3G3SA

Crystal structure of gcn5-related n-acetyltransferase-like protein (zp_00874857) (zp_00874857.1) from streptococcus suis 89/1591 at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
GMAEQMRRVARLFGDWPETIIWTCLEGTMGDIYVDDSQSPQSALALYGRQSFFGFLAGQPHRDLLKICEGKNIILVPQNQAWSDLIEEVYGDGVRFFTRYATKKDTEFDLGHLQKLVDDLPESFDMKLIDRNLYETCLVEEWSRDLVGNYIDVEQFLDLGLGCVILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDAHTLTSLKLAEKLGYELDKAYQAYEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title Crystal structure of GCN5-related N-acetyltransferase-like protein (ZP_00874857) (ZP_00874857.1) from Streptococcus suis 89/1591 at 1.80 A resolution
rcsb
source organism Streptococcus suis
molecule tags Transferase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA02
3.40.630.110 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA01
4AVBA 4HNWB 3TOBA 3EC4A 3DR8A 4AG9A 4OLLA 4JLYA 4E0AA 4U5YA 1L0CA 2FSRA 2P0WA 2CNMA 4CAVA 1N71A 3QB8A 2B4DA 1M4GA 2B3VA 4K30A 3DSBA 4AB7A 3TFYA 1I1DA 5J8CA 1NSLA 1PUAA 2PDOA 3F5BA 4HKFA 4LUAA 4FD5A 4JXQA 3IGRA 4ZBGA 2FXFA 2ZW5A 3QAHA 5F47A 4DNCA 4L8AA 2FIAA 2ARHA 2G3TA 5H84A 5E96A 4QBJA 1KUYA 4BMHA 2ATRA 4NSQA 3TOAA 2X7BA 2P6GA 3T90A 1RXTA 2VXKA 5IX3A 2B5GB 3MGDA 4XPLA 3GKRA 1Q2CA 2HQYA 4FD4A 4RI1A 5DWNA 2HV2A 4H6UA 3F0AA 4E8OA 3GYAA 1WK4A 5F48A 1YK3A 5DWMA 3CXQA 5C82A 1M4DA 1V0CA 2J8MA 1CJWA 2I79A 4R3KA 2B58A 3GY9A 2J8RA 2HUZA 1NMTA 1IIDA 4IF5A 1SQHA 1Y9WA 2Q44A 2R8VA 3V8IA 1S7FA 4KLWA 4NF1A 2OZHA 3EO4A 4KZTA 5HMNA 2Q0YA 3W6XA 2GIVA 3EFAA 2NMTA 3F8KA 3C26A 1U6MA 4KOVA 1OZPA 1IICA 1P4NA 2G0BA 1PU9A 3FYNA 4H6ZA 3EXNA 4R87A 4KOWA 3TT2A 1S3ZA 3VWEA 4UBRA 4Y49C 4KOXA 4Y49B 3R9FA 2OZUA 1B6BA 2QMLA 4XPDC 4XPDB 4I49A 2FCKA 2Z11A 3NE7A 4EVYA 2G3AA 2P6EA 4PSXA 2IL4A 1BO4A 2Y0MA 2WPWA 1VKCA 4GS4A 3ZZIA 2VI7A 3PZJA 1YVOA 3KKWA 3PGPA 1YX0A 2FE7A 2R1IA 5HH1A 3H4QA 4F0YA 5IV0A 1B87A 1KZFA 4QVTA 3IWGA 3DNSA 2H5MA 1YVKA 5CNPA 4CAXA 4HNYB 2OZGA 3S6FA 4HNXB 4KOTA 3BJ8A 2FS5A 3D2PA 4KVXA 3R1KA 4LX9A 4PK2A 4ONUA 1M1DA 1IYKA 2FL4A 4YGOA 1MJ9A 4U9YA 1WWZA 4M3SA 1XE4A 4CRYB 4RS2A 3BLNA 1VHSA 1YR0A 1RO5A 3SXNA 1QSTA 4FD7A 2VQYA 3EY5A 3DDDA 4CRZB 2D4PA 3FRMA 1XEBA 2OU2A 2BUEA 2QIRA 4MI4A 3LODA 1QSOA 4XNHC 4U9ZA 4XNHB 2R98A 4IUSA 4AVCA 1S7LA 1YLEA 2I00A 2ZW7A 3P2HA 2J8NA 4KLVA 4B5PB 4MJ8A 2Q4YA 1Z4EA 3FB3A 1IB1E 3WR7A 2PC1A 2GANA 3D3SA 5H86A 4AVAA 4CAWA 2ZW4A 4M85A 1KUVA 4JWPA 3ZJ0A 1UFHA 4H89A 4MHDA 2OH1A 1S7NA 4FD6A 5EC4A 2AJ6A 2PSWA 5I0CA 3CXSA 5C88A 3E0KA 2ZPAA 4PV6A 3R96A 5GCNA 2BSWA 1YREA 1XF8A 4JD6A 3VWDA 1QSNA 4B5OA 4ORFA 1Z9UA 1QSMA 2PR8A 4OADA 5EBVA 5IB0A 5F46A 2O28A 1I12A 4X5KA 2PRBA 3TO9A 1FY7A 2Q7BA 1KUXA 4KUAA 1TIQA 4KOUA 2Z0ZA 1S7KA 1Y7RA 4KUBA 2BEIA 4MY3A 2CNTA 3TTHA 1IYLA 4AG7A 2A4NA 1Y9KA 5F49A 1YGHA 2JLMA 3B8GA 4YRHA 1XIXA 4JXRA 2B4DB 4KVME 2VEZA 1J4JA 1P0HA 1R57A 1K4JA 2JDCA 2QECA 2AE6A 3R9EA 3S6HA 3OWCA 3I9SA 2REEA 3DR6A 2Q4VA 5JPHA 2Z10A 4E2AA 4R3LA 3TO7A 4KOYA 4KOSA 2B3UA 3FIXA 3S6KA 1M44A 1GHEA 3N7ZA 2GE3A 5KTCA 2EVNA 1ON0A 2BL1A 3BJ7A 4J3GA 3SXOA 2RC4A 1M4IA 2FIWA 2R7HA 1NE9A 3LD2A 3R9GA 5ISVA 2DXQA 2PQ8A 3R95A 3JUWA 4MY0A 4PSWA 2D4OA 2FT0A 4KVOE 2VZYA 4UA3A 2ZW6A 4JJXA 2JDDA 1S5KA 3D2MA 1MJBA 4XPKA 5JQ4A 2EUIA 2C27A 3P2FA 2VZZA 3W6SA 1MK4A 3RYOA 2ZXVA 2K5TA 4UWIA 1BOBA 5KTDA 4YFJA 2Q04A 2B5GA 3I3GA 3PP9A 3D8PA 4R9MA 3K9UA 1Q2DA 2KCWA 4PK3A 3S6GA 2REFA 1LRZA 5J8FA 4II9A 4L89A 1I21A 4B5PA 1XMTA 1CM0A 1MJAA 4NCZA 2F5IA 3TE4A 4MBUA 4R57A 1Q2YA 3UY5A 2WPXA 2CNSA 1Z4RA 3FNCA 3FBUA 4KORA 4QC6A 3TCVA 4QB9A 2VBQA 1S60A 2B4BA 4CS0B 4OAEA 3JVNA 4F6AA 3SHPA 3CXPA 3T9YA 1QSRA 4QUSA 3G3SA 2JEVA 5KTAA 2P6FA 4NXYA 2OB0A 3G8WA 3TO6A 2CY2A 2PR1A 4UWJA 4NEXA 3FXTA 3W91A 5FVJA
chains in the Genus database with same CATH superfamily
2BOAA 3CDXA 4UEZA 3BI1A 3VH9A 4AVBA 4HNWB 3TOBA 3EC4A 4ZI6A 3DR8A 3A9LA 4X2TA 1BPMA 4AG9A 3L2NA 1TKFA 4OLLA 3KQXA 4W9YA 4WWVA 2O53A 2EBJA 3PFEA 4JLYA 4E0AA 4BBHA 4U5YA 1L0CA 2FSRA 2ZEDA 3PB7X 4P10A 4Q38A 3HLPA 2P0WA 3IEHA 2CNMA 4UEEA 2ZEPA 4CAVA 1N71A 3BHXA 1Y7EA 3DGVA 2V77A 5JGFA 1HDUA 2B4DA 3QB8A 4X8IA 4IK2A 1M4GA 2B3VA 4K30A 4UIBA 3TC8A 3D7HA 3DSBA 4AB7A 3B3VA 3TFYA 1I1DA 2BCOA 5J8CA 4R6TA 1NSLA 1PUAA 3SI2A 2PJ5A 3SJGA 4P44A 2ZENA 5K8PA 3IWWA 4K3NA 4NGTA 4DYOA 1ARLA 1IOFA 2PDOA 2YNEA 3F5BA 4F9VA 4HKFA 2YGWA 4LUAA 4FD5A 4P4BA 4P45A 3GB0A 4JXQA 3IGRA 4ZBGA 2WUUA 2DF5A 2FXFA 2ZEMA 2PCUA 4IAVA 2C6PA 2ZW5A 3QAHA 5F47A 2QJ8A 4JZ0A 5G21A 4OIWA 3NA6A 3KGQA 4DNCA 2EK9A 2PJ7A 4L8AA 2BO9A 1A2ZA 2GFQA 5JH9A 2FIAA 4C2YA 2ARHA 2G3TA 2Z3LA 4RUHA 5H84A 3IIBA 5E96A 1LANA 4QBJA 5A28A 1KUYA 1XOVA 3ISZA 4BMHA 2PJ0A 2ATRA 4NSQA 3FF3A 5JM6A 4FBEA 3QAYA 4CGPA 1ELLP 3FJUA 3TOAA 2X7BA 4EMEA 2P6GA 3VATA 1Z8WA 2OOTA 3T90A 3LWUA 1RXTA 1M4LA 2V8VA 2VXKA 2ZEHA 3CZXA 3D67A 3ISXA 1VIXA 2B5GB 1UWYA 5IX3A 4GM5A 3MGDA 4LQGA 4XPLA 3GKRA 4CPAA 1Q2CA 2HQYA 3PBEA 2ODFA 1FT7A 2RFHA 2WYRA 4FD4A 4NFRA 5EMIA 4RI1A 1IOIA 4OC1A 2HV2A 4H6UA 3KL9A 5DWNA 4CGLA 3F0AA 1F2PA 3B2YA 4E8OA 3GYAA 2PIYA 4MFPA 5LRGA 1WK4A 5F48A 3I1UA 1YK3A 1Z2LA 3CXQA 5DWMA 4B12A 1M4DA 1V0CA 5C82A 3BXMA 2J8MA 4PXCA 1CJWA 2I79A 4R3KA 4NJQA 4CGMA 1Z5RA 2B58A 4ONWA 3SI1A 1IGBA 1OBRA 4FAIA 3GY9A 1YW4A 2WSAA 3IC1A 4A94A 3H8FA 2J8RA 3FX6A 4TNUA 2HUZA 1NMTA 4JYWA 4NGRA 1IIDA 2IQ6A 4IF5A 1LAMA 1GYTA 2C6GA 1Z8XA 4MHPA 5K8NA 1SQHA 4C68A 1Y9WA 2G9DA 2Q44A 2R8VA 4WJBA 3V8IA 1S7FA 4KLWA 1JQGA 2OZHA 3EO4A 2PJCA 4NF1A 4KZTA 5LRKA 5HMNA 2Q0YA 4CYOA 3H8GA 2GLJA 4MMOA 3W6XA 2V8DA 2GIVA 3EFAA 4M6HA 4B14A 2NMTA 1DTDA 3BI0A 1X10A 4OC0A 3F8KA 2ZELA 4P4IA 2YNCC 2POKA 1R43A 1U6MA 3C26A 4KOVA 1OZPA 2XEGA 1BPNA 1IICA 1P4NA 4ZX8A 4C7HA 2G0BA 5HVHA 4UFXA 5HVFA 1ARMA 1IY7A 1PU9A 2NSMA 2PJ9A 3FYNA 4H6ZA 3EXNA 2O4HA 3D4UA 4CYQA 1Z8LA 4R87A 4KOWA 3TT2A 3IFEA 6CPAA 1S3ZA 3VWEA 2CXAA 4UBRA 1ZO0A 4KOXA 4Y49C 4Y49B 3R9FA 4FUUA 2OZUA 4KSIA 1B6BA 3KQZA 2JBJA 2C6CA 2QMLA 4MHYA 3SI0A 5J1QA 1TKHA 3KR5A 4B11A 4OC2A 4CGOA 4XPDC 3D66A 4XPDB 4I49A 2FCKA 2Z11A 3NE7A 4EVYA 2ZEFA 4O23A 2G3AA 2P6EA 3GIUA 4PSXA 3WC5A 2Z3OA 2IL4A 1BO4A 2Y0MA 2WPWA 1VKCA 2ZOGA 2JBKA 4GS4A 3WC7A 3ZZIA 1LOKA 2VI7A 3PZJA 2Q43A 1YVOA 3KKWA 2V8GA 5G20A 3NE8A 3PGPA 3S9MA 1YX0A 4OC3A 3PFOA 1TXRA 4DJLA 2FE7A 2R1IA 2ZEGA 3FH4A 4AXVA 2OR4A 5HH1A 4B13A 2Z3PA 3H4QA 1ZLHA 5BWAB 4F0YA 5IV0A 1LAPA 1B87A 1KZFA 2AFOA 4A39A 4QVTA 4UIAA 2PJ2A 3S9LA 3V38A 1XMBA 3IWGA 4OMEA 2DPSA 2H5MA 3DNSA 1YVKA 1TF8A 4MHZA 3H8EA 5CNPA 4CAXA 2PJ8A 4HNYB 2OZGA 3S6FA 4HNXB 4KS9A 1VHOA 4KOTA 3BJ8A 4A37A 1ELMP 1FNOA 4MCQA 2FS5A 3D2PA 4MXUA 4OC4A 4KVXA 3R1KA 3JTKA 4LX9A 4ONUA 4PK2A 1M1DA 1CX8A 3CPXA 1IYKA 1TKJA 2FL4A 4YGOA 1HEEA 1MJ9A 4U9YA 2CIJA 3SJFA 4B10A 1WWZA 4M3SA 1XE4A 8CPAA 4CRYB 4RS2A 3KR4A 3BLNA 1VHSA 4GXHA 4M6GA 2DEAA 2Q7SA 5LYLA 1YR0A 1CPSA 1RO5A 3QNVA 3CPAA 3SXNA 2XEIA 1LFWA 3N5FA 2VL1A 1QSTA 4FD7A 2VQYA 3FEEA 3EY5A 4ZY0A 2PJ4A 3DDDA 4FWUA 4CRZB 2D4PA 3RNZA 3FRMA 4UFWA 1XEBA 1QQ9A 2OU2A 4NJRA 2BUEA 2QIRA 4G1PA 1AMPA 4MI4A 4PQAA 3LODA 1QSOA 4UCMA 4U9ZA 2HC9A 4XNHB 4XNHC 2R98A 2AFUA 4IUSA 4ZGYB 3KASA 4AVCA 1S7LA 1ZG7A 1YLEA 4Q7AA 2I00A 2ZW7A 4NGQA 3P2HA 4A38A 2J8NA 4MHNA 4KLVA 4B5PB 3PB6X 4MJ8A 2Q4YA 3LACA 1Z4EA 5AG6A 5HXDA 3FB3A 2I3CA 1IB1E 2PVWA 3WR7A 2PC1A 3WC6A 1TF9A 2GANA 1Z8TA 3D3SA 3K2KA 3JRUA 2ABZA 5H86A 4AVAA 4CAWA 3VARA 4C2XA 2ZW4A 5I4MA 3SJEA 1AUGA 3FVLA 4M85A 1KUVA 4JWPA 5G22A 3ZJ0A 1UFHA 3CT9A 4H89A 4MHDA 2OH1A 2XEFA 4A31A 5G1ZA 1AYEA 1S7NA 4FD6A 5LYIA 5EC4A 4F0XA 2AJ6A 2PSWA 2F8HA 3CXSA 5C88A 1ZG9A 1CBXA 3E0KA 5I0CA 3B35A 2ZPAA 4PV6A 3D68A 3R96A 5GCNA 2BSWA 2IMOA 2C1CA 3HUVA 1YREA 5LYFA 1YW6A 1XF8A 3LMSA 1PCAA 2WZNA 4JD6A 3VWDA 1QSNA 3PB4X 4P4JA 2V8HA 4B5OA 4ORFA 1Z9UA 5D8NA 1QSMA 2PR8A 4OADA 1YMEA 4PXEA 5AG7A 5EBVA 3RAMA 7CPAA 1RTQA 4OIDA 5F46A 5IB0A 2YNDA 2O28A 1I12A 3KZWA 4A95A 3IU2A 1X12A 4CYPA 4X5KA 3KHZA 2GLFA 3TX8A 4EFDA 2GREA 2PRBA 3MRUA 4YWYA 3TO9A 1FY7A 3NFZA 4F8ZA 2Q7BA 1KUXA 4KUAA 3PEIA 1TIQA 4KOUA 2Z0ZA 5AG4A 2XEJA 3KHXA 1S7KA 4NGSA 3RZAA 4X3RA 2Q51A 2YNCA 3K9TA 1Y7RA 2PIZA 4KUBA 2BEIA 3DLJA 4PXDA 5THWA 4DUKA 4MY3A 3SJXA 2CNTA 3TTHA 1IYLA 4UCPA 4MCSA 4AG7A 3KI9A 2PJAA 2A4NA 1Y9KA 4MCPA 5F49A 1YGHA 2F7VA 4UEFA 4CGNA 2JLMA 1Y0RA 1ZG8A 2PJBA 2RB7A 3B8GA 4YRHA 1XIXA 3PB9X 4MFQA 4JXRA 2Z3MA 2B4DB 4YU9A 4NGNA 4KVME 2VEZA 4F9UA 2ZEOA 1J4JA 4PPZA 1P0HA 5AG5A 1R57A 1K4JA 3D7GA 2JDCA 1VHEA 3GUXA 2QECA 2AE6A 3R9EA 4MFKA 4TWEA 3S6HA 3D7FA 3WT4A 4HPSA 3OWCA 3I9SA 1YSJA 2REEA 2Q4ZA 2Z3NA 3DR6A 2Q4VA 2JEWA 3PBBA 4EWTA 5JPHA 1NSAA 2Z10A 3D7DA 4MRIA 4OC5A 5A27A 4R7MA 4E2AA 4CAFA 1F57A 4R3LA 3TO7A 4KOYA 4KOSA 3B3TA 2B3UA 3FIXA 2NYQA 3RO0A 3S6KA 3NH8A 4BD9A 1M44A 1GHEA 2FVGA 3N7ZA 1PYTB 1BLLE 2GE3A 5KTCA 2EK8A 2EVNA 2HB6A 1ON0A 2BL1A 1HDQA 4KSFA 4NGPA 3BJ7A 4J3GA 3SXOA 3FMCA 2RC4A 5LYDA 1M4IA 4MCRA 1CPXA 2GU2A 4RN7A 2FIWA 2R7HA 5LRJA 1NE9A 2PRQA 3B3WA 4NGMA 3LD2A 3R9GA 3IO1A 5ISVA 2DXQA 4R76A 2PQ8A 2PJ3A 1JWQA 3R95A 4ZY1A 3JUWA 2AFXA 4MFLA 1XFOA 1CP6A 2AFMA 2CF4A 3IJ3A 1Q7LA 4MY0A 4PSWA 4ZX9A 2D4OA 2FT0A 5K8MA 2EO8A 4KVOE 3MN8A 5AGEA 4CYNA 5HVGA 4B6ZA 1XRYA 1XBUA 2VZYA 4UA3A 3GLJA 2ZW6A 4Z65A 4UFVA 2AFSA 4JJXA 3WABA 2JDDA 1S5KA 4UCNA 3D2MA 1CP7A 1R3NA 1ZLIA 4CAEA 3H5ZA 1MJBA 1BAVA 4XPKA 3S9NA 5JQ4A 2EUIA 3NH5A 2C27A 1H8LA 3P2FA 5ELYA 2VZZA 3W6SA 2AFZA 4A30A 1MK4A 3RYOA 2ZXVA 3B3SA 2K5TA 4KSAA 2QYVA 4UWIA 1BOBA 5KTDA 3RBUA 4BINA 4YFJA 4H2KA 2Q04A 5CBMA 2B5GA 3I3GA 3PP9A 2J9AA 1CG2A 1VGYA 4UF4A 3D8PA 4R9MA 1Y0YA 3K9UA 1Q2DA 3B3CA 4R8FA 1XJOA 2KCWA 4PK3A 3S6GA 3V7ZA 2REFA 5IB9A 5K8OA 1F2OA 1LRZA 2PVVA 4ZYQA 1IU8A 4OKOA 5J8FA 4II9A 4L89A 2CTBA 1I21A 4A33A 2ANPA 4B5PA 1XMTA 1CM0A 1MJAA 4MFJA 4NCZA 1YQEA 3IWEA 1YLOA 2EWBA 2CTCA 2F5IA 4ZY2A 4P4FA 3TE4A 4MBUA 4R57A 1KWMA 1Q2YA 2ZEEA 2ZOFA 3FECA 4P4EA 5F09A 3PB8X 4Q36A 3NH4A 3UY5A 2WPXA 1DE4C 2DPTA 3FEDA 4A32A 2CNSA 1Z4RA 4LQ6A 3FNCA 3FBUA 4KORA 2PE3A 4QC6A 1QMUA 3IU1A 3TCVA 4PXBA 4QB9A 4C7IA 2VBQA 4OP4A 5CPAA 1S60A 2B4BA 4M6IA 4CS0B 4OAEA 1EE3P 3T8WA 3JVNA 4F6AA 3SHPA 4C2ZA 3CXPA 2Z3KA 2QVPA 2PJ6A 3T9YA 1QSRA 4QUSA 5DS0A 2AFWA 3B7IA 3G3SA 2JEVA 5KTAA 2P6FA 4P4DA 4NXYA 4A2ZA 2OB0A 3G8WA 4P6YA 3TO6A 2CY2A 2PR1A 2IJZA 4UWJA 4MFZA 4NEXA 3FXTA 3W91A 1LCPA 5D29A 2PJ1A 5FVJA 3PRTA 4IHMA
chains in the Genus database with same CATH topology
4AVBA 4HNWB 3TOBA 3EC4A 3DR8A 3A9LA 4AG9A 4OLLA 4JLYA 4E0AA 4BBHA 4U5YA 1L0CA 2FSRA 4Q38A 2P0WA 2CNMA 4CAVA 1N71A 3QB8A 2B4DA 1M4GA 2B3VA 4K30A 3DSBA 4AB7A 3TFYA 1I1DA 5J8CA 1NSLA 1PUAA 2PDOA 2YNEA 3F5BA 4HKFA 2YGWA 4LUAA 4FD5A 4JXQA 3IGRA 4ZBGA 2WUUA 2FXFA 2ZW5A 3QAHA 5F47A 5G21A 4DNCA 4L8AA 2FIAA 4C2YA 2ARHA 2G3TA 2Z3LA 5H84A 5E96A 4QBJA 5A28A 1KUYA 4BMHA 2ATRA 4NSQA 4CGPA 3TOAA 2X7BA 2P6GA 3T90A 1RXTA 2VXKA 5IX3A 2B5GB 3MGDA 4XPLA 3GKRA 1Q2CA 2HQYA 4FD4A 4CYQA 4RI1A 5DWNA 4CGLA 2HV2A 4H6UA 3F0AA 4E8OA 3GYAA 4MFPA 1WK4A 5F48A 1YK3A 5DWMA 3CXQA 4B12A 5C82A 1M4DA 1V0CA 2J8MA 1CJWA 2I79A 4R3KA 4CGMA 2B58A 3GY9A 2WSAA 2J8RA 2HUZA 1NMTA 1IIDA 4IF5A 1SQHA 4C68A 1Y9WA 2Q44A 2R8VA 3V8IA 1S7FA 4KLWA 4NF1A 2OZHA 3EO4A 4KZTA 5HMNA 2Q0YA 4CYOA 3W6XA 2GIVA 3EFAA 4B14A 2NMTA 3F8KA 2YNCC 3C26A 1U6MA 4C7HA 4KOVA 1OZPA 1IICA 1P4NA 2G0BA 4UFXA 1PU9A 3FYNA 4H6ZA 3EXNA 4R87A 4KOWA 3TT2A 1S3ZA 3VWEA 2CXAA 4UBRA 1ZO0A 4KOXA 4Y49C 4Y49B 3R9FA 2OZUA 1B6BA 2QMLA 4B11A 4CGOA 4XPDC 4XPDB 4I49A 2FCKA 2Z11A 3NE7A 4EVYA 2G3AA 2P6EA 4PSXA 2Z3OA 2IL4A 1BO4A 2Y0MA 2WPWA 1VKCA 4GS4A 3ZZIA 2VI7A 3PZJA 1YVOA 3KKWA 5G20A 3PGPA 1YX0A 2FE7A 2R1IA 4B13A 5HH1A 2Z3PA 3H4QA 5BWAB 4F0YA 5IV0A 1B87A 1KZFA 4QVTA 3IWGA 2DPSA 2H5MA 3DNSA 1YVKA 5CNPA 4CAXA 4HNYB 2OZGA 3S6FA 4HNXB 4KS9A 4KOTA 3BJ8A 2FS5A 3D2PA 4KVXA 3R1KA 3JTKA 4LX9A 4ONUA 4PK2A 1M1DA 1IYKA 2FL4A 4YGOA 1MJ9A 4U9YA 4B10A 1WWZA 4M3SA 1XE4A 4CRYB 4RS2A 3BLNA 1VHSA 1YR0A 1RO5A 3SXNA 1QSTA 4FD7A 2VQYA 3EY5A 3DDDA 4CRZB 2D4PA 3FRMA 4UFWA 1XEBA 2OU2A 2BUEA 2QIRA 4MI4A 3LODA 1QSOA 4UCMA 4U9ZA 4XNHC 4XNHB 2R98A 4IUSA 4ZGYB 4AVCA 1S7LA 1YLEA 2I00A 2ZW7A 3P2HA 2J8NA 4KLVA 4B5PB 4MJ8A 2Q4YA 1Z4EA 5AG6A 3FB3A 1IB1E 3WR7A 2PC1A 2GANA 3D3SA 5H86A 4AVAA 4CAWA 4C2XA 2ZW4A 4M85A 1KUVA 4JWPA 5G22A 3ZJ0A 1UFHA 4H89A 4MHDA 2OH1A 4A31A 5G1ZA 1S7NA 4FD6A 4F0XA 5EC4A 2AJ6A 2PSWA 5I0CA 3CXSA 5C88A 3E0KA 2ZPAA 4PV6A 3R96A 5GCNA 2BSWA 1YREA 1XF8A 4JD6A 3VWDA 1QSNA 4B5OA 4ORFA 1Z9UA 1QSMA 2PR8A 4OADA 5AG7A 5EBVA 5IB0A 5F46A 2YNDA 2O28A 1I12A 4A95A 4CYPA 3IU2A 4X5KA 2PRBA 3TO9A 1FY7A 2Q7BA 1KUXA 4KUAA 5AG4A 1TIQA 4KOUA 2Z0ZA 1S7KA 2YNCA 1Y7RA 4KUBA 2BEIA 4MY3A 2CNTA 3TTHA 1IYLA 4UCPA 4AG7A 2A4NA 1Y9KA 5F49A 4CGNA 1YGHA 2JLMA 3B8GA 4YRHA 1XIXA 4MFQA 4JXRA 2Z3MA 2B4DB 4KVME 2VEZA 1J4JA 1P0HA 5AG5A 1R57A 1K4JA 2JDCA 2QECA 2AE6A 3R9EA 4MFKA 3S6HA 3OWCA 3I9SA 2REEA 2Z3NA 3DR6A 2Q4VA 5JPHA 2Z10A 5A27A 4E2AA 4CAFA 4R3LA 3TO7A 4KOYA 4KOSA 2B3UA 3FIXA 3S6KA 1M44A 1GHEA 3N7ZA 2GE3A 5KTCA 2EVNA 1ON0A 2BL1A 4KSFA 3BJ7A 4J3GA 3SXOA 2RC4A 1M4IA 2FIWA 2R7HA 1NE9A 3LD2A 3R9GA 5ISVA 2DXQA 2PQ8A 3R95A 3JUWA 4MFLA 4MY0A 4PSWA 2D4OA 2FT0A 4KVOE 5AGEA 4CYNA 2VZYA 4UA3A 2ZW6A 4UFVA 4JJXA 2JDDA 1S5KA 4UCNA 3D2MA 4CAEA 3H5ZA 1MJBA 4XPKA 5JQ4A 2EUIA 2C27A 3P2FA 2VZZA 3W6SA 4A30A 1MK4A 3RYOA 2ZXVA 2K5TA 4KSAA 4UWIA 1BOBA 5KTDA 4YFJA 2Q04A 2B5GA 3I3GA 3PP9A 3D8PA 4R9MA 3K9UA 1Q2DA 2KCWA 4PK3A 3S6GA 2REFA 1LRZA 5J8FA 4II9A 4L89A 1I21A 4A33A 4B5PA 1XMTA 1CM0A 1MJAA 4MFJA 4NCZA 3IWEA 2F5IA 3TE4A 4MBUA 4R57A 1Q2YA 4Q36A 3UY5A 2WPXA 2DPTA 4A32A 2CNSA 1Z4RA 3FNCA 3FBUA 4KORA 4QC6A 3IU1A 3TCVA 4QB9A 4C7IA 2VBQA 1S60A 2B4BA 4CS0B 4OAEA 3JVNA 4F6AA 3SHPA 4C2ZA 3CXPA 2Z3KA 3T9YA 1QSRA 4QUSA 3G3SA 2JEVA 5KTAA 2P6FA 4NXYA 4A2ZA 2OB0A 3G8WA 3TO6A 2CY2A 2PR1A 4UWJA 4MFZA 4NEXA 3FXTA 3W91A 5FVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVB A;  4HNW B;  3TOB A;  3EC4 A;  3DR8 A;  4AG9 A;  4OLL A;  4JLY A;  4E0A A;  4U5Y A;  1L0C A;  2FSR A;  2P0W A;  2CNM A;  4CAV A;  1N71 A;  3QB8 A;  2B4D A;  1M4G A;  2B3V A;  4K30 A;  3DSB A;  4AB7 A;  3TFY A;  1I1D A;  5J8C A;  1NSL A;  1PUA A;  2PDO A;  3F5B A;  4HKF A;  4LUA A;  4FD5 A;  4JXQ A;  3IGR A;  4ZBG A;  2FXF A;  2ZW5 A;  3QAH A;  5F47 A;  4DNC A;  4L8A A;  2FIA A;  2ARH A;  2G3T A;  5H84 A;  5E96 A;  4QBJ A;  1KUY A;  4BMH A;  2ATR A;  4NSQ A;  3TOA A;  2X7B A;  2P6G A;  3T90 A;  1RXT A;  2VXK A;  5IX3 A;  2B5G B;  3MGD A;  4XPL A;  3GKR A;  1Q2C A;  2HQY A;  4FD4 A;  4RI1 A;  5DWN A;  2HV2 A;  4H6U A;  3F0A A;  4E8O A;  3GYA A;  1WK4 A;  5F48 A;  1YK3 A;  5DWM A;  3CXQ A;  5C82 A;  1M4D A;  1V0C A;  2J8M A;  1CJW A;  2I79 A;  4R3K A;  2B58 A;  3GY9 A;  2J8R A;  2HUZ A;  1NMT A;  1IID A;  4IF5 A;  1SQH A;  1Y9W A;  2Q44 A;  2R8V A;  3V8I A;  1S7F A;  4KLW A;  4NF1 A;  2OZH A;  3EO4 A;  4KZT A;  5HMN A;  2Q0Y A;  3W6X A;  2GIV A;  3EFA A;  2NMT A;  3F8K A;  3C26 A;  1U6M A;  4KOV A;  1OZP A;  1IIC A;  1P4N A;  2G0B A;  1PU9 A;  3FYN A;  4H6Z A;  3EXN A;  4R87 A;  4KOW A;  3TT2 A;  1S3Z A;  3VWE A;  4UBR A;  4Y49 C;  4KOX A;  4Y49 B;  3R9F A;  2OZU A;  1B6B A;  2QML A;  4XPD C;  4XPD B;  4I49 A;  2FCK A;  2Z11 A;  3NE7 A;  4EVY A;  2G3A A;  2P6E A;  4PSX A;  2IL4 A;  1BO4 A;  2Y0M A;  2WPW A;  1VKC A;  4GS4 A;  3ZZI A;  2VI7 A;  3PZJ A;  1YVO A;  3KKW A;  3PGP A;  1YX0 A;  2FE7 A;  2R1I A;  5HH1 A;  3H4Q A;  4F0Y A;  5IV0 A;  1B87 A;  1KZF A;  4QVT A;  3IWG A;  3DNS A;  2H5M A;  1YVK A;  5CNP A;  4CAX A;  4HNY B;  2OZG A;  3S6F A;  4HNX B;  4KOT A;  3BJ8 A;  2FS5 A;  3D2P A;  4KVX A;  3R1K A;  4LX9 A;  4PK2 A;  4ONU A;  1M1D A;  1IYK A;  2FL4 A;  4YGO A;  1MJ9 A;  4U9Y A;  1WWZ A;  4M3S A;  1XE4 A;  4CRY B;  4RS2 A;  3BLN A;  1VHS A;  1YR0 A;  1RO5 A;  3SXN A;  1QST A;  4FD7 A;  2VQY A;  3EY5 A;  3DDD A;  4CRZ B;  2D4P A;  3FRM A;  1XEB A;  2OU2 A;  2BUE A;  2QIR A;  4MI4 A;  3LOD A;  1QSO A;  4XNH C;  4U9Z A;  4XNH B;  2R98 A;  4IUS A;  4AVC A;  1S7L A;  1YLE A;  2I00 A;  2ZW7 A;  3P2H A;  2J8N A;  4KLV A;  4B5P B;  4MJ8 A;  2Q4Y A;  1Z4E A;  3FB3 A;  1IB1 E;  3WR7 A;  2PC1 A;  2GAN A;  3D3S A;  5H86 A;  4AVA A;  4CAW A;  2ZW4 A;  4M85 A;  1KUV A;  4JWP A;  3ZJ0 A;  1UFH A;  4H89 A;  4MHD A;  2OH1 A;  1S7N A;  4FD6 A;  5EC4 A;  2AJ6 A;  2PSW A;  5I0C A;  3CXS A;  5C88 A;  3E0K A;  2ZPA A;  4PV6 A;  3R96 A;  5GCN A;  2BSW A;  1YRE A;  1XF8 A;  4JD6 A;  3VWD A;  1QSN A;  4B5O A;  4ORF A;  1Z9U A;  1QSM A;  2PR8 A;  4OAD A;  5EBV A;  5IB0 A;  5F46 A;  2O28 A;  1I12 A;  4X5K A;  2PRB A;  3TO9 A;  1FY7 A;  2Q7B A;  1KUX A;  4KUA A;  1TIQ A;  4KOU A;  2Z0Z A;  1S7K A;  1Y7R A;  4KUB A;  2BEI A;  4MY3 A;  2CNT A;  3TTH A;  1IYL A;  4AG7 A;  2A4N A;  1Y9K A;  5F49 A;  1YGH A;  2JLM A;  3B8G A;  4YRH A;  1XIX A;  4JXR A;  2B4D B;  4KVM E;  2VEZ A;  1J4J A;  1P0H A;  1R57 A;  1K4J A;  2JDC A;  2QEC A;  2AE6 A;  3R9E A;  3S6H A;  3OWC A;  3I9S A;  2REE A;  3DR6 A;  2Q4V A;  5JPH A;  2Z10 A;  4E2A A;  4R3L A;  3TO7 A;  4KOY A;  4KOS A;  2B3U A;  3FIX A;  3S6K A;  1M44 A;  1GHE A;  3N7Z A;  2GE3 A;  5KTC A;  2EVN A;  1ON0 A;  2BL1 A;  3BJ7 A;  4J3G A;  3SXO A;  2RC4 A;  1M4I A;  2FIW A;  2R7H A;  1NE9 A;  3LD2 A;  3R9G A;  5ISV A;  2DXQ A;  2PQ8 A;  3R95 A;  3JUW A;  4MY0 A;  4PSW A;  2D4O A;  2FT0 A;  4KVO E;  2VZY A;  4UA3 A;  2ZW6 A;  4JJX A;  2JDD A;  1S5K A;  3D2M A;  1MJB A;  4XPK A;  5JQ4 A;  2EUI A;  2C27 A;  3P2F A;  2VZZ A;  3W6S A;  1MK4 A;  3RYO A;  2ZXV A;  2K5T A;  4UWI A;  1BOB A;  5KTD A;  4YFJ A;  2Q04 A;  2B5G A;  3I3G A;  3PP9 A;  3D8P A;  4R9M A;  3K9U A;  1Q2D A;  2KCW A;  4PK3 A;  3S6G A;  2REF A;  1LRZ A;  5J8F A;  4II9 A;  4L89 A;  1I21 A;  4B5P A;  1XMT A;  1CM0 A;  1MJA A;  4NCZ A;  2F5I A;  3TE4 A;  4MBU A;  4R57 A;  1Q2Y A;  3UY5 A;  2WPX A;  2CNS A;  1Z4R A;  3FNC A;  3FBU A;  4KOR A;  4QC6 A;  3TCV A;  4QB9 A;  2VBQ A;  1S60 A;  2B4B A;  4CS0 B;  4OAE A;  3JVN A;  4F6A A;  3SHP A;  3CXP A;  3T9Y A;  1QSR A;  4QUS A;  3G3S A;  2JEV A;  5KTA A;  2P6F A;  4NXY A;  2OB0 A;  3G8W A;  3TO6 A;  2CY2 A;  2PR1 A;  4UWJ A;  4NEX A;  3FXT A;  3W91 A;  5FVJ A; 
#chains in the Genus database with same CATH topology
 2BOA A;  3CDX A;  4UEZ A;  3BI1 A;  3VH9 A;  4AVB A;  4HNW B;  3TOB A;  3EC4 A;  4ZI6 A;  3DR8 A;  3A9L A;  4X2T A;  1BPM A;  4AG9 A;  3L2N A;  1TKF A;  4OLL A;  3KQX A;  4W9Y A;  4WWV A;  2O53 A;  2EBJ A;  3PFE A;  4JLY A;  4E0A A;  4BBH A;  4U5Y A;  1L0C A;  2FSR A;  2ZED A;  3PB7 X;  4P10 A;  4Q38 A;  3HLP A;  2P0W A;  3IEH A;  2CNM A;  4UEE A;  2ZEP A;  4CAV A;  1N71 A;  3BHX A;  1Y7E A;  3DGV A;  2V77 A;  5JGF A;  1HDU A;  2B4D A;  3QB8 A;  4X8I A;  4IK2 A;  1M4G A;  2B3V A;  4K30 A;  4UIB A;  3TC8 A;  3D7H A;  3DSB A;  4AB7 A;  3B3V A;  3TFY A;  1I1D A;  2BCO A;  5J8C A;  4R6T A;  1NSL A;  1PUA A;  3SI2 A;  2PJ5 A;  3SJG A;  4P44 A;  2ZEN A;  5K8P A;  3IWW A;  4K3N A;  4NGT A;  4DYO A;  1ARL A;  1IOF A;  2PDO A;  2YNE A;  3F5B A;  4F9V A;  4HKF A;  2YGW A;  4LUA A;  4FD5 A;  4P4B A;  4P45 A;  3GB0 A;  4JXQ A;  3IGR A;  4ZBG A;  2WUU A;  2DF5 A;  2FXF A;  2ZEM A;  2PCU A;  4IAV A;  2C6P A;  2ZW5 A;  3QAH A;  5F47 A;  2QJ8 A;  4JZ0 A;  5G21 A;  4OIW A;  3NA6 A;  3KGQ A;  4DNC A;  2EK9 A;  2PJ7 A;  4L8A A;  2BO9 A;  1A2Z A;  2GFQ A;  5JH9 A;  2FIA A;  4C2Y A;  2ARH A;  2G3T A;  2Z3L A;  4RUH A;  5H84 A;  3IIB A;  5E96 A;  1LAN A;  4QBJ A;  5A28 A;  1KUY A;  1XOV A;  3ISZ A;  4BMH A;  2PJ0 A;  2ATR A;  4NSQ A;  3FF3 A;  5JM6 A;  4FBE A;  3QAY A;  4CGP A;  1ELL P;  3FJU A;  3TOA A;  2X7B A;  4EME A;  2P6G A;  3VAT A;  1Z8W A;  2OOT A;  3T90 A;  3LWU A;  1RXT A;  1M4L A;  2V8V A;  2VXK A;  2ZEH A;  3CZX A;  3D67 A;  3ISX A;  1VIX A;  2B5G B;  1UWY A;  5IX3 A;  4GM5 A;  3MGD A;  4LQG A;  4XPL A;  3GKR A;  4CPA A;  1Q2C A;  2HQY A;  3PBE A;  2ODF A;  1FT7 A;  2RFH A;  2WYR A;  4FD4 A;  4NFR A;  5EMI A;  4RI1 A;  1IOI A;  4OC1 A;  2HV2 A;  4H6U A;  3KL9 A;  5DWN A;  4CGL A;  3F0A A;  1F2P A;  3B2Y A;  4E8O A;  3GYA A;  2PIY A;  4MFP A;  5LRG A;  1WK4 A;  5F48 A;  3I1U A;  1YK3 A;  1Z2L A;  3CXQ A;  5DWM A;  4B12 A;  1M4D A;  1V0C A;  5C82 A;  3BXM A;  2J8M A;  4PXC A;  1CJW A;  2I79 A;  4R3K A;  4NJQ A;  4CGM A;  1Z5R A;  2B58 A;  4ONW A;  3SI1 A;  1IGB A;  1OBR A;  4FAI A;  3GY9 A;  1YW4 A;  2WSA A;  3IC1 A;  4A94 A;  3H8F A;  2J8R A;  3FX6 A;  4TNU A;  2HUZ A;  1NMT A;  4JYW A;  4NGR A;  1IID A;  2IQ6 A;  4IF5 A;  1LAM A;  1GYT A;  2C6G A;  1Z8X A;  4MHP A;  5K8N A;  1SQH A;  4C68 A;  1Y9W A;  2G9D A;  2Q44 A;  2R8V A;  4WJB A;  3V8I A;  1S7F A;  4KLW A;  1JQG A;  2OZH A;  3EO4 A;  2PJC A;  4NF1 A;  4KZT A;  5LRK A;  5HMN A;  2Q0Y A;  4CYO A;  3H8G A;  2GLJ A;  4MMO A;  3W6X A;  2V8D A;  2GIV A;  3EFA A;  4M6H A;  4B14 A;  2NMT A;  1DTD A;  3BI0 A;  1X10 A;  4OC0 A;  3F8K A;  2ZEL A;  4P4I A;  2YNC C;  2POK A;  1R43 A;  1U6M A;  3C26 A;  4KOV A;  1OZP A;  2XEG A;  1BPN A;  1IIC A;  1P4N A;  4ZX8 A;  4C7H A;  2G0B A;  5HVH A;  4UFX A;  5HVF A;  1ARM A;  1IY7 A;  1PU9 A;  2NSM A;  2PJ9 A;  3FYN A;  4H6Z A;  3EXN A;  2O4H A;  3D4U A;  4CYQ A;  1Z8L A;  4R87 A;  4KOW A;  3TT2 A;  3IFE A;  6CPA A;  1S3Z A;  3VWE A;  2CXA A;  4UBR A;  1ZO0 A;  4KOX A;  4Y49 C;  4Y49 B;  3R9F A;  4FUU A;  2OZU A;  4KSI A;  1B6B A;  3KQZ A;  2JBJ A;  2C6C A;  2QML A;  4MHY A;  3SI0 A;  5J1Q A;  1TKH A;  3KR5 A;  4B11 A;  4OC2 A;  4CGO A;  4XPD C;  3D66 A;  4XPD B;  4I49 A;  2FCK A;  2Z11 A;  3NE7 A;  4EVY A;  2ZEF A;  4O23 A;  2G3A A;  2P6E A;  3GIU A;  4PSX A;  3WC5 A;  2Z3O A;  2IL4 A;  1BO4 A;  2Y0M A;  2WPW A;  1VKC A;  2ZOG A;  2JBK A;  4GS4 A;  3WC7 A;  3ZZI A;  1LOK A;  2VI7 A;  3PZJ A;  2Q43 A;  1YVO A;  3KKW A;  2V8G A;  5G20 A;  3NE8 A;  3PGP A;  3S9M A;  1YX0 A;  4OC3 A;  3PFO A;  1TXR A;  4DJL A;  2FE7 A;  2R1I A;  2ZEG A;  3FH4 A;  4AXV A;  2OR4 A;  5HH1 A;  4B13 A;  2Z3P A;  3H4Q A;  1ZLH A;  5BWA B;  4F0Y A;  5IV0 A;  1LAP A;  1B87 A;  1KZF A;  2AFO A;  4A39 A;  4QVT A;  4UIA A;  2PJ2 A;  3S9L A;  3V38 A;  1XMB A;  3IWG A;  4OME A;  2DPS A;  2H5M A;  3DNS A;  1YVK A;  1TF8 A;  4MHZ A;  3H8E A;  5CNP A;  4CAX A;  2PJ8 A;  4HNY B;  2OZG A;  3S6F A;  4HNX B;  4KS9 A;  1VHO A;  4KOT A;  3BJ8 A;  4A37 A;  1ELM P;  1FNO A;  4MCQ A;  2FS5 A;  3D2P A;  4MXU A;  4OC4 A;  4KVX A;  3R1K A;  3JTK A;  4LX9 A;  4ONU A;  4PK2 A;  1M1D A;  1CX8 A;  3CPX A;  1IYK A;  1TKJ A;  2FL4 A;  4YGO A;  1HEE A;  1MJ9 A;  4U9Y A;  2CIJ A;  3SJF A;  4B10 A;  1WWZ A;  4M3S A;  1XE4 A;  8CPA A;  4CRY B;  4RS2 A;  3KR4 A;  3BLN A;  1VHS A;  4GXH A;  4M6G A;  2DEA A;  2Q7S A;  5LYL A;  1YR0 A;  1CPS A;  1RO5 A;  3QNV A;  3CPA A;  3SXN A;  2XEI A;  1LFW A;  3N5F A;  2VL1 A;  1QST A;  4FD7 A;  2VQY A;  3FEE A;  3EY5 A;  4ZY0 A;  2PJ4 A;  3DDD A;  4FWU A;  4CRZ B;  2D4P A;  3RNZ A;  3FRM A;  4UFW A;  1XEB A;  1QQ9 A;  2OU2 A;  4NJR A;  2BUE A;  2QIR A;  4G1P A;  1AMP A;  4MI4 A;  4PQA A;  3LOD A;  1QSO A;  4UCM A;  4U9Z A;  2HC9 A;  4XNH B;  4XNH C;  2R98 A;  2AFU A;  4IUS A;  4ZGY B;  3KAS A;  4AVC A;  1S7L A;  1ZG7 A;  1YLE A;  4Q7A A;  2I00 A;  2ZW7 A;  4NGQ A;  3P2H A;  4A38 A;  2J8N A;  4MHN A;  4KLV A;  4B5P B;  3PB6 X;  4MJ8 A;  2Q4Y A;  3LAC A;  1Z4E A;  5AG6 A;  5HXD A;  3FB3 A;  2I3C A;  1IB1 E;  2PVW A;  3WR7 A;  2PC1 A;  3WC6 A;  1TF9 A;  2GAN A;  1Z8T A;  3D3S A;  3K2K A;  3JRU A;  2ABZ A;  5H86 A;  4AVA A;  4CAW A;  3VAR A;  4C2X A;  2ZW4 A;  5I4M A;  3SJE A;  1AUG A;  3FVL A;  4M85 A;  1KUV A;  4JWP A;  5G22 A;  3ZJ0 A;  1UFH A;  3CT9 A;  4H89 A;  4MHD A;  2OH1 A;  2XEF A;  4A31 A;  5G1Z A;  1AYE A;  1S7N A;  4FD6 A;  5LYI A;  5EC4 A;  4F0X A;  2AJ6 A;  2PSW A;  2F8H A;  3CXS A;  5C88 A;  1ZG9 A;  1CBX A;  3E0K A;  5I0C A;  3B35 A;  2ZPA A;  4PV6 A;  3D68 A;  3R96 A;  5GCN A;  2BSW A;  2IMO A;  2C1C A;  3HUV A;  1YRE A;  5LYF A;  1YW6 A;  1XF8 A;  3LMS A;  1PCA A;  2WZN A;  4JD6 A;  3VWD A;  1QSN A;  3PB4 X;  4P4J A;  2V8H A;  4B5O A;  4ORF A;  1Z9U A;  5D8N A;  1QSM A;  2PR8 A;  4OAD A;  1YME A;  4PXE A;  5AG7 A;  5EBV A;  3RAM A;  7CPA A;  1RTQ A;  4OID A;  5F46 A;  5IB0 A;  2YND A;  2O28 A;  1I12 A;  3KZW A;  4A95 A;  3IU2 A;  1X12 A;  4CYP A;  4X5K A;  3KHZ A;  2GLF A;  3TX8 A;  4EFD A;  2GRE A;  2PRB A;  3MRU A;  4YWY A;  3TO9 A;  1FY7 A;  3NFZ A;  4F8Z A;  2Q7B A;  1KUX A;  4KUA A;  3PEI A;  1TIQ A;  4KOU A;  2Z0Z A;  5AG4 A;  2XEJ A;  3KHX A;  1S7K A;  4NGS A;  3RZA A;  4X3R A;  2Q51 A;  2YNC A;  3K9T A;  1Y7R A;  2PIZ A;  4KUB A;  2BEI A;  3DLJ A;  4PXD A;  5THW A;  4DUK A;  4MY3 A;  3SJX A;  2CNT A;  3TTH A;  1IYL A;  4UCP A;  4MCS A;  4AG7 A;  3KI9 A;  2PJA A;  2A4N A;  1Y9K A;  4MCP A;  5F49 A;  1YGH A;  2F7V A;  4UEF A;  4CGN A;  2JLM A;  1Y0R A;  1ZG8 A;  2PJB A;  2RB7 A;  3B8G A;  4YRH A;  1XIX A;  3PB9 X;  4MFQ A;  4JXR A;  2Z3M A;  2B4D B;  4YU9 A;  4NGN A;  4KVM E;  2VEZ A;  4F9U A;  2ZEO A;  1J4J A;  4PPZ A;  1P0H A;  5AG5 A;  1R57 A;  1K4J A;  3D7G A;  2JDC A;  1VHE A;  3GUX A;  2QEC A;  2AE6 A;  3R9E A;  4MFK A;  4TWE A;  3S6H A;  3D7F A;  3WT4 A;  4HPS A;  3OWC A;  3I9S A;  1YSJ A;  2REE A;  2Q4Z A;  2Z3N A;  3DR6 A;  2Q4V A;  2JEW A;  3PBB A;  4EWT A;  5JPH A;  1NSA A;  2Z10 A;  3D7D A;  4MRI A;  4OC5 A;  5A27 A;  4R7M A;  4E2A A;  4CAF A;  1F57 A;  4R3L A;  3TO7 A;  4KOY A;  4KOS A;  3B3T A;  2B3U A;  3FIX A;  2NYQ A;  3RO0 A;  3S6K A;  3NH8 A;  4BD9 A;  1M44 A;  1GHE A;  2FVG A;  3N7Z A;  1PYT B;  1BLL E;  2GE3 A;  5KTC A;  2EK8 A;  2EVN A;  2HB6 A;  1ON0 A;  2BL1 A;  1HDQ A;  4KSF A;  4NGP A;  3BJ7 A;  4J3G A;  3SXO A;  3FMC A;  2RC4 A;  5LYD A;  1M4I A;  4MCR A;  1CPX A;  2GU2 A;  4RN7 A;  2FIW A;  2R7H A;  5LRJ A;  1NE9 A;  2PRQ A;  3B3W A;  4NGM A;  3LD2 A;  3R9G A;  3IO1 A;  5ISV A;  2DXQ A;  4R76 A;  2PQ8 A;  2PJ3 A;  1JWQ A;  3R95 A;  4ZY1 A;  3JUW A;  2AFX A;  4MFL A;  1XFO A;  1CP6 A;  2AFM A;  2CF4 A;  3IJ3 A;  1Q7L A;  4MY0 A;  4PSW A;  4ZX9 A;  2D4O A;  2FT0 A;  5K8M A;  2EO8 A;  4KVO E;  3MN8 A;  5AGE A;  4CYN A;  5HVG A;  4B6Z A;  1XRY A;  1XBU A;  2VZY A;  4UA3 A;  3GLJ A;  2ZW6 A;  4Z65 A;  4UFV A;  2AFS A;  4JJX A;  3WAB A;  2JDD A;  1S5K A;  4UCN A;  3D2M A;  1CP7 A;  1R3N A;  1ZLI A;  4CAE A;  3H5Z A;  1MJB A;  1BAV A;  4XPK A;  3S9N A;  5JQ4 A;  2EUI A;  3NH5 A;  2C27 A;  1H8L A;  3P2F A;  5ELY A;  2VZZ A;  3W6S A;  2AFZ A;  4A30 A;  1MK4 A;  3RYO A;  2ZXV A;  3B3S A;  2K5T A;  4KSA A;  2QYV A;  4UWI A;  1BOB A;  5KTD A;  3RBU A;  4BIN A;  4YFJ A;  4H2K A;  2Q04 A;  5CBM A;  2B5G A;  3I3G A;  3PP9 A;  2J9A A;  1CG2 A;  1VGY A;  4UF4 A;  3D8P A;  4R9M A;  1Y0Y A;  3K9U A;  1Q2D A;  3B3C A;  4R8F A;  1XJO A;  2KCW A;  4PK3 A;  3S6G A;  3V7Z A;  2REF A;  5IB9 A;  5K8O A;  1F2O A;  1LRZ A;  2PVV A;  4ZYQ A;  1IU8 A;  4OKO A;  5J8F A;  4II9 A;  4L89 A;  2CTB A;  1I21 A;  4A33 A;  2ANP A;  4B5P A;  1XMT A;  1CM0 A;  1MJA A;  4MFJ A;  4NCZ A;  1YQE A;  3IWE A;  1YLO A;  2EWB A;  2CTC A;  2F5I A;  4ZY2 A;  4P4F A;  3TE4 A;  4MBU A;  4R57 A;  1KWM A;  1Q2Y A;  2ZEE A;  2ZOF A;  3FEC A;  4P4E A;  5F09 A;  3PB8 X;  4Q36 A;  3NH4 A;  3UY5 A;  2WPX A;  1DE4 C;  2DPT A;  3FED A;  4A32 A;  2CNS A;  1Z4R A;  4LQ6 A;  3FNC A;  3FBU A;  4KOR A;  2PE3 A;  4QC6 A;  1QMU A;  3IU1 A;  3TCV A;  4PXB A;  4QB9 A;  4C7I A;  2VBQ A;  4OP4 A;  5CPA A;  1S60 A;  2B4B A;  4M6I A;  4CS0 B;  4OAE A;  1EE3 P;  3T8W A;  3JVN A;  4F6A A;  3SHP A;  4C2Z A;  3CXP A;  2Z3K A;  2QVP A;  2PJ6 A;  3T9Y A;  1QSR A;  4QUS A;  5DS0 A;  2AFW A;  3B7I A;  3G3S A;  2JEV A;  5KTA A;  2P6F A;  4P4D A;  4NXY A;  4A2Z A;  2OB0 A;  3G8W A;  4P6Y A;  3TO6 A;  2CY2 A;  2PR1 A;  2IJZ A;  4UWJ A;  4MFZ A;  4NEX A;  3FXT A;  3W91 A;  1LCP A;  5D29 A;  2PJ1 A;  5FVJ A;  3PRT A;  4IHM A; 
#chains in the Genus database with same CATH homology
 4AVB A;  4HNW B;  3TOB A;  3EC4 A;  3DR8 A;  3A9L A;  4AG9 A;  4OLL A;  4JLY A;  4E0A A;  4BBH A;  4U5Y A;  1L0C A;  2FSR A;  4Q38 A;  2P0W A;  2CNM A;  4CAV A;  1N71 A;  3QB8 A;  2B4D A;  1M4G A;  2B3V A;  4K30 A;  3DSB A;  4AB7 A;  3TFY A;  1I1D A;  5J8C A;  1NSL A;  1PUA A;  2PDO A;  2YNE A;  3F5B A;  4HKF A;  2YGW A;  4LUA A;  4FD5 A;  4JXQ A;  3IGR A;  4ZBG A;  2WUU A;  2FXF A;  2ZW5 A;  3QAH A;  5F47 A;  5G21 A;  4DNC A;  4L8A A;  2FIA A;  4C2Y A;  2ARH A;  2G3T A;  2Z3L A;  5H84 A;  5E96 A;  4QBJ A;  5A28 A;  1KUY A;  4BMH A;  2ATR A;  4NSQ A;  4CGP A;  3TOA A;  2X7B A;  2P6G A;  3T90 A;  1RXT A;  2VXK A;  5IX3 A;  2B5G B;  3MGD A;  4XPL A;  3GKR A;  1Q2C A;  2HQY A;  4FD4 A;  4CYQ A;  4RI1 A;  5DWN A;  4CGL A;  2HV2 A;  4H6U A;  3F0A A;  4E8O A;  3GYA A;  4MFP A;  1WK4 A;  5F48 A;  1YK3 A;  5DWM A;  3CXQ A;  4B12 A;  5C82 A;  1M4D A;  1V0C A;  2J8M A;  1CJW A;  2I79 A;  4R3K A;  4CGM A;  2B58 A;  3GY9 A;  2WSA A;  2J8R A;  2HUZ A;  1NMT A;  1IID A;  4IF5 A;  1SQH A;  4C68 A;  1Y9W A;  2Q44 A;  2R8V A;  3V8I A;  1S7F A;  4KLW A;  4NF1 A;  2OZH A;  3EO4 A;  4KZT A;  5HMN A;  2Q0Y A;  4CYO A;  3W6X A;  2GIV A;  3EFA A;  4B14 A;  2NMT A;  3F8K A;  2YNC C;  3C26 A;  1U6M A;  4C7H A;  4KOV A;  1OZP A;  1IIC A;  1P4N A;  2G0B A;  4UFX A;  1PU9 A;  3FYN A;  4H6Z A;  3EXN A;  4R87 A;  4KOW A;  3TT2 A;  1S3Z A;  3VWE A;  2CXA A;  4UBR A;  1ZO0 A;  4KOX A;  4Y49 C;  4Y49 B;  3R9F A;  2OZU A;  1B6B A;  2QML A;  4B11 A;  4CGO A;  4XPD C;  4XPD B;  4I49 A;  2FCK A;  2Z11 A;  3NE7 A;  4EVY A;  2G3A A;  2P6E A;  4PSX A;  2Z3O A;  2IL4 A;  1BO4 A;  2Y0M A;  2WPW A;  1VKC A;  4GS4 A;  3ZZI A;  2VI7 A;  3PZJ A;  1YVO A;  3KKW A;  5G20 A;  3PGP A;  1YX0 A;  2FE7 A;  2R1I A;  4B13 A;  5HH1 A;  2Z3P A;  3H4Q A;  5BWA B;  4F0Y A;  5IV0 A;  1B87 A;  1KZF A;  4QVT A;  3IWG A;  2DPS A;  2H5M A;  3DNS A;  1YVK A;  5CNP A;  4CAX A;  4HNY B;  2OZG A;  3S6F A;  4HNX B;  4KS9 A;  4KOT A;  3BJ8 A;  2FS5 A;  3D2P A;  4KVX A;  3R1K A;  3JTK A;  4LX9 A;  4ONU A;  4PK2 A;  1M1D A;  1IYK A;  2FL4 A;  4YGO A;  1MJ9 A;  4U9Y A;  4B10 A;  1WWZ A;  4M3S A;  1XE4 A;  4CRY B;  4RS2 A;  3BLN A;  1VHS A;  1YR0 A;  1RO5 A;  3SXN A;  1QST A;  4FD7 A;  2VQY A;  3EY5 A;  3DDD A;  4CRZ B;  2D4P A;  3FRM A;  4UFW A;  1XEB A;  2OU2 A;  2BUE A;  2QIR A;  4MI4 A;  3LOD A;  1QSO A;  4UCM A;  4U9Z A;  4XNH C;  4XNH B;  2R98 A;  4IUS A;  4ZGY B;  4AVC A;  1S7L A;  1YLE A;  2I00 A;  2ZW7 A;  3P2H A;  2J8N A;  4KLV A;  4B5P B;  4MJ8 A;  2Q4Y A;  1Z4E A;  5AG6 A;  3FB3 A;  1IB1 E;  3WR7 A;  2PC1 A;  2GAN A;  3D3S A;  5H86 A;  4AVA A;  4CAW A;  4C2X A;  2ZW4 A;  4M85 A;  1KUV A;  4JWP A;  5G22 A;  3ZJ0 A;  1UFH A;  4H89 A;  4MHD A;  2OH1 A;  4A31 A;  5G1Z A;  1S7N A;  4FD6 A;  4F0X A;  5EC4 A;  2AJ6 A;  2PSW A;  5I0C A;  3CXS A;  5C88 A;  3E0K A;  2ZPA A;  4PV6 A;  3R96 A;  5GCN A;  2BSW A;  1YRE A;  1XF8 A;  4JD6 A;  3VWD A;  1QSN A;  4B5O A;  4ORF A;  1Z9U A;  1QSM A;  2PR8 A;  4OAD A;  5AG7 A;  5EBV A;  5IB0 A;  5F46 A;  2YND A;  2O28 A;  1I12 A;  4A95 A;  4CYP A;  3IU2 A;  4X5K A;  2PRB A;  3TO9 A;  1FY7 A;  2Q7B A;  1KUX A;  4KUA A;  5AG4 A;  1TIQ A;  4KOU A;  2Z0Z A;  1S7K A;  2YNC A;  1Y7R A;  4KUB A;  2BEI A;  4MY3 A;  2CNT A;  3TTH A;  1IYL A;  4UCP A;  4AG7 A;  2A4N A;  1Y9K A;  5F49 A;  4CGN A;  1YGH A;  2JLM A;  3B8G A;  4YRH A;  1XIX A;  4MFQ A;  4JXR A;  2Z3M A;  2B4D B;  4KVM E;  2VEZ A;  1J4J A;  1P0H A;  5AG5 A;  1R57 A;  1K4J A;  2JDC A;  2QEC A;  2AE6 A;  3R9E A;  4MFK A;  3S6H A;  3OWC A;  3I9S A;  2REE A;  2Z3N A;  3DR6 A;  2Q4V A;  5JPH A;  2Z10 A;  5A27 A;  4E2A A;  4CAF A;  4R3L A;  3TO7 A;  4KOY A;  4KOS A;  2B3U A;  3FIX A;  3S6K A;  1M44 A;  1GHE A;  3N7Z A;  2GE3 A;  5KTC A;  2EVN A;  1ON0 A;  2BL1 A;  4KSF A;  3BJ7 A;  4J3G A;  3SXO A;  2RC4 A;  1M4I A;  2FIW A;  2R7H A;  1NE9 A;  3LD2 A;  3R9G A;  5ISV A;  2DXQ A;  2PQ8 A;  3R95 A;  3JUW A;  4MFL A;  4MY0 A;  4PSW A;  2D4O A;  2FT0 A;  4KVO E;  5AGE A;  4CYN A;  2VZY A;  4UA3 A;  2ZW6 A;  4UFV A;  4JJX A;  2JDD A;  1S5K A;  4UCN A;  3D2M A;  4CAE A;  3H5Z A;  1MJB A;  4XPK A;  5JQ4 A;  2EUI A;  2C27 A;  3P2F A;  2VZZ A;  3W6S A;  4A30 A;  1MK4 A;  3RYO A;  2ZXV A;  2K5T A;  4KSA A;  4UWI A;  1BOB A;  5KTD A;  4YFJ A;  2Q04 A;  2B5G A;  3I3G A;  3PP9 A;  3D8P A;  4R9M A;  3K9U A;  1Q2D A;  2KCW A;  4PK3 A;  3S6G A;  2REF A;  1LRZ A;  5J8F A;  4II9 A;  4L89 A;  1I21 A;  4A33 A;  4B5P A;  1XMT A;  1CM0 A;  1MJA A;  4MFJ A;  4NCZ A;  3IWE A;  2F5I A;  3TE4 A;  4MBU A;  4R57 A;  1Q2Y A;  4Q36 A;  3UY5 A;  2WPX A;  2DPT A;  4A32 A;  2CNS A;  1Z4R A;  3FNC A;  3FBU A;  4KOR A;  4QC6 A;  3IU1 A;  3TCV A;  4QB9 A;  4C7I A;  2VBQ A;  1S60 A;  2B4B A;  4CS0 B;  4OAE A;  3JVN A;  4F6A A;  3SHP A;  4C2Z A;  3CXP A;  2Z3K A;  3T9Y A;  1QSR A;  4QUS A;  3G3S A;  2JEV A;  5KTA A;  2P6F A;  4NXY A;  4A2Z A;  2OB0 A;  3G8W A;  3TO6 A;  2CY2 A;  2PR1 A;  4UWJ A;  4MFZ A;  4NEX A;  3FXT A;  3W91 A;  5FVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...