3FB3A

Crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLMIQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
molecule keywords N-acetyltransferase
total genus 36
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fb3A00
2JDDA 5H84A 1Q2DA 4LX9A 1IYLA 4J3GA 2FE7A 2Q4YA 1S3ZA 3DR6A 2C27A 1PU9A 2B3VA 2OZGA 2ZW4A 3V8IA 4F6AA 2D4PA 1R57A 2ZW6A 2AJ6A 4QVTA 5F49A 3BLNA 3C26A 3IWGA 1M44A 4K30A 3B8GA 4NCZA 4JXRA 2WPXA 3CXPA 4QB9A 3W6SA 2FCKA 2K5TA 2CNSA 4B5PB 2FXFA 5CNPA 2Q0YA 4AG7A 1U6MA 4U9YA 3VWEA 3K9UA 1Z4EA 4FD6A 5FVJA 3WR7A 3UY5A 4MBUA 3RYOA 4KZTA 3FNCA 4PK3A 4UWJA 2AE6A 1YVKA 1CM0A 4M3SA 4IUSA 5IB0A 3W6XA 4DNCA 4HNWB 1QSRA 1YREA 3N7ZA 3VWDA 4AVBA 2Q4VA 2OZUA 3FIXA 3R9EA 4XNHB 4YRHA 2B3UA 3TFYA 2ATRA 1B87A 5J8FA 2FT0A 4HNXB 5ISVA 4QUSA 2HUZA 1QSNA 2Q44A 4M85A 1XMTA 4XPKA 4KOVA 1S7FA 4JXQA 4B5OA 3I9SA 1XIXA 2QIRA 2CY2A 2BSWA 4XPDC 2VXKA 4CAXA 5C82A 2R7HA 3TT2A 3R95A 2FL4A 4JWPA 2ZXVA 4YGOA 3D2PA 1OZPA 5HMNA 3F8KA 3CXSA 1KZFA 2B4DA 3TOBA 4AVAA 2JDCA 4AG9A 3FYNA 3TO7A 1P4NA 5F48A 2G3TA 4R87A 1M4GA 1M1DA 2CNTA 1YGHA 5KTDA 2B5GA 3FRMA 2HV2A 1BOBA 4XPDB 2I79A 3FBUA 5KTAA 4JJXA 1YR0A 4PSWA 5JQ4A 2PQ8A 4H6UA 2ZPAA 1RXTA 4CAVA 4KOXA 2VBQA 2OH1A 1V0CA 4AB7A 4OLLA 2GE3A 4LUAA 4U9ZA 2J8RA 4JD6A 1S7NA 3EC4A 4KOWA 1CJWA 2G3AA 2J8MA 3GYAA 1N71A 5I0CA 2G0BA 1J4JA 4MHDA 3S6GA 4KOTA 2CNMA 2PSWA 5DWNA 2FIWA 4NSQA 2HQYA 2B4DB 2B58A 3T9YA 3KKWA 4I49A 1TIQA 2R1IA 1YLEA 5EBVA 3QB8A 4OAEA 5IV0A 4BMHA 2VI7A 4E2AA 3CXQA 3QAHA 1KUYA 2D4OA 3DSBA 4CRYB 3GKRA 3OWCA 3PZJA 3T90A 1LRZA 3S6KA 4PK2A 1Z9UA 2DXQA 3R96A 2JEVA 3EFAA 4EVYA 3G8WA 2OU2A 4FD4A 1VKCA 3TO6A 1YK3A 4KUAA 1WK4A 2QMLA 2R98A 1B6BA 2ZW5A 3P2HA 4E0AA 5J8CA 3SXNA 4OADA 4H6ZA 1PUAA 4UA3A 5C88A 2F5IA 1YVOA 2O28A 3S6HA 1MJ9A 4B5PA 2FIAA 4HKFA 2VZZA 2Q04A 2ARHA 2PDOA 4HNYB 1L0CA 4GS4A 4II9A 4PV6A 2R8VA 3LODA 4RI1A 2OB0A 4KLVA 3DDDA 2BEIA 5GCNA 2P6FA 1I21A 2PR1A 4R57A 4X5KA 2REEA 4KVXA 1XE4A 3ZZIA 1S60A 2A4NA 3D3SA 4H89A 1NMTA 3W91A 3D8PA 4JLYA 3I3GA 1Y9WA 1XEBA 1P0HA 1Q2YA 3TO9A 1Y7RA 1MJBA 4KUBA 2PRBA 4KOSA 2B5GB 3P2FA 1I1DA 3G3SA 4IF5A 1I12A 2Z0ZA 4QBJA 4KLWA 3TCVA 4PSXA 5IX3A 4AVCA 4NXYA 3R1KA 1Q2CA 5DWMA 3LD2A 1MJAA 4CAWA 2H5MA 2P0WA 2FSRA 4KVME 1RO5A 2Z11A 3MGDA 1SQHA 3R9GA 3IGRA 2JLMA 2OZHA 1NE9A 4NF1A 2X7BA 4XNHC 3BJ8A 2PC1A 2ZW7A 2P6GA 1WWZA 4UWIA 2B4BA 1QSOA 4L89A 1IICA 5E96A 4CS0B 5HH1A 1QSMA 1IYKA 4KOUA 3SXOA 1NSLA 4U5YA 4F0YA 1IB1E 4FD5A 4NEXA 1S7KA 3EXNA 3PP9A 3EO4A 3SHPA 4UBRA 1QSTA 3FB3A 4ZBGA 5F46A 4R3KA 1Z4RA 4Y49C 1ON0A 3E0KA 4KORA 3F0AA 2IL4A 5KTCA 2BL1A 1XF8A 1GHEA 1MK4A 1M4DA 3F5BA 4KOYA 5F47A 2FS5A 4ORFA 4RS2A 3NE7A 3DR8A 4MY0A 4L8AA 1KUVA 1IIDA 2BUEA 2WPWA 4MY3A 1BO4A 3FXTA 4Y49B 2P6EA 4R3LA 3ZJ0A 4CRZB 2RC4A 4MJ8A 2PR8A 3H4QA 3S6FA 1M4IA 5EC4A 4ONUA 1K4JA 1KUXA 4MI4A 2KCWA 4R9MA 2EUIA 2EVNA 4E8OA 1S7LA 3BJ7A 2VQYA 3JUWA 2J8NA 4KVOE 4YFJA 5JPHA 2Z10A 3GY9A 2GANA 1S5KA 2QECA 3TE4A 3EY5A 2I00A 3TOAA 1UFHA 2NMTA 3D2MA 1YX0A 2GIVA 3TTHA 3JVNA 1VHSA 2Q7BA 1FY7A 1Y9KA 2VZYA 3DNSA 2VEZA 2Y0MA 3PGPA 2REFA 5H86A 4FD7A 4XPLA 4QC6A 3R9FA
chains in the Genus database with same CATH superfamily
2JDDA 4NGMA 5H84A 1Q2DA 4LX9A 1IYLA 3FECA 4J3GA 3SJEA 2FE7A 1YMEA 1ARMA 2ZEHA 4B11A 2PJ7A 2Q4YA 1S3ZA 4P10A 3B3TA 3DR6A 5D29A 2C27A 5AGEA 2DPSA 1PU9A 2B3VA 4X8IA 4YWYA 3PB8X 2ZOFA 2OZGA 2ZW4A 3V8IA 4F6AA 4UFWA 2D4PA 1R57A 1F2PA 3NH5A 5HVGA 4PXEA 2ZW6A 2PIZA 1PYTB 1YQEA 2AJ6A 4OP4A 5AG6A 1BLLE 4A32A 4QVTA 5F49A 3BLNA 3C26A 2PVVA 3K2KA 5A27A 1H8LA 3IWGA 3IJ3A 5LYIA 3D7HA 1M44A 4A37A 2OR4A 4Q7AA 1ARLA 2IMOA 2YNEA 4K30A 3B8GA 4NCZA 4C2YA 3TX8A 4JXRA 4CYNA 8CPAA 1ELMP 4UEZA 2CIJA 2WPXA 3CXPA 4QB9A 3W6SA 2FCKA 4MFJA 1YLOA 4KSFA 2K5TA 2CNSA 4B5PB 2FXFA 5CNPA 4NGTA 1TKHA 2Q0YA 4A39A 4AG7A 4C68A 2I3CA 4LQGA 3GB0A 1U6MA 4PXCA 3FEDA 4P45A 4B13A 1EE3P 4U9YA 3VWEA 5K8MA 1CP7A 2WSAA 3ISXA 2V77A 3K9UA 3DLJA 4MFLA 4MCSA 5K8NA 2XEIA 4UIAA 1Z4EA 3GIUA 4FD6A 5FVJA 2QVPA 3WR7A 2PJ8A 2PVWA 3UY5A 4CYPA 1ELLP 4MBUA 3RYOA 4MHYA 2Z3LA 4KZTA 3FNCA 4PK3A 4UWJA 2AE6A 1DTDA 3KHZA 1HDQA 3LWUA 3PBEA 3QAYA 4F0XA 3H5ZA 1X10A 1YVKA 4LQ6A 4NGPA 1CM0A 2O4HA 3HLPA 4M3SA 4IUSA 3WABA 4CAFA 5A28A 5IB0A 2AFWA 3H8FA 3W6XA 5LYFA 4DNCA 4HNWB 1QSRA 1YREA 3N7ZA 3VWDA 4TWEA 2PJ6A 4AVBA 2Q4VA 4X2TA 1DE4C 2OZUA 2OOTA 3FIXA 3R9EA 1AMPA 4XNHB 3RO0A 4K3NA 2PJAA 4YRHA 2B3UA 3TFYA 2ATRA 1B87A 1JWQA 2PJ3A 5J8FA 2FT0A 1XBUA 4Q38A 4HNXB 5ISVA 4OC3A 1ZO0A 4QUSA 2HUZA 4ZY0A 1QSNA 2Q44A 4M85A 1NSAA 3D7DA 4MCRA 1XMTA 4XPKA 5AG7A 2PJBA 3GLJA 4A38A 4KOVA 4ZX8A 1S7FA 3IWEA 2PJ2A 4JXQA 4B5OA 3I9SA 3B3VA 1XIXA 2QIRA 2CY2A 3B3WA 4MRIA 2BSWA 4XPDC 4MHPA 2VXKA 4CAXA 4RN7A 5C82A 5K8OA 2R7HA 3IU1A 3B7IA 3TT2A 3B35A 3R95A 4IHMA 2FL4A 4JWPA 2ZXVA 3KI9A 4YGOA 1OZPA 3D2PA 3KZWA 5HMNA 3F8KA 3CXSA 1KZFA 2B4DA 2HC9A 1FT7A 5HVHA 3TOBA 2NSMA 3KR5A 4AVAA 3WC5A 1Z2LA 1TF8A 2JDCA 2ZELA 3FYNA 1VHEA 3TO7A 4AG9A 7CPAA 1P4NA 3D66A 2F8HA 2NYQA 2G3TA 3BXMA 3IIBA 1M4LA 4R87A 4UCMA 4UCPA 1M4GA 1M1DA 2CNTA 1YGHA 4B14A 4CGPA 1ZG8A 5KTDA 2B5GA 3FRMA 1LAMA 3FVLA 1VIXA 3WT4A 4BINA 2HV2A 1BOBA 4ZX9A 4XPDB 2I79A 5LYLA 3FBUA 5KTAA 4JJXA 4NGSA 3SI1A 1YR0A 4A31A 4PSWA 5JQ4A 5G20A 2XEGA 2DPTA 2PQ8A 3H8GA 2ZPAA 3IEHA 1RXTA 4H6UA 3WC6A 4KOXA 4CAVA 1XJOA 3D67A 5I4MA 4MFPA 1ZLHA 2VBQA 2OH1A 4NJRA 1V0CA 2ZEFA 4AB7A 4OLLA 4MHZA 2Q7SA 2GE3A 4GXHA 2PE3A 2ODFA 4MXUA 4UFVA 5G1ZA 2XEJA 4LUAA 2V8HA 4UEEA 4U9ZA 3MN8A 2J8RA 3JTKA 4JD6A 3S9MA 3TC8A 1S7NA 3EC4A 3CZXA 4A94A 4KOWA 4CGMA 1CJWA 1X12A 2G3AA 4P44A 2J8MA 3GYAA 1N71A 2ANPA 4CYQA 5I0CA 4MCQA 2G0BA 1J4JA 3FF3A 4M6IA 4MHDA 3S6GA 3NE8A 3KQZA 5G22A 4B12A 4KOTA 2CNMA 5THWA 2JBJA 2PSWA 3PB9X 2FIWA 5DWNA 1TF9A 2Z3KA 4NSQA 2HQYA 4OC4A 2B4DB 1ZG9A 2B58A 3L2NA 1CBXA 1Z8WA 3T9YA 3KKWA 4I49A 2ZEMA 3PBBA 1TIQA 3RAMA 3BHXA 2CTBA 2R1IA 2CF4A 5LYDA 1YLEA 5EBVA 3QB8A 3D7GA 2BCOA 4OAEA 2DF5A 1KWMA 4B6ZA 5IV0A 4BMHA 4CGLA 2VI7A 4E2AA 4FAIA 2Z3PA 3CXQA 4NGRA 3QAHA 4X3RA 4IK2A 1QQ9A 4OC0A 2ZOGA 3BI0A 1KUYA 2D4OA 4WWVA 4ZI6A 3ISZA 2Q51A 3DSBA 4CRYB 3GKRA 3OWCA 3PB6X 3PZJA 4UIBA 1Y7EA 5IB9A 3T90A 6CPAA 1IOIA 1LRZA 4F9UA 5G21A 3S6KA 4AXVA 4A95A 4A33A 4ONWA 4PK2A 5F48A 3I1UA 5JGFA 2GU2A 3PB7X 1Z9UA 3HUVA 2DXQA 3R96A 4WJBA 4OC1A 2GREA 2C6GA 5LRKA 2JEVA 1YSJA 4M6GA 1UWYA 2ZEOA 1FNOA 3EFAA 4EVYA 2IQ6A 3G8WA 2OU2A 3IO1A 3T8WA 1TXRA 4FD4A 2EK9A 4MFQA 1VKCA 1XMBA 3TO6A 4P4IA 1YK3A 4FWUA 2CTCA 4MMOA 3SI0A 4CGOA 3B3CA 2PCUA 4KUAA 1WK4A 2QMLA 1LOKA 2R98A 3B3SA 1IU8A 1B6BA 2F7VA 4ZY2A 2ZW5A 3P2HA 4E0AA 4R8FA 5J8CA 4MCPA 3SXNA 4OADA 4UF4A 2G9DA 4H6ZA 2YNCA 1GYTA 1PUAA 4OC5A 4UA3A 2F5IA 5C88A 1YVOA 4UEFA 2O28A 3V7ZA 1AUGA 1QMUA 3S6HA 2V8GA 1MJ9A 4B5PA 2FIAA 4HKFA 4H2KA 2VZZA 1LFWA 4C2XA 4KSIA 4PPZA 2Q04A 2ARHA 1VGYA 2PDOA 4HNYB 1L0CA 2PIYA 3LMSA 4GS4A 4PV6A 3RZAA 5CBMA 4II9A 1VHOA 3NH8A 2ZEDA 1ZG7A 1AYEA 3FEEA 1TKFA 2Q43A 2R8VA 3LODA 4RI1A 4R7MA 1IY7A 2OB0A 3DDDA 4KLVA 2BEIA 5GCNA 2P6FA 1I21A 2PR1A 2JEWA 4R57A 2QJ8A 3IC1A 3LACA 3NFZA 2C1CA 4X5KA 1Z5RA 5AG5A 2REEA 4KVXA 1XE4A 3ZZIA 4F8ZA 1Z8LA 2AFXA 4PXBA 1S60A 4P4DA 2A4NA 5HVFA 3D3SA 4H89A 1NMTA 2ABZA 3FH4A 3W91A 4P4BA 2EK8A 3D8PA 4F9VA 4JLYA 3I3GA 1Y9WA 5D8NA 1XOVA 4R76A 2ZEGA 1XEBA 3H8EA 3S9NA 3WC7A 2PRQA 2EWBA 3RBUA 3SI2A 1CP6A 3BI1A 2J9AA 2V8VA 1P0HA 1Q2YA 3TO9A 3N5FA 2QYVA 1Y7RA 1MJBA 2V8DA 1LCPA 4KUBA 2PRBA 4KOSA 4P4EA 4DJLA 2B5GB 3P2FA 1I1DA 3G3SA 4IF5A 3CPAA 1I12A 5DS0A 3RNZA 2Z0ZA 4QBJA 2YNCC 4KLWA 3IFEA 2GFQA 3KGQA 4P6YA 4JZ0A 3SJGA 3TCVA 4CYOA 4PSXA 1LAPA 5IX3A 4AVCA 4OIWA 4NXYA 3R1KA 1Q2CA 4NGQA 5DWMA 4RUHA 3LD2A 1MJAA 4CAWA 2H5MA 2P0WA 4MHNA 2FSRA 3PFEA 4FUUA 4P4FA 4HPSA 4FBEA 4UFXA 4KVME 1RO5A 2Z11A 3CT9A 3MGDA 1SQHA 2PJ9A 2C6CA 2PJ4A 3R9GA 2O53A 2C6PA 2JLMA 3IGRA 2WUUA 1F2OA 2OZHA 1NE9A 4UCNA 4EMEA 2AFUA 2WYRA 1Y0RA 1Z8TA 4NF1A 5EMIA 4ZY1A 2X7BA 4CAEA 2YGWA 1R3NA 4XNHC 5JM6A 3BJ8A 2AFOA 2PC1A 2ZW7A 2P6GA 1WWZA 2GLFA 4UWIA 2B4BA 2AFMA 3VARA 1JQGA 2POKA 4YU9A 4EFDA 3PFOA 1QSOA 2Z3MA 3MRUA 4L89A 1XFOA 4EWTA 4OIDA 1IICA 1YW4A 5E96A 1R43A 4CS0B 4CGNA 5HH1A 3PRTA 1QSMA 4OKOA 1IYKA 1YW6A 2PJ1A 4KOUA 3IWWA 3SXOA 1NSLA 4U5YA 4F0YA 1IB1E 3CDXA 4FD5A 4NEXA 2BOAA 4W9YA 4NFRA 1S7KA 3EXNA 3PP9A 1PCAA 3EO4A 3SHPA 4UBRA 1QSTA 1Z8XA 3VATA 3FB3A 4ZBGA 5F46A 4R3KA 1Z4RA 2VL1A 4OC2A 4Y49C 3SJFA 4P4JA 5J1QA 1ON0A 1CPXA 2ZENA 1CPSA 2EBJA 3E0KA 4KORA 1BPNA 2ZEPA 3F0AA 3SJXA 2IL4A 3D4UA 5KTCA 4C7HA 3FJUA 2BL1A 1XF8A 3FX6A 1CX8A 3KR4A 3VH9A 1GHEA 1MK4A 4O23A 2EO8A 5AG4A 2PJCA 1F57A 1M4DA 2AFSA 3F5BA 4KOYA 5F47A 4PQAA 2FS5A 4ORFA 4BD9A 4RS2A 3NE7A 3DR8A 5BWAB 5K8PA 1BPMA 3PB4X 4MY0A 4L8AA 5LRGA 1KUVA 3KQXA 4KSAA 1OBRA 1IIDA 2BUEA 4M6HA 4DUKA 2DEAA 2WPWA 4OMEA 5LRJA 5HXDA 4IAVA 4MY3A 1BAVA 4A30A 1BO4A 3FXTA 4Y49B 2P6EA 4R3LA 3ZJ0A 4C2ZA 4CRZB 4BBHA 3NA6A 3KASA 2RC4A 4MJ8A 3D68A 2PR8A 3H4QA 3S6FA 1M4IA 1ZLIA 1Y0YA 4ZGYB 3V38A 5EC4A 3FMCA 4ONUA 2PJ0A 1K4JA 1KUXA 4MI4A 4Z65A 1TKJA 2XEFA 2KCWA 2Q4ZA 4NGNA 4R9MA 2FVGA 2EUIA 4GM5A 2AFZA 4JYWA 2EVNA 3CPXA 1CG2A 4NJQA 4E8OA 1S7LA 3BJ7A 4G1PA 1HEEA 1IGBA 4R6TA 2VQYA 3JUWA 2J8NA 2HB6A 4KVOE 2Z3OA 3PEIA 4KS9A 4YFJA 2Z10A 5JPHA 3D7FA 3NH4A 2IJZA 3DGVA 3GY9A 4MFKA 2GANA 3GUXA 4B10A 2JBKA 5CPAA 4CPAA 3KHXA 1S5KA 2ZEEA 4A2ZA 2QECA 4PXDA 4TNUA 3TE4A 3EY5A 1RTQA 2I00A 3TOAA 1UFHA 2NMTA 3IU2A 5F09A 5ELYA 3D2MA 1YX0A 1A2ZA 1IOFA 3JRUA 2GIVA 4C7IA 3TTHA 3JVNA 1VHSA 2RB7A 4MFZA 2RFHA 2Q7BA 1FY7A 1Y9KA 3B2YA 2GLJA 4Q36A 2VZYA 3DNSA 2VEZA 4DYOA 5JH9A 2Z3NA 2WZNA 3A9LA 2Y0MA 2YNDA 3PGPA 1LANA 2REFA 2CXAA 5H86A 4ZYQA 2PJ5A 4FD7A 1XRYA 1Q7LA 2BO9A 4XPLA 3S9LA 3K9TA 4QC6A 3R9FA 1HDUA 3KL9A 3QNVA
chains in the Genus database with same CATH topology
2JDDA 5H84A 1Q2DA 4LX9A 1IYLA 4J3GA 2FE7A 4B11A 2Q4YA 1S3ZA 3DR6A 2C27A 5AGEA 2DPSA 1PU9A 2B3VA 2OZGA 2ZW4A 3V8IA 4F6AA 4UFWA 2D4PA 1R57A 2ZW6A 2AJ6A 5AG6A 4A32A 4QVTA 5F49A 3BLNA 3C26A 5A27A 3IWGA 1M44A 2YNEA 4K30A 3B8GA 4NCZA 4C2YA 4CYNA 4JXRA 2WPXA 3CXPA 4QB9A 3W6SA 2FCKA 4MFJA 4KSFA 2K5TA 2CNSA 4B5PB 2FXFA 5CNPA 2Q0YA 4C68A 4AG7A 1U6MA 4B13A 4U9YA 3VWEA 2WSAA 3K9UA 4MFLA 1Z4EA 4FD6A 5FVJA 3WR7A 3UY5A 4CYPA 4MBUA 3RYOA 2Z3LA 4KZTA 3FNCA 4PK3A 4UWJA 2AE6A 4F0XA 3H5ZA 1YVKA 5A28A 1CM0A 4M3SA 4CAFA 4IUSA 5IB0A 3W6XA 4DNCA 4HNWB 1QSRA 1YREA 3N7ZA 3VWDA 4AVBA 2Q4VA 2OZUA 3FIXA 3R9EA 4XNHB 4YRHA 2B3UA 3TFYA 2ATRA 1B87A 5J8FA 2FT0A 4Q38A 4HNXB 5ISVA 1ZO0A 4QUSA 2HUZA 1QSNA 2Q44A 4M85A 1XMTA 4XPKA 5AG7A 4KOVA 1S7FA 3IWEA 4JXQA 4B5OA 3I9SA 1XIXA 2QIRA 2CY2A 2BSWA 4XPDC 2VXKA 4CAXA 5C82A 2R7HA 3IU1A 3TT2A 3R95A 2FL4A 4JWPA 2ZXVA 4YGOA 3D2PA 1OZPA 5HMNA 3F8KA 3CXSA 1KZFA 2B4DA 3TOBA 4AVAA 2JDCA 4AG9A 3FYNA 3TO7A 1P4NA 5F48A 2G3TA 4R87A 4UCMA 4UCPA 4B14A 1M4GA 1M1DA 2CNTA 1YGHA 4CGPA 5KTDA 2B5GA 3FRMA 2HV2A 1BOBA 4XPDB 2I79A 3FBUA 5KTAA 4JJXA 1YR0A 4A31A 4PSWA 5JQ4A 5G20A 2DPTA 2PQ8A 4H6UA 2ZPAA 1RXTA 4CAVA 4KOXA 4MFPA 2VBQA 2OH1A 1V0CA 4AB7A 4OLLA 2GE3A 4UFVA 5G1ZA 4LUAA 4U9ZA 2J8RA 3JTKA 4JD6A 1S7NA 3EC4A 4KOWA 4CGMA 1CJWA 2G3AA 2J8MA 3GYAA 1N71A 4CYQA 5I0CA 2G0BA 1J4JA 4MHDA 3S6GA 5G22A 4B12A 4KOTA 2CNMA 2PSWA 5DWNA 2FIWA 2Z3KA 4NSQA 2HQYA 2B4DB 2B58A 3T9YA 3KKWA 4I49A 1TIQA 2R1IA 1YLEA 5EBVA 3QB8A 4OAEA 5IV0A 4BMHA 4CGLA 2VI7A 4E2AA 2Z3PA 3CXQA 3QAHA 1KUYA 2D4OA 3DSBA 4CRYB 3GKRA 3OWCA 3PZJA 3T90A 1LRZA 5G21A 3S6KA 4A95A 4A33A 4PK2A 1Z9UA 2DXQA 3R96A 2JEVA 3EFAA 4EVYA 3G8WA 2OU2A 4FD4A 4MFQA 1VKCA 3TO6A 4CGOA 1YK3A 4KUAA 1WK4A 2QMLA 2R98A 1B6BA 2ZW5A 3P2HA 4E0AA 5J8CA 3SXNA 4OADA 4H6ZA 2YNCA 1PUAA 4UA3A 5C88A 2F5IA 1YVOA 2O28A 3S6HA 1MJ9A 4B5PA 2FIAA 4HKFA 2VZZA 4C2XA 2Q04A 2ARHA 2PDOA 4HNYB 1L0CA 4GS4A 4II9A 4PV6A 2R8VA 3LODA 4RI1A 2OB0A 4KLVA 3DDDA 2BEIA 5GCNA 2P6FA 1I21A 2PR1A 4R57A 4X5KA 5AG5A 2REEA 4KVXA 1XE4A 3ZZIA 1S60A 2A4NA 3D3SA 4H89A 1NMTA 3W91A 3D8PA 4JLYA 3I3GA 1Y9WA 1XEBA 1P0HA 1Q2YA 3TO9A 1Y7RA 1MJBA 4KUBA 2PRBA 4KOSA 2B5GB 3P2FA 1I1DA 3G3SA 4IF5A 1I12A 2Z0ZA 4QBJA 2YNCC 4KLWA 3TCVA 4CYOA 4PSXA 5IX3A 4AVCA 4NXYA 3R1KA 1Q2CA 5DWMA 3LD2A 1MJAA 4CAWA 2H5MA 2P0WA 2FSRA 4UFXA 4KVME 1RO5A 2Z11A 3MGDA 1SQHA 3R9GA 3IGRA 2JLMA 2WUUA 2OZHA 1NE9A 4UCNA 4NF1A 2X7BA 4CAEA 2YGWA 4XNHC 3BJ8A 2PC1A 2ZW7A 2P6GA 1WWZA 4UWIA 2B4BA 1QSOA 2Z3MA 4L89A 1IICA 5E96A 4CS0B 4CGNA 5HH1A 1QSMA 1IYKA 4KOUA 3SXOA 1NSLA 4U5YA 4F0YA 1IB1E 4FD5A 4NEXA 1S7KA 3PP9A 3EXNA 3EO4A 3SHPA 4UBRA 1QSTA 3FB3A 4ZBGA 5F46A 4R3KA 1Z4RA 4Y49C 1ON0A 3E0KA 4KORA 3F0AA 2IL4A 5KTCA 4C7HA 2BL1A 1XF8A 1GHEA 1MK4A 5AG4A 1M4DA 3F5BA 4KOYA 5F47A 2FS5A 4ORFA 4RS2A 3NE7A 3DR8A 5BWAB 4MY0A 4L8AA 1KUVA 4KSAA 1IIDA 2BUEA 2WPWA 4MY3A 4A30A 1BO4A 3FXTA 4Y49B 2P6EA 4R3LA 3ZJ0A 4C2ZA 4CRZB 4BBHA 2RC4A 4MJ8A 2PR8A 3H4QA 3S6FA 1M4IA 4ZGYB 5EC4A 4ONUA 1K4JA 1KUXA 4MI4A 2KCWA 4R9MA 2EUIA 2EVNA 4E8OA 1S7LA 3BJ7A 2VQYA 3JUWA 2J8NA 4KVOE 2Z3OA 4KS9A 4YFJA 5JPHA 2Z10A 3GY9A 4MFKA 2GANA 4B10A 1S5KA 4A2ZA 2QECA 3TE4A 3EY5A 2I00A 3TOAA 1UFHA 2NMTA 3IU2A 3D2MA 1YX0A 2GIVA 4C7IA 3TTHA 3JVNA 1VHSA 4MFZA 2Q7BA 1FY7A 1Y9KA 4Q36A 2VZYA 3DNSA 2VEZA 2Z3NA 3A9LA 2Y0MA 2YNDA 3PGPA 2REFA 2CXAA 5H86A 4FD7A 4XPLA 4QC6A 3R9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDD A;  5H84 A;  1Q2D A;  4LX9 A;  1IYL A;  4J3G A;  2FE7 A;  2Q4Y A;  1S3Z A;  3DR6 A;  2C27 A;  1PU9 A;  2B3V A;  2OZG A;  2ZW4 A;  3V8I A;  4F6A A;  2D4P A;  1R57 A;  2ZW6 A;  2AJ6 A;  4QVT A;  5F49 A;  3BLN A;  3C26 A;  3IWG A;  1M44 A;  4K30 A;  3B8G A;  4NCZ A;  4JXR A;  2WPX A;  3CXP A;  4QB9 A;  3W6S A;  2FCK A;  2K5T A;  2CNS A;  4B5P B;  2FXF A;  5CNP A;  2Q0Y A;  4AG7 A;  1U6M A;  4U9Y A;  3VWE A;  3K9U A;  1Z4E A;  4FD6 A;  5FVJ A;  3WR7 A;  3UY5 A;  4MBU A;  3RYO A;  4KZT A;  3FNC A;  4PK3 A;  4UWJ A;  2AE6 A;  1YVK A;  1CM0 A;  4M3S A;  4IUS A;  5IB0 A;  3W6X A;  4DNC A;  4HNW B;  1QSR A;  1YRE A;  3N7Z A;  3VWD A;  4AVB A;  2Q4V A;  2OZU A;  3FIX A;  3R9E A;  4XNH B;  4YRH A;  2B3U A;  3TFY A;  2ATR A;  1B87 A;  5J8F A;  2FT0 A;  4HNX B;  5ISV A;  4QUS A;  2HUZ A;  1QSN A;  2Q44 A;  4M85 A;  1XMT A;  4XPK A;  4KOV A;  1S7F A;  4JXQ A;  4B5O A;  3I9S A;  1XIX A;  2QIR A;  2CY2 A;  2BSW A;  4XPD C;  2VXK A;  4CAX A;  5C82 A;  2R7H A;  3TT2 A;  3R95 A;  2FL4 A;  4JWP A;  2ZXV A;  4YGO A;  3D2P A;  1OZP A;  5HMN A;  3F8K A;  3CXS A;  1KZF A;  2B4D A;  3TOB A;  4AVA A;  2JDC A;  4AG9 A;  3FYN A;  3TO7 A;  1P4N A;  5F48 A;  2G3T A;  4R87 A;  1M4G A;  1M1D A;  2CNT A;  1YGH A;  5KTD A;  2B5G A;  3FRM A;  2HV2 A;  1BOB A;  4XPD B;  2I79 A;  3FBU A;  5KTA A;  4JJX A;  1YR0 A;  4PSW A;  5JQ4 A;  2PQ8 A;  4H6U A;  2ZPA A;  1RXT A;  4CAV A;  4KOX A;  2VBQ A;  2OH1 A;  1V0C A;  4AB7 A;  4OLL A;  2GE3 A;  4LUA A;  4U9Z A;  2J8R A;  4JD6 A;  1S7N A;  3EC4 A;  4KOW A;  1CJW A;  2G3A A;  2J8M A;  3GYA A;  1N71 A;  5I0C A;  2G0B A;  1J4J A;  4MHD A;  3S6G A;  4KOT A;  2CNM A;  2PSW A;  5DWN A;  2FIW A;  4NSQ A;  2HQY A;  2B4D B;  2B58 A;  3T9Y A;  3KKW A;  4I49 A;  1TIQ A;  2R1I A;  1YLE A;  5EBV A;  3QB8 A;  4OAE A;  5IV0 A;  4BMH A;  2VI7 A;  4E2A A;  3CXQ A;  3QAH A;  1KUY A;  2D4O A;  3DSB A;  4CRY B;  3GKR A;  3OWC A;  3PZJ A;  3T90 A;  1LRZ A;  3S6K A;  4PK2 A;  1Z9U A;  2DXQ A;  3R96 A;  2JEV A;  3EFA A;  4EVY A;  3G8W A;  2OU2 A;  4FD4 A;  1VKC A;  3TO6 A;  1YK3 A;  4KUA A;  1WK4 A;  2QML A;  2R98 A;  1B6B A;  2ZW5 A;  3P2H A;  4E0A A;  5J8C A;  3SXN A;  4OAD A;  4H6Z A;  1PUA A;  4UA3 A;  5C88 A;  2F5I A;  1YVO A;  2O28 A;  3S6H A;  1MJ9 A;  4B5P A;  2FIA A;  4HKF A;  2VZZ A;  2Q04 A;  2ARH A;  2PDO A;  4HNY B;  1L0C A;  4GS4 A;  4II9 A;  4PV6 A;  2R8V A;  3LOD A;  4RI1 A;  2OB0 A;  4KLV A;  3DDD A;  2BEI A;  5GCN A;  2P6F A;  1I21 A;  2PR1 A;  4R57 A;  4X5K A;  2REE A;  4KVX A;  1XE4 A;  3ZZI A;  1S60 A;  2A4N A;  3D3S A;  4H89 A;  1NMT A;  3W91 A;  3D8P A;  4JLY A;  3I3G A;  1Y9W A;  1XEB A;  1P0H A;  1Q2Y A;  3TO9 A;  1Y7R A;  1MJB A;  4KUB A;  2PRB A;  4KOS A;  2B5G B;  3P2F A;  1I1D A;  3G3S A;  4IF5 A;  1I12 A;  2Z0Z A;  4QBJ A;  4KLW A;  3TCV A;  4PSX A;  5IX3 A;  4AVC A;  4NXY A;  3R1K A;  1Q2C A;  5DWM A;  3LD2 A;  1MJA A;  4CAW A;  2H5M A;  2P0W A;  2FSR A;  4KVM E;  1RO5 A;  2Z11 A;  3MGD A;  1SQH A;  3R9G A;  3IGR A;  2JLM A;  2OZH A;  1NE9 A;  4NF1 A;  2X7B A;  4XNH C;  3BJ8 A;  2PC1 A;  2ZW7 A;  2P6G A;  1WWZ A;  4UWI A;  2B4B A;  1QSO A;  4L89 A;  1IIC A;  5E96 A;  4CS0 B;  5HH1 A;  1QSM A;  1IYK A;  4KOU A;  3SXO A;  1NSL A;  4U5Y A;  4F0Y A;  1IB1 E;  4FD5 A;  4NEX A;  1S7K A;  3EXN A;  3PP9 A;  3EO4 A;  3SHP A;  4UBR A;  1QST A;  3FB3 A;  4ZBG A;  5F46 A;  4R3K A;  1Z4R A;  4Y49 C;  1ON0 A;  3E0K A;  4KOR A;  3F0A A;  2IL4 A;  5KTC A;  2BL1 A;  1XF8 A;  1GHE A;  1MK4 A;  1M4D A;  3F5B A;  4KOY A;  5F47 A;  2FS5 A;  4ORF A;  4RS2 A;  3NE7 A;  3DR8 A;  4MY0 A;  4L8A A;  1KUV A;  1IID A;  2BUE A;  2WPW A;  4MY3 A;  1BO4 A;  3FXT A;  4Y49 B;  2P6E A;  4R3L A;  3ZJ0 A;  4CRZ B;  2RC4 A;  4MJ8 A;  2PR8 A;  3H4Q A;  3S6F A;  1M4I A;  5EC4 A;  4ONU A;  1K4J A;  1KUX A;  4MI4 A;  2KCW A;  4R9M A;  2EUI A;  2EVN A;  4E8O A;  1S7L A;  3BJ7 A;  2VQY A;  3JUW A;  2J8N A;  4KVO E;  4YFJ A;  5JPH A;  2Z10 A;  3GY9 A;  2GAN A;  1S5K A;  2QEC A;  3TE4 A;  3EY5 A;  2I00 A;  3TOA A;  1UFH A;  2NMT A;  3D2M A;  1YX0 A;  2GIV A;  3TTH A;  3JVN A;  1VHS A;  2Q7B A;  1FY7 A;  1Y9K A;  2VZY A;  3DNS A;  2VEZ A;  2Y0M A;  3PGP A;  2REF A;  5H86 A;  4FD7 A;  4XPL A;  4QC6 A;  3R9F A; 
#chains in the Genus database with same CATH topology
 2JDD A;  4NGM A;  5H84 A;  1Q2D A;  4LX9 A;  1IYL A;  3FEC A;  4J3G A;  3SJE A;  2FE7 A;  1YME A;  1ARM A;  2ZEH A;  4B11 A;  2PJ7 A;  2Q4Y A;  1S3Z A;  4P10 A;  3B3T A;  3DR6 A;  5D29 A;  2C27 A;  5AGE A;  2DPS A;  1PU9 A;  2B3V A;  4X8I A;  4YWY A;  3PB8 X;  2ZOF A;  2OZG A;  2ZW4 A;  3V8I A;  4F6A A;  4UFW A;  2D4P A;  1R57 A;  1F2P A;  3NH5 A;  5HVG A;  4PXE A;  2ZW6 A;  2PIZ A;  1PYT B;  1YQE A;  2AJ6 A;  4OP4 A;  5AG6 A;  1BLL E;  4A32 A;  4QVT A;  5F49 A;  3BLN A;  3C26 A;  2PVV A;  3K2K A;  5A27 A;  1H8L A;  3IWG A;  3IJ3 A;  5LYI A;  3D7H A;  1M44 A;  4A37 A;  2OR4 A;  4Q7A A;  1ARL A;  2IMO A;  2YNE A;  4K30 A;  3B8G A;  4NCZ A;  4C2Y A;  3TX8 A;  4JXR A;  4CYN A;  8CPA A;  1ELM P;  4UEZ A;  2CIJ A;  2WPX A;  3CXP A;  4QB9 A;  3W6S A;  2FCK A;  4MFJ A;  1YLO A;  4KSF A;  2K5T A;  2CNS A;  4B5P B;  2FXF A;  5CNP A;  4NGT A;  1TKH A;  2Q0Y A;  4A39 A;  4AG7 A;  4C68 A;  2I3C A;  4LQG A;  3GB0 A;  1U6M A;  4PXC A;  3FED A;  4P45 A;  4B13 A;  1EE3 P;  4U9Y A;  3VWE A;  5K8M A;  1CP7 A;  2WSA A;  3ISX A;  2V77 A;  3K9U A;  3DLJ A;  4MFL A;  4MCS A;  5K8N A;  2XEI A;  4UIA A;  1Z4E A;  3GIU A;  4FD6 A;  5FVJ A;  2QVP A;  3WR7 A;  2PJ8 A;  2PVW A;  3UY5 A;  4CYP A;  1ELL P;  4MBU A;  3RYO A;  4MHY A;  2Z3L A;  4KZT A;  3FNC A;  4PK3 A;  4UWJ A;  2AE6 A;  1DTD A;  3KHZ A;  1HDQ A;  3LWU A;  3PBE A;  3QAY A;  4F0X A;  3H5Z A;  1X10 A;  1YVK A;  4LQ6 A;  4NGP A;  1CM0 A;  2O4H A;  3HLP A;  4M3S A;  4IUS A;  3WAB A;  4CAF A;  5A28 A;  5IB0 A;  2AFW A;  3H8F A;  3W6X A;  5LYF A;  4DNC A;  4HNW B;  1QSR A;  1YRE A;  3N7Z A;  3VWD A;  4TWE A;  2PJ6 A;  4AVB A;  2Q4V A;  4X2T A;  1DE4 C;  2OZU A;  2OOT A;  3FIX A;  3R9E A;  1AMP A;  4XNH B;  3RO0 A;  4K3N A;  2PJA A;  4YRH A;  2B3U A;  3TFY A;  2ATR A;  1B87 A;  1JWQ A;  2PJ3 A;  5J8F A;  2FT0 A;  1XBU A;  4Q38 A;  4HNX B;  5ISV A;  4OC3 A;  1ZO0 A;  4QUS A;  2HUZ A;  4ZY0 A;  1QSN A;  2Q44 A;  4M85 A;  1NSA A;  3D7D A;  4MCR A;  1XMT A;  4XPK A;  5AG7 A;  2PJB A;  3GLJ A;  4A38 A;  4KOV A;  4ZX8 A;  1S7F A;  3IWE A;  2PJ2 A;  4JXQ A;  4B5O A;  3I9S A;  3B3V A;  1XIX A;  2QIR A;  2CY2 A;  3B3W A;  4MRI A;  2BSW A;  4XPD C;  4MHP A;  2VXK A;  4CAX A;  4RN7 A;  5C82 A;  5K8O A;  2R7H A;  3IU1 A;  3B7I A;  3TT2 A;  3B35 A;  3R95 A;  4IHM A;  2FL4 A;  4JWP A;  2ZXV A;  3KI9 A;  4YGO A;  1OZP A;  3D2P A;  3KZW A;  5HMN A;  3F8K A;  3CXS A;  1KZF A;  2B4D A;  2HC9 A;  1FT7 A;  5HVH A;  3TOB A;  2NSM A;  3KR5 A;  4AVA A;  3WC5 A;  1Z2L A;  1TF8 A;  2JDC A;  2ZEL A;  3FYN A;  1VHE A;  3TO7 A;  4AG9 A;  7CPA A;  1P4N A;  3D66 A;  2F8H A;  2NYQ A;  2G3T A;  3BXM A;  3IIB A;  1M4L A;  4R87 A;  4UCM A;  4UCP A;  1M4G A;  1M1D A;  2CNT A;  1YGH A;  4B14 A;  4CGP A;  1ZG8 A;  5KTD A;  2B5G A;  3FRM A;  1LAM A;  3FVL A;  1VIX A;  3WT4 A;  4BIN A;  2HV2 A;  1BOB A;  4ZX9 A;  4XPD B;  2I79 A;  5LYL A;  3FBU A;  5KTA A;  4JJX A;  4NGS A;  3SI1 A;  1YR0 A;  4A31 A;  4PSW A;  5JQ4 A;  5G20 A;  2XEG A;  2DPT A;  2PQ8 A;  3H8G A;  2ZPA A;  3IEH A;  1RXT A;  4H6U A;  3WC6 A;  4KOX A;  4CAV A;  1XJO A;  3D67 A;  5I4M A;  4MFP A;  1ZLH A;  2VBQ A;  2OH1 A;  4NJR A;  1V0C A;  2ZEF A;  4AB7 A;  4OLL A;  4MHZ A;  2Q7S A;  2GE3 A;  4GXH A;  2PE3 A;  2ODF A;  4MXU A;  4UFV A;  5G1Z A;  2XEJ A;  4LUA A;  2V8H A;  4UEE A;  4U9Z A;  3MN8 A;  2J8R A;  3JTK A;  4JD6 A;  3S9M A;  3TC8 A;  1S7N A;  3EC4 A;  3CZX A;  4A94 A;  4KOW A;  4CGM A;  1CJW A;  1X12 A;  2G3A A;  4P44 A;  2J8M A;  3GYA A;  1N71 A;  2ANP A;  4CYQ A;  5I0C A;  4MCQ A;  2G0B A;  1J4J A;  3FF3 A;  4M6I A;  4MHD A;  3S6G A;  3NE8 A;  3KQZ A;  5G22 A;  4B12 A;  4KOT A;  2CNM A;  5THW A;  2JBJ A;  2PSW A;  3PB9 X;  2FIW A;  5DWN A;  1TF9 A;  2Z3K A;  4NSQ A;  2HQY A;  4OC4 A;  2B4D B;  1ZG9 A;  2B58 A;  3L2N A;  1CBX A;  1Z8W A;  3T9Y A;  3KKW A;  4I49 A;  2ZEM A;  3PBB A;  1TIQ A;  3RAM A;  3BHX A;  2CTB A;  2R1I A;  2CF4 A;  5LYD A;  1YLE A;  5EBV A;  3QB8 A;  3D7G A;  2BCO A;  4OAE A;  2DF5 A;  1KWM A;  4B6Z A;  5IV0 A;  4BMH A;  4CGL A;  2VI7 A;  4E2A A;  4FAI A;  2Z3P A;  3CXQ A;  4NGR A;  3QAH A;  4X3R A;  4IK2 A;  1QQ9 A;  4OC0 A;  2ZOG A;  3BI0 A;  1KUY A;  2D4O A;  4WWV A;  4ZI6 A;  3ISZ A;  2Q51 A;  3DSB A;  4CRY B;  3GKR A;  3OWC A;  3PB6 X;  3PZJ A;  4UIB A;  1Y7E A;  5IB9 A;  3T90 A;  6CPA A;  1IOI A;  1LRZ A;  4F9U A;  5G21 A;  3S6K A;  4AXV A;  4A95 A;  4A33 A;  4ONW A;  4PK2 A;  5F48 A;  3I1U A;  5JGF A;  2GU2 A;  3PB7 X;  1Z9U A;  3HUV A;  2DXQ A;  3R96 A;  4WJB A;  4OC1 A;  2GRE A;  2C6G A;  5LRK A;  2JEV A;  1YSJ A;  4M6G A;  1UWY A;  2ZEO A;  1FNO A;  3EFA A;  4EVY A;  2IQ6 A;  3G8W A;  2OU2 A;  3IO1 A;  3T8W A;  1TXR A;  4FD4 A;  2EK9 A;  4MFQ A;  1VKC A;  1XMB A;  3TO6 A;  4P4I A;  1YK3 A;  4FWU A;  2CTC A;  4MMO A;  3SI0 A;  4CGO A;  3B3C A;  2PCU A;  4KUA A;  1WK4 A;  2QML A;  1LOK A;  2R98 A;  3B3S A;  1IU8 A;  1B6B A;  2F7V A;  4ZY2 A;  2ZW5 A;  3P2H A;  4E0A A;  4R8F A;  5J8C A;  4MCP A;  3SXN A;  4OAD A;  4UF4 A;  2G9D A;  4H6Z A;  2YNC A;  1GYT A;  1PUA A;  4OC5 A;  4UA3 A;  2F5I A;  5C88 A;  1YVO A;  4UEF A;  2O28 A;  3V7Z A;  1AUG A;  1QMU A;  3S6H A;  2V8G A;  1MJ9 A;  4B5P A;  2FIA A;  4HKF A;  4H2K A;  2VZZ A;  1LFW A;  4C2X A;  4KSI A;  4PPZ A;  2Q04 A;  2ARH A;  1VGY A;  2PDO A;  4HNY B;  1L0C A;  2PIY A;  3LMS A;  4GS4 A;  4PV6 A;  3RZA A;  5CBM A;  4II9 A;  1VHO A;  3NH8 A;  2ZED A;  1ZG7 A;  1AYE A;  3FEE A;  1TKF A;  2Q43 A;  2R8V A;  3LOD A;  4RI1 A;  4R7M A;  1IY7 A;  2OB0 A;  3DDD A;  4KLV A;  2BEI A;  5GCN A;  2P6F A;  1I21 A;  2PR1 A;  2JEW A;  4R57 A;  2QJ8 A;  3IC1 A;  3LAC A;  3NFZ A;  2C1C A;  4X5K A;  1Z5R A;  5AG5 A;  2REE A;  4KVX A;  1XE4 A;  3ZZI A;  4F8Z A;  1Z8L A;  2AFX A;  4PXB A;  1S60 A;  4P4D A;  2A4N A;  5HVF A;  3D3S A;  4H89 A;  1NMT A;  2ABZ A;  3FH4 A;  3W91 A;  4P4B A;  2EK8 A;  3D8P A;  4F9V A;  4JLY A;  3I3G A;  1Y9W A;  5D8N A;  1XOV A;  4R76 A;  2ZEG A;  1XEB A;  3H8E A;  3S9N A;  3WC7 A;  2PRQ A;  2EWB A;  3RBU A;  3SI2 A;  1CP6 A;  3BI1 A;  2J9A A;  2V8V A;  1P0H A;  1Q2Y A;  3TO9 A;  3N5F A;  2QYV A;  1Y7R A;  1MJB A;  2V8D A;  1LCP A;  4KUB A;  2PRB A;  4KOS A;  4P4E A;  4DJL A;  2B5G B;  3P2F A;  1I1D A;  3G3S A;  4IF5 A;  3CPA A;  1I12 A;  5DS0 A;  3RNZ A;  2Z0Z A;  4QBJ A;  2YNC C;  4KLW A;  3IFE A;  2GFQ A;  3KGQ A;  4P6Y A;  4JZ0 A;  3SJG A;  3TCV A;  4CYO A;  4PSX A;  1LAP A;  5IX3 A;  4AVC A;  4OIW A;  4NXY A;  3R1K A;  1Q2C A;  4NGQ A;  5DWM A;  4RUH A;  3LD2 A;  1MJA A;  4CAW A;  2H5M A;  2P0W A;  4MHN A;  2FSR A;  3PFE A;  4FUU A;  4P4F A;  4HPS A;  4FBE A;  4UFX A;  4KVM E;  1RO5 A;  2Z11 A;  3CT9 A;  3MGD A;  1SQH A;  2PJ9 A;  2C6C A;  2PJ4 A;  3R9G A;  2O53 A;  2C6P A;  2JLM A;  3IGR A;  2WUU A;  1F2O A;  2OZH A;  1NE9 A;  4UCN A;  4EME A;  2AFU A;  2WYR A;  1Y0R A;  1Z8T A;  4NF1 A;  5EMI A;  4ZY1 A;  2X7B A;  4CAE A;  2YGW A;  1R3N A;  4XNH C;  5JM6 A;  3BJ8 A;  2AFO A;  2PC1 A;  2ZW7 A;  2P6G A;  1WWZ A;  2GLF A;  4UWI A;  2B4B A;  2AFM A;  3VAR A;  1JQG A;  2POK A;  4YU9 A;  4EFD A;  3PFO A;  1QSO A;  2Z3M A;  3MRU A;  4L89 A;  1XFO A;  4EWT A;  4OID A;  1IIC A;  1YW4 A;  5E96 A;  1R43 A;  4CS0 B;  4CGN A;  5HH1 A;  3PRT A;  1QSM A;  4OKO A;  1IYK A;  1YW6 A;  2PJ1 A;  4KOU A;  3IWW A;  3SXO A;  1NSL A;  4U5Y A;  4F0Y A;  1IB1 E;  3CDX A;  4FD5 A;  4NEX A;  2BOA A;  4W9Y A;  4NFR A;  1S7K A;  3EXN A;  3PP9 A;  1PCA A;  3EO4 A;  3SHP A;  4UBR A;  1QST A;  1Z8X A;  3VAT A;  3FB3 A;  4ZBG A;  5F46 A;  4R3K A;  1Z4R A;  2VL1 A;  4OC2 A;  4Y49 C;  3SJF A;  4P4J A;  5J1Q A;  1ON0 A;  1CPX A;  2ZEN A;  1CPS A;  2EBJ A;  3E0K A;  4KOR A;  1BPN A;  2ZEP A;  3F0A A;  3SJX A;  2IL4 A;  3D4U A;  5KTC A;  4C7H A;  3FJU A;  2BL1 A;  1XF8 A;  3FX6 A;  1CX8 A;  3KR4 A;  3VH9 A;  1GHE A;  1MK4 A;  4O23 A;  2EO8 A;  5AG4 A;  2PJC A;  1F57 A;  1M4D A;  2AFS A;  3F5B A;  4KOY A;  5F47 A;  4PQA A;  2FS5 A;  4ORF A;  4BD9 A;  4RS2 A;  3NE7 A;  3DR8 A;  5BWA B;  5K8P A;  1BPM A;  3PB4 X;  4MY0 A;  4L8A A;  5LRG A;  1KUV A;  3KQX A;  4KSA A;  1OBR A;  1IID A;  2BUE A;  4M6H A;  4DUK A;  2DEA A;  2WPW A;  4OME A;  5LRJ A;  5HXD A;  4IAV A;  4MY3 A;  1BAV A;  4A30 A;  1BO4 A;  3FXT A;  4Y49 B;  2P6E A;  4R3L A;  3ZJ0 A;  4C2Z A;  4CRZ B;  4BBH A;  3NA6 A;  3KAS A;  2RC4 A;  4MJ8 A;  3D68 A;  2PR8 A;  3H4Q A;  3S6F A;  1M4I A;  1ZLI A;  1Y0Y A;  4ZGY B;  3V38 A;  5EC4 A;  3FMC A;  4ONU A;  2PJ0 A;  1K4J A;  1KUX A;  4MI4 A;  4Z65 A;  1TKJ A;  2XEF A;  2KCW A;  2Q4Z A;  4NGN A;  4R9M A;  2FVG A;  2EUI A;  4GM5 A;  2AFZ A;  4JYW A;  2EVN A;  3CPX A;  1CG2 A;  4NJQ A;  4E8O A;  1S7L A;  3BJ7 A;  4G1P A;  1HEE A;  1IGB A;  4R6T A;  2VQY A;  3JUW A;  2J8N A;  2HB6 A;  4KVO E;  2Z3O A;  3PEI A;  4KS9 A;  4YFJ A;  2Z10 A;  5JPH A;  3D7F A;  3NH4 A;  2IJZ A;  3DGV A;  3GY9 A;  4MFK A;  2GAN A;  3GUX A;  4B10 A;  2JBK A;  5CPA A;  4CPA A;  3KHX A;  1S5K A;  2ZEE A;  4A2Z A;  2QEC A;  4PXD A;  4TNU A;  3TE4 A;  3EY5 A;  1RTQ A;  2I00 A;  3TOA A;  1UFH A;  2NMT A;  3IU2 A;  5F09 A;  5ELY A;  3D2M A;  1YX0 A;  1A2Z A;  1IOF A;  3JRU A;  2GIV A;  4C7I A;  3TTH A;  3JVN A;  1VHS A;  2RB7 A;  4MFZ A;  2RFH A;  2Q7B A;  1FY7 A;  1Y9K A;  3B2Y A;  2GLJ A;  4Q36 A;  2VZY A;  3DNS A;  2VEZ A;  4DYO A;  5JH9 A;  2Z3N A;  2WZN A;  3A9L A;  2Y0M A;  2YND A;  3PGP A;  1LAN A;  2REF A;  2CXA A;  5H86 A;  4ZYQ A;  2PJ5 A;  4FD7 A;  1XRY A;  1Q7L A;  2BO9 A;  4XPL A;  3S9L A;  3K9T A;  4QC6 A;  3R9F A;  1HDU A;  3KL9 A;  3QNV A; 
#chains in the Genus database with same CATH homology
 2JDD A;  5H84 A;  1Q2D A;  4LX9 A;  1IYL A;  4J3G A;  2FE7 A;  4B11 A;  2Q4Y A;  1S3Z A;  3DR6 A;  2C27 A;  5AGE A;  2DPS A;  1PU9 A;  2B3V A;  2OZG A;  2ZW4 A;  3V8I A;  4F6A A;  4UFW A;  2D4P A;  1R57 A;  2ZW6 A;  2AJ6 A;  5AG6 A;  4A32 A;  4QVT A;  5F49 A;  3BLN A;  3C26 A;  5A27 A;  3IWG A;  1M44 A;  2YNE A;  4K30 A;  3B8G A;  4NCZ A;  4C2Y A;  4CYN A;  4JXR A;  2WPX A;  3CXP A;  4QB9 A;  3W6S A;  2FCK A;  4MFJ A;  4KSF A;  2K5T A;  2CNS A;  4B5P B;  2FXF A;  5CNP A;  2Q0Y A;  4C68 A;  4AG7 A;  1U6M A;  4B13 A;  4U9Y A;  3VWE A;  2WSA A;  3K9U A;  4MFL A;  1Z4E A;  4FD6 A;  5FVJ A;  3WR7 A;  3UY5 A;  4CYP A;  4MBU A;  3RYO A;  2Z3L A;  4KZT A;  3FNC A;  4PK3 A;  4UWJ A;  2AE6 A;  4F0X A;  3H5Z A;  1YVK A;  5A28 A;  1CM0 A;  4M3S A;  4CAF A;  4IUS A;  5IB0 A;  3W6X A;  4DNC A;  4HNW B;  1QSR A;  1YRE A;  3N7Z A;  3VWD A;  4AVB A;  2Q4V A;  2OZU A;  3FIX A;  3R9E A;  4XNH B;  4YRH A;  2B3U A;  3TFY A;  2ATR A;  1B87 A;  5J8F A;  2FT0 A;  4Q38 A;  4HNX B;  5ISV A;  1ZO0 A;  4QUS A;  2HUZ A;  1QSN A;  2Q44 A;  4M85 A;  1XMT A;  4XPK A;  5AG7 A;  4KOV A;  1S7F A;  3IWE A;  4JXQ A;  4B5O A;  3I9S A;  1XIX A;  2QIR A;  2CY2 A;  2BSW A;  4XPD C;  2VXK A;  4CAX A;  5C82 A;  2R7H A;  3IU1 A;  3TT2 A;  3R95 A;  2FL4 A;  4JWP A;  2ZXV A;  4YGO A;  3D2P A;  1OZP A;  5HMN A;  3F8K A;  3CXS A;  1KZF A;  2B4D A;  3TOB A;  4AVA A;  2JDC A;  4AG9 A;  3FYN A;  3TO7 A;  1P4N A;  5F48 A;  2G3T A;  4R87 A;  4UCM A;  4UCP A;  4B14 A;  1M4G A;  1M1D A;  2CNT A;  1YGH A;  4CGP A;  5KTD A;  2B5G A;  3FRM A;  2HV2 A;  1BOB A;  4XPD B;  2I79 A;  3FBU A;  5KTA A;  4JJX A;  1YR0 A;  4A31 A;  4PSW A;  5JQ4 A;  5G20 A;  2DPT A;  2PQ8 A;  4H6U A;  2ZPA A;  1RXT A;  4CAV A;  4KOX A;  4MFP A;  2VBQ A;  2OH1 A;  1V0C A;  4AB7 A;  4OLL A;  2GE3 A;  4UFV A;  5G1Z A;  4LUA A;  4U9Z A;  2J8R A;  3JTK A;  4JD6 A;  1S7N A;  3EC4 A;  4KOW A;  4CGM A;  1CJW A;  2G3A A;  2J8M A;  3GYA A;  1N71 A;  4CYQ A;  5I0C A;  2G0B A;  1J4J A;  4MHD A;  3S6G A;  5G22 A;  4B12 A;  4KOT A;  2CNM A;  2PSW A;  5DWN A;  2FIW A;  2Z3K A;  4NSQ A;  2HQY A;  2B4D B;  2B58 A;  3T9Y A;  3KKW A;  4I49 A;  1TIQ A;  2R1I A;  1YLE A;  5EBV A;  3QB8 A;  4OAE A;  5IV0 A;  4BMH A;  4CGL A;  2VI7 A;  4E2A A;  2Z3P A;  3CXQ A;  3QAH A;  1KUY A;  2D4O A;  3DSB A;  4CRY B;  3GKR A;  3OWC A;  3PZJ A;  3T90 A;  1LRZ A;  5G21 A;  3S6K A;  4A95 A;  4A33 A;  4PK2 A;  1Z9U A;  2DXQ A;  3R96 A;  2JEV A;  3EFA A;  4EVY A;  3G8W A;  2OU2 A;  4FD4 A;  4MFQ A;  1VKC A;  3TO6 A;  4CGO A;  1YK3 A;  4KUA A;  1WK4 A;  2QML A;  2R98 A;  1B6B A;  2ZW5 A;  3P2H A;  4E0A A;  5J8C A;  3SXN A;  4OAD A;  4H6Z A;  2YNC A;  1PUA A;  4UA3 A;  5C88 A;  2F5I A;  1YVO A;  2O28 A;  3S6H A;  1MJ9 A;  4B5P A;  2FIA A;  4HKF A;  2VZZ A;  4C2X A;  2Q04 A;  2ARH A;  2PDO A;  4HNY B;  1L0C A;  4GS4 A;  4II9 A;  4PV6 A;  2R8V A;  3LOD A;  4RI1 A;  2OB0 A;  4KLV A;  3DDD A;  2BEI A;  5GCN A;  2P6F A;  1I21 A;  2PR1 A;  4R57 A;  4X5K A;  5AG5 A;  2REE A;  4KVX A;  1XE4 A;  3ZZI A;  1S60 A;  2A4N A;  3D3S A;  4H89 A;  1NMT A;  3W91 A;  3D8P A;  4JLY A;  3I3G A;  1Y9W A;  1XEB A;  1P0H A;  1Q2Y A;  3TO9 A;  1Y7R A;  1MJB A;  4KUB A;  2PRB A;  4KOS A;  2B5G B;  3P2F A;  1I1D A;  3G3S A;  4IF5 A;  1I12 A;  2Z0Z A;  4QBJ A;  2YNC C;  4KLW A;  3TCV A;  4CYO A;  4PSX A;  5IX3 A;  4AVC A;  4NXY A;  3R1K A;  1Q2C A;  5DWM A;  3LD2 A;  1MJA A;  4CAW A;  2H5M A;  2P0W A;  2FSR A;  4UFX A;  4KVM E;  1RO5 A;  2Z11 A;  3MGD A;  1SQH A;  3R9G A;  3IGR A;  2JLM A;  2WUU A;  2OZH A;  1NE9 A;  4UCN A;  4NF1 A;  2X7B A;  4CAE A;  2YGW A;  4XNH C;  3BJ8 A;  2PC1 A;  2ZW7 A;  2P6G A;  1WWZ A;  4UWI A;  2B4B A;  1QSO A;  2Z3M A;  4L89 A;  1IIC A;  5E96 A;  4CS0 B;  4CGN A;  5HH1 A;  1QSM A;  1IYK A;  4KOU A;  3SXO A;  1NSL A;  4U5Y A;  4F0Y A;  1IB1 E;  4FD5 A;  4NEX A;  1S7K A;  3PP9 A;  3EXN A;  3EO4 A;  3SHP A;  4UBR A;  1QST A;  3FB3 A;  4ZBG A;  5F46 A;  4R3K A;  1Z4R A;  4Y49 C;  1ON0 A;  3E0K A;  4KOR A;  3F0A A;  2IL4 A;  5KTC A;  4C7H A;  2BL1 A;  1XF8 A;  1GHE A;  1MK4 A;  5AG4 A;  1M4D A;  3F5B A;  4KOY A;  5F47 A;  2FS5 A;  4ORF A;  4RS2 A;  3NE7 A;  3DR8 A;  5BWA B;  4MY0 A;  4L8A A;  1KUV A;  4KSA A;  1IID A;  2BUE A;  2WPW A;  4MY3 A;  4A30 A;  1BO4 A;  3FXT A;  4Y49 B;  2P6E A;  4R3L A;  3ZJ0 A;  4C2Z A;  4CRZ B;  4BBH A;  2RC4 A;  4MJ8 A;  2PR8 A;  3H4Q A;  3S6F A;  1M4I A;  4ZGY B;  5EC4 A;  4ONU A;  1K4J A;  1KUX A;  4MI4 A;  2KCW A;  4R9M A;  2EUI A;  2EVN A;  4E8O A;  1S7L A;  3BJ7 A;  2VQY A;  3JUW A;  2J8N A;  4KVO E;  2Z3O A;  4KS9 A;  4YFJ A;  5JPH A;  2Z10 A;  3GY9 A;  4MFK A;  2GAN A;  4B10 A;  1S5K A;  4A2Z A;  2QEC A;  3TE4 A;  3EY5 A;  2I00 A;  3TOA A;  1UFH A;  2NMT A;  3IU2 A;  3D2M A;  1YX0 A;  2GIV A;  4C7I A;  3TTH A;  3JVN A;  1VHS A;  4MFZ A;  2Q7B A;  1FY7 A;  1Y9K A;  4Q36 A;  2VZY A;  3DNS A;  2VEZ A;  2Z3N A;  3A9L A;  2Y0M A;  2YND A;  3PGP A;  2REF A;  2CXA A;  5H86 A;  4FD7 A;  4XPL A;  4QC6 A;  3R9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...