3G3SA

Crystal structure of gcn5-related n-acetyltransferase-like protein (zp_00874857) (zp_00874857.1) from streptococcus suis 89/1591 at 1.80 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
249
Chain Sequence
GMAEQMRRVARLFGDWPETIIWTCLEGTMGDIYVDDSQSPQSALALYGRQSFFGFLAGQPHRDLLKICEGKNIILVPQNQAWSDLIEEVYGDGVRFFTRYATKKDTEFDLGHLQKLVDDLPESFDMKLIDRNLYETCLVEEWSRDLVGNYIDVEQFLDLGLGCVILHKGQVVSGASSYASYSAGIEIEVDTREDYRGLGLAKACAAQLILACLDRGLYPSWDAHTLTSLKLAEKLGYELDKAYQAYEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GCN5-related N-acetyltransferase-like protein (ZP_00874857) (ZP_00874857.1) from Streptococcus suis 89/1591 at 1.80 A resolution
rcsb
source organism Streptococcus suis
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
total genus 82
structure length 249
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA02
3.40.630.110 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3g3sA01
1VKCA 1XF8A 1YLEA 3E0KA 4LUAA 4M3SA 5KTAA 5DWMA 1S7KA 5F48A 1Y9WA 1QSRA 1Z9UA 1L0CA 1QSTA 4NXYA 1YK3A 3S6HA 3PGPA 4MY3A 5I0CA 3QB8A 2CNSA 3D2MA 3CXSA 1YVKA 3EC4A 4Y49C 1QSNA 2HQYA 4JJXA 4KOSA 1NSLA 1XIXA 3TO9A 1I21A 3SXNA 4U5YA 4KVME 2VEZA 5C88A 2FSRA 1XMTA 3TT2A 1QSOA 3S6KA 4B5PA 4NSQA 3R95A 3N7ZA 3S6FA 4XNHB 2FS5A 2KCWA 2OZHA 2A4NA 2FCKA 2OH1A 2P6EA 3PP9A 1IICA 2G3TA 1M4DA 2JLMA 4UBRA 5KTCA 3BJ8A 3T9YA 3RYOA 1B6BA 1Z4EA 4E0AA 4F0YA 2AE6A 2Q04A 1MJ9A 1YGHA 1WK4A 4KOXA 4LX9A 2FL4A 4M85A 4BMHA 2BEIA 2BL1A 1P0HA 2CNMA 4JD6A 2VBQA 2PQ8A 2JDDA 3T90A 1Q2DA 4DNCA 1YR0A 2ZW6A 3BLNA 5H84A 2Q4VA 1SQHA 2PRBA 4YRHA 4AG9A 1S5KA 1YX0A 3B8GA 1R57A 4PSWA 1B87A 2I00A 3TCVA 3LODA 4CAXA 1I1DA 2R1IA 4FD6A 4Y49B 1ON0A 1S7LA 3G8WA 4MBUA 3P2HA 3FRMA 2FXFA 3W91A 1M4GA 4I49A 2O28A 1PU9A 1BO4A 4YFJA 1OZPA 2VI7A 1BOBA 1CJWA 1IIDA 4FD5A 4J3GA 1UFHA 2PDOA 4UWJA 3K9UA 2FIWA 2PC1A 3DDDA 4YGOA 1IB1E 2QECA 5E96A 3SHPA 3P2FA 4MY0A 2REEA 2HV2A 2JEVA 2R7HA 1CM0A 1Q2CA 2GANA 3FYNA 2J8RA 5CNPA 2ATRA 3F5BA 3KKWA 4H6ZA 1IYLA 2GE3A 4ONUA 3R96A 4PK3A 4H89A 5EBVA 3R9GA 4U9YA 1PUAA 3JVNA 4AVCA 1GHEA 2B5GB 2P0WA 4FD4A 3TFYA 2F5IA 4AVAA 2NMTA 4QC6A 3EY5A 2Z10A 2ZW7A 5KTDA 3EFAA 4U9ZA 4L89A 5HH1A 2EUIA 5IX3A 1WWZA 2Q44A 3F0AA 5HMNA 3FIXA 2FIAA 2VQYA 2B58A 1Z4RA 4JLYA 2OZGA 2ARHA 4KUBA 3TOAA 4EVYA 3DSBA 4KZTA 1S7FA 4CAVA 3C26A 1RO5A 1MJAA 4H6UA 5DWNA 3CXPA 3EO4A 1YREA 2DXQA 4KLVA 2B4BA 2PR8A 3IGRA 3R1KA 1XEBA 2HUZA 3IWGA 2VZYA 4XPKA 4AVBA 5JQ4A 1S3ZA 2D4OA 4ZBGA 5FVJA 1MK4A 2J8MA 3JUWA 4CS0B 4R9MA 2OU2A 3QAHA 5C82A 2QMLA 3R9FA 4KVXA 2RC4A 4JWPA 3GYAA 2P6FA 4KOWA 2B3UA 1XE4A 3NE7A 4HNWB 4JXRA 2QIRA 5ISVA 4HKFA 2WPXA 2Q4YA 3TOBA 1KUVA 1S60A 3MGDA 4XNHC 2Z0ZA 4RS2A 4XPLA 4GS4A 1RXTA 4PV6A 4R57A 4E8OA 2D4PA 4KOUA 5F47A 3G3SA 5GCNA 4HNXB 4MHDA 4E2AA 2VXKA 3SXOA 3FB3A 2K5TA 4KVOE 2G0BA 3TO7A 5IB0A 4AB7A 4OAEA 4R3KA 4JXQA 2BSWA 3V8IA 4QVTA 2FT0A 1P4NA 3WR7A 4II9A 3DNSA 4PK2A 3ZZIA 1N71A 3D2PA 1FY7A 4UA3A 5J8FA 3R9EA 2CNTA 1IYKA 4KOYA 4QB9A 4UWIA 2R8VA 2ZXVA 1NMTA 4F6AA 3ZJ0A 1K4JA 4ORFA 1Q2YA 3I3GA 4X5KA 5F49A 3I9SA 4XPDC 2GIVA 2P6GA 2H5MA 2I79A 4NF1A 2PR1A 3FBUA 3CXQA 1U6MA 4IF5A 4QUSA 3D3SA 1S7NA 1I12A 3DR8A 4QBJA 2PSWA 2CY2A 5H86A 3F8KA 3W6XA 4PSXA 1M4IA 2R98A 3OWCA 2FE7A 2B5GA 2B4DA 2ZPAA 2G3AA 5JPHA 4HNYB 4CRZB 3PZJA 1NE9A 4L8AA 4OADA 1YVOA 4KOVA 4R87A 4B5PB 2BUEA 4CAWA 2Z11A 4NCZA 3S6GA 2Q7BA 2JDCA 5EC4A 2OB0A 3H4QA 3VWEA 2REFA 2IL4A 1KUXA 3FNCA 1KUYA 2Q0YA 4MJ8A 3TO6A 1LRZA 3BJ7A 1MJBA 3GKRA 2X7BA 1QSMA 4K30A 3TE4A 3GY9A 2OZUA 3EXNA 5F46A 3LD2A 2C27A 2VZZA 2J8NA 4KORA 4KUAA 1Y9KA 2EVNA 3TTHA 4KOTA 3UY5A 2ZW4A 4R3LA 2Y0MA 2ZW5A 4IUSA 1Y7RA 4KLWA 4FD7A 2B4DB 4CRYB 1V0CA 4OLLA 1J4JA 1M44A 1VHSA 3VWDA 3DR6A 2AJ6A 5J8CA 1M1DA 2B3VA 4XPDB 2WPWA 3D8PA 1TIQA 4RI1A 5IV0A 4MI4A 3W6SA 4B5OA 4AG7A 3FXTA 4NEXA 1KZFA
chains in the Genus database with same CATH superfamily
1VKCA 1TF8A 1XF8A 1YLEA 3WT4A 5LYIA 3E0KA 3KL9A 4BBHA 4LUAA 4M3SA 4MHYA 1AUGA 1ELLP 4F8ZA 2Q43A 5KTAA 5DWMA 3IC1A 4ZY0A 1S7KA 2QVPA 2Z3MA 4ZYQA 5F48A 1Y9WA 4PXEA 1QSRA 1Z9UA 6CPAA 1L0CA 1QSTA 4NXYA 3BHXA 1YK3A 3S6HA 4MFKA 5IB9A 3PGPA 4MY3A 5I0CA 3QB8A 2G9DA 4Q38A 2CNSA 3HUVA 4CYOA 3D2MA 2CF4A 1TKJA 3CXSA 1YVKA 3EC4A 4Y49C 1A2ZA 1XBUA 1XJOA 3SJFA 5CPAA 4CYNA 1QSNA 1HDUA 3K9TA 4B13A 2HQYA 4JJXA 4KOSA 1TKFA 3I1UA 2AFWA 1NSLA 1XIXA 5AG5A 3TO9A 4CYQA 1I21A 3IWEA 4CGNA 3SXNA 3KQZA 3WC5A 2EO8A 4U5YA 4KVME 2VEZA 4LQGA 5C88A 7CPAA 2FSRA 1XMTA 3TT2A 2ABZA 4PQAA 1QSOA 3S6KA 1LAPA 4B5PA 2CTBA 3KGQA 4OC0A 4NSQA 3R95A 4OMEA 2AFXA 3N7ZA 5HXDA 1CP6A 4IHMA 5LRGA 3S6FA 2JBKA 4TNUA 4XNHB 4CYPA 2FS5A 2KCWA 2OZHA 4NGRA 2A4NA 3FF3A 2FCKA 3B7IA 2PCUA 4EWTA 2OH1A 2P6EA 3PP9A 3MN8A 1IICA 5D8NA 4W9YA 2G3TA 4ZX9A 3IO1A 4C2ZA 1M4DA 2JLMA 3D4UA 3NH5A 3BJ8A 4OIDA 4UBRA 1ARMA 3RYOA 3T9YA 2ZELA 1B6BA 5KTCA 4FUUA 5LYDA 4R6TA 1Z4EA 3DLJA 3D68A 4E0AA 2AE6A 3FX6A 4F0YA 1Z2LA 5JM6A 2WZNA 2AFSA 2Q04A 5K8OA 4R76A 1MJ9A 1YGHA 1DTDA 1WK4A 4KOXA 4LX9A 1VIXA 2FL4A 4M85A 4BMHA 3PEIA 3H8FA 2BEIA 2BL1A 4UF4A 4FAIA 1P0HA 4X2TA 1R3NA 1FT7A 2CNMA 4JD6A 4P44A 2PJBA 3LWUA 2VBQA 1ZG9A 2C6GA 2PQ8A 3IU1A 1CPSA 4A37A 2JDDA 4C68A 3T90A 8CPAA 3RZAA 3L2NA 1Q2DA 4DNCA 3NH8A 1QMUA 4LQ6A 1YR0A 2CTCA 2ZW6A 3BLNA 5H84A 2HB6A 2Q4VA 1SQHA 1BPMA 1JQGA 4Q7AA 2PRBA 2EBJA 4P6YA 4YRHA 3FH4A 4AG9A 4DJLA 4A33A 2EK8A 1S5KA 4F9VA 4A30A 1YX0A 3B8GA 1R57A 3GLJA 4PSWA 3S9LA 1B87A 2I00A 2DF5A 4OC2A 2FVGA 4KSIA 1Z8LA 1HDQA 4UEEA 4UCPA 3TCVA 3LODA 2PVVA 4CAXA 1I1DA 1TXRA 3GB0A 2R1IA 1IY7A 5A27A 4MHPA 4FD6A 4Y49B 1ON0A 1S7LA 4JYWA 3G8WA 4OC1A 5HVGA 4MBUA 3P2HA 3B3VA 3D7DA 3PB9X 5HVHA 1LCPA 3FRMA 3KR4A 4Q36A 4FBEA 5I4MA 3PB7X 4MXUA 2FXFA 3W91A 1M4GA 4P45A 4C2XA 4I49A 2O28A 1PU9A 1BO4A 4PPZA 4YFJA 1OZPA 4UFVA 2VI7A 1BOBA 1CJWA 1IIDA 2V8HA 4FD5A 4J3GA 1UFHA 2PDOA 1YW4A 4P4BA 4UWJA 3CDXA 5HVFA 3B3SA 3K9UA 2FIWA 2VL1A 1DE4C 3CPXA 3IWWA 2PC1A 2V8GA 2ZOFA 1IB1E 2NYQA 2QECA 2Z3LA 3CZXA 3DDDA 3P2FA 3QNVA 4K3NA 4MCPA 4MY0A 5E96A 3FEDA 4MHNA 4UFWA 1LOKA 3B2YA 2REEA 3H5ZA 3ISZA 2HV2A 2JEVA 2R7HA 1CM0A 1Z5RA 2GU2A 4M6IA 1Q2CA 1IU8A 4NGPA 2DEAA 3LACA 2GANA 2V8DA 3FYNA 2J8RA 5CNPA 3KHXA 2ATRA 2Q7SA 3SI1A 3F5BA 3KKWA 2OOTA 5G20A 4H6ZA 5K8MA 1IYLA 2GE3A 2ZEPA 4ONUA 3IJ3A 3R96A 1YW6A 4PK3A 4H89A 2PVWA 5EBVA 3R9GA 2EK9A 4U9YA 4P4JA 3VARA 4F0XA 1PUAA 1YLOA 3JVNA 4M6HA 4AVCA 1GHEA 2B5GB 1Z8XA 2ANPA 2P0WA 4FD4A 4B6ZA 5DS0A 3TFYA 5A28A 2F5IA 4B14A 5LYFA 4AVAA 3VATA 2NMTA 4KSAA 3SJGA 4QC6A 4HPSA 5J1QA 3EY5A 2C1CA 2Z10A 2ZEFA 2ZW7A 5KTDA 3EFAA 4U9ZA 4L89A 3TC8A 2Z3PA 5G22A 5HH1A 2EUIA 3RBUA 1LFWA 1WWZA 4PXBA 3TX8A 2Q44A 4DYOA 3F0AA 5HMNA 3FIXA 3GUXA 2FIAA 2VQYA 2B58A 1Z4RA 4RUHA 2F8HA 4JLYA 5AG4A 1F2OA 2ARHA 2OZGA 4KUBA 3TOAA 4EVYA 2ZEHA 3JRUA 4YGOA 3DSBA 4P4FA 4KZTA 4A38A 2PJ7A 1ZG8A 3ISXA 5LRKA 4ZX8A 3FECA 1ZO0A 4OC4A 1S7FA 4OIWA 4CAVA 5JH9A 3C26A 4NGQA 4UEFA 1X10A 1RO5A 1MJAA 4H6UA 5DWNA 1EE3P 3VH9A 3CXPA 2J9AA 4UCNA 4G1PA 2PJ0A 3EO4A 1YREA 4BINA 2DXQA 4ZY1A 4KS9A 4KLVA 4A39A 2AFMA 2B4BA 3PFEA 2PR8A 3IGRA 3R1KA 1M4LA 1BPNA 1XEBA 2HUZA 3IWGA 2VZYA 1CBXA 4XPKA 4AVBA 5JQ4A 1S3ZA 2D4OA 4UFXA 4ZBGA 1MK4A 1XOVA 2YNCA 5FVJA 2J8MA 3JUWA 2AFUA 4NJRA 1PCAA 2IMOA 3IU2A 4R9MA 2OU2A 3QAHA 4CS0B 3MRUA 5C82A 4BD9A 2QMLA 3B35A 3R9FA 3BI1A 4KVXA 2BCOA 2RC4A 3GYAA 4JWPA 4JZ0A 2P6FA 4KOWA 2AFOA 1XE4A 2B3UA 1CP7A 3NE7A 4HNWB 4JXRA 1VHEA 4UIAA 2QIRA 2PJ2A 3PFOA 5ISVA 3CT9A 4HKFA 2WPXA 4NGSA 3S9NA 2Q4YA 3TOBA 1KUVA 2DPTA 1S60A 3MGDA 4XNHC 2GLJA 2Z0ZA 3PRTA 4MFLA 4RS2A 4XPLA 4GS4A 3PB6X 4CAFA 1RXTA 1YSJA 4PV6A 2BO9A 2YNEA 1VHOA 5AGEA 1RTQA 4NJQA 4R57A 4X8IA 2D4PA 4E8OA 1AMPA 4KOUA 4F9UA 5F47A 2IJZA 1LAMA 2V8VA 2CXAA 2QYVA 3G3SA 5GCNA 1ELMP 4HNXB 3KZWA 3FJUA 4YU9A 3IFEA 1BLLE 2Z3KA 4MHDA 3V38A 4E2AA 3D7GA 2VXKA 2C6PA 4A94A 4MFZA 3SXOA 3FB3A 2IQ6A 4MHZA 4OKOA 4MRIA 5CBMA 2K5TA 2POKA 3FVLA 4IAVA 5LYLA 4ZI6A 1F57A 1Y0YA 4KVOE 2G0BA 3A9LA 3TO7A 4B10A 3NE8A 4KSFA 2ZOGA 2F7VA 2ZEGA 3PBEA 4UIBA 4TWEA 5THWA 5IB0A 4AB7A 4OAEA 4R3KA 4JXQA 1TF9A 2BSWA 4MCQA 1IOIA 3JTKA 5AG7A 3V8IA 2RB7A 1XMBA 4QVTA 3SI0A 2FT0A 1JWQA 1R43A 2PJ3A 2ZEDA 3IEHA 1P4NA 3WR7A 1Z8WA 4II9A 3DNSA 1CPXA 4PK2A 4CAEA 2O53A 2OR4A 3ZZIA 4CGOA 3RAMA 1N71A 3BXMA 5K8NA 2ZENA 5LRJA 4CPAA 3D2PA 1FY7A 4UA3A 3WC6A 2WUUA 1GYTA 3R9EA 5J8FA 2CNTA 1IYKA 2PIZA 3HLPA 1Z8TA 4KOYA 3V7ZA 4PXCA 3SJXA 2JEWA 2WYRA 4QB9A 4UWIA 2R8VA 2DPSA 2V77A 3PB4X 2PJ8A 2ZXVA 3B3WA 5AG6A 4NGNA 1NMTA 4R8FA 1ZLIA 5D29A 2NSMA 1CG2A 4M6GA 4ZY2A 4A95A 4NGMA 3H8EA 4F6AA 5IX3A 3ZJ0A 1K4JA 4ORFA 1Q2YA 1CX8A 4P4DA 1TKHA 3I3GA 2BOAA 4A31A 4H2KA 2YNDA 4X5KA 5F49A 1H8LA 1Y0RA 3I9SA 3FMCA 4XPDC 3RNZA 5F09A 2Z3NA 2GIVA 1KWMA 3NA6A 4MFPA 4O23A 2P6GA 2H5MA 2I79A 4NF1A 2PR1A 3FBUA 3CXQA 5JGFA 1U6MA 1VGYA 3RO0A 2HC9A 4C7HA 1XFOA 2ZEEA 3D67A 1PYTB 4IF5A 4AXVA 4EMEA 4QUSA 4P10A 1Q7LA 3D3SA 1S7NA 3IIBA 1I12A 3DR8A 2CIJA 3PBBA 4DUKA 4QBJA 2PSWA 4FWUA 2CY2A 5H86A 3F8KA 1YMEA 4OC5A 4WJBA 3W6XA 4PSXA 1M4IA 2R98A 4B11A 3WC7A 4YWYA 4CGMA 3NFZA 4PXDA 3OWCA 1OBRA 2GLFA 3PB8X 4OP4A 2FE7A 2B5GA 2B4DA 3GIUA 2O4HA 1UWYA 4UCMA 2ZPAA 2G3AA 2JBJA 4MFJA 1LANA 1XRYA 4HNYB 5JPHA 4CRZB 3PZJA 1NE9A 4MCRA 4L8AA 4OADA 2PRQA 1YVOA 4KOVA 4P4EA 4R87A 4B5PB 2BUEA 3B3CA 4CAWA 4GM5A 2XEFA 5BWAB 4A2ZA 2Z11A 3KASA 4NCZA 3LMSA 1IOFA 2C6CA 3S6GA 2AFZA 3D7HA 2Q51A 3K2KA 2Q7BA 2JDCA 2ZEOA 2YGWA 2OB0A 3H4QA 3KHZA 5EC4A 3DGVA 3VWEA 2YNCC 3BI0A 4R7MA 2REFA 2IL4A 3KQXA 1KUXA 1F2PA 3FNCA 1KUYA 4EFDA 2Q0YA 4MJ8A 3TO6A 3SJEA 1LRZA 3BJ7A 1AYEA 2GFQA 1MJBA 2PJAA 2XEIA 4WWVA 3GKRA 2X7BA 2PJ5A 2WSAA 1QSMA 3H8GA 3N5FA 4K30A 3TE4A 3GY9A 2OZUA 3EXNA 4B12A 5F46A 4UEZA 3LD2A 2C27A 4C7IA 4CGPA 2VZZA 1HEEA 3D66A 2J8NA 4KORA 4KUAA 1Y9KA 2GREA 2EVNA 4ONWA 1X12A 3TTHA 1ZLHA 2PJ1A 4KOTA 3S9MA 3UY5A 2ZW4A 3NH4A 2ZEMA 4MCSA 4R3LA 4MFQA 2EWBA 2Y0MA 2PJ4A 2RFHA 2ZW5A 4IUSA 1Y7RA 4KLWA 4FD7A 4NFRA 2B4DB 3QAYA 4C2YA 4CRYB 2PJ9A 1V0CA 3KI9A 4OLLA 1J4JA 1M44A 4IK2A 4CGLA 2XEJA 3SI2A 1VHSA 2XEGA 3VWDA 3DR6A 4GXHA 4Z65A 2I3CA 2Q4ZA 2AJ6A 3CPAA 5J8CA 3FEEA 3B3TA 1M1DA 3T8WA 4A32A 1QQ9A 5K8PA 3WABA 1IGBA 4MMOA 2PJ6A 5G21A 1ZG7A 2B3VA 4XPDB 5ELYA 2Z3OA 5G1ZA 2WPWA 4X3RA 4P4IA 2ODFA 3D8PA 1TIQA 4RI1A 5IV0A 4MI4A 3W6SA 4B5OA 1NSAA 1Y7EA 1YQEA 2PIYA 2PE3A 3KR5A 4AG7A 1BAVA 4NGTA 2QJ8A 3FXTA 2PJCA 4ZGYB 1FNOA 5EMIA 4RN7A 3SHPA 4NEXA 1KZFA 4OC3A 1ARLA 3D7FA
chains in the Genus database with same CATH topology
1VKCA 1XF8A 1YLEA 3E0KA 4BBHA 4LUAA 4M3SA 5KTAA 5DWMA 1S7KA 2Z3MA 5F48A 1Y9WA 1QSRA 1Z9UA 1L0CA 1QSTA 4NXYA 1YK3A 3S6HA 4MFKA 3PGPA 4MY3A 5I0CA 3QB8A 4Q38A 2CNSA 4CYOA 3D2MA 3CXSA 1YVKA 3EC4A 4Y49C 4CYNA 1QSNA 4B13A 2HQYA 4JJXA 4KOSA 1NSLA 4CYQA 1XIXA 5AG5A 3TO9A 1I21A 3IWEA 4CGNA 3SXNA 4U5YA 4KVME 2VEZA 5C88A 2FSRA 1XMTA 3TT2A 1QSOA 3S6KA 4B5PA 4NSQA 3R95A 3N7ZA 3S6FA 4XNHB 4CYPA 2FS5A 2KCWA 2OZHA 2A4NA 2FCKA 2OH1A 2P6EA 3PP9A 1IICA 2G3TA 4C2ZA 1M4DA 2JLMA 4UBRA 5KTCA 3BJ8A 3T9YA 3RYOA 1B6BA 1Z4EA 4E0AA 4F0YA 2AE6A 2Q04A 1MJ9A 1YGHA 1WK4A 4KOXA 4LX9A 2FL4A 4M85A 4BMHA 2BEIA 2BL1A 1P0HA 2CNMA 4JD6A 2VBQA 2PQ8A 3IU1A 2JDDA 4C68A 3T90A 1Q2DA 4DNCA 1YR0A 2ZW6A 3BLNA 5H84A 2Q4VA 1SQHA 2PRBA 4YRHA 4AG9A 4A33A 1S5KA 4A30A 1YX0A 3B8GA 1R57A 4PSWA 1B87A 2I00A 4UCPA 3TCVA 3LODA 4CAXA 1I1DA 2R1IA 5A27A 4FD6A 4Y49B 1ON0A 1S7LA 3G8WA 4MBUA 3P2HA 3FRMA 4Q36A 2FXFA 3W91A 1M4GA 4C2XA 4I49A 2O28A 1PU9A 1BO4A 4YFJA 1OZPA 4UFVA 2VI7A 1BOBA 1CJWA 1IIDA 4FD5A 4J3GA 1UFHA 2PDOA 4UWJA 3K9UA 2FIWA 2PC1A 3DDDA 4YGOA 1IB1E 2Z3LA 2QECA 5E96A 3SHPA 3P2FA 4MY0A 4UFWA 2REEA 3H5ZA 2HV2A 2JEVA 2R7HA 1CM0A 1Q2CA 2GANA 3FYNA 2J8RA 5CNPA 2ATRA 3F5BA 3KKWA 5G20A 4H6ZA 1IYLA 2GE3A 4ONUA 3R96A 4PK3A 4H89A 5EBVA 3R9GA 4U9YA 4F0XA 1PUAA 3JVNA 4AVCA 1GHEA 2B5GB 2P0WA 4FD4A 3TFYA 5A28A 2F5IA 4B14A 4AVAA 2NMTA 4KSAA 4QC6A 3EY5A 2Z10A 2ZW7A 5KTDA 3EFAA 4U9ZA 4L89A 2Z3PA 5G22A 5HH1A 2EUIA 5IX3A 1WWZA 2Q44A 3F0AA 5HMNA 3FIXA 2FIAA 2VQYA 2B58A 1Z4RA 4JLYA 5AG4A 2OZGA 2ARHA 4KUBA 3TOAA 4EVYA 3DSBA 4KZTA 1ZO0A 1S7FA 4CAVA 3C26A 1RO5A 1MJAA 4H6UA 5DWNA 3CXPA 4UCNA 3EO4A 1YREA 2DXQA 4KS9A 4KLVA 2B4BA 2PR8A 3IGRA 3R1KA 1XEBA 2HUZA 3IWGA 2VZYA 4XPKA 4AVBA 5JQ4A 1S3ZA 2D4OA 4UFXA 4ZBGA 1MK4A 2YNCA 5FVJA 2J8MA 3JUWA 4CS0B 4R9MA 3IU2A 2OU2A 3QAHA 5C82A 2QMLA 3R9FA 4KVXA 2RC4A 4JWPA 3GYAA 2P6FA 4KOWA 2B3UA 1XE4A 3NE7A 4HNWB 4JXRA 2QIRA 5ISVA 4HKFA 2WPXA 2Q4YA 3TOBA 1KUVA 2DPTA 1S60A 3MGDA 4XNHC 2Z0ZA 4MFLA 4RS2A 4CAFA 4XPLA 4GS4A 1RXTA 4PV6A 2YNEA 5AGEA 4R57A 4E8OA 2D4PA 4KOUA 5F47A 2CXAA 3G3SA 5GCNA 4HNXB 2Z3KA 4MHDA 4E2AA 2VXKA 4MFZA 3SXOA 3FB3A 2K5TA 4KVOE 2G0BA 3A9LA 3TO7A 4B10A 4KSFA 5IB0A 4AB7A 4OAEA 4R3KA 4JXQA 2BSWA 3JTKA 5AG7A 3V8IA 4QVTA 2FT0A 1P4NA 3WR7A 4II9A 3DNSA 4PK2A 4CAEA 3ZZIA 4CGOA 1N71A 3D2PA 1FY7A 4UA3A 5J8FA 2WUUA 3R9EA 2CNTA 1IYKA 4KOYA 4QB9A 4UWIA 2R8VA 2DPSA 2ZXVA 5AG6A 1NMTA 4A95A 4F6AA 3ZJ0A 1K4JA 4ORFA 1Q2YA 4A31A 3I3GA 2YNDA 4X5KA 5F49A 3I9SA 4XPDC 2Z3NA 2GIVA 4MFPA 2P6GA 2H5MA 2I79A 4NF1A 2PR1A 3FBUA 3CXQA 1U6MA 4C7HA 4IF5A 4QUSA 3D3SA 1S7NA 1I12A 3DR8A 4QBJA 2PSWA 2CY2A 5H86A 3F8KA 3W6XA 4PSXA 1M4IA 2R98A 4B11A 4CGMA 3OWCA 2FE7A 2B5GA 2B4DA 4UCMA 2ZPAA 2G3AA 4MFJA 5JPHA 4HNYB 4CRZB 3PZJA 1NE9A 4L8AA 4OADA 1YVOA 4KOVA 4R87A 4B5PB 2BUEA 4CAWA 5BWAB 4A2ZA 2Z11A 4NCZA 3S6GA 2Q7BA 2JDCA 2YGWA 2OB0A 3H4QA 5EC4A 3VWEA 2YNCC 2REFA 2IL4A 1KUXA 3FNCA 1KUYA 2Q0YA 4MJ8A 3TO6A 1LRZA 3BJ7A 1MJBA 3GKRA 2X7BA 2WSAA 1QSMA 4K30A 3TE4A 3GY9A 2OZUA 3EXNA 4B12A 5F46A 3LD2A 2C27A 4C7IA 4CGPA 2VZZA 2J8NA 4KORA 4KUAA 1Y9KA 2EVNA 3TTHA 4KOTA 3UY5A 2ZW4A 4R3LA 4MFQA 2Y0MA 2ZW5A 4IUSA 1Y7RA 4KLWA 4FD7A 4C2YA 2B4DB 4CRYB 1V0CA 4OLLA 1J4JA 1M44A 4CGLA 1VHSA 3VWDA 3DR6A 2AJ6A 5J8CA 1M1DA 4A32A 5G21A 2B3VA 4XPDB 5G1ZA 2Z3OA 2WPWA 3D8PA 1TIQA 4RI1A 5IV0A 4MI4A 3W6SA 4B5OA 4AG7A 3FXTA 4ZGYB 4NEXA 1KZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKC A;  1XF8 A;  1YLE A;  3E0K A;  4LUA A;  4M3S A;  5KTA A;  5DWM A;  1S7K A;  5F48 A;  1Y9W A;  1QSR A;  1Z9U A;  1L0C A;  1QST A;  4NXY A;  1YK3 A;  3S6H A;  3PGP A;  4MY3 A;  5I0C A;  3QB8 A;  2CNS A;  3D2M A;  3CXS A;  1YVK A;  3EC4 A;  4Y49 C;  1QSN A;  2HQY A;  4JJX A;  4KOS A;  1NSL A;  1XIX A;  3TO9 A;  1I21 A;  3SXN A;  4U5Y A;  4KVM E;  2VEZ A;  5C88 A;  2FSR A;  1XMT A;  3TT2 A;  1QSO A;  3S6K A;  4B5P A;  4NSQ A;  3R95 A;  3N7Z A;  3S6F A;  4XNH B;  2FS5 A;  2KCW A;  2OZH A;  2A4N A;  2FCK A;  2OH1 A;  2P6E A;  3PP9 A;  1IIC A;  2G3T A;  1M4D A;  2JLM A;  4UBR A;  5KTC A;  3BJ8 A;  3T9Y A;  3RYO A;  1B6B A;  1Z4E A;  4E0A A;  4F0Y A;  2AE6 A;  2Q04 A;  1MJ9 A;  1YGH A;  1WK4 A;  4KOX A;  4LX9 A;  2FL4 A;  4M85 A;  4BMH A;  2BEI A;  2BL1 A;  1P0H A;  2CNM A;  4JD6 A;  2VBQ A;  2PQ8 A;  2JDD A;  3T90 A;  1Q2D A;  4DNC A;  1YR0 A;  2ZW6 A;  3BLN A;  5H84 A;  2Q4V A;  1SQH A;  2PRB A;  4YRH A;  4AG9 A;  1S5K A;  1YX0 A;  3B8G A;  1R57 A;  4PSW A;  1B87 A;  2I00 A;  3TCV A;  3LOD A;  4CAX A;  1I1D A;  2R1I A;  4FD6 A;  4Y49 B;  1ON0 A;  1S7L A;  3G8W A;  4MBU A;  3P2H A;  3FRM A;  2FXF A;  3W91 A;  1M4G A;  4I49 A;  2O28 A;  1PU9 A;  1BO4 A;  4YFJ A;  1OZP A;  2VI7 A;  1BOB A;  1CJW A;  1IID A;  4FD5 A;  4J3G A;  1UFH A;  2PDO A;  4UWJ A;  3K9U A;  2FIW A;  2PC1 A;  3DDD A;  4YGO A;  1IB1 E;  2QEC A;  5E96 A;  3SHP A;  3P2F A;  4MY0 A;  2REE A;  2HV2 A;  2JEV A;  2R7H A;  1CM0 A;  1Q2C A;  2GAN A;  3FYN A;  2J8R A;  5CNP A;  2ATR A;  3F5B A;  3KKW A;  4H6Z A;  1IYL A;  2GE3 A;  4ONU A;  3R96 A;  4PK3 A;  4H89 A;  5EBV A;  3R9G A;  4U9Y A;  1PUA A;  3JVN A;  4AVC A;  1GHE A;  2B5G B;  2P0W A;  4FD4 A;  3TFY A;  2F5I A;  4AVA A;  2NMT A;  4QC6 A;  3EY5 A;  2Z10 A;  2ZW7 A;  5KTD A;  3EFA A;  4U9Z A;  4L89 A;  5HH1 A;  2EUI A;  5IX3 A;  1WWZ A;  2Q44 A;  3F0A A;  5HMN A;  3FIX A;  2FIA A;  2VQY A;  2B58 A;  1Z4R A;  4JLY A;  2OZG A;  2ARH A;  4KUB A;  3TOA A;  4EVY A;  3DSB A;  4KZT A;  1S7F A;  4CAV A;  3C26 A;  1RO5 A;  1MJA A;  4H6U A;  5DWN A;  3CXP A;  3EO4 A;  1YRE A;  2DXQ A;  4KLV A;  2B4B A;  2PR8 A;  3IGR A;  3R1K A;  1XEB A;  2HUZ A;  3IWG A;  2VZY A;  4XPK A;  4AVB A;  5JQ4 A;  1S3Z A;  2D4O A;  4ZBG A;  5FVJ A;  1MK4 A;  2J8M A;  3JUW A;  4CS0 B;  4R9M A;  2OU2 A;  3QAH A;  5C82 A;  2QML A;  3R9F A;  4KVX A;  2RC4 A;  4JWP A;  3GYA A;  2P6F A;  4KOW A;  2B3U A;  1XE4 A;  3NE7 A;  4HNW B;  4JXR A;  2QIR A;  5ISV A;  4HKF A;  2WPX A;  2Q4Y A;  3TOB A;  1KUV A;  1S60 A;  3MGD A;  4XNH C;  2Z0Z A;  4RS2 A;  4XPL A;  4GS4 A;  1RXT A;  4PV6 A;  4R57 A;  4E8O A;  2D4P A;  4KOU A;  5F47 A;  3G3S A;  5GCN A;  4HNX B;  4MHD A;  4E2A A;  2VXK A;  3SXO A;  3FB3 A;  2K5T A;  4KVO E;  2G0B A;  3TO7 A;  5IB0 A;  4AB7 A;  4OAE A;  4R3K A;  4JXQ A;  2BSW A;  3V8I A;  4QVT A;  2FT0 A;  1P4N A;  3WR7 A;  4II9 A;  3DNS A;  4PK2 A;  3ZZI A;  1N71 A;  3D2P A;  1FY7 A;  4UA3 A;  5J8F A;  3R9E A;  2CNT A;  1IYK A;  4KOY A;  4QB9 A;  4UWI A;  2R8V A;  2ZXV A;  1NMT A;  4F6A A;  3ZJ0 A;  1K4J A;  4ORF A;  1Q2Y A;  3I3G A;  4X5K A;  5F49 A;  3I9S A;  4XPD C;  2GIV A;  2P6G A;  2H5M A;  2I79 A;  4NF1 A;  2PR1 A;  3FBU A;  3CXQ A;  1U6M A;  4IF5 A;  4QUS A;  3D3S A;  1S7N A;  1I12 A;  3DR8 A;  4QBJ A;  2PSW A;  2CY2 A;  5H86 A;  3F8K A;  3W6X A;  4PSX A;  1M4I A;  2R98 A;  3OWC A;  2FE7 A;  2B5G A;  2B4D A;  2ZPA A;  2G3A A;  5JPH A;  4HNY B;  4CRZ B;  3PZJ A;  1NE9 A;  4L8A A;  4OAD A;  1YVO A;  4KOV A;  4R87 A;  4B5P B;  2BUE A;  4CAW A;  2Z11 A;  4NCZ A;  3S6G A;  2Q7B A;  2JDC A;  5EC4 A;  2OB0 A;  3H4Q A;  3VWE A;  2REF A;  2IL4 A;  1KUX A;  3FNC A;  1KUY A;  2Q0Y A;  4MJ8 A;  3TO6 A;  1LRZ A;  3BJ7 A;  1MJB A;  3GKR A;  2X7B A;  1QSM A;  4K30 A;  3TE4 A;  3GY9 A;  2OZU A;  3EXN A;  5F46 A;  3LD2 A;  2C27 A;  2VZZ A;  2J8N A;  4KOR A;  4KUA A;  1Y9K A;  2EVN A;  3TTH A;  4KOT A;  3UY5 A;  2ZW4 A;  4R3L A;  2Y0M A;  2ZW5 A;  4IUS A;  1Y7R A;  4KLW A;  4FD7 A;  2B4D B;  4CRY B;  1V0C A;  4OLL A;  1J4J A;  1M44 A;  1VHS A;  3VWD A;  3DR6 A;  2AJ6 A;  5J8C A;  1M1D A;  2B3V A;  4XPD B;  2WPW A;  3D8P A;  1TIQ A;  4RI1 A;  5IV0 A;  4MI4 A;  3W6S A;  4B5O A;  4AG7 A;  3FXT A;  4NEX A;  1KZF A; 
#chains in the Genus database with same CATH topology
 1VKC A;  1TF8 A;  1XF8 A;  1YLE A;  3WT4 A;  5LYI A;  3E0K A;  3KL9 A;  4BBH A;  4LUA A;  4M3S A;  4MHY A;  1AUG A;  1ELL P;  4F8Z A;  2Q43 A;  5KTA A;  5DWM A;  3IC1 A;  4ZY0 A;  1S7K A;  2QVP A;  2Z3M A;  4ZYQ A;  5F48 A;  1Y9W A;  4PXE A;  1QSR A;  1Z9U A;  6CPA A;  1L0C A;  1QST A;  4NXY A;  3BHX A;  1YK3 A;  3S6H A;  4MFK A;  5IB9 A;  3PGP A;  4MY3 A;  5I0C A;  3QB8 A;  2G9D A;  4Q38 A;  2CNS A;  3HUV A;  4CYO A;  3D2M A;  2CF4 A;  1TKJ A;  3CXS A;  1YVK A;  3EC4 A;  4Y49 C;  1A2Z A;  1XBU A;  1XJO A;  3SJF A;  5CPA A;  4CYN A;  1QSN A;  1HDU A;  3K9T A;  4B13 A;  2HQY A;  4JJX A;  4KOS A;  1TKF A;  3I1U A;  2AFW A;  1NSL A;  1XIX A;  5AG5 A;  3TO9 A;  4CYQ A;  1I21 A;  3IWE A;  4CGN A;  3SXN A;  3KQZ A;  3WC5 A;  2EO8 A;  4U5Y A;  4KVM E;  2VEZ A;  4LQG A;  5C88 A;  7CPA A;  2FSR A;  1XMT A;  3TT2 A;  2ABZ A;  4PQA A;  1QSO A;  3S6K A;  1LAP A;  4B5P A;  2CTB A;  3KGQ A;  4OC0 A;  4NSQ A;  3R95 A;  4OME A;  2AFX A;  3N7Z A;  5HXD A;  1CP6 A;  4IHM A;  5LRG A;  3S6F A;  2JBK A;  4TNU A;  4XNH B;  4CYP A;  2FS5 A;  2KCW A;  2OZH A;  4NGR A;  2A4N A;  3FF3 A;  2FCK A;  3B7I A;  2PCU A;  4EWT A;  2OH1 A;  2P6E A;  3PP9 A;  3MN8 A;  1IIC A;  5D8N A;  4W9Y A;  2G3T A;  4ZX9 A;  3IO1 A;  4C2Z A;  1M4D A;  2JLM A;  3D4U A;  3NH5 A;  3BJ8 A;  4OID A;  4UBR A;  1ARM A;  3RYO A;  3T9Y A;  2ZEL A;  1B6B A;  5KTC A;  4FUU A;  5LYD A;  4R6T A;  1Z4E A;  3DLJ A;  3D68 A;  4E0A A;  2AE6 A;  3FX6 A;  4F0Y A;  1Z2L A;  5JM6 A;  2WZN A;  2AFS A;  2Q04 A;  5K8O A;  4R76 A;  1MJ9 A;  1YGH A;  1DTD A;  1WK4 A;  4KOX A;  4LX9 A;  1VIX A;  2FL4 A;  4M85 A;  4BMH A;  3PEI A;  3H8F A;  2BEI A;  2BL1 A;  4UF4 A;  4FAI A;  1P0H A;  4X2T A;  1R3N A;  1FT7 A;  2CNM A;  4JD6 A;  4P44 A;  2PJB A;  3LWU A;  2VBQ A;  1ZG9 A;  2C6G A;  2PQ8 A;  3IU1 A;  1CPS A;  4A37 A;  2JDD A;  4C68 A;  3T90 A;  8CPA A;  3RZA A;  3L2N A;  1Q2D A;  4DNC A;  3NH8 A;  1QMU A;  4LQ6 A;  1YR0 A;  2CTC A;  2ZW6 A;  3BLN A;  5H84 A;  2HB6 A;  2Q4V A;  1SQH A;  1BPM A;  1JQG A;  4Q7A A;  2PRB A;  2EBJ A;  4P6Y A;  4YRH A;  3FH4 A;  4AG9 A;  4DJL A;  4A33 A;  2EK8 A;  1S5K A;  4F9V A;  4A30 A;  1YX0 A;  3B8G A;  1R57 A;  3GLJ A;  4PSW A;  3S9L A;  1B87 A;  2I00 A;  2DF5 A;  4OC2 A;  2FVG A;  4KSI A;  1Z8L A;  1HDQ A;  4UEE A;  4UCP A;  3TCV A;  3LOD A;  2PVV A;  4CAX A;  1I1D A;  1TXR A;  3GB0 A;  2R1I A;  1IY7 A;  5A27 A;  4MHP A;  4FD6 A;  4Y49 B;  1ON0 A;  1S7L A;  4JYW A;  3G8W A;  4OC1 A;  5HVG A;  4MBU A;  3P2H A;  3B3V A;  3D7D A;  3PB9 X;  5HVH A;  1LCP A;  3FRM A;  3KR4 A;  4Q36 A;  4FBE A;  5I4M A;  3PB7 X;  4MXU A;  2FXF A;  3W91 A;  1M4G A;  4P45 A;  4C2X A;  4I49 A;  2O28 A;  1PU9 A;  1BO4 A;  4PPZ A;  4YFJ A;  1OZP A;  4UFV A;  2VI7 A;  1BOB A;  1CJW A;  1IID A;  2V8H A;  4FD5 A;  4J3G A;  1UFH A;  2PDO A;  1YW4 A;  4P4B A;  4UWJ A;  3CDX A;  5HVF A;  3B3S A;  3K9U A;  2FIW A;  2VL1 A;  1DE4 C;  3CPX A;  3IWW A;  2PC1 A;  2V8G A;  2ZOF A;  1IB1 E;  2NYQ A;  2QEC A;  2Z3L A;  3CZX A;  3DDD A;  3P2F A;  3QNV A;  4K3N A;  4MCP A;  4MY0 A;  5E96 A;  3FED A;  4MHN A;  4UFW A;  1LOK A;  3B2Y A;  2REE A;  3H5Z A;  3ISZ A;  2HV2 A;  2JEV A;  2R7H A;  1CM0 A;  1Z5R A;  2GU2 A;  4M6I A;  1Q2C A;  1IU8 A;  4NGP A;  2DEA A;  3LAC A;  2GAN A;  2V8D A;  3FYN A;  2J8R A;  5CNP A;  3KHX A;  2ATR A;  2Q7S A;  3SI1 A;  3F5B A;  3KKW A;  2OOT A;  5G20 A;  4H6Z A;  5K8M A;  1IYL A;  2GE3 A;  2ZEP A;  4ONU A;  3IJ3 A;  3R96 A;  1YW6 A;  4PK3 A;  4H89 A;  2PVW A;  5EBV A;  3R9G A;  2EK9 A;  4U9Y A;  4P4J A;  3VAR A;  4F0X A;  1PUA A;  1YLO A;  3JVN A;  4M6H A;  4AVC A;  1GHE A;  2B5G B;  1Z8X A;  2ANP A;  2P0W A;  4FD4 A;  4B6Z A;  5DS0 A;  3TFY A;  5A28 A;  2F5I A;  4B14 A;  5LYF A;  4AVA A;  3VAT A;  2NMT A;  4KSA A;  3SJG A;  4QC6 A;  4HPS A;  5J1Q A;  3EY5 A;  2C1C A;  2Z10 A;  2ZEF A;  2ZW7 A;  5KTD A;  3EFA A;  4U9Z A;  4L89 A;  3TC8 A;  2Z3P A;  5G22 A;  5HH1 A;  2EUI A;  3RBU A;  1LFW A;  1WWZ A;  4PXB A;  3TX8 A;  2Q44 A;  4DYO A;  3F0A A;  5HMN A;  3FIX A;  3GUX A;  2FIA A;  2VQY A;  2B58 A;  1Z4R A;  4RUH A;  2F8H A;  4JLY A;  5AG4 A;  1F2O A;  2ARH A;  2OZG A;  4KUB A;  3TOA A;  4EVY A;  2ZEH A;  3JRU A;  4YGO A;  3DSB A;  4P4F A;  4KZT A;  4A38 A;  2PJ7 A;  1ZG8 A;  3ISX A;  5LRK A;  4ZX8 A;  3FEC A;  1ZO0 A;  4OC4 A;  1S7F A;  4OIW A;  4CAV A;  5JH9 A;  3C26 A;  4NGQ A;  4UEF A;  1X10 A;  1RO5 A;  1MJA A;  4H6U A;  5DWN A;  1EE3 P;  3VH9 A;  3CXP A;  2J9A A;  4UCN A;  4G1P A;  2PJ0 A;  3EO4 A;  1YRE A;  4BIN A;  2DXQ A;  4ZY1 A;  4KS9 A;  4KLV A;  4A39 A;  2AFM A;  2B4B A;  3PFE A;  2PR8 A;  3IGR A;  3R1K A;  1M4L A;  1BPN A;  1XEB A;  2HUZ A;  3IWG A;  2VZY A;  1CBX A;  4XPK A;  4AVB A;  5JQ4 A;  1S3Z A;  2D4O A;  4UFX A;  4ZBG A;  1MK4 A;  1XOV A;  2YNC A;  5FVJ A;  2J8M A;  3JUW A;  2AFU A;  4NJR A;  1PCA A;  2IMO A;  3IU2 A;  4R9M A;  2OU2 A;  3QAH A;  4CS0 B;  3MRU A;  5C82 A;  4BD9 A;  2QML A;  3B35 A;  3R9F A;  3BI1 A;  4KVX A;  2BCO A;  2RC4 A;  3GYA A;  4JWP A;  4JZ0 A;  2P6F A;  4KOW A;  2AFO A;  1XE4 A;  2B3U A;  1CP7 A;  3NE7 A;  4HNW B;  4JXR A;  1VHE A;  4UIA A;  2QIR A;  2PJ2 A;  3PFO A;  5ISV A;  3CT9 A;  4HKF A;  2WPX A;  4NGS A;  3S9N A;  2Q4Y A;  3TOB A;  1KUV A;  2DPT A;  1S60 A;  3MGD A;  4XNH C;  2GLJ A;  2Z0Z A;  3PRT A;  4MFL A;  4RS2 A;  4XPL A;  4GS4 A;  3PB6 X;  4CAF A;  1RXT A;  1YSJ A;  4PV6 A;  2BO9 A;  2YNE A;  1VHO A;  5AGE A;  1RTQ A;  4NJQ A;  4R57 A;  4X8I A;  2D4P A;  4E8O A;  1AMP A;  4KOU A;  4F9U A;  5F47 A;  2IJZ A;  1LAM A;  2V8V A;  2CXA A;  2QYV A;  3G3S A;  5GCN A;  1ELM P;  4HNX B;  3KZW A;  3FJU A;  4YU9 A;  3IFE A;  1BLL E;  2Z3K A;  4MHD A;  3V38 A;  4E2A A;  3D7G A;  2VXK A;  2C6P A;  4A94 A;  4MFZ A;  3SXO A;  3FB3 A;  2IQ6 A;  4MHZ A;  4OKO A;  4MRI A;  5CBM A;  2K5T A;  2POK A;  3FVL A;  4IAV A;  5LYL A;  4ZI6 A;  1F57 A;  1Y0Y A;  4KVO E;  2G0B A;  3A9L A;  3TO7 A;  4B10 A;  3NE8 A;  4KSF A;  2ZOG A;  2F7V A;  2ZEG A;  3PBE A;  4UIB A;  4TWE A;  5THW A;  5IB0 A;  4AB7 A;  4OAE A;  4R3K A;  4JXQ A;  1TF9 A;  2BSW A;  4MCQ A;  1IOI A;  3JTK A;  5AG7 A;  3V8I A;  2RB7 A;  1XMB A;  4QVT A;  3SI0 A;  2FT0 A;  1JWQ A;  1R43 A;  2PJ3 A;  2ZED A;  3IEH A;  1P4N A;  3WR7 A;  1Z8W A;  4II9 A;  3DNS A;  1CPX A;  4PK2 A;  4CAE A;  2O53 A;  2OR4 A;  3ZZI A;  4CGO A;  3RAM A;  1N71 A;  3BXM A;  5K8N A;  2ZEN A;  5LRJ A;  4CPA A;  3D2P A;  1FY7 A;  4UA3 A;  3WC6 A;  2WUU A;  1GYT A;  3R9E A;  5J8F A;  2CNT A;  1IYK A;  2PIZ A;  3HLP A;  1Z8T A;  4KOY A;  3V7Z A;  4PXC A;  3SJX A;  2JEW A;  2WYR A;  4QB9 A;  4UWI A;  2R8V A;  2DPS A;  2V77 A;  3PB4 X;  2PJ8 A;  2ZXV A;  3B3W A;  5AG6 A;  4NGN A;  1NMT A;  4R8F A;  1ZLI A;  5D29 A;  2NSM A;  1CG2 A;  4M6G A;  4ZY2 A;  4A95 A;  4NGM A;  3H8E A;  4F6A A;  5IX3 A;  3ZJ0 A;  1K4J A;  4ORF A;  1Q2Y A;  1CX8 A;  4P4D A;  1TKH A;  3I3G A;  2BOA A;  4A31 A;  4H2K A;  2YND A;  4X5K A;  5F49 A;  1H8L A;  1Y0R A;  3I9S A;  3FMC A;  4XPD C;  3RNZ A;  5F09 A;  2Z3N A;  2GIV A;  1KWM A;  3NA6 A;  4MFP A;  4O23 A;  2P6G A;  2H5M A;  2I79 A;  4NF1 A;  2PR1 A;  3FBU A;  3CXQ A;  5JGF A;  1U6M A;  1VGY A;  3RO0 A;  2HC9 A;  4C7H A;  1XFO A;  2ZEE A;  3D67 A;  1PYT B;  4IF5 A;  4AXV A;  4EME A;  4QUS A;  4P10 A;  1Q7L A;  3D3S A;  1S7N A;  3IIB A;  1I12 A;  3DR8 A;  2CIJ A;  3PBB A;  4DUK A;  4QBJ A;  2PSW A;  4FWU A;  2CY2 A;  5H86 A;  3F8K A;  1YME A;  4OC5 A;  4WJB A;  3W6X A;  4PSX A;  1M4I A;  2R98 A;  4B11 A;  3WC7 A;  4YWY A;  4CGM A;  3NFZ A;  4PXD A;  3OWC A;  1OBR A;  2GLF A;  3PB8 X;  4OP4 A;  2FE7 A;  2B5G A;  2B4D A;  3GIU A;  2O4H A;  1UWY A;  4UCM A;  2ZPA A;  2G3A A;  2JBJ A;  4MFJ A;  1LAN A;  1XRY A;  4HNY B;  5JPH A;  4CRZ B;  3PZJ A;  1NE9 A;  4MCR A;  4L8A A;  4OAD A;  2PRQ A;  1YVO A;  4KOV A;  4P4E A;  4R87 A;  4B5P B;  2BUE A;  3B3C A;  4CAW A;  4GM5 A;  2XEF A;  5BWA B;  4A2Z A;  2Z11 A;  3KAS A;  4NCZ A;  3LMS A;  1IOF A;  2C6C A;  3S6G A;  2AFZ A;  3D7H A;  2Q51 A;  3K2K A;  2Q7B A;  2JDC A;  2ZEO A;  2YGW A;  2OB0 A;  3H4Q A;  3KHZ A;  5EC4 A;  3DGV A;  3VWE A;  2YNC C;  3BI0 A;  4R7M A;  2REF A;  2IL4 A;  3KQX A;  1KUX A;  1F2P A;  3FNC A;  1KUY A;  4EFD A;  2Q0Y A;  4MJ8 A;  3TO6 A;  3SJE A;  1LRZ A;  3BJ7 A;  1AYE A;  2GFQ A;  1MJB A;  2PJA A;  2XEI A;  4WWV A;  3GKR A;  2X7B A;  2PJ5 A;  2WSA A;  1QSM A;  3H8G A;  3N5F A;  4K30 A;  3TE4 A;  3GY9 A;  2OZU A;  3EXN A;  4B12 A;  5F46 A;  4UEZ A;  3LD2 A;  2C27 A;  4C7I A;  4CGP A;  2VZZ A;  1HEE A;  3D66 A;  2J8N A;  4KOR A;  4KUA A;  1Y9K A;  2GRE A;  2EVN A;  4ONW A;  1X12 A;  3TTH A;  1ZLH A;  2PJ1 A;  4KOT A;  3S9M A;  3UY5 A;  2ZW4 A;  3NH4 A;  2ZEM A;  4MCS A;  4R3L A;  4MFQ A;  2EWB A;  2Y0M A;  2PJ4 A;  2RFH A;  2ZW5 A;  4IUS A;  1Y7R A;  4KLW A;  4FD7 A;  4NFR A;  2B4D B;  3QAY A;  4C2Y A;  4CRY B;  2PJ9 A;  1V0C A;  3KI9 A;  4OLL A;  1J4J A;  1M44 A;  4IK2 A;  4CGL A;  2XEJ A;  3SI2 A;  1VHS A;  2XEG A;  3VWD A;  3DR6 A;  4GXH A;  4Z65 A;  2I3C A;  2Q4Z A;  2AJ6 A;  3CPA A;  5J8C A;  3FEE A;  3B3T A;  1M1D A;  3T8W A;  4A32 A;  1QQ9 A;  5K8P A;  3WAB A;  1IGB A;  4MMO A;  2PJ6 A;  5G21 A;  1ZG7 A;  2B3V A;  4XPD B;  5ELY A;  2Z3O A;  5G1Z A;  2WPW A;  4X3R A;  4P4I A;  2ODF A;  3D8P A;  1TIQ A;  4RI1 A;  5IV0 A;  4MI4 A;  3W6S A;  4B5O A;  1NSA A;  1Y7E A;  1YQE A;  2PIY A;  2PE3 A;  3KR5 A;  4AG7 A;  1BAV A;  4NGT A;  2QJ8 A;  3FXT A;  2PJC A;  4ZGY B;  1FNO A;  5EMI A;  4RN7 A;  3SHP A;  4NEX A;  1KZF A;  4OC3 A;  1ARL A;  3D7F A; 
#chains in the Genus database with same CATH homology
 1VKC A;  1XF8 A;  1YLE A;  3E0K A;  4BBH A;  4LUA A;  4M3S A;  5KTA A;  5DWM A;  1S7K A;  2Z3M A;  5F48 A;  1Y9W A;  1QSR A;  1Z9U A;  1L0C A;  1QST A;  4NXY A;  1YK3 A;  3S6H A;  4MFK A;  3PGP A;  4MY3 A;  5I0C A;  3QB8 A;  4Q38 A;  2CNS A;  4CYO A;  3D2M A;  3CXS A;  1YVK A;  3EC4 A;  4Y49 C;  4CYN A;  1QSN A;  4B13 A;  2HQY A;  4JJX A;  4KOS A;  1NSL A;  4CYQ A;  1XIX A;  5AG5 A;  3TO9 A;  1I21 A;  3IWE A;  4CGN A;  3SXN A;  4U5Y A;  4KVM E;  2VEZ A;  5C88 A;  2FSR A;  1XMT A;  3TT2 A;  1QSO A;  3S6K A;  4B5P A;  4NSQ A;  3R95 A;  3N7Z A;  3S6F A;  4XNH B;  4CYP A;  2FS5 A;  2KCW A;  2OZH A;  2A4N A;  2FCK A;  2OH1 A;  2P6E A;  3PP9 A;  1IIC A;  2G3T A;  4C2Z A;  1M4D A;  2JLM A;  4UBR A;  5KTC A;  3BJ8 A;  3T9Y A;  3RYO A;  1B6B A;  1Z4E A;  4E0A A;  4F0Y A;  2AE6 A;  2Q04 A;  1MJ9 A;  1YGH A;  1WK4 A;  4KOX A;  4LX9 A;  2FL4 A;  4M85 A;  4BMH A;  2BEI A;  2BL1 A;  1P0H A;  2CNM A;  4JD6 A;  2VBQ A;  2PQ8 A;  3IU1 A;  2JDD A;  4C68 A;  3T90 A;  1Q2D A;  4DNC A;  1YR0 A;  2ZW6 A;  3BLN A;  5H84 A;  2Q4V A;  1SQH A;  2PRB A;  4YRH A;  4AG9 A;  4A33 A;  1S5K A;  4A30 A;  1YX0 A;  3B8G A;  1R57 A;  4PSW A;  1B87 A;  2I00 A;  4UCP A;  3TCV A;  3LOD A;  4CAX A;  1I1D A;  2R1I A;  5A27 A;  4FD6 A;  4Y49 B;  1ON0 A;  1S7L A;  3G8W A;  4MBU A;  3P2H A;  3FRM A;  4Q36 A;  2FXF A;  3W91 A;  1M4G A;  4C2X A;  4I49 A;  2O28 A;  1PU9 A;  1BO4 A;  4YFJ A;  1OZP A;  4UFV A;  2VI7 A;  1BOB A;  1CJW A;  1IID A;  4FD5 A;  4J3G A;  1UFH A;  2PDO A;  4UWJ A;  3K9U A;  2FIW A;  2PC1 A;  3DDD A;  4YGO A;  1IB1 E;  2Z3L A;  2QEC A;  5E96 A;  3SHP A;  3P2F A;  4MY0 A;  4UFW A;  2REE A;  3H5Z A;  2HV2 A;  2JEV A;  2R7H A;  1CM0 A;  1Q2C A;  2GAN A;  3FYN A;  2J8R A;  5CNP A;  2ATR A;  3F5B A;  3KKW A;  5G20 A;  4H6Z A;  1IYL A;  2GE3 A;  4ONU A;  3R96 A;  4PK3 A;  4H89 A;  5EBV A;  3R9G A;  4U9Y A;  4F0X A;  1PUA A;  3JVN A;  4AVC A;  1GHE A;  2B5G B;  2P0W A;  4FD4 A;  3TFY A;  5A28 A;  2F5I A;  4B14 A;  4AVA A;  2NMT A;  4KSA A;  4QC6 A;  3EY5 A;  2Z10 A;  2ZW7 A;  5KTD A;  3EFA A;  4U9Z A;  4L89 A;  2Z3P A;  5G22 A;  5HH1 A;  2EUI A;  5IX3 A;  1WWZ A;  2Q44 A;  3F0A A;  5HMN A;  3FIX A;  2FIA A;  2VQY A;  2B58 A;  1Z4R A;  4JLY A;  5AG4 A;  2OZG A;  2ARH A;  4KUB A;  3TOA A;  4EVY A;  3DSB A;  4KZT A;  1ZO0 A;  1S7F A;  4CAV A;  3C26 A;  1RO5 A;  1MJA A;  4H6U A;  5DWN A;  3CXP A;  4UCN A;  3EO4 A;  1YRE A;  2DXQ A;  4KS9 A;  4KLV A;  2B4B A;  2PR8 A;  3IGR A;  3R1K A;  1XEB A;  2HUZ A;  3IWG A;  2VZY A;  4XPK A;  4AVB A;  5JQ4 A;  1S3Z A;  2D4O A;  4UFX A;  4ZBG A;  1MK4 A;  2YNC A;  5FVJ A;  2J8M A;  3JUW A;  4CS0 B;  4R9M A;  3IU2 A;  2OU2 A;  3QAH A;  5C82 A;  2QML A;  3R9F A;  4KVX A;  2RC4 A;  4JWP A;  3GYA A;  2P6F A;  4KOW A;  2B3U A;  1XE4 A;  3NE7 A;  4HNW B;  4JXR A;  2QIR A;  5ISV A;  4HKF A;  2WPX A;  2Q4Y A;  3TOB A;  1KUV A;  2DPT A;  1S60 A;  3MGD A;  4XNH C;  2Z0Z A;  4MFL A;  4RS2 A;  4CAF A;  4XPL A;  4GS4 A;  1RXT A;  4PV6 A;  2YNE A;  5AGE A;  4R57 A;  4E8O A;  2D4P A;  4KOU A;  5F47 A;  2CXA A;  3G3S A;  5GCN A;  4HNX B;  2Z3K A;  4MHD A;  4E2A A;  2VXK A;  4MFZ A;  3SXO A;  3FB3 A;  2K5T A;  4KVO E;  2G0B A;  3A9L A;  3TO7 A;  4B10 A;  4KSF A;  5IB0 A;  4AB7 A;  4OAE A;  4R3K A;  4JXQ A;  2BSW A;  3JTK A;  5AG7 A;  3V8I A;  4QVT A;  2FT0 A;  1P4N A;  3WR7 A;  4II9 A;  3DNS A;  4PK2 A;  4CAE A;  3ZZI A;  4CGO A;  1N71 A;  3D2P A;  1FY7 A;  4UA3 A;  5J8F A;  2WUU A;  3R9E A;  2CNT A;  1IYK A;  4KOY A;  4QB9 A;  4UWI A;  2R8V A;  2DPS A;  2ZXV A;  5AG6 A;  1NMT A;  4A95 A;  4F6A A;  3ZJ0 A;  1K4J A;  4ORF A;  1Q2Y A;  4A31 A;  3I3G A;  2YND A;  4X5K A;  5F49 A;  3I9S A;  4XPD C;  2Z3N A;  2GIV A;  4MFP A;  2P6G A;  2H5M A;  2I79 A;  4NF1 A;  2PR1 A;  3FBU A;  3CXQ A;  1U6M A;  4C7H A;  4IF5 A;  4QUS A;  3D3S A;  1S7N A;  1I12 A;  3DR8 A;  4QBJ A;  2PSW A;  2CY2 A;  5H86 A;  3F8K A;  3W6X A;  4PSX A;  1M4I A;  2R98 A;  4B11 A;  4CGM A;  3OWC A;  2FE7 A;  2B5G A;  2B4D A;  4UCM A;  2ZPA A;  2G3A A;  4MFJ A;  5JPH A;  4HNY B;  4CRZ B;  3PZJ A;  1NE9 A;  4L8A A;  4OAD A;  1YVO A;  4KOV A;  4R87 A;  4B5P B;  2BUE A;  4CAW A;  5BWA B;  4A2Z A;  2Z11 A;  4NCZ A;  3S6G A;  2Q7B A;  2JDC A;  2YGW A;  2OB0 A;  3H4Q A;  5EC4 A;  3VWE A;  2YNC C;  2REF A;  2IL4 A;  1KUX A;  3FNC A;  1KUY A;  2Q0Y A;  4MJ8 A;  3TO6 A;  1LRZ A;  3BJ7 A;  1MJB A;  3GKR A;  2X7B A;  2WSA A;  1QSM A;  4K30 A;  3TE4 A;  3GY9 A;  2OZU A;  3EXN A;  4B12 A;  5F46 A;  3LD2 A;  2C27 A;  4C7I A;  4CGP A;  2VZZ A;  2J8N A;  4KOR A;  4KUA A;  1Y9K A;  2EVN A;  3TTH A;  4KOT A;  3UY5 A;  2ZW4 A;  4R3L A;  4MFQ A;  2Y0M A;  2ZW5 A;  4IUS A;  1Y7R A;  4KLW A;  4FD7 A;  4C2Y A;  2B4D B;  4CRY B;  1V0C A;  4OLL A;  1J4J A;  1M44 A;  4CGL A;  1VHS A;  3VWD A;  3DR6 A;  2AJ6 A;  5J8C A;  1M1D A;  4A32 A;  5G21 A;  2B3V A;  4XPD B;  5G1Z A;  2Z3O A;  2WPW A;  3D8P A;  1TIQ A;  4RI1 A;  5IV0 A;  4MI4 A;  3W6S A;  4B5O A;  4AG7 A;  3FXT A;  4ZGY B;  4NEX A;  1KZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...