3FB3A

Crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLMIQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyltransferase
publication title Crystal Structure of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 36
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fb3A00
3R96A 1BOBA 1M44A 5HMNA 2VZYA 4AVCA 3R95A 4ONUA 4XNHC 3S6FA 4E0AA 1QSNA 3BJ7A 3F8KA 5F49A 2D4OA 2HUZA 3BJ8A 2P0WA 2G3TA 1CJWA 5I0CA 4KVOE 2PC1A 2PQ8A 4KZTA 1YREA 4E8OA 3TOBA 4F6AA 3MGDA 3TO7A 1NMTA 5F46A 2Q4YA 2B4BA 4NEXA 2R7HA 4IUSA 2O28A 2OB0A 4M85A 3DNSA 1K4JA 2ZW4A 2BL1A 2BEIA 2G3AA 3S6KA 2B5GA 2D4PA 1S60A 4NF1A 2OH1A 2WPWA 4KLWA 5GCNA 1P0HA 2BUEA 4YRHA 2R8VA 2NMTA 4HKFA 1S7KA 3TO6A 4FD4A 4L89A 4PSWA 4U5YA 4MBUA 1ON0A 3P2FA 3TO9A 2QIRA 3R9GA 3LODA 3EO4A 2FE7A 3DSBA 1LRZA 2F5IA 3NE7A 2GANA 3F0AA 1QSMA 4LUAA 1NSLA 4QUSA 3SXOA 5KTAA 1S7NA 4QVTA 4KVME 3ZZIA 1VKCA 1TIQA 3ZJ0A 2VZZA 1QSOA 1I12A 3E0KA 3K9UA 4CRYB 2JDCA 1Y7RA 4B5PB 4H6UA 1KZFA 5IB0A 5F47A 4R57A 1I21A 4XPLA 2EVNA 2ZW6A 5C82A 2Q44A 2QECA 5EBVA 2PDOA 1J4JA 5DWMA 3T90A 2RC4A 2EUIA 3W6SA 1XF8A 1KUYA 5J8FA 3G3SA 3CXSA 1Q2CA 2J8NA 4KOXA 4CAWA 3EY5A 2DXQA 1Q2YA 2GE3A 4JLYA 1GHEA 1IYLA 4KOUA 4AB7A 4R87A 2JEVA 4OAEA 4JJXA 1PUAA 4LX9A 4KOVA 4KVXA 4ORFA 4X5KA 5E96A 3N7ZA 3TT2A 2QMLA 3P2HA 1M4IA 4PSXA 3V8IA 3IGRA 3S6HA 4YFJA 2VQYA 1Y9WA 3FNCA 2KCWA 1IB1E 1XE4A 2J8MA 3CXPA 4JWPA 1B87A 3GKRA 4KOSA 4JD6A 2B3UA 2C27A 4OLLA 3I9SA 2J8RA 2OZUA 4OADA 2X7BA 2VI7A 2B58A 3DDDA 5J8CA 2ZW7A 1SQHA 4R3LA 1IICA 4U9ZA 2CNTA 4EVYA 3VWDA 5IV0A 4JXQA 4XPKA 2Q04A 3WR7A 1I1DA 3OWCA 2PR8A 3SXNA 3H4QA 4CS0B 2ZW5A 1U6MA 2R1IA 4QBJA 4J3GA 3GY9A 2P6GA 1BO4A 3UY5A 1WK4A 3B8GA 2FL4A 2CY2A 2B3VA 3FB3A 4B5PA 3FRMA 5ISVA 5H84A 2JDDA 4XPDB 5IX3A 4UBRA 4QB9A 2G0BA 4DNCA 1MJ9A 2HV2A 2B4DB 4Y49C 2ZPAA 2CNMA 4KUAA 1S7FA 4AG7A 1YVOA 3FXTA 4CRZB 2Q7BA 3GYAA 4YGOA 4RS2A 3G8WA 1B6BA 1Y9KA 4QC6A 3QAHA 3JUWA 2Z0ZA 1XMTA 1N71A 2JLMA 3R1KA 4KOTA 4KOWA 4NCZA 4RI1A 3TFYA 3F5BA 4KORA 4NSQA 4MY3A 4Y49B 5H86A 3JVNA 3T9YA 1FY7A 1UFHA 4M3SA 2P6EA 1VHSA 2FIWA 3PZJA 4GS4A 2FS5A 2BSWA 3S6GA 4JXRA 3VWEA 4AG9A 3W6XA 2PRBA 3QB8A 1CM0A 1S3ZA 3KKWA 5C88A 2VEZA 5CNPA 3D8PA 2HQYA 3CXQA 3C26A 1R57A 3TOAA 4HNXB 1QSTA 1S7LA 4BMHA 2AJ6A 2PR1A 4B5OA 3W91A 4PV6A 1YLEA 4NXYA 1MK4A 2Y0MA 1YVKA 2CNSA 2OZGA 1WWZA 3D2PA 2FT0A 4R3KA 1NE9A 4FD5A 3TCVA 4CAVA 3I3GA 4H6ZA 2FXFA 1MJAA 2Q4VA 1KUVA 4HNWB 4XNHB 3R9FA 3PP9A 5HH1A 2ZXVA 1XIXA 3DR8A 4HNYB 2ATRA 3EC4A 2OU2A 1XEBA 4FD6A 3IWGA 4FD7A 4XPDC 2B4DA 4PK2A 5JPHA 4II9A 3SHPA 2Z11A 4MY0A 3FYNA 3FIXA 2REEA 4UWJA 2WPXA 5FVJA 1YK3A 2GIVA 1P4NA 5F48A 3PGPA 4AVAA 4E2AA 4F0YA 1QSRA 1V0CA 1YGHA 4R9MA 1PU9A 3DR6A 5KTDA 1M1DA 3EXNA 1RXTA 3RYOA 2FSRA 4KLVA 1L0CA 4AVBA 3D2MA 4MHDA 2B5GB 4ZBGA 2H5MA 1S5KA 2VBQA 4KUBA 2FCKA 4PK3A 5EC4A 2K5TA 2VXKA 4H89A 4L8AA 4UWIA 1Z4EA 1Z9UA 2IL4A 4I49A 3FBUA 3EFAA 2P6FA 3TTHA 4UA3A 4MI4A 1M4GA 3BLNA 5KTCA 4CAXA 1Q2DA 1Z4RA 3D3SA 1OZPA 3TE4A 2R98A 2FIAA 2I79A 2ARHA 2PSWA 2Q0YA 1KUXA 5JQ4A 2Z10A 2AE6A 4U9YA 1MJBA 4IF5A 1M4DA 1YX0A 2A4NA 2REFA 1IIDA 4KOYA 1IYKA 4MJ8A 2I00A 3R9EA 5DWNA 4K30A 1RO5A 3LD2A 1YR0A 2OZHA
chains in the Genus database with same CATH superfamily
1Y0RA 2EO8A 3R96A 2BO9A 1BOBA 1M44A 5HMNA 3NH5A 2VZYA 4OIDA 4AVCA 5G1ZA 3R95A 4ONUA 4LQGA 4OP4A 4X8IA 4B12A 4XNHC 1CBXA 3NE8A 3S6FA 4E0AA 1ZG7A 1QSNA 3BJ7A 3F8KA 5F49A 2D4OA 2HUZA 3B3TA 3BJ8A 1ZG8A 3PB9X 4OC2A 4OKOA 4PXEA 2C1CA 5K8PA 2P0WA 4MFQA 4F0XA 2G3TA 1XFOA 1F2PA 3KHZA 1CJWA 5I0CA 4A30A 2XEGA 4KVOE 2PC1A 2AFWA 2PQ8A 2ZEOA 4KZTA 1YREA 4E8OA 3LMSA 3TOBA 4F6AA 4C2XA 3MGDA 3IFEA 2QVPA 5AG5A 3TO7A 3IEHA 1NMTA 2Z3PA 1FNOA 5F46A 4NGRA 4UCNA 1CX8A 4FAIA 2PJ1A 2Q4YA 4FUUA 2PJ3A 3IJ3A 2B4BA 5LRGA 2ODFA 4NEXA 2Q4ZA 4Q7AA 4EMEA 2OR4A 2R7HA 1CP7A 4IUSA 2O28A 3WT4A 2V8GA 3BI1A 1AUGA 2OB0A 1TKFA 4M85A 2YNDA 5D29A 4EWTA 3DNSA 4IAVA 1K4JA 2ZW4A 2BL1A 5CPAA 2BEIA 3IC1A 2GREA 1OBRA 2G3AA 3S6KA 2IQ6A 2B5GA 1LOKA 2D4PA 4MFJA 1CPXA 1VGYA 1S60A 4NF1A 1HEEA 2G9DA 2OH1A 1F2OA 2WPWA 4UEFA 4P4EA 2YNCA 4KLWA 5GCNA 4A33A 4P4JA 2YNCC 4CGMA 4C68A 1P0HA 5LRKA 1DTDA 2CTCA 1ARMA 4A37A 3QNVA 2BUEA 3DLJA 3FVLA 4MHNA 4P45A 5K8MA 4YRHA 2R8VA 2NMTA 4HKFA 1S7KA 1Y7EA 3TO6A 4FD4A 2RB7A 3PBBA 2CXAA 2QJ8A 3BI0A 4L89A 4PSWA 4U5YA 4MBUA 1ON0A 3B35A 3P2FA 4TNUA 1IU8A 2WSAA 1IGBA 3TO9A 2ZEPA 3B3WA 2QIRA 4MRIA 4OC1A 5LYIA 3NA6A 3R9GA 3N5FA 4ZX8A 3LODA 3EO4A 5DS0A 3RO0A 2C6CA 3K2KA 2FE7A 3SJFA 1JQGA 3DSBA 2PVVA 4NGTA 4DUKA 3KL9A 1AYEA 1LRZA 2Z3KA 1LAMA 4ZX9A 2F5IA 4BINA 1Z2LA 3NE7A 1R43A 3FMCA 2GANA 2V77A 4GM5A 3PB4X 3F0AA 4Q38A 2PJAA 1IOFA 4P4FA 1QSMA 3WC5A 4LUAA 2PCUA 4NJRA 1NSLA 3KR4A 3KI9A 3FECA 4MHPA 4QUSA 4YU9A 3SXOA 5KTAA 1XRYA 2ZOGA 3A9LA 3D68A 4ZY0A 2PVWA 4F9VA 1S7NA 2HC9A 4QVTA 4KVME 1XMBA 3ZZIA 4WWVA 1VKCA 3LACA 4MFZA 3D7DA 1TIQA 3BHXA 3ZJ0A 2VZZA 4NGMA 4UF4A 1QSOA 2PJ2A 4UFVA 1I12A 3E0KA 1YLOA 3H8FA 3K9UA 4MFKA 5G20A 3RBUA 4CRYB 8CPAA 2JDCA 5A27A 2NYQA 2PJ9A 1Y7RA 2F7VA 4B5PB 4ZGYB 4A2ZA 4MHZA 1ARLA 4G1PA 4H6UA 2PJBA 4A31A 4CYPA 1KZFA 5IB0A 4BD9A 4GXHA 4NFRA 3KGQA 2JEWA 4UIBA 5F47A 3T8WA 4R57A 1I21A 1YW6A 3SJGA 2O53A 1HDQA 4XPLA 2EVNA 4KSAA 2ZW6A 3H5ZA 5C82A 2Q44A 2QECA 4WJBA 5EBVA 2YNEA 3S9MA 3KR5A 4CGPA 2PDOA 4YWYA 1J4JA 5DWMA 3T90A 2RC4A 4PXCA 5LYFA 4NGQA 2EUIA 3W6SA 1TF8A 1QQ9A 1XF8A 2PIYA 1KUYA 3PB6X 2YGWA 1LCPA 3QAYA 1X10A 3RZAA 3G3SA 2ZEFA 2NSMA 2I3CA 1Q2CA 2VL1A 3CXSA 5J8FA 2PJ0A 2J8NA 4KOXA 3GUXA 2C6GA 3KZWA 3WC6A 1Z8XA 4CAWA 4PQAA 3EY5A 3FJUA 2DXQA 1Q2YA 2GE3A 2PJ5A 2PJ4A 4B10A 4JLYA 1GHEA 3I1UA 1IYLA 3PFOA 3NFZA 2JBKA 4KOUA 3FEDA 4FBEA 2Q7SA 3D67A 4AB7A 4R87A 1ZLHA 4CGOA 1Y0YA 2AFSA 4MCRA 2JEVA 1HDUA 4OAEA 4P6YA 4X2TA 4JJXA 1PUAA 4LX9A 3V7ZA 4KOVA 4KVXA 3SI2A 4CYQA 4ORFA 4MFPA 4X5KA 2ZOFA 5E96A 3VARA 5J1QA 5AG7A 3H8EA 3N7ZA 2V8HA 1QMUA 3TT2A 2QMLA 3P2HA 1M4IA 2Z3LA 4PSXA 3V8IA 3B7IA 3IGRA 5LRJA 3S6HA 4YFJA 4UEZA 4ZYQA 4R76A 2ANPA 2EWBA 1ZO0A 3NH8A 4MFLA 2BCOA 2VQYA 1KWMA 1Y9WA 3FNCA 4IHMA 2KCWA 4A32A 5IB9A 1IB1E 3JRUA 3FF3A 1XE4A 2J8MA 3CXPA 4BBHA 4JWPA 3ISXA 1TXRA 1B87A 2PE3A 2PRQA 3GKRA 4PPZA 5K8NA 3ISZA 3D7FA 4KOSA 3JTKA 4LQ6A 4JD6A 2B3UA 2C27A 1VHEA 3LWUA 4OLLA 4P4DA 3I9SA 4HPSA 2J8RA 2OZUA 4JYWA 2X7BA 4OADA 2VI7A 4OC4A 3RAMA 1IOIA 2B58A 3DDDA 4R7MA 5J8CA 2ZW7A 2WUUA 1SQHA 3GB0A 4R3LA 1IICA 2O4HA 4U9ZA 2CNTA 4EVYA 3VWDA 3WABA 4JXQA 4XPKA 5IV0A 2POKA 2Q04A 1Z5RA 1I1DA 3OWCA 3WR7A 2PR8A 2J9AA 3SXNA 3H4QA 4CYNA 4NGPA 5LYDA 4CS0B 1U6MA 2ZW5A 2R1IA 3NH4A 3D4UA 4QBJA 2QYVA 4J3GA 3GY9A 2P6GA 2WZNA 1BO4A 5IX3A 5BWAB 5G21A 3GLJA 2EBJA 3GIUA 3UY5A 1WK4A 1EE3P 1LAPA 1Z8WA 3B8GA 2FL4A 4KSFA 4Q36A 2CY2A 4M6GA 4UIAA 4UCMA 2B3VA 3FB3A 4B5PA 2ZEEA 3CPXA 4F8ZA 3FRMA 5ISVA 1XBUA 3B3CA 5H84A 4CAEA 2JDDA 4XPDB 3IWEA 4UBRA 4QB9A 2G0BA 4DNCA 4A38A 7CPAA 1A2ZA 1MJ9A 2CTBA 4B13A 2EK8A 2HV2A 3RNZA 2B4DB 4DYOA 5HXDA 4KS9A 4W9YA 2Z3MA 4Y49C 1IY7A 4B14A 2ZPAA 4C7HA 3MN8A 2CNMA 4KUAA 5JGFA 3PB7X 2Q43A 2CF4A 1S7FA 5HVFA 4A94A 4AG7A 1YVOA 3B2YA 3IU2A 2JBJA 3FXTA 3FH4A 3MRUA 2Q7BA 4CRZB 3GYAA 4OIWA 4YGOA 5A28A 4RS2A 3G8WA 3PBEA 1B6BA 1Y9KA 1H8LA 4QC6A 3CT9A 2PJ8A 4M6HA 2IMOA 3QAHA 3JUWA 2Z0ZA 1PCAA 1XMTA 1N71A 2JLMA 3R1KA 2PJCA 4KOTA 3TC8A 1GYTA 4CGLA 4KOWA 4ONWA 4NCZA 4A95A 4RI1A 3TFYA 3D7GA 3F5BA 4KORA 4NJQA 4NSQA 2EK9A 4MY3A 4Y49B 5H86A 3JVNA 3T9YA 5K8OA 1FY7A 5AGEA 3S9NA 4EFDA 4CAFA 1UFHA 4M3SA 2PJ6A 2P6EA 1VHSA 2FIWA 2HB6A 3PZJA 4IK2A 4GS4A 1CPSA 2OOTA 2FS5A 5THWA 4R6TA 3TX8A 2BSWA 1FT7A 3S6GA 4JXRA 3VWEA 4AG9A 3W6XA 1Z8LA 2PRBA 4NGSA 2AFZA 2AFXA 3QB8A 5F09A 4ZY1A 1CM0A 1S3ZA 3KKWA 5C88A 4R8FA 2VEZA 5CNPA 1PYTB 3D8PA 4CYOA 2HQYA 4CGNA 5HVHA 4JZ0A 3KASA 3CXQA 2BOAA 5EMIA 2AFUA 2CIJA 1LANA 1Z8TA 2PIZA 3C26A 2PJ7A 3PRTA 5I4MA 1R57A 3TOAA 4HNXB 1QSTA 1S7LA 2XEIA 4BMHA 1XJOA 1YQEA 2AJ6A 4K3NA 4B6ZA 2PR1A 4B5OA 3W91A 4DJLA 4PV6A 3B3SA 1YLEA 3WC7A 4NXYA 1MK4A 2Y0MA 2XEFA 1YVKA 2CNSA 2OZGA 1WWZA 3D2PA 4P4IA 2FT0A 3KHXA 4R3KA 1NE9A 4FD5A 4P10A 4C7IA 3TCVA 4CAVA 4H2KA 1CP6A 3I3GA 3PB8X 4H6ZA 4PXDA 2ZEDA 3VATA 1YW4A 5JH9A 4NGNA 2FXFA 5CBMA 1MJAA 2Q4VA 1KUVA 4HNWB 4XNHB 3R9FA 1X12A 3PP9A 4M6IA 3SI1A 5HH1A 1Q7LA 2ZEHA 2ZXVA 3V38A 1XIXA 2IJZA 3DR8A 4HNYB 3B3VA 4MHYA 3IIBA 3D7HA 3KQZA 2ZEMA 2ATRA 1ELLP 1DE4C 3H8GA 3IWWA 3EC4A 2OU2A 3D66A 4C2ZA 1BAVA 1ELMP 1XEBA 4X3RA 4ZI6A 4FD6A 3IWGA 4FD7A 1BPMA 4XPDC 4ZY2A 1M4LA 2B4DA 1RTQA 4PK2A 5JPHA 3HLPA 1NSAA 4F9UA 4II9A 4OC3A 3HUVA 3SHPA 2Z11A 1TKJA 3PFEA 4MY0A 3FYNA 3FIXA 2REEA 3K9TA 6CPAA 2GFQA 4UWJA 2WPXA 5FVJA 5LYLA 1YK3A 2GIVA 1P4NA 2RFHA 5JM6A 5F48A 3PGPA 4OMEA 4AVAA 3CPAA 4C2YA 5ELYA 4E2AA 1QSRA 4F0YA 5HVGA 1AMPA 1V0CA 1YGHA 5AG6A 4R9MA 1PU9A 3DR6A 4Z65A 5KTDA 1M1DA 2AFOA 3EXNA 1RXTA 3RYOA 1R3NA 2FSRA 4MCSA 4KLVA 5D8NA 4RN7A 4RUHA 1UWYA 1L0CA 4AVBA 2Z3OA 3D2MA 4MHDA 1ZG9A 2B5GB 2V8VA 4ZBGA 1LFWA 1TF9A 3CZXA 3IO1A 2GLFA 2H5MA 3SJEA 1CG2A 3KQXA 1S5KA 2VBQA 2GLJA 4KUBA 5G22A 2FCKA 4UEEA 4PK3A 5EC4A 2K5TA 2DF5A 3SI0A 2C6PA 4OC0A 3DGVA 2VXKA 4H89A 4L8AA 4UWIA 3L2NA 3S9LA 4KSIA 1Z4EA 3FEEA 1Z9UA 3VH9A 2IL4A 4I49A 2DPSA 3FBUA 2DPTA 1ZLIA 4MCPA 4MXUA 3EFAA 2P6FA 3TTHA 1XOVA 3CDXA 4UA3A 4MCQA 4MI4A 3SJXA 4CPAA 1M4GA 2FVGA 1F57A 2ZEGA 2GU2A 2XEJA 1BLLE 1JWQA 1YSJA 4TWEA 3BLNA 5KTCA 2ABZA 4CAXA 1TKHA 1Q2DA 2DEAA 1Z4RA 3D3SA 1OZPA 3TE4A 2AFMA 1BPNA 4PXBA 4FWUA 4UFWA 1YMEA 2R98A 2F8HA 2FIAA 2I79A 2ARHA 1VIXA 2PSWA 2Q0YA 1KUXA 2WYRA 4AXVA 5AG4A 5JQ4A 2Z10A 2Q51A 4UCPA 1VHOA 2AE6A 2Z3NA 4U9YA 4B11A 1MJBA 4P4BA 3FX6A 4UFXA 4IF5A 1M4DA 4P44A 2ZELA 1YX0A 2A4NA 2REFA 1IIDA 2ZENA 4KOYA 3PEIA 1IYKA 3BXMA 2I00A 4MJ8A 4OC5A 4A39A 3R9EA 3IU1A 5DWNA 2V8DA 4O23A 4K30A 1RO5A 4MMOA 3LD2A 1YR0A 2OZHA
chains in the Genus database with same CATH topology
3R96A 1BOBA 1M44A 5HMNA 2VZYA 4AVCA 5G1ZA 3R95A 4ONUA 4B12A 4XNHC 3S6FA 4E0AA 1QSNA 3BJ7A 3F8KA 5F49A 2D4OA 2HUZA 3BJ8A 2P0WA 4MFQA 4F0XA 2G3TA 1CJWA 5I0CA 4A30A 4KVOE 2PC1A 2PQ8A 4KZTA 1YREA 4E8OA 3TOBA 4F6AA 4C2XA 3MGDA 5AG5A 3TO7A 1NMTA 2Z3PA 5F46A 4UCNA 2Q4YA 2B4BA 4NEXA 2R7HA 4IUSA 2O28A 2OB0A 4M85A 2YNDA 3DNSA 1K4JA 2ZW4A 2BL1A 2BEIA 2G3AA 3S6KA 2B5GA 2D4PA 4MFJA 1S60A 4NF1A 2OH1A 2WPWA 4A33A 2YNCA 4KLWA 5GCNA 2YNCC 4CGMA 4C68A 1P0HA 2BUEA 4YRHA 2R8VA 2NMTA 4HKFA 1S7KA 3TO6A 4FD4A 2CXAA 4L89A 4PSWA 4U5YA 4MBUA 1ON0A 3P2FA 2WSAA 3TO9A 2QIRA 3R9GA 3LODA 3EO4A 2FE7A 3DSBA 1LRZA 2Z3KA 2F5IA 3NE7A 2GANA 4Q38A 3F0AA 1QSMA 4LUAA 1NSLA 4QUSA 3SXOA 5KTAA 3A9LA 1S7NA 4QVTA 4KVME 3ZZIA 1VKCA 4MFZA 1TIQA 3ZJ0A 2VZZA 1QSOA 4UFVA 1I12A 3E0KA 3K9UA 4MFKA 5G20A 4CRYB 2JDCA 5A27A 1Y7RA 4B5PB 4ZGYB 4A2ZA 4CYPA 4H6UA 4A31A 1KZFA 5IB0A 5F47A 4R57A 1I21A 4XPLA 2EVNA 4KSAA 2ZW6A 3H5ZA 5C82A 2Q44A 2QECA 5EBVA 2YNEA 4CGPA 2PDOA 1J4JA 5DWMA 3T90A 2RC4A 2EUIA 3W6SA 1XF8A 1KUYA 2YGWA 5J8FA 3G3SA 3CXSA 1Q2CA 2J8NA 4KOXA 4CAWA 3EY5A 2DXQA 1Q2YA 2GE3A 4B10A 4JLYA 1GHEA 1IYLA 4KOUA 4AB7A 4R87A 4CGOA 2JEVA 4OAEA 4JJXA 1PUAA 4LX9A 4KOVA 4KVXA 4CYQA 4ORFA 4MFPA 4X5KA 5E96A 5AG7A 3N7ZA 3TT2A 2QMLA 3P2HA 1M4IA 2Z3LA 4PSXA 3V8IA 3IGRA 3S6HA 4YFJA 1ZO0A 4MFLA 2VQYA 1Y9WA 3FNCA 2KCWA 4A32A 1IB1E 1XE4A 2J8MA 3CXPA 4BBHA 4JWPA 1B87A 3GKRA 4KOSA 3JTKA 4B11A 4JD6A 2B3UA 2C27A 4OLLA 3I9SA 2J8RA 2OZUA 4OADA 2X7BA 2VI7A 2B58A 3DDDA 5J8CA 2ZW7A 2WUUA 1SQHA 4R3LA 1IICA 4U9ZA 2CNTA 4EVYA 3VWDA 5IV0A 4JXQA 4XPKA 2Q04A 3WR7A 1I1DA 3OWCA 2PR8A 3SXNA 3H4QA 4CYNA 4CS0B 2ZW5A 1U6MA 2R1IA 4QBJA 4J3GA 3GY9A 2P6GA 1BO4A 5BWAB 5G21A 3UY5A 1WK4A 3B8GA 2FL4A 4KSFA 4Q36A 2CY2A 4UCMA 2B3VA 3FB3A 4B5PA 3FRMA 5ISVA 4CAEA 5H84A 2JDDA 4XPDB 3IWEA 4UBRA 4QB9A 2G0BA 4DNCA 5IX3A 1MJ9A 4B13A 2HV2A 2B4DB 4KS9A 2Z3MA 4Y49C 4B14A 2ZPAA 4C7HA 2CNMA 4KUAA 1S7FA 4AG7A 1YVOA 3IU2A 3FXTA 4CRZB 2Q7BA 5A28A 3GYAA 4YGOA 4RS2A 3G8WA 1B6BA 1Y9KA 4QC6A 3QAHA 3JUWA 2Z0ZA 1XMTA 1N71A 2JLMA 3R1KA 4CGLA 4KOTA 4KOWA 4A95A 4NCZA 4RI1A 3TFYA 3F5BA 4KORA 4NSQA 4MY3A 4Y49B 5H86A 3JVNA 3T9YA 1FY7A 5AGEA 4CAFA 1UFHA 4M3SA 2P6EA 1VHSA 2FIWA 3PZJA 4GS4A 2FS5A 2BSWA 3S6GA 4JXRA 3VWEA 4AG9A 3W6XA 2PRBA 3QB8A 1CM0A 1S3ZA 3KKWA 5C88A 2VEZA 5CNPA 3D8PA 4CYOA 2HQYA 4CGNA 3CXQA 3C26A 1R57A 3TOAA 4HNXB 1QSTA 1S7LA 4BMHA 2AJ6A 2PR1A 4B5OA 3W91A 4PV6A 1YLEA 4NXYA 1MK4A 2Y0MA 1YVKA 2CNSA 2OZGA 1WWZA 3D2PA 2FT0A 4R3KA 1NE9A 4FD5A 4C7IA 3TCVA 4CAVA 3I3GA 4H6ZA 2FXFA 1MJAA 2Q4VA 1KUVA 4HNWB 4XNHB 3R9FA 3PP9A 5HH1A 2ZXVA 1XIXA 3DR8A 4HNYB 2ATRA 3EC4A 2OU2A 4C2ZA 1XEBA 4FD6A 3IWGA 4FD7A 4XPDC 2B4DA 4PK2A 5JPHA 4II9A 3SHPA 2Z11A 4MY0A 3FYNA 3FIXA 2REEA 4UWJA 2WPXA 5FVJA 1YK3A 2GIVA 1P4NA 5F48A 3PGPA 4AVAA 4E2AA 4F0YA 4C2YA 1QSRA 1V0CA 1YGHA 5AG6A 4R9MA 1PU9A 3DR6A 5KTDA 1M1DA 3EXNA 1RXTA 3RYOA 2FSRA 4KLVA 1L0CA 4AVBA 2Z3OA 3D2MA 4MHDA 2B5GB 4ZBGA 2H5MA 1S5KA 2VBQA 4KUBA 5G22A 2FCKA 4PK3A 5EC4A 2K5TA 2VXKA 4H89A 4L8AA 4UWIA 1Z4EA 1Z9UA 2IL4A 4I49A 2DPSA 3FBUA 2DPTA 3EFAA 2P6FA 3TTHA 4UA3A 4MI4A 1M4GA 3BLNA 5KTCA 4CAXA 1Q2DA 1Z4RA 3D3SA 1OZPA 3TE4A 4UFWA 2R98A 2FIAA 2I79A 2ARHA 2PSWA 2Q0YA 1KUXA 5AG4A 5JQ4A 2Z10A 4UCPA 2AE6A 2Z3NA 4U9YA 1MJBA 4UFXA 4IF5A 1M4DA 1YX0A 2A4NA 2REFA 1IIDA 4KOYA 1IYKA 4MJ8A 2I00A 3R9EA 3IU1A 5DWNA 4K30A 1RO5A 3LD2A 1YR0A 2OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R96 A;  1BOB A;  1M44 A;  5HMN A;  2VZY A;  4AVC A;  3R95 A;  4ONU A;  4XNH C;  3S6F A;  4E0A A;  1QSN A;  3BJ7 A;  3F8K A;  5F49 A;  2D4O A;  2HUZ A;  3BJ8 A;  2P0W A;  2G3T A;  1CJW A;  5I0C A;  4KVO E;  2PC1 A;  2PQ8 A;  4KZT A;  1YRE A;  4E8O A;  3TOB A;  4F6A A;  3MGD A;  3TO7 A;  1NMT A;  5F46 A;  2Q4Y A;  2B4B A;  4NEX A;  2R7H A;  4IUS A;  2O28 A;  2OB0 A;  4M85 A;  3DNS A;  1K4J A;  2ZW4 A;  2BL1 A;  2BEI A;  2G3A A;  3S6K A;  2B5G A;  2D4P A;  1S60 A;  4NF1 A;  2OH1 A;  2WPW A;  4KLW A;  5GCN A;  1P0H A;  2BUE A;  4YRH A;  2R8V A;  2NMT A;  4HKF A;  1S7K A;  3TO6 A;  4FD4 A;  4L89 A;  4PSW A;  4U5Y A;  4MBU A;  1ON0 A;  3P2F A;  3TO9 A;  2QIR A;  3R9G A;  3LOD A;  3EO4 A;  2FE7 A;  3DSB A;  1LRZ A;  2F5I A;  3NE7 A;  2GAN A;  3F0A A;  1QSM A;  4LUA A;  1NSL A;  4QUS A;  3SXO A;  5KTA A;  1S7N A;  4QVT A;  4KVM E;  3ZZI A;  1VKC A;  1TIQ A;  3ZJ0 A;  2VZZ A;  1QSO A;  1I12 A;  3E0K A;  3K9U A;  4CRY B;  2JDC A;  1Y7R A;  4B5P B;  4H6U A;  1KZF A;  5IB0 A;  5F47 A;  4R57 A;  1I21 A;  4XPL A;  2EVN A;  2ZW6 A;  5C82 A;  2Q44 A;  2QEC A;  5EBV A;  2PDO A;  1J4J A;  5DWM A;  3T90 A;  2RC4 A;  2EUI A;  3W6S A;  1XF8 A;  1KUY A;  5J8F A;  3G3S A;  3CXS A;  1Q2C A;  2J8N A;  4KOX A;  4CAW A;  3EY5 A;  2DXQ A;  1Q2Y A;  2GE3 A;  4JLY A;  1GHE A;  1IYL A;  4KOU A;  4AB7 A;  4R87 A;  2JEV A;  4OAE A;  4JJX A;  1PUA A;  4LX9 A;  4KOV A;  4KVX A;  4ORF A;  4X5K A;  5E96 A;  3N7Z A;  3TT2 A;  2QML A;  3P2H A;  1M4I A;  4PSX A;  3V8I A;  3IGR A;  3S6H A;  4YFJ A;  2VQY A;  1Y9W A;  3FNC A;  2KCW A;  1IB1 E;  1XE4 A;  2J8M A;  3CXP A;  4JWP A;  1B87 A;  3GKR A;  4KOS A;  4JD6 A;  2B3U A;  2C27 A;  4OLL A;  3I9S A;  2J8R A;  2OZU A;  4OAD A;  2X7B A;  2VI7 A;  2B58 A;  3DDD A;  5J8C A;  2ZW7 A;  1SQH A;  4R3L A;  1IIC A;  4U9Z A;  2CNT A;  4EVY A;  3VWD A;  5IV0 A;  4JXQ A;  4XPK A;  2Q04 A;  3WR7 A;  1I1D A;  3OWC A;  2PR8 A;  3SXN A;  3H4Q A;  4CS0 B;  2ZW5 A;  1U6M A;  2R1I A;  4QBJ A;  4J3G A;  3GY9 A;  2P6G A;  1BO4 A;  3UY5 A;  1WK4 A;  3B8G A;  2FL4 A;  2CY2 A;  2B3V A;  3FB3 A;  4B5P A;  3FRM A;  5ISV A;  5H84 A;  2JDD A;  4XPD B;  5IX3 A;  4UBR A;  4QB9 A;  2G0B A;  4DNC A;  1MJ9 A;  2HV2 A;  2B4D B;  4Y49 C;  2ZPA A;  2CNM A;  4KUA A;  1S7F A;  4AG7 A;  1YVO A;  3FXT A;  4CRZ B;  2Q7B A;  3GYA A;  4YGO A;  4RS2 A;  3G8W A;  1B6B A;  1Y9K A;  4QC6 A;  3QAH A;  3JUW A;  2Z0Z A;  1XMT A;  1N71 A;  2JLM A;  3R1K A;  4KOT A;  4KOW A;  4NCZ A;  4RI1 A;  3TFY A;  3F5B A;  4KOR A;  4NSQ A;  4MY3 A;  4Y49 B;  5H86 A;  3JVN A;  3T9Y A;  1FY7 A;  1UFH A;  4M3S A;  2P6E A;  1VHS A;  2FIW A;  3PZJ A;  4GS4 A;  2FS5 A;  2BSW A;  3S6G A;  4JXR A;  3VWE A;  4AG9 A;  3W6X A;  2PRB A;  3QB8 A;  1CM0 A;  1S3Z A;  3KKW A;  5C88 A;  2VEZ A;  5CNP A;  3D8P A;  2HQY A;  3CXQ A;  3C26 A;  1R57 A;  3TOA A;  4HNX B;  1QST A;  1S7L A;  4BMH A;  2AJ6 A;  2PR1 A;  4B5O A;  3W91 A;  4PV6 A;  1YLE A;  4NXY A;  1MK4 A;  2Y0M A;  1YVK A;  2CNS A;  2OZG A;  1WWZ A;  3D2P A;  2FT0 A;  4R3K A;  1NE9 A;  4FD5 A;  3TCV A;  4CAV A;  3I3G A;  4H6Z A;  2FXF A;  1MJA A;  2Q4V A;  1KUV A;  4HNW B;  4XNH B;  3R9F A;  3PP9 A;  5HH1 A;  2ZXV A;  1XIX A;  3DR8 A;  4HNY B;  2ATR A;  3EC4 A;  2OU2 A;  1XEB A;  4FD6 A;  3IWG A;  4FD7 A;  4XPD C;  2B4D A;  4PK2 A;  5JPH A;  4II9 A;  3SHP A;  2Z11 A;  4MY0 A;  3FYN A;  3FIX A;  2REE A;  4UWJ A;  2WPX A;  5FVJ A;  1YK3 A;  2GIV A;  1P4N A;  5F48 A;  3PGP A;  4AVA A;  4E2A A;  4F0Y A;  1QSR A;  1V0C A;  1YGH A;  4R9M A;  1PU9 A;  3DR6 A;  5KTD A;  1M1D A;  3EXN A;  1RXT A;  3RYO A;  2FSR A;  4KLV A;  1L0C A;  4AVB A;  3D2M A;  4MHD A;  2B5G B;  4ZBG A;  2H5M A;  1S5K A;  2VBQ A;  4KUB A;  2FCK A;  4PK3 A;  5EC4 A;  2K5T A;  2VXK A;  4H89 A;  4L8A A;  4UWI A;  1Z4E A;  1Z9U A;  2IL4 A;  4I49 A;  3FBU A;  3EFA A;  2P6F A;  3TTH A;  4UA3 A;  4MI4 A;  1M4G A;  3BLN A;  5KTC A;  4CAX A;  1Q2D A;  1Z4R A;  3D3S A;  1OZP A;  3TE4 A;  2R98 A;  2FIA A;  2I79 A;  2ARH A;  2PSW A;  2Q0Y A;  1KUX A;  5JQ4 A;  2Z10 A;  2AE6 A;  4U9Y A;  1MJB A;  4IF5 A;  1M4D A;  1YX0 A;  2A4N A;  2REF A;  1IID A;  4KOY A;  1IYK A;  4MJ8 A;  2I00 A;  3R9E A;  5DWN A;  4K30 A;  1RO5 A;  3LD2 A;  1YR0 A;  2OZH A; 
#chains in the Genus database with same CATH topology
 1Y0R A;  2EO8 A;  3R96 A;  2BO9 A;  1BOB A;  1M44 A;  5HMN A;  3NH5 A;  2VZY A;  4OID A;  4AVC A;  5G1Z A;  3R95 A;  4ONU A;  4LQG A;  4OP4 A;  4X8I A;  4B12 A;  4XNH C;  1CBX A;  3NE8 A;  3S6F A;  4E0A A;  1ZG7 A;  1QSN A;  3BJ7 A;  3F8K A;  5F49 A;  2D4O A;  2HUZ A;  3B3T A;  3BJ8 A;  1ZG8 A;  3PB9 X;  4OC2 A;  4OKO A;  4PXE A;  2C1C A;  5K8P A;  2P0W A;  4MFQ A;  4F0X A;  2G3T A;  1XFO A;  1F2P A;  3KHZ A;  1CJW A;  5I0C A;  4A30 A;  2XEG A;  4KVO E;  2PC1 A;  2AFW A;  2PQ8 A;  2ZEO A;  4KZT A;  1YRE A;  4E8O A;  3LMS A;  3TOB A;  4F6A A;  4C2X A;  3MGD A;  3IFE A;  2QVP A;  5AG5 A;  3TO7 A;  3IEH A;  1NMT A;  2Z3P A;  1FNO A;  5F46 A;  4NGR A;  4UCN A;  1CX8 A;  4FAI A;  2PJ1 A;  2Q4Y A;  4FUU A;  2PJ3 A;  3IJ3 A;  2B4B A;  5LRG A;  2ODF A;  4NEX A;  2Q4Z A;  4Q7A A;  4EME A;  2OR4 A;  2R7H A;  1CP7 A;  4IUS A;  2O28 A;  3WT4 A;  2V8G A;  3BI1 A;  1AUG A;  2OB0 A;  1TKF A;  4M85 A;  2YND A;  5D29 A;  4EWT A;  3DNS A;  4IAV A;  1K4J A;  2ZW4 A;  2BL1 A;  5CPA A;  2BEI A;  3IC1 A;  2GRE A;  1OBR A;  2G3A A;  3S6K A;  2IQ6 A;  2B5G A;  1LOK A;  2D4P A;  4MFJ A;  1CPX A;  1VGY A;  1S60 A;  4NF1 A;  1HEE A;  2G9D A;  2OH1 A;  1F2O A;  2WPW A;  4UEF A;  4P4E A;  2YNC A;  4KLW A;  5GCN A;  4A33 A;  4P4J A;  2YNC C;  4CGM A;  4C68 A;  1P0H A;  5LRK A;  1DTD A;  2CTC A;  1ARM A;  4A37 A;  3QNV A;  2BUE A;  3DLJ A;  3FVL A;  4MHN A;  4P45 A;  5K8M A;  4YRH A;  2R8V A;  2NMT A;  4HKF A;  1S7K A;  1Y7E A;  3TO6 A;  4FD4 A;  2RB7 A;  3PBB A;  2CXA A;  2QJ8 A;  3BI0 A;  4L89 A;  4PSW A;  4U5Y A;  4MBU A;  1ON0 A;  3B35 A;  3P2F A;  4TNU A;  1IU8 A;  2WSA A;  1IGB A;  3TO9 A;  2ZEP A;  3B3W A;  2QIR A;  4MRI A;  4OC1 A;  5LYI A;  3NA6 A;  3R9G A;  3N5F A;  4ZX8 A;  3LOD A;  3EO4 A;  5DS0 A;  3RO0 A;  2C6C A;  3K2K A;  2FE7 A;  3SJF A;  1JQG A;  3DSB A;  2PVV A;  4NGT A;  4DUK A;  3KL9 A;  1AYE A;  1LRZ A;  2Z3K A;  1LAM A;  4ZX9 A;  2F5I A;  4BIN A;  1Z2L A;  3NE7 A;  1R43 A;  3FMC A;  2GAN A;  2V77 A;  4GM5 A;  3PB4 X;  3F0A A;  4Q38 A;  2PJA A;  1IOF A;  4P4F A;  1QSM A;  3WC5 A;  4LUA A;  2PCU A;  4NJR A;  1NSL A;  3KR4 A;  3KI9 A;  3FEC A;  4MHP A;  4QUS A;  4YU9 A;  3SXO A;  5KTA A;  1XRY A;  2ZOG A;  3A9L A;  3D68 A;  4ZY0 A;  2PVW A;  4F9V A;  1S7N A;  2HC9 A;  4QVT A;  4KVM E;  1XMB A;  3ZZI A;  4WWV A;  1VKC A;  3LAC A;  4MFZ A;  3D7D A;  1TIQ A;  3BHX A;  3ZJ0 A;  2VZZ A;  4NGM A;  4UF4 A;  1QSO A;  2PJ2 A;  4UFV A;  1I12 A;  3E0K A;  1YLO A;  3H8F A;  3K9U A;  4MFK A;  5G20 A;  3RBU A;  4CRY B;  8CPA A;  2JDC A;  5A27 A;  2NYQ A;  2PJ9 A;  1Y7R A;  2F7V A;  4B5P B;  4ZGY B;  4A2Z A;  4MHZ A;  1ARL A;  4G1P A;  4H6U A;  2PJB A;  4A31 A;  4CYP A;  1KZF A;  5IB0 A;  4BD9 A;  4GXH A;  4NFR A;  3KGQ A;  2JEW A;  4UIB A;  5F47 A;  3T8W A;  4R57 A;  1I21 A;  1YW6 A;  3SJG A;  2O53 A;  1HDQ A;  4XPL A;  2EVN A;  4KSA A;  2ZW6 A;  3H5Z A;  5C82 A;  2Q44 A;  2QEC A;  4WJB A;  5EBV A;  2YNE A;  3S9M A;  3KR5 A;  4CGP A;  2PDO A;  4YWY A;  1J4J A;  5DWM A;  3T90 A;  2RC4 A;  4PXC A;  5LYF A;  4NGQ A;  2EUI A;  3W6S A;  1TF8 A;  1QQ9 A;  1XF8 A;  2PIY A;  1KUY A;  3PB6 X;  2YGW A;  1LCP A;  3QAY A;  1X10 A;  3RZA A;  3G3S A;  2ZEF A;  2NSM A;  2I3C A;  1Q2C A;  2VL1 A;  3CXS A;  5J8F A;  2PJ0 A;  2J8N A;  4KOX A;  3GUX A;  2C6G A;  3KZW A;  3WC6 A;  1Z8X A;  4CAW A;  4PQA A;  3EY5 A;  3FJU A;  2DXQ A;  1Q2Y A;  2GE3 A;  2PJ5 A;  2PJ4 A;  4B10 A;  4JLY A;  1GHE A;  3I1U A;  1IYL A;  3PFO A;  3NFZ A;  2JBK A;  4KOU A;  3FED A;  4FBE A;  2Q7S A;  3D67 A;  4AB7 A;  4R87 A;  1ZLH A;  4CGO A;  1Y0Y A;  2AFS A;  4MCR A;  2JEV A;  1HDU A;  4OAE A;  4P6Y A;  4X2T A;  4JJX A;  1PUA A;  4LX9 A;  3V7Z A;  4KOV A;  4KVX A;  3SI2 A;  4CYQ A;  4ORF A;  4MFP A;  4X5K A;  2ZOF A;  5E96 A;  3VAR A;  5J1Q A;  5AG7 A;  3H8E A;  3N7Z A;  2V8H A;  1QMU A;  3TT2 A;  2QML A;  3P2H A;  1M4I A;  2Z3L A;  4PSX A;  3V8I A;  3B7I A;  3IGR A;  5LRJ A;  3S6H A;  4YFJ A;  4UEZ A;  4ZYQ A;  4R76 A;  2ANP A;  2EWB A;  1ZO0 A;  3NH8 A;  4MFL A;  2BCO A;  2VQY A;  1KWM A;  1Y9W A;  3FNC A;  4IHM A;  2KCW A;  4A32 A;  5IB9 A;  1IB1 E;  3JRU A;  3FF3 A;  1XE4 A;  2J8M A;  3CXP A;  4BBH A;  4JWP A;  3ISX A;  1TXR A;  1B87 A;  2PE3 A;  2PRQ A;  3GKR A;  4PPZ A;  5K8N A;  3ISZ A;  3D7F A;  4KOS A;  3JTK A;  4LQ6 A;  4JD6 A;  2B3U A;  2C27 A;  1VHE A;  3LWU A;  4OLL A;  4P4D A;  3I9S A;  4HPS A;  2J8R A;  2OZU A;  4JYW A;  2X7B A;  4OAD A;  2VI7 A;  4OC4 A;  3RAM A;  1IOI A;  2B58 A;  3DDD A;  4R7M A;  5J8C A;  2ZW7 A;  2WUU A;  1SQH A;  3GB0 A;  4R3L A;  1IIC A;  2O4H A;  4U9Z A;  2CNT A;  4EVY A;  3VWD A;  3WAB A;  4JXQ A;  4XPK A;  5IV0 A;  2POK A;  2Q04 A;  1Z5R A;  1I1D A;  3OWC A;  3WR7 A;  2PR8 A;  2J9A A;  3SXN A;  3H4Q A;  4CYN A;  4NGP A;  5LYD A;  4CS0 B;  1U6M A;  2ZW5 A;  2R1I A;  3NH4 A;  3D4U A;  4QBJ A;  2QYV A;  4J3G A;  3GY9 A;  2P6G A;  2WZN A;  1BO4 A;  5IX3 A;  5BWA B;  5G21 A;  3GLJ A;  2EBJ A;  3GIU A;  3UY5 A;  1WK4 A;  1EE3 P;  1LAP A;  1Z8W A;  3B8G A;  2FL4 A;  4KSF A;  4Q36 A;  2CY2 A;  4M6G A;  4UIA A;  4UCM A;  2B3V A;  3FB3 A;  4B5P A;  2ZEE A;  3CPX A;  4F8Z A;  3FRM A;  5ISV A;  1XBU A;  3B3C A;  5H84 A;  4CAE A;  2JDD A;  4XPD B;  3IWE A;  4UBR A;  4QB9 A;  2G0B A;  4DNC A;  4A38 A;  7CPA A;  1A2Z A;  1MJ9 A;  2CTB A;  4B13 A;  2EK8 A;  2HV2 A;  3RNZ A;  2B4D B;  4DYO A;  5HXD A;  4KS9 A;  4W9Y A;  2Z3M A;  4Y49 C;  1IY7 A;  4B14 A;  2ZPA A;  4C7H A;  3MN8 A;  2CNM A;  4KUA A;  5JGF A;  3PB7 X;  2Q43 A;  2CF4 A;  1S7F A;  5HVF A;  4A94 A;  4AG7 A;  1YVO A;  3B2Y A;  3IU2 A;  2JBJ A;  3FXT A;  3FH4 A;  3MRU A;  2Q7B A;  4CRZ B;  3GYA A;  4OIW A;  4YGO A;  5A28 A;  4RS2 A;  3G8W A;  3PBE A;  1B6B A;  1Y9K A;  1H8L A;  4QC6 A;  3CT9 A;  2PJ8 A;  4M6H A;  2IMO A;  3QAH A;  3JUW A;  2Z0Z A;  1PCA A;  1XMT A;  1N71 A;  2JLM A;  3R1K A;  2PJC A;  4KOT A;  3TC8 A;  1GYT A;  4CGL A;  4KOW A;  4ONW A;  4NCZ A;  4A95 A;  4RI1 A;  3TFY A;  3D7G A;  3F5B A;  4KOR A;  4NJQ A;  4NSQ A;  2EK9 A;  4MY3 A;  4Y49 B;  5H86 A;  3JVN A;  3T9Y A;  5K8O A;  1FY7 A;  5AGE A;  3S9N A;  4EFD A;  4CAF A;  1UFH A;  4M3S A;  2PJ6 A;  2P6E A;  1VHS A;  2FIW A;  2HB6 A;  3PZJ A;  4IK2 A;  4GS4 A;  1CPS A;  2OOT A;  2FS5 A;  5THW A;  4R6T A;  3TX8 A;  2BSW A;  1FT7 A;  3S6G A;  4JXR A;  3VWE A;  4AG9 A;  3W6X A;  1Z8L A;  2PRB A;  4NGS A;  2AFZ A;  2AFX A;  3QB8 A;  5F09 A;  4ZY1 A;  1CM0 A;  1S3Z A;  3KKW A;  5C88 A;  4R8F A;  2VEZ A;  5CNP A;  1PYT B;  3D8P A;  4CYO A;  2HQY A;  4CGN A;  5HVH A;  4JZ0 A;  3KAS A;  3CXQ A;  2BOA A;  5EMI A;  2AFU A;  2CIJ A;  1LAN A;  1Z8T A;  2PIZ A;  3C26 A;  2PJ7 A;  3PRT A;  5I4M A;  1R57 A;  3TOA A;  4HNX B;  1QST A;  1S7L A;  2XEI A;  4BMH A;  1XJO A;  1YQE A;  2AJ6 A;  4K3N A;  4B6Z A;  2PR1 A;  4B5O A;  3W91 A;  4DJL A;  4PV6 A;  3B3S A;  1YLE A;  3WC7 A;  4NXY A;  1MK4 A;  2Y0M A;  2XEF A;  1YVK A;  2CNS A;  2OZG A;  1WWZ A;  3D2P A;  4P4I A;  2FT0 A;  3KHX A;  4R3K A;  1NE9 A;  4FD5 A;  4P10 A;  4C7I A;  3TCV A;  4CAV A;  4H2K A;  1CP6 A;  3I3G A;  3PB8 X;  4H6Z A;  4PXD A;  2ZED A;  3VAT A;  1YW4 A;  5JH9 A;  4NGN A;  2FXF A;  5CBM A;  1MJA A;  2Q4V A;  1KUV A;  4HNW B;  4XNH B;  3R9F A;  1X12 A;  3PP9 A;  4M6I A;  3SI1 A;  5HH1 A;  1Q7L A;  2ZEH A;  2ZXV A;  3V38 A;  1XIX A;  2IJZ A;  3DR8 A;  4HNY B;  3B3V A;  4MHY A;  3IIB A;  3D7H A;  3KQZ A;  2ZEM A;  2ATR A;  1ELL P;  1DE4 C;  3H8G A;  3IWW A;  3EC4 A;  2OU2 A;  3D66 A;  4C2Z A;  1BAV A;  1ELM P;  1XEB A;  4X3R A;  4ZI6 A;  4FD6 A;  3IWG A;  4FD7 A;  1BPM A;  4XPD C;  4ZY2 A;  1M4L A;  2B4D A;  1RTQ A;  4PK2 A;  5JPH A;  3HLP A;  1NSA A;  4F9U A;  4II9 A;  4OC3 A;  3HUV A;  3SHP A;  2Z11 A;  1TKJ A;  3PFE A;  4MY0 A;  3FYN A;  3FIX A;  2REE A;  3K9T A;  6CPA A;  2GFQ A;  4UWJ A;  2WPX A;  5FVJ A;  5LYL A;  1YK3 A;  2GIV A;  1P4N A;  2RFH A;  5JM6 A;  5F48 A;  3PGP A;  4OME A;  4AVA A;  3CPA A;  4C2Y A;  5ELY A;  4E2A A;  1QSR A;  4F0Y A;  5HVG A;  1AMP A;  1V0C A;  1YGH A;  5AG6 A;  4R9M A;  1PU9 A;  3DR6 A;  4Z65 A;  5KTD A;  1M1D A;  2AFO A;  3EXN A;  1RXT A;  3RYO A;  1R3N A;  2FSR A;  4MCS A;  4KLV A;  5D8N A;  4RN7 A;  4RUH A;  1UWY A;  1L0C A;  4AVB A;  2Z3O A;  3D2M A;  4MHD A;  1ZG9 A;  2B5G B;  2V8V A;  4ZBG A;  1LFW A;  1TF9 A;  3CZX A;  3IO1 A;  2GLF A;  2H5M A;  3SJE A;  1CG2 A;  3KQX A;  1S5K A;  2VBQ A;  2GLJ A;  4KUB A;  5G22 A;  2FCK A;  4UEE A;  4PK3 A;  5EC4 A;  2K5T A;  2DF5 A;  3SI0 A;  2C6P A;  4OC0 A;  3DGV A;  2VXK A;  4H89 A;  4L8A A;  4UWI A;  3L2N A;  3S9L A;  4KSI A;  1Z4E A;  3FEE A;  1Z9U A;  3VH9 A;  2IL4 A;  4I49 A;  2DPS A;  3FBU A;  2DPT A;  1ZLI A;  4MCP A;  4MXU A;  3EFA A;  2P6F A;  3TTH A;  1XOV A;  3CDX A;  4UA3 A;  4MCQ A;  4MI4 A;  3SJX A;  4CPA A;  1M4G A;  2FVG A;  1F57 A;  2ZEG A;  2GU2 A;  2XEJ A;  1BLL E;  1JWQ A;  1YSJ A;  4TWE A;  3BLN A;  5KTC A;  2ABZ A;  4CAX A;  1TKH A;  1Q2D A;  2DEA A;  1Z4R A;  3D3S A;  1OZP A;  3TE4 A;  2AFM A;  1BPN A;  4PXB A;  4FWU A;  4UFW A;  1YME A;  2R98 A;  2F8H A;  2FIA A;  2I79 A;  2ARH A;  1VIX A;  2PSW A;  2Q0Y A;  1KUX A;  2WYR A;  4AXV A;  5AG4 A;  5JQ4 A;  2Z10 A;  2Q51 A;  4UCP A;  1VHO A;  2AE6 A;  2Z3N A;  4U9Y A;  4B11 A;  1MJB A;  4P4B A;  3FX6 A;  4UFX A;  4IF5 A;  1M4D A;  4P44 A;  2ZEL A;  1YX0 A;  2A4N A;  2REF A;  1IID A;  2ZEN A;  4KOY A;  3PEI A;  1IYK A;  3BXM A;  2I00 A;  4MJ8 A;  4OC5 A;  4A39 A;  3R9E A;  3IU1 A;  5DWN A;  2V8D A;  4O23 A;  4K30 A;  1RO5 A;  4MMO A;  3LD2 A;  1YR0 A;  2OZH A; 
#chains in the Genus database with same CATH homology
 3R96 A;  1BOB A;  1M44 A;  5HMN A;  2VZY A;  4AVC A;  5G1Z A;  3R95 A;  4ONU A;  4B12 A;  4XNH C;  3S6F A;  4E0A A;  1QSN A;  3BJ7 A;  3F8K A;  5F49 A;  2D4O A;  2HUZ A;  3BJ8 A;  2P0W A;  4MFQ A;  4F0X A;  2G3T A;  1CJW A;  5I0C A;  4A30 A;  4KVO E;  2PC1 A;  2PQ8 A;  4KZT A;  1YRE A;  4E8O A;  3TOB A;  4F6A A;  4C2X A;  3MGD A;  5AG5 A;  3TO7 A;  1NMT A;  2Z3P A;  5F46 A;  4UCN A;  2Q4Y A;  2B4B A;  4NEX A;  2R7H A;  4IUS A;  2O28 A;  2OB0 A;  4M85 A;  2YND A;  3DNS A;  1K4J A;  2ZW4 A;  2BL1 A;  2BEI A;  2G3A A;  3S6K A;  2B5G A;  2D4P A;  4MFJ A;  1S60 A;  4NF1 A;  2OH1 A;  2WPW A;  4A33 A;  2YNC A;  4KLW A;  5GCN A;  2YNC C;  4CGM A;  4C68 A;  1P0H A;  2BUE A;  4YRH A;  2R8V A;  2NMT A;  4HKF A;  1S7K A;  3TO6 A;  4FD4 A;  2CXA A;  4L89 A;  4PSW A;  4U5Y A;  4MBU A;  1ON0 A;  3P2F A;  2WSA A;  3TO9 A;  2QIR A;  3R9G A;  3LOD A;  3EO4 A;  2FE7 A;  3DSB A;  1LRZ A;  2Z3K A;  2F5I A;  3NE7 A;  2GAN A;  4Q38 A;  3F0A A;  1QSM A;  4LUA A;  1NSL A;  4QUS A;  3SXO A;  5KTA A;  3A9L A;  1S7N A;  4QVT A;  4KVM E;  3ZZI A;  1VKC A;  4MFZ A;  1TIQ A;  3ZJ0 A;  2VZZ A;  1QSO A;  4UFV A;  1I12 A;  3E0K A;  3K9U A;  4MFK A;  5G20 A;  4CRY B;  2JDC A;  5A27 A;  1Y7R A;  4B5P B;  4ZGY B;  4A2Z A;  4CYP A;  4H6U A;  4A31 A;  1KZF A;  5IB0 A;  5F47 A;  4R57 A;  1I21 A;  4XPL A;  2EVN A;  4KSA A;  2ZW6 A;  3H5Z A;  5C82 A;  2Q44 A;  2QEC A;  5EBV A;  2YNE A;  4CGP A;  2PDO A;  1J4J A;  5DWM A;  3T90 A;  2RC4 A;  2EUI A;  3W6S A;  1XF8 A;  1KUY A;  2YGW A;  5J8F A;  3G3S A;  3CXS A;  1Q2C A;  2J8N A;  4KOX A;  4CAW A;  3EY5 A;  2DXQ A;  1Q2Y A;  2GE3 A;  4B10 A;  4JLY A;  1GHE A;  1IYL A;  4KOU A;  4AB7 A;  4R87 A;  4CGO A;  2JEV A;  4OAE A;  4JJX A;  1PUA A;  4LX9 A;  4KOV A;  4KVX A;  4CYQ A;  4ORF A;  4MFP A;  4X5K A;  5E96 A;  5AG7 A;  3N7Z A;  3TT2 A;  2QML A;  3P2H A;  1M4I A;  2Z3L A;  4PSX A;  3V8I A;  3IGR A;  3S6H A;  4YFJ A;  1ZO0 A;  4MFL A;  2VQY A;  1Y9W A;  3FNC A;  2KCW A;  4A32 A;  1IB1 E;  1XE4 A;  2J8M A;  3CXP A;  4BBH A;  4JWP A;  1B87 A;  3GKR A;  4KOS A;  3JTK A;  4B11 A;  4JD6 A;  2B3U A;  2C27 A;  4OLL A;  3I9S A;  2J8R A;  2OZU A;  4OAD A;  2X7B A;  2VI7 A;  2B58 A;  3DDD A;  5J8C A;  2ZW7 A;  2WUU A;  1SQH A;  4R3L A;  1IIC A;  4U9Z A;  2CNT A;  4EVY A;  3VWD A;  5IV0 A;  4JXQ A;  4XPK A;  2Q04 A;  3WR7 A;  1I1D A;  3OWC A;  2PR8 A;  3SXN A;  3H4Q A;  4CYN A;  4CS0 B;  2ZW5 A;  1U6M A;  2R1I A;  4QBJ A;  4J3G A;  3GY9 A;  2P6G A;  1BO4 A;  5BWA B;  5G21 A;  3UY5 A;  1WK4 A;  3B8G A;  2FL4 A;  4KSF A;  4Q36 A;  2CY2 A;  4UCM A;  2B3V A;  3FB3 A;  4B5P A;  3FRM A;  5ISV A;  4CAE A;  5H84 A;  2JDD A;  4XPD B;  3IWE A;  4UBR A;  4QB9 A;  2G0B A;  4DNC A;  5IX3 A;  1MJ9 A;  4B13 A;  2HV2 A;  2B4D B;  4KS9 A;  2Z3M A;  4Y49 C;  4B14 A;  2ZPA A;  4C7H A;  2CNM A;  4KUA A;  1S7F A;  4AG7 A;  1YVO A;  3IU2 A;  3FXT A;  4CRZ B;  2Q7B A;  5A28 A;  3GYA A;  4YGO A;  4RS2 A;  3G8W A;  1B6B A;  1Y9K A;  4QC6 A;  3QAH A;  3JUW A;  2Z0Z A;  1XMT A;  1N71 A;  2JLM A;  3R1K A;  4CGL A;  4KOT A;  4KOW A;  4A95 A;  4NCZ A;  4RI1 A;  3TFY A;  3F5B A;  4KOR A;  4NSQ A;  4MY3 A;  4Y49 B;  5H86 A;  3JVN A;  3T9Y A;  1FY7 A;  5AGE A;  4CAF A;  1UFH A;  4M3S A;  2P6E A;  1VHS A;  2FIW A;  3PZJ A;  4GS4 A;  2FS5 A;  2BSW A;  3S6G A;  4JXR A;  3VWE A;  4AG9 A;  3W6X A;  2PRB A;  3QB8 A;  1CM0 A;  1S3Z A;  3KKW A;  5C88 A;  2VEZ A;  5CNP A;  3D8P A;  4CYO A;  2HQY A;  4CGN A;  3CXQ A;  3C26 A;  1R57 A;  3TOA A;  4HNX B;  1QST A;  1S7L A;  4BMH A;  2AJ6 A;  2PR1 A;  4B5O A;  3W91 A;  4PV6 A;  1YLE A;  4NXY A;  1MK4 A;  2Y0M A;  1YVK A;  2CNS A;  2OZG A;  1WWZ A;  3D2P A;  2FT0 A;  4R3K A;  1NE9 A;  4FD5 A;  4C7I A;  3TCV A;  4CAV A;  3I3G A;  4H6Z A;  2FXF A;  1MJA A;  2Q4V A;  1KUV A;  4HNW B;  4XNH B;  3R9F A;  3PP9 A;  5HH1 A;  2ZXV A;  1XIX A;  3DR8 A;  4HNY B;  2ATR A;  3EC4 A;  2OU2 A;  4C2Z A;  1XEB A;  4FD6 A;  3IWG A;  4FD7 A;  4XPD C;  2B4D A;  4PK2 A;  5JPH A;  4II9 A;  3SHP A;  2Z11 A;  4MY0 A;  3FYN A;  3FIX A;  2REE A;  4UWJ A;  2WPX A;  5FVJ A;  1YK3 A;  2GIV A;  1P4N A;  5F48 A;  3PGP A;  4AVA A;  4E2A A;  4F0Y A;  4C2Y A;  1QSR A;  1V0C A;  1YGH A;  5AG6 A;  4R9M A;  1PU9 A;  3DR6 A;  5KTD A;  1M1D A;  3EXN A;  1RXT A;  3RYO A;  2FSR A;  4KLV A;  1L0C A;  4AVB A;  2Z3O A;  3D2M A;  4MHD A;  2B5G B;  4ZBG A;  2H5M A;  1S5K A;  2VBQ A;  4KUB A;  5G22 A;  2FCK A;  4PK3 A;  5EC4 A;  2K5T A;  2VXK A;  4H89 A;  4L8A A;  4UWI A;  1Z4E A;  1Z9U A;  2IL4 A;  4I49 A;  2DPS A;  3FBU A;  2DPT A;  3EFA A;  2P6F A;  3TTH A;  4UA3 A;  4MI4 A;  1M4G A;  3BLN A;  5KTC A;  4CAX A;  1Q2D A;  1Z4R A;  3D3S A;  1OZP A;  3TE4 A;  4UFW A;  2R98 A;  2FIA A;  2I79 A;  2ARH A;  2PSW A;  2Q0Y A;  1KUX A;  5AG4 A;  5JQ4 A;  2Z10 A;  4UCP A;  2AE6 A;  2Z3N A;  4U9Y A;  1MJB A;  4UFX A;  4IF5 A;  1M4D A;  1YX0 A;  2A4N A;  2REF A;  1IID A;  4KOY A;  1IYK A;  4MJ8 A;  2I00 A;  3R9E A;  3IU1 A;  5DWN A;  4K30 A;  1RO5 A;  3LD2 A;  1YR0 A;  2OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...