3FB3A

Crystal structure of trypanosoma brucei acetyltransferase, tb11.01.2886
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
b'DLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLMIQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRSKGCYKVILDSSEKSLPFYEKLGFRAHERQMRLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyltransferase
publication title Crystal Structure of Trypanosoma Brucei Acetyltransferase, Tb11.01.2886
rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 36
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fb3A00
3TE4A 3D8PA 2Q4VA 1Z4EA 4AVBA 4QBJA 4CAVA 4FD5A 3S6FA 2Q44A 3P2FA 4HNYB 4R9MA 3TTHA 2RC4A 1CJWA 4AG7A 1Z9UA 5JQ4A 2BUEA 1CM0A 1B87A 1IB1E 2PQ8A 4NF1A 2Q4YA 3R1KA 4B5PB 4AVAA 2G0BA 2REFA 3UY5A 4H6UA 1MK4A 5IX3A 1RO5A 3OWCA 4CAWA 3FXTA 3TOBA 4LX9A 2NMTA 4ONUA 4E8OA 2HQYA 3R9FA 4NEXA 2EUIA 4PV6A 4PSWA 3VWEA 5GCNA 4IUSA 1OZPA 3GYAA 3C26A 5F49A 1KZFA 3I3GA 3H4QA 4HNXB 1V0CA 3FRMA 3B8GA 1WWZA 5DWNA 4J3GA 3DR8A 1TIQA 3T90A 1M1DA 2B58A 2KCWA 1Y9WA 2PSWA 3CXPA 3DNSA 4Y49B 3G3SA 4KVXA 2R7HA 3W6SA 3FBUA 3I9SA 5C82A 2AE6A 3TOAA 1PUAA 4FD6A 4OAEA 1S7FA 3CXSA 2R1IA 1XE4A 4FD4A 3N7ZA 2FE7A 1ON0A 2IL4A 2B4DA 2ZW5A 4F0YA 1YLEA 1P0HA 2Q0YA 3K9UA 4Y49C 4XPKA 3T9YA 1I12A 2VQYA 1S7LA 2P6EA 1YK3A 2B4DB 4JJXA 4E0AA 4KUBA 4KOXA 4NCZA 4KLVA 2CNTA 2ZPAA 4MI4A 4L89A 5KTAA 5J8FA 2AJ6A 1J4JA 3QB8A 1IICA 4MBUA 3BLNA 4X5KA 3GKRA 2P0WA 3TFYA 5JPHA 2Z0ZA 2G3TA 1XMTA 3R96A 3FIXA 4YRHA 2P6FA 3CXQA 2B3UA 5EBVA 5ISVA 1FY7A 4NXYA 4JXRA 3R9EA 3SXOA 3SHPA 3S6KA 5H84A 2PDOA 2F5IA 4QVTA 4FD7A 3V8IA 4F6AA 4YFJA 2Y0MA 4KLWA 2HUZA 3RYOA 1NSLA 2Z11A 1Y7RA 1GHEA 3D3SA 3TO7A 2C27A 2H5MA 1I21A 2JDDA 3QAHA 4M3SA 1KUYA 1KUXA 1WK4A 4PK2A 2J8NA 1M4IA 2FIWA 2GANA 3F0AA 3WR7A 1QSRA 4HNWB 4PK3A 2OU2A 2FIAA 2I00A 1IYLA 1MJ9A 4ZBGA 2ZW7A 1LRZA 3D2PA 1IYKA 2D4PA 2QECA 2G3AA 1U6MA 3TT2A 5F48A 3SXNA 3EXNA 4AB7A 1QSMA 2X7BA 1YGHA 2PR8A 4CS0B 2B4BA 1YX0A 1MJBA 4XPDC 2PRBA 4M85A 1Q2DA 1VKCA 5EC4A 4K30A 2CY2A 4OLLA 4CAXA 2QMLA 1XF8A 2JEVA 3FNCA 1QSOA 1XEBA 2FCKA 1I1DA 3PGPA 4RI1A 4BMHA 2A4NA 1YVOA 1UFHA 3GY9A 4R57A 2FXFA 2WPWA 3FB3A 4H89A 1S60A 2Q04A 2FT0A 3TO9A 3VWDA 2WPXA 2ZXVA 2B5GA 4II9A 4MJ8A 4LUAA 3KKWA 4JXQA 4KUAA 2OZHA 3EO4A 1M4GA 1Q2CA 4QC6A 3EY5A 2P6GA 4U9ZA 4MY3A 2Z10A 1Z4RA 4UBRA 4KOUA 2B3VA 2GE3A 2VXKA 5HH1A 4XNHC 1S3ZA 1XIXA 1L0CA 1MJAA 5E96A 3G8WA 2BSWA 3TCVA 4MHDA 1K4JA 4OADA 3W6XA 4KVME 1BOBA 2ATRA 3PZJA 4JD6A 2FSRA 3E0KA 5KTDA 2DXQA 5C88A 1B6BA 2VBQA 5FVJA 3IWGA 2OB0A 3LODA 2VZZA 3R95A 2PR1A 3IGRA 2R8VA 4KZTA 5IB0A 4UWJA 2VEZA 4U9YA 1R57A 4KVOE 4XPLA 5I0CA 4I49A 4KOVA 2J8RA 4CRZB 1BO4A 2VI7A 3BJ7A 2GIVA 3LD2A 4KOTA 4KOYA 2OZUA 2ZW6A 1RXTA 4AVCA 4B5PA 2HV2A 1Q2YA 4XPDB 1S7KA 4PSXA 5F47A 3ZZIA 2OH1A 3DR6A 3MGDA 3TO6A 4CRYB 1NMTA 3W91A 1KUVA 3D2MA 4H6ZA 4E2AA 2BL1A 1YR0A 2Q7BA 4QB9A 4GS4A 4UWIA 2D4OA 2J8MA 1QSNA 4EVYA 4NSQA 2VZYA 4R3KA 3P2HA 3DDDA 3S6HA 1VHSA 5H86A 1YVKA 1PU9A 1Y9KA 2PC1A 4YGOA 2ARHA 5F46A 4RS2A 4KORA 4R3LA 2O28A 4JWPA 5HMNA 1SQHA 3DSBA 3PP9A 1S7NA 1P4NA 4ORFA 3F8KA 4JLYA 2BEIA 2REEA 1QSTA 3EFAA 1M44A 2QIRA 4XNHB 4MY0A 3ZJ0A 3FYNA 2JDCA 1N71A 2OZGA 2I79A 2FL4A 4QUSA 4IF5A 3NE7A 2EVNA 5IV0A 4KOSA 5KTCA 2B5GB 1NE9A 4R87A 3F5BA 4DNCA 3BJ8A 3S6GA 2JLMA 4AG9A 1M4DA 5DWMA 4B5OA 4UA3A 5CNPA 3JUWA 5J8CA 4L8AA 1S5KA 4U5YA 3JVNA 4KOWA 2CNSA 2CNMA 2ZW4A 4HKFA 2FS5A 2K5TA 3R9GA 1YREA 1IIDA 2R98A 3EC4A
chains in the Genus database with same CATH superfamily
4RUHA 3TE4A 3D8PA 3KL9A 2Q4VA 1Z4EA 4AVBA 3S9LA 3PB7X 2PJ9A 3NH8A 3IIBA 3H8FA 4UF4A 3D7DA 2IQ6A 4CAVA 4CGPA 4QBJA 4CGNA 4FAIA 2ZEMA 4FD5A 2QJ8A 3CT9A 3S6FA 4B14A 1IOFA 2Q44A 3P2FA 3FMCA 4HNYB 1XRYA 4R9MA 3TTHA 1OBRA 3KHXA 2RC4A 4KSAA 4C68A 1CJWA 4AG7A 1Z9UA 1ZLIA 4F9VA 1YMEA 2BUEA 1CP6A 3B3SA 4UEEA 1UWYA 5JQ4A 3B3TA 4UCPA 1CM0A 4Z65A 2V8GA 3SJEA 1XBUA 5AG6A 3V7ZA 1B87A 1IB1E 2PQ8A 3L2NA 4NF1A 1Z2LA 2Q4YA 3TC8A 1TXRA 5JGFA 4MFZA 3R1KA 2PJ3A 4NGPA 4AVAA 4B5PB 2EWBA 2Z3OA 2ANPA 2G0BA 2REFA 2AFUA 3UY5A 4R8FA 5LYFA 1LAPA 4H6UA 4MFKA 2WUUA 1MK4A 5IX3A 4HPSA 1RO5A 3KR5A 3OWCA 3T8WA 4CAWA 5LYDA 3S9MA 3FXTA 1R3NA 3TOBA 4LX9A 2NMTA 5LRKA 1VHEA 1ARMA 4MCQA 4ONUA 4UCMA 2ODFA 4OC1A 4E8OA 2PJ6A 2G9DA 2HQYA 4MMOA 3R9FA 1YQEA 4MCRA 3KASA 4P10A 4NEXA 5HXDA 1Q7LA 2WYRA 5G21A 2EUIA 4P4JA 4PV6A 3MN8A 4B6ZA 1ZO0A 5G22A 3GLJA 1LAMA 1Z8TA 4PSWA 1RTQA 4PXDA 3SI2A 3VWEA 1LANA 4MXUA 4ONWA 1IU8A 5GCNA 1CG2A 4IUSA 1OZPA 3GYAA 2Q43A 3C26A 5F49A 1KZFA 3FEDA 2IMOA 3I3GA 5K8NA 1CX8A 3H4QA 4HNXB 1V0CA 4OC0A 5CPAA 5LYLA 3FRMA 3B8GA 3PB6X 1WWZA 1TKJA 5DWNA 3RNZA 3QAYA 1TF8A 4J3GA 1EE3P 1TIQA 3DR8A 3T90A 4C7HA 1M1DA 4GM5A 2B58A 2KCWA 1Y9WA 2PSWA 3CXPA 3DNSA 4NGNA 3CPXA 3G3SA 4P6YA 4Y49B 3WC5A 4KVXA 2R7HA 3W6SA 3FBUA 3WC6A 1QQ9A 4A39A 2GFQA 4M6GA 3A9LA 2ZEDA 3CPAA 3I9SA 5C82A 2AE6A 3B3CA 1PUAA 2Z3KA 3TOAA 3B7IA 2ZENA 4FD6A 4OAEA 4Q36A 1S7FA 4JZ0A 4UFVA 2XEJA 2R1IA 1XE4A 3CXSA 4FD4A 4Q38A 4KS9A 3N7ZA 4OKOA 5LYIA 4DYOA 2FE7A 3D67A 4UEZA 1ON0A 4BINA 1LOKA 2IL4A 4UEFA 2B4DA 2ZW5A 4F0YA 5AG7A 1YLEA 1P0HA 2Q0YA 3K9UA 4MCSA 4Y49C 4XPKA 5G20A 3T9YA 4MFJA 1F2PA 2ZEPA 2NSMA 1I12A 2VQYA 2ZOGA 1LCPA 4AXVA 1S7LA 1YW4A 2P6EA 3D7FA 1YK3A 2B4DB 4JJXA 2HC9A 4E0AA 3BI1A 2O4HA 3VARA 1F2OA 4KOXA 4KUBA 7CPAA 4YU9A 3SJFA 2V8DA 4NCZA 4KLVA 4G1PA 2CNTA 3RBUA 2ZPAA 3PB8X 2YNDA 4L89A 3CZXA 4MI4A 4F0XA 4CGMA 5KTAA 5J8FA 1FNOA 4C7IA 2AJ6A 4NGRA 1J4JA 3QB8A 4CGOA 1IICA 3D4UA 2DPSA 4DJLA 2DEAA 4MBUA 3BLNA 4OC3A 5D29A 3PFOA 2GLFA 4X5KA 3GKRA 2P0WA 2CTBA 3SI0A 5JPHA 2Z0ZA 3IC1A 1IY7A 3RZAA 3TFYA 2G3TA 1XMTA 3R96A 4EWTA 3FIXA 3KR4A 4YRHA 1HDQA 2V77A 2NYQA 2P6FA 1YSJA 3CXQA 3NH4A 1ZG8A 2B3UA 3IU1A 5EBVA 4X3RA 5ISVA 3KHZA 2Z3LA 1FY7A 4KSFA 3B3VA 4NXYA 4JXRA 4NGMA 3R9EA 3SHPA 3SXOA 2PJ7A 4A37A 3S6KA 4P4EA 5H84A 3ISZA 5LRJA 5JM6A 5THWA 2PDOA 2F5IA 3PB9X 2V8HA 5ELYA 4EFDA 4QVTA 4FD7A 3V8IA 4A2ZA 4F6AA 2OR4A 2CF4A 5I4MA 4PQAA 4YFJA 2Y0MA 1JQGA 2Z3MA 4H2KA 4KLWA 2AFOA 4MHZA 2HUZA 4P4BA 1NSLA 3RYOA 3WC7A 1Z8WA 2Z11A 1Y7RA 1GHEA 3BHXA 3D3SA 3PBBA 3TO7A 4PXEA 2C27A 3K9TA 4NJQA 2Z3PA 5HVHA 1ELLP 2H5MA 1I21A 2JDDA 3QAHA 4M3SA 4P4IA 5F09A 1KUYA 1KUXA 1NSAA 2PJ2A 4C2ZA 2ZEEA 1WK4A 3TX8A 4ZY0A 4PK2A 3IEHA 2J8NA 1M4IA 2FIWA 2GANA 2ZEFA 3F0AA 4R76A 1VHOA 3WR7A 1QSRA 2GLJA 4HNWB 4MFQA 4PK3A 2OU2A 4EMEA 1Z8LA 2FIAA 2I00A 1PCAA 1IYLA 5A28A 1MJ9A 2GU2A 4ZBGA 1LFWA 2ZW7A 1LRZA 3D2PA 4TNUA 4W9YA 1IYKA 2D4PA 2PJ0A 2QECA 2G3AA 4P44A 1Y7EA 4B12A 4CGLA 4MCPA 4NGTA 1U6MA 2PVVA 4B10A 3TT2A 4IHMA 4BD9A 5F48A 4BBHA 5LRGA 3SXNA 1FT7A 3EXNA 4PXBA 4AB7A 1QSMA 2X7BA 3I1UA 5K8OA 1IOIA 1YGHA 3S9NA 4CYQA 1TKHA 2PR8A 4CS0B 2B4BA 2BO9A 1YW6A 1YX0A 2ZELA 1MJBA 4XPDC 4TWEA 2PRBA 2OOTA 4M85A 4DUKA 5K8MA 3LACA 1Q2DA 1VKCA 2EK8A 3LWUA 5EC4A 4K30A 1Z5RA 2CY2A 4OLLA 2QVPA 3CDXA 1QMUA 2AFWA 2QMLA 4CAXA 1PYTB 1XF8A 2YNCA 2JEVA 3FNCA 1QSOA 3BI0A 4ZY1A 3NE8A 3WABA 1XEBA 2EO8A 1JWQA 4UIBA 5D8NA 2FCKA 1I1DA 3PGPA 4RI1A 4YWYA 8CPAA 4BMHA 2A4NA 2PRQA 5G1ZA 4FWUA 1YVOA 1UFHA 3GY9A 2PJ4A 2ZEHA 4R57A 1BLLE 2XEGA 2FXFA 2WPWA 3FB3A 4H89A 1S60A 2Q04A 2FT0A 2Q7SA 3TO9A 3VWDA 4K3NA 4P45A 6CPAA 2WPXA 2ZXVA 2B5GA 4FBEA 4IK2A 4II9A 1HEEA 5HVGA 4MJ8A 4A31A 1X12A 4A30A 1CPXA 3GUXA 3H8EA 4LUAA 3KKWA 4JXQA 4KUAA 2RB7A 3PBEA 2OZHA 3RAMA 3EO4A 3DGVA 1M4GA 3QNVA 1Q2CA 4QC6A 2PE3A 3IU2A 1Y0RA 3EY5A 2P6GA 4U9ZA 4KSIA 4MY3A 1DE4C 2Z10A 2C6CA 1Z4RA 4UBRA 2YNCC 4KOUA 2WZNA 2B3VA 1CBXA 2GE3A 2VXKA 4C2XA 5HH1A 2XEFA 4XNHC 1S3ZA 3KQZA 1XIXA 3JTKA 2XEIA 1L0CA 1MJAA 5E96A 2CTCA 2PCUA 3G8WA 4MHNA 2BSWA 2J9AA 4OC4A 3TCVA 4MHDA 1K4JA 1IGBA 3K2KA 4OADA 4OC2A 3W6XA 4CAFA 1CPSA 5A27A 4KVME 1BOBA 2ATRA 3PZJA 4JD6A 2FSRA 3E0KA 5KTDA 2DXQA 1KWMA 5C88A 1B6BA 1TKFA 2VBQA 1TF9A 4R7MA 2IJZA 3PFEA 4RN7A 3FECA 3MRUA 5FVJA 2OB0A 3IWGA 3LODA 2VZZA 3R95A 4CYOA 2PR1A 3IGRA 2R8VA 2PJBA 4UFXA 4KZTA 5IB0A 3GIUA 2VEZA 4IAVA 4UWJA 1VIXA 3IFEA 4U9YA 1R57A 2F8HA 3B35A 2ZEGA 4KVOE 1XOVA 4XPLA 2Q4ZA 4I49A 4KOVA 4A38A 4OIDA 2JBKA 5I0CA 2J8RA 2O53A 4CRZB 1BO4A 3IWEA 2VI7A 3BJ7A 2GIVA 4OP4A 4MHYA 2AFMA 3LD2A 4KOTA 2POKA 4GXHA 4KOYA 2OZUA 4ZX8A 4OC5A 2JBJA 2ZW6A 1ELMP 1ARLA 4CPAA 1RXTA 4AVCA 5K8PA 4B5PA 2HV2A 1Q2YA 4XPDB 3VATA 1S7KA 4PSXA 1AYEA 3BXMA 3FH4A 5F47A 2OH1A 3DR6A 3ZZIA 5AG5A 3MGDA 4WJBA 2BOAA 2PJ1A 3D68A 4LQ6A 4O23A 1NMTA 3KZWA 3TO6A 4CRYB 1ZLHA 3W91A 1KUVA 2AFZA 3D2MA 1BPMA 1A2ZA 4H6ZA 4E2AA 2BL1A 1YR0A 2Q7BA 2VL1A 2C6PA 4CYNA 4QB9A 3SJGA 2DPTA 4GS4A 4UWIA 2ZEOA 1BAVA 1DTDA 2D4OA 2J8MA 1QSNA 4EVYA 3D66A 4NSQA 3NFZA 5J1QA 2FVGA 4A94A 2Q51A 2VZYA 4R3KA 3P2HA 3FX6A 1XFOA 3HLPA 4C2YA 4PXCA 3DDDA 1VGYA 3D7GA 2CXAA 3N5FA 3SJXA 3V38A 4X8IA 3FJUA 3S6HA 1VHSA 5H86A 1Z8XA 1YVKA 2EK9A 4M6HA 5IB9A 4ZGYB 3NA6A 5HVFA 1ZG7A 1M4LA 1PU9A 1Y9KA 1Y0YA 3HUVA 4MHPA 2C6GA 5JH9A 2PC1A 4YGOA 5DS0A 1XJOA 2ARHA 4ZX9A 5F46A 1GYTA 2PIZA 4P4DA 4RS2A 4A95A 4KORA 4R3LA 2O28A 1AUGA 1XMBA 3KI9A 1F57A 4JWPA 1SQHA 2PJAA 3DSBA 3PP9A 2QYVA 1S7NA 1P4NA 4Q7AA 4ORFA 3F8KA 4JLYA 4UFWA 2BEIA 2EBJA 3PRTA 4ZY2A 2REEA 1QSTA 3EFAA 1CP7A 1M44A 2QIRA 4XNHB 2C1CA 4MY0A 3IWWA 3VH9A 1H8LA 2PJCA 3ZJ0A 4UIAA 4F8ZA 4NGSA 2HB6A 3PB4X 2CIJA 3FYNA 1YLOA 2JDCA 4OMEA 4P4FA 1N71A 4B11A 1AMPA 3NH5A 2OZGA 2BCOA 2I79A 4M6IA 2FL4A 4PPZA 4QUSA 4F9UA 4IF5A 4ZI6A 3NE7A 2YGWA 2EVNA 3PEIA 4KOSA 4MFPA 5IV0A 5KTCA 3KQXA 2B5GB 3RO0A 1NE9A 4JYWA 1HDUA 4NFRA 4OIWA 4R87A 1R43A 1X10A 3DLJA 4WWVA 4MFLA 2PJ8A 3F5BA 2I3CA 4DNCA 2PJ5A 3BJ8A 3IJ3A 4A33A 2AFXA 3S6GA 4CYPA 1ZG9A 2GREA 4FUUA 4A32A 2JLMA 5AGEA 3LMSA 5EMIA 4X2TA 5CBMA 4AG9A 1M4DA 3B2YA 4R6TA 5DWMA 4B5OA 2AFSA 3WT4A 3IO1A 4UA3A 3B3WA 4LQGA 5CNPA 3FVLA 3JUWA 3ISXA 3H5ZA 5BWAB 3JRUA 2RFHA 2JEWA 5J8CA 4L8AA 1S5KA 4U5YA 2ZOFA 3JVNA 3H8GA 5HMNA 2DF5A 3FEEA 4ZYQA 4KOWA 2CNSA 2ABZA 2CNMA 2ZW4A 3FF3A 4NGQA 2F7VA 2PIYA 4HKFA 2FS5A 3GB0A 3SI1A 5AG4A 2K5TA 3KGQA 4B13A 2Z3NA 4CAEA 2V8VA 3D7HA 1BPNA 4UCNA 4NJRA 3R9GA 2YNEA 2PVWA 2WSAA 1YREA 4MRIA 1IIDA 2R98A 3EC4A
chains in the Genus database with same CATH topology
3TE4A 3D8PA 2Q4VA 1Z4EA 4AVBA 4QBJA 4CAVA 4CGPA 4CGNA 4FD5A 3S6FA 4B14A 2Q44A 3P2FA 4HNYB 4R9MA 3TTHA 4C68A 2RC4A 4KSAA 1CJWA 4AG7A 1Z9UA 5JQ4A 2BUEA 4UCPA 1CM0A 5AG6A 1B87A 1IB1E 2PQ8A 4NF1A 2Q4YA 4MFZA 3R1KA 4B5PB 4AVAA 2Z3OA 2G0BA 2REFA 3UY5A 4H6UA 4MFKA 2WUUA 1MK4A 5IX3A 1RO5A 3OWCA 4CAWA 3FXTA 3TOBA 4LX9A 2NMTA 4UCMA 4ONUA 4E8OA 2HQYA 3R9FA 4NEXA 5G21A 2EUIA 4PV6A 1ZO0A 5G22A 4PSWA 3VWEA 5GCNA 4IUSA 1OZPA 3GYAA 3C26A 5F49A 1KZFA 3I3GA 3H4QA 4HNXB 1V0CA 3FRMA 3B8GA 1WWZA 5DWNA 4J3GA 4C7HA 3DR8A 1TIQA 3T90A 1M1DA 2B58A 2KCWA 1Y9WA 2PSWA 3CXPA 3DNSA 4Y49B 3G3SA 4KVXA 2R7HA 3W6SA 3FBUA 3A9LA 3I9SA 5C82A 2AE6A 3TOAA 1PUAA 2Z3KA 4FD6A 4OAEA 4Q36A 1S7FA 4UFVA 3CXSA 2R1IA 1XE4A 4FD4A 4Q38A 4KS9A 3N7ZA 2FE7A 1ON0A 2IL4A 2B4DA 2ZW5A 4F0YA 5AG7A 1YLEA 3K9UA 1P0HA 2Q0YA 4Y49C 4XPKA 5G20A 3T9YA 4MFJA 1I12A 2VQYA 1S7LA 2P6EA 1YK3A 2B4DB 4JJXA 4E0AA 4KUBA 4KOXA 4NCZA 4KLVA 2CNTA 2ZPAA 4MI4A 2YNDA 4L89A 4F0XA 4CGMA 5KTAA 5J8FA 4C7IA 2AJ6A 1J4JA 3QB8A 4CGOA 1IICA 2DPSA 4MBUA 3BLNA 4X5KA 3GKRA 2P0WA 3TFYA 5JPHA 2Z0ZA 2G3TA 1XMTA 3R96A 3FIXA 4YRHA 2P6FA 3CXQA 2B3UA 3IU1A 5EBVA 5ISVA 2Z3LA 1FY7A 4KSFA 4NXYA 4JXRA 3R9EA 3SXOA 3SHPA 3S6KA 5H84A 2PDOA 2F5IA 4QVTA 4FD7A 3V8IA 4A2ZA 4F6AA 4YFJA 2Y0MA 2Z3MA 4KLWA 2HUZA 3RYOA 1NSLA 2Z11A 1Y7RA 1GHEA 3D3SA 3TO7A 2C27A 2Z3PA 2H5MA 1I21A 2JDDA 3QAHA 4M3SA 1KUYA 1KUXA 4C2ZA 1WK4A 4PK2A 2J8NA 1M4IA 2FIWA 2GANA 3F0AA 3WR7A 1QSRA 4MFQA 4HNWB 4PK3A 2OU2A 2FIAA 2I00A 5A28A 1IYLA 1MJ9A 4ZBGA 2ZW7A 1LRZA 3D2PA 1IYKA 2D4PA 2QECA 2G3AA 4B12A 4CGLA 1U6MA 4B10A 3TT2A 5F48A 4BBHA 3SXNA 3EXNA 4AB7A 1QSMA 2X7BA 1YGHA 4CYQA 2PR8A 4CS0B 2B4BA 1YX0A 1MJBA 4XPDC 2PRBA 4M85A 1Q2DA 1VKCA 5EC4A 4K30A 2CY2A 4OLLA 4CAXA 2QMLA 1XF8A 2YNCA 2JEVA 3FNCA 1QSOA 1XEBA 2FCKA 1I1DA 3PGPA 4RI1A 4BMHA 2A4NA 5G1ZA 1YVOA 1UFHA 3GY9A 4R57A 4MFLA 2FXFA 2WPWA 3FB3A 4H89A 1S60A 2Q04A 2FT0A 3TO9A 3VWDA 2WPXA 2ZXVA 2B5GA 4II9A 4MJ8A 4A31A 4A30A 4LUAA 3KKWA 4JXQA 4KUAA 2OZHA 3EO4A 1M4GA 1Q2CA 4QC6A 3IU2A 3EY5A 2P6GA 4U9ZA 4MY3A 2Z10A 1Z4RA 4UBRA 2YNCC 4KOUA 2B3VA 4C2XA 2GE3A 2VXKA 5HH1A 4XNHC 1S3ZA 1XIXA 3JTKA 1L0CA 1MJAA 5E96A 3G8WA 2BSWA 3TCVA 4MHDA 1K4JA 4OADA 3W6XA 4CAFA 5A27A 4KVME 1BOBA 2ATRA 3PZJA 4JD6A 2FSRA 3E0KA 5KTDA 2DXQA 5C88A 1B6BA 2VBQA 5FVJA 3IWGA 2OB0A 3LODA 2VZZA 3R95A 4CYOA 2PR1A 3IGRA 2R8VA 4UFXA 4KZTA 5IB0A 4UWJA 2VEZA 4U9YA 1R57A 4KVOE 4XPLA 5I0CA 4I49A 4KOVA 2J8RA 4CRZB 1BO4A 3IWEA 2VI7A 3BJ7A 2GIVA 3LD2A 4KOTA 4KOYA 2OZUA 2ZW6A 1RXTA 4AVCA 4B5PA 2HV2A 1Q2YA 4XPDB 1S7KA 4PSXA 5F47A 3ZZIA 2OH1A 3DR6A 5AG5A 3MGDA 3TO6A 4CRYB 1NMTA 3W91A 1KUVA 3D2MA 4H6ZA 4E2AA 2BL1A 1YR0A 2Q7BA 4CYNA 4QB9A 2DPTA 4GS4A 4UWIA 2D4OA 2J8MA 1QSNA 4EVYA 4NSQA 2VZYA 4R3KA 3P2HA 4C2YA 3DDDA 2CXAA 3S6HA 1VHSA 5H86A 1YVKA 4ZGYB 1PU9A 1Y9KA 2PC1A 4YGOA 2ARHA 5F46A 4RS2A 4A95A 4KORA 4R3LA 2O28A 4JWPA 5HMNA 1SQHA 3DSBA 3PP9A 1S7NA 1P4NA 4ORFA 3F8KA 4JLYA 4UFWA 2BEIA 2REEA 1QSTA 3EFAA 1M44A 2QIRA 4XNHB 4MY0A 3ZJ0A 3FYNA 2JDCA 4B11A 1N71A 2OZGA 2I79A 2FL4A 4QUSA 4IF5A 3NE7A 2YGWA 2EVNA 4MFPA 4KOSA 5IV0A 5KTCA 2B5GB 1NE9A 4R87A 3F5BA 4DNCA 3BJ8A 4A33A 3S6GA 4CYPA 4A32A 2JLMA 5AGEA 4AG9A 1M4DA 5DWMA 4B5OA 4UA3A 5CNPA 5BWAB 3JUWA 3H5ZA 5J8CA 4L8AA 1S5KA 4U5YA 3JVNA 4KOWA 2CNSA 2CNMA 2ZW4A 4HKFA 2FS5A 5AG4A 2K5TA 4B13A 2Z3NA 4CAEA 4UCNA 3R9GA 2YNEA 2WSAA 1YREA 1IIDA 2R98A 3EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TE4 A;  3D8P A;  2Q4V A;  1Z4E A;  4AVB A;  4QBJ A;  4CAV A;  4FD5 A;  3S6F A;  2Q44 A;  3P2F A;  4HNY B;  4R9M A;  3TTH A;  2RC4 A;  1CJW A;  4AG7 A;  1Z9U A;  5JQ4 A;  2BUE A;  1CM0 A;  1B87 A;  1IB1 E;  2PQ8 A;  4NF1 A;  2Q4Y A;  3R1K A;  4B5P B;  4AVA A;  2G0B A;  2REF A;  3UY5 A;  4H6U A;  1MK4 A;  5IX3 A;  1RO5 A;  3OWC A;  4CAW A;  3FXT A;  3TOB A;  4LX9 A;  2NMT A;  4ONU A;  4E8O A;  2HQY A;  3R9F A;  4NEX A;  2EUI A;  4PV6 A;  4PSW A;  3VWE A;  5GCN A;  4IUS A;  1OZP A;  3GYA A;  3C26 A;  5F49 A;  1KZF A;  3I3G A;  3H4Q A;  4HNX B;  1V0C A;  3FRM A;  3B8G A;  1WWZ A;  5DWN A;  4J3G A;  3DR8 A;  1TIQ A;  3T90 A;  1M1D A;  2B58 A;  2KCW A;  1Y9W A;  2PSW A;  3CXP A;  3DNS A;  4Y49 B;  3G3S A;  4KVX A;  2R7H A;  3W6S A;  3FBU A;  3I9S A;  5C82 A;  2AE6 A;  3TOA A;  1PUA A;  4FD6 A;  4OAE A;  1S7F A;  3CXS A;  2R1I A;  1XE4 A;  4FD4 A;  3N7Z A;  2FE7 A;  1ON0 A;  2IL4 A;  2B4D A;  2ZW5 A;  4F0Y A;  1YLE A;  1P0H A;  2Q0Y A;  3K9U A;  4Y49 C;  4XPK A;  3T9Y A;  1I12 A;  2VQY A;  1S7L A;  2P6E A;  1YK3 A;  2B4D B;  4JJX A;  4E0A A;  4KUB A;  4KOX A;  4NCZ A;  4KLV A;  2CNT A;  2ZPA A;  4MI4 A;  4L89 A;  5KTA A;  5J8F A;  2AJ6 A;  1J4J A;  3QB8 A;  1IIC A;  4MBU A;  3BLN A;  4X5K A;  3GKR A;  2P0W A;  3TFY A;  5JPH A;  2Z0Z A;  2G3T A;  1XMT A;  3R96 A;  3FIX A;  4YRH A;  2P6F A;  3CXQ A;  2B3U A;  5EBV A;  5ISV A;  1FY7 A;  4NXY A;  4JXR A;  3R9E A;  3SXO A;  3SHP A;  3S6K A;  5H84 A;  2PDO A;  2F5I A;  4QVT A;  4FD7 A;  3V8I A;  4F6A A;  4YFJ A;  2Y0M A;  4KLW A;  2HUZ A;  3RYO A;  1NSL A;  2Z11 A;  1Y7R A;  1GHE A;  3D3S A;  3TO7 A;  2C27 A;  2H5M A;  1I21 A;  2JDD A;  3QAH A;  4M3S A;  1KUY A;  1KUX A;  1WK4 A;  4PK2 A;  2J8N A;  1M4I A;  2FIW A;  2GAN A;  3F0A A;  3WR7 A;  1QSR A;  4HNW B;  4PK3 A;  2OU2 A;  2FIA A;  2I00 A;  1IYL A;  1MJ9 A;  4ZBG A;  2ZW7 A;  1LRZ A;  3D2P A;  1IYK A;  2D4P A;  2QEC A;  2G3A A;  1U6M A;  3TT2 A;  5F48 A;  3SXN A;  3EXN A;  4AB7 A;  1QSM A;  2X7B A;  1YGH A;  2PR8 A;  4CS0 B;  2B4B A;  1YX0 A;  1MJB A;  4XPD C;  2PRB A;  4M85 A;  1Q2D A;  1VKC A;  5EC4 A;  4K30 A;  2CY2 A;  4OLL A;  4CAX A;  2QML A;  1XF8 A;  2JEV A;  3FNC A;  1QSO A;  1XEB A;  2FCK A;  1I1D A;  3PGP A;  4RI1 A;  4BMH A;  2A4N A;  1YVO A;  1UFH A;  3GY9 A;  4R57 A;  2FXF A;  2WPW A;  3FB3 A;  4H89 A;  1S60 A;  2Q04 A;  2FT0 A;  3TO9 A;  3VWD A;  2WPX A;  2ZXV A;  2B5G A;  4II9 A;  4MJ8 A;  4LUA A;  3KKW A;  4JXQ A;  4KUA A;  2OZH A;  3EO4 A;  1M4G A;  1Q2C A;  4QC6 A;  3EY5 A;  2P6G A;  4U9Z A;  4MY3 A;  2Z10 A;  1Z4R A;  4UBR A;  4KOU A;  2B3V A;  2GE3 A;  2VXK A;  5HH1 A;  4XNH C;  1S3Z A;  1XIX A;  1L0C A;  1MJA A;  5E96 A;  3G8W A;  2BSW A;  3TCV A;  4MHD A;  1K4J A;  4OAD A;  3W6X A;  4KVM E;  1BOB A;  2ATR A;  3PZJ A;  4JD6 A;  2FSR A;  3E0K A;  5KTD A;  2DXQ A;  5C88 A;  1B6B A;  2VBQ A;  5FVJ A;  3IWG A;  2OB0 A;  3LOD A;  2VZZ A;  3R95 A;  2PR1 A;  3IGR A;  2R8V A;  4KZT A;  5IB0 A;  4UWJ A;  2VEZ A;  4U9Y A;  1R57 A;  4KVO E;  4XPL A;  5I0C A;  4I49 A;  4KOV A;  2J8R A;  4CRZ B;  1BO4 A;  2VI7 A;  3BJ7 A;  2GIV A;  3LD2 A;  4KOT A;  4KOY A;  2OZU A;  2ZW6 A;  1RXT A;  4AVC A;  4B5P A;  2HV2 A;  1Q2Y A;  4XPD B;  1S7K A;  4PSX A;  5F47 A;  3ZZI A;  2OH1 A;  3DR6 A;  3MGD A;  3TO6 A;  4CRY B;  1NMT A;  3W91 A;  1KUV A;  3D2M A;  4H6Z A;  4E2A A;  2BL1 A;  1YR0 A;  2Q7B A;  4QB9 A;  4GS4 A;  4UWI A;  2D4O A;  2J8M A;  1QSN A;  4EVY A;  4NSQ A;  2VZY A;  4R3K A;  3P2H A;  3DDD A;  3S6H A;  1VHS A;  5H86 A;  1YVK A;  1PU9 A;  1Y9K A;  2PC1 A;  4YGO A;  2ARH A;  5F46 A;  4RS2 A;  4KOR A;  4R3L A;  2O28 A;  4JWP A;  5HMN A;  1SQH A;  3DSB A;  3PP9 A;  1S7N A;  1P4N A;  4ORF A;  3F8K A;  4JLY A;  2BEI A;  2REE A;  1QST A;  3EFA A;  1M44 A;  2QIR A;  4XNH B;  4MY0 A;  3ZJ0 A;  3FYN A;  2JDC A;  1N71 A;  2OZG A;  2I79 A;  2FL4 A;  4QUS A;  4IF5 A;  3NE7 A;  2EVN A;  5IV0 A;  4KOS A;  5KTC A;  2B5G B;  1NE9 A;  4R87 A;  3F5B A;  4DNC A;  3BJ8 A;  3S6G A;  2JLM A;  4AG9 A;  1M4D A;  5DWM A;  4B5O A;  4UA3 A;  5CNP A;  3JUW A;  5J8C A;  4L8A A;  1S5K A;  4U5Y A;  3JVN A;  4KOW A;  2CNS A;  2CNM A;  2ZW4 A;  4HKF A;  2FS5 A;  2K5T A;  3R9G A;  1YRE A;  1IID A;  2R98 A;  3EC4 A; 
#chains in the Genus database with same CATH topology
 4RUH A;  3TE4 A;  3D8P A;  3KL9 A;  2Q4V A;  1Z4E A;  4AVB A;  3S9L A;  3PB7 X;  2PJ9 A;  3NH8 A;  3IIB A;  3H8F A;  4UF4 A;  3D7D A;  2IQ6 A;  4CAV A;  4CGP A;  4QBJ A;  4CGN A;  4FAI A;  2ZEM A;  4FD5 A;  2QJ8 A;  3CT9 A;  3S6F A;  4B14 A;  1IOF A;  2Q44 A;  3P2F A;  3FMC A;  4HNY B;  1XRY A;  4R9M A;  3TTH A;  1OBR A;  3KHX A;  2RC4 A;  4KSA A;  4C68 A;  1CJW A;  4AG7 A;  1Z9U A;  1ZLI A;  4F9V A;  1YME A;  2BUE A;  1CP6 A;  3B3S A;  4UEE A;  1UWY A;  5JQ4 A;  3B3T A;  4UCP A;  1CM0 A;  4Z65 A;  2V8G A;  3SJE A;  1XBU A;  5AG6 A;  3V7Z A;  1B87 A;  1IB1 E;  2PQ8 A;  3L2N A;  4NF1 A;  1Z2L A;  2Q4Y A;  3TC8 A;  1TXR A;  5JGF A;  4MFZ A;  3R1K A;  2PJ3 A;  4NGP A;  4AVA A;  4B5P B;  2EWB A;  2Z3O A;  2ANP A;  2G0B A;  2REF A;  2AFU A;  3UY5 A;  4R8F A;  5LYF A;  1LAP A;  4H6U A;  4MFK A;  2WUU A;  1MK4 A;  5IX3 A;  4HPS A;  1RO5 A;  3KR5 A;  3OWC A;  3T8W A;  4CAW A;  5LYD A;  3S9M A;  3FXT A;  1R3N A;  3TOB A;  4LX9 A;  2NMT A;  5LRK A;  1VHE A;  1ARM A;  4MCQ A;  4ONU A;  4UCM A;  2ODF A;  4OC1 A;  4E8O A;  2PJ6 A;  2G9D A;  2HQY A;  4MMO A;  3R9F A;  1YQE A;  4MCR A;  3KAS A;  4P10 A;  4NEX A;  5HXD A;  1Q7L A;  2WYR A;  5G21 A;  2EUI A;  4P4J A;  4PV6 A;  3MN8 A;  4B6Z A;  1ZO0 A;  5G22 A;  3GLJ A;  1LAM A;  1Z8T A;  4PSW A;  1RTQ A;  4PXD A;  3SI2 A;  3VWE A;  1LAN A;  4MXU A;  4ONW A;  1IU8 A;  5GCN A;  1CG2 A;  4IUS A;  1OZP A;  3GYA A;  2Q43 A;  3C26 A;  5F49 A;  1KZF A;  3FED A;  2IMO A;  3I3G A;  5K8N A;  1CX8 A;  3H4Q A;  4HNX B;  1V0C A;  4OC0 A;  5CPA A;  5LYL A;  3FRM A;  3B8G A;  3PB6 X;  1WWZ A;  1TKJ A;  5DWN A;  3RNZ A;  3QAY A;  1TF8 A;  4J3G A;  1EE3 P;  1TIQ A;  3DR8 A;  3T90 A;  4C7H A;  1M1D A;  4GM5 A;  2B58 A;  2KCW A;  1Y9W A;  2PSW A;  3CXP A;  3DNS A;  4NGN A;  3CPX A;  3G3S A;  4P6Y A;  4Y49 B;  3WC5 A;  4KVX A;  2R7H A;  3W6S A;  3FBU A;  3WC6 A;  1QQ9 A;  4A39 A;  2GFQ A;  4M6G A;  3A9L A;  2ZED A;  3CPA A;  3I9S A;  5C82 A;  2AE6 A;  3B3C A;  1PUA A;  2Z3K A;  3TOA A;  3B7I A;  2ZEN A;  4FD6 A;  4OAE A;  4Q36 A;  1S7F A;  4JZ0 A;  4UFV A;  2XEJ A;  2R1I A;  1XE4 A;  3CXS A;  4FD4 A;  4Q38 A;  4KS9 A;  3N7Z A;  4OKO A;  5LYI A;  4DYO A;  2FE7 A;  3D67 A;  4UEZ A;  1ON0 A;  4BIN A;  1LOK A;  2IL4 A;  4UEF A;  2B4D A;  2ZW5 A;  4F0Y A;  5AG7 A;  1YLE A;  1P0H A;  2Q0Y A;  3K9U A;  4MCS A;  4Y49 C;  4XPK A;  5G20 A;  3T9Y A;  4MFJ A;  1F2P A;  2ZEP A;  2NSM A;  1I12 A;  2VQY A;  2ZOG A;  1LCP A;  4AXV A;  1S7L A;  1YW4 A;  2P6E A;  3D7F A;  1YK3 A;  2B4D B;  4JJX A;  2HC9 A;  4E0A A;  3BI1 A;  2O4H A;  3VAR A;  1F2O A;  4KOX A;  4KUB A;  7CPA A;  4YU9 A;  3SJF A;  2V8D A;  4NCZ A;  4KLV A;  4G1P A;  2CNT A;  3RBU A;  2ZPA A;  3PB8 X;  2YND A;  4L89 A;  3CZX A;  4MI4 A;  4F0X A;  4CGM A;  5KTA A;  5J8F A;  1FNO A;  4C7I A;  2AJ6 A;  4NGR A;  1J4J A;  3QB8 A;  4CGO A;  1IIC A;  3D4U A;  2DPS A;  4DJL A;  2DEA A;  4MBU A;  3BLN A;  4OC3 A;  5D29 A;  3PFO A;  2GLF A;  4X5K A;  3GKR A;  2P0W A;  2CTB A;  3SI0 A;  5JPH A;  2Z0Z A;  3IC1 A;  1IY7 A;  3RZA A;  3TFY A;  2G3T A;  1XMT A;  3R96 A;  4EWT A;  3FIX A;  3KR4 A;  4YRH A;  1HDQ A;  2V77 A;  2NYQ A;  2P6F A;  1YSJ A;  3CXQ A;  3NH4 A;  1ZG8 A;  2B3U A;  3IU1 A;  5EBV A;  4X3R A;  5ISV A;  3KHZ A;  2Z3L A;  1FY7 A;  4KSF A;  3B3V A;  4NXY A;  4JXR A;  4NGM A;  3R9E A;  3SHP A;  3SXO A;  2PJ7 A;  4A37 A;  3S6K A;  4P4E A;  5H84 A;  3ISZ A;  5LRJ A;  5JM6 A;  5THW A;  2PDO A;  2F5I A;  3PB9 X;  2V8H A;  5ELY A;  4EFD A;  4QVT A;  4FD7 A;  3V8I A;  4A2Z A;  4F6A A;  2OR4 A;  2CF4 A;  5I4M A;  4PQA A;  4YFJ A;  2Y0M A;  1JQG A;  2Z3M A;  4H2K A;  4KLW A;  2AFO A;  4MHZ A;  2HUZ A;  4P4B A;  1NSL A;  3RYO A;  3WC7 A;  1Z8W A;  2Z11 A;  1Y7R A;  1GHE A;  3BHX A;  3D3S A;  3PBB A;  3TO7 A;  4PXE A;  2C27 A;  3K9T A;  4NJQ A;  2Z3P A;  5HVH A;  1ELL P;  2H5M A;  1I21 A;  2JDD A;  3QAH A;  4M3S A;  4P4I A;  5F09 A;  1KUY A;  1KUX A;  1NSA A;  2PJ2 A;  4C2Z A;  2ZEE A;  1WK4 A;  3TX8 A;  4ZY0 A;  4PK2 A;  3IEH A;  2J8N A;  1M4I A;  2FIW A;  2GAN A;  2ZEF A;  3F0A A;  4R76 A;  1VHO A;  3WR7 A;  1QSR A;  2GLJ A;  4HNW B;  4MFQ A;  4PK3 A;  2OU2 A;  4EME A;  1Z8L A;  2FIA A;  2I00 A;  1PCA A;  1IYL A;  5A28 A;  1MJ9 A;  2GU2 A;  4ZBG A;  1LFW A;  2ZW7 A;  1LRZ A;  3D2P A;  4TNU A;  4W9Y A;  1IYK A;  2D4P A;  2PJ0 A;  2QEC A;  2G3A A;  4P44 A;  1Y7E A;  4B12 A;  4CGL A;  4MCP A;  4NGT A;  1U6M A;  2PVV A;  4B10 A;  3TT2 A;  4IHM A;  4BD9 A;  5F48 A;  4BBH A;  5LRG A;  3SXN A;  1FT7 A;  3EXN A;  4PXB A;  4AB7 A;  1QSM A;  2X7B A;  3I1U A;  5K8O A;  1IOI A;  1YGH A;  3S9N A;  4CYQ A;  1TKH A;  2PR8 A;  4CS0 B;  2B4B A;  2BO9 A;  1YW6 A;  1YX0 A;  2ZEL A;  1MJB A;  4XPD C;  4TWE A;  2PRB A;  2OOT A;  4M85 A;  4DUK A;  5K8M A;  3LAC A;  1Q2D A;  1VKC A;  2EK8 A;  3LWU A;  5EC4 A;  4K30 A;  1Z5R A;  2CY2 A;  4OLL A;  2QVP A;  3CDX A;  1QMU A;  2AFW A;  2QML A;  4CAX A;  1PYT B;  1XF8 A;  2YNC A;  2JEV A;  3FNC A;  1QSO A;  3BI0 A;  4ZY1 A;  3NE8 A;  3WAB A;  1XEB A;  2EO8 A;  1JWQ A;  4UIB A;  5D8N A;  2FCK A;  1I1D A;  3PGP A;  4RI1 A;  4YWY A;  8CPA A;  4BMH A;  2A4N A;  2PRQ A;  5G1Z A;  4FWU A;  1YVO A;  1UFH A;  3GY9 A;  2PJ4 A;  2ZEH A;  4R57 A;  1BLL E;  2XEG A;  2FXF A;  2WPW A;  3FB3 A;  4H89 A;  1S60 A;  2Q04 A;  2FT0 A;  2Q7S A;  3TO9 A;  3VWD A;  4K3N A;  4P45 A;  6CPA A;  2WPX A;  2ZXV A;  2B5G A;  4FBE A;  4IK2 A;  4II9 A;  1HEE A;  5HVG A;  4MJ8 A;  4A31 A;  1X12 A;  4A30 A;  1CPX A;  3GUX A;  3H8E A;  4LUA A;  3KKW A;  4JXQ A;  4KUA A;  2RB7 A;  3PBE A;  2OZH A;  3RAM A;  3EO4 A;  3DGV A;  1M4G A;  3QNV A;  1Q2C A;  4QC6 A;  2PE3 A;  3IU2 A;  1Y0R A;  3EY5 A;  2P6G A;  4U9Z A;  4KSI A;  4MY3 A;  1DE4 C;  2Z10 A;  2C6C A;  1Z4R A;  4UBR A;  2YNC C;  4KOU A;  2WZN A;  2B3V A;  1CBX A;  2GE3 A;  2VXK A;  4C2X A;  5HH1 A;  2XEF A;  4XNH C;  1S3Z A;  3KQZ A;  1XIX A;  3JTK A;  2XEI A;  1L0C A;  1MJA A;  5E96 A;  2CTC A;  2PCU A;  3G8W A;  4MHN A;  2BSW A;  2J9A A;  4OC4 A;  3TCV A;  4MHD A;  1K4J A;  1IGB A;  3K2K A;  4OAD A;  4OC2 A;  3W6X A;  4CAF A;  1CPS A;  5A27 A;  4KVM E;  1BOB A;  2ATR A;  3PZJ A;  4JD6 A;  2FSR A;  3E0K A;  5KTD A;  2DXQ A;  1KWM A;  5C88 A;  1B6B A;  1TKF A;  2VBQ A;  1TF9 A;  4R7M A;  2IJZ A;  3PFE A;  4RN7 A;  3FEC A;  3MRU A;  5FVJ A;  2OB0 A;  3IWG A;  3LOD A;  2VZZ A;  3R95 A;  4CYO A;  2PR1 A;  3IGR A;  2R8V A;  2PJB A;  4UFX A;  4KZT A;  5IB0 A;  3GIU A;  2VEZ A;  4IAV A;  4UWJ A;  1VIX A;  3IFE A;  4U9Y A;  1R57 A;  2F8H A;  3B35 A;  2ZEG A;  4KVO E;  1XOV A;  4XPL A;  2Q4Z A;  4I49 A;  4KOV A;  4A38 A;  4OID A;  2JBK A;  5I0C A;  2J8R A;  2O53 A;  4CRZ B;  1BO4 A;  3IWE A;  2VI7 A;  3BJ7 A;  2GIV A;  4OP4 A;  4MHY A;  2AFM A;  3LD2 A;  4KOT A;  2POK A;  4GXH A;  4KOY A;  2OZU A;  4ZX8 A;  4OC5 A;  2JBJ A;  2ZW6 A;  1ELM P;  1ARL A;  4CPA A;  1RXT A;  4AVC A;  5K8P A;  4B5P A;  2HV2 A;  1Q2Y A;  4XPD B;  3VAT A;  1S7K A;  4PSX A;  1AYE A;  3BXM A;  3FH4 A;  5F47 A;  2OH1 A;  3DR6 A;  3ZZI A;  5AG5 A;  3MGD A;  4WJB A;  2BOA A;  2PJ1 A;  3D68 A;  4LQ6 A;  4O23 A;  1NMT A;  3KZW A;  3TO6 A;  4CRY B;  1ZLH A;  3W91 A;  1KUV A;  2AFZ A;  3D2M A;  1BPM A;  1A2Z A;  4H6Z A;  4E2A A;  2BL1 A;  1YR0 A;  2Q7B A;  2VL1 A;  2C6P A;  4CYN A;  4QB9 A;  3SJG A;  2DPT A;  4GS4 A;  4UWI A;  2ZEO A;  1BAV A;  1DTD A;  2D4O A;  2J8M A;  1QSN A;  4EVY A;  3D66 A;  4NSQ A;  3NFZ A;  5J1Q A;  2FVG A;  4A94 A;  2Q51 A;  2VZY A;  4R3K A;  3P2H A;  3FX6 A;  1XFO A;  3HLP A;  4C2Y A;  4PXC A;  3DDD A;  1VGY A;  3D7G A;  2CXA A;  3N5F A;  3SJX A;  3V38 A;  4X8I A;  3FJU A;  3S6H A;  1VHS A;  5H86 A;  1Z8X A;  1YVK A;  2EK9 A;  4M6H A;  5IB9 A;  4ZGY B;  3NA6 A;  5HVF A;  1ZG7 A;  1M4L A;  1PU9 A;  1Y9K A;  1Y0Y A;  3HUV A;  4MHP A;  2C6G A;  5JH9 A;  2PC1 A;  4YGO A;  5DS0 A;  1XJO A;  2ARH A;  4ZX9 A;  5F46 A;  1GYT A;  2PIZ A;  4P4D A;  4RS2 A;  4A95 A;  4KOR A;  4R3L A;  2O28 A;  1AUG A;  1XMB A;  3KI9 A;  1F57 A;  4JWP A;  1SQH A;  2PJA A;  3DSB A;  3PP9 A;  2QYV A;  1S7N A;  1P4N A;  4Q7A A;  4ORF A;  3F8K A;  4JLY A;  4UFW A;  2BEI A;  2EBJ A;  3PRT A;  4ZY2 A;  2REE A;  1QST A;  3EFA A;  1CP7 A;  1M44 A;  2QIR A;  4XNH B;  2C1C A;  4MY0 A;  3IWW A;  3VH9 A;  1H8L A;  2PJC A;  3ZJ0 A;  4UIA A;  4F8Z A;  4NGS A;  2HB6 A;  3PB4 X;  2CIJ A;  3FYN A;  1YLO A;  2JDC A;  4OME A;  4P4F A;  1N71 A;  4B11 A;  1AMP A;  3NH5 A;  2OZG A;  2BCO A;  2I79 A;  4M6I A;  2FL4 A;  4PPZ A;  4QUS A;  4F9U A;  4IF5 A;  4ZI6 A;  3NE7 A;  2YGW A;  2EVN A;  3PEI A;  4KOS A;  4MFP A;  5IV0 A;  5KTC A;  3KQX A;  2B5G B;  3RO0 A;  1NE9 A;  4JYW A;  1HDU A;  4NFR A;  4OIW A;  4R87 A;  1R43 A;  1X10 A;  3DLJ A;  4WWV A;  4MFL A;  2PJ8 A;  3F5B A;  2I3C A;  4DNC A;  2PJ5 A;  3BJ8 A;  3IJ3 A;  4A33 A;  2AFX A;  3S6G A;  4CYP A;  1ZG9 A;  2GRE A;  4FUU A;  4A32 A;  2JLM A;  5AGE A;  3LMS A;  5EMI A;  4X2T A;  5CBM A;  4AG9 A;  1M4D A;  3B2Y A;  4R6T A;  5DWM A;  4B5O A;  2AFS A;  3WT4 A;  3IO1 A;  4UA3 A;  3B3W A;  4LQG A;  5CNP A;  3FVL A;  3JUW A;  3ISX A;  3H5Z A;  5BWA B;  3JRU A;  2RFH A;  2JEW A;  5J8C A;  4L8A A;  1S5K A;  4U5Y A;  2ZOF A;  3JVN A;  3H8G A;  5HMN A;  2DF5 A;  3FEE A;  4ZYQ A;  4KOW A;  2CNS A;  2ABZ A;  2CNM A;  2ZW4 A;  3FF3 A;  4NGQ A;  2F7V A;  2PIY A;  4HKF A;  2FS5 A;  3GB0 A;  3SI1 A;  5AG4 A;  2K5T A;  3KGQ A;  4B13 A;  2Z3N A;  4CAE A;  2V8V A;  3D7H A;  1BPN A;  4UCN A;  4NJR A;  3R9G A;  2YNE A;  2PVW A;  2WSA A;  1YRE A;  4MRI A;  1IID A;  2R98 A;  3EC4 A; 
#chains in the Genus database with same CATH homology
 3TE4 A;  3D8P A;  2Q4V A;  1Z4E A;  4AVB A;  4QBJ A;  4CAV A;  4CGP A;  4CGN A;  4FD5 A;  3S6F A;  4B14 A;  2Q44 A;  3P2F A;  4HNY B;  4R9M A;  3TTH A;  4C68 A;  2RC4 A;  4KSA A;  1CJW A;  4AG7 A;  1Z9U A;  5JQ4 A;  2BUE A;  4UCP A;  1CM0 A;  5AG6 A;  1B87 A;  1IB1 E;  2PQ8 A;  4NF1 A;  2Q4Y A;  4MFZ A;  3R1K A;  4B5P B;  4AVA A;  2Z3O A;  2G0B A;  2REF A;  3UY5 A;  4H6U A;  4MFK A;  2WUU A;  1MK4 A;  5IX3 A;  1RO5 A;  3OWC A;  4CAW A;  3FXT A;  3TOB A;  4LX9 A;  2NMT A;  4UCM A;  4ONU A;  4E8O A;  2HQY A;  3R9F A;  4NEX A;  5G21 A;  2EUI A;  4PV6 A;  1ZO0 A;  5G22 A;  4PSW A;  3VWE A;  5GCN A;  4IUS A;  1OZP A;  3GYA A;  3C26 A;  5F49 A;  1KZF A;  3I3G A;  3H4Q A;  4HNX B;  1V0C A;  3FRM A;  3B8G A;  1WWZ A;  5DWN A;  4J3G A;  4C7H A;  3DR8 A;  1TIQ A;  3T90 A;  1M1D A;  2B58 A;  2KCW A;  1Y9W A;  2PSW A;  3CXP A;  3DNS A;  4Y49 B;  3G3S A;  4KVX A;  2R7H A;  3W6S A;  3FBU A;  3A9L A;  3I9S A;  5C82 A;  2AE6 A;  3TOA A;  1PUA A;  2Z3K A;  4FD6 A;  4OAE A;  4Q36 A;  1S7F A;  4UFV A;  3CXS A;  2R1I A;  1XE4 A;  4FD4 A;  4Q38 A;  4KS9 A;  3N7Z A;  2FE7 A;  1ON0 A;  2IL4 A;  2B4D A;  2ZW5 A;  4F0Y A;  5AG7 A;  1YLE A;  3K9U A;  1P0H A;  2Q0Y A;  4Y49 C;  4XPK A;  5G20 A;  3T9Y A;  4MFJ A;  1I12 A;  2VQY A;  1S7L A;  2P6E A;  1YK3 A;  2B4D B;  4JJX A;  4E0A A;  4KUB A;  4KOX A;  4NCZ A;  4KLV A;  2CNT A;  2ZPA A;  4MI4 A;  2YND A;  4L89 A;  4F0X A;  4CGM A;  5KTA A;  5J8F A;  4C7I A;  2AJ6 A;  1J4J A;  3QB8 A;  4CGO A;  1IIC A;  2DPS A;  4MBU A;  3BLN A;  4X5K A;  3GKR A;  2P0W A;  3TFY A;  5JPH A;  2Z0Z A;  2G3T A;  1XMT A;  3R96 A;  3FIX A;  4YRH A;  2P6F A;  3CXQ A;  2B3U A;  3IU1 A;  5EBV A;  5ISV A;  2Z3L A;  1FY7 A;  4KSF A;  4NXY A;  4JXR A;  3R9E A;  3SXO A;  3SHP A;  3S6K A;  5H84 A;  2PDO A;  2F5I A;  4QVT A;  4FD7 A;  3V8I A;  4A2Z A;  4F6A A;  4YFJ A;  2Y0M A;  2Z3M A;  4KLW A;  2HUZ A;  3RYO A;  1NSL A;  2Z11 A;  1Y7R A;  1GHE A;  3D3S A;  3TO7 A;  2C27 A;  2Z3P A;  2H5M A;  1I21 A;  2JDD A;  3QAH A;  4M3S A;  1KUY A;  1KUX A;  4C2Z A;  1WK4 A;  4PK2 A;  2J8N A;  1M4I A;  2FIW A;  2GAN A;  3F0A A;  3WR7 A;  1QSR A;  4MFQ A;  4HNW B;  4PK3 A;  2OU2 A;  2FIA A;  2I00 A;  5A28 A;  1IYL A;  1MJ9 A;  4ZBG A;  2ZW7 A;  1LRZ A;  3D2P A;  1IYK A;  2D4P A;  2QEC A;  2G3A A;  4B12 A;  4CGL A;  1U6M A;  4B10 A;  3TT2 A;  5F48 A;  4BBH A;  3SXN A;  3EXN A;  4AB7 A;  1QSM A;  2X7B A;  1YGH A;  4CYQ A;  2PR8 A;  4CS0 B;  2B4B A;  1YX0 A;  1MJB A;  4XPD C;  2PRB A;  4M85 A;  1Q2D A;  1VKC A;  5EC4 A;  4K30 A;  2CY2 A;  4OLL A;  4CAX A;  2QML A;  1XF8 A;  2YNC A;  2JEV A;  3FNC A;  1QSO A;  1XEB A;  2FCK A;  1I1D A;  3PGP A;  4RI1 A;  4BMH A;  2A4N A;  5G1Z A;  1YVO A;  1UFH A;  3GY9 A;  4R57 A;  4MFL A;  2FXF A;  2WPW A;  3FB3 A;  4H89 A;  1S60 A;  2Q04 A;  2FT0 A;  3TO9 A;  3VWD A;  2WPX A;  2ZXV A;  2B5G A;  4II9 A;  4MJ8 A;  4A31 A;  4A30 A;  4LUA A;  3KKW A;  4JXQ A;  4KUA A;  2OZH A;  3EO4 A;  1M4G A;  1Q2C A;  4QC6 A;  3IU2 A;  3EY5 A;  2P6G A;  4U9Z A;  4MY3 A;  2Z10 A;  1Z4R A;  4UBR A;  2YNC C;  4KOU A;  2B3V A;  4C2X A;  2GE3 A;  2VXK A;  5HH1 A;  4XNH C;  1S3Z A;  1XIX A;  3JTK A;  1L0C A;  1MJA A;  5E96 A;  3G8W A;  2BSW A;  3TCV A;  4MHD A;  1K4J A;  4OAD A;  3W6X A;  4CAF A;  5A27 A;  4KVM E;  1BOB A;  2ATR A;  3PZJ A;  4JD6 A;  2FSR A;  3E0K A;  5KTD A;  2DXQ A;  5C88 A;  1B6B A;  2VBQ A;  5FVJ A;  3IWG A;  2OB0 A;  3LOD A;  2VZZ A;  3R95 A;  4CYO A;  2PR1 A;  3IGR A;  2R8V A;  4UFX A;  4KZT A;  5IB0 A;  4UWJ A;  2VEZ A;  4U9Y A;  1R57 A;  4KVO E;  4XPL A;  5I0C A;  4I49 A;  4KOV A;  2J8R A;  4CRZ B;  1BO4 A;  3IWE A;  2VI7 A;  3BJ7 A;  2GIV A;  3LD2 A;  4KOT A;  4KOY A;  2OZU A;  2ZW6 A;  1RXT A;  4AVC A;  4B5P A;  2HV2 A;  1Q2Y A;  4XPD B;  1S7K A;  4PSX A;  5F47 A;  3ZZI A;  2OH1 A;  3DR6 A;  5AG5 A;  3MGD A;  3TO6 A;  4CRY B;  1NMT A;  3W91 A;  1KUV A;  3D2M A;  4H6Z A;  4E2A A;  2BL1 A;  1YR0 A;  2Q7B A;  4CYN A;  4QB9 A;  2DPT A;  4GS4 A;  4UWI A;  2D4O A;  2J8M A;  1QSN A;  4EVY A;  4NSQ A;  2VZY A;  4R3K A;  3P2H A;  4C2Y A;  3DDD A;  2CXA A;  3S6H A;  1VHS A;  5H86 A;  1YVK A;  4ZGY B;  1PU9 A;  1Y9K A;  2PC1 A;  4YGO A;  2ARH A;  5F46 A;  4RS2 A;  4A95 A;  4KOR A;  4R3L A;  2O28 A;  4JWP A;  5HMN A;  1SQH A;  3DSB A;  3PP9 A;  1S7N A;  1P4N A;  4ORF A;  3F8K A;  4JLY A;  4UFW A;  2BEI A;  2REE A;  1QST A;  3EFA A;  1M44 A;  2QIR A;  4XNH B;  4MY0 A;  3ZJ0 A;  3FYN A;  2JDC A;  4B11 A;  1N71 A;  2OZG A;  2I79 A;  2FL4 A;  4QUS A;  4IF5 A;  3NE7 A;  2YGW A;  2EVN A;  4MFP A;  4KOS A;  5IV0 A;  5KTC A;  2B5G B;  1NE9 A;  4R87 A;  3F5B A;  4DNC A;  3BJ8 A;  4A33 A;  3S6G A;  4CYP A;  4A32 A;  2JLM A;  5AGE A;  4AG9 A;  1M4D A;  5DWM A;  4B5O A;  4UA3 A;  5CNP A;  5BWA B;  3JUW A;  3H5Z A;  5J8C A;  4L8A A;  1S5K A;  4U5Y A;  3JVN A;  4KOW A;  2CNS A;  2CNM A;  2ZW4 A;  4HKF A;  2FS5 A;  5AG4 A;  2K5T A;  4B13 A;  2Z3N A;  4CAE A;  4UCN A;  3R9G A;  2YNE A;  2WSA A;  1YRE A;  1IID A;  2R98 A;  3EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...