3G3SA

Crystal structure of gcn5-related n-acetyltransferase-like protein (zp_00874857) (zp_00874857.1) from streptococcus suis 89/1591 at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
GMAEQMRRVARLFGDWPETIIWTCLEGTMGDIYVDDSQSPQSALALYGRQSFFGFLAGQPHRDLLKICEGKNIILVPQNQAWSDLIEEVYGDGVRFFTRYATKKDTEFDLGHLQKLVDDLPESFDMKLIDRNLYETCLVEEWSRDLVGNYIDVEQFLDLGLGCVILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDAHTLTSLKLAEKLGYELDKAYQAYEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title Crystal structure of GCN5-related N-acetyltransferase-like protein (ZP_00874857) (ZP_00874857.1) from Streptococcus suis 89/1591 at 1.80 A resolution
rcsb
source organism Streptococcus suis
molecule tags Transferase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA02
3.40.630.110 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA01
3W91A 1YK3A 2Q0YA 3IGRA 4XPKA 3EC4A 4JLYA 1IIDA 4MJ8A 4JD6A 2PDOA 3E0KA 4E2AA 5JPHA 1J4JA 3DNSA 3TFYA 3K9UA 3R96A 3JUWA 2B5GA 4KOSA 2FE7A 1S3ZA 5GCNA 3TE4A 1MJBA 1FY7A 1PU9A 1ON0A 2R8VA 5DWMA 3R95A 1B6BA 4MY3A 5KTCA 2FIWA 3R9EA 2B4BA 4KVME 4UBRA 2PR8A 4QUSA 1XMTA 3ZZIA 3TOAA 2EUIA 2PSWA 1XE4A 3S6HA 4RS2A 4J3GA 1M4IA 1QSRA 4E8OA 3FRMA 5DWNA 5HH1A 2G3AA 1XEBA 2Z10A 1YGHA 2VBQA 4Y49C 1M44A 1B87A 2FIAA 3DSBA 2BSWA 1IYLA 4U9YA 5C88A 2Q04A 1YX0A 2CNMA 3S6KA 4UWIA 4B5PA 1MJ9A 3F8KA 4XPDC 4PK2A 5FVJA 2NMTA 5F49A 2B3UA 2Y0MA 3FIXA 3I9SA 2VXKA 2HV2A 4R3KA 4M3SA 1S60A 3PGPA 3TO9A 5F46A 2O28A 2JEVA 3NE7A 4K30A 2PR1A 2VEZA 4MHDA 4KUBA 5IB0A 4CAWA 1XF8A 4AVAA 3W6SA 4FD7A 2JDCA 4UWJA 4OADA 3V8IA 2HUZA 5C82A 3LD2A 3D8PA 3D2PA 4NEXA 4QC6A 4I49A 2JDDA 1V0CA 2J8RA 3FNCA 2QIRA 1NSLA 4H6UA 4ONUA 2KCWA 1LRZA 2B4DA 4YRHA 2X7BA 1U6MA 3R9GA 1CM0A 1N71A 3DR8A 3RYOA 4KLWA 4R3LA 4KOVA 4KVXA 2ZW4A 4PV6A 4FD6A 2VI7A 4MBUA 3QB8A 2CY2A 4M85A 2K5TA 3DDDA 4PK3A 3EXNA 3FXTA 4XNHB 2Q44A 2OZGA 2FSRA 3PP9A 1BO4A 4H6ZA 4KUAA 3CXPA 1GHEA 3TCVA 2P6GA 3PZJA 1Z4EA 2IL4A 1IYKA 2WPXA 2RC4A 3W6XA 4CS0B 2I00A 2QECA 4JWPA 2HQYA 3S6GA 1S7LA 2AE6A 2P6EA 2Z11A 2R1IA 1RO5A 4XPLA 2ZW7A 4U9ZA 2ZW5A 1NMTA 4JXRA 4OAEA 2REEA 2WPWA 1Y9KA 2CNTA 3D2MA 1WWZA 5CNPA 2Z0ZA 3BJ8A 2C27A 1KUYA 1QSMA 5KTAA 3VWDA 2OB0A 4AB7A 4FD4A 5I0CA 2VZYA 1QSTA 2BEIA 2H5MA 2DXQA 1S5KA 3D3SA 4HKFA 4AVCA 1VHSA 3EO4A 2I79A 2QMLA 4PSXA 3JVNA 3I3GA 2CNSA 3OWCA 1YR0A 3KKWA 3MGDA 4R57A 1BOBA 3EY5A 4GS4A 5J8CA 2PQ8A 3WR7A 4NF1A 2PC1A 3ZJ0A 4ORFA 1Z4RA 4YFJA 5H86A 2OU2A 4KOUA 3T90A 2F5IA 4CRYB 3SXNA 4U5YA 5E96A 4R9MA 1L0CA 4KZTA 1PUAA 1MK4A 4KVOE 2D4PA 5IV0A 3G3SA 3SHPA 4KOWA 1VKCA 4L8AA 2FS5A 1Z9UA 5F47A 1Y9WA 1RXTA 3R1KA 2ATRA 2BL1A 3TTHA 3N7ZA 4L89A 1TIQA 1M4GA 3R9FA 4HNWB 4LUAA 5H84A 1Q2DA 2G3TA 2ZW6A 2Q4VA 4B5OA 1M4DA 1Q2CA 2B5GB 2R98A 3C26A 2FL4A 3B8GA 4KLVA 2GANA 2PRBA 2B3VA 4JJXA 2OH1A 4NXYA 1P4NA 1KUXA 4HNYB 5EBVA 2GE3A 2BUEA 3CXQA 2A4NA 1IB1E 3H4QA 4XNHC 4F6AA 4DNCA 1S7KA 1MJAA 1XIXA 5KTDA 4E0AA 1QSOA 3SXOA 1Q2YA 1I12A 3VWEA 4QB9A 3FBUA 5J8FA 2OZUA 4QVTA 1WK4A 2VZZA 2ARHA 3UY5A 3TO6A 4CAVA 1I1DA 3FB3A 2D4OA 2EVNA 2P6FA 3GKRA 4YGOA 4RI1A 4F0YA 1Y7RA 3CXSA 2B58A 3F0AA 4B5PB 4HNXB 3P2FA 4H89A 5IX3A 3P2HA 4UA3A 4KORA 5HMNA 4ZBGA 2R7HA 3F5BA 1KUVA 5EC4A 4EVYA 2P0WA 2FCKA 3BLNA 1I21A 4FD5A 1QSNA 2JLMA 1YVOA 3G8WA 3TOBA 4Y49B 1SQHA 4LX9A 1YVKA 4MI4A 3TO7A 2Q4YA 1S7FA 2J8NA 2ZPAA 2REFA 4AG7A 5ISVA 4OLLA 1OZPA 3EFAA 4XPDB 4QBJA 4JXQA 2VQYA 2FXFA 3DR6A 4IUSA 3IWGA 4KOTA 2B4DB 1YREA 4CRZB 1CJWA 2GIVA 4BMHA 2J8MA 3QAHA 1NE9A 1KZFA 2ZXVA 4X5KA 1S7NA 4AVBA 4IF5A 3GYAA 4CAXA 3LODA 2AJ6A 3GY9A 4KOYA 2Q7BA 4NCZA 2OZHA 4NSQA 1IICA 5F48A 1K4JA 1YLEA 3FYNA 1R57A 4KOXA 1M1DA 5JQ4A 3BJ7A 4PSWA 4II9A 2FT0A 1UFHA 4R87A 4AG9A 2G0BA 1P0HA 3TT2A 4MY0A 3S6FA 3T9YA
chains in the Genus database with same CATH superfamily
4Q38A 3W91A 4P4BA 1YK3A 3LACA 1FT7A 3B3VA 2GREA 3FF3A 2HC9A 2WSAA 1Z8XA 2Q0YA 2EO8A 3WC7A 3IGRA 4XPKA 2WYRA 2BCOA 3EC4A 4X3RA 4JLYA 1LAMA 4P4EA 1IIDA 3SI0A 3JTKA 4MCQA 4A30A 4MJ8A 3KQXA 4JD6A 3SJXA 1PYTB 2PDOA 1UWYA 3E0KA 3KQZA 2ZOGA 2Q4ZA 4E2AA 3JRUA 4EWTA 5JPHA 4CYPA 1J4JA 4F9UA 1ELLP 2JEWA 3PB9X 4M6GA 2PJ7A 4WWVA 4UFVA 5LRGA 4CGMA 5HVHA 2CXAA 3DNSA 3IEHA 3TFYA 2ZEOA 3K9UA 3R96A 3JUWA 2B5GA 3GIUA 4KOSA 2FE7A 2C6GA 5EMIA 1S3ZA 5GCNA 3TE4A 4P44A 1MJBA 4DUKA 1FY7A 2I3CA 2V77A 4A33A 1PU9A 4LQ6A 5HVGA 1ON0A 2FVGA 2R8VA 2PJ5A 5DWMA 3R95A 1TKHA 1B6BA 4MY3A 3PB7X 5KTCA 3NE8A 2FIWA 3IWWA 3R9EA 1CPSA 2B4BA 4KVME 1FNOA 2C6CA 4UBRA 2PR8A 4QUSA 3NH4A 1XMTA 4OMEA 3ZZIA 3TOAA 4PXCA 2EUIA 2PSWA 1LOKA 1XE4A 2Z3MA 3S6HA 4OC0A 4RS2A 7CPAA 4J3GA 1F2OA 1QQ9A 1M4IA 2ZOFA 3A9LA 4YU9A 1QSRA 1BPMA 4WJBA 4A37A 1LFWA 4C2XA 4E8OA 4CGOA 2YNEA 3FRMA 5DWNA 4C2YA 2CTBA 4NGNA 5HH1A 2G3AA 3PRTA 1XEBA 3RBUA 2Z10A 1YGHA 2VBQA 4Y49C 3GLJA 1M44A 1B87A 2FIAA 4MHYA 3DSBA 2BSWA 1IYLA 2Q43A 3IFEA 4IK2A 4U9YA 3NA6A 1CX8A 4GXHA 5C88A 4NGMA 4MCPA 2Q04A 1YX0A 4IAVA 1TXRA 2PJ6A 2CNMA 2CF4A 1ZG9A 3MRUA 2JBJA 5ELYA 3S6KA 4B13A 1IOFA 1LANA 2O53A 2WUUA 4JYWA 4MFQA 4UWIA 5LRJA 4P10A 4B5PA 1MJ9A 1Y0YA 2IMOA 3F8KA 4XPDC 1VIXA 1IY7A 3WT4A 4PK2A 5FVJA 3D7DA 2Z3KA 2NMTA 5F49A 2B3UA 2Y0MA 3FEEA 3KI9A 4TWEA 3FIXA 4MXUA 3I9SA 3FMCA 2AFOA 2PJ1A 2XEGA 4X8IA 2VXKA 2ODFA 4MHNA 2HV2A 4R3KA 2ZEFA 4B14A 2DF5A 3B3SA 4M3SA 4B10A 4A32A 1DE4C 4B12A 1IU8A 1S60A 3PGPA 1VHEA 1TKJA 2IJZA 4PXEA 3IIBA 5THWA 3TO9A 5F46A 4CYQA 1ARLA 2AFWA 2O28A 2JEVA 3ISZA 3L2NA 3NE7A 5CPAA 4CGLA 4F0XA 2CTCA 4Z65A 4CYOA 4K30A 2PR1A 5A27A 2VEZA 4MHDA 4P45A 4C7IA 3H5ZA 4KUBA 4UIBA 4CAWA 1XF8A 4AVAA 5CBMA 5IB0A 4R6TA 3B3WA 3W6SA 3KHZA 4FD7A 2JDCA 4UWJA 3TC8A 4M6IA 4OADA 4A39A 3FECA 3BI0A 3PB8X 2HUZA 3V8IA 5C82A 1Z2LA 3LD2A 4MRIA 3D8PA 3D2PA 4NEXA 4OC2A 4QC6A 3D66A 3H8GA 1ZG7A 3B35A 4I49A 1JWQA 2JDDA 3RAMA 2GFQA 1V0CA 4FWUA 2J8RA 2F7VA 3NH5A 3FNCA 1Y0RA 1Z8TA 2QIRA 1TKFA 1HEEA 2AFZA 5G1ZA 1NSLA 4RUHA 4H6UA 4ONUA 4UFWA 2KCWA 3FH4A 1LRZA 2B4DA 4YRHA 1EE3P 1YLOA 2X7BA 1U6MA 4KSAA 1XRYA 4OIWA 3R9GA 1CM0A 2XEJA 2VL1A 1N71A 3DR8A 2Q7SA 2Z3PA 2ZEGA 3RYOA 4KLWA 2PRQA 4R3LA 4CPAA 4KOVA 1XOVA 3IU2A 5A28A 4KVXA 5LYIA 3ISXA 2ZW4A 4PV6A 4ZX9A 5K8MA 4FD6A 2VI7A 2PJ4A 1CP6A 1NSAA 4P4JA 4MBUA 5D8NA 3QB8A 4RN7A 4UCMA 2CY2A 4K3NA 5JH9A 4M85A 2K5TA 3DDDA 3DGVA 4OIDA 4PK3A 3EXNA 3FXTA 4XNHB 2PVVA 2Q44A 2F8HA 1VGYA 2OZGA 8CPAA 2FSRA 3PP9A 4MHZA 4X2TA 1Z8WA 1BO4A 3PFEA 6CPAA 2Z3LA 2V8DA 4H6ZA 2Z3NA 3D68A 4KUAA 3CXPA 4P4FA 4NGSA 1GHEA 1M4LA 3QNVA 3TCVA 1XMBA 2P6GA 1Z4EA 2XEFA 2IL4A 1IYKA 2WPXA 3PZJA 2RC4A 2PJ9A 3W6XA 2ZENA 4CS0B 1X12A 4MFKA 2GLJA 1ZLIA 2I00A 4PXDA 2QECA 3IC1A 4JWPA 2HQYA 4UF4A 3S6GA 1S7LA 3VARA 2AE6A 5JM6A 2P6EA 2Z11A 2R1IA 1RO5A 4XPLA 2ZW7A 4U9ZA 2ZW5A 5LYFA 1NMTA 2AFXA 4JXRA 4OAEA 5HVFA 4JZ0A 4KSFA 2REEA 2WPWA 1Y9KA 3D7FA 4PPZA 5JGFA 2CNTA 3D2MA 1WWZA 4Q36A 5I4MA 5K8PA 5LYLA 3RZAA 2AFMA 4M6HA 5CNPA 2Z0ZA 3BJ8A 2C27A 2ZELA 1KUYA 4MFJA 1QSMA 1ZO0A 1CG2A 2OOTA 5KTAA 3VWDA 2Q51A 3IO1A 4EMEA 3LWUA 4YWYA 1PCAA 2OB0A 4AB7A 4FD4A 2ZEDA 1IOIA 5I0CA 5LRKA 2VZYA 1QSTA 2ZEPA 2BEIA 2H5MA 1YSJA 2DXQA 1S5KA 1A2ZA 3D3SA 5F09A 4HKFA 4ZX8A 1VHSA 4NJQA 4A38A 1YW6A 4AVCA 3EO4A 4NFRA 1CP7A 1CPXA 3CPXA 5HMNA 3SI2A 3BXMA 4MCRA 3H8FA 2I79A 3IWEA 2DEAA 2QMLA 3B3CA 4ZI6A 2PCUA 4PSXA 3JVNA 4TNUA 3I3GA 2CNSA 1HDUA 1ZG8A 1YR0A 3OWCA 4MFZA 4R76A 3KKWA 2YNDA 3MGDA 1BOBA 4R57A 4OC4A 3EY5A 4KS9A 4GS4A 5D29A 3PEIA 5J8CA 2PQ8A 4BD9A 3WR7A 4NF1A 4A95A 4A94A 2PC1A 3ZJ0A 4ORFA 1Z4RA 3H8EA 4YFJA 5H86A 2OU2A 3CZXA 4CAEA 1TF8A 4KOUA 3T90A 2F5IA 2QJ8A 3MN8A 4CRYB 4UEFA 2PIZA 3FEDA 1Z5RA 3FX6A 3I1UA 3SXNA 3WABA 4U5YA 4PQAA 2GLFA 5E96A 4CGPA 2OR4A 4R9MA 1L0CA 4KZTA 2WZNA 4NGQA 4NGTA 5G21A 3SJEA 1PUAA 1MK4A 1VHOA 4KVOE 2D4PA 5AG6A 3G3SA 5G20A 3T8WA 5IV0A 2EK9A 5K8OA 3SHPA 2CIJA 4KOWA 1VKCA 4L8AA 2FS5A 1Z9UA 5F47A 1Y9WA 1RXTA 3R1KA 2ATRA 2BL1A 3KL9A 4A31A 3S9NA 3S9LA 3TTHA 1BLLE 4EFDA 3N7ZA 4L89A 1TIQA 3NH8A 2DPTA 4MMOA 1M4GA 4A2ZA 3WC5A 5AG7A 3PBEA 2DPSA 3R9FA 4HNWB 2POKA 4FUUA 4LUAA 3IJ3A 3TX8A 5H84A 1F2PA 1Q2DA 2G3TA 4NJRA 3D67A 2ZW6A 2Q4VA 4B5OA 3KASA 1M4DA 1Q2CA 2B5GB 2R98A 3C26A 4NGPA 3B2YA 2J9AA 3B7IA 2FL4A 4F8ZA 3B8GA 4UIAA 2ANPA 1LAPA 1X10A 4UCPA 2PE3A 4KLVA 2GANA 2PRBA 2B3VA 4JJXA 2OH1A 2NYQA 4NXYA 3RNZA 4F9VA 1P4NA 1ARMA 3BI1A 1KUXA 2AFUA 3PB6X 5IB9A 4HNYB 2EWBA 5EBVA 2GE3A 2BUEA 4CGNA 3CXQA 4KSIA 2A4NA 1YMEA 1IB1E 2V8VA 3H4QA 2G9DA 4XNHC 4F6AA 4FBEA 4C68A 4DNCA 3SI1A 2QYVA 2PJ3A 1S7KA 1MJAA 1XIXA 3SJGA 5KTDA 4C7HA 4E0AA 1QSOA 4NGRA 3SXOA 3PBBA 1Q2YA 5AG5A 4UCNA 1I12A 2AFSA 2C1CA 1H8LA 3VWEA 4QB9A 4DJLA 3HLPA 3FBUA 1R3NA 4GM5A 5J8FA 1BAVA 4LQGA 2OZUA 4QVTA 1WK4A 2VZZA 2PJCA 2ARHA 3UY5A 3TO6A 4CAVA 4UFXA 4MCSA 1YW4A 1I1DA 3KHXA 3FB3A 3N5FA 2D4OA 2EVNA 2P6FA 3GKRA 1Z8LA 4YGOA 4RI1A 4F0YA 3VATA 1Y7RA 3CXSA 3D7HA 4B11A 3RO0A 2B58A 4OC1A 1Y7EA 2O4HA 2XEIA 4PXBA 4UEEA 3S9MA 3F0AA 3QAYA 2ABZA 4BINA 4W9YA 4B5PB 5HXDA 4HNXB 1OBRA 4IHMA 3P2FA 2PIYA 1RTQA 4H89A 1CBXA 1F57A 5IX3A 2PVWA 1ZLHA 3P2HA 4KORA 4UA3A 1BPNA 4R8FA 3WC6A 2RB7A 2V8HA 3PFOA 4ZBGA 5BWAB 2PJ0A 5DS0A 2R7HA 3CPAA 3F5BA 4UEZA 1KUVA 2YNCC 4P6YA 5EC4A 2V8GA 2QVPA 5J1QA 1DTDA 2JBKA 4EVYA 2P0WA 2FCKA 1R43A 3BLNA 1I21A 4O23A 4OC5A 3V38A 1LCPA 2EBJA 4FD5A 4Q7AA 1QSNA 1Q7LA 1YVOA 2JLMA 3G8WA 3TOBA 3LMSA 4H2KA 1TF9A 4Y49B 5LYDA 3PB4X 4HPSA 1SQHA 2PJ8A 3KZWA 4LX9A 1YVKA 4MI4A 2Z3OA 3TO7A 2Q4YA 4G1PA 1S7FA 4DYOA 2J8NA 2ZPAA 2BO9A 2REFA 2YGWA 4AG7A 2NSMA 1XFOA 3K2KA 3KR4A 4ZGYB 5ISVA 2EK8A 4OLLA 3SJFA 3CT9A 3GB0A 3V7ZA 1OZPA 3EFAA 2PJ2A 4XPDB 3IU1A 4MFPA 4P4IA 1GYTA 4JXQA 4QBJA 1AUGA 2BOAA 4ZY1A 2VQYA 2HB6A 5AG4A 1HDQA 2FXFA 2RFHA 4OP4A 3DR6A 3NFZA 4IUSA 3GUXA 3D4UA 4ONWA 3FJUA 3IWGA 4KOTA 2YNCA 1QMUA 4AXVA 2B4DB 1YREA 4CRZB 5G22A 1CJWA 2GIVA 3HUVA 5AGEA 2ZEEA 4CAFA 4BMHA 2J8MA 4OC3A 3QAHA 1NE9A 1KZFA 2ZXVA 4X5KA 1S7NA 4AVBA 3DLJA 4IF5A 2C6PA 3GYAA 3KGQA 1JQGA 1YQEA 4B6ZA 4CAXA 2PJBA 3LODA 4MHPA 2AJ6A 1XJOA 3GY9A 2IQ6A 2ZEMA 4ZYQA 3VH9A 4C2ZA 1IGBA 4KOYA 1XBUA 2Q7BA 4CYNA 4NCZA 3B3TA 3K9TA 2OZHA 3BHXA 4MFLA 4P4DA 4NSQA 1IICA 5F48A 1K4JA 1YLEA 2ZEHA 2PJAA 4BBHA 1ELMP 1AMPA 4OKOA 4ZY2A 5K8NA 4ZY0A 3FYNA 1R57A 4KOXA 4FAIA 1M1DA 1AYEA 3CDXA 3BJ7A 5JQ4A 4R7MA 2GU2A 4PSWA 4II9A 2FT0A 1UFHA 4R87A 4AG9A 2G0BA 3D7GA 1P0HA 3FVLA 3TT2A 4MY0A 3KR5A 3S6FA 3T9YA 1KWMA
chains in the Genus database with same CATH topology
4Q38A 3W91A 1YK3A 2WSAA 2Q0YA 3IGRA 4XPKA 3EC4A 4JLYA 1IIDA 3JTKA 4A30A 4MJ8A 4JD6A 2PDOA 3E0KA 4E2AA 5JPHA 4CYPA 1J4JA 4UFVA 4CGMA 2CXAA 3DNSA 3TFYA 3K9UA 3R96A 3JUWA 2B5GA 4KOSA 2FE7A 1S3ZA 5GCNA 3TE4A 1MJBA 1FY7A 4A33A 1PU9A 1ON0A 2R8VA 5DWMA 3R95A 1B6BA 4MY3A 5KTCA 2FIWA 3R9EA 2B4BA 4KVME 4UBRA 2PR8A 4QUSA 1XMTA 3ZZIA 3TOAA 2EUIA 2PSWA 1XE4A 2Z3MA 3S6HA 4RS2A 4J3GA 1M4IA 3A9LA 1QSRA 4C2XA 4E8OA 4CGOA 2YNEA 3FRMA 5DWNA 4C2YA 5HH1A 2G3AA 1XEBA 2Z10A 1YGHA 2VBQA 4Y49C 1M44A 1B87A 2FIAA 3DSBA 2BSWA 1IYLA 4U9YA 5C88A 2Q04A 1YX0A 2CNMA 3S6KA 4B13A 2WUUA 4UWIA 4MFQA 4B5PA 1MJ9A 3F8KA 4XPDC 4PK2A 5FVJA 2Z3KA 2NMTA 5F49A 2B3UA 2Y0MA 3FIXA 3I9SA 2VXKA 2HV2A 4R3KA 4B14A 4M3SA 4B10A 4A32A 4B12A 1S60A 3PGPA 3TO9A 5F46A 4CYQA 2O28A 2JEVA 3NE7A 4F0XA 4CGLA 4CYOA 4K30A 2PR1A 5A27A 2VEZA 4MHDA 4C7IA 3H5ZA 4KUBA 4CAWA 5IB0A 1XF8A 4AVAA 3W6SA 4FD7A 2JDCA 4UWJA 4OADA 3V8IA 2HUZA 5C82A 3LD2A 3D8PA 3D2PA 4NEXA 4QC6A 4I49A 2JDDA 1V0CA 2J8RA 3FNCA 2QIRA 5G1ZA 1NSLA 4H6UA 4ONUA 4UFWA 2KCWA 1LRZA 2B4DA 4YRHA 4KSAA 2X7BA 1U6MA 3R9GA 1CM0A 1N71A 3DR8A 2Z3PA 3RYOA 4KLWA 4R3LA 4KOVA 3IU2A 5A28A 4KVXA 2ZW4A 4PV6A 4FD6A 2VI7A 4MBUA 3QB8A 4UCMA 2CY2A 4M85A 2K5TA 3DDDA 4PK3A 3EXNA 3FXTA 4XNHB 2Q44A 2OZGA 2FSRA 3PP9A 1BO4A 2Z3LA 4H6ZA 2Z3NA 4KUAA 3CXPA 1GHEA 3TCVA 2P6GA 3PZJA 1Z4EA 2IL4A 1IYKA 2WPXA 2RC4A 3W6XA 4CS0B 4MFKA 2I00A 2QECA 4JWPA 2HQYA 3S6GA 1S7LA 2AE6A 2P6EA 2Z11A 2R1IA 1RO5A 4XPLA 2ZW7A 4U9ZA 2ZW5A 1NMTA 4JXRA 4OAEA 4KSFA 2REEA 2WPWA 1Y9KA 2CNTA 3D2MA 1WWZA 4Q36A 5CNPA 2Z0ZA 3BJ8A 2C27A 1KUYA 4MFJA 1QSMA 1ZO0A 5KTAA 3VWDA 2OB0A 4AB7A 4FD4A 5I0CA 2VZYA 1QSTA 2BEIA 2H5MA 2DXQA 1S5KA 3D3SA 4HKFA 4AVCA 1VHSA 3EO4A 2I79A 3IWEA 2QMLA 4PSXA 3JVNA 3I3GA 2CNSA 3OWCA 1YR0A 4MFZA 3KKWA 2YNDA 3MGDA 1BOBA 4R57A 3EY5A 4KS9A 4GS4A 5J8CA 2PQ8A 3WR7A 4NF1A 4A95A 2PC1A 3ZJ0A 4ORFA 1Z4RA 4YFJA 5H86A 2OU2A 4CAEA 4KOUA 3T90A 2F5IA 4CRYB 3SXNA 4U5YA 5E96A 4CGPA 4R9MA 1L0CA 4KZTA 5G21A 1PUAA 1MK4A 4KVOE 2D4PA 5AG6A 3G3SA 5G20A 5IV0A 3SHPA 4KOWA 1VKCA 4L8AA 2FS5A 1Z9UA 5F47A 1Y9WA 1RXTA 3R1KA 2ATRA 2BL1A 4A31A 3TTHA 3N7ZA 4L89A 1TIQA 2DPTA 1M4GA 4A2ZA 5AG7A 2DPSA 3R9FA 4HNWB 4LUAA 5H84A 1Q2DA 2G3TA 2ZW6A 2Q4VA 4B5OA 1M4DA 1Q2CA 2B5GB 2R98A 3C26A 2FL4A 3B8GA 4UCPA 4KLVA 2GANA 2PRBA 2B3VA 4JJXA 2OH1A 4NXYA 1P4NA 1KUXA 4HNYB 5EBVA 2GE3A 2BUEA 4CGNA 3CXQA 2A4NA 1IB1E 3H4QA 4XNHC 4F6AA 4C68A 4DNCA 1S7KA 1MJAA 1XIXA 5KTDA 4C7HA 4E0AA 1QSOA 3SXOA 1Q2YA 5AG5A 4UCNA 1I12A 3VWEA 4QB9A 3FBUA 5J8FA 2OZUA 4QVTA 1WK4A 2VZZA 2ARHA 3UY5A 3TO6A 4CAVA 4UFXA 1I1DA 3FB3A 2D4OA 2EVNA 2P6FA 3GKRA 4YGOA 4RI1A 4F0YA 1Y7RA 3CXSA 4B11A 2B58A 3F0AA 4B5PB 4HNXB 3P2FA 4H89A 5IX3A 3P2HA 4UA3A 4KORA 5HMNA 5BWAB 4ZBGA 2R7HA 3F5BA 1KUVA 2YNCC 5EC4A 4EVYA 2P0WA 2FCKA 3BLNA 1I21A 4FD5A 1QSNA 2JLMA 1YVOA 3G8WA 3TOBA 4Y49B 1SQHA 4LX9A 1YVKA 4MI4A 2Z3OA 3TO7A 2Q4YA 1S7FA 2J8NA 2ZPAA 2YGWA 2REFA 4AG7A 4ZGYB 5ISVA 4OLLA 1OZPA 3EFAA 4XPDB 3IU1A 4MFPA 4QBJA 4JXQA 2VQYA 5AG4A 2FXFA 3DR6A 4IUSA 3IWGA 4KOTA 2YNCA 2B4DB 1YREA 4CRZB 5G22A 1CJWA 2GIVA 5AGEA 4CAFA 4BMHA 2J8MA 3QAHA 1NE9A 1KZFA 2ZXVA 4X5KA 1S7NA 4AVBA 4IF5A 3GYAA 4CAXA 3LODA 2AJ6A 3GY9A 4C2ZA 4KOYA 2Q7BA 4CYNA 4NCZA 2OZHA 4MFLA 4NSQA 1IICA 5F48A 1K4JA 1YLEA 4BBHA 3FYNA 1R57A 4KOXA 1M1DA 5JQ4A 3BJ7A 4PSWA 4II9A 2FT0A 1UFHA 4R87A 4AG9A 2G0BA 1P0HA 3TT2A 4MY0A 3S6FA 3T9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W91 A;  1YK3 A;  2Q0Y A;  3IGR A;  4XPK A;  3EC4 A;  4JLY A;  1IID A;  4MJ8 A;  4JD6 A;  2PDO A;  3E0K A;  4E2A A;  5JPH A;  1J4J A;  3DNS A;  3TFY A;  3K9U A;  3R96 A;  3JUW A;  2B5G A;  4KOS A;  2FE7 A;  1S3Z A;  5GCN A;  3TE4 A;  1MJB A;  1FY7 A;  1PU9 A;  1ON0 A;  2R8V A;  5DWM A;  3R95 A;  1B6B A;  4MY3 A;  5KTC A;  2FIW A;  3R9E A;  2B4B A;  4KVM E;  4UBR A;  2PR8 A;  4QUS A;  1XMT A;  3ZZI A;  3TOA A;  2EUI A;  2PSW A;  1XE4 A;  3S6H A;  4RS2 A;  4J3G A;  1M4I A;  1QSR A;  4E8O A;  3FRM A;  5DWN A;  5HH1 A;  2G3A A;  1XEB A;  2Z10 A;  1YGH A;  2VBQ A;  4Y49 C;  1M44 A;  1B87 A;  2FIA A;  3DSB A;  2BSW A;  1IYL A;  4U9Y A;  5C88 A;  2Q04 A;  1YX0 A;  2CNM A;  3S6K A;  4UWI A;  4B5P A;  1MJ9 A;  3F8K A;  4XPD C;  4PK2 A;  5FVJ A;  2NMT A;  5F49 A;  2B3U A;  2Y0M A;  3FIX A;  3I9S A;  2VXK A;  2HV2 A;  4R3K A;  4M3S A;  1S60 A;  3PGP A;  3TO9 A;  5F46 A;  2O28 A;  2JEV A;  3NE7 A;  4K30 A;  2PR1 A;  2VEZ A;  4MHD A;  4KUB A;  5IB0 A;  4CAW A;  1XF8 A;  4AVA A;  3W6S A;  4FD7 A;  2JDC A;  4UWJ A;  4OAD A;  3V8I A;  2HUZ A;  5C82 A;  3LD2 A;  3D8P A;  3D2P A;  4NEX A;  4QC6 A;  4I49 A;  2JDD A;  1V0C A;  2J8R A;  3FNC A;  2QIR A;  1NSL A;  4H6U A;  4ONU A;  2KCW A;  1LRZ A;  2B4D A;  4YRH A;  2X7B A;  1U6M A;  3R9G A;  1CM0 A;  1N71 A;  3DR8 A;  3RYO A;  4KLW A;  4R3L A;  4KOV A;  4KVX A;  2ZW4 A;  4PV6 A;  4FD6 A;  2VI7 A;  4MBU A;  3QB8 A;  2CY2 A;  4M85 A;  2K5T A;  3DDD A;  4PK3 A;  3EXN A;  3FXT A;  4XNH B;  2Q44 A;  2OZG A;  2FSR A;  3PP9 A;  1BO4 A;  4H6Z A;  4KUA A;  3CXP A;  1GHE A;  3TCV A;  2P6G A;  3PZJ A;  1Z4E A;  2IL4 A;  1IYK A;  2WPX A;  2RC4 A;  3W6X A;  4CS0 B;  2I00 A;  2QEC A;  4JWP A;  2HQY A;  3S6G A;  1S7L A;  2AE6 A;  2P6E A;  2Z11 A;  2R1I A;  1RO5 A;  4XPL A;  2ZW7 A;  4U9Z A;  2ZW5 A;  1NMT A;  4JXR A;  4OAE A;  2REE A;  2WPW A;  1Y9K A;  2CNT A;  3D2M A;  1WWZ A;  5CNP A;  2Z0Z A;  3BJ8 A;  2C27 A;  1KUY A;  1QSM A;  5KTA A;  3VWD A;  2OB0 A;  4AB7 A;  4FD4 A;  5I0C A;  2VZY A;  1QST A;  2BEI A;  2H5M A;  2DXQ A;  1S5K A;  3D3S A;  4HKF A;  4AVC A;  1VHS A;  3EO4 A;  2I79 A;  2QML A;  4PSX A;  3JVN A;  3I3G A;  2CNS A;  3OWC A;  1YR0 A;  3KKW A;  3MGD A;  4R57 A;  1BOB A;  3EY5 A;  4GS4 A;  5J8C A;  2PQ8 A;  3WR7 A;  4NF1 A;  2PC1 A;  3ZJ0 A;  4ORF A;  1Z4R A;  4YFJ A;  5H86 A;  2OU2 A;  4KOU A;  3T90 A;  2F5I A;  4CRY B;  3SXN A;  4U5Y A;  5E96 A;  4R9M A;  1L0C A;  4KZT A;  1PUA A;  1MK4 A;  4KVO E;  2D4P A;  5IV0 A;  3G3S A;  3SHP A;  4KOW A;  1VKC A;  4L8A A;  2FS5 A;  1Z9U A;  5F47 A;  1Y9W A;  1RXT A;  3R1K A;  2ATR A;  2BL1 A;  3TTH A;  3N7Z A;  4L89 A;  1TIQ A;  1M4G A;  3R9F A;  4HNW B;  4LUA A;  5H84 A;  1Q2D A;  2G3T A;  2ZW6 A;  2Q4V A;  4B5O A;  1M4D A;  1Q2C A;  2B5G B;  2R98 A;  3C26 A;  2FL4 A;  3B8G A;  4KLV A;  2GAN A;  2PRB A;  2B3V A;  4JJX A;  2OH1 A;  4NXY A;  1P4N A;  1KUX A;  4HNY B;  5EBV A;  2GE3 A;  2BUE A;  3CXQ A;  2A4N A;  1IB1 E;  3H4Q A;  4XNH C;  4F6A A;  4DNC A;  1S7K A;  1MJA A;  1XIX A;  5KTD A;  4E0A A;  1QSO A;  3SXO A;  1Q2Y A;  1I12 A;  3VWE A;  4QB9 A;  3FBU A;  5J8F A;  2OZU A;  4QVT A;  1WK4 A;  2VZZ A;  2ARH A;  3UY5 A;  3TO6 A;  4CAV A;  1I1D A;  3FB3 A;  2D4O A;  2EVN A;  2P6F A;  3GKR A;  4YGO A;  4RI1 A;  4F0Y A;  1Y7R A;  3CXS A;  2B58 A;  3F0A A;  4B5P B;  4HNX B;  3P2F A;  4H89 A;  5IX3 A;  3P2H A;  4UA3 A;  4KOR A;  5HMN A;  4ZBG A;  2R7H A;  3F5B A;  1KUV A;  5EC4 A;  4EVY A;  2P0W A;  2FCK A;  3BLN A;  1I21 A;  4FD5 A;  1QSN A;  2JLM A;  1YVO A;  3G8W A;  3TOB A;  4Y49 B;  1SQH A;  4LX9 A;  1YVK A;  4MI4 A;  3TO7 A;  2Q4Y A;  1S7F A;  2J8N A;  2ZPA A;  2REF A;  4AG7 A;  5ISV A;  4OLL A;  1OZP A;  3EFA A;  4XPD B;  4QBJ A;  4JXQ A;  2VQY A;  2FXF A;  3DR6 A;  4IUS A;  3IWG A;  4KOT A;  2B4D B;  1YRE A;  4CRZ B;  1CJW A;  2GIV A;  4BMH A;  2J8M A;  3QAH A;  1NE9 A;  1KZF A;  2ZXV A;  4X5K A;  1S7N A;  4AVB A;  4IF5 A;  3GYA A;  4CAX A;  3LOD A;  2AJ6 A;  3GY9 A;  4KOY A;  2Q7B A;  4NCZ A;  2OZH A;  4NSQ A;  1IIC A;  5F48 A;  1K4J A;  1YLE A;  3FYN A;  1R57 A;  4KOX A;  1M1D A;  5JQ4 A;  3BJ7 A;  4PSW A;  4II9 A;  2FT0 A;  1UFH A;  4R87 A;  4AG9 A;  2G0B A;  1P0H A;  3TT2 A;  4MY0 A;  3S6F A;  3T9Y A; 
#chains in the Genus database with same CATH topology
 4Q38 A;  3W91 A;  4P4B A;  1YK3 A;  3LAC A;  1FT7 A;  3B3V A;  2GRE A;  3FF3 A;  2HC9 A;  2WSA A;  1Z8X A;  2Q0Y A;  2EO8 A;  3WC7 A;  3IGR A;  4XPK A;  2WYR A;  2BCO A;  3EC4 A;  4X3R A;  4JLY A;  1LAM A;  4P4E A;  1IID A;  3SI0 A;  3JTK A;  4MCQ A;  4A30 A;  4MJ8 A;  3KQX A;  4JD6 A;  3SJX A;  1PYT B;  2PDO A;  1UWY A;  3E0K A;  3KQZ A;  2ZOG A;  2Q4Z A;  4E2A A;  3JRU A;  4EWT A;  5JPH A;  4CYP A;  1J4J A;  4F9U A;  1ELL P;  2JEW A;  3PB9 X;  4M6G A;  2PJ7 A;  4WWV A;  4UFV A;  5LRG A;  4CGM A;  5HVH A;  2CXA A;  3DNS A;  3IEH A;  3TFY A;  2ZEO A;  3K9U A;  3R96 A;  3JUW A;  2B5G A;  3GIU A;  4KOS A;  2FE7 A;  2C6G A;  5EMI A;  1S3Z A;  5GCN A;  3TE4 A;  4P44 A;  1MJB A;  4DUK A;  1FY7 A;  2I3C A;  2V77 A;  4A33 A;  1PU9 A;  4LQ6 A;  5HVG A;  1ON0 A;  2FVG A;  2R8V A;  2PJ5 A;  5DWM A;  3R95 A;  1TKH A;  1B6B A;  4MY3 A;  3PB7 X;  5KTC A;  3NE8 A;  2FIW A;  3IWW A;  3R9E A;  1CPS A;  2B4B A;  4KVM E;  1FNO A;  2C6C A;  4UBR A;  2PR8 A;  4QUS A;  3NH4 A;  1XMT A;  4OME A;  3ZZI A;  3TOA A;  4PXC A;  2EUI A;  2PSW A;  1LOK A;  1XE4 A;  2Z3M A;  3S6H A;  4OC0 A;  4RS2 A;  7CPA A;  4J3G A;  1F2O A;  1QQ9 A;  1M4I A;  2ZOF A;  3A9L A;  4YU9 A;  1QSR A;  1BPM A;  4WJB A;  4A37 A;  1LFW A;  4C2X A;  4E8O A;  4CGO A;  2YNE A;  3FRM A;  5DWN A;  4C2Y A;  2CTB A;  4NGN A;  5HH1 A;  2G3A A;  3PRT A;  1XEB A;  3RBU A;  2Z10 A;  1YGH A;  2VBQ A;  4Y49 C;  3GLJ A;  1M44 A;  1B87 A;  2FIA A;  4MHY A;  3DSB A;  2BSW A;  1IYL A;  2Q43 A;  3IFE A;  4IK2 A;  4U9Y A;  3NA6 A;  1CX8 A;  4GXH A;  5C88 A;  4NGM A;  4MCP A;  2Q04 A;  1YX0 A;  4IAV A;  1TXR A;  2PJ6 A;  2CNM A;  2CF4 A;  1ZG9 A;  3MRU A;  2JBJ A;  5ELY A;  3S6K A;  4B13 A;  1IOF A;  1LAN A;  2O53 A;  2WUU A;  4JYW A;  4MFQ A;  4UWI A;  5LRJ A;  4P10 A;  4B5P A;  1MJ9 A;  1Y0Y A;  2IMO A;  3F8K A;  4XPD C;  1VIX A;  1IY7 A;  3WT4 A;  4PK2 A;  5FVJ A;  3D7D A;  2Z3K A;  2NMT A;  5F49 A;  2B3U A;  2Y0M A;  3FEE A;  3KI9 A;  4TWE A;  3FIX A;  4MXU A;  3I9S A;  3FMC A;  2AFO A;  2PJ1 A;  2XEG A;  4X8I A;  2VXK A;  2ODF A;  4MHN A;  2HV2 A;  4R3K A;  2ZEF A;  4B14 A;  2DF5 A;  3B3S A;  4M3S A;  4B10 A;  4A32 A;  1DE4 C;  4B12 A;  1IU8 A;  1S60 A;  3PGP A;  1VHE A;  1TKJ A;  2IJZ A;  4PXE A;  3IIB A;  5THW A;  3TO9 A;  5F46 A;  4CYQ A;  1ARL A;  2AFW A;  2O28 A;  2JEV A;  3ISZ A;  3L2N A;  3NE7 A;  5CPA A;  4CGL A;  4F0X A;  2CTC A;  4Z65 A;  4CYO A;  4K30 A;  2PR1 A;  5A27 A;  2VEZ A;  4MHD A;  4P45 A;  4C7I A;  3H5Z A;  4KUB A;  4UIB A;  4CAW A;  1XF8 A;  4AVA A;  5CBM A;  5IB0 A;  4R6T A;  3B3W A;  3W6S A;  3KHZ A;  4FD7 A;  2JDC A;  4UWJ A;  3TC8 A;  4M6I A;  4OAD A;  4A39 A;  3FEC A;  3BI0 A;  3PB8 X;  2HUZ A;  3V8I A;  5C82 A;  1Z2L A;  3LD2 A;  4MRI A;  3D8P A;  3D2P A;  4NEX A;  4OC2 A;  4QC6 A;  3D66 A;  3H8G A;  1ZG7 A;  3B35 A;  4I49 A;  1JWQ A;  2JDD A;  3RAM A;  2GFQ A;  1V0C A;  4FWU A;  2J8R A;  2F7V A;  3NH5 A;  3FNC A;  1Y0R A;  1Z8T A;  2QIR A;  1TKF A;  1HEE A;  2AFZ A;  5G1Z A;  1NSL A;  4RUH A;  4H6U A;  4ONU A;  4UFW A;  2KCW A;  3FH4 A;  1LRZ A;  2B4D A;  4YRH A;  1EE3 P;  1YLO A;  2X7B A;  1U6M A;  4KSA A;  1XRY A;  4OIW A;  3R9G A;  1CM0 A;  2XEJ A;  2VL1 A;  1N71 A;  3DR8 A;  2Q7S A;  2Z3P A;  2ZEG A;  3RYO A;  4KLW A;  2PRQ A;  4R3L A;  4CPA A;  4KOV A;  1XOV A;  3IU2 A;  5A28 A;  4KVX A;  5LYI A;  3ISX A;  2ZW4 A;  4PV6 A;  4ZX9 A;  5K8M A;  4FD6 A;  2VI7 A;  2PJ4 A;  1CP6 A;  1NSA A;  4P4J A;  4MBU A;  5D8N A;  3QB8 A;  4RN7 A;  4UCM A;  2CY2 A;  4K3N A;  5JH9 A;  4M85 A;  2K5T A;  3DDD A;  3DGV A;  4OID A;  4PK3 A;  3EXN A;  3FXT A;  4XNH B;  2PVV A;  2Q44 A;  2F8H A;  1VGY A;  2OZG A;  8CPA A;  2FSR A;  3PP9 A;  4MHZ A;  4X2T A;  1Z8W A;  1BO4 A;  3PFE A;  6CPA A;  2Z3L A;  2V8D A;  4H6Z A;  2Z3N A;  3D68 A;  4KUA A;  3CXP A;  4P4F A;  4NGS A;  1GHE A;  1M4L A;  3QNV A;  3TCV A;  1XMB A;  2P6G A;  1Z4E A;  2XEF A;  2IL4 A;  1IYK A;  2WPX A;  3PZJ A;  2RC4 A;  2PJ9 A;  3W6X A;  2ZEN A;  4CS0 B;  1X12 A;  4MFK A;  2GLJ A;  1ZLI A;  2I00 A;  4PXD A;  2QEC A;  3IC1 A;  4JWP A;  2HQY A;  4UF4 A;  3S6G A;  1S7L A;  3VAR A;  2AE6 A;  5JM6 A;  2P6E A;  2Z11 A;  2R1I A;  1RO5 A;  4XPL A;  2ZW7 A;  4U9Z A;  2ZW5 A;  5LYF A;  1NMT A;  2AFX A;  4JXR A;  4OAE A;  5HVF A;  4JZ0 A;  4KSF A;  2REE A;  2WPW A;  1Y9K A;  3D7F A;  4PPZ A;  5JGF A;  2CNT A;  3D2M A;  1WWZ A;  4Q36 A;  5I4M A;  5K8P A;  5LYL A;  3RZA A;  2AFM A;  4M6H A;  5CNP A;  2Z0Z A;  3BJ8 A;  2C27 A;  2ZEL A;  1KUY A;  4MFJ A;  1QSM A;  1ZO0 A;  1CG2 A;  2OOT A;  5KTA A;  3VWD A;  2Q51 A;  3IO1 A;  4EME A;  3LWU A;  4YWY A;  1PCA A;  2OB0 A;  4AB7 A;  4FD4 A;  2ZED A;  1IOI A;  5I0C A;  5LRK A;  2VZY A;  1QST A;  2ZEP A;  2BEI A;  2H5M A;  1YSJ A;  2DXQ A;  1S5K A;  1A2Z A;  3D3S A;  5F09 A;  4HKF A;  4ZX8 A;  1VHS A;  4NJQ A;  4A38 A;  1YW6 A;  4AVC A;  3EO4 A;  4NFR A;  1CP7 A;  1CPX A;  3CPX A;  5HMN A;  3SI2 A;  3BXM A;  4MCR A;  3H8F A;  2I79 A;  3IWE A;  2DEA A;  2QML A;  3B3C A;  4ZI6 A;  2PCU A;  4PSX A;  3JVN A;  4TNU A;  3I3G A;  2CNS A;  1HDU A;  1ZG8 A;  1YR0 A;  3OWC A;  4MFZ A;  4R76 A;  3KKW A;  2YND A;  3MGD A;  1BOB A;  4R57 A;  4OC4 A;  3EY5 A;  4KS9 A;  4GS4 A;  5D29 A;  3PEI A;  5J8C A;  2PQ8 A;  4BD9 A;  3WR7 A;  4NF1 A;  4A95 A;  4A94 A;  2PC1 A;  3ZJ0 A;  4ORF A;  1Z4R A;  3H8E A;  4YFJ A;  5H86 A;  2OU2 A;  3CZX A;  4CAE A;  1TF8 A;  4KOU A;  3T90 A;  2F5I A;  2QJ8 A;  3MN8 A;  4CRY B;  4UEF A;  2PIZ A;  3FED A;  1Z5R A;  3FX6 A;  3I1U A;  3SXN A;  3WAB A;  4U5Y A;  4PQA A;  2GLF A;  5E96 A;  4CGP A;  2OR4 A;  4R9M A;  1L0C A;  4KZT A;  2WZN A;  4NGQ A;  4NGT A;  5G21 A;  3SJE A;  1PUA A;  1MK4 A;  1VHO A;  4KVO E;  2D4P A;  5AG6 A;  3G3S A;  5G20 A;  3T8W A;  5IV0 A;  2EK9 A;  5K8O A;  3SHP A;  2CIJ A;  4KOW A;  1VKC A;  4L8A A;  2FS5 A;  1Z9U A;  5F47 A;  1Y9W A;  1RXT A;  3R1K A;  2ATR A;  2BL1 A;  3KL9 A;  4A31 A;  3S9N A;  3S9L A;  3TTH A;  1BLL E;  4EFD A;  3N7Z A;  4L89 A;  1TIQ A;  3NH8 A;  2DPT A;  4MMO A;  1M4G A;  4A2Z A;  3WC5 A;  5AG7 A;  3PBE A;  2DPS A;  3R9F A;  4HNW B;  2POK A;  4FUU A;  4LUA A;  3IJ3 A;  3TX8 A;  5H84 A;  1F2P A;  1Q2D A;  2G3T A;  4NJR A;  3D67 A;  2ZW6 A;  2Q4V A;  4B5O A;  3KAS A;  1M4D A;  1Q2C A;  2B5G B;  2R98 A;  3C26 A;  4NGP A;  3B2Y A;  2J9A A;  3B7I A;  2FL4 A;  4F8Z A;  3B8G A;  4UIA A;  2ANP A;  1LAP A;  1X10 A;  4UCP A;  2PE3 A;  4KLV A;  2GAN A;  2PRB A;  2B3V A;  4JJX A;  2OH1 A;  2NYQ A;  4NXY A;  3RNZ A;  4F9V A;  1P4N A;  1ARM A;  3BI1 A;  1KUX A;  2AFU A;  3PB6 X;  5IB9 A;  4HNY B;  2EWB A;  5EBV A;  2GE3 A;  2BUE A;  4CGN A;  3CXQ A;  4KSI A;  2A4N A;  1YME A;  1IB1 E;  2V8V A;  3H4Q A;  2G9D A;  4XNH C;  4F6A A;  4FBE A;  4C68 A;  4DNC A;  3SI1 A;  2QYV A;  2PJ3 A;  1S7K A;  1MJA A;  1XIX A;  3SJG A;  5KTD A;  4C7H A;  4E0A A;  1QSO A;  4NGR A;  3SXO A;  3PBB A;  1Q2Y A;  5AG5 A;  4UCN A;  1I12 A;  2AFS A;  2C1C A;  1H8L A;  3VWE A;  4QB9 A;  4DJL A;  3HLP A;  3FBU A;  1R3N A;  4GM5 A;  5J8F A;  1BAV A;  4LQG A;  2OZU A;  4QVT A;  1WK4 A;  2VZZ A;  2PJC A;  2ARH A;  3UY5 A;  3TO6 A;  4CAV A;  4UFX A;  4MCS A;  1YW4 A;  1I1D A;  3KHX A;  3FB3 A;  3N5F A;  2D4O A;  2EVN A;  2P6F A;  3GKR A;  1Z8L A;  4YGO A;  4RI1 A;  4F0Y A;  3VAT A;  1Y7R A;  3CXS A;  3D7H A;  4B11 A;  3RO0 A;  2B58 A;  4OC1 A;  1Y7E A;  2O4H A;  2XEI A;  4PXB A;  4UEE A;  3S9M A;  3F0A A;  3QAY A;  2ABZ A;  4BIN A;  4W9Y A;  4B5P B;  5HXD A;  4HNX B;  1OBR A;  4IHM A;  3P2F A;  2PIY A;  1RTQ A;  4H89 A;  1CBX A;  1F57 A;  5IX3 A;  2PVW A;  1ZLH A;  3P2H A;  4KOR A;  4UA3 A;  1BPN A;  4R8F A;  3WC6 A;  2RB7 A;  2V8H A;  3PFO A;  4ZBG A;  5BWA B;  2PJ0 A;  5DS0 A;  2R7H A;  3CPA A;  3F5B A;  4UEZ A;  1KUV A;  2YNC C;  4P6Y A;  5EC4 A;  2V8G A;  2QVP A;  5J1Q A;  1DTD A;  2JBK A;  4EVY A;  2P0W A;  2FCK A;  1R43 A;  3BLN A;  1I21 A;  4O23 A;  4OC5 A;  3V38 A;  1LCP A;  2EBJ A;  4FD5 A;  4Q7A A;  1QSN A;  1Q7L A;  1YVO A;  2JLM A;  3G8W A;  3TOB A;  3LMS A;  4H2K A;  1TF9 A;  4Y49 B;  5LYD A;  3PB4 X;  4HPS A;  1SQH A;  2PJ8 A;  3KZW A;  4LX9 A;  1YVK A;  4MI4 A;  2Z3O A;  3TO7 A;  2Q4Y A;  4G1P A;  1S7F A;  4DYO A;  2J8N A;  2ZPA A;  2BO9 A;  2REF A;  2YGW A;  4AG7 A;  2NSM A;  1XFO A;  3K2K A;  3KR4 A;  4ZGY B;  5ISV A;  2EK8 A;  4OLL A;  3SJF A;  3CT9 A;  3GB0 A;  3V7Z A;  1OZP A;  3EFA A;  2PJ2 A;  4XPD B;  3IU1 A;  4MFP A;  4P4I A;  1GYT A;  4JXQ A;  4QBJ A;  1AUG A;  2BOA A;  4ZY1 A;  2VQY A;  2HB6 A;  5AG4 A;  1HDQ A;  2FXF A;  2RFH A;  4OP4 A;  3DR6 A;  3NFZ A;  4IUS A;  3GUX A;  3D4U A;  4ONW A;  3FJU A;  3IWG A;  4KOT A;  2YNC A;  1QMU A;  4AXV A;  2B4D B;  1YRE A;  4CRZ B;  5G22 A;  1CJW A;  2GIV A;  3HUV A;  5AGE A;  2ZEE A;  4CAF A;  4BMH A;  2J8M A;  4OC3 A;  3QAH A;  1NE9 A;  1KZF A;  2ZXV A;  4X5K A;  1S7N A;  4AVB A;  3DLJ A;  4IF5 A;  2C6P A;  3GYA A;  3KGQ A;  1JQG A;  1YQE A;  4B6Z A;  4CAX A;  2PJB A;  3LOD A;  4MHP A;  2AJ6 A;  1XJO A;  3GY9 A;  2IQ6 A;  2ZEM A;  4ZYQ A;  3VH9 A;  4C2Z A;  1IGB A;  4KOY A;  1XBU A;  2Q7B A;  4CYN A;  4NCZ A;  3B3T A;  3K9T A;  2OZH A;  3BHX A;  4MFL A;  4P4D A;  4NSQ A;  1IIC A;  5F48 A;  1K4J A;  1YLE A;  2ZEH A;  2PJA A;  4BBH A;  1ELM P;  1AMP A;  4OKO A;  4ZY2 A;  5K8N A;  4ZY0 A;  3FYN A;  1R57 A;  4KOX A;  4FAI A;  1M1D A;  1AYE A;  3CDX A;  3BJ7 A;  5JQ4 A;  4R7M A;  2GU2 A;  4PSW A;  4II9 A;  2FT0 A;  1UFH A;  4R87 A;  4AG9 A;  2G0B A;  3D7G A;  1P0H A;  3FVL A;  3TT2 A;  4MY0 A;  3KR5 A;  3S6F A;  3T9Y A;  1KWM A; 
#chains in the Genus database with same CATH homology
 4Q38 A;  3W91 A;  1YK3 A;  2WSA A;  2Q0Y A;  3IGR A;  4XPK A;  3EC4 A;  4JLY A;  1IID A;  3JTK A;  4A30 A;  4MJ8 A;  4JD6 A;  2PDO A;  3E0K A;  4E2A A;  5JPH A;  4CYP A;  1J4J A;  4UFV A;  4CGM A;  2CXA A;  3DNS A;  3TFY A;  3K9U A;  3R96 A;  3JUW A;  2B5G A;  4KOS A;  2FE7 A;  1S3Z A;  5GCN A;  3TE4 A;  1MJB A;  1FY7 A;  4A33 A;  1PU9 A;  1ON0 A;  2R8V A;  5DWM A;  3R95 A;  1B6B A;  4MY3 A;  5KTC A;  2FIW A;  3R9E A;  2B4B A;  4KVM E;  4UBR A;  2PR8 A;  4QUS A;  1XMT A;  3ZZI A;  3TOA A;  2EUI A;  2PSW A;  1XE4 A;  2Z3M A;  3S6H A;  4RS2 A;  4J3G A;  1M4I A;  3A9L A;  1QSR A;  4C2X A;  4E8O A;  4CGO A;  2YNE A;  3FRM A;  5DWN A;  4C2Y A;  5HH1 A;  2G3A A;  1XEB A;  2Z10 A;  1YGH A;  2VBQ A;  4Y49 C;  1M44 A;  1B87 A;  2FIA A;  3DSB A;  2BSW A;  1IYL A;  4U9Y A;  5C88 A;  2Q04 A;  1YX0 A;  2CNM A;  3S6K A;  4B13 A;  2WUU A;  4UWI A;  4MFQ A;  4B5P A;  1MJ9 A;  3F8K A;  4XPD C;  4PK2 A;  5FVJ A;  2Z3K A;  2NMT A;  5F49 A;  2B3U A;  2Y0M A;  3FIX A;  3I9S A;  2VXK A;  2HV2 A;  4R3K A;  4B14 A;  4M3S A;  4B10 A;  4A32 A;  4B12 A;  1S60 A;  3PGP A;  3TO9 A;  5F46 A;  4CYQ A;  2O28 A;  2JEV A;  3NE7 A;  4F0X A;  4CGL A;  4CYO A;  4K30 A;  2PR1 A;  5A27 A;  2VEZ A;  4MHD A;  4C7I A;  3H5Z A;  4KUB A;  4CAW A;  5IB0 A;  1XF8 A;  4AVA A;  3W6S A;  4FD7 A;  2JDC A;  4UWJ A;  4OAD A;  3V8I A;  2HUZ A;  5C82 A;  3LD2 A;  3D8P A;  3D2P A;  4NEX A;  4QC6 A;  4I49 A;  2JDD A;  1V0C A;  2J8R A;  3FNC A;  2QIR A;  5G1Z A;  1NSL A;  4H6U A;  4ONU A;  4UFW A;  2KCW A;  1LRZ A;  2B4D A;  4YRH A;  4KSA A;  2X7B A;  1U6M A;  3R9G A;  1CM0 A;  1N71 A;  3DR8 A;  2Z3P A;  3RYO A;  4KLW A;  4R3L A;  4KOV A;  3IU2 A;  5A28 A;  4KVX A;  2ZW4 A;  4PV6 A;  4FD6 A;  2VI7 A;  4MBU A;  3QB8 A;  4UCM A;  2CY2 A;  4M85 A;  2K5T A;  3DDD A;  4PK3 A;  3EXN A;  3FXT A;  4XNH B;  2Q44 A;  2OZG A;  2FSR A;  3PP9 A;  1BO4 A;  2Z3L A;  4H6Z A;  2Z3N A;  4KUA A;  3CXP A;  1GHE A;  3TCV A;  2P6G A;  3PZJ A;  1Z4E A;  2IL4 A;  1IYK A;  2WPX A;  2RC4 A;  3W6X A;  4CS0 B;  4MFK A;  2I00 A;  2QEC A;  4JWP A;  2HQY A;  3S6G A;  1S7L A;  2AE6 A;  2P6E A;  2Z11 A;  2R1I A;  1RO5 A;  4XPL A;  2ZW7 A;  4U9Z A;  2ZW5 A;  1NMT A;  4JXR A;  4OAE A;  4KSF A;  2REE A;  2WPW A;  1Y9K A;  2CNT A;  3D2M A;  1WWZ A;  4Q36 A;  5CNP A;  2Z0Z A;  3BJ8 A;  2C27 A;  1KUY A;  4MFJ A;  1QSM A;  1ZO0 A;  5KTA A;  3VWD A;  2OB0 A;  4AB7 A;  4FD4 A;  5I0C A;  2VZY A;  1QST A;  2BEI A;  2H5M A;  2DXQ A;  1S5K A;  3D3S A;  4HKF A;  4AVC A;  1VHS A;  3EO4 A;  2I79 A;  3IWE A;  2QML A;  4PSX A;  3JVN A;  3I3G A;  2CNS A;  3OWC A;  1YR0 A;  4MFZ A;  3KKW A;  2YND A;  3MGD A;  1BOB A;  4R57 A;  3EY5 A;  4KS9 A;  4GS4 A;  5J8C A;  2PQ8 A;  3WR7 A;  4NF1 A;  4A95 A;  2PC1 A;  3ZJ0 A;  4ORF A;  1Z4R A;  4YFJ A;  5H86 A;  2OU2 A;  4CAE A;  4KOU A;  3T90 A;  2F5I A;  4CRY B;  3SXN A;  4U5Y A;  5E96 A;  4CGP A;  4R9M A;  1L0C A;  4KZT A;  5G21 A;  1PUA A;  1MK4 A;  4KVO E;  2D4P A;  5AG6 A;  3G3S A;  5G20 A;  5IV0 A;  3SHP A;  4KOW A;  1VKC A;  4L8A A;  2FS5 A;  1Z9U A;  5F47 A;  1Y9W A;  1RXT A;  3R1K A;  2ATR A;  2BL1 A;  4A31 A;  3TTH A;  3N7Z A;  4L89 A;  1TIQ A;  2DPT A;  1M4G A;  4A2Z A;  5AG7 A;  2DPS A;  3R9F A;  4HNW B;  4LUA A;  5H84 A;  1Q2D A;  2G3T A;  2ZW6 A;  2Q4V A;  4B5O A;  1M4D A;  1Q2C A;  2B5G B;  2R98 A;  3C26 A;  2FL4 A;  3B8G A;  4UCP A;  4KLV A;  2GAN A;  2PRB A;  2B3V A;  4JJX A;  2OH1 A;  4NXY A;  1P4N A;  1KUX A;  4HNY B;  5EBV A;  2GE3 A;  2BUE A;  4CGN A;  3CXQ A;  2A4N A;  1IB1 E;  3H4Q A;  4XNH C;  4F6A A;  4C68 A;  4DNC A;  1S7K A;  1MJA A;  1XIX A;  5KTD A;  4C7H A;  4E0A A;  1QSO A;  3SXO A;  1Q2Y A;  5AG5 A;  4UCN A;  1I12 A;  3VWE A;  4QB9 A;  3FBU A;  5J8F A;  2OZU A;  4QVT A;  1WK4 A;  2VZZ A;  2ARH A;  3UY5 A;  3TO6 A;  4CAV A;  4UFX A;  1I1D A;  3FB3 A;  2D4O A;  2EVN A;  2P6F A;  3GKR A;  4YGO A;  4RI1 A;  4F0Y A;  1Y7R A;  3CXS A;  4B11 A;  2B58 A;  3F0A A;  4B5P B;  4HNX B;  3P2F A;  4H89 A;  5IX3 A;  3P2H A;  4UA3 A;  4KOR A;  5HMN A;  5BWA B;  4ZBG A;  2R7H A;  3F5B A;  1KUV A;  2YNC C;  5EC4 A;  4EVY A;  2P0W A;  2FCK A;  3BLN A;  1I21 A;  4FD5 A;  1QSN A;  2JLM A;  1YVO A;  3G8W A;  3TOB A;  4Y49 B;  1SQH A;  4LX9 A;  1YVK A;  4MI4 A;  2Z3O A;  3TO7 A;  2Q4Y A;  1S7F A;  2J8N A;  2ZPA A;  2YGW A;  2REF A;  4AG7 A;  4ZGY B;  5ISV A;  4OLL A;  1OZP A;  3EFA A;  4XPD B;  3IU1 A;  4MFP A;  4QBJ A;  4JXQ A;  2VQY A;  5AG4 A;  2FXF A;  3DR6 A;  4IUS A;  3IWG A;  4KOT A;  2YNC A;  2B4D B;  1YRE A;  4CRZ B;  5G22 A;  1CJW A;  2GIV A;  5AGE A;  4CAF A;  4BMH A;  2J8M A;  3QAH A;  1NE9 A;  1KZF A;  2ZXV A;  4X5K A;  1S7N A;  4AVB A;  4IF5 A;  3GYA A;  4CAX A;  3LOD A;  2AJ6 A;  3GY9 A;  4C2Z A;  4KOY A;  2Q7B A;  4CYN A;  4NCZ A;  2OZH A;  4MFL A;  4NSQ A;  1IIC A;  5F48 A;  1K4J A;  1YLE A;  4BBH A;  3FYN A;  1R57 A;  4KOX A;  1M1D A;  5JQ4 A;  3BJ7 A;  4PSW A;  4II9 A;  2FT0 A;  1UFH A;  4R87 A;  4AG9 A;  2G0B A;  1P0H A;  3TT2 A;  4MY0 A;  3S6F A;  3T9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...