1YGHA

Hat domain of gcn5 from saccharomyces cerevisiae
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRANSCRIPTIONAL ACTIVATOR GCN5)
publication title Crystal structure and mechanism of histone acetylation of the yeast GCN5 transcriptional coactivator.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 51
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yghA00
5I0CA 1B87A 1M4DA 4KUBA 4MY3A 1RXTA 4I49A 3R9EA 3PZJA 2VZYA 4AVBA 3FXTA 4R9MA 4CRZB 2PC1A 4QVTA 3FYNA 1XMTA 2Q04A 4E2AA 3GKRA 1I12A 1Z9UA 2I00A 2Q0YA 4B5PA 3IWGA 4KVXA 2VZZA 2B4BA 4R3LA 3DNSA 1KUYA 5J8FA 5E96A 1IIDA 2PRBA 3FIXA 5C88A 1I21A 3R9FA 4UA3A 2G3AA 2Z10A 4KZTA 2BL1A 2REFA 3F8KA 4NF1A 3QAHA 3I3GA 4PK2A 1WWZA 4OAEA 3S6GA 4JXRA 1J4JA 1YK3A 2R1IA 2PDOA 4KVME 1BO4A 2REEA 1U6MA 2K5TA 4R3KA 3DSBA 2CY2A 3DDDA 4FD7A 4ZBGA 1YREA 3G8WA 3EFAA 4F0YA 1S7KA 1NE9A 3R95A 1L0CA 2D4PA 2Q4VA 4Y49B 1S5KA 1I1DA 4B5PB 4XNHB 4ORFA 5F47A 2PR1A 1BOBA 3EC4A 1GHEA 5J8CA 1YX0A 1MJBA 1Q2CA 3DR6A 2A4NA 3R9GA 2B5GA 4PV6A 3TE4A 5H84A 2J8RA 2CNMA 5JQ4A 2EVNA 4Y49C 3E0KA 4QB9A 4AVCA 2BSWA 1RO5A 3B8GA 2HV2A 2JLMA 3SHPA 1MJ9A 4K30A 2DXQA 2OU2A 4AG9A 2Z11A 3FNCA 2ZPAA 4CAXA 1XF8A 4L89A 4KOWA 3F5BA 2Z0ZA 2HQYA 4IF5A 4RS2A 1YR0A 1OZPA 1S7FA 2B58A 2ZW5A 3D8PA 4CAWA 4R87A 4UWIA 5ISVA 3BJ8A 3BJ7A 3EY5A 4YRHA 2OZHA 3G3SA 4FD5A 2B5GB 3TTHA 1Z4EA 2FSRA 1Y9KA 2ARHA 2FT0A 4EVYA 2ATRA 4JJXA 2P6GA 2AE6A 3S6HA 3T9YA 2FIWA 2Q7BA 3UY5A 2HUZA 4AG7A 1Y7RA 3FBUA 4H89A 4H6UA 3D3SA 4FD4A 2J8NA 4X5KA 2P6FA 2FL4A 5F49A 2D4OA 2P0WA 3DR8A 4XPDB 1R57A 2PSWA 2CNSA 4M85A 4L8AA 3QB8A 1Z4RA 4KOSA 3VWDA 4IUSA 2AJ6A 5HMNA 2NMTA 3NE7A 3CXSA 3TOBA 3D2PA 4OLLA 2JDCA 4KOUA 4H6ZA 3RYOA 2X7BA 1IYLA 4XPDC 2FXFA 1YGHA 2PQ8A 4ONUA 2GE3A 3V8IA 4II9A 4KLWA 1MK4A 1M44A 4NSQA 2B4DA 2O28A 2FS5A 3CXQA 2QIRA 3JVNA 3TOAA 4YFJA 4CS0B 3PGPA 2EUIA 3W91A 4MI4A 4LX9A 2B3VA 2RC4A 5JPHA 1ON0A 4QUSA 1K4JA 4XPLA 1QSOA 1MJAA 3F0AA 2B3UA 4XPKA 3IGRA 3GYAA 3TT2A 2J8MA 2Q4YA 1P4NA 2VQYA 4QBJA 1KUXA 1WK4A 2ZW6A 4MBUA 1M4GA 5GCNA 3EO4A 4MY0A 2FIAA 3LD2A 1TIQA 1QSNA 1QSTA 5H86A 4RI1A 1LRZA 2JEVA 5F46A 4AVAA 1YLEA 2OZUA 4KOTA 2P6EA 2B4DB 2ZXVA 4DNCA 5KTDA 3S6KA 2VI7A 3D2MA 1IYKA 4FD6A 1S7LA 2F5IA 1VKCA 3TFYA 2R7HA 4LUAA 1XE4A 5CNPA 2BUEA 4KORA 4E8OA 4KUAA 1SQHA 3JUWA 5IV0A 4CRYB 2R8VA 3T90A 2C27A 1XEBA 1CM0A 3WR7A 1V0CA 3OWCA 4KOVA 3S6FA 1YVKA 1NMTA 5F48A 1M1DA 4U5YA 2Q44A 3N7ZA 5KTCA 3C26A 2JDDA 5KTAA 3TCVA 1Q2DA 1QSMA 4E0AA 3CXPA 2Y0MA 4M3SA 4KLVA 1Y9WA 2IL4A 4JLYA 1PU9A 3P2HA 4KVOE 4R57A 4PSXA 4PK3A 4KOXA 1M4IA 4JWPA 1S3ZA 4NEXA 3TO6A 3P2FA 4HNWB 2OH1A 3ZZIA 4UBRA 3MGDA 2OZGA 3I9SA 2G0BA 1KZFA 4BMHA 4NCZA 1CJWA 3SXNA 4PSWA 2VEZA 3VWEA 3FRMA 4MHDA 5EBVA 3R96A 1YVOA 4YGOA 3W6SA 4UWJA 4MJ8A 1KUVA 1PUAA 2G3TA 2H5MA 2VXKA 3TO7A 5FVJA 3H4QA 1S60A 3EXNA 4U9YA 2R98A 2GIVA 2OB0A 5C82A 2QECA 4J3GA 1P0HA 4JXQA 4GS4A 5DWNA 3ZJ0A 4OADA 5DWMA 4HNXB 3FB3A 2BEIA 2KCWA 3SXOA 2FE7A 3W6XA 3KKWA 1N71A 4U9ZA 4QC6A 3K9UA 5HH1A 3TO9A 4F6AA 1VHSA 2ZW7A 4AB7A 4KOYA 2FCKA 2VBQA 4HKFA 4XNHC 1S7NA 5IX3A 2GANA 2PR8A 1Q2YA 4JD6A 1NSLA 4B5OA 2QMLA 1UFHA 2WPXA 4CAVA 1FY7A 3LODA 1XIXA 5EC4A 5IB0A 3PP9A 2WPWA 4HNYB 1IICA 3R1KA 4NXYA 1IB1E 3GY9A 1B6BA 2CNTA 2ZW4A 1QSRA 3BLNA 2I79A
chains in the Genus database with same CATH superfamily
2Z3PA 4LQ6A 5I0CA 1B87A 1M4DA 2ZEHA 3JRUA 4KUBA 2PJAA 1R43A 4ZYQA 5CPAA 5HVHA 1NSAA 3FVLA 4MY3A 1RXTA 1XBUA 4I49A 3R9EA 3PZJA 2VZYA 3NFZA 1Z8WA 3IO1A 2ZOGA 3IU1A 3CDXA 4AVBA 3FXTA 3KQZA 4R9MA 1LAMA 3SI1A 4BINA 4CRZB 4CGLA 1VHOA 3IJ3A 2PC1A 4QVTA 3TC8A 2PRQA 3FYNA 3B3TA 5AG5A 4A30A 1XMTA 2Q04A 4UEFA 4E2AA 2O53A 3GKRA 1I12A 1Z9UA 2I00A 1CPXA 2YGWA 3WABA 3D68A 1Y0YA 2DEAA 2QVPA 4P4EA 2Q0YA 4B5PA 1HDQA 3FF3A 5D8NA 3IWGA 4KVXA 2VZZA 2WYRA 4R76A 4WWVA 2B4BA 4R3LA 3IWWA 1CG2A 2DPSA 4IK2A 3DNSA 4PPZA 1DE4C 2OR4A 1KUYA 1YW6A 2HB6A 5J8FA 5E96A 2AFMA 1IIDA 3KHZA 3IU2A 3GLJA 2PRBA 3FIXA 3KR4A 4AXVA 1I21A 1CX8A 3R9FA 4B14A 5C88A 3PB8X 3SJGA 2AFUA 4UA3A 2Z3NA 1BAVA 3KI9A 2G3AA 2Z10A 4ZI6A 3JTKA 4KZTA 2BL1A 1PCAA 2REFA 3KL9A 3CPXA 3F8KA 4NF1A 5A28A 3QAHA 4P4FA 5K8OA 2Z3KA 3I3GA 4C2XA 2JBJA 4B13A 2EK8A 1WWZA 4PK2A 4MXUA 4KSAA 2C1CA 4K3NA 4OAEA 4W9YA 5HVGA 3S6GA 2NSMA 4JXRA 4MCSA 5AG4A 1J4JA 3KZWA 4UIBA 1YK3A 2R1IA 2POKA 2PDOA 4KVME 4MFQA 2ZEDA 2ZENA 1BO4A 2REEA 1U6MA 2K5TA 4R3KA 2OOTA 4RUHA 3DSBA 5IB9A 2CY2A 3DDDA 4FD7A 4ZBGA 2PJ7A 1YREA 3PBEA 1VGYA 2V8VA 3G8WA 1IY7A 2IJZA 3VATA 3B7IA 3EFAA 5G20A 4F0YA 1S7KA 3PFEA 1NE9A 1Z5RA 3R95A 1L0CA 2D4PA 4MMOA 2Q4VA 4Y49B 4KSIA 2Q7SA 1I1DA 1S5KA 2QYVA 4B5PB 5K8NA 4XNHB 2Z3MA 4ORFA 2IQ6A 5F47A 3B3VA 4OC4A 2PR1A 1BOBA 4YWYA 4UFVA 3D66A 3EC4A 1GHEA 3D7HA 3FEEA 5J8CA 4F9UA 1YX0A 1MJBA 1Q2CA 3DR6A 2A4NA 3IEHA 2B5GA 3R9GA 4M6HA 4PV6A 3TE4A 3PB7X 2Q43A 5H84A 2CXAA 1TXRA 2J8RA 1HEEA 4B11A 2PCUA 3CT9A 2CNMA 4YU9A 2PVVA 4MFJA 2EVNA 5JQ4A 4Y49C 2ZEPA 3E0KA 3H5ZA 4QB9A 3V38A 4TWEA 4AVCA 2BSWA 1RO5A 1LCPA 2HV2A 2JLMA 2PJ3A 2V8DA 3B8GA 3SHPA 4RN7A 2YNCC 3K9TA 2PJ9A 4BBHA 1LAPA 4C68A 1MJ9A 4K30A 2WUUA 3GIUA 4OC1A 3SJEA 2DXQA 5AG7A 1F57A 5LYFA 2OU2A 2YNEA 4MHNA 1EE3P 4OC3A 4AG9A 2ZEGA 2Z11A 3FNCA 2F7VA 2ZPAA 4TNUA 4ZGYB 3WT4A 2PIZA 4CAXA 1XF8A 4L89A 5THWA 2GU2A 4KOWA 3PRTA 4PXEA 1XOVA 3PB4X 3S9NA 3F5BA 2Z0ZA 3BI1A 4CAFA 4EFDA 1ELMP 2PJ4A 1A2ZA 2HQYA 4IF5A 4P10A 4P4BA 3WC7A 4RS2A 1YR0A 3S9LA 1OZPA 1S7FA 1VHEA 2B58A 2ZW5A 3D8PA 4R87A 5D29A 2DPTA 4MFLA 3RZAA 4CAWA 5EMIA 4UWIA 2CTCA 1CP6A 4NFRA 4UCMA 3BJ8A 3BJ7A 5ISVA 3EY5A 3HLPA 4DUKA 2VL1A 3B35A 4YRHA 2OZHA 5HXDA 1ZG7A 3G3SA 2NYQA 3FH4A 2B5GB 4FD5A 3TTHA 1Z4EA 2FSRA 1Y9KA 2ARHA 2FT0A 4NJRA 4P45A 1QMUA 5G22A 3B2YA 4EVYA 2ATRA 2CF4A 4JJXA 3WC5A 4CGOA 2P6GA 3D7DA 1Z8LA 2AE6A 3S6HA 2BOAA 1IOIA 2FIWA 2PJCA 4MFZA 4KS9A 3MN8A 2Q7BA 3NH8A 2EO8A 3UY5A 1ZLHA 1Q7LA 2HUZA 4AG7A 4WJBA 8CPAA 1Y7RA 1X12A 3FBUA 4ZX8A 3CPAA 2YNCA 4H89A 4H6UA 3D3SA 5G1ZA 4FD4A 4LQGA 4UCPA 2J8NA 4P6YA 2P6FA 4X5KA 4A37A 2FL4A 5F49A 2D4OA 2P0WA 3DR8A 3GUXA 2ZEOA 3KHXA 1R57A 4XPDB 1Z8XA 2ABZA 4OC5A 2PSWA 2CNSA 2XEIA 2XEJA 4M85A 4L8AA 5J1QA 3QB8A 1IGBA 4Q38A 4M6GA 4F8ZA 1Z4RA 4KOSA 4F9VA 2PIYA 3L2NA 3VWDA 4IUSA 2AJ6A 5HMNA 4B6ZA 2NMTA 3NE7A 3CXSA 3TOBA 4CYQA 3D2PA 2WZNA 2C6CA 4OLLA 2JDCA 3T9YA 4KOUA 2YNDA 4H6ZA 4ZY2A 4CPAA 3IC1A 3RYOA 2X7BA 4M6IA 4JZ0A 1IYLA 4ZY1A 2QJ8A 2FXFA 1YGHA 1AUGA 2PQ8A 2GLFA 2BCOA 2PVWA 2GE3A 4ONUA 3N5FA 3V8IA 4II9A 1KWMA 4UIAA 4KLWA 1BPMA 1MK4A 1VIXA 1M44A 3NH4A 3QNVA 4NSQA 2B4DA 4NGRA 1ELLP 4MCQA 4Q7AA 2O28A 2FS5A 4R6TA 4C2ZA 2Q4ZA 3CXQA 2QIRA 3JVNA 3TOAA 4YFJA 4CS0B 3BXMA 1HDUA 4FUUA 4UF4A 4R8FA 1YW4A 3PGPA 4KSFA 4X2TA 1CBXA 3D7FA 2EUIA 4OP4A 3W91A 4A33A 4MI4A 3RAMA 1OBRA 1R3NA 4LX9A 3DGVA 3FECA 2B3VA 2RC4A 3D67A 5JPHA 4FBEA 1ON0A 4P4JA 4QUSA 1K4JA 3VARA 4XPLA 1PYTB 1QSOA 1MJAA 3F0AA 4OKOA 2B3UA 4Q36A 4XPKA 3IGRA 2ZEFA 3SI2A 4OC0A 3GYAA 3TT2A 2J8MA 1CP7A 2Q4YA 1P4NA 2VQYA 4QBJA 1KUXA 3D7GA 4B12A 2PJ1A 1WK4A 3B3CA 2ZW6A 4MBUA 1Z8TA 2JEWA 4MCPA 1M4GA 5A27A 1LANA 2XEGA 5GCNA 3EO4A 1ARLA 4OC2A 3LACA 3NH5A 4MY0A 2FIAA 3LD2A 2GREA 1TIQA 1QSNA 3FEDA 1QSTA 5H86A 4RI1A 1LRZA 2JEVA 4MHPA 2AFWA 5F46A 5AGEA 4AVAA 5LRJA 4O23A 1YLEA 1IU8A 2OZUA 4KOTA 2P6EA 4EMEA 2B4DB 4P44A 2ZXVA 1TKHA 5KTAA 4DNCA 5LRKA 1UWYA 3BHXA 2V8GA 5KTDA 1ARMA 3S6KA 5LYLA 4CYNA 4CAEA 1CPSA 2J9AA 2VI7A 3MRUA 1H8LA 1IYKA 3D2MA 4FD6A 1S7LA 5ELYA 1YQEA 1ZLIA 2F5IA 1VKCA 4C7HA 2EWBA 3TFYA 2R7HA 1YMEA 4LUAA 1XE4A 2RFHA 4NGSA 5CNPA 2BUEA 2PJ6A 2PJ8A 2CTBA 2Q51A 3RO0A 4CGNA 4KORA 1F2PA 4DJLA 4PXDA 4KUAA 1DTDA 4E8OA 5JH9A 1SQHA 3JUWA 4R7MA 1M4LA 1F2OA 5IV0A 4CRYB 4A2ZA 2R8VA 3T90A 3CZXA 4Z65A 2C27A 1XEBA 4XPDC 4PXBA 1CM0A 2XEFA 2ZOFA 4NJQA 5I4MA 2HC9A 3WR7A 1X10A 4CGMA 1V0CA 3I1UA 4EWTA 3OWCA 4KOVA 3S6FA 3D4UA 4F0XA 1FT7A 1YVKA 1NMTA 3K2KA 4A31A 2ANPA 5F48A 5K8PA 1FNOA 1M1DA 3ISXA 4MFKA 2Z3LA 1TF8A 2PJ5A 2Q44A 3N7ZA 4GXHA 4U5YA 3C26A 3PB6X 5KTCA 1XRYA 2JDDA 2F8HA 3ISZA 4MHZA 4NGPA 1Q2DA 3TCVA 3B3SA 1TKJA 2EBJA 3V7ZA 4FAIA 1QSMA 2C6GA 4E0AA 3CXPA 2Y0MA 4M3SA 3KR5A 2ODFA 4CYOA 4KLVA 3LWUA 1Y9WA 2V8HA 4UCNA 1Y7EA 2IL4A 4JLYA 3IFEA 1PU9A 1IOFA 2AFOA 5LRGA 5F09A 3P2HA 3SJFA 7CPAA 4KVOE 5JM6A 4R57A 4PSXA 4BD9A 4PK3A 4KOXA 1M4IA 4JWPA 3HUVA 1S3ZA 2AFSA 3QAYA 3B3WA 5JGFA 4UFWA 4NEXA 3TO6A 2FVGA 3P2FA 4FWUA 3KGQA 4HNWB 2OH1A 3ZZIA 4UBRA 2PE3A 4P4DA 4A95A 3PB9X 3MGDA 2OZGA 3I9SA 3PEIA 2G0BA 4A32A 4ZY0A 1KZFA 3IWEA 4BMHA 4NCZA 1CJWA 1BPNA 3SXNA 4DYOA 4PSWA 2CIJA 2VEZA 3VWEA 4OIWA 1AMPA 3FRMA 2C6PA 4MHDA 1RTQA 4NGNA 5EBVA 3R96A 4MCRA 1YSJA 2I3CA 4MFPA 1Z2LA 3FJUA 4OIDA 2DF5A 1YVOA 3NE8A 4YGOA 3W6SA 4UWJA 1GYTA 1LFWA 2V77A 4MJ8A 1JWQA 1KUVA 1PUAA 2G3TA 4NGTA 4A38A 4JYWA 2H5MA 2AFZA 2VXKA 3TO7A 5FVJA 3H4QA 3KQXA 3PBBA 1S60A 4X3RA 1YLOA 5LYDA 3RBUA 3EXNA 3TX8A 1TF9A 4U9YA 3WC6A 2R98A 2GIVA 2OB0A 4UFXA 3NA6A 5C82A 2QECA 5AG6A 3DLJA 4A94A 4J3GA 1LOKA 4CGPA 2EK9A 4NGQA 1P0HA 2O4HA 4JXQA 4PQAA 4PXCA 3KASA 4GS4A 5DWNA 2PJBA 3SI0A 3ZJ0A 4OADA 4ONWA 5DWMA 3SJXA 2IMOA 3GB0A 1TKFA 3A9LA 3VH9A 4HNXB 4ZX9A 3FB3A 2BEIA 2KCWA 4B10A 4HPSA 4IAVA 2FE7A 1Y0RA 3BI0A 1ZO0A 3SXOA 3W6XA 3KKWA 1ZG8A 1N71A 4U9ZA 3H8EA 3RNZA 4QC6A 3K9UA 5HH1A 3TO9A 3FX6A 2RB7A 5CBMA 1JQGA 4F6AA 1XMBA 1VHSA 4NGMA 1AYEA 2ZW7A 1QQ9A 4G1PA 3S9MA 4AB7A 4MHYA 4KOYA 4H2KA 2FCKA 2VBQA 4P4IA 4C7IA 4HKFA 4GM5A 4X8IA 2Z3OA 5HVFA 4XNHC 3FMCA 5LYIA 5K8MA 1S7NA 2GFQA 2PJ2A 5IX3A 2GANA 2PR8A 1Q2YA 2AFXA 2G9DA 3PFOA 4JD6A 4A39A 4UEZA 1BLLE 1XJOA 2WSAA 1NSLA 3LMSA 2JBKA 4B5OA 5BWAB 4UEEA 2ZEEA 6CPAA 4MRIA 3IIBA 2QMLA 1UFHA 2WPXA 2ZEMA 4CAVA 1FY7A 1XFOA 2PJ0A 5DS0A 3LODA 1XIXA 5EC4A 4C2YA 2GLJA 3PP9A 5IB0A 2WPWA 3H8FA 2BO9A 4HNYB 1IICA 2ZELA 3H8GA 3R1KA 4NXYA 1IB1E 1ZG9A 3GY9A 4IHMA 1B6BA 2CNTA 2ZW4A 4CYPA 1QSRA 3BLNA 2I79A 3T8WA 5G21A 4OMEA
chains in the Genus database with same CATH topology
2Z3PA 5I0CA 1B87A 1M4DA 4KUBA 4MY3A 1RXTA 4I49A 3R9EA 3PZJA 2VZYA 3IU1A 4AVBA 3FXTA 4R9MA 4CRZB 4CGLA 2PC1A 4QVTA 3FYNA 5AG5A 4A30A 1XMTA 2Q04A 4E2AA 3GKRA 1I12A 1Z9UA 2I00A 2YGWA 2Q0YA 4B5PA 3IWGA 4KVXA 2VZZA 2B4BA 4R3LA 2DPSA 3DNSA 1KUYA 5J8FA 5E96A 1IIDA 3IU2A 2PRBA 3FIXA 5C88A 1I21A 3R9FA 4B14A 4UA3A 2Z3NA 2G3AA 2Z10A 3JTKA 4KZTA 2BL1A 2REFA 3F8KA 4NF1A 5A28A 3QAHA 2Z3KA 3I3GA 4C2XA 4B13A 4PK2A 1WWZA 4KSAA 4OAEA 3S6GA 4JXRA 5AG4A 1J4JA 1YK3A 2R1IA 2PDOA 4KVME 4MFQA 1BO4A 2REEA 1U6MA 2K5TA 4R3KA 3DSBA 2CY2A 3DDDA 4FD7A 4ZBGA 1YREA 3G8WA 3EFAA 5G20A 4F0YA 1S7KA 1NE9A 3R95A 1L0CA 2D4PA 2Q4VA 4Y49B 1S5KA 1I1DA 4B5PB 4XNHB 2Z3MA 4ORFA 5F47A 2PR1A 1BOBA 4UFVA 3EC4A 1GHEA 5J8CA 3DR6A 1YX0A 1MJBA 1Q2CA 2A4NA 3R9GA 2B5GA 4PV6A 3TE4A 5H84A 2CXAA 4B11A 2J8RA 2CNMA 4MFJA 2EVNA 5JQ4A 4Y49C 3E0KA 3H5ZA 4QB9A 4AVCA 2BSWA 1RO5A 3B8GA 2HV2A 2JLMA 3SHPA 2YNCC 4BBHA 4C68A 1MJ9A 4K30A 2WUUA 2DXQA 5AG7A 2OU2A 2YNEA 4AG9A 2Z11A 3FNCA 2ZPAA 4ZGYB 4CAXA 1XF8A 4L89A 4KOWA 3F5BA 2Z0ZA 4CAFA 2HQYA 4IF5A 4RS2A 1YR0A 1OZPA 1S7FA 2B58A 2ZW5A 3D8PA 4CAWA 4R87A 2DPTA 4MFLA 4UWIA 4UCMA 5ISVA 3BJ8A 3BJ7A 3EY5A 4YRHA 2OZHA 3G3SA 4FD5A 2B5GB 3TTHA 1Z4EA 2FSRA 1Y9KA 2ARHA 2FT0A 5G22A 4EVYA 2ATRA 4CGOA 4JJXA 2P6GA 2AE6A 3S6HA 4MFZA 2FIWA 3T9YA 2Q7BA 4KS9A 3UY5A 2HUZA 4AG7A 1Y7RA 3FBUA 2YNCA 4H89A 4H6UA 3D3SA 5G1ZA 4FD4A 4UCPA 2J8NA 4X5KA 2P6FA 2FL4A 5F49A 2D4OA 2P0WA 3DR8A 4XPDB 1R57A 2PSWA 2CNSA 4M85A 4L8AA 3QB8A 4Q38A 1Z4RA 4KOSA 3VWDA 4IUSA 2AJ6A 5HMNA 2NMTA 3NE7A 3CXSA 3TOBA 4CYQA 3D2PA 4OLLA 2JDCA 4KOUA 2YNDA 4H6ZA 3RYOA 2X7BA 1IYLA 4XPDC 2FXFA 1YGHA 2PQ8A 4ONUA 2GE3A 3V8IA 4II9A 4KLWA 1MK4A 1M44A 4NSQA 2B4DA 2O28A 2FS5A 4C2ZA 3CXQA 2QIRA 3JVNA 3TOAA 4YFJA 4CS0B 3PGPA 4KSFA 2EUIA 3W91A 4A33A 4MI4A 4LX9A 2B3VA 2RC4A 5JPHA 1ON0A 4QUSA 1K4JA 4XPLA 1QSOA 1MJAA 3F0AA 2B3UA 4Q36A 4XPKA 3IGRA 3GYAA 3TT2A 2J8MA 2Q4YA 1P4NA 2VQYA 4QBJA 1KUXA 4B12A 1WK4A 2ZW6A 4MBUA 1M4GA 5A27A 5GCNA 3EO4A 4MY0A 2FIAA 3LD2A 1TIQA 1QSNA 1QSTA 5H86A 4RI1A 1LRZA 2JEVA 5F46A 5AGEA 4AVAA 1YLEA 2OZUA 4KOTA 2P6EA 2B4DB 2ZXVA 4DNCA 5KTDA 3S6KA 4CYNA 4CAEA 2VI7A 3D2MA 1IYKA 4FD6A 1S7LA 2F5IA 1VKCA 4C7HA 3TFYA 2R7HA 4LUAA 1XE4A 5CNPA 2BUEA 4CGNA 4KORA 4E8OA 4KUAA 1SQHA 3JUWA 5IV0A 4CRYB 4A2ZA 2R8VA 3T90A 2C27A 1XEBA 1CM0A 4CGMA 3WR7A 1V0CA 3OWCA 4KOVA 3S6FA 4F0XA 1YVKA 1NMTA 4A31A 5F48A 1M1DA 4MFKA 2Z3LA 4U5YA 2Q44A 3N7ZA 5KTCA 3C26A 2JDDA 5KTAA 3TCVA 1Q2DA 1QSMA 4E0AA 3CXPA 2Y0MA 4M3SA 4CYOA 4KLVA 1Y9WA 4UCNA 2IL4A 4JLYA 1PU9A 3P2HA 4KVOE 4R57A 4PSXA 4PK3A 4KOXA 1M4IA 4JWPA 1S3ZA 4UFWA 4NEXA 3TO6A 3P2FA 4HNWB 2OH1A 3ZZIA 4UBRA 4A95A 3MGDA 2OZGA 3I9SA 2G0BA 4A32A 1KZFA 3IWEA 4BMHA 4NCZA 1CJWA 3SXNA 4PSWA 2VEZA 3VWEA 3FRMA 4MHDA 5EBVA 3R96A 4MFPA 1YVOA 4YGOA 3W6SA 4UWJA 4MJ8A 1KUVA 1PUAA 2G3TA 2H5MA 2VXKA 3TO7A 5FVJA 3H4QA 1S60A 3EXNA 4U9YA 2R98A 2GIVA 2OB0A 4UFXA 5C82A 2QECA 5AG6A 4CGPA 4J3GA 1P0HA 4JXQA 4GS4A 5DWNA 3ZJ0A 4OADA 5DWMA 3A9LA 4HNXB 3FB3A 2BEIA 2KCWA 4B10A 3SXOA 2FE7A 3W6XA 1ZO0A 3KKWA 1N71A 4U9ZA 4QC6A 3K9UA 5HH1A 3TO9A 4F6AA 1VHSA 2ZW7A 4AB7A 4KOYA 2FCKA 2VBQA 4C7IA 4HKFA 2Z3OA 4XNHC 1S7NA 5IX3A 2GANA 2PR8A 1Q2YA 4JD6A 2WSAA 1NSLA 5BWAB 4B5OA 2QMLA 1UFHA 2WPXA 4CAVA 1FY7A 3LODA 1XIXA 5EC4A 4C2YA 5IB0A 3PP9A 2WPWA 4HNYB 1IICA 3R1KA 4NXYA 1IB1E 3GY9A 1B6BA 2CNTA 2ZW4A 4CYPA 1QSRA 3BLNA 2I79A 5G21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I0C A;  1B87 A;  1M4D A;  4KUB A;  4MY3 A;  1RXT A;  4I49 A;  3R9E A;  3PZJ A;  2VZY A;  4AVB A;  3FXT A;  4R9M A;  4CRZ B;  2PC1 A;  4QVT A;  3FYN A;  1XMT A;  2Q04 A;  4E2A A;  3GKR A;  1I12 A;  1Z9U A;  2I00 A;  2Q0Y A;  4B5P A;  3IWG A;  4KVX A;  2VZZ A;  2B4B A;  4R3L A;  3DNS A;  1KUY A;  5J8F A;  5E96 A;  1IID A;  2PRB A;  3FIX A;  5C88 A;  1I21 A;  3R9F A;  4UA3 A;  2G3A A;  2Z10 A;  4KZT A;  2BL1 A;  2REF A;  3F8K A;  4NF1 A;  3QAH A;  3I3G A;  4PK2 A;  1WWZ A;  4OAE A;  3S6G A;  4JXR A;  1J4J A;  1YK3 A;  2R1I A;  2PDO A;  4KVM E;  1BO4 A;  2REE A;  1U6M A;  2K5T A;  4R3K A;  3DSB A;  2CY2 A;  3DDD A;  4FD7 A;  4ZBG A;  1YRE A;  3G8W A;  3EFA A;  4F0Y A;  1S7K A;  1NE9 A;  3R95 A;  1L0C A;  2D4P A;  2Q4V A;  4Y49 B;  1S5K A;  1I1D A;  4B5P B;  4XNH B;  4ORF A;  5F47 A;  2PR1 A;  1BOB A;  3EC4 A;  1GHE A;  5J8C A;  1YX0 A;  1MJB A;  1Q2C A;  3DR6 A;  2A4N A;  3R9G A;  2B5G A;  4PV6 A;  3TE4 A;  5H84 A;  2J8R A;  2CNM A;  5JQ4 A;  2EVN A;  4Y49 C;  3E0K A;  4QB9 A;  4AVC A;  2BSW A;  1RO5 A;  3B8G A;  2HV2 A;  2JLM A;  3SHP A;  1MJ9 A;  4K30 A;  2DXQ A;  2OU2 A;  4AG9 A;  2Z11 A;  3FNC A;  2ZPA A;  4CAX A;  1XF8 A;  4L89 A;  4KOW A;  3F5B A;  2Z0Z A;  2HQY A;  4IF5 A;  4RS2 A;  1YR0 A;  1OZP A;  1S7F A;  2B58 A;  2ZW5 A;  3D8P A;  4CAW A;  4R87 A;  4UWI A;  5ISV A;  3BJ8 A;  3BJ7 A;  3EY5 A;  4YRH A;  2OZH A;  3G3S A;  4FD5 A;  2B5G B;  3TTH A;  1Z4E A;  2FSR A;  1Y9K A;  2ARH A;  2FT0 A;  4EVY A;  2ATR A;  4JJX A;  2P6G A;  2AE6 A;  3S6H A;  3T9Y A;  2FIW A;  2Q7B A;  3UY5 A;  2HUZ A;  4AG7 A;  1Y7R A;  3FBU A;  4H89 A;  4H6U A;  3D3S A;  4FD4 A;  2J8N A;  4X5K A;  2P6F A;  2FL4 A;  5F49 A;  2D4O A;  2P0W A;  3DR8 A;  4XPD B;  1R57 A;  2PSW A;  2CNS A;  4M85 A;  4L8A A;  3QB8 A;  1Z4R A;  4KOS A;  3VWD A;  4IUS A;  2AJ6 A;  5HMN A;  2NMT A;  3NE7 A;  3CXS A;  3TOB A;  3D2P A;  4OLL A;  2JDC A;  4KOU A;  4H6Z A;  3RYO A;  2X7B A;  1IYL A;  4XPD C;  2FXF A;  1YGH A;  2PQ8 A;  4ONU A;  2GE3 A;  3V8I A;  4II9 A;  4KLW A;  1MK4 A;  1M44 A;  4NSQ A;  2B4D A;  2O28 A;  2FS5 A;  3CXQ A;  2QIR A;  3JVN A;  3TOA A;  4YFJ A;  4CS0 B;  3PGP A;  2EUI A;  3W91 A;  4MI4 A;  4LX9 A;  2B3V A;  2RC4 A;  5JPH A;  1ON0 A;  4QUS A;  1K4J A;  4XPL A;  1QSO A;  1MJA A;  3F0A A;  2B3U A;  4XPK A;  3IGR A;  3GYA A;  3TT2 A;  2J8M A;  2Q4Y A;  1P4N A;  2VQY A;  4QBJ A;  1KUX A;  1WK4 A;  2ZW6 A;  4MBU A;  1M4G A;  5GCN A;  3EO4 A;  4MY0 A;  2FIA A;  3LD2 A;  1TIQ A;  1QSN A;  1QST A;  5H86 A;  4RI1 A;  1LRZ A;  2JEV A;  5F46 A;  4AVA A;  1YLE A;  2OZU A;  4KOT A;  2P6E A;  2B4D B;  2ZXV A;  4DNC A;  5KTD A;  3S6K A;  2VI7 A;  3D2M A;  1IYK A;  4FD6 A;  1S7L A;  2F5I A;  1VKC A;  3TFY A;  2R7H A;  4LUA A;  1XE4 A;  5CNP A;  2BUE A;  4KOR A;  4E8O A;  4KUA A;  1SQH A;  3JUW A;  5IV0 A;  4CRY B;  2R8V A;  3T90 A;  2C27 A;  1XEB A;  1CM0 A;  3WR7 A;  1V0C A;  3OWC A;  4KOV A;  3S6F A;  1YVK A;  1NMT A;  5F48 A;  1M1D A;  4U5Y A;  2Q44 A;  3N7Z A;  5KTC A;  3C26 A;  2JDD A;  5KTA A;  3TCV A;  1Q2D A;  1QSM A;  4E0A A;  3CXP A;  2Y0M A;  4M3S A;  4KLV A;  1Y9W A;  2IL4 A;  4JLY A;  1PU9 A;  3P2H A;  4KVO E;  4R57 A;  4PSX A;  4PK3 A;  4KOX A;  1M4I A;  4JWP A;  1S3Z A;  4NEX A;  3TO6 A;  3P2F A;  4HNW B;  2OH1 A;  3ZZI A;  4UBR A;  3MGD A;  2OZG A;  3I9S A;  2G0B A;  1KZF A;  4BMH A;  4NCZ A;  1CJW A;  3SXN A;  4PSW A;  2VEZ A;  3VWE A;  3FRM A;  4MHD A;  5EBV A;  3R96 A;  1YVO A;  4YGO A;  3W6S A;  4UWJ A;  4MJ8 A;  1KUV A;  1PUA A;  2G3T A;  2H5M A;  2VXK A;  3TO7 A;  5FVJ A;  3H4Q A;  1S60 A;  3EXN A;  4U9Y A;  2R98 A;  2GIV A;  2OB0 A;  5C82 A;  2QEC A;  4J3G A;  1P0H A;  4JXQ A;  4GS4 A;  5DWN A;  3ZJ0 A;  4OAD A;  5DWM A;  4HNX B;  3FB3 A;  2BEI A;  2KCW A;  3SXO A;  2FE7 A;  3W6X A;  3KKW A;  1N71 A;  4U9Z A;  4QC6 A;  3K9U A;  5HH1 A;  3TO9 A;  4F6A A;  1VHS A;  2ZW7 A;  4AB7 A;  4KOY A;  2FCK A;  2VBQ A;  4HKF A;  4XNH C;  1S7N A;  5IX3 A;  2GAN A;  2PR8 A;  1Q2Y A;  4JD6 A;  1NSL A;  4B5O A;  2QML A;  1UFH A;  2WPX A;  4CAV A;  1FY7 A;  3LOD A;  1XIX A;  5EC4 A;  5IB0 A;  3PP9 A;  2WPW A;  4HNY B;  1IIC A;  3R1K A;  4NXY A;  1IB1 E;  3GY9 A;  1B6B A;  2CNT A;  2ZW4 A;  1QSR A;  3BLN A;  2I79 A; 
#chains in the Genus database with same CATH topology
 2Z3P A;  4LQ6 A;  5I0C A;  1B87 A;  1M4D A;  2ZEH A;  3JRU A;  4KUB A;  2PJA A;  1R43 A;  4ZYQ A;  5CPA A;  5HVH A;  1NSA A;  3FVL A;  4MY3 A;  1RXT A;  1XBU A;  4I49 A;  3R9E A;  3PZJ A;  2VZY A;  3NFZ A;  1Z8W A;  3IO1 A;  2ZOG A;  3IU1 A;  3CDX A;  4AVB A;  3FXT A;  3KQZ A;  4R9M A;  1LAM A;  3SI1 A;  4BIN A;  4CRZ B;  4CGL A;  1VHO A;  3IJ3 A;  2PC1 A;  4QVT A;  3TC8 A;  2PRQ A;  3FYN A;  3B3T A;  5AG5 A;  4A30 A;  1XMT A;  2Q04 A;  4UEF A;  4E2A A;  2O53 A;  3GKR A;  1I12 A;  1Z9U A;  2I00 A;  1CPX A;  2YGW A;  3WAB A;  3D68 A;  1Y0Y A;  2DEA A;  2QVP A;  4P4E A;  2Q0Y A;  4B5P A;  1HDQ A;  3FF3 A;  5D8N A;  3IWG A;  4KVX A;  2VZZ A;  2WYR A;  4R76 A;  4WWV A;  2B4B A;  4R3L A;  3IWW A;  1CG2 A;  2DPS A;  4IK2 A;  3DNS A;  4PPZ A;  1DE4 C;  2OR4 A;  1KUY A;  1YW6 A;  2HB6 A;  5J8F A;  5E96 A;  2AFM A;  1IID A;  3KHZ A;  3IU2 A;  3GLJ A;  2PRB A;  3FIX A;  3KR4 A;  4AXV A;  1I21 A;  1CX8 A;  3R9F A;  4B14 A;  5C88 A;  3PB8 X;  3SJG A;  2AFU A;  4UA3 A;  2Z3N A;  1BAV A;  3KI9 A;  2G3A A;  2Z10 A;  4ZI6 A;  3JTK A;  4KZT A;  2BL1 A;  1PCA A;  2REF A;  3KL9 A;  3CPX A;  3F8K A;  4NF1 A;  5A28 A;  3QAH A;  4P4F A;  5K8O A;  2Z3K A;  3I3G A;  4C2X A;  2JBJ A;  4B13 A;  2EK8 A;  1WWZ A;  4PK2 A;  4MXU A;  4KSA A;  2C1C A;  4K3N A;  4OAE A;  4W9Y A;  5HVG A;  3S6G A;  2NSM A;  4JXR A;  4MCS A;  5AG4 A;  1J4J A;  3KZW A;  4UIB A;  1YK3 A;  2R1I A;  2POK A;  2PDO A;  4KVM E;  4MFQ A;  2ZED A;  2ZEN A;  1BO4 A;  2REE A;  1U6M A;  2K5T A;  4R3K A;  2OOT A;  4RUH A;  3DSB A;  5IB9 A;  2CY2 A;  3DDD A;  4FD7 A;  4ZBG A;  2PJ7 A;  1YRE A;  3PBE A;  1VGY A;  2V8V A;  3G8W A;  1IY7 A;  2IJZ A;  3VAT A;  3B7I A;  3EFA A;  5G20 A;  4F0Y A;  1S7K A;  3PFE A;  1NE9 A;  1Z5R A;  3R95 A;  1L0C A;  2D4P A;  4MMO A;  2Q4V A;  4Y49 B;  4KSI A;  2Q7S A;  1I1D A;  1S5K A;  2QYV A;  4B5P B;  5K8N A;  4XNH B;  2Z3M A;  4ORF A;  2IQ6 A;  5F47 A;  3B3V A;  4OC4 A;  2PR1 A;  1BOB A;  4YWY A;  4UFV A;  3D66 A;  3EC4 A;  1GHE A;  3D7H A;  3FEE A;  5J8C A;  4F9U A;  1YX0 A;  1MJB A;  1Q2C A;  3DR6 A;  2A4N A;  3IEH A;  2B5G A;  3R9G A;  4M6H A;  4PV6 A;  3TE4 A;  3PB7 X;  2Q43 A;  5H84 A;  2CXA A;  1TXR A;  2J8R A;  1HEE A;  4B11 A;  2PCU A;  3CT9 A;  2CNM A;  4YU9 A;  2PVV A;  4MFJ A;  2EVN A;  5JQ4 A;  4Y49 C;  2ZEP A;  3E0K A;  3H5Z A;  4QB9 A;  3V38 A;  4TWE A;  4AVC A;  2BSW A;  1RO5 A;  1LCP A;  2HV2 A;  2JLM A;  2PJ3 A;  2V8D A;  3B8G A;  3SHP A;  4RN7 A;  2YNC C;  3K9T A;  2PJ9 A;  4BBH A;  1LAP A;  4C68 A;  1MJ9 A;  4K30 A;  2WUU A;  3GIU A;  4OC1 A;  3SJE A;  2DXQ A;  5AG7 A;  1F57 A;  5LYF A;  2OU2 A;  2YNE A;  4MHN A;  1EE3 P;  4OC3 A;  4AG9 A;  2ZEG A;  2Z11 A;  3FNC A;  2F7V A;  2ZPA A;  4TNU A;  4ZGY B;  3WT4 A;  2PIZ A;  4CAX A;  1XF8 A;  4L89 A;  5THW A;  2GU2 A;  4KOW A;  3PRT A;  4PXE A;  1XOV A;  3PB4 X;  3S9N A;  3F5B A;  2Z0Z A;  3BI1 A;  4CAF A;  4EFD A;  1ELM P;  2PJ4 A;  1A2Z A;  2HQY A;  4IF5 A;  4P10 A;  4P4B A;  3WC7 A;  4RS2 A;  1YR0 A;  3S9L A;  1OZP A;  1S7F A;  1VHE A;  2B58 A;  2ZW5 A;  3D8P A;  4R87 A;  5D29 A;  2DPT A;  4MFL A;  3RZA A;  4CAW A;  5EMI A;  4UWI A;  2CTC A;  1CP6 A;  4NFR A;  4UCM A;  3BJ8 A;  3BJ7 A;  5ISV A;  3EY5 A;  3HLP A;  4DUK A;  2VL1 A;  3B35 A;  4YRH A;  2OZH A;  5HXD A;  1ZG7 A;  3G3S A;  2NYQ A;  3FH4 A;  2B5G B;  4FD5 A;  3TTH A;  1Z4E A;  2FSR A;  1Y9K A;  2ARH A;  2FT0 A;  4NJR A;  4P45 A;  1QMU A;  5G22 A;  3B2Y A;  4EVY A;  2ATR A;  2CF4 A;  4JJX A;  3WC5 A;  4CGO A;  2P6G A;  3D7D A;  1Z8L A;  2AE6 A;  3S6H A;  2BOA A;  1IOI A;  2FIW A;  2PJC A;  4MFZ A;  4KS9 A;  3MN8 A;  2Q7B A;  3NH8 A;  2EO8 A;  3UY5 A;  1ZLH A;  1Q7L A;  2HUZ A;  4AG7 A;  4WJB A;  8CPA A;  1Y7R A;  1X12 A;  3FBU A;  4ZX8 A;  3CPA A;  2YNC A;  4H89 A;  4H6U A;  3D3S A;  5G1Z A;  4FD4 A;  4LQG A;  4UCP A;  2J8N A;  4P6Y A;  2P6F A;  4X5K A;  4A37 A;  2FL4 A;  5F49 A;  2D4O A;  2P0W A;  3DR8 A;  3GUX A;  2ZEO A;  3KHX A;  1R57 A;  4XPD B;  1Z8X A;  2ABZ A;  4OC5 A;  2PSW A;  2CNS A;  2XEI A;  2XEJ A;  4M85 A;  4L8A A;  5J1Q A;  3QB8 A;  1IGB A;  4Q38 A;  4M6G A;  4F8Z A;  1Z4R A;  4KOS A;  4F9V A;  2PIY A;  3L2N A;  3VWD A;  4IUS A;  2AJ6 A;  5HMN A;  4B6Z A;  2NMT A;  3NE7 A;  3CXS A;  3TOB A;  4CYQ A;  3D2P A;  2WZN A;  2C6C A;  4OLL A;  2JDC A;  3T9Y A;  4KOU A;  2YND A;  4H6Z A;  4ZY2 A;  4CPA A;  3IC1 A;  3RYO A;  2X7B A;  4M6I A;  4JZ0 A;  1IYL A;  4ZY1 A;  2QJ8 A;  2FXF A;  1YGH A;  1AUG A;  2PQ8 A;  2GLF A;  2BCO A;  2PVW A;  2GE3 A;  4ONU A;  3N5F A;  3V8I A;  4II9 A;  1KWM A;  4UIA A;  4KLW A;  1BPM A;  1MK4 A;  1VIX A;  1M44 A;  3NH4 A;  3QNV A;  4NSQ A;  2B4D A;  4NGR A;  1ELL P;  4MCQ A;  4Q7A A;  2O28 A;  2FS5 A;  4R6T A;  4C2Z A;  2Q4Z A;  3CXQ A;  2QIR A;  3JVN A;  3TOA A;  4YFJ A;  4CS0 B;  3BXM A;  1HDU A;  4FUU A;  4UF4 A;  4R8F A;  1YW4 A;  3PGP A;  4KSF A;  4X2T A;  1CBX A;  3D7F A;  2EUI A;  4OP4 A;  3W91 A;  4A33 A;  4MI4 A;  3RAM A;  1OBR A;  1R3N A;  4LX9 A;  3DGV A;  3FEC A;  2B3V A;  2RC4 A;  3D67 A;  5JPH A;  4FBE A;  1ON0 A;  4P4J A;  4QUS A;  1K4J A;  3VAR A;  4XPL A;  1PYT B;  1QSO A;  1MJA A;  3F0A A;  4OKO A;  2B3U A;  4Q36 A;  4XPK A;  3IGR A;  2ZEF A;  3SI2 A;  4OC0 A;  3GYA A;  3TT2 A;  2J8M A;  1CP7 A;  2Q4Y A;  1P4N A;  2VQY A;  4QBJ A;  1KUX A;  3D7G A;  4B12 A;  2PJ1 A;  1WK4 A;  3B3C A;  2ZW6 A;  4MBU A;  1Z8T A;  2JEW A;  4MCP A;  1M4G A;  5A27 A;  1LAN A;  2XEG A;  5GCN A;  3EO4 A;  1ARL A;  4OC2 A;  3LAC A;  3NH5 A;  4MY0 A;  2FIA A;  3LD2 A;  2GRE A;  1TIQ A;  1QSN A;  3FED A;  1QST A;  5H86 A;  4RI1 A;  1LRZ A;  2JEV A;  4MHP A;  2AFW A;  5F46 A;  5AGE A;  4AVA A;  5LRJ A;  4O23 A;  1YLE A;  1IU8 A;  2OZU A;  4KOT A;  2P6E A;  4EME A;  2B4D B;  4P44 A;  2ZXV A;  1TKH A;  5KTA A;  4DNC A;  5LRK A;  1UWY A;  3BHX A;  2V8G A;  5KTD A;  1ARM A;  3S6K A;  5LYL A;  4CYN A;  4CAE A;  1CPS A;  2J9A A;  2VI7 A;  3MRU A;  1H8L A;  1IYK A;  3D2M A;  4FD6 A;  1S7L A;  5ELY A;  1YQE A;  1ZLI A;  2F5I A;  1VKC A;  4C7H A;  2EWB A;  3TFY A;  2R7H A;  1YME A;  4LUA A;  1XE4 A;  2RFH A;  4NGS A;  5CNP A;  2BUE A;  2PJ6 A;  2PJ8 A;  2CTB A;  2Q51 A;  3RO0 A;  4CGN A;  4KOR A;  1F2P A;  4DJL A;  4PXD A;  4KUA A;  1DTD A;  4E8O A;  5JH9 A;  1SQH A;  3JUW A;  4R7M A;  1M4L A;  1F2O A;  5IV0 A;  4CRY B;  4A2Z A;  2R8V A;  3T90 A;  3CZX A;  4Z65 A;  2C27 A;  1XEB A;  4XPD C;  4PXB A;  1CM0 A;  2XEF A;  2ZOF A;  4NJQ A;  5I4M A;  2HC9 A;  3WR7 A;  1X10 A;  4CGM A;  1V0C A;  3I1U A;  4EWT A;  3OWC A;  4KOV A;  3S6F A;  3D4U A;  4F0X A;  1FT7 A;  1YVK A;  1NMT A;  3K2K A;  4A31 A;  2ANP A;  5F48 A;  5K8P A;  1FNO A;  1M1D A;  3ISX A;  4MFK A;  2Z3L A;  1TF8 A;  2PJ5 A;  2Q44 A;  3N7Z A;  4GXH A;  4U5Y A;  3C26 A;  3PB6 X;  5KTC A;  1XRY A;  2JDD A;  2F8H A;  3ISZ A;  4MHZ A;  4NGP A;  1Q2D A;  3TCV A;  3B3S A;  1TKJ A;  2EBJ A;  3V7Z A;  4FAI A;  1QSM A;  2C6G A;  4E0A A;  3CXP A;  2Y0M A;  4M3S A;  3KR5 A;  2ODF A;  4CYO A;  4KLV A;  3LWU A;  1Y9W A;  2V8H A;  4UCN A;  1Y7E A;  2IL4 A;  4JLY A;  3IFE A;  1PU9 A;  1IOF A;  2AFO A;  5LRG A;  5F09 A;  3P2H A;  3SJF A;  7CPA A;  4KVO E;  5JM6 A;  4R57 A;  4PSX A;  4BD9 A;  4PK3 A;  4KOX A;  1M4I A;  4JWP A;  3HUV A;  1S3Z A;  2AFS A;  3QAY A;  3B3W A;  5JGF A;  4UFW A;  4NEX A;  3TO6 A;  2FVG A;  3P2F A;  4FWU A;  3KGQ A;  4HNW B;  2OH1 A;  3ZZI A;  4UBR A;  2PE3 A;  4P4D A;  4A95 A;  3PB9 X;  3MGD A;  2OZG A;  3I9S A;  3PEI A;  2G0B A;  4A32 A;  4ZY0 A;  1KZF A;  3IWE A;  4BMH A;  4NCZ A;  1CJW A;  1BPN A;  3SXN A;  4DYO A;  4PSW A;  2CIJ A;  2VEZ A;  3VWE A;  4OIW A;  1AMP A;  3FRM A;  2C6P A;  4MHD A;  1RTQ A;  4NGN A;  5EBV A;  3R96 A;  4MCR A;  1YSJ A;  2I3C A;  4MFP A;  1Z2L A;  3FJU A;  4OID A;  2DF5 A;  1YVO A;  3NE8 A;  4YGO A;  3W6S A;  4UWJ A;  1GYT A;  1LFW A;  2V77 A;  4MJ8 A;  1JWQ A;  1KUV A;  1PUA A;  2G3T A;  4NGT A;  4A38 A;  4JYW A;  2H5M A;  2AFZ A;  2VXK A;  3TO7 A;  5FVJ A;  3H4Q A;  3KQX A;  3PBB A;  1S60 A;  4X3R A;  1YLO A;  5LYD A;  3RBU A;  3EXN A;  3TX8 A;  1TF9 A;  4U9Y A;  3WC6 A;  2R98 A;  2GIV A;  2OB0 A;  4UFX A;  3NA6 A;  5C82 A;  2QEC A;  5AG6 A;  3DLJ A;  4A94 A;  4J3G A;  1LOK A;  4CGP A;  2EK9 A;  4NGQ A;  1P0H A;  2O4H A;  4JXQ A;  4PQA A;  4PXC A;  3KAS A;  4GS4 A;  5DWN A;  2PJB A;  3SI0 A;  3ZJ0 A;  4OAD A;  4ONW A;  5DWM A;  3SJX A;  2IMO A;  3GB0 A;  1TKF A;  3A9L A;  3VH9 A;  4HNX B;  4ZX9 A;  3FB3 A;  2BEI A;  2KCW A;  4B10 A;  4HPS A;  4IAV A;  2FE7 A;  1Y0R A;  3BI0 A;  1ZO0 A;  3SXO A;  3W6X A;  3KKW A;  1ZG8 A;  1N71 A;  4U9Z A;  3H8E A;  3RNZ A;  4QC6 A;  3K9U A;  5HH1 A;  3TO9 A;  3FX6 A;  2RB7 A;  5CBM A;  1JQG A;  4F6A A;  1XMB A;  1VHS A;  4NGM A;  1AYE A;  2ZW7 A;  1QQ9 A;  4G1P A;  3S9M A;  4AB7 A;  4MHY A;  4KOY A;  4H2K A;  2FCK A;  2VBQ A;  4P4I A;  4C7I A;  4HKF A;  4GM5 A;  4X8I A;  2Z3O A;  5HVF A;  4XNH C;  3FMC A;  5LYI A;  5K8M A;  1S7N A;  2GFQ A;  2PJ2 A;  5IX3 A;  2GAN A;  2PR8 A;  1Q2Y A;  2AFX A;  2G9D A;  3PFO A;  4JD6 A;  4A39 A;  4UEZ A;  1BLL E;  1XJO A;  2WSA A;  1NSL A;  3LMS A;  2JBK A;  4B5O A;  5BWA B;  4UEE A;  2ZEE A;  6CPA A;  4MRI A;  3IIB A;  2QML A;  1UFH A;  2WPX A;  2ZEM A;  4CAV A;  1FY7 A;  1XFO A;  2PJ0 A;  5DS0 A;  3LOD A;  1XIX A;  5EC4 A;  4C2Y A;  2GLJ A;  3PP9 A;  5IB0 A;  2WPW A;  3H8F A;  2BO9 A;  4HNY B;  1IIC A;  2ZEL A;  3H8G A;  3R1K A;  4NXY A;  1IB1 E;  1ZG9 A;  3GY9 A;  4IHM A;  1B6B A;  2CNT A;  2ZW4 A;  4CYP A;  1QSR A;  3BLN A;  2I79 A;  3T8W A;  5G21 A;  4OME A; 
#chains in the Genus database with same CATH homology
 2Z3P A;  5I0C A;  1B87 A;  1M4D A;  4KUB A;  4MY3 A;  1RXT A;  4I49 A;  3R9E A;  3PZJ A;  2VZY A;  3IU1 A;  4AVB A;  3FXT A;  4R9M A;  4CRZ B;  4CGL A;  2PC1 A;  4QVT A;  3FYN A;  5AG5 A;  4A30 A;  1XMT A;  2Q04 A;  4E2A A;  3GKR A;  1I12 A;  1Z9U A;  2I00 A;  2YGW A;  2Q0Y A;  4B5P A;  3IWG A;  4KVX A;  2VZZ A;  2B4B A;  4R3L A;  2DPS A;  3DNS A;  1KUY A;  5J8F A;  5E96 A;  1IID A;  3IU2 A;  2PRB A;  3FIX A;  5C88 A;  1I21 A;  3R9F A;  4B14 A;  4UA3 A;  2Z3N A;  2G3A A;  2Z10 A;  3JTK A;  4KZT A;  2BL1 A;  2REF A;  3F8K A;  4NF1 A;  5A28 A;  3QAH A;  2Z3K A;  3I3G A;  4C2X A;  4B13 A;  4PK2 A;  1WWZ A;  4KSA A;  4OAE A;  3S6G A;  4JXR A;  5AG4 A;  1J4J A;  1YK3 A;  2R1I A;  2PDO A;  4KVM E;  4MFQ A;  1BO4 A;  2REE A;  1U6M A;  2K5T A;  4R3K A;  3DSB A;  2CY2 A;  3DDD A;  4FD7 A;  4ZBG A;  1YRE A;  3G8W A;  3EFA A;  5G20 A;  4F0Y A;  1S7K A;  1NE9 A;  3R95 A;  1L0C A;  2D4P A;  2Q4V A;  4Y49 B;  1S5K A;  1I1D A;  4B5P B;  4XNH B;  2Z3M A;  4ORF A;  5F47 A;  2PR1 A;  1BOB A;  4UFV A;  3EC4 A;  1GHE A;  5J8C A;  3DR6 A;  1YX0 A;  1MJB A;  1Q2C A;  2A4N A;  3R9G A;  2B5G A;  4PV6 A;  3TE4 A;  5H84 A;  2CXA A;  4B11 A;  2J8R A;  2CNM A;  4MFJ A;  2EVN A;  5JQ4 A;  4Y49 C;  3E0K A;  3H5Z A;  4QB9 A;  4AVC A;  2BSW A;  1RO5 A;  3B8G A;  2HV2 A;  2JLM A;  3SHP A;  2YNC C;  4BBH A;  4C68 A;  1MJ9 A;  4K30 A;  2WUU A;  2DXQ A;  5AG7 A;  2OU2 A;  2YNE A;  4AG9 A;  2Z11 A;  3FNC A;  2ZPA A;  4ZGY B;  4CAX A;  1XF8 A;  4L89 A;  4KOW A;  3F5B A;  2Z0Z A;  4CAF A;  2HQY A;  4IF5 A;  4RS2 A;  1YR0 A;  1OZP A;  1S7F A;  2B58 A;  2ZW5 A;  3D8P A;  4CAW A;  4R87 A;  2DPT A;  4MFL A;  4UWI A;  4UCM A;  5ISV A;  3BJ8 A;  3BJ7 A;  3EY5 A;  4YRH A;  2OZH A;  3G3S A;  4FD5 A;  2B5G B;  3TTH A;  1Z4E A;  2FSR A;  1Y9K A;  2ARH A;  2FT0 A;  5G22 A;  4EVY A;  2ATR A;  4CGO A;  4JJX A;  2P6G A;  2AE6 A;  3S6H A;  4MFZ A;  2FIW A;  3T9Y A;  2Q7B A;  4KS9 A;  3UY5 A;  2HUZ A;  4AG7 A;  1Y7R A;  3FBU A;  2YNC A;  4H89 A;  4H6U A;  3D3S A;  5G1Z A;  4FD4 A;  4UCP A;  2J8N A;  4X5K A;  2P6F A;  2FL4 A;  5F49 A;  2D4O A;  2P0W A;  3DR8 A;  4XPD B;  1R57 A;  2PSW A;  2CNS A;  4M85 A;  4L8A A;  3QB8 A;  4Q38 A;  1Z4R A;  4KOS A;  3VWD A;  4IUS A;  2AJ6 A;  5HMN A;  2NMT A;  3NE7 A;  3CXS A;  3TOB A;  4CYQ A;  3D2P A;  4OLL A;  2JDC A;  4KOU A;  2YND A;  4H6Z A;  3RYO A;  2X7B A;  1IYL A;  4XPD C;  2FXF A;  1YGH A;  2PQ8 A;  4ONU A;  2GE3 A;  3V8I A;  4II9 A;  4KLW A;  1MK4 A;  1M44 A;  4NSQ A;  2B4D A;  2O28 A;  2FS5 A;  4C2Z A;  3CXQ A;  2QIR A;  3JVN A;  3TOA A;  4YFJ A;  4CS0 B;  3PGP A;  4KSF A;  2EUI A;  3W91 A;  4A33 A;  4MI4 A;  4LX9 A;  2B3V A;  2RC4 A;  5JPH A;  1ON0 A;  4QUS A;  1K4J A;  4XPL A;  1QSO A;  1MJA A;  3F0A A;  2B3U A;  4Q36 A;  4XPK A;  3IGR A;  3GYA A;  3TT2 A;  2J8M A;  2Q4Y A;  1P4N A;  2VQY A;  4QBJ A;  1KUX A;  4B12 A;  1WK4 A;  2ZW6 A;  4MBU A;  1M4G A;  5A27 A;  5GCN A;  3EO4 A;  4MY0 A;  2FIA A;  3LD2 A;  1TIQ A;  1QSN A;  1QST A;  5H86 A;  4RI1 A;  1LRZ A;  2JEV A;  5F46 A;  5AGE A;  4AVA A;  1YLE A;  2OZU A;  4KOT A;  2P6E A;  2B4D B;  2ZXV A;  4DNC A;  5KTD A;  3S6K A;  4CYN A;  4CAE A;  2VI7 A;  3D2M A;  1IYK A;  4FD6 A;  1S7L A;  2F5I A;  1VKC A;  4C7H A;  3TFY A;  2R7H A;  4LUA A;  1XE4 A;  5CNP A;  2BUE A;  4CGN A;  4KOR A;  4E8O A;  4KUA A;  1SQH A;  3JUW A;  5IV0 A;  4CRY B;  4A2Z A;  2R8V A;  3T90 A;  2C27 A;  1XEB A;  1CM0 A;  4CGM A;  3WR7 A;  1V0C A;  3OWC A;  4KOV A;  3S6F A;  4F0X A;  1YVK A;  1NMT A;  4A31 A;  5F48 A;  1M1D A;  4MFK A;  2Z3L A;  4U5Y A;  2Q44 A;  3N7Z A;  5KTC A;  3C26 A;  2JDD A;  5KTA A;  3TCV A;  1Q2D A;  1QSM A;  4E0A A;  3CXP A;  2Y0M A;  4M3S A;  4CYO A;  4KLV A;  1Y9W A;  4UCN A;  2IL4 A;  4JLY A;  1PU9 A;  3P2H A;  4KVO E;  4R57 A;  4PSX A;  4PK3 A;  4KOX A;  1M4I A;  4JWP A;  1S3Z A;  4UFW A;  4NEX A;  3TO6 A;  3P2F A;  4HNW B;  2OH1 A;  3ZZI A;  4UBR A;  4A95 A;  3MGD A;  2OZG A;  3I9S A;  2G0B A;  4A32 A;  1KZF A;  3IWE A;  4BMH A;  4NCZ A;  1CJW A;  3SXN A;  4PSW A;  2VEZ A;  3VWE A;  3FRM A;  4MHD A;  5EBV A;  3R96 A;  4MFP A;  1YVO A;  4YGO A;  3W6S A;  4UWJ A;  4MJ8 A;  1KUV A;  1PUA A;  2G3T A;  2H5M A;  2VXK A;  3TO7 A;  5FVJ A;  3H4Q A;  1S60 A;  3EXN A;  4U9Y A;  2R98 A;  2GIV A;  2OB0 A;  4UFX A;  5C82 A;  2QEC A;  5AG6 A;  4CGP A;  4J3G A;  1P0H A;  4JXQ A;  4GS4 A;  5DWN A;  3ZJ0 A;  4OAD A;  5DWM A;  3A9L A;  4HNX B;  3FB3 A;  2BEI A;  2KCW A;  4B10 A;  3SXO A;  2FE7 A;  3W6X A;  1ZO0 A;  3KKW A;  1N71 A;  4U9Z A;  4QC6 A;  3K9U A;  5HH1 A;  3TO9 A;  4F6A A;  1VHS A;  2ZW7 A;  4AB7 A;  4KOY A;  2FCK A;  2VBQ A;  4C7I A;  4HKF A;  2Z3O A;  4XNH C;  1S7N A;  5IX3 A;  2GAN A;  2PR8 A;  1Q2Y A;  4JD6 A;  2WSA A;  1NSL A;  5BWA B;  4B5O A;  2QML A;  1UFH A;  2WPX A;  4CAV A;  1FY7 A;  3LOD A;  1XIX A;  5EC4 A;  4C2Y A;  5IB0 A;  3PP9 A;  2WPW A;  4HNY B;  1IIC A;  3R1K A;  4NXY A;  1IB1 E;  3GY9 A;  1B6B A;  2CNT A;  2ZW4 A;  4CYP A;  1QSR A;  3BLN A;  2I79 A;  5G21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...