3G3SA

Crystal structure of gcn5-related n-acetyltransferase-like protein (zp_00874857) (zp_00874857.1) from streptococcus suis 89/1591 at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
GMAEQMRRVARLFGDWPETIIWTCLEGTMGDIYVDDSQSPQSALALYGRQSFFGFLAGQPHRDLLKICEGKNIILVPQNQAWSDLIEEVYGDGVRFFTRYATKKDTEFDLGHLQKLVDDLPESFDMKLIDRNLYETCLVEEWSRDLVGNYIDVEQFLDLGLGCVILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDAHTLTSLKLAEKLGYELDKAYQAYEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
publication title Crystal structure of GCN5-related N-acetyltransferase-like protein (ZP_00874857) (ZP_00874857.1) from Streptococcus suis 89/1591 at 1.80 A resolution
rcsb
source organism Streptococcus suis
total genus 82
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA02
3.40.630.110 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA01
5C88A 3IGRA 2FE7A 1QSRA 3LD2A 1YREA 2QECA 3PZJA 4H6ZA 2VQYA 4XNHB 3SXOA 2ARHA 3F5BA 4R9MA 2OU2A 1KUVA 1PU9A 1I21A 2B5GB 3MGDA 3VWDA 3P2FA 1B6BA 2B3VA 3OWCA 2FT0A 2OZHA 4F6AA 1SQHA 2FCKA 4H89A 2FSRA 4B5PB 3S6FA 4KOXA 4H6UA 4AVBA 2R98A 2B4DB 3S6HA 2ZPAA 2QMLA 3CXQA 3EO4A 1M44A 3N7ZA 4FD4A 3FBUA 4JLYA 4PK2A 1NSLA 2WPXA 3TTHA 2NMTA 3RYOA 4MHDA 2A4NA 1U6MA 4B5OA 4IF5A 4U9YA 2REFA 4CRZB 2CNTA 4NEXA 4MBUA 4PK3A 4ONUA 2B4BA 5H84A 4E8OA 3PP9A 1YGHA 1Z4EA 5IV0A 4OADA 4MJ8A 1WK4A 3I9SA 4OLLA 3QB8A 2Z10A 2GE3A 5KTDA 1M4GA 1XMTA 5JPHA 5FVJA 4KOVA 1QSMA 4HKFA 3B8GA 3IWGA 4YRHA 4EVYA 1XF8A 1YVKA 2Y0MA 1S5KA 5ISVA 3EY5A 3GY9A 4KOYA 2Q4YA 4AVAA 2ZXVA 4FD5A 3DSBA 2FL4A 1XE4A 2ZW6A 3UY5A 4QC6A 4MY3A 5IB0A 5F46A 4L89A 4KLWA 4II9A 4E2AA 2CY2A 3K9UA 2P0WA 2JEVA 4AVCA 1MJAA 1TIQA 1MJ9A 2R7HA 2I79A 1YR0A 1IIDA 4PSXA 2WPWA 1M1DA 1XIXA 2FIAA 2EUIA 4CAXA 4AB7A 1KZFA 5HH1A 2BL1A 2RC4A 5I0CA 4KVOE 4JXRA 2ATRA 4LX9A 4JWPA 1MJBA 2VI7A 5DWNA 2PR8A 4ORFA 2Z11A 1VKCA 2OB0A 3EXNA 2GANA 2J8MA 2EVNA 2O28A 3SXNA 1XEBA 5JQ4A 5F48A 4MI4A 3I3GA 2VZZA 2AJ6A 1VHSA 1Z9UA 4XPDB 3CXSA 1KUYA 3E0KA 2VEZA 1OZPA 5IX3A 3ZZIA 1Z4RA 4CAVA 2OH1A 4U9ZA 1RO5A 4FD6A 4K30A 1Y9KA 2B58A 2HUZA 1L0CA 3EFAA 3R9FA 2QIRA 4RI1A 2Z0ZA 3GYAA 2B3UA 4YGOA 1S7LA 3D2MA 5KTCA 3TOBA 4MY0A 4XNHC 1R57A 2Q44A 2VXKA 2Q0YA 4UWIA 2B5GA 2J8RA 4NF1A 1S3ZA 3R1KA 1BO4A 4JD6A 5KTAA 4XPLA 1GHEA 3JVNA 4KORA 3EC4A 4B5PA 1B87A 1I12A 3KKWA 4HNWB 3ZJ0A 1N71A 2JLMA 3D2PA 2I00A 2Q04A 2BSWA 3V8IA 3BLNA 4U5YA 3WR7A 1IYKA 3PGPA 2J8NA 5C82A 4HNXB 4R87A 4CS0B 3R96A 3S6KA 4OAEA 3TFYA 1YK3A 3D3SA 4XPKA 3DR6A 3F0AA 2D4OA 2FXFA 1PUAA 4F0YA 2PC1A 4ZBGA 4LUAA 2K5TA 1NMTA 4PSWA 4IUSA 5F47A 3R9EA 1Q2YA 1S7FA 4KZTA 4J3GA 2R1IA 3FYNA 4CAWA 2G0BA 3W6SA 1LRZA 1I1DA 3W6XA 2H5MA 3P2HA 5E96A 4JXQA 1QSOA 5CNPA 1CM0A 3JUWA 2D4PA 3TT2A 4M3SA 1FY7A 3S6GA 1J4JA 5EBVA 1IB1E 4KOSA 2ZW7A 4QBJA 3FIXA 4QVTA 4KOUA 2DXQA 2PR1A 4M85A 2P6EA 3TO7A 2Q7BA 4AG9A 5J8FA 5EC4A 4RS2A 1Y7RA 4JJXA 1P0HA 1CJWA 1IICA 3H4QA 2REEA 4QB9A 3DDDA 2AE6A 2P6FA 4BMHA 4NCZA 4Y49C 3TOAA 2G3AA 5GCNA 4I49A 1S60A 2JDDA 2P6GA 3QAHA 1BOBA 1NE9A 4QUSA 3BJ7A 2Q4VA 3DR8A 1Y9WA 5HMNA 4L8AA 4AG7A 3F8KA 4R3KA 2FS5A 2HV2A 4CRYB 2CNMA 3TO9A 3TE4A 1K4JA 1ON0A 3G8WA 2C27A 1M4DA 2BUEA 1QSNA 2GIVA 2IL4A 4KVXA 2F5IA 1P4NA 2B4DA 3FB3A 1YVOA 2VZYA 4GS4A 2OZUA 3SHPA 5J8CA 4XPDC 1KUXA 1IYLA 3G3SA 3VWEA 1WWZA 2ZW4A 4UBRA 3W91A 1RXTA 4X5KA 4UWJA 4UA3A 3R95A 1Q2DA 4KUBA 1S7KA 4NSQA 2PDOA 2VBQA 4E0AA 3CXPA 2BEIA 2G3TA 5DWMA 1Q2CA 3FNCA 4FD7A 4NXYA 3T90A 1V0CA 1UFHA 1YLEA 1QSTA 3TCVA 2JDCA 3GKRA 4R3LA 2PRBA 4R57A 3D8PA 4KVME 2KCWA 2FIWA 5H86A 2ZW5A 2X7BA 4HNYB 1M4IA 4KLVA 2PQ8A 1S7NA 1YX0A 3BJ8A 4KOTA 3T9YA 2CNSA 3TO6A 3LODA 3C26A 4PV6A 3R9GA 4KUAA 4DNCA 2PSWA 4KOWA 3DNSA 3FRMA 2HQYA 4YFJA 1MK4A 2OZGA 2R8VA 5F49A 3NE7A 4Y49B 3FXTA
chains in the Genus database with same CATH superfamily
5C88A 3IGRA 2ZELA 1ELMP 4A95A 2FE7A 4X8IA 1QSRA 1Z2LA 3LD2A 2AFMA 1YREA 2QECA 3PZJA 4H6ZA 4M6HA 4CYOA 2VQYA 4OMEA 4XNHB 3SXOA 3V38A 4CGPA 1LOKA 2ARHA 2EBJA 3PB7X 4ZY1A 3F5BA 2DPSA 5DS0A 5D8NA 4CGNA 4R9MA 1ELLP 2HB6A 4B12A 2C6CA 2OU2A 1KUVA 1PU9A 5I4MA 1I21A 4B6ZA 2B5GB 1JQGA 3MGDA 3PB9X 3VWDA 4UFXA 3P2FA 2DEAA 2GLFA 1B6BA 3IWWA 2B3VA 4YU9A 3SI1A 2YGWA 4MFJA 4W9YA 3OWCA 2FT0A 2OZHA 4MCQA 4F6AA 2IMOA 5AG6A 4CGMA 1SQHA 2FCKA 4H89A 4F9VA 2FSRA 1QMUA 4B5PB 4KS9A 3S6FA 5HVFA 4H6UA 4KOXA 2C6PA 4CGLA 4P4JA 4PXDA 2WUUA 3JTKA 4MHZA 4A38A 4AVBA 2R98A 2B4DB 3S6HA 2ZPAA 2Q43A 2QMLA 3CXQA 4P4IA 3EO4A 1LAMA 1M44A 3N7ZA 2CTCA 4FD4A 1Z5RA 3FBUA 4BD9A 3GB0A 4CPAA 4MRIA 5F09A 1AYEA 4JLYA 4MCSA 4P44A 4PQAA 1RTQA 5JM6A 4PK2A 1NSLA 5AG7A 2WPXA 2XEFA 3H8GA 2EO8A 3TTHA 2NMTA 3RYOA 4MHDA 2A4NA 1KWMA 4P4BA 1U6MA 1VHOA 3FEEA 3IFEA 3KR5A 4IF5A 4B5OA 4Q38A 4U9YA 1YW4A 2REFA 4MHPA 3D67A 2IJZA 4CRZB 2CNTA 4NEXA 4TNUA 4MBUA 4PK3A 4UEEA 1VIXA 3B3CA 4ONUA 1HEEA 3B3TA 5THWA 2B4BA 5H84A 2AFUA 4E8OA 4C7HA 3PP9A 1YGHA 3QAYA 4JYWA 1Z4EA 5IV0A 4B11A 4FAIA 5AGEA 3B3SA 4OADA 5LYDA 4MJ8A 1X10A 4NGRA 4CYPA 3KASA 1WK4A 8CPAA 2PJ3A 3I9SA 4OLLA 4B13A 1VGYA 1Z8WA 3KQXA 1CP7A 2YNEA 3NH4A 3QB8A 2PIZA 2EWBA 1BPMA 2Z10A 2GE3A 5KTDA 2Z3KA 4G1PA 1IOFA 1M4GA 1XBUA 5CPAA 3NA6A 4MFKA 4OC4A 4CAFA 1XMTA 2XEIA 2ZEHA 1GYTA 3IO1A 5FVJA 2F7VA 3D7FA 1YLOA 1QSMA 4HKFA 3B8GA 1A2ZA 3GLJA 3IWGA 4KOVA 4O23A 4YRHA 2PJAA 3QNVA 1XF8A 3RZAA 4EVYA 5K8OA 2ZEGA 1YVKA 2Y0MA 2ZOFA 1XRYA 1S5KA 3BXMA 4F9UA 5ISVA 4NJRA 1ZLIA 3B3WA 3EY5A 3GY9A 3HLPA 4KOYA 1XMBA 2Q4YA 2PJ0A 4AVAA 2ZXVA 4FD5A 3DSBA 1TKJA 2FL4A 1XE4A 2ZW6A 3UY5A 5BWAB 4QC6A 4MY3A 5IB0A 4LQGA 5F46A 4L89A 4KLWA 3L2NA 4II9A 4E2AA 1H8LA 2CY2A 4MFLA 1TF9A 2P0WA 3K9UA 2WSAA 3PBEA 2JEVA 4NGSA 1ZG8A 4P10A 4AVCA 3MRUA 1FT7A 2PJ9A 2G9DA 3LWUA 1MJAA 4PXBA 1TIQA 3FEDA 3T8WA 1MJ9A 4X2TA 5K8PA 2R7HA 1YMEA 2I79A 4GM5A 2ODFA 1YR0A 2PJCA 3DGVA 3SJFA 4NFRA 5AG4A 1IIDA 4PSXA 3BHXA 1CPSA 1IU8A 3SI2A 2FVGA 2XEGA 2WPWA 5K8NA 1M1DA 1XIXA 2FIAA 4NGNA 2EUIA 3H5ZA 4AB7A 1KZFA 4CAXA 5HH1A 3IIBA 3KR4A 2BL1A 2RC4A 3RBUA 5I0CA 4KVOE 4JXRA 1CX8A 1YQEA 3A9LA 3SHPA 1LAPA 4A31A 3S9NA 2ATRA 4LX9A 4X3RA 3SJXA 4JWPA 1MJBA 3PFOA 2VI7A 4GXHA 5DWNA 3PRTA 2PR8A 5LYIA 4ORFA 2Z11A 1VKCA 2OB0A 3EXNA 4C7IA 4JZ0A 4M6GA 3CPAA 4UFWA 2GANA 2F8HA 2AFZA 2EVNA 2O28A 2I3CA 2J8MA 4UEFA 1TF8A 3SXNA 1XEBA 3WC5A 4P4FA 4UIBA 1ARMA 2RFHA 5JQ4A 4R8FA 5F48A 3H8EA 4MI4A 3D7DA 5LRJA 2PJ1A 4MFZA 3K2KA 4TWEA 3I3GA 4IAVA 2VZZA 2AJ6A 1VHSA 1Z9UA 4XPDB 1FNOA 4FBEA 3CXSA 2ZEOA 3PB4X 1KUYA 3D66A 2BO9A 3RO0A 3E0KA 3D7GA 5ELYA 1DE4C 1OZPA 2VEZA 5IX3A 1HDQA 3ZZIA 2O4HA 1Z4RA 4CAVA 2OH1A 1CG2A 1TKHA 4MCPA 1RO5A 4OC2A 3NH8A 4PXEA 2PCUA 4U9ZA 2PRQA 2JBJA 4FD6A 4K30A 1Y9KA 5K8MA 4R6TA 1CP6A 2B58A 3CT9A 2HUZA 3PB6X 1L0CA 3EFAA 4ONWA 2QIRA 3R9FA 4CYQA 4RI1A 2CF4A 2Z0ZA 4EFDA 3GYAA 2B3UA 4YGOA 1S7LA 3KHZA 3D2MA 3V7ZA 3FH4A 4MFQA 2PJBA 5KTCA 2PIYA 3TOBA 1Z8TA 2ZOGA 5G20A 4ZY2A 3PEIA 4MY0A 3PBBA 4XNHC 3K9TA 3DLJA 1R57A 2Q44A 2VXKA 2Q0YA 4UWIA 3FJUA 2B5GA 1F2PA 2J8RA 4OC3A 1F57A 3VATA 1VHEA 1S3ZA 4NF1A 3R1KA 3H8FA 1BO4A 4JD6A 1ZG9A 5KTAA 1DTDA 4EMEA 3WC7A 4XPLA 4ZX8A 5HVGA 1GHEA 1AMPA 3IJ3A 2QYVA 3JVNA 4A32A 2CTBA 4KORA 3SI0A 2POKA 3EC4A 4B5PA 1B87A 1I12A 3KKWA 4EWTA 3CZXA 4HNWB 3ZJ0A 1N71A 3PB8X 4C68A 4A94A 2J9AA 2PJ2A 4IK2A 4CAEA 2WYRA 3D2PA 4RN7A 4OC1A 2I00A 2Q04A 2BSWA 1IY7A 4UCNA 4UF4A 1ZO0A 3I1UA 3BLNA 3KHXA 4U5YA 3V8IA 3WR7A 1IYKA 1PCAA 3PGPA 4FUUA 4ZYQA 2J8NA 5C82A 4KSAA 4OIWA 3VH9A 4HNXB 4R87A 4CS0B 4ZI6A 3D68A 2AFXA 3R96A 4A2ZA 3S6KA 1QQ9A 4OAEA 3TFYA 1YK3A 3D3SA 3IEHA 3ISZA 4XPKA 3DR6A 3F0AA 2D4OA 4R7MA 4C2XA 2FXFA 1Z8LA 1PUAA 2NYQA 4F0YA 3KQZA 2PC1A 2BOAA 3KL9A 4ZBGA 4LUAA 2K5TA 1NMTA 4PSWA 2V77A 4RUHA 4IUSA 5F47A 4A39A 2AFWA 3B7IA 1LCPA 3R9EA 1LFWA 4MCRA 1F2OA 4R76A 2BCOA 4ZY0A 2XEJA 2V8VA 1Q2YA 2GU2A 2VL1A 1S7FA 4KZTA 4J3GA 2R1IA 3FYNA 4CAWA 2QVPA 1XFOA 2G0BA 3BI1A 5G22A 3LMSA 2YNDA 4NJQA 2CIJA 2IQ6A 3FX6A 3SJEA 3W6SA 1LRZA 1I1DA 3W6XA 4HPSA 2H5MA 3P2HA 4IHMA 5E96A 2Z3LA 4UCPA 4JXQA 1QSOA 4OP4A 4NGMA 5CNPA 3TX8A 5A27A 4OIDA 2V8GA 5J1QA 4WWVA 2PVWA 1XJOA 4C2ZA 4UCMA 1CM0A 4CYNA 3GUXA 3JUWA 2D4PA 3TT2A 1YW6A 4P4DA 4NGTA 4M3SA 4AXVA 4PXCA 4K3NA 1FY7A 4OC5A 3S6GA 1J4JA 5EBVA 2Q7SA 1IB1E 4UIAA 2QJ8A 1AUGA 4ZGYB 4KOSA 2ZW7A 4QBJA 4F8ZA 3GIUA 3FIXA 4QVTA 2C6GA 4KOUA 5CBMA 2DXQA 2Q4ZA 2PR1A 4M85A 2P6EA 3TO7A 2JEWA 2Q51A 2Z3MA 4A30A 2Q7BA 3B3VA 4AG9A 5J8FA 5EC4A 1LANA 4RS2A 1EE3P 1Y7RA 4JJXA 1P0HA 3MN8A 3NH5A 5LRGA 1CJWA 3WABA 5G1ZA 1IICA 3H4QA 3B2YA 3NE7A 2EK8A 2REEA 2AFOA 4P45A 1CBXA 3DDDA 2YNCA 4QB9A 2AE6A 2PJ5A 2P6FA 3CPXA 4WJBA 2HC9A 2WZNA 1XOVA 5HVHA 4ZX9A 4BMHA 4MHYA 1YSJA 1Y7EA 4NCZA 4Y49C 2YNCC 3TOAA 2G3AA 1BAVA 5GCNA 1CPXA 1ZLHA 6CPAA 4I49A 2ZEDA 1S60A 2JDDA 2P6GA 3QAHA 4NGQA 1BOBA 1NE9A 1PYTB 3HUVA 1ARLA 4QUSA 3BJ7A 2Q4VA 1M4LA 3DR8A 2ZENA 1Y9WA 5HMNA 3BI0A 3D7HA 4L8AA 4AG7A 5JPHA 2O53A 5JH9A 4BINA 2GLJA 3F8KA 4R3KA 5AG5A 4DJLA 2FS5A 2HV2A 3FVLA 2ZEFA 3WC6A 4CRYB 7CPAA 2CNMA 3NE8A 3TO9A 3VARA 5HXDA 2PJ6A 3KZWA 3RNZA 4A37A 1K4JA 1ON0A 3KGQA 3TE4A 3G8WA 3IU2A 2C27A 3FECA 1M4DA 1BPNA 5LRKA 2BUEA 2GFQA 3ISXA 4PPZA 5JGFA 1QSNA 2GIVA 2IL4A 4KVXA 2OR4A 2PE3A 2F5IA 1P4NA 2B4DA 3FB3A 1YVOA 1HDUA 2EK9A 2OZUA 2VZYA 3IU1A 4GS4A 4MFPA 4OC0A 5J8CA 4OKOA 3KI9A 4XPDC 4C2YA 1KUXA 5LYFA 1IYLA 3G3SA 3VWEA 1WWZA 2ZW4A 4CGOA 4UBRA 4UFVA 3W91A 1Y0YA 1RXTA 2ZEEA 4X5KA 4UWJA 4M6IA 3S9LA 4UA3A 4B14A 3R95A 4LQ6A 1Q2DA 1IGBA 2V8HA 2NSMA 4KUBA 4UEZA 1S7KA 4NSQA 3FMCA 3TC8A 1TXRA 2PDOA 2VBQA 4P4EA 2RB7A 4E0AA 3CXPA 4YWYA 2BEIA 2G3TA 3IWEA 4DYOA 5DWMA 1Q2CA 1UWYA 3FNCA 4MMOA 3S9MA 3RAMA 4FD7A 4F0XA 4NXYA 3T90A 2DPTA 3D4UA 2JBKA 1V0CA 2C1CA 1UFHA 1YLEA 2PJ8A 1QSTA 1JWQA 4Q7AA 2ZEPA 3TCVA 3WT4A 1IOIA 2JDCA 3B35A 3GKRA 4Q36A 4R3LA 2PRBA 4R57A 3D8PA 2ANPA 4KVME 2KCWA 2GREA 3JRUA 3FF3A 1OBRA 2FIWA 5H86A 5A28A 2ZW5A 4MHNA 2Z3NA 2X7BA 4HNYB 5LYLA 1M4IA 1R43A 4KLVA 2PQ8A 4BBHA 3LACA 2PVVA 1S7NA 1YX0A 3BJ8A 4KOTA 5D29A 2ZEMA 2OOTA 3T9YA 4DUKA 4KSIA 5IB9A 2CNSA 1Y0RA 3NFZA 1X12A 3TO6A 1TKFA 2PJ7A 1ZG7A 3C26A 3LODA 4PV6A 5EMIA 3R9GA 2V8DA 4H2KA 4NGPA 2AFSA 4KUAA 2Z3OA 1NSAA 3CDXA 4DNCA 4A33A 2Z3PA 2ABZA 1BLLE 1Q7LA 1R3NA 2PSWA 3N5FA 4MXUA 4KOWA 2PJ4A 3DNSA 3SJGA 3FRMA 5G21A 3IC1A 1Z8XA 2DF5A 2HQYA 4YFJA 1MK4A 4KSFA 4Z65A 2OZGA 2R8VA 4FWUA 3PFEA 5F49A 2CXAA 4P6YA 2JLMA 4B10A 4Y49B 3FXTA
chains in the Genus database with same CATH topology
5C88A 3IGRA 4A95A 2FE7A 1QSRA 3LD2A 1YREA 2QECA 3PZJA 4H6ZA 4CYOA 2VQYA 4XNHB 3SXOA 4CGPA 2ARHA 3F5BA 2DPSA 4CGNA 4R9MA 2OU2A 1KUVA 1PU9A 1I21A 2B5GB 3MGDA 3VWDA 4UFXA 3P2FA 1B6BA 2B3VA 2YGWA 4MFJA 3OWCA 2FT0A 2OZHA 4F6AA 5AG6A 4CGMA 1SQHA 2FCKA 4H89A 2FSRA 4B5PB 4KS9A 3S6FA 4H6UA 4KOXA 4CGLA 2WUUA 3JTKA 4AVBA 2R98A 2B4DB 3S6HA 2ZPAA 2QMLA 3CXQA 3EO4A 1M44A 3N7ZA 4FD4A 3FBUA 4JLYA 4PK2A 1NSLA 5AG7A 2WPXA 3TTHA 2NMTA 3RYOA 4MHDA 2A4NA 1U6MA 4B5OA 4IF5A 4Q38A 4U9YA 2REFA 4CRZB 2CNTA 4NEXA 4MBUA 4PK3A 4ONUA 2B4BA 5H84A 4E8OA 4C7HA 3PP9A 1YGHA 1Z4EA 5IV0A 4B11A 5AGEA 4OADA 4MJ8A 4CYPA 1WK4A 3I9SA 4OLLA 4B13A 2YNEA 3QB8A 2Z10A 2GE3A 5KTDA 2Z3KA 1M4GA 4MFKA 4CAFA 1XMTA 5JPHA 5FVJA 4KOVA 1QSMA 4HKFA 3B8GA 3IWGA 4YRHA 4EVYA 1XF8A 1YVKA 2Y0MA 1S5KA 5ISVA 3EY5A 3GY9A 4KOYA 2Q4YA 4AVAA 2ZXVA 4FD5A 3DSBA 2FL4A 1XE4A 2ZW6A 3UY5A 5BWAB 4QC6A 4MY3A 5IB0A 5F46A 4L89A 4KLWA 4II9A 4E2AA 2CY2A 4MFLA 3K9UA 2P0WA 4B12A 2WSAA 2JEVA 4AVCA 1MJAA 1TIQA 1MJ9A 2R7HA 2I79A 1YR0A 5AG4A 1IIDA 4PSXA 2WPWA 1M1DA 1XIXA 2FIAA 2EUIA 3H5ZA 4AB7A 1KZFA 4CAXA 5HH1A 2BL1A 2RC4A 5I0CA 4KVOE 4JXRA 3A9LA 4A31A 2ATRA 4LX9A 4JWPA 1MJBA 2VI7A 5DWNA 2PR8A 4ORFA 2Z11A 1VKCA 2OB0A 3EXNA 4C7IA 4UFWA 2GANA 2J8MA 2EVNA 2O28A 3SXNA 1XEBA 5JQ4A 5F48A 4MI4A 4MFZA 3I3GA 2VZZA 2AJ6A 1VHSA 1Z9UA 4XPDB 3CXSA 1KUYA 3E0KA 2VEZA 1OZPA 5IX3A 3ZZIA 1Z4RA 4CAVA 2OH1A 4U9ZA 1RO5A 4FD6A 4K30A 1Y9KA 2B58A 2HUZA 1L0CA 3EFAA 3R9FA 2QIRA 4CYQA 4RI1A 2Z0ZA 3GYAA 2B3UA 4YGOA 1S7LA 3D2MA 5KTCA 4MFQA 3TOBA 5G20A 4MY0A 4XNHC 1R57A 2Q44A 2VXKA 2Q0YA 4UWIA 2B5GA 2J8RA 4NF1A 1S3ZA 3R1KA 1BO4A 4JD6A 5KTAA 4XPLA 1GHEA 3JVNA 4A32A 4KORA 3EC4A 4B5PA 1B87A 1I12A 3KKWA 4HNWB 3ZJ0A 1N71A 4C68A 2JLMA 4CAEA 3D2PA 2I00A 2Q04A 2BSWA 3V8IA 4UCNA 1ZO0A 3BLNA 4U5YA 3WR7A 1IYKA 3PGPA 2J8NA 5C82A 4KSAA 4HNXB 4R87A 4CS0B 3R96A 4A2ZA 3S6KA 4OAEA 3TFYA 1YK3A 3D3SA 4XPKA 3DR6A 3F0AA 2D4OA 4C2XA 2FXFA 1PUAA 4F0YA 2PC1A 4ZBGA 4LUAA 2K5TA 1NMTA 4PSWA 4IUSA 5F47A 3R9EA 1Q2YA 1S7FA 4KZTA 4J3GA 2R1IA 3FYNA 4CAWA 2G0BA 5G22A 2YNDA 3W6SA 1LRZA 1I1DA 3W6XA 2H5MA 3P2HA 5E96A 2Z3LA 4UCPA 4JXQA 1QSOA 5CNPA 5A27A 4C2ZA 4UCMA 1CM0A 4CYNA 3JUWA 2D4PA 3TT2A 4M3SA 1FY7A 3S6GA 1J4JA 5EBVA 1IB1E 4ZGYB 4KOSA 2ZW7A 4QBJA 3FIXA 4QVTA 4KOUA 2DXQA 2PR1A 4M85A 2P6EA 3TO7A 2Z3MA 4A30A 2Q7BA 4AG9A 5J8FA 5EC4A 4RS2A 1Y7RA 4JJXA 1P0HA 1CJWA 5G1ZA 1IICA 3H4QA 2REEA 4QB9A 3DDDA 2YNCA 2AE6A 2P6FA 4BMHA 4NCZA 4Y49C 3TOAA 2YNCC 2G3AA 5GCNA 4I49A 1S60A 2JDDA 2P6GA 3QAHA 1BOBA 1NE9A 4QUSA 3BJ7A 2Q4VA 3DR8A 1Y9WA 5HMNA 4L8AA 4AG7A 3F8KA 4R3KA 5AG5A 2FS5A 2HV2A 4CRYB 2CNMA 3TO9A 3TE4A 1K4JA 1ON0A 3G8WA 3IU2A 2C27A 1M4DA 2BUEA 1QSNA 2GIVA 2IL4A 4KVXA 2F5IA 1P4NA 2B4DA 3FB3A 1YVOA 2VZYA 3IU1A 2OZUA 4GS4A 4MFPA 3SHPA 5J8CA 4XPDC 4C2YA 1KUXA 1IYLA 3G3SA 3VWEA 1WWZA 2ZW4A 4CGOA 4UBRA 4UFVA 3W91A 1RXTA 4X5KA 4UWJA 4UA3A 4B14A 3R95A 1Q2DA 4KUBA 1S7KA 4NSQA 2PDOA 2VBQA 4E0AA 3CXPA 2BEIA 2G3TA 3IWEA 5DWMA 1Q2CA 3FNCA 4FD7A 4F0XA 4NXYA 3T90A 2DPTA 1V0CA 1UFHA 1YLEA 1QSTA 3TCVA 2JDCA 3GKRA 4Q36A 4R3LA 2PRBA 4R57A 3D8PA 4KVME 2KCWA 5A28A 2FIWA 5H86A 2ZW5A 2Z3NA 2X7BA 4HNYB 1M4IA 4KLVA 2PQ8A 4BBHA 1S7NA 1YX0A 3BJ8A 4KOTA 3T9YA 2CNSA 3TO6A 3LODA 3C26A 4PV6A 3R9GA 4KUAA 2Z3OA 4DNCA 4A33A 2Z3PA 2PSWA 4KOWA 3DNSA 3FRMA 5G21A 2HQYA 4YFJA 1MK4A 4KSFA 2OZGA 2R8VA 5F49A 2CXAA 3NE7A 4B10A 4Y49B 3FXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C88 A;  3IGR A;  2FE7 A;  1QSR A;  3LD2 A;  1YRE A;  2QEC A;  3PZJ A;  4H6Z A;  2VQY A;  4XNH B;  3SXO A;  2ARH A;  3F5B A;  4R9M A;  2OU2 A;  1KUV A;  1PU9 A;  1I21 A;  2B5G B;  3MGD A;  3VWD A;  3P2F A;  1B6B A;  2B3V A;  3OWC A;  2FT0 A;  2OZH A;  4F6A A;  1SQH A;  2FCK A;  4H89 A;  2FSR A;  4B5P B;  3S6F A;  4KOX A;  4H6U A;  4AVB A;  2R98 A;  2B4D B;  3S6H A;  2ZPA A;  2QML A;  3CXQ A;  3EO4 A;  1M44 A;  3N7Z A;  4FD4 A;  3FBU A;  4JLY A;  4PK2 A;  1NSL A;  2WPX A;  3TTH A;  2NMT A;  3RYO A;  4MHD A;  2A4N A;  1U6M A;  4B5O A;  4IF5 A;  4U9Y A;  2REF A;  4CRZ B;  2CNT A;  4NEX A;  4MBU A;  4PK3 A;  4ONU A;  2B4B A;  5H84 A;  4E8O A;  3PP9 A;  1YGH A;  1Z4E A;  5IV0 A;  4OAD A;  4MJ8 A;  1WK4 A;  3I9S A;  4OLL A;  3QB8 A;  2Z10 A;  2GE3 A;  5KTD A;  1M4G A;  1XMT A;  5JPH A;  5FVJ A;  4KOV A;  1QSM A;  4HKF A;  3B8G A;  3IWG A;  4YRH A;  4EVY A;  1XF8 A;  1YVK A;  2Y0M A;  1S5K A;  5ISV A;  3EY5 A;  3GY9 A;  4KOY A;  2Q4Y A;  4AVA A;  2ZXV A;  4FD5 A;  3DSB A;  2FL4 A;  1XE4 A;  2ZW6 A;  3UY5 A;  4QC6 A;  4MY3 A;  5IB0 A;  5F46 A;  4L89 A;  4KLW A;  4II9 A;  4E2A A;  2CY2 A;  3K9U A;  2P0W A;  2JEV A;  4AVC A;  1MJA A;  1TIQ A;  1MJ9 A;  2R7H A;  2I79 A;  1YR0 A;  1IID A;  4PSX A;  2WPW A;  1M1D A;  1XIX A;  2FIA A;  2EUI A;  4CAX A;  4AB7 A;  1KZF A;  5HH1 A;  2BL1 A;  2RC4 A;  5I0C A;  4KVO E;  4JXR A;  2ATR A;  4LX9 A;  4JWP A;  1MJB A;  2VI7 A;  5DWN A;  2PR8 A;  4ORF A;  2Z11 A;  1VKC A;  2OB0 A;  3EXN A;  2GAN A;  2J8M A;  2EVN A;  2O28 A;  3SXN A;  1XEB A;  5JQ4 A;  5F48 A;  4MI4 A;  3I3G A;  2VZZ A;  2AJ6 A;  1VHS A;  1Z9U A;  4XPD B;  3CXS A;  1KUY A;  3E0K A;  2VEZ A;  1OZP A;  5IX3 A;  3ZZI A;  1Z4R A;  4CAV A;  2OH1 A;  4U9Z A;  1RO5 A;  4FD6 A;  4K30 A;  1Y9K A;  2B58 A;  2HUZ A;  1L0C A;  3EFA A;  3R9F A;  2QIR A;  4RI1 A;  2Z0Z A;  3GYA A;  2B3U A;  4YGO A;  1S7L A;  3D2M A;  5KTC A;  3TOB A;  4MY0 A;  4XNH C;  1R57 A;  2Q44 A;  2VXK A;  2Q0Y A;  4UWI A;  2B5G A;  2J8R A;  4NF1 A;  1S3Z A;  3R1K A;  1BO4 A;  4JD6 A;  5KTA A;  4XPL A;  1GHE A;  3JVN A;  4KOR A;  3EC4 A;  4B5P A;  1B87 A;  1I12 A;  3KKW A;  4HNW B;  3ZJ0 A;  1N71 A;  2JLM A;  3D2P A;  2I00 A;  2Q04 A;  2BSW A;  3V8I A;  3BLN A;  4U5Y A;  3WR7 A;  1IYK A;  3PGP A;  2J8N A;  5C82 A;  4HNX B;  4R87 A;  4CS0 B;  3R96 A;  3S6K A;  4OAE A;  3TFY A;  1YK3 A;  3D3S A;  4XPK A;  3DR6 A;  3F0A A;  2D4O A;  2FXF A;  1PUA A;  4F0Y A;  2PC1 A;  4ZBG A;  4LUA A;  2K5T A;  1NMT A;  4PSW A;  4IUS A;  5F47 A;  3R9E A;  1Q2Y A;  1S7F A;  4KZT A;  4J3G A;  2R1I A;  3FYN A;  4CAW A;  2G0B A;  3W6S A;  1LRZ A;  1I1D A;  3W6X A;  2H5M A;  3P2H A;  5E96 A;  4JXQ A;  1QSO A;  5CNP A;  1CM0 A;  3JUW A;  2D4P A;  3TT2 A;  4M3S A;  1FY7 A;  3S6G A;  1J4J A;  5EBV A;  1IB1 E;  4KOS A;  2ZW7 A;  4QBJ A;  3FIX A;  4QVT A;  4KOU A;  2DXQ A;  2PR1 A;  4M85 A;  2P6E A;  3TO7 A;  2Q7B A;  4AG9 A;  5J8F A;  5EC4 A;  4RS2 A;  1Y7R A;  4JJX A;  1P0H A;  1CJW A;  1IIC A;  3H4Q A;  2REE A;  4QB9 A;  3DDD A;  2AE6 A;  2P6F A;  4BMH A;  4NCZ A;  4Y49 C;  3TOA A;  2G3A A;  5GCN A;  4I49 A;  1S60 A;  2JDD A;  2P6G A;  3QAH A;  1BOB A;  1NE9 A;  4QUS A;  3BJ7 A;  2Q4V A;  3DR8 A;  1Y9W A;  5HMN A;  4L8A A;  4AG7 A;  3F8K A;  4R3K A;  2FS5 A;  2HV2 A;  4CRY B;  2CNM A;  3TO9 A;  3TE4 A;  1K4J A;  1ON0 A;  3G8W A;  2C27 A;  1M4D A;  2BUE A;  1QSN A;  2GIV A;  2IL4 A;  4KVX A;  2F5I A;  1P4N A;  2B4D A;  3FB3 A;  1YVO A;  2VZY A;  4GS4 A;  2OZU A;  3SHP A;  5J8C A;  4XPD C;  1KUX A;  1IYL A;  3G3S A;  3VWE A;  1WWZ A;  2ZW4 A;  4UBR A;  3W91 A;  1RXT A;  4X5K A;  4UWJ A;  4UA3 A;  3R95 A;  1Q2D A;  4KUB A;  1S7K A;  4NSQ A;  2PDO A;  2VBQ A;  4E0A A;  3CXP A;  2BEI A;  2G3T A;  5DWM A;  1Q2C A;  3FNC A;  4FD7 A;  4NXY A;  3T90 A;  1V0C A;  1UFH A;  1YLE A;  1QST A;  3TCV A;  2JDC A;  3GKR A;  4R3L A;  2PRB A;  4R57 A;  3D8P A;  4KVM E;  2KCW A;  2FIW A;  5H86 A;  2ZW5 A;  2X7B A;  4HNY B;  1M4I A;  4KLV A;  2PQ8 A;  1S7N A;  1YX0 A;  3BJ8 A;  4KOT A;  3T9Y A;  2CNS A;  3TO6 A;  3LOD A;  3C26 A;  4PV6 A;  3R9G A;  4KUA A;  4DNC A;  2PSW A;  4KOW A;  3DNS A;  3FRM A;  2HQY A;  4YFJ A;  1MK4 A;  2OZG A;  2R8V A;  5F49 A;  3NE7 A;  4Y49 B;  3FXT A; 
#chains in the Genus database with same CATH topology
 5C88 A;  3IGR A;  2ZEL A;  1ELM P;  4A95 A;  2FE7 A;  4X8I A;  1QSR A;  1Z2L A;  3LD2 A;  2AFM A;  1YRE A;  2QEC A;  3PZJ A;  4H6Z A;  4M6H A;  4CYO A;  2VQY A;  4OME A;  4XNH B;  3SXO A;  3V38 A;  4CGP A;  1LOK A;  2ARH A;  2EBJ A;  3PB7 X;  4ZY1 A;  3F5B A;  2DPS A;  5DS0 A;  5D8N A;  4CGN A;  4R9M A;  1ELL P;  2HB6 A;  4B12 A;  2C6C A;  2OU2 A;  1KUV A;  1PU9 A;  5I4M A;  1I21 A;  4B6Z A;  2B5G B;  1JQG A;  3MGD A;  3PB9 X;  3VWD A;  4UFX A;  3P2F A;  2DEA A;  2GLF A;  1B6B A;  3IWW A;  2B3V A;  4YU9 A;  3SI1 A;  2YGW A;  4MFJ A;  4W9Y A;  3OWC A;  2FT0 A;  2OZH A;  4MCQ A;  4F6A A;  2IMO A;  5AG6 A;  4CGM A;  1SQH A;  2FCK A;  4H89 A;  4F9V A;  2FSR A;  1QMU A;  4B5P B;  4KS9 A;  3S6F A;  5HVF A;  4H6U A;  4KOX A;  2C6P A;  4CGL A;  4P4J A;  4PXD A;  2WUU A;  3JTK A;  4MHZ A;  4A38 A;  4AVB A;  2R98 A;  2B4D B;  3S6H A;  2ZPA A;  2Q43 A;  2QML A;  3CXQ A;  4P4I A;  3EO4 A;  1LAM A;  1M44 A;  3N7Z A;  2CTC A;  4FD4 A;  1Z5R A;  3FBU A;  4BD9 A;  3GB0 A;  4CPA A;  4MRI A;  5F09 A;  1AYE A;  4JLY A;  4MCS A;  4P44 A;  4PQA A;  1RTQ A;  5JM6 A;  4PK2 A;  1NSL A;  5AG7 A;  2WPX A;  2XEF A;  3H8G A;  2EO8 A;  3TTH A;  2NMT A;  3RYO A;  4MHD A;  2A4N A;  1KWM A;  4P4B A;  1U6M A;  1VHO A;  3FEE A;  3IFE A;  3KR5 A;  4IF5 A;  4B5O A;  4Q38 A;  4U9Y A;  1YW4 A;  2REF A;  4MHP A;  3D67 A;  2IJZ A;  4CRZ B;  2CNT A;  4NEX A;  4TNU A;  4MBU A;  4PK3 A;  4UEE A;  1VIX A;  3B3C A;  4ONU A;  1HEE A;  3B3T A;  5THW A;  2B4B A;  5H84 A;  2AFU A;  4E8O A;  4C7H A;  3PP9 A;  1YGH A;  3QAY A;  4JYW A;  1Z4E A;  5IV0 A;  4B11 A;  4FAI A;  5AGE A;  3B3S A;  4OAD A;  5LYD A;  4MJ8 A;  1X10 A;  4NGR A;  4CYP A;  3KAS A;  1WK4 A;  8CPA A;  2PJ3 A;  3I9S A;  4OLL A;  4B13 A;  1VGY A;  1Z8W A;  3KQX A;  1CP7 A;  2YNE A;  3NH4 A;  3QB8 A;  2PIZ A;  2EWB A;  1BPM A;  2Z10 A;  2GE3 A;  5KTD A;  2Z3K A;  4G1P A;  1IOF A;  1M4G A;  1XBU A;  5CPA A;  3NA6 A;  4MFK A;  4OC4 A;  4CAF A;  1XMT A;  2XEI A;  2ZEH A;  1GYT A;  3IO1 A;  5FVJ A;  2F7V A;  3D7F A;  1YLO A;  1QSM A;  4HKF A;  3B8G A;  1A2Z A;  3GLJ A;  3IWG A;  4KOV A;  4O23 A;  4YRH A;  2PJA A;  3QNV A;  1XF8 A;  3RZA A;  4EVY A;  5K8O A;  2ZEG A;  1YVK A;  2Y0M A;  2ZOF A;  1XRY A;  1S5K A;  3BXM A;  4F9U A;  5ISV A;  4NJR A;  1ZLI A;  3B3W A;  3EY5 A;  3GY9 A;  3HLP A;  4KOY A;  1XMB A;  2Q4Y A;  2PJ0 A;  4AVA A;  2ZXV A;  4FD5 A;  3DSB A;  1TKJ A;  2FL4 A;  1XE4 A;  2ZW6 A;  3UY5 A;  5BWA B;  4QC6 A;  4MY3 A;  5IB0 A;  4LQG A;  5F46 A;  4L89 A;  4KLW A;  3L2N A;  4II9 A;  4E2A A;  1H8L A;  2CY2 A;  4MFL A;  1TF9 A;  2P0W A;  3K9U A;  2WSA A;  3PBE A;  2JEV A;  4NGS A;  1ZG8 A;  4P10 A;  4AVC A;  3MRU A;  1FT7 A;  2PJ9 A;  2G9D A;  3LWU A;  1MJA A;  4PXB A;  1TIQ A;  3FED A;  3T8W A;  1MJ9 A;  4X2T A;  5K8P A;  2R7H A;  1YME A;  2I79 A;  4GM5 A;  2ODF A;  1YR0 A;  2PJC A;  3DGV A;  3SJF A;  4NFR A;  5AG4 A;  1IID A;  4PSX A;  3BHX A;  1CPS A;  1IU8 A;  3SI2 A;  2FVG A;  2XEG A;  2WPW A;  5K8N A;  1M1D A;  1XIX A;  2FIA A;  4NGN A;  2EUI A;  3H5Z A;  4AB7 A;  1KZF A;  4CAX A;  5HH1 A;  3IIB A;  3KR4 A;  2BL1 A;  2RC4 A;  3RBU A;  5I0C A;  4KVO E;  4JXR A;  1CX8 A;  1YQE A;  3A9L A;  3SHP A;  1LAP A;  4A31 A;  3S9N A;  2ATR A;  4LX9 A;  4X3R A;  3SJX A;  4JWP A;  1MJB A;  3PFO A;  2VI7 A;  4GXH A;  5DWN A;  3PRT A;  2PR8 A;  5LYI A;  4ORF A;  2Z11 A;  1VKC A;  2OB0 A;  3EXN A;  4C7I A;  4JZ0 A;  4M6G A;  3CPA A;  4UFW A;  2GAN A;  2F8H A;  2AFZ A;  2EVN A;  2O28 A;  2I3C A;  2J8M A;  4UEF A;  1TF8 A;  3SXN A;  1XEB A;  3WC5 A;  4P4F A;  4UIB A;  1ARM A;  2RFH A;  5JQ4 A;  4R8F A;  5F48 A;  3H8E A;  4MI4 A;  3D7D A;  5LRJ A;  2PJ1 A;  4MFZ A;  3K2K A;  4TWE A;  3I3G A;  4IAV A;  2VZZ A;  2AJ6 A;  1VHS A;  1Z9U A;  4XPD B;  1FNO A;  4FBE A;  3CXS A;  2ZEO A;  3PB4 X;  1KUY A;  3D66 A;  2BO9 A;  3RO0 A;  3E0K A;  3D7G A;  5ELY A;  1DE4 C;  1OZP A;  2VEZ A;  5IX3 A;  1HDQ A;  3ZZI A;  2O4H A;  1Z4R A;  4CAV A;  2OH1 A;  1CG2 A;  1TKH A;  4MCP A;  1RO5 A;  4OC2 A;  3NH8 A;  4PXE A;  2PCU A;  4U9Z A;  2PRQ A;  2JBJ A;  4FD6 A;  4K30 A;  1Y9K A;  5K8M A;  4R6T A;  1CP6 A;  2B58 A;  3CT9 A;  2HUZ A;  3PB6 X;  1L0C A;  3EFA A;  4ONW A;  2QIR A;  3R9F A;  4CYQ A;  4RI1 A;  2CF4 A;  2Z0Z A;  4EFD A;  3GYA A;  2B3U A;  4YGO A;  1S7L A;  3KHZ A;  3D2M A;  3V7Z A;  3FH4 A;  4MFQ A;  2PJB A;  5KTC A;  2PIY A;  3TOB A;  1Z8T A;  2ZOG A;  5G20 A;  4ZY2 A;  3PEI A;  4MY0 A;  3PBB A;  4XNH C;  3K9T A;  3DLJ A;  1R57 A;  2Q44 A;  2VXK A;  2Q0Y A;  4UWI A;  3FJU A;  2B5G A;  1F2P A;  2J8R A;  4OC3 A;  1F57 A;  3VAT A;  1VHE A;  1S3Z A;  4NF1 A;  3R1K A;  3H8F A;  1BO4 A;  4JD6 A;  1ZG9 A;  5KTA A;  1DTD A;  4EME A;  3WC7 A;  4XPL A;  4ZX8 A;  5HVG A;  1GHE A;  1AMP A;  3IJ3 A;  2QYV A;  3JVN A;  4A32 A;  2CTB A;  4KOR A;  3SI0 A;  2POK A;  3EC4 A;  4B5P A;  1B87 A;  1I12 A;  3KKW A;  4EWT A;  3CZX A;  4HNW B;  3ZJ0 A;  1N71 A;  3PB8 X;  4C68 A;  4A94 A;  2J9A A;  2PJ2 A;  4IK2 A;  4CAE A;  2WYR A;  3D2P A;  4RN7 A;  4OC1 A;  2I00 A;  2Q04 A;  2BSW A;  1IY7 A;  4UCN A;  4UF4 A;  1ZO0 A;  3I1U A;  3BLN A;  3KHX A;  4U5Y A;  3V8I A;  3WR7 A;  1IYK A;  1PCA A;  3PGP A;  4FUU A;  4ZYQ A;  2J8N A;  5C82 A;  4KSA A;  4OIW A;  3VH9 A;  4HNX B;  4R87 A;  4CS0 B;  4ZI6 A;  3D68 A;  2AFX A;  3R96 A;  4A2Z A;  3S6K A;  1QQ9 A;  4OAE A;  3TFY A;  1YK3 A;  3D3S A;  3IEH A;  3ISZ A;  4XPK A;  3DR6 A;  3F0A A;  2D4O A;  4R7M A;  4C2X A;  2FXF A;  1Z8L A;  1PUA A;  2NYQ A;  4F0Y A;  3KQZ A;  2PC1 A;  2BOA A;  3KL9 A;  4ZBG A;  4LUA A;  2K5T A;  1NMT A;  4PSW A;  2V77 A;  4RUH A;  4IUS A;  5F47 A;  4A39 A;  2AFW A;  3B7I A;  1LCP A;  3R9E A;  1LFW A;  4MCR A;  1F2O A;  4R76 A;  2BCO A;  4ZY0 A;  2XEJ A;  2V8V A;  1Q2Y A;  2GU2 A;  2VL1 A;  1S7F A;  4KZT A;  4J3G A;  2R1I A;  3FYN A;  4CAW A;  2QVP A;  1XFO A;  2G0B A;  3BI1 A;  5G22 A;  3LMS A;  2YND A;  4NJQ A;  2CIJ A;  2IQ6 A;  3FX6 A;  3SJE A;  3W6S A;  1LRZ A;  1I1D A;  3W6X A;  4HPS A;  2H5M A;  3P2H A;  4IHM A;  5E96 A;  2Z3L A;  4UCP A;  4JXQ A;  1QSO A;  4OP4 A;  4NGM A;  5CNP A;  3TX8 A;  5A27 A;  4OID A;  2V8G A;  5J1Q A;  4WWV A;  2PVW A;  1XJO A;  4C2Z A;  4UCM A;  1CM0 A;  4CYN A;  3GUX A;  3JUW A;  2D4P A;  3TT2 A;  1YW6 A;  4P4D A;  4NGT A;  4M3S A;  4AXV A;  4PXC A;  4K3N A;  1FY7 A;  4OC5 A;  3S6G A;  1J4J A;  5EBV A;  2Q7S A;  1IB1 E;  4UIA A;  2QJ8 A;  1AUG A;  4ZGY B;  4KOS A;  2ZW7 A;  4QBJ A;  4F8Z A;  3GIU A;  3FIX A;  4QVT A;  2C6G A;  4KOU A;  5CBM A;  2DXQ A;  2Q4Z A;  2PR1 A;  4M85 A;  2P6E A;  3TO7 A;  2JEW A;  2Q51 A;  2Z3M A;  4A30 A;  2Q7B A;  3B3V A;  4AG9 A;  5J8F A;  5EC4 A;  1LAN A;  4RS2 A;  1EE3 P;  1Y7R A;  4JJX A;  1P0H A;  3MN8 A;  3NH5 A;  5LRG A;  1CJW A;  3WAB A;  5G1Z A;  1IIC A;  3H4Q A;  3B2Y A;  3NE7 A;  2EK8 A;  2REE A;  2AFO A;  4P45 A;  1CBX A;  3DDD A;  2YNC A;  4QB9 A;  2AE6 A;  2PJ5 A;  2P6F A;  3CPX A;  4WJB A;  2HC9 A;  2WZN A;  1XOV A;  5HVH A;  4ZX9 A;  4BMH A;  4MHY A;  1YSJ A;  1Y7E A;  4NCZ A;  4Y49 C;  2YNC C;  3TOA A;  2G3A A;  1BAV A;  5GCN A;  1CPX A;  1ZLH A;  6CPA A;  4I49 A;  2ZED A;  1S60 A;  2JDD A;  2P6G A;  3QAH A;  4NGQ A;  1BOB A;  1NE9 A;  1PYT B;  3HUV A;  1ARL A;  4QUS A;  3BJ7 A;  2Q4V A;  1M4L A;  3DR8 A;  2ZEN A;  1Y9W A;  5HMN A;  3BI0 A;  3D7H A;  4L8A A;  4AG7 A;  5JPH A;  2O53 A;  5JH9 A;  4BIN A;  2GLJ A;  3F8K A;  4R3K A;  5AG5 A;  4DJL A;  2FS5 A;  2HV2 A;  3FVL A;  2ZEF A;  3WC6 A;  4CRY B;  7CPA A;  2CNM A;  3NE8 A;  3TO9 A;  3VAR A;  5HXD A;  2PJ6 A;  3KZW A;  3RNZ A;  4A37 A;  1K4J A;  1ON0 A;  3KGQ A;  3TE4 A;  3G8W A;  3IU2 A;  2C27 A;  3FEC A;  1M4D A;  1BPN A;  5LRK A;  2BUE A;  2GFQ A;  3ISX A;  4PPZ A;  5JGF A;  1QSN A;  2GIV A;  2IL4 A;  4KVX A;  2OR4 A;  2PE3 A;  2F5I A;  1P4N A;  2B4D A;  3FB3 A;  1YVO A;  1HDU A;  2EK9 A;  2OZU A;  2VZY A;  3IU1 A;  4GS4 A;  4MFP A;  4OC0 A;  5J8C A;  4OKO A;  3KI9 A;  4XPD C;  4C2Y A;  1KUX A;  5LYF A;  1IYL A;  3G3S A;  3VWE A;  1WWZ A;  2ZW4 A;  4CGO A;  4UBR A;  4UFV A;  3W91 A;  1Y0Y A;  1RXT A;  2ZEE A;  4X5K A;  4UWJ A;  4M6I A;  3S9L A;  4UA3 A;  4B14 A;  3R95 A;  4LQ6 A;  1Q2D A;  1IGB A;  2V8H A;  2NSM A;  4KUB A;  4UEZ A;  1S7K A;  4NSQ A;  3FMC A;  3TC8 A;  1TXR A;  2PDO A;  2VBQ A;  4P4E A;  2RB7 A;  4E0A A;  3CXP A;  4YWY A;  2BEI A;  2G3T A;  3IWE A;  4DYO A;  5DWM A;  1Q2C A;  1UWY A;  3FNC A;  4MMO A;  3S9M A;  3RAM A;  4FD7 A;  4F0X A;  4NXY A;  3T90 A;  2DPT A;  3D4U A;  2JBK A;  1V0C A;  2C1C A;  1UFH A;  1YLE A;  2PJ8 A;  1QST A;  1JWQ A;  4Q7A A;  2ZEP A;  3TCV A;  3WT4 A;  1IOI A;  2JDC A;  3B35 A;  3GKR A;  4Q36 A;  4R3L A;  2PRB A;  4R57 A;  3D8P A;  2ANP A;  4KVM E;  2KCW A;  2GRE A;  3JRU A;  3FF3 A;  1OBR A;  2FIW A;  5H86 A;  5A28 A;  2ZW5 A;  4MHN A;  2Z3N A;  2X7B A;  4HNY B;  5LYL A;  1M4I A;  1R43 A;  4KLV A;  2PQ8 A;  4BBH A;  3LAC A;  2PVV A;  1S7N A;  1YX0 A;  3BJ8 A;  4KOT A;  5D29 A;  2ZEM A;  2OOT A;  3T9Y A;  4DUK A;  4KSI A;  5IB9 A;  2CNS A;  1Y0R A;  3NFZ A;  1X12 A;  3TO6 A;  1TKF A;  2PJ7 A;  1ZG7 A;  3C26 A;  3LOD A;  4PV6 A;  5EMI A;  3R9G A;  2V8D A;  4H2K A;  4NGP A;  2AFS A;  4KUA A;  2Z3O A;  1NSA A;  3CDX A;  4DNC A;  4A33 A;  2Z3P A;  2ABZ A;  1BLL E;  1Q7L A;  1R3N A;  2PSW A;  3N5F A;  4MXU A;  4KOW A;  2PJ4 A;  3DNS A;  3SJG A;  3FRM A;  5G21 A;  3IC1 A;  1Z8X A;  2DF5 A;  2HQY A;  4YFJ A;  1MK4 A;  4KSF A;  4Z65 A;  2OZG A;  2R8V A;  4FWU A;  3PFE A;  5F49 A;  2CXA A;  4P6Y A;  2JLM A;  4B10 A;  4Y49 B;  3FXT A; 
#chains in the Genus database with same CATH homology
 5C88 A;  3IGR A;  4A95 A;  2FE7 A;  1QSR A;  3LD2 A;  1YRE A;  2QEC A;  3PZJ A;  4H6Z A;  4CYO A;  2VQY A;  4XNH B;  3SXO A;  4CGP A;  2ARH A;  3F5B A;  2DPS A;  4CGN A;  4R9M A;  2OU2 A;  1KUV A;  1PU9 A;  1I21 A;  2B5G B;  3MGD A;  3VWD A;  4UFX A;  3P2F A;  1B6B A;  2B3V A;  2YGW A;  4MFJ A;  3OWC A;  2FT0 A;  2OZH A;  4F6A A;  5AG6 A;  4CGM A;  1SQH A;  2FCK A;  4H89 A;  2FSR A;  4B5P B;  4KS9 A;  3S6F A;  4H6U A;  4KOX A;  4CGL A;  2WUU A;  3JTK A;  4AVB A;  2R98 A;  2B4D B;  3S6H A;  2ZPA A;  2QML A;  3CXQ A;  3EO4 A;  1M44 A;  3N7Z A;  4FD4 A;  3FBU A;  4JLY A;  4PK2 A;  1NSL A;  5AG7 A;  2WPX A;  3TTH A;  2NMT A;  3RYO A;  4MHD A;  2A4N A;  1U6M A;  4B5O A;  4IF5 A;  4Q38 A;  4U9Y A;  2REF A;  4CRZ B;  2CNT A;  4NEX A;  4MBU A;  4PK3 A;  4ONU A;  2B4B A;  5H84 A;  4E8O A;  4C7H A;  3PP9 A;  1YGH A;  1Z4E A;  5IV0 A;  4B11 A;  5AGE A;  4OAD A;  4MJ8 A;  4CYP A;  1WK4 A;  3I9S A;  4OLL A;  4B13 A;  2YNE A;  3QB8 A;  2Z10 A;  2GE3 A;  5KTD A;  2Z3K A;  1M4G A;  4MFK A;  4CAF A;  1XMT A;  5JPH A;  5FVJ A;  4KOV A;  1QSM A;  4HKF A;  3B8G A;  3IWG A;  4YRH A;  4EVY A;  1XF8 A;  1YVK A;  2Y0M A;  1S5K A;  5ISV A;  3EY5 A;  3GY9 A;  4KOY A;  2Q4Y A;  4AVA A;  2ZXV A;  4FD5 A;  3DSB A;  2FL4 A;  1XE4 A;  2ZW6 A;  3UY5 A;  5BWA B;  4QC6 A;  4MY3 A;  5IB0 A;  5F46 A;  4L89 A;  4KLW A;  4II9 A;  4E2A A;  2CY2 A;  4MFL A;  3K9U A;  2P0W A;  4B12 A;  2WSA A;  2JEV A;  4AVC A;  1MJA A;  1TIQ A;  1MJ9 A;  2R7H A;  2I79 A;  1YR0 A;  5AG4 A;  1IID A;  4PSX A;  2WPW A;  1M1D A;  1XIX A;  2FIA A;  2EUI A;  3H5Z A;  4AB7 A;  1KZF A;  4CAX A;  5HH1 A;  2BL1 A;  2RC4 A;  5I0C A;  4KVO E;  4JXR A;  3A9L A;  4A31 A;  2ATR A;  4LX9 A;  4JWP A;  1MJB A;  2VI7 A;  5DWN A;  2PR8 A;  4ORF A;  2Z11 A;  1VKC A;  2OB0 A;  3EXN A;  4C7I A;  4UFW A;  2GAN A;  2J8M A;  2EVN A;  2O28 A;  3SXN A;  1XEB A;  5JQ4 A;  5F48 A;  4MI4 A;  4MFZ A;  3I3G A;  2VZZ A;  2AJ6 A;  1VHS A;  1Z9U A;  4XPD B;  3CXS A;  1KUY A;  3E0K A;  2VEZ A;  1OZP A;  5IX3 A;  3ZZI A;  1Z4R A;  4CAV A;  2OH1 A;  4U9Z A;  1RO5 A;  4FD6 A;  4K30 A;  1Y9K A;  2B58 A;  2HUZ A;  1L0C A;  3EFA A;  3R9F A;  2QIR A;  4CYQ A;  4RI1 A;  2Z0Z A;  3GYA A;  2B3U A;  4YGO A;  1S7L A;  3D2M A;  5KTC A;  4MFQ A;  3TOB A;  5G20 A;  4MY0 A;  4XNH C;  1R57 A;  2Q44 A;  2VXK A;  2Q0Y A;  4UWI A;  2B5G A;  2J8R A;  4NF1 A;  1S3Z A;  3R1K A;  1BO4 A;  4JD6 A;  5KTA A;  4XPL A;  1GHE A;  3JVN A;  4A32 A;  4KOR A;  3EC4 A;  4B5P A;  1B87 A;  1I12 A;  3KKW A;  4HNW B;  3ZJ0 A;  1N71 A;  4C68 A;  2JLM A;  4CAE A;  3D2P A;  2I00 A;  2Q04 A;  2BSW A;  3V8I A;  4UCN A;  1ZO0 A;  3BLN A;  4U5Y A;  3WR7 A;  1IYK A;  3PGP A;  2J8N A;  5C82 A;  4KSA A;  4HNX B;  4R87 A;  4CS0 B;  3R96 A;  4A2Z A;  3S6K A;  4OAE A;  3TFY A;  1YK3 A;  3D3S A;  4XPK A;  3DR6 A;  3F0A A;  2D4O A;  4C2X A;  2FXF A;  1PUA A;  4F0Y A;  2PC1 A;  4ZBG A;  4LUA A;  2K5T A;  1NMT A;  4PSW A;  4IUS A;  5F47 A;  3R9E A;  1Q2Y A;  1S7F A;  4KZT A;  4J3G A;  2R1I A;  3FYN A;  4CAW A;  2G0B A;  5G22 A;  2YND A;  3W6S A;  1LRZ A;  1I1D A;  3W6X A;  2H5M A;  3P2H A;  5E96 A;  2Z3L A;  4UCP A;  4JXQ A;  1QSO A;  5CNP A;  5A27 A;  4C2Z A;  4UCM A;  1CM0 A;  4CYN A;  3JUW A;  2D4P A;  3TT2 A;  4M3S A;  1FY7 A;  3S6G A;  1J4J A;  5EBV A;  1IB1 E;  4ZGY B;  4KOS A;  2ZW7 A;  4QBJ A;  3FIX A;  4QVT A;  4KOU A;  2DXQ A;  2PR1 A;  4M85 A;  2P6E A;  3TO7 A;  2Z3M A;  4A30 A;  2Q7B A;  4AG9 A;  5J8F A;  5EC4 A;  4RS2 A;  1Y7R A;  4JJX A;  1P0H A;  1CJW A;  5G1Z A;  1IIC A;  3H4Q A;  2REE A;  4QB9 A;  3DDD A;  2YNC A;  2AE6 A;  2P6F A;  4BMH A;  4NCZ A;  4Y49 C;  3TOA A;  2YNC C;  2G3A A;  5GCN A;  4I49 A;  1S60 A;  2JDD A;  2P6G A;  3QAH A;  1BOB A;  1NE9 A;  4QUS A;  3BJ7 A;  2Q4V A;  3DR8 A;  1Y9W A;  5HMN A;  4L8A A;  4AG7 A;  3F8K A;  4R3K A;  5AG5 A;  2FS5 A;  2HV2 A;  4CRY B;  2CNM A;  3TO9 A;  3TE4 A;  1K4J A;  1ON0 A;  3G8W A;  3IU2 A;  2C27 A;  1M4D A;  2BUE A;  1QSN A;  2GIV A;  2IL4 A;  4KVX A;  2F5I A;  1P4N A;  2B4D A;  3FB3 A;  1YVO A;  2VZY A;  3IU1 A;  2OZU A;  4GS4 A;  4MFP A;  3SHP A;  5J8C A;  4XPD C;  4C2Y A;  1KUX A;  1IYL A;  3G3S A;  3VWE A;  1WWZ A;  2ZW4 A;  4CGO A;  4UBR A;  4UFV A;  3W91 A;  1RXT A;  4X5K A;  4UWJ A;  4UA3 A;  4B14 A;  3R95 A;  1Q2D A;  4KUB A;  1S7K A;  4NSQ A;  2PDO A;  2VBQ A;  4E0A A;  3CXP A;  2BEI A;  2G3T A;  3IWE A;  5DWM A;  1Q2C A;  3FNC A;  4FD7 A;  4F0X A;  4NXY A;  3T90 A;  2DPT A;  1V0C A;  1UFH A;  1YLE A;  1QST A;  3TCV A;  2JDC A;  3GKR A;  4Q36 A;  4R3L A;  2PRB A;  4R57 A;  3D8P A;  4KVM E;  2KCW A;  5A28 A;  2FIW A;  5H86 A;  2ZW5 A;  2Z3N A;  2X7B A;  4HNY B;  1M4I A;  4KLV A;  2PQ8 A;  4BBH A;  1S7N A;  1YX0 A;  3BJ8 A;  4KOT A;  3T9Y A;  2CNS A;  3TO6 A;  3LOD A;  3C26 A;  4PV6 A;  3R9G A;  4KUA A;  2Z3O A;  4DNC A;  4A33 A;  2Z3P A;  2PSW A;  4KOW A;  3DNS A;  3FRM A;  5G21 A;  2HQY A;  4YFJ A;  1MK4 A;  4KSF A;  2OZG A;  2R8V A;  5F49 A;  2CXA A;  3NE7 A;  4B10 A;  4Y49 B;  3FXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...