3FB3A

Crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLMIQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-acetyltransferase
publication title Crystal Structure of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886
rcsb
source organism Trypanosoma brucei
total genus 36
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fb3A00
2P6FA 2Z11A 3LD2A 4XNHC 3D2MA 3CXPA 2C27A 1QSRA 1I1DA 1YGHA 4LUAA 2Q44A 2J8RA 3V8IA 3PGPA 1WK4A 4E2AA 3SHPA 2X7BA 4RS2A 3TFYA 1YREA 2P6EA 1YX0A 4JXQA 4HNYB 2J8MA 4OADA 2BL1A 1VHSA 2ARHA 4RI1A 2VQYA 1QSNA 1TIQA 4H6UA 4CRYB 1S5KA 1FY7A 1KUYA 4QBJA 5KTCA 3TO7A 1P0HA 5I0CA 2G3TA 2WPXA 3GY9A 4UWIA 1M44A 1S7FA 3T90A 2OZGA 4U9ZA 3H4QA 4KVME 4II9A 4KOWA 3PP9A 4FD5A 1I21A 4XPDB 4KVOE 3ZZIA 1YVKA 3N7ZA 3DSBA 4L8AA 1Y9KA 4I49A 3R9GA 2B58A 5ISVA 5DWMA 2NMTA 4AG9A 4H89A 2FIWA 4JD6A 3FYNA 2VXKA 3GYAA 2A4NA 2VI7A 4HNXB 5GCNA 4IUSA 3W91A 2Z0ZA 4KOYA 2AE6A 2OH1A 3VWEA 4CAVA 4PV6A 3FBUA 2HV2A 4KLVA 2FT0A 5F47A 2K5TA 3P2FA 4ORFA 1Y9WA 4H6ZA 4CS0B 2QMLA 1BOBA 3RYOA 1PUAA 4PK3A 3WR7A 2DXQA 2EVNA 3R1KA 4PSWA 3TTHA 4AG7A 1MJBA 1Z9UA 4QC6A 4YGOA 3UY5A 3R9FA 1N71A 5H84A 3IGRA 2D4OA 1B6BA 4UA3A 2B4BA 2QIRA 2ZW4A 4NEXA 1LRZA 4AB7A 5JPHA 4QUSA 1M4GA 4R3LA 4FD6A 4CAWA 1WWZA 4JLYA 2EUIA 2GIVA 3D8PA 1CJWA 2BUEA 4M3SA 2P6GA 4JXRA 4B5OA 5CNPA 3TO9A 2JDDA 4AVAA 1YK3A 2D4PA 4MY3A 1S7LA 4L89A 3EXNA 4MI4A 1Q2DA 5IX3A 1Q2YA 2G3AA 4KOUA 3TOBA 3I9SA 1NSLA 1J4JA 3IWGA 3TOAA 2IL4A 1XE4A 2PC1A 4Y49B 5JQ4A 2CNSA 4EVYA 2G0BA 1NMTA 1L0CA 4ONUA 1XIXA 2RC4A 5FVJA 3D2PA 3TCVA 2O28A 3G8WA 1SQHA 4K30A 1NE9A 2FIAA 1CM0A 1Y7RA 3G3SA 2F5IA 3EO4A 1M1DA 5J8CA 2OZHA 3I3GA 3F5BA 3BLNA 2VZZA 2REFA 4E8OA 4KUBA 2VEZA 1M4DA 1XMTA 4KORA 2BEIA 4UBRA 2GANA 4YRHA 2B4DA 1Q2CA 1R57A 4J3GA 4AVCA 3R95A 2PDOA 1IIDA 4XNHB 4XPKA 3DNSA 3S6HA 1QSOA 3CXSA 1MJ9A 5IV0A 3CXQA 2B3VA 2R7HA 2JEVA 4HNWB 3F8KA 4QB9A 4PSXA 3C26A 2AJ6A 5KTAA 4KOSA 4GS4A 2B5GA 1QSMA 4X5KA 4NSQA 1PU9A 2ZPAA 5C88A 4R87A 3FB3A 4XPLA 1XF8A 3SXOA 3JVNA 2BSWA 4B5PA 4CRZB 1S7KA 2FSRA 4JWPA 2ZW5A 2B4DB 3GKRA 3F0AA 4R9MA 3EC4A 2OZUA 3FNCA 4KVXA 3ZJ0A 4JJXA 2CNTA 1P4NA 2PR1A 4F6AA 4IF5A 2PQ8A 1YVOA 2FE7A 4M85A 1IYLA 2ZW7A 3TO6A 3VWDA 1GHEA 3NE7A 4MBUA 2Q04A 3R96A 2B5GB 2CNMA 2VZYA 4KUAA 2KCWA 3FXTA 3LODA 4KOTA 3S6FA 2PRBA 2ATRA 3JUWA 5KTDA 5F48A 4B5PB 4OAEA 4QVTA 2R98A 3T9YA 1MJAA 3FRMA 2R8VA 1UFHA 5EC4A 2I79A 1KUXA 4UWJA 3FIXA 3DR6A 1B87A 3EFAA 1IB1E 2ZXVA 1XEBA 2B3UA 5F46A 2HUZA 1VKCA 2Q7BA 4FD4A 2HQYA 4E0AA 4DNCA 1KUVA 4AVBA 4U5YA 5H86A 2WPWA 4NCZA 3P2HA 4KOXA 2FXFA 2OB0A 2QECA 2Q0YA 2ZW6A 3K9UA 2VBQA 4MJ8A 4KOVA 1RXTA 3E0KA 1K4JA 4LX9A 2JDCA 3W6SA 4BMHA 3S6KA 1S7NA 1M4IA 5E96A 1RO5A 1OZPA 4FD7A 4MY0A 2Y0MA 2FL4A 3TT2A 3DR8A 2R1IA 4ZBGA 2I00A 1YLEA 3EY5A 2JLMA 1YR0A 2H5MA 4Y49C 2OU2A 3QAHA 4R57A 3PZJA 5IB0A 2P0WA 2PSWA 4F0YA 1I12A 3BJ8A 2FS5A 3KKWA 4XPDC 4KLWA 4CAXA 4PK2A 5J8FA 3R9EA 3B8GA 3MGDA 4KZTA 3S6GA 5F49A 1IYKA 3TE4A 1ON0A 3DDDA 2Z10A 5C82A 3QB8A 3D3SA 3W6XA 1QSTA 1U6MA 1KZFA 4R3KA 1MK4A 5HMNA 2CY2A 4HKFA 3OWCA 2PR8A 2REEA 2Q4VA 4OLLA 1IICA 5DWNA 5HH1A 2Q4YA 5EBVA 2J8NA 1S3ZA 4NF1A 1Z4EA 4YFJA 3BJ7A 1Z4RA 3SXNA 2GE3A 4U9YA 4MHDA 1BO4A 1S60A 4NXYA 1V0CA 2FCKA
chains in the Genus database with same CATH superfamily
2Q7SA 1TKFA 5EMIA 2P6FA 2C6CA 4KSAA 2Z11A 3LD2A 3IU1A 4NGMA 4XNHC 3D2MA 3CXPA 2C27A 1QSRA 3MRUA 1AMPA 2PJ9A 1I1DA 4A95A 1YGHA 4LUAA 2Q44A 2RB7A 3RAMA 2J8RA 3V8IA 3PGPA 2CF4A 1WK4A 4E2AA 3SHPA 2X7BA 4RS2A 4MFKA 3TFYA 4MFJA 4Q38A 1Z8XA 3IWEA 1YREA 2P6EA 4B10A 1YX0A 4JXQA 4HNYB 4ZI6A 5HXDA 1XBUA 1Y0RA 2J8MA 4OADA 1AUGA 3IEHA 2BL1A 1VHSA 2ARHA 2Z3OA 4RI1A 2VQYA 5J1QA 1QSNA 1TIQA 1ZO0A 4H6UA 4Q36A 4CRYB 1DTDA 1S5KA 2G9DA 3WT4A 1ARMA 1PCAA 3WC7A 5G22A 1VGYA 1YMEA 1Z8WA 2JBJA 5THWA 8CPAA 1FY7A 1KUYA 3B3CA 4QBJA 5KTCA 4OIDA 3TO7A 1P0HA 5D8NA 5I0CA 4ONWA 4UFXA 1CX8A 4OC2A 2G3TA 2WPXA 1XFOA 4B12A 4CGNA 3GY9A 3ISZA 3NA6A 4UIBA 1M44A 4UWIA 4ZY2A 5BWAB 1S7FA 4IHMA 2ZELA 3FEEA 5HVHA 4UF4A 1FNOA 1HEEA 2OZGA 2YNCA 3PEIA 1LCPA 4U9ZA 3T90A 3H4QA 4KVME 3GB0A 4II9A 2ODFA 4CGPA 4KOWA 3PP9A 4FD5A 1I21A 3CZXA 4P4IA 2V77A 4XPDB 4KVOE 2CIJA 2PJ6A 3K2KA 4JZ0A 2PJ3A 3ZZIA 5A27A 2HC9A 1GYTA 4OC5A 4P4BA 1YVKA 2Z3LA 3DSBA 3N7ZA 4PQAA 2NSMA 4L8AA 1Y9KA 1XRYA 4KS9A 4I49A 2BCOA 4MHZA 5LRJA 3R9GA 2CXAA 2B58A 4DJLA 2CTCA 1H8LA 5ISVA 5DWMA 3D67A 4A30A 5IB9A 2NMTA 4TNUA 3CPAA 4AG9A 1TF9A 4OIWA 1R3NA 4H89A 3D68A 5G20A 1JWQA 2FIWA 2ZEGA 4JD6A 5F09A 3FYNA 4P44A 3K9TA 4A32A 2VXKA 4UCNA 3D7DA 4B11A 4ZY1A 3GYAA 2F8HA 2A4NA 5A28A 4MFZA 2QYVA 2RFHA 3FF3A 4MFLA 4X2TA 2VI7A 4HNXB 3NH4A 2Z3KA 4IUSA 5GCNA 2Z0ZA 4KOYA 3W91A 2AE6A 4RUHA 4OC1A 1TXRA 2OH1A 3VWEA 4CAVA 3JTKA 4PV6A 3FBUA 4CGOA 4EWTA 4PXDA 3PB6X 2HV2A 2DEAA 1V0CA 1BPMA 4KLVA 2XEGA 2IJZA 2FT0A 2PVVA 2K5TA 2PJBA 5F47A 3P2FA 2CTBA 4R76A 4C2ZA 4ORFA 1UWYA 1Y9WA 1AYEA 4H6ZA 4CS0B 4B13A 1ZLIA 2QMLA 5JGFA 1BOBA 3RYOA 3NH8A 1PUAA 4PK3A 3B2YA 4GXHA 1VHOA 3WR7A 3D4UA 2DXQA 2V8GA 2EVNA 3H8FA 4B14A 3V38A 3T8WA 3B7IA 3R1KA 4PSWA 3KQZA 5K8MA 3TTHA 1PYTB 3N5FA 4AG7A 1MJBA 1ZG8A 2ZEHA 1IOIA 1Z9UA 4QC6A 4YGOA 3UY5A 3VH9A 3R9FA 1N71A 3HUVA 1HDQA 3FMCA 5H84A 5DS0A 1CPXA 3IGRA 2D4OA 2PJ2A 2Q4ZA 2ZEMA 4OP4A 1B6BA 2HB6A 2F7VA 2JEWA 3LMSA 1QQ9A 4UA3A 2B4BA 4R6TA 3WABA 2QIRA 2ZW4A 4X3RA 4NEXA 1LRZA 4CGLA 4AB7A 3IU2A 4FWUA 3KHXA 1EE3P 2ZOGA 2OOTA 5JPHA 4QUSA 2Z3PA 1M4GA 3KGQA 1YW6A 4R3LA 4FD6A 2PJ8A 3I1UA 4MXUA 4CAWA 1WWZA 3IFEA 3FVLA 4JLYA 4UCMA 5D29A 2V8HA 4WWVA 2EUIA 4MRIA 1CP7A 2GIVA 4LQGA 4C7IA 3D8PA 1CJWA 2BUEA 4M3SA 2P6GA 4JXRA 3KQXA 4B5OA 5CNPA 2BO9A 3TO9A 2JDDA 4AVAA 2DF5A 1YK3A 2D4PA 4MY3A 2WZNA 2WUUA 1S7LA 4L89A 4EFDA 4IK2A 3EXNA 4MI4A 1RTQA 1Z8LA 1Q2DA 5IX3A 3KI9A 2ZEEA 1Q2YA 1FT7A 1ZLHA 4ZY0A 2G3AA 2GREA 4A2ZA 2ZEFA 3CT9A 4BBHA 4KOUA 1LOKA 3TOBA 2YGWA 3VATA 4G1PA 3I9SA 3NE8A 1NSLA 1J4JA 3IIBA 3H8GA 5HVFA 3IWGA 3TOAA 4C2XA 4NGQA 5JH9A 2IL4A 1XE4A 2O4HA 2ZEOA 1IY7A 2PC1A 4Y49B 4KSIA 1Y0YA 5JQ4A 2CNSA 4EMEA 4EVYA 2G0BA 4MHNA 4OC4A 4ZGYB 4UFVA 1NMTA 1L0CA 4ONUA 1XIXA 3S9MA 2RC4A 3PB4X 3ISXA 2PJCA 2GLFA 4HPSA 5FVJA 3SJXA 2PRQA 4MCQA 4CYQA 3PB8X 2POKA 3D2PA 3RBUA 4RN7A 2O28A 3TCVA 2DPTA 1OBRA 4TWEA 3G8WA 1SQHA 4K30A 5G21A 4F9VA 1NE9A 2O53A 5K8PA 4P4FA 4DYOA 1Z5RA 2FIAA 1CM0A 1TKHA 1Y7RA 4CAFA 3G3SA 1X12A 3PRTA 3PFOA 2F5IA 5G1ZA 3EO4A 1M1DA 2QJ8A 1IU8A 2PJ7A 5CPAA 5J8CA 2OZHA 4Q7AA 1YW4A 3F5BA 3I3GA 3BLNA 4UEFA 2VZZA 4F0XA 2PJ1A 4CYPA 3MN8A 2REFA 5LYLA 4NGPA 1QMUA 3SI2A 4C7HA 3V7ZA 4E8OA 4KUBA 2AFWA 1Z2LA 2VEZA 4NJQA 1F57A 1M4DA 4OC0A 4ZYQA 7CPAA 4P10A 3KR5A 4UCPA 3RZAA 1XMTA 3S9LA 4MCSA 4MFQA 4KORA 2BEIA 4UBRA 1A2ZA 4MFPA 4NJRA 2GANA 2GLJA 2XEJA 1CPSA 4YRHA 2B4DA 1CBXA 3BHXA 4Z65A 1KWMA 3KZWA 1Q2CA 1R57A 4A39A 4J3GA 4IAVA 4AVCA 3R95A 2PDOA 4FAIA 5AGEA 3QAYA 1IIDA 1XOVA 4XNHB 4OMEA 4XPKA 2PIZA 3JRUA 3RO0A 3DNSA 1YQEA 1QSOA 3PBBA 3FECA 3CXSA 1MJ9A 3S6HA 4F9UA 5IV0A 2WYRA 1LANA 3CXQA 3NFZA 2B3VA 2R7HA 3VARA 2JEVA 3LWUA 2AFZA 4HNWB 5HVGA 3F8KA 3BXMA 4QB9A 4PSXA 1YSJA 3C26A 3TX8A 2EO8A 2AJ6A 3IO1A 1JQGA 2PVWA 4NGTA 4UEZA 4FBEA 3B3TA 5KTAA 4KOSA 3BI1A 4GS4A 2B5GA 1QSMA 5LRKA 4X5KA 2WSAA 1PU9A 2ZPAA 4NSQA 5C88A 4R87A 6CPAA 4M6GA 3FB3A 4NGRA 4XPLA 1XF8A 1VIXA 3PBEA 3SJEA 3SXOA 3JVNA 2BSWA 4B5PA 4CRZB 1S7KA 2FSRA 3PB7X 4JWPA 1R43A 4R8FA 2ZW5A 3PFEA 2ANPA 4OKOA 2EBJA 4YU9A 2B4DB 3GKRA 1Z8TA 3F0AA 2JBKA 4PXCA 2YNDA 4ZX8A 4R9MA 4FUUA 3WC5A 2C6GA 3CPXA 3EC4A 4P6YA 3LACA 1ZG7A 2OZUA 4OC3A 3FNCA 4KSFA 4KVXA 3ZJ0A 4JJXA 2CNTA 1P4NA 4UIAA 1TF8A 4P4DA 3SI1A 2PR1A 4F6AA 2YNCC 4IF5A 2PQ8A 1YVOA 2FE7A 3KHZA 4M85A 2IMOA 2GFQA 1IYLA 2ZW7A 3TO6A 4P45A 3VWDA 5CBMA 1GHEA 2EK8A 3D7HA 2Z3NA 3NE7A 4MBUA 3B3SA 4O23A 2Q04A 3R96A 3IJ3A 2B5GB 2CNMA 1M4LA 3H8EA 5LRGA 1ELMP 4NGSA 4UEEA 4A31A 2VZYA 4KUAA 2KCWA 3FXTA 3LODA 4KOTA 4WJBA 5AG7A 4MCRA 2PJ4A 3B3WA 3S6FA 1BPNA 2PRBA 2ATRA 2YNEA 3JUWA 5KTDA 5F48A 4B5PB 4R7MA 2Q43A 2NYQA 3GLJA 4OAEA 4QVTA 2R98A 3T9YA 1MJAA 2PJ5A 3FRMA 3IC1A 3CDXA 2R8VA 2PCUA 1UFHA 1LFWA 5EC4A 4AXVA 2DPSA 2I79A 2C6PA 1KUXA 4UWJA 3L2NA 4K3NA 4A33A 5JM6A 3FIXA 1HDUA 3DR6A 1B87A 3EFAA 4PPZA 3FJUA 1IB1E 2ZXVA 5AG6A 1XEBA 1YLOA 2Q51A 1IGBA 2B3UA 2QVPA 5F46A 2PE3A 3A9LA 2XEFA 2HUZA 1VKCA 4C2YA 3FEDA 2Q7BA 4FD4A 3KR4A 2HQYA 4E0AA 4CAEA 1NSAA 5AG5A 2XEIA 2FVGA 3FX6A 4DNCA 4NXYA 1KUVA 4M6HA 2AFOA 4AVBA 4U5YA 5H86A 2Z3MA 4JYWA 2WPWA 4NCZA 4W9YA 2C1CA 2OR4A 3KASA 2FXFA 2OB0A 3P2HA 4KOXA 2QECA 2Q0YA 1TKJA 2ZW6A 3K9UA 4A38A 1ELLP 1VHEA 1F2OA 2VBQA 1RXTA 3IWWA 3E0KA 1K4JA 4KOVA 4MJ8A 4BD9A 3H5ZA 4LX9A 2JDCA 3B3VA 3W6SA 1LAMA 4M6IA 3S6KA 4BMHA 1S7NA 3DGVA 3QNVA 1M4IA 4B6ZA 5E96A 2V8DA 1RO5A 1OZPA 4FD7A 3NH5A 4P4EA 3GUXA 4MY0A 3KL9A 2Y0MA 4NGNA 3SJGA 4YWYA 4CPAA 2FL4A 2ZENA 3SI0A 3TT2A 3DR8A 2R1IA 4MHPA 3SJFA 4ZBGA 2I00A 4MCPA 2BOAA 2AFXA 1YLEA 5AG4A 3EY5A 2JLMA 4MHYA 1DE4C 4CYNA 1YR0A 2AFUA 4NFRA 1CG2A 2ABZA 5LYIA 2H5MA 1IOFA 4Y49C 2OU2A 3QAHA 4R57A 5LYDA 2AFMA 4MMOA 3PZJA 5IB0A 2ZEPA 2P0WA 2PSWA 4F0YA 5I4MA 2PIYA 1I12A 1LAPA 3BJ8A 2FS5A 5K8OA 3KKWA 4XPDC 5K8NA 4KLWA 4CAXA 4PK2A 3TC8A 5J8FA 1F2PA 3B8GA 3D66A 3FH4A 3MGDA 4KZTA 3R9EA 3S6GA 2ZOFA 5F49A 1IYKA 4A37A 3TE4A 1ON0A 1Y7EA 3DDDA 2Z10A 4BINA 3QB8A 5C82A 2ZEDA 3D3SA 4ZX9A 3W6XA 2EWBA 1QSTA 1U6MA 3S9NA 1Q7LA 1BAVA 1KZFA 4C68A 4GM5A 2I3CA 4DUKA 4R3KA 4PXBA 4A94A 1MK4A 4UFWA 5HMNA 2CY2A 5LYFA 2PJ0A 4F8ZA 3DLJA 2PJAA 4LQ6A 4HKFA 4X8IA 2IQ6A 3BI0A 3OWCA 2PR8A 2GU2A 2REEA 3HLPA 5ELYA 2Q4VA 4OLLA 2V8VA 1XJOA 3WC6A 1IICA 4PXEA 4CYOA 4H2KA 5DWNA 5HH1A 1XMBA 2Q4YA 5EBVA 3B35A 3RNZA 2J8NA 1X10A 1S3ZA 1ZG9A 2VL1A 4NF1A 1Z4EA 1CP6A 4CGMA 4YFJA 3BJ7A 3D7FA 2AFSA 1Z4RA 3GIUA 3PB9X 4P4JA 3SXNA 2GE3A 1BLLE 4U9YA 3D7GA 1ARLA 4MHDA 1BO4A 1S60A 2J9AA 2EK9A 2FCKA
chains in the Genus database with same CATH topology
2P6FA 4KSAA 2Z11A 3LD2A 3IU1A 4XNHC 3D2MA 3CXPA 2C27A 1QSRA 1I1DA 4A95A 1YGHA 4LUAA 2Q44A 2J8RA 3V8IA 3PGPA 1WK4A 4E2AA 3SHPA 2X7BA 4RS2A 4MFKA 3TFYA 4MFJA 4Q38A 3IWEA 1YREA 2P6EA 4B10A 1YX0A 4JXQA 4HNYB 2J8MA 4OADA 2BL1A 1VHSA 2ARHA 2Z3OA 4RI1A 2VQYA 1QSNA 1TIQA 1ZO0A 4H6UA 4Q36A 4CRYB 1S5KA 5G22A 1FY7A 1KUYA 4QBJA 5KTCA 3TO7A 1P0HA 5I0CA 4UFXA 2G3TA 2WPXA 4CGNA 4B12A 3GY9A 4UWIA 1M44A 5BWAB 1S7FA 2YNCA 2OZGA 3T90A 4U9ZA 3H4QA 4KVME 4II9A 4CGPA 4KOWA 3PP9A 4FD5A 1I21A 4XPDB 4KVOE 3ZZIA 5A27A 1YVKA 2Z3LA 3DSBA 3N7ZA 4L8AA 1Y9KA 4KS9A 4I49A 3R9GA 2CXAA 2B58A 5ISVA 5DWMA 4A30A 2NMTA 4AG9A 4H89A 5G20A 2FIWA 4JD6A 3FYNA 2VXKA 4UCNA 4B11A 3GYAA 2A4NA 5A28A 4MFZA 4MFLA 2VI7A 4HNXB 5GCNA 2Z3KA 4IUSA 3W91A 2Z0ZA 4KOYA 2AE6A 2OH1A 3VWEA 4CAVA 3JTKA 4PV6A 3FBUA 4CGOA 2HV2A 4KLVA 2FT0A 5F47A 2K5TA 3P2FA 4C2ZA 4ORFA 1Y9WA 4H6ZA 4CS0B 4B13A 2QMLA 1BOBA 3RYOA 1PUAA 4PK3A 3WR7A 2DXQA 2EVNA 4B14A 3R1KA 4PSWA 3TTHA 4AG7A 1MJBA 1Z9UA 4QC6A 4YGOA 3UY5A 3R9FA 1N71A 5H84A 3IGRA 2D4OA 1B6BA 4UA3A 2B4BA 2QIRA 2ZW4A 4CGLA 4NEXA 1LRZA 4AB7A 3IU2A 5JPHA 4QUSA 2Z3PA 1M4GA 4R3LA 4FD6A 4CAWA 1WWZA 4JLYA 4UCMA 2EUIA 2GIVA 4C7IA 3D8PA 1CJWA 2BUEA 4M3SA 2P6GA 4JXRA 4B5OA 5CNPA 3TO9A 2JDDA 4AVAA 1YK3A 2D4PA 4MY3A 2WUUA 1S7LA 4L89A 3EXNA 4MI4A 1Q2DA 5IX3A 1Q2YA 2G3AA 4A2ZA 4BBHA 4KOUA 3TOBA 2YGWA 3I9SA 1NSLA 1J4JA 3IWGA 3TOAA 4C2XA 2IL4A 1XE4A 2PC1A 4Y49B 5JQ4A 2CNSA 4EVYA 2G0BA 4ZGYB 4UFVA 1NMTA 1L0CA 4ONUA 1XIXA 2RC4A 5FVJA 4CYQA 3D2PA 3TCVA 2O28A 2DPTA 3G8WA 1SQHA 4K30A 5G21A 1NE9A 2FIAA 1CM0A 1Y7RA 4CAFA 3G3SA 2F5IA 5G1ZA 3EO4A 1M1DA 5J8CA 2OZHA 3I3GA 3F5BA 3BLNA 2VZZA 4F0XA 4CYPA 2REFA 4C7HA 4E8OA 4KUBA 2VEZA 1M4DA 4UCPA 1XMTA 4MFQA 4KORA 2BEIA 4UBRA 4MFPA 2GANA 4YRHA 2B4DA 1Q2CA 1R57A 4J3GA 4AVCA 3R95A 2PDOA 5AGEA 1IIDA 4XNHB 4XPKA 4A32A 3DNSA 3S6HA 1QSOA 3CXSA 1MJ9A 5IV0A 3CXQA 2B3VA 2R7HA 2JEVA 4HNWB 3F8KA 4QB9A 4PSXA 3C26A 2AJ6A 5KTAA 4KOSA 4GS4A 2B5GA 1QSMA 4X5KA 2WSAA 1PU9A 2ZPAA 4NSQA 5C88A 4R87A 3FB3A 4XPLA 1XF8A 3SXOA 3JVNA 2BSWA 4B5PA 4CRZB 1S7KA 2FSRA 4JWPA 2ZW5A 2B4DB 3GKRA 3F0AA 2YNDA 4R9MA 3EC4A 2OZUA 3FNCA 4KSFA 4KVXA 3ZJ0A 4JJXA 2CNTA 1P4NA 2PR1A 4F6AA 2YNCC 4IF5A 2PQ8A 1YVOA 2FE7A 4M85A 1IYLA 2ZW7A 3TO6A 3VWDA 1GHEA 3NE7A 2Z3NA 4MBUA 2Q04A 3R96A 2B5GB 2CNMA 4A31A 2VZYA 4KUAA 2KCWA 3FXTA 3LODA 4KOTA 5AG7A 3S6FA 2PRBA 2ATRA 2YNEA 3JUWA 5KTDA 5F48A 4B5PB 4OAEA 4QVTA 2R98A 3T9YA 1MJAA 3FRMA 2R8VA 1UFHA 5EC4A 2DPSA 2I79A 1KUXA 4UWJA 4A33A 3FIXA 3DR6A 1B87A 3EFAA 1IB1E 2ZXVA 5AG6A 1XEBA 2B3UA 5F46A 2HUZA 1VKCA 4C2YA 2Q7BA 4FD4A 2HQYA 4E0AA 4CAEA 5AG5A 4DNCA 4NXYA 1KUVA 4AVBA 4U5YA 5H86A 2Z3MA 2WPWA 4NCZA 3P2HA 4KOXA 2FXFA 2OB0A 2QECA 2Q0YA 2ZW6A 3K9UA 2VBQA 4MJ8A 4KOVA 1RXTA 3E0KA 1K4JA 3H5ZA 4LX9A 2JDCA 3W6SA 4BMHA 3S6KA 1S7NA 1M4IA 5E96A 1RO5A 1OZPA 4FD7A 4MY0A 2Y0MA 2FL4A 3TT2A 3DR8A 2R1IA 4ZBGA 2I00A 1YLEA 5AG4A 3EY5A 2JLMA 4CYNA 1YR0A 2H5MA 4Y49C 2OU2A 3QAHA 4R57A 3PZJA 5IB0A 2P0WA 2PSWA 4F0YA 1I12A 3BJ8A 2FS5A 3KKWA 4XPDC 4KLWA 4CAXA 4PK2A 5J8FA 3R9EA 3B8GA 3MGDA 4KZTA 3S6GA 5F49A 1IYKA 3TE4A 1ON0A 3DDDA 2Z10A 5C82A 3QB8A 3D3SA 3W6XA 1QSTA 1U6MA 1KZFA 4C68A 4R3KA 1MK4A 4UFWA 5HMNA 2CY2A 4HKFA 3OWCA 2PR8A 2REEA 2Q4VA 4OLLA 1IICA 4CYOA 5DWNA 5HH1A 2Q4YA 5EBVA 2J8NA 1S3ZA 4NF1A 1Z4EA 4CGMA 4YFJA 3BJ7A 1Z4RA 3SXNA 2GE3A 4U9YA 4MHDA 1BO4A 1S60A 3A9LA 1V0CA 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6F A;  2Z11 A;  3LD2 A;  4XNH C;  3D2M A;  3CXP A;  2C27 A;  1QSR A;  1I1D A;  1YGH A;  4LUA A;  2Q44 A;  2J8R A;  3V8I A;  3PGP A;  1WK4 A;  4E2A A;  3SHP A;  2X7B A;  4RS2 A;  3TFY A;  1YRE A;  2P6E A;  1YX0 A;  4JXQ A;  4HNY B;  2J8M A;  4OAD A;  2BL1 A;  1VHS A;  2ARH A;  4RI1 A;  2VQY A;  1QSN A;  1TIQ A;  4H6U A;  4CRY B;  1S5K A;  1FY7 A;  1KUY A;  4QBJ A;  5KTC A;  3TO7 A;  1P0H A;  5I0C A;  2G3T A;  2WPX A;  3GY9 A;  4UWI A;  1M44 A;  1S7F A;  3T90 A;  2OZG A;  4U9Z A;  3H4Q A;  4KVM E;  4II9 A;  4KOW A;  3PP9 A;  4FD5 A;  1I21 A;  4XPD B;  4KVO E;  3ZZI A;  1YVK A;  3N7Z A;  3DSB A;  4L8A A;  1Y9K A;  4I49 A;  3R9G A;  2B58 A;  5ISV A;  5DWM A;  2NMT A;  4AG9 A;  4H89 A;  2FIW A;  4JD6 A;  3FYN A;  2VXK A;  3GYA A;  2A4N A;  2VI7 A;  4HNX B;  5GCN A;  4IUS A;  3W91 A;  2Z0Z A;  4KOY A;  2AE6 A;  2OH1 A;  3VWE A;  4CAV A;  4PV6 A;  3FBU A;  2HV2 A;  4KLV A;  2FT0 A;  5F47 A;  2K5T A;  3P2F A;  4ORF A;  1Y9W A;  4H6Z A;  4CS0 B;  2QML A;  1BOB A;  3RYO A;  1PUA A;  4PK3 A;  3WR7 A;  2DXQ A;  2EVN A;  3R1K A;  4PSW A;  3TTH A;  4AG7 A;  1MJB A;  1Z9U A;  4QC6 A;  4YGO A;  3UY5 A;  3R9F A;  1N71 A;  5H84 A;  3IGR A;  2D4O A;  1B6B A;  4UA3 A;  2B4B A;  2QIR A;  2ZW4 A;  4NEX A;  1LRZ A;  4AB7 A;  5JPH A;  4QUS A;  1M4G A;  4R3L A;  4FD6 A;  4CAW A;  1WWZ A;  4JLY A;  2EUI A;  2GIV A;  3D8P A;  1CJW A;  2BUE A;  4M3S A;  2P6G A;  4JXR A;  4B5O A;  5CNP A;  3TO9 A;  2JDD A;  4AVA A;  1YK3 A;  2D4P A;  4MY3 A;  1S7L A;  4L89 A;  3EXN A;  4MI4 A;  1Q2D A;  5IX3 A;  1Q2Y A;  2G3A A;  4KOU A;  3TOB A;  3I9S A;  1NSL A;  1J4J A;  3IWG A;  3TOA A;  2IL4 A;  1XE4 A;  2PC1 A;  4Y49 B;  5JQ4 A;  2CNS A;  4EVY A;  2G0B A;  1NMT A;  1L0C A;  4ONU A;  1XIX A;  2RC4 A;  5FVJ A;  3D2P A;  3TCV A;  2O28 A;  3G8W A;  1SQH A;  4K30 A;  1NE9 A;  2FIA A;  1CM0 A;  1Y7R A;  3G3S A;  2F5I A;  3EO4 A;  1M1D A;  5J8C A;  2OZH A;  3I3G A;  3F5B A;  3BLN A;  2VZZ A;  2REF A;  4E8O A;  4KUB A;  2VEZ A;  1M4D A;  1XMT A;  4KOR A;  2BEI A;  4UBR A;  2GAN A;  4YRH A;  2B4D A;  1Q2C A;  1R57 A;  4J3G A;  4AVC A;  3R95 A;  2PDO A;  1IID A;  4XNH B;  4XPK A;  3DNS A;  3S6H A;  1QSO A;  3CXS A;  1MJ9 A;  5IV0 A;  3CXQ A;  2B3V A;  2R7H A;  2JEV A;  4HNW B;  3F8K A;  4QB9 A;  4PSX A;  3C26 A;  2AJ6 A;  5KTA A;  4KOS A;  4GS4 A;  2B5G A;  1QSM A;  4X5K A;  4NSQ A;  1PU9 A;  2ZPA A;  5C88 A;  4R87 A;  3FB3 A;  4XPL A;  1XF8 A;  3SXO A;  3JVN A;  2BSW A;  4B5P A;  4CRZ B;  1S7K A;  2FSR A;  4JWP A;  2ZW5 A;  2B4D B;  3GKR A;  3F0A A;  4R9M A;  3EC4 A;  2OZU A;  3FNC A;  4KVX A;  3ZJ0 A;  4JJX A;  2CNT A;  1P4N A;  2PR1 A;  4F6A A;  4IF5 A;  2PQ8 A;  1YVO A;  2FE7 A;  4M85 A;  1IYL A;  2ZW7 A;  3TO6 A;  3VWD A;  1GHE A;  3NE7 A;  4MBU A;  2Q04 A;  3R96 A;  2B5G B;  2CNM A;  2VZY A;  4KUA A;  2KCW A;  3FXT A;  3LOD A;  4KOT A;  3S6F A;  2PRB A;  2ATR A;  3JUW A;  5KTD A;  5F48 A;  4B5P B;  4OAE A;  4QVT A;  2R98 A;  3T9Y A;  1MJA A;  3FRM A;  2R8V A;  1UFH A;  5EC4 A;  2I79 A;  1KUX A;  4UWJ A;  3FIX A;  3DR6 A;  1B87 A;  3EFA A;  1IB1 E;  2ZXV A;  1XEB A;  2B3U A;  5F46 A;  2HUZ A;  1VKC A;  2Q7B A;  4FD4 A;  2HQY A;  4E0A A;  4DNC A;  1KUV A;  4AVB A;  4U5Y A;  5H86 A;  2WPW A;  4NCZ A;  3P2H A;  4KOX A;  2FXF A;  2OB0 A;  2QEC A;  2Q0Y A;  2ZW6 A;  3K9U A;  2VBQ A;  4MJ8 A;  4KOV A;  1RXT A;  3E0K A;  1K4J A;  4LX9 A;  2JDC A;  3W6S A;  4BMH A;  3S6K A;  1S7N A;  1M4I A;  5E96 A;  1RO5 A;  1OZP A;  4FD7 A;  4MY0 A;  2Y0M A;  2FL4 A;  3TT2 A;  3DR8 A;  2R1I A;  4ZBG A;  2I00 A;  1YLE A;  3EY5 A;  2JLM A;  1YR0 A;  2H5M A;  4Y49 C;  2OU2 A;  3QAH A;  4R57 A;  3PZJ A;  5IB0 A;  2P0W A;  2PSW A;  4F0Y A;  1I12 A;  3BJ8 A;  2FS5 A;  3KKW A;  4XPD C;  4KLW A;  4CAX A;  4PK2 A;  5J8F A;  3R9E A;  3B8G A;  3MGD A;  4KZT A;  3S6G A;  5F49 A;  1IYK A;  3TE4 A;  1ON0 A;  3DDD A;  2Z10 A;  5C82 A;  3QB8 A;  3D3S A;  3W6X A;  1QST A;  1U6M A;  1KZF A;  4R3K A;  1MK4 A;  5HMN A;  2CY2 A;  4HKF A;  3OWC A;  2PR8 A;  2REE A;  2Q4V A;  4OLL A;  1IIC A;  5DWN A;  5HH1 A;  2Q4Y A;  5EBV A;  2J8N A;  1S3Z A;  4NF1 A;  1Z4E A;  4YFJ A;  3BJ7 A;  1Z4R A;  3SXN A;  2GE3 A;  4U9Y A;  4MHD A;  1BO4 A;  1S60 A;  4NXY A;  1V0C A;  2FCK A; 
#chains in the Genus database with same CATH topology
 2Q7S A;  1TKF A;  5EMI A;  2P6F A;  2C6C A;  4KSA A;  2Z11 A;  3LD2 A;  3IU1 A;  4NGM A;  4XNH C;  3D2M A;  3CXP A;  2C27 A;  1QSR A;  3MRU A;  1AMP A;  2PJ9 A;  1I1D A;  4A95 A;  1YGH A;  4LUA A;  2Q44 A;  2RB7 A;  3RAM A;  2J8R A;  3V8I A;  3PGP A;  2CF4 A;  1WK4 A;  4E2A A;  3SHP A;  2X7B A;  4RS2 A;  4MFK A;  3TFY A;  4MFJ A;  4Q38 A;  1Z8X A;  3IWE A;  1YRE A;  2P6E A;  4B10 A;  1YX0 A;  4JXQ A;  4HNY B;  4ZI6 A;  5HXD A;  1XBU A;  1Y0R A;  2J8M A;  4OAD A;  1AUG A;  3IEH A;  2BL1 A;  1VHS A;  2ARH A;  2Z3O A;  4RI1 A;  2VQY A;  5J1Q A;  1QSN A;  1TIQ A;  1ZO0 A;  4H6U A;  4Q36 A;  4CRY B;  1DTD A;  1S5K A;  2G9D A;  3WT4 A;  1ARM A;  1PCA A;  3WC7 A;  5G22 A;  1VGY A;  1YME A;  1Z8W A;  2JBJ A;  5THW A;  8CPA A;  1FY7 A;  1KUY A;  3B3C A;  4QBJ A;  5KTC A;  4OID A;  3TO7 A;  1P0H A;  5D8N A;  5I0C A;  4ONW A;  4UFX A;  1CX8 A;  4OC2 A;  2G3T A;  2WPX A;  1XFO A;  4B12 A;  4CGN A;  3GY9 A;  3ISZ A;  3NA6 A;  4UIB A;  1M44 A;  4UWI A;  4ZY2 A;  5BWA B;  1S7F A;  4IHM A;  2ZEL A;  3FEE A;  5HVH A;  4UF4 A;  1FNO A;  1HEE A;  2OZG A;  2YNC A;  3PEI A;  1LCP A;  4U9Z A;  3T90 A;  3H4Q A;  4KVM E;  3GB0 A;  4II9 A;  2ODF A;  4CGP A;  4KOW A;  3PP9 A;  4FD5 A;  1I21 A;  3CZX A;  4P4I A;  2V77 A;  4XPD B;  4KVO E;  2CIJ A;  2PJ6 A;  3K2K A;  4JZ0 A;  2PJ3 A;  3ZZI A;  5A27 A;  2HC9 A;  1GYT A;  4OC5 A;  4P4B A;  1YVK A;  2Z3L A;  3DSB A;  3N7Z A;  4PQA A;  2NSM A;  4L8A A;  1Y9K A;  1XRY A;  4KS9 A;  4I49 A;  2BCO A;  4MHZ A;  5LRJ A;  3R9G A;  2CXA A;  2B58 A;  4DJL A;  2CTC A;  1H8L A;  5ISV A;  5DWM A;  3D67 A;  4A30 A;  5IB9 A;  2NMT A;  4TNU A;  3CPA A;  4AG9 A;  1TF9 A;  4OIW A;  1R3N A;  4H89 A;  3D68 A;  5G20 A;  1JWQ A;  2FIW A;  2ZEG A;  4JD6 A;  5F09 A;  3FYN A;  4P44 A;  3K9T A;  4A32 A;  2VXK A;  4UCN A;  3D7D A;  4B11 A;  4ZY1 A;  3GYA A;  2F8H A;  2A4N A;  5A28 A;  4MFZ A;  2QYV A;  2RFH A;  3FF3 A;  4MFL A;  4X2T A;  2VI7 A;  4HNX B;  3NH4 A;  2Z3K A;  4IUS A;  5GCN A;  2Z0Z A;  4KOY A;  3W91 A;  2AE6 A;  4RUH A;  4OC1 A;  1TXR A;  2OH1 A;  3VWE A;  4CAV A;  3JTK A;  4PV6 A;  3FBU A;  4CGO A;  4EWT A;  4PXD A;  3PB6 X;  2HV2 A;  2DEA A;  1V0C A;  1BPM A;  4KLV A;  2XEG A;  2IJZ A;  2FT0 A;  2PVV A;  2K5T A;  2PJB A;  5F47 A;  3P2F A;  2CTB A;  4R76 A;  4C2Z A;  4ORF A;  1UWY A;  1Y9W A;  1AYE A;  4H6Z A;  4CS0 B;  4B13 A;  1ZLI A;  2QML A;  5JGF A;  1BOB A;  3RYO A;  3NH8 A;  1PUA A;  4PK3 A;  3B2Y A;  4GXH A;  1VHO A;  3WR7 A;  3D4U A;  2DXQ A;  2V8G A;  2EVN A;  3H8F A;  4B14 A;  3V38 A;  3T8W A;  3B7I A;  3R1K A;  4PSW A;  3KQZ A;  5K8M A;  3TTH A;  1PYT B;  3N5F A;  4AG7 A;  1MJB A;  1ZG8 A;  2ZEH A;  1IOI A;  1Z9U A;  4QC6 A;  4YGO A;  3UY5 A;  3VH9 A;  3R9F A;  1N71 A;  3HUV A;  1HDQ A;  3FMC A;  5H84 A;  5DS0 A;  1CPX A;  3IGR A;  2D4O A;  2PJ2 A;  2Q4Z A;  2ZEM A;  4OP4 A;  1B6B A;  2HB6 A;  2F7V A;  2JEW A;  3LMS A;  1QQ9 A;  4UA3 A;  2B4B A;  4R6T A;  3WAB A;  2QIR A;  2ZW4 A;  4X3R A;  4NEX A;  1LRZ A;  4CGL A;  4AB7 A;  3IU2 A;  4FWU A;  3KHX A;  1EE3 P;  2ZOG A;  2OOT A;  5JPH A;  4QUS A;  2Z3P A;  1M4G A;  3KGQ A;  1YW6 A;  4R3L A;  4FD6 A;  2PJ8 A;  3I1U A;  4MXU A;  4CAW A;  1WWZ A;  3IFE A;  3FVL A;  4JLY A;  4UCM A;  5D29 A;  2V8H A;  4WWV A;  2EUI A;  4MRI A;  1CP7 A;  2GIV A;  4LQG A;  4C7I A;  3D8P A;  1CJW A;  2BUE A;  4M3S A;  2P6G A;  4JXR A;  3KQX A;  4B5O A;  5CNP A;  2BO9 A;  3TO9 A;  2JDD A;  4AVA A;  2DF5 A;  1YK3 A;  2D4P A;  4MY3 A;  2WZN A;  2WUU A;  1S7L A;  4L89 A;  4EFD A;  4IK2 A;  3EXN A;  4MI4 A;  1RTQ A;  1Z8L A;  1Q2D A;  5IX3 A;  3KI9 A;  2ZEE A;  1Q2Y A;  1FT7 A;  1ZLH A;  4ZY0 A;  2G3A A;  2GRE A;  4A2Z A;  2ZEF A;  3CT9 A;  4BBH A;  4KOU A;  1LOK A;  3TOB A;  2YGW A;  3VAT A;  4G1P A;  3I9S A;  3NE8 A;  1NSL A;  1J4J A;  3IIB A;  3H8G A;  5HVF A;  3IWG A;  3TOA A;  4C2X A;  4NGQ A;  5JH9 A;  2IL4 A;  1XE4 A;  2O4H A;  2ZEO A;  1IY7 A;  2PC1 A;  4Y49 B;  4KSI A;  1Y0Y A;  5JQ4 A;  2CNS A;  4EME A;  4EVY A;  2G0B A;  4MHN A;  4OC4 A;  4ZGY B;  4UFV A;  1NMT A;  1L0C A;  4ONU A;  1XIX A;  3S9M A;  2RC4 A;  3PB4 X;  3ISX A;  2PJC A;  2GLF A;  4HPS A;  5FVJ A;  3SJX A;  2PRQ A;  4MCQ A;  4CYQ A;  3PB8 X;  2POK A;  3D2P A;  3RBU A;  4RN7 A;  2O28 A;  3TCV A;  2DPT A;  1OBR A;  4TWE A;  3G8W A;  1SQH A;  4K30 A;  5G21 A;  4F9V A;  1NE9 A;  2O53 A;  5K8P A;  4P4F A;  4DYO A;  1Z5R A;  2FIA A;  1CM0 A;  1TKH A;  1Y7R A;  4CAF A;  3G3S A;  1X12 A;  3PRT A;  3PFO A;  2F5I A;  5G1Z A;  3EO4 A;  1M1D A;  2QJ8 A;  1IU8 A;  2PJ7 A;  5CPA A;  5J8C A;  2OZH A;  4Q7A A;  1YW4 A;  3F5B A;  3I3G A;  3BLN A;  4UEF A;  2VZZ A;  4F0X A;  2PJ1 A;  4CYP A;  3MN8 A;  2REF A;  5LYL A;  4NGP A;  1QMU A;  3SI2 A;  4C7H A;  3V7Z A;  4E8O A;  4KUB A;  2AFW A;  1Z2L A;  2VEZ A;  4NJQ A;  1F57 A;  1M4D A;  4OC0 A;  4ZYQ A;  7CPA A;  4P10 A;  3KR5 A;  4UCP A;  3RZA A;  1XMT A;  3S9L A;  4MCS A;  4MFQ A;  4KOR A;  2BEI A;  4UBR A;  1A2Z A;  4MFP A;  4NJR A;  2GAN A;  2GLJ A;  2XEJ A;  1CPS A;  4YRH A;  2B4D A;  1CBX A;  3BHX A;  4Z65 A;  1KWM A;  3KZW A;  1Q2C A;  1R57 A;  4A39 A;  4J3G A;  4IAV A;  4AVC A;  3R95 A;  2PDO A;  4FAI A;  5AGE A;  3QAY A;  1IID A;  1XOV A;  4XNH B;  4OME A;  4XPK A;  2PIZ A;  3JRU A;  3RO0 A;  3DNS A;  1YQE A;  1QSO A;  3PBB A;  3FEC A;  3CXS A;  1MJ9 A;  3S6H A;  4F9U A;  5IV0 A;  2WYR A;  1LAN A;  3CXQ A;  3NFZ A;  2B3V A;  2R7H A;  3VAR A;  2JEV A;  3LWU A;  2AFZ A;  4HNW B;  5HVG A;  3F8K A;  3BXM A;  4QB9 A;  4PSX A;  1YSJ A;  3C26 A;  3TX8 A;  2EO8 A;  2AJ6 A;  3IO1 A;  1JQG A;  2PVW A;  4NGT A;  4UEZ A;  4FBE A;  3B3T A;  5KTA A;  4KOS A;  3BI1 A;  4GS4 A;  2B5G A;  1QSM A;  5LRK A;  4X5K A;  2WSA A;  1PU9 A;  2ZPA A;  4NSQ A;  5C88 A;  4R87 A;  6CPA A;  4M6G A;  3FB3 A;  4NGR A;  4XPL A;  1XF8 A;  1VIX A;  3PBE A;  3SJE A;  3SXO A;  3JVN A;  2BSW A;  4B5P A;  4CRZ B;  1S7K A;  2FSR A;  3PB7 X;  4JWP A;  1R43 A;  4R8F A;  2ZW5 A;  3PFE A;  2ANP A;  4OKO A;  2EBJ A;  4YU9 A;  2B4D B;  3GKR A;  1Z8T A;  3F0A A;  2JBK A;  4PXC A;  2YND A;  4ZX8 A;  4R9M A;  4FUU A;  3WC5 A;  2C6G A;  3CPX A;  3EC4 A;  4P6Y A;  3LAC A;  1ZG7 A;  2OZU A;  4OC3 A;  3FNC A;  4KSF A;  4KVX A;  3ZJ0 A;  4JJX A;  2CNT A;  1P4N A;  4UIA A;  1TF8 A;  4P4D A;  3SI1 A;  2PR1 A;  4F6A A;  2YNC C;  4IF5 A;  2PQ8 A;  1YVO A;  2FE7 A;  3KHZ A;  4M85 A;  2IMO A;  2GFQ A;  1IYL A;  2ZW7 A;  3TO6 A;  4P45 A;  3VWD A;  5CBM A;  1GHE A;  2EK8 A;  3D7H A;  2Z3N A;  3NE7 A;  4MBU A;  3B3S A;  4O23 A;  2Q04 A;  3R96 A;  3IJ3 A;  2B5G B;  2CNM A;  1M4L A;  3H8E A;  5LRG A;  1ELM P;  4NGS A;  4UEE A;  4A31 A;  2VZY A;  4KUA A;  2KCW A;  3FXT A;  3LOD A;  4KOT A;  4WJB A;  5AG7 A;  4MCR A;  2PJ4 A;  3B3W A;  3S6F A;  1BPN A;  2PRB A;  2ATR A;  2YNE A;  3JUW A;  5KTD A;  5F48 A;  4B5P B;  4R7M A;  2Q43 A;  2NYQ A;  3GLJ A;  4OAE A;  4QVT A;  2R98 A;  3T9Y A;  1MJA A;  2PJ5 A;  3FRM A;  3IC1 A;  3CDX A;  2R8V A;  2PCU A;  1UFH A;  1LFW A;  5EC4 A;  4AXV A;  2DPS A;  2I79 A;  2C6P A;  1KUX A;  4UWJ A;  3L2N A;  4K3N A;  4A33 A;  5JM6 A;  3FIX A;  1HDU A;  3DR6 A;  1B87 A;  3EFA A;  4PPZ A;  3FJU A;  1IB1 E;  2ZXV A;  5AG6 A;  1XEB A;  1YLO A;  2Q51 A;  1IGB A;  2B3U A;  2QVP A;  5F46 A;  2PE3 A;  3A9L A;  2XEF A;  2HUZ A;  1VKC A;  4C2Y A;  3FED A;  2Q7B A;  4FD4 A;  3KR4 A;  2HQY A;  4E0A A;  4CAE A;  1NSA A;  5AG5 A;  2XEI A;  2FVG A;  3FX6 A;  4DNC A;  4NXY A;  1KUV A;  4M6H A;  2AFO A;  4AVB A;  4U5Y A;  5H86 A;  2Z3M A;  4JYW A;  2WPW A;  4NCZ A;  4W9Y A;  2C1C A;  2OR4 A;  3KAS A;  2FXF A;  2OB0 A;  3P2H A;  4KOX A;  2QEC A;  2Q0Y A;  1TKJ A;  2ZW6 A;  3K9U A;  4A38 A;  1ELL P;  1VHE A;  1F2O A;  2VBQ A;  1RXT A;  3IWW A;  3E0K A;  1K4J A;  4KOV A;  4MJ8 A;  4BD9 A;  3H5Z A;  4LX9 A;  2JDC A;  3B3V A;  3W6S A;  1LAM A;  4M6I A;  3S6K A;  4BMH A;  1S7N A;  3DGV A;  3QNV A;  1M4I A;  4B6Z A;  5E96 A;  2V8D A;  1RO5 A;  1OZP A;  4FD7 A;  3NH5 A;  4P4E A;  3GUX A;  4MY0 A;  3KL9 A;  2Y0M A;  4NGN A;  3SJG A;  4YWY A;  4CPA A;  2FL4 A;  2ZEN A;  3SI0 A;  3TT2 A;  3DR8 A;  2R1I A;  4MHP A;  3SJF A;  4ZBG A;  2I00 A;  4MCP A;  2BOA A;  2AFX A;  1YLE A;  5AG4 A;  3EY5 A;  2JLM A;  4MHY A;  1DE4 C;  4CYN A;  1YR0 A;  2AFU A;  4NFR A;  1CG2 A;  2ABZ A;  5LYI A;  2H5M A;  1IOF A;  4Y49 C;  2OU2 A;  3QAH A;  4R57 A;  5LYD A;  2AFM A;  4MMO A;  3PZJ A;  5IB0 A;  2ZEP A;  2P0W A;  2PSW A;  4F0Y A;  5I4M A;  2PIY A;  1I12 A;  1LAP A;  3BJ8 A;  2FS5 A;  5K8O A;  3KKW A;  4XPD C;  5K8N A;  4KLW A;  4CAX A;  4PK2 A;  3TC8 A;  5J8F A;  1F2P A;  3B8G A;  3D66 A;  3FH4 A;  3MGD A;  4KZT A;  3R9E A;  3S6G A;  2ZOF A;  5F49 A;  1IYK A;  4A37 A;  3TE4 A;  1ON0 A;  1Y7E A;  3DDD A;  2Z10 A;  4BIN A;  3QB8 A;  5C82 A;  2ZED A;  3D3S A;  4ZX9 A;  3W6X A;  2EWB A;  1QST A;  1U6M A;  3S9N A;  1Q7L A;  1BAV A;  1KZF A;  4C68 A;  4GM5 A;  2I3C A;  4DUK A;  4R3K A;  4PXB A;  4A94 A;  1MK4 A;  4UFW A;  5HMN A;  2CY2 A;  5LYF A;  2PJ0 A;  4F8Z A;  3DLJ A;  2PJA A;  4LQ6 A;  4HKF A;  4X8I A;  2IQ6 A;  3BI0 A;  3OWC A;  2PR8 A;  2GU2 A;  2REE A;  3HLP A;  5ELY A;  2Q4V A;  4OLL A;  2V8V A;  1XJO A;  3WC6 A;  1IIC A;  4PXE A;  4CYO A;  4H2K A;  5DWN A;  5HH1 A;  1XMB A;  2Q4Y A;  5EBV A;  3B35 A;  3RNZ A;  2J8N A;  1X10 A;  1S3Z A;  1ZG9 A;  2VL1 A;  4NF1 A;  1Z4E A;  1CP6 A;  4CGM A;  4YFJ A;  3BJ7 A;  3D7F A;  2AFS A;  1Z4R A;  3GIU A;  3PB9 X;  4P4J A;  3SXN A;  2GE3 A;  1BLL E;  4U9Y A;  3D7G A;  1ARL A;  4MHD A;  1BO4 A;  1S60 A;  2J9A A;  2EK9 A;  2FCK A; 
#chains in the Genus database with same CATH homology
 2P6F A;  4KSA A;  2Z11 A;  3LD2 A;  3IU1 A;  4XNH C;  3D2M A;  3CXP A;  2C27 A;  1QSR A;  1I1D A;  4A95 A;  1YGH A;  4LUA A;  2Q44 A;  2J8R A;  3V8I A;  3PGP A;  1WK4 A;  4E2A A;  3SHP A;  2X7B A;  4RS2 A;  4MFK A;  3TFY A;  4MFJ A;  4Q38 A;  3IWE A;  1YRE A;  2P6E A;  4B10 A;  1YX0 A;  4JXQ A;  4HNY B;  2J8M A;  4OAD A;  2BL1 A;  1VHS A;  2ARH A;  2Z3O A;  4RI1 A;  2VQY A;  1QSN A;  1TIQ A;  1ZO0 A;  4H6U A;  4Q36 A;  4CRY B;  1S5K A;  5G22 A;  1FY7 A;  1KUY A;  4QBJ A;  5KTC A;  3TO7 A;  1P0H A;  5I0C A;  4UFX A;  2G3T A;  2WPX A;  4CGN A;  4B12 A;  3GY9 A;  4UWI A;  1M44 A;  5BWA B;  1S7F A;  2YNC A;  2OZG A;  3T90 A;  4U9Z A;  3H4Q A;  4KVM E;  4II9 A;  4CGP A;  4KOW A;  3PP9 A;  4FD5 A;  1I21 A;  4XPD B;  4KVO E;  3ZZI A;  5A27 A;  1YVK A;  2Z3L A;  3DSB A;  3N7Z A;  4L8A A;  1Y9K A;  4KS9 A;  4I49 A;  3R9G A;  2CXA A;  2B58 A;  5ISV A;  5DWM A;  4A30 A;  2NMT A;  4AG9 A;  4H89 A;  5G20 A;  2FIW A;  4JD6 A;  3FYN A;  2VXK A;  4UCN A;  4B11 A;  3GYA A;  2A4N A;  5A28 A;  4MFZ A;  4MFL A;  2VI7 A;  4HNX B;  5GCN A;  2Z3K A;  4IUS A;  3W91 A;  2Z0Z A;  4KOY A;  2AE6 A;  2OH1 A;  3VWE A;  4CAV A;  3JTK A;  4PV6 A;  3FBU A;  4CGO A;  2HV2 A;  4KLV A;  2FT0 A;  5F47 A;  2K5T A;  3P2F A;  4C2Z A;  4ORF A;  1Y9W A;  4H6Z A;  4CS0 B;  4B13 A;  2QML A;  1BOB A;  3RYO A;  1PUA A;  4PK3 A;  3WR7 A;  2DXQ A;  2EVN A;  4B14 A;  3R1K A;  4PSW A;  3TTH A;  4AG7 A;  1MJB A;  1Z9U A;  4QC6 A;  4YGO A;  3UY5 A;  3R9F A;  1N71 A;  5H84 A;  3IGR A;  2D4O A;  1B6B A;  4UA3 A;  2B4B A;  2QIR A;  2ZW4 A;  4CGL A;  4NEX A;  1LRZ A;  4AB7 A;  3IU2 A;  5JPH A;  4QUS A;  2Z3P A;  1M4G A;  4R3L A;  4FD6 A;  4CAW A;  1WWZ A;  4JLY A;  4UCM A;  2EUI A;  2GIV A;  4C7I A;  3D8P A;  1CJW A;  2BUE A;  4M3S A;  2P6G A;  4JXR A;  4B5O A;  5CNP A;  3TO9 A;  2JDD A;  4AVA A;  1YK3 A;  2D4P A;  4MY3 A;  2WUU A;  1S7L A;  4L89 A;  3EXN A;  4MI4 A;  1Q2D A;  5IX3 A;  1Q2Y A;  2G3A A;  4A2Z A;  4BBH A;  4KOU A;  3TOB A;  2YGW A;  3I9S A;  1NSL A;  1J4J A;  3IWG A;  3TOA A;  4C2X A;  2IL4 A;  1XE4 A;  2PC1 A;  4Y49 B;  5JQ4 A;  2CNS A;  4EVY A;  2G0B A;  4ZGY B;  4UFV A;  1NMT A;  1L0C A;  4ONU A;  1XIX A;  2RC4 A;  5FVJ A;  4CYQ A;  3D2P A;  3TCV A;  2O28 A;  2DPT A;  3G8W A;  1SQH A;  4K30 A;  5G21 A;  1NE9 A;  2FIA A;  1CM0 A;  1Y7R A;  4CAF A;  3G3S A;  2F5I A;  5G1Z A;  3EO4 A;  1M1D A;  5J8C A;  2OZH A;  3I3G A;  3F5B A;  3BLN A;  2VZZ A;  4F0X A;  4CYP A;  2REF A;  4C7H A;  4E8O A;  4KUB A;  2VEZ A;  1M4D A;  4UCP A;  1XMT A;  4MFQ A;  4KOR A;  2BEI A;  4UBR A;  4MFP A;  2GAN A;  4YRH A;  2B4D A;  1Q2C A;  1R57 A;  4J3G A;  4AVC A;  3R95 A;  2PDO A;  5AGE A;  1IID A;  4XNH B;  4XPK A;  4A32 A;  3DNS A;  3S6H A;  1QSO A;  3CXS A;  1MJ9 A;  5IV0 A;  3CXQ A;  2B3V A;  2R7H A;  2JEV A;  4HNW B;  3F8K A;  4QB9 A;  4PSX A;  3C26 A;  2AJ6 A;  5KTA A;  4KOS A;  4GS4 A;  2B5G A;  1QSM A;  4X5K A;  2WSA A;  1PU9 A;  2ZPA A;  4NSQ A;  5C88 A;  4R87 A;  3FB3 A;  4XPL A;  1XF8 A;  3SXO A;  3JVN A;  2BSW A;  4B5P A;  4CRZ B;  1S7K A;  2FSR A;  4JWP A;  2ZW5 A;  2B4D B;  3GKR A;  3F0A A;  2YND A;  4R9M A;  3EC4 A;  2OZU A;  3FNC A;  4KSF A;  4KVX A;  3ZJ0 A;  4JJX A;  2CNT A;  1P4N A;  2PR1 A;  4F6A A;  2YNC C;  4IF5 A;  2PQ8 A;  1YVO A;  2FE7 A;  4M85 A;  1IYL A;  2ZW7 A;  3TO6 A;  3VWD A;  1GHE A;  3NE7 A;  2Z3N A;  4MBU A;  2Q04 A;  3R96 A;  2B5G B;  2CNM A;  4A31 A;  2VZY A;  4KUA A;  2KCW A;  3FXT A;  3LOD A;  4KOT A;  5AG7 A;  3S6F A;  2PRB A;  2ATR A;  2YNE A;  3JUW A;  5KTD A;  5F48 A;  4B5P B;  4OAE A;  4QVT A;  2R98 A;  3T9Y A;  1MJA A;  3FRM A;  2R8V A;  1UFH A;  5EC4 A;  2DPS A;  2I79 A;  1KUX A;  4UWJ A;  4A33 A;  3FIX A;  3DR6 A;  1B87 A;  3EFA A;  1IB1 E;  2ZXV A;  5AG6 A;  1XEB A;  2B3U A;  5F46 A;  2HUZ A;  1VKC A;  4C2Y A;  2Q7B A;  4FD4 A;  2HQY A;  4E0A A;  4CAE A;  5AG5 A;  4DNC A;  4NXY A;  1KUV A;  4AVB A;  4U5Y A;  5H86 A;  2Z3M A;  2WPW A;  4NCZ A;  3P2H A;  4KOX A;  2FXF A;  2OB0 A;  2QEC A;  2Q0Y A;  2ZW6 A;  3K9U A;  2VBQ A;  4MJ8 A;  4KOV A;  1RXT A;  3E0K A;  1K4J A;  3H5Z A;  4LX9 A;  2JDC A;  3W6S A;  4BMH A;  3S6K A;  1S7N A;  1M4I A;  5E96 A;  1RO5 A;  1OZP A;  4FD7 A;  4MY0 A;  2Y0M A;  2FL4 A;  3TT2 A;  3DR8 A;  2R1I A;  4ZBG A;  2I00 A;  1YLE A;  5AG4 A;  3EY5 A;  2JLM A;  4CYN A;  1YR0 A;  2H5M A;  4Y49 C;  2OU2 A;  3QAH A;  4R57 A;  3PZJ A;  5IB0 A;  2P0W A;  2PSW A;  4F0Y A;  1I12 A;  3BJ8 A;  2FS5 A;  3KKW A;  4XPD C;  4KLW A;  4CAX A;  4PK2 A;  5J8F A;  3R9E A;  3B8G A;  3MGD A;  4KZT A;  3S6G A;  5F49 A;  1IYK A;  3TE4 A;  1ON0 A;  3DDD A;  2Z10 A;  5C82 A;  3QB8 A;  3D3S A;  3W6X A;  1QST A;  1U6M A;  1KZF A;  4C68 A;  4R3K A;  1MK4 A;  4UFW A;  5HMN A;  2CY2 A;  4HKF A;  3OWC A;  2PR8 A;  2REE A;  2Q4V A;  4OLL A;  1IIC A;  4CYO A;  5DWN A;  5HH1 A;  2Q4Y A;  5EBV A;  2J8N A;  1S3Z A;  4NF1 A;  1Z4E A;  4CGM A;  4YFJ A;  3BJ7 A;  1Z4R A;  3SXN A;  2GE3 A;  4U9Y A;  4MHD A;  1BO4 A;  1S60 A;  3A9L A;  1V0C A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...