  4C7I A;  5I0C A;  5A27 A;  2ZW7 A;  4MBU A;  5FVJ A;  4CAV A;  4A95 A;  4R9M A;  2OH1 A;  4KVM E;  4XPL A;  1QSN A;  3D8P A;  2R8V A;  5F47 A;  1QSM A;  4LX9 A;  4UWI A;  1L0C A;  5F48 A;  4IUS A;  3EC4 A;  2CNT A;  2ARH A;  1Y9K A;  3F8K A;  2HV2 A;  3PP9 A;  4CAW A;  4KVX A;  1Z4R A;  4L89 A;  1Q2C A;  2ZW6 A;  5F49 A;  5IV0 A;  3D2P A;  4OAE A;  4C2Z A;  1J4J A;  4UFW A;  4E0A A;  4JWP A;  3T9Y A;  5GCN A;  2FT0 A;  1BO4 A;  4MFP A;  3IWG A;  5DWM A;  2Q0Y A;  4HKF A;  1CJW A;  4KSF A;  1PUA A;  2B4D B;  3TO6 A;  3GKR A;  4PK2 A;  2ATR A;  1N71 A;  3CXQ A;  3DSB A;  3JTK A;  1S7N A;  1NE9 A;  4NF1 A;  4F0X A;  2Z3O A;  2KCW A;  4R57 A;  4AB7 A;  2P6G A;  2IL4 A;  4H89 A;  1IYK A;  2F5I A;  3R9F A;  1S7F A;  2B3U A;  1Q2D A;  3IU1 A;  3G8W A;  3KKW A;  3E0K A;  3JUW A;  2NMT A;  2VI7 A;  4XNH B;  2YNE A;  3IGR A;  3TO9 A;  3CXS A;  4NEX A;  1Z4E A;  4UWJ A;  2DXQ A;  4CGN A;  4HNY B;  2B5G A;  3RYO A;  3SXN A;  5KTA A;  4CGM A;  2R98 A;  1QSO A;  3TCV A;  3N7Z A;  1IID A;  2JLM A;  3LD2 A;  4KOS A;  4X5K A;  2QIR A;  1K4J A;  4ORF A;  3EO4 A;  2G3T A;  2GIV A;  5DWN A;  1MJB A;  1YVO A;  2Z10 A;  4JJX A;  2D4P A;  1NSL A;  4C68 A;  2FS5 A;  3T90 A;  2H5M A;  4K30 A;  4Q38 A;  1M4D A;  4YRH A;  1M4G A;  4JXR A;  1ON0 A;  4II9 A;  4U9Y A;  2B3V A;  1KZF A;  4EVY A;  3B8G A;  5C88 A;  5JQ4 A;  4OLL A;  1UFH A;  3OWC A;  2PDO A;  4YGO A;  4CRY B;  4KOX A;  4ZGY B;  5JPH A;  1TIQ A;  2Y0M A;  4XPK A;  1VKC A;  3K9U A;  4F0Y A;  3P2H A;  5G1Z A;  4Y49 C;  2J8R A;  3CXP A;  3EY5 A;  1YR0 A;  5HH1 A;  4BBH A;  5AG4 A;  2AE6 A;  2OB0 A;  1M4I A;  2ZW4 A;  4B11 A;  4KOR A;  4QC6 A;  3F5B A;  3S6F A;  3FB3 A;  4NXY A;  2VBQ A;  2PR8 A;  4GS4 A;  1Y7R A;  1YRE A;  4CAF A;  3C26 A;  4CS0 B;  4A33 A;  4UCN A;  4FD4 A;  3PGP A;  2B58 A;  2EUI A;  1SQH A;  2RC4 A;  2JDD A;  4CGO A;  4PK3 A;  5IB0 A;  1PU9 A;  3NE7 A;  2Z11 A;  3SHP A;  3FYN A;  1I21 A;  4CYQ A;  5A28 A;  1M1D A;  2Q4V A;  1XMT A;  4KLW A;  1B6B A;  4MFK A;  3LOD A;  4ZBG A;  1I1D A;  2EVN A;  4A2Z A;  2VQY A;  1S7K A;  3S6G A;  1KUV A;  3TO7 A;  2Z3P A;  4B13 A;  4CYN A;  1OZP A;  1IB1 E;  3BLN A;  4UCM A;  5AG6 A;  5AG5 A;  4C2X A;  2PRB A;  1U6M A;  4A31 A;  4MJ8 A;  4E2A A;  1S60 A;  1S7L A;  4AVC A;  4MY0 A;  4CAE A;  2D4O A;  1KUX A;  4QVT A;  4AG7 A;  4XPD C;  4R87 A;  4KVO E;  5IX3 A;  2Z3K A;  2YGW A;  4KUB A;  4DNC A;  2CNM A;  4H6Z A;  2Q7B A;  3A9L A;  1XE4 A;  1S3Z A;  4B5P B;  1QSR A;  3DDD A;  2VZZ A;  1YVK A;  1MJ9 A;  2GE3 A;  2PSW A;  2CY2 A;  3TT2 A;  3TOB A;  2BEI A;  3FXT A;  1B87 A;  2HUZ A;  5C82 A;  3IWE A;  1BOB A;  2AJ6 A;  3MGD A;  1WWZ A;  5EC4 A;  3R9G A;  3WR7 A;  3H5Z A;  4R3K A;  4BMH A;  2B4B A;  4U9Z A;  4AG9 A;  5G22 A;  4L8A A;  5E96 A;  2PC1 A;  2REF A;  2OZH A;  4B5O A;  2GAN A;  4KOV A;  4C2Y A;  4CRZ B;  3FIX A;  1KUY A;  3S6H A;  1R57 A;  2JDC A;  1VHS A;  4JXQ A;  4A32 A;  2BL1 A;  3ZZI A;  1P4N A;  3R95 A;  3DR6 A;  3W91 A;  2B4D A;  3DNS A;  5AGE A;  1M44 A;  2PQ8 A;  2PR1 A;  1RXT A;  2X7B A;  3G3S A;  3GYA A;  2I00 A;  3S6K A;  4RI1 A;  3TE4 A;  2Z0Z A;  4HNW B;  5CNP A;  4UA3 A;  1RO5 A;  4UFV A;  2BSW A;  2HQY A;  2OU2 A;  2Z3N A;  4LUA A;  4H6U A;  2R1I A;  2K5T A;  2WPW A;  3FNC A;  3TTH A;  3VWD A;  1QST A;  2G3A A;  1MK4 A;  2JEV A;  1Z9U A;  3PZJ A;  4OAD A;  1NMT A;  2REE A;  2FIA A;  2VXK A;  4KUA A;  4QB9 A;  3I9S A;  4MFZ A;  2R7H A;  2J8M A;  4FD7 A;  4MFJ A;  4M85 A;  4ONU A;  4UFX A;  1P0H A;  3GY9 A;  4MY3 A;  2G0B A;  3BJ8 A;  1Q2Y A;  2DPT A;  5H86 A;  5G21 A;  3IU2 A;  2B5G B;  4NSQ A;  5AG7 A;  1XF8 A;  3QB8 A;  4XNH C;  1CM0 A;  2DPS A;  2Q4Y A;  2FXF A;  3F0A A;  4M3S A;  2P0W A;  4PV6 A;  1LRZ A;  4KZT A;  1YLE A;  3R96 A;  4UCP A;  2Z3L A;  4KLV A;  1XEB A;  2WPX A;  4Y49 B;  2FL4 A;  4C7H A;  4KSA A;  4J3G A;  4IF5 A;  2J8N A;  4QUS A;  2P6F A;  4KOU A;  2WUU A;  4YFJ A;  2OZG A;  3W6X A;  4AVA A;  5H84 A;  4F6A A;  4E8O A;  4CYP A;  3H4Q A;  4CAX A;  4Q36 A;  4KOY A;  3P2F A;  4UBR A;  4MI4 A;  5G20 A;  3BJ7 A;  5KTD A;  4PSW A;  3W6S A;  4B14 A;  2O28 A;  4MHD A;  4PSX A;  5EBV A;  1MJA A;  1YK3 A;  4CGP A;  1GHE A;  4FD6 A;  2A4N A;  2FSR A;  2VEZ A;  3UY5 A;  4B10 A;  4JD6 A;  4HNX B;  5F46 A;  3EXN A;  1XIX A;  2WSA A;  3TOA A;  3R9E A;  2C27 A;  2QEC A;  2YNC A;  2OZU A;  2FE7 A;  2P6E A;  5BWA B;  2ZW5 A;  2ZXV A;  3FRM A;  5ISV A;  1YGH A;  4B12 A;  5HMN A;  1Y9W A;  1V0C A;  4KOW A;  3DR8 A;  2FIW A;  4QBJ A;  3I3G A;  4CYO A;  4AVB A;  4RS2 A;  2CXA A;  1IIC A;  2YND A;  2VZY A;  4U5Y A;  3D2M A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...