1YGHA

Hat domain of gcn5 from saccharomyces cerevisiae
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
KIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PROTEIN (TRANSCRIPTIONAL ACTIVATOR GCN5)
publication title Crystal structure and mechanism of histone acetylation of the yeast GCN5 transcriptional coactivator.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yghA00
4NEXA 1YREA 4PK3A 2FL4A 3ZJ0A 2EVNA 3TO7A 3T90A 4MJ8A 2BEIA 3FXTA 4M85A 2ZW4A 1Z4RA 2PC1A 4FD5A 2ATRA 3G3SA 3VWEA 4NSQA 2CNSA 1Z9UA 4H89A 3EXNA 3GY9A 4JLYA 2OB0A 1U6MA 4QB9A 2WPXA 4KOXA 4Y49B 2R98A 2Z0ZA 1YLEA 3C26A 3TOBA 2Z10A 4H6ZA 5IX3A 2C27A 1GHEA 2B5GB 2FSRA 3GYAA 5EC4A 4UWJA 2JDDA 2NMTA 4Y49C 1Z4EA 4JWPA 2FT0A 4FD4A 1J4JA 4II9A 2FXFA 2Q4VA 3CXQA 4R87A 5HH1A 4K30A 4DNCA 2R7HA 1I12A 2QMLA 1MJAA 2VQYA 2PRBA 4AG7A 2ARHA 1P0HA 3D2MA 2O28A 4HNXB 4CAVA 4JJXA 4KLVA 2VI7A 3F0AA 1M4IA 1YX0A 2BUEA 2B5GA 2REFA 3DR8A 4PK2A 3BJ7A 1Y7RA 2G3AA 2B4DA 2D4OA 1YVKA 4UWIA 4PSXA 3JUWA 3D8PA 5DWNA 1XMTA 3LODA 1KUXA 4CRZB 3EC4A 4HNYB 5C88A 2P6EA 2K5TA 3P2HA 3T9YA 2Q04A 3ZZIA 3FB3A 4ORFA 3V8IA 3SXOA 2VEZA 4PSWA 2JEVA 2VBQA 3EFAA 1Y9KA 1V0CA 2CNMA 3F8KA 4E8OA 4AG9A 4L8AA 3DSBA 1CJWA 1UFHA 4KUAA 3FBUA 4B5PA 4E2AA 5FVJA 5JPHA 2JDCA 4MHDA 5KTDA 2OU2A 4KOYA 3FRMA 4H6UA 1K4JA 1NMTA 2F5IA 3I3GA 2Q4YA 1QSMA 3TOAA 1M4DA 4UBRA 2QECA 4AVCA 1SQHA 2H5MA 4XNHC 3H4QA 4MBUA 3K9UA 3PZJA 1R57A 4YGOA 5HMNA 4U5YA 3TFYA 2HV2A 1PUAA 1IICA 3SXNA 3S6FA 4JXRA 1M4GA 4HKFA 1CM0A 2GIVA 3R1KA 4IUSA 1I21A 4JXQA 1QSTA 1ON0A 2PR1A 4AVAA 2ZXVA 3CXSA 2FE7A 3S6HA 5F48A 1S5KA 3E0KA 5ISVA 3S6KA 5H84A 1S7NA 1XE4A 4YFJA 2B4DB 4E0AA 4AVBA 2J8NA 3TTHA 4OLLA 3IWGA 3NE7A 5J8FA 3UY5A 4QUSA 4KVOE 3W6SA 2P6GA 4NF1A 2I79A 3PGPA 3WR7A 2PSWA 4UA3A 3TO6A 3PP9A 1XIXA 2G3TA 3TE4A 5H86A 1RXTA 3DR6A 4FD7A 5KTAA 4I49A 1I1DA 4B5PB 4KUBA 4FD6A 3B8GA 4L89A 4KOSA 1QSOA 2B3UA 1LRZA 5IV0A 3R9EA 2GE3A 1MJ9A 2P0WA 1S60A 4RS2A 2Z11A 4KOWA 4CAXA 3QAHA 1VHSA 4F6AA 2Q0YA 5F47A 4KORA 5I0CA 5F49A 2CY2A 4NCZA 4LX9A 1B6BA 4LUAA 4KZTA 4XPDB 4CS0B 1IYLA 3SHPA 1B87A 3W91A 4OADA 4XPDC 4U9YA 4ZBGA 1VKCA 3CXPA 2AJ6A 1IYKA 3P2FA 2R8VA 2B3VA 4XNHB 2R1IA 4JD6A 1L0CA 3MGDA 2FS5A 1BOBA 1PU9A 1MK4A 2B58A 5JQ4A 2Y0MA 5DWMA 5CNPA 2A4NA 3DDDA 4NXYA 3TT2A 4CAWA 3R96A 5C82A 3BLNA 1KZFA 1Y9WA 3D3SA 2VXKA 4RI1A 4U9ZA 2KCWA 3TCVA 2HUZA 1QSNA 4HNWB 3BJ8A 4KOUA 4R3LA 4QC6A 2GANA 4R57A 3JVNA 2J8MA 5IB0A 1FY7A 3R95A 2PDOA 3FNCA 1Q2CA 3FIXA 2JLMA 2BL1A 4R9MA 5EBVA 1NSLA 1IB1E 3N7ZA 4R3KA 2Q7BA 1OZPA 3I9SA 4MY3A 1S7FA 2FCKA 3EY5A 3DNSA 3EO4A 4OAEA 1QSRA 1NE9A 2AE6A 2EUIA 2QIRA 1WWZA 4M3SA 4X5KA 2D4PA 2OH1A 3GKRA 1S3ZA 3RYOA 1KUYA 2ZW5A 2REEA 2X7BA 2G0BA 1Q2YA 2B4BA 2DXQA 2IL4A 3R9FA 5KTCA 1KUVA 2ZW7A 1IIDA 2WPWA 1S7KA 2BSWA 1WK4A 3TO9A 1M44A 4KOTA 4J3GA 3W6XA 2HQYA 4KOVA 2PQ8A 2Q44A 4AB7A 4KVME 2FIAA 4KVXA 4MI4A 1TIQA 1YGHA 2VZYA 2I00A 2ZPAA 3OWCA 1BO4A 2VZZA 3S6GA 2RC4A 2OZGA 1M1DA 4GS4A 5J8CA 2CNTA 1XF8A 4CRYB 3G8WA 1YK3A 4QBJA 1RO5A 4KLWA 1MJBA 1P4NA 3F5BA 4MY0A 3VWDA 3KKWA 2PR8A 3QB8A 3FYNA 3D2PA 1YR0A 3R9GA 4XPKA 2FIWA 2OZUA 4QVTA 5E96A 5GCNA 4BMHA 5F46A 2P6FA 2OZHA 1Q2DA 3IGRA 4XPLA 3LD2A 1YVOA 2J8RA 1S7LA 4ONUA 1XEBA 4PV6A 4YRHA 4IF5A 4EVYA 4F0YA 2ZW6A 4B5OA 1N71A
chains in the Genus database with same CATH superfamily
3SJFA 4NEXA 1YREA 4UEFA 1JQGA 4PK3A 2AFMA 2FL4A 3ZJ0A 1YMEA 2EVNA 1CG2A 3TO7A 2PVVA 3T90A 2PJ8A 3PEIA 4MJ8A 2BEIA 4UFVA 3FXTA 4C7IA 4M85A 4OC3A 2ZW4A 1Z4RA 4PPZA 2PC1A 4FD5A 2Q7SA 2ATRA 3G3SA 1IY7A 3VWEA 4NSQA 2CNSA 1HEEA 4UFXA 1Z9UA 2WUUA 4W9YA 5CBMA 4H89A 1ZG9A 2PE3A 3EXNA 3BXMA 3B2YA 1PCAA 3IIBA 3NE8A 3KI9A 4R76A 3GY9A 3VARA 1IGBA 4JLYA 2OB0A 3SI2A 4R8FA 1U6MA 1XOVA 4QB9A 2WPXA 2EWBA 2ZEEA 1YQEA 3CPXA 3FEEA 4KOXA 2PCUA 2R98A 4Y49B 5EMIA 3FJUA 4A38A 2QYVA 2Z0ZA 1YLEA 4MRIA 4P6YA 3C26A 3TOBA 1BAVA 1IOFA 2EBJA 1VHEA 2Z10A 4H6ZA 1Y7EA 2C27A 3HUVA 1GHEA 2B5GB 2FSRA 3GYAA 4PXBA 5EC4A 4IHMA 4UWJA 2J9AA 2JDDA 2YNDA 4NFRA 2NMTA 4Q7AA 4Y49C 1CX8A 1Z4EA 3BI1A 3CT9A 4JWPA 3HLPA 2CTBA 2FT0A 1XFOA 3CDXA 4KSIA 4FD4A 2Q51A 1HDQA 1M4LA 3ISZA 3WT4A 2YNCC 1J4JA 1TXRA 4II9A 2FXFA 2Q4VA 3KGQA 4A95A 5F09A 3CXQA 4R87A 5HH1A 4K30A 4DNCA 2ZEOA 5HXDA 5LYDA 5DS0A 2QVPA 2R7HA 4UIAA 1I12A 4A39A 4Z65A 4NGSA 2QMLA 3KQXA 4A31A 1MJAA 2VQYA 1Y0RA 1LAPA 2PRBA 4R7MA 4B14A 4PXEA 4FUUA 4AG7A 3KASA 4GM5A 2ARHA 4FBEA 4Q36A 1P0HA 3D2MA 4H2KA 1BPNA 2O28A 4HNXB 3D67A 1VGYA 2OOTA 4MCRA 5AG4A 4P4FA 2F8HA 5CPAA 3CPAA 1LANA 4B6ZA 4UCMA 4AXVA 4CAVA 3KZWA 4JJXA 2GLJA 4KLVA 4UEZA 3V38A 2VI7A 2PJ0A 3B3VA 3B3TA 1BPMA 3FEDA 3F0AA 2YNCA 1M4IA 1YX0A 2BUEA 2B5GA 2REFA 3DR8A 3JRUA 3N5FA 3PB9X 4PK2A 4P10A 2ZEPA 4UCNA 4MHZA 3BJ7A 1Y7RA 2G3AA 4BINA 4CGOA 3CZXA 2B4DA 3QNVA 2D4OA 1YVKA 4M6GA 4UWIA 2FVGA 4PSXA 3JUWA 3D8PA 3MN8A 5DWNA 1XMTA 3LODA 1KUXA 5G20A 4BD9A 1Z8XA 4CRZB 4P4EA 4MFKA 1H8LA 3EC4A 2PJ4A 4HNYB 2ZOGA 1YW4A 3LACA 3NH4A 5C88A 2P6EA 3GUXA 2K5TA 3VH9A 1R3NA 1TF9A 1TKHA 4MFQA 3P2HA 3T9YA 2Q04A 2DPSA 3GB0A 3ZZIA 3FB3A 2PJAA 4ORFA 2JBKA 3V8IA 5K8OA 3SXOA 2VEZA 4PSWA 5A28A 2JEVA 3KL9A 5K8MA 2VBQA 3NH8A 3EFAA 5JGFA 4ZYQA 5THWA 1Y9KA 1YSJA 1V0CA 1FNOA 2CNMA 3F8KA 2PJ2A 4E8OA 4AG9A 2ZOFA 1IOIA 2BOAA 1CJWA 3DSBA 1UFHA 4KUAA 4L8AA 3FBUA 4MHNA 4B5PA 4E2AA 5FVJA 4X2TA 5JPHA 2JDCA 4F9UA 4MHDA 5KTDA 2OU2A 1X12A 4BBHA 1F2OA 2CIJA 4KOYA 3FRMA 3D7GA 4H6UA 3NA6A 1K4JA 1NMTA 2F5IA 3TC8A 1DE4C 3I3GA 1YW6A 3RNZA 2Q4YA 3PB4X 1QSMA 3TOAA 1M4DA 5LYLA 4UBRA 2QJ8A 4KSFA 2QECA 2PIZA 4ZX8A 4AVCA 5IB0A 2V77A 1SQHA 3RZAA 2AFSA 2H5MA 4XNHC 3H4QA 4P4BA 4CYPA 4MBUA 3K9UA 1F2PA 2AFUA 2V8GA 3PZJA 1R57A 1LAMA 2BCOA 3LWUA 4YGOA 5HMNA 4U5YA 3TFYA 2HV2A 1PUAA 1QMUA 1IICA 3SXNA 3S6FA 4B10A 4JXRA 1M4GA 3IC1A 4HKFA 1CM0A 2PJ6A 4R6TA 2GIVA 2WZNA 3WC6A 2ANPA 4NGNA 4C2ZA 3R1KA 4IUSA 6CPAA 1I21A 4JXQA 3WABA 1QSTA 1ON0A 2PR1A 4ZGYB 1X10A 2IMOA 4AVAA 2ZXVA 2C6CA 4F0XA 3CXSA 3D4UA 1F57A 1BLLE 2FE7A 3S6HA 3PB8X 3H5ZA 5F48A 1ZG8A 2WYRA 5J1QA 1S5KA 5A27A 3B3WA 3D7DA 3DLJA 3E0KA 5AG6A 3BI0A 3SI0A 3SJGA 3IO1A 3S6KA 4A32A 4FAIA 5ISVA 5H84A 4C7HA 5I4MA 3DGVA 1S7NA 1XE4A 4KS9A 4YFJA 4TWEA 3K2KA 2B4DB 3H8FA 4E0AA 2XEGA 1OBRA 4AVBA 2J8NA 3TTHA 2CF4A 4OLLA 3S9LA 1IU8A 3IWGA 3NE7A 4A2ZA 8CPAA 4EWTA 5J8FA 5K8NA 1ZG7A 1HDUA 2VL1A 3UY5A 4QUSA 1ELMP 4KVOE 1FT7A 1XRYA 4UCPA 4MHYA 1JWQA 4A94A 3IEHA 4HPSA 3W6SA 2P6GA 4NF1A 4UIBA 5LYIA 2NSMA 2PIYA 4RN7A 2I79A 4P4DA 3PGPA 1Z8LA 3B3CA 2PSWA 3WR7A 4UA3A 3TO6A 1VHOA 2F7VA 2O53A 3PP9A 4CAFA 2XEFA 1XIXA 1RTQA 2G3TA 3TE4A 2XEJA 3ISXA 5H86A 4OKOA 1XMBA 2JEWA 3LMSA 4CYQA 1RXTA 1LCPA 2PJ7A 2RFHA 3DR6A 4IK2A 1NSAA 4FD7A 3RAMA 4AB7A 5KTAA 4MCSA 3FMCA 4G1PA 1I1DA 2GU2A 4I49A 4CYOA 4B5PB 1LFWA 1TF8A 4KUBA 4NJRA 3FH4A 3FECA 2Q4ZA 4FD6A 4FWUA 1KWMA 2IJZA 1LOKA 4ZY1A 3B8GA 2ZENA 4K3NA 4L89A 2DF5A 3PRTA 4PXCA 4KOSA 2ZEGA 1QSOA 3T8WA 2B3UA 3MRUA 1LRZA 5JM6A 5IV0A 3R9EA 2GE3A 1MJ9A 2P0WA 5G21A 4A30A 1CPSA 1S60A 2BO9A 2AFZA 2V8VA 4RS2A 1XJOA 2Z11A 4KOWA 4CGNA 2PJ1A 2ZEDA 3H8EA 5G22A 3BHXA 3TX8A 4CAXA 3QAHA 1VHSA 4A37A 4F6AA 2Q0YA 5F47A 4A33A 4DUKA 4C2XA 4KORA 5I0CA 5F49A 2CY2A 4NCZA 4WJBA 4LX9A 1B6BA 3WC7A 3KHZA 2PJBA 4LUAA 1CP7A 3A9LA 1ZO0A 4KZTA 7CPAA 4XPDB 4CS0B 1IYLA 3SHPA 3FX6A 4NGTA 1GYTA 1B87A 3W91A 4EMEA 4CGPA 4OIWA 5LRKA 4IAVA 2EK9A 4OADA 2ODFA 4XPDC 4U9YA 2HC9A 2XEIA 4F8ZA 2Z3KA 4ZBGA 4ONWA 2PRQA 4KSAA 1VKCA 3CXPA 1PYTB 2Z3MA 2AJ6A 1IYKA 3P2FA 2R8VA 2B3VA 3KHXA 3K9TA 4XNHB 4YWYA 2I3CA 2PJ5A 2R1IA 3IWWA 4JD6A 1ZLHA 1CPXA 1L0CA 2V8HA 2PVWA 3PB7X 3MGDA 1XBUA 2FS5A 2Q43A 1TKJA 3B7IA 4CGLA 2EO8A 1BOBA 1YLOA 1PU9A 4MFJA 5LRJA 1MK4A 5AGEA 2B58A 2CXAA 2ZEFA 4CPAA 4OC0A 5JQ4A 3IJ3A 2Y0MA 5DWMA 4EFDA 4P44A 3IU2A 4PXDA 3PFOA 4MCPA 3PBEA 5CNPA 4B12A 2A4NA 4B13A 4JZ0A 3S9MA 3DDDA 4NXYA 3TT2A 3KR5A 4WWVA 4CAWA 3R96A 5C82A 2Z3PA 3BLNA 1KZFA 1Y9WA 2EK8A 3D3SA 5HVHA 4OC4A 4DJLA 2VXKA 4RI1A 4U9ZA 2RB7A 2KCWA 5D8NA 3TCVA 2HUZA 1QSNA 2DPTA 4HNWB 2OR4A 3BJ8A 4OC5A 1Z5RA 4KOUA 4R3LA 4QC6A 2GANA 4R57A 4MFPA 3JVNA 2Z3OA 2J8MA 1UWYA 4JYWA 1FY7A 4OMEA 3QAYA 3R95A 3RO0A 2PDOA 2GREA 3IU1A 3FNCA 1DTDA 4UFWA 3B3SA 1VIXA 1Q2CA 5AG5A 4M6IA 3FIXA 2JLMA 2BL1A 4R9MA 5EBVA 1NSLA 1IB1E 4P4JA 2C6PA 3I1UA 3N7ZA 4TNUA 4R3KA 3SI1A 2YNEA 3KQZA 4YU9A 2Q7BA 1OZPA 4MFZA 2V8DA 3I9SA 1Z2LA 4MY3A 2IQ6A 1S7FA 4NGQA 3JTKA 4MFLA 2FCKA 3EY5A 3IWEA 3DNSA 4ZI6A 4GXHA 4MCQA 2PJ3A 3EO4A 4OAEA 1QSRA 5AG7A 1Z8WA 2DEAA 1NE9A 4LQ6A 2AE6A 5G1ZA 4M6HA 2EUIA 2Z3NA 2QIRA 1WWZA 1QQ9A 4M3SA 1Y0YA 2D4PA 2OH1A 4X5KA 3GKRA 1S3ZA 3RYOA 4CGMA 4MHPA 3V7ZA 3GLJA 1A2ZA 1KUYA 2ZW5A 3NFZA 2PJ9A 2REEA 2X7BA 4Q38A 2G0BA 1Q2YA 2AFWA 2PJCA 4NGMA 2NYQA 1R43A 2B4BA 2DXQA 4ZY2A 3SJXA 2IL4A 3R9FA 3S9NA 5KTCA 1KUVA 2ZW7A 3WC5A 5LYFA 1IIDA 2WPWA 2C1CA 1S7KA 3VATA 2BSWA 1WK4A 3TO9A 1M44A 4J3GA 4KOTA 3W6XA 2HQYA 4X8IA 4KOVA 2PQ8A 2Q44A 4OC2A 4KVME 3GIUA 4X3RA 2FIAA 2Z3LA 4KVXA 4MI4A 4OC1A 4ZY0A 1TIQA 1YGHA 2VZYA 2I00A 2ZPAA 3OWCA 1BO4A 2VZZA 3PBBA 2RC4A 3S6GA 2OZGA 1M1DA 4GS4A 3H8GA 3L2NA 2O4HA 2ZEHA 4DYOA 5J8CA 4LQGA 4CAEA 2C6GA 2CNTA 1XF8A 3RBUA 4CRYB 4F9VA 3G8WA 4RUHA 2WSAA 1YK3A 3D7FA 1ZLIA 2ABZA 3FF3A 1EE3P 3D7HA 5LRGA 4QBJA 2CTCA 1RO5A 2AFXA 4MXUA 2YGWA 4PQAA 5BWAB 3PFEA 4KLWA 5D29A 5JH9A 2GLFA 2G9DA 4C2YA 1AYEA 1MJBA 1P4NA 3F5BA 3B35A 3FVLA 4MY0A 1Z8TA 1ARMA 1AMPA 3KR4A 4P4IA 3VWDA 3NH5A 2ZELA 5HVFA 2ZEMA 3KKWA 5HVGA 1ARLA 2PR8A 2GFQA 3QB8A 4P45A 3FYNA 3D2PA 4ZX9A 1YR0A 3R9GA 4B11A 4XPKA 5IX3A 4NGPA 4NGRA 2FIWA 1TKFA 4UEEA 2OZUA 4QVTA 5E96A 5GCNA 4BMHA 3D68A 5F46A 4OIDA 4MMOA 1ELLP 2P6FA 2OZHA 1AUGA 1Q2DA 1Q7LA 2JBJA 3IGRA 4UF4A 4XPLA 5ELYA 2HB6A 3PB6X 3LD2A 1YVOA 1CBXA 4C68A 2POKA 1CP6A 2J8RA 3D66A 1S7LA 4ONUA 5K8PA 1XEBA 4PV6A 4YRHA 4IF5A 3IFEA 4O23A 2AFOA 3SJEA 4EVYA 4F0YA 2ZW6A 4B5OA 4CYNA 5IB9A 4OP4A 4NJQA 1N71A
chains in the Genus database with same CATH topology
4NEXA 1YREA 4PK3A 2FL4A 3ZJ0A 2EVNA 3TO7A 3T90A 4MJ8A 2BEIA 4UFVA 3FXTA 4C7IA 4M85A 2ZW4A 1Z4RA 2PC1A 4FD5A 2ATRA 3G3SA 3VWEA 4NSQA 2CNSA 4UFXA 1Z9UA 2WUUA 4H89A 3EXNA 3GY9A 4JLYA 2OB0A 1U6MA 4QB9A 2WPXA 4KOXA 4Y49B 2R98A 2Z0ZA 1YLEA 3C26A 3TOBA 2Z10A 4H6ZA 5IX3A 2C27A 1GHEA 2B5GB 2FSRA 3GYAA 5EC4A 4UWJA 2JDDA 2YNDA 2NMTA 4Y49C 1Z4EA 4JWPA 2FT0A 4FD4A 2YNCC 1J4JA 4II9A 2FXFA 2Q4VA 4A95A 3CXQA 4R87A 5HH1A 4K30A 4DNCA 2R7HA 1I12A 4A31A 2QMLA 1MJAA 2VQYA 2PRBA 4B14A 4AG7A 2ARHA 4Q36A 1P0HA 3D2MA 2O28A 4HNXB 5AG4A 4UCMA 4CAVA 4JJXA 4KLVA 2VI7A 3F0AA 2YNCA 1M4IA 1YX0A 2BUEA 2B5GA 2REFA 3DR8A 4PK2A 4UCNA 3BJ7A 1Y7RA 2G3AA 4CGOA 2B4DA 2D4OA 1YVKA 4UWIA 4PSXA 3JUWA 3D8PA 5DWNA 1XMTA 3LODA 1KUXA 5G20A 4CRZB 4MFKA 3EC4A 4HNYB 5C88A 2P6EA 2K5TA 4MFQA 3P2HA 3T9YA 2Q04A 2DPSA 3ZZIA 3FB3A 4ORFA 3V8IA 3SXOA 2VEZA 4PSWA 5A28A 2JEVA 2VBQA 3EFAA 1Y9KA 1V0CA 2CNMA 3F8KA 4E8OA 4AG9A 4L8AA 3DSBA 1CJWA 1UFHA 4KUAA 3FBUA 4B5PA 4E2AA 5FVJA 5JPHA 2JDCA 4MHDA 5KTDA 2OU2A 4BBHA 4KOYA 3FRMA 4H6UA 1K4JA 1NMTA 2F5IA 3I3GA 2Q4YA 1QSMA 3TOAA 1M4DA 4UBRA 4KSFA 2QECA 4AVCA 1SQHA 2H5MA 4XNHC 3H4QA 4CYPA 4MBUA 3K9UA 3PZJA 1R57A 4YGOA 5HMNA 4U5YA 3TFYA 2HV2A 1PUAA 1IICA 3SXNA 3S6FA 4B10A 4JXRA 1M4GA 4HKFA 1CM0A 4C2ZA 2GIVA 3R1KA 4IUSA 1I21A 4JXQA 1QSTA 1ON0A 2PR1A 4ZGYB 4AVAA 2ZXVA 4F0XA 3CXSA 2FE7A 3S6HA 3H5ZA 5F48A 1S5KA 5A27A 4A32A 3E0KA 5AG6A 5ISVA 3S6KA 5H84A 4C7HA 1S7NA 1XE4A 4KS9A 4YFJA 2B4DB 4E0AA 4AVBA 2J8NA 3TTHA 4OLLA 3IWGA 3NE7A 4A2ZA 5J8FA 3UY5A 4QUSA 4KVOE 4UCPA 3W6SA 2P6GA 4NF1A 2I79A 3PGPA 3WR7A 2PSWA 4UA3A 3TO6A 4CAFA 3PP9A 1XIXA 2G3TA 3TE4A 5H86A 4CYQA 1RXTA 3DR6A 4FD7A 5KTAA 4CYOA 4I49A 1I1DA 4B5PB 4KUBA 4FD6A 3B8GA 4L89A 4KOSA 1QSOA 2B3UA 1LRZA 5IV0A 3R9EA 2GE3A 1MJ9A 2P0WA 5G21A 4A30A 1S60A 4RS2A 2Z11A 4KOWA 4CGNA 5G22A 4CAXA 3QAHA 1VHSA 4F6AA 2Q0YA 5F47A 4A33A 4C2XA 4KORA 5I0CA 5F49A 2CY2A 4NCZA 4LX9A 1B6BA 4LUAA 4KZTA 3A9LA 1ZO0A 4XPDB 4CS0B 1IYLA 3SHPA 1B87A 3W91A 4CGPA 4OADA 4XPDC 4U9YA 2Z3KA 4ZBGA 4KSAA 1VKCA 3CXPA 2Z3MA 2AJ6A 1IYKA 3P2FA 2R8VA 2B3VA 4XNHB 2R1IA 4JD6A 1L0CA 3MGDA 2FS5A 4CGLA 1BOBA 1PU9A 4MFJA 1MK4A 5AGEA 2B58A 2CXAA 5JQ4A 2Y0MA 5DWMA 3IU2A 5CNPA 4B12A 2A4NA 4B13A 3DDDA 4NXYA 3TT2A 4CAWA 3R96A 5C82A 2Z3PA 3BLNA 1KZFA 1Y9WA 3D3SA 2VXKA 4RI1A 4U9ZA 2KCWA 3TCVA 2HUZA 1QSNA 2DPTA 4HNWB 3BJ8A 4KOUA 4R3LA 4QC6A 2GANA 4R57A 4MFPA 3JVNA 2Z3OA 2J8MA 5IB0A 1FY7A 3R95A 2PDOA 3IU1A 3FNCA 4UFWA 1Q2CA 5AG5A 3FIXA 2JLMA 2BL1A 4R9MA 5EBVA 1NSLA 1IB1E 3N7ZA 4R3KA 2YNEA 2Q7BA 1OZPA 4MFZA 3I9SA 4MY3A 1S7FA 3JTKA 4MFLA 2FCKA 3EY5A 3IWEA 3DNSA 3EO4A 4OAEA 1QSRA 5AG7A 1NE9A 2AE6A 5G1ZA 2EUIA 2Z3NA 2QIRA 1WWZA 4M3SA 4X5KA 2D4PA 2OH1A 4CGMA 3GKRA 1S3ZA 3RYOA 1KUYA 2ZW5A 2REEA 2X7BA 4Q38A 2G0BA 1Q2YA 2B4BA 2DXQA 2IL4A 3R9FA 5KTCA 1KUVA 2ZW7A 1IIDA 2WPWA 1S7KA 2BSWA 1WK4A 3TO9A 1M44A 4J3GA 4KOTA 3W6XA 2HQYA 4KOVA 2PQ8A 2Q44A 4AB7A 4KVME 2FIAA 2Z3LA 4KVXA 4MI4A 1TIQA 1YGHA 2VZYA 2I00A 2ZPAA 3OWCA 1BO4A 2VZZA 3S6GA 2RC4A 2OZGA 1M1DA 4GS4A 5J8CA 4CAEA 2CNTA 1XF8A 4CRYB 3G8WA 2WSAA 1YK3A 4QBJA 1RO5A 5BWAB 2YGWA 4KLWA 4C2YA 1MJBA 1P4NA 3F5BA 4MY0A 3VWDA 3KKWA 2PR8A 3QB8A 3FYNA 3D2PA 4B11A 1YR0A 3R9GA 4XPKA 2FIWA 2OZUA 4QVTA 5E96A 5GCNA 4BMHA 5F46A 2P6FA 2OZHA 1Q2DA 3IGRA 4XPLA 3LD2A 1YVOA 4C68A 2J8RA 1S7LA 4ONUA 1XEBA 4PV6A 4YRHA 4IF5A 4EVYA 4F0YA 2ZW6A 4B5OA 4CYNA 1N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEX A;  1YRE A;  4PK3 A;  2FL4 A;  3ZJ0 A;  2EVN A;  3TO7 A;  3T90 A;  4MJ8 A;  2BEI A;  3FXT A;  4M85 A;  2ZW4 A;  1Z4R A;  2PC1 A;  4FD5 A;  2ATR A;  3G3S A;  3VWE A;  4NSQ A;  2CNS A;  1Z9U A;  4H89 A;  3EXN A;  3GY9 A;  4JLY A;  2OB0 A;  1U6M A;  4QB9 A;  2WPX A;  4KOX A;  4Y49 B;  2R98 A;  2Z0Z A;  1YLE A;  3C26 A;  3TOB A;  2Z10 A;  4H6Z A;  5IX3 A;  2C27 A;  1GHE A;  2B5G B;  2FSR A;  3GYA A;  5EC4 A;  4UWJ A;  2JDD A;  2NMT A;  4Y49 C;  1Z4E A;  4JWP A;  2FT0 A;  4FD4 A;  1J4J A;  4II9 A;  2FXF A;  2Q4V A;  3CXQ A;  4R87 A;  5HH1 A;  4K30 A;  4DNC A;  2R7H A;  1I12 A;  2QML A;  1MJA A;  2VQY A;  2PRB A;  4AG7 A;  2ARH A;  1P0H A;  3D2M A;  2O28 A;  4HNX B;  4CAV A;  4JJX A;  4KLV A;  2VI7 A;  3F0A A;  1M4I A;  1YX0 A;  2BUE A;  2B5G A;  2REF A;  3DR8 A;  4PK2 A;  3BJ7 A;  1Y7R A;  2G3A A;  2B4D A;  2D4O A;  1YVK A;  4UWI A;  4PSX A;  3JUW A;  3D8P A;  5DWN A;  1XMT A;  3LOD A;  1KUX A;  4CRZ B;  3EC4 A;  4HNY B;  5C88 A;  2P6E A;  2K5T A;  3P2H A;  3T9Y A;  2Q04 A;  3ZZI A;  3FB3 A;  4ORF A;  3V8I A;  3SXO A;  2VEZ A;  4PSW A;  2JEV A;  2VBQ A;  3EFA A;  1Y9K A;  1V0C A;  2CNM A;  3F8K A;  4E8O A;  4AG9 A;  4L8A A;  3DSB A;  1CJW A;  1UFH A;  4KUA A;  3FBU A;  4B5P A;  4E2A A;  5FVJ A;  5JPH A;  2JDC A;  4MHD A;  5KTD A;  2OU2 A;  4KOY A;  3FRM A;  4H6U A;  1K4J A;  1NMT A;  2F5I A;  3I3G A;  2Q4Y A;  1QSM A;  3TOA A;  1M4D A;  4UBR A;  2QEC A;  4AVC A;  1SQH A;  2H5M A;  4XNH C;  3H4Q A;  4MBU A;  3K9U A;  3PZJ A;  1R57 A;  4YGO A;  5HMN A;  4U5Y A;  3TFY A;  2HV2 A;  1PUA A;  1IIC A;  3SXN A;  3S6F A;  4JXR A;  1M4G A;  4HKF A;  1CM0 A;  2GIV A;  3R1K A;  4IUS A;  1I21 A;  4JXQ A;  1QST A;  1ON0 A;  2PR1 A;  4AVA A;  2ZXV A;  3CXS A;  2FE7 A;  3S6H A;  5F48 A;  1S5K A;  3E0K A;  5ISV A;  3S6K A;  5H84 A;  1S7N A;  1XE4 A;  4YFJ A;  2B4D B;  4E0A A;  4AVB A;  2J8N A;  3TTH A;  4OLL A;  3IWG A;  3NE7 A;  5J8F A;  3UY5 A;  4QUS A;  4KVO E;  3W6S A;  2P6G A;  4NF1 A;  2I79 A;  3PGP A;  3WR7 A;  2PSW A;  4UA3 A;  3TO6 A;  3PP9 A;  1XIX A;  2G3T A;  3TE4 A;  5H86 A;  1RXT A;  3DR6 A;  4FD7 A;  5KTA A;  4I49 A;  1I1D A;  4B5P B;  4KUB A;  4FD6 A;  3B8G A;  4L89 A;  4KOS A;  1QSO A;  2B3U A;  1LRZ A;  5IV0 A;  3R9E A;  2GE3 A;  1MJ9 A;  2P0W A;  1S60 A;  4RS2 A;  2Z11 A;  4KOW A;  4CAX A;  3QAH A;  1VHS A;  4F6A A;  2Q0Y A;  5F47 A;  4KOR A;  5I0C A;  5F49 A;  2CY2 A;  4NCZ A;  4LX9 A;  1B6B A;  4LUA A;  4KZT A;  4XPD B;  4CS0 B;  1IYL A;  3SHP A;  1B87 A;  3W91 A;  4OAD A;  4XPD C;  4U9Y A;  4ZBG A;  1VKC A;  3CXP A;  2AJ6 A;  1IYK A;  3P2F A;  2R8V A;  2B3V A;  4XNH B;  2R1I A;  4JD6 A;  1L0C A;  3MGD A;  2FS5 A;  1BOB A;  1PU9 A;  1MK4 A;  2B58 A;  5JQ4 A;  2Y0M A;  5DWM A;  5CNP A;  2A4N A;  3DDD A;  4NXY A;  3TT2 A;  4CAW A;  3R96 A;  5C82 A;  3BLN A;  1KZF A;  1Y9W A;  3D3S A;  2VXK A;  4RI1 A;  4U9Z A;  2KCW A;  3TCV A;  2HUZ A;  1QSN A;  4HNW B;  3BJ8 A;  4KOU A;  4R3L A;  4QC6 A;  2GAN A;  4R57 A;  3JVN A;  2J8M A;  5IB0 A;  1FY7 A;  3R95 A;  2PDO A;  3FNC A;  1Q2C A;  3FIX A;  2JLM A;  2BL1 A;  4R9M A;  5EBV A;  1NSL A;  1IB1 E;  3N7Z A;  4R3K A;  2Q7B A;  1OZP A;  3I9S A;  4MY3 A;  1S7F A;  2FCK A;  3EY5 A;  3DNS A;  3EO4 A;  4OAE A;  1QSR A;  1NE9 A;  2AE6 A;  2EUI A;  2QIR A;  1WWZ A;  4M3S A;  4X5K A;  2D4P A;  2OH1 A;  3GKR A;  1S3Z A;  3RYO A;  1KUY A;  2ZW5 A;  2REE A;  2X7B A;  2G0B A;  1Q2Y A;  2B4B A;  2DXQ A;  2IL4 A;  3R9F A;  5KTC A;  1KUV A;  2ZW7 A;  1IID A;  2WPW A;  1S7K A;  2BSW A;  1WK4 A;  3TO9 A;  1M44 A;  4KOT A;  4J3G A;  3W6X A;  2HQY A;  4KOV A;  2PQ8 A;  2Q44 A;  4AB7 A;  4KVM E;  2FIA A;  4KVX A;  4MI4 A;  1TIQ A;  1YGH A;  2VZY A;  2I00 A;  2ZPA A;  3OWC A;  1BO4 A;  2VZZ A;  3S6G A;  2RC4 A;  2OZG A;  1M1D A;  4GS4 A;  5J8C A;  2CNT A;  1XF8 A;  4CRY B;  3G8W A;  1YK3 A;  4QBJ A;  1RO5 A;  4KLW A;  1MJB A;  1P4N A;  3F5B A;  4MY0 A;  3VWD A;  3KKW A;  2PR8 A;  3QB8 A;  3FYN A;  3D2P A;  1YR0 A;  3R9G A;  4XPK A;  2FIW A;  2OZU A;  4QVT A;  5E96 A;  5GCN A;  4BMH A;  5F46 A;  2P6F A;  2OZH A;  1Q2D A;  3IGR A;  4XPL A;  3LD2 A;  1YVO A;  2J8R A;  1S7L A;  4ONU A;  1XEB A;  4PV6 A;  4YRH A;  4IF5 A;  4EVY A;  4F0Y A;  2ZW6 A;  4B5O A;  1N71 A; 
#chains in the Genus database with same CATH topology
 3SJF A;  4NEX A;  1YRE A;  4UEF A;  1JQG A;  4PK3 A;  2AFM A;  2FL4 A;  3ZJ0 A;  1YME A;  2EVN A;  1CG2 A;  3TO7 A;  2PVV A;  3T90 A;  2PJ8 A;  3PEI A;  4MJ8 A;  2BEI A;  4UFV A;  3FXT A;  4C7I A;  4M85 A;  4OC3 A;  2ZW4 A;  1Z4R A;  4PPZ A;  2PC1 A;  4FD5 A;  2Q7S A;  2ATR A;  3G3S A;  1IY7 A;  3VWE A;  4NSQ A;  2CNS A;  1HEE A;  4UFX A;  1Z9U A;  2WUU A;  4W9Y A;  5CBM A;  4H89 A;  1ZG9 A;  2PE3 A;  3EXN A;  3BXM A;  3B2Y A;  1PCA A;  3IIB A;  3NE8 A;  3KI9 A;  4R76 A;  3GY9 A;  3VAR A;  1IGB A;  4JLY A;  2OB0 A;  3SI2 A;  4R8F A;  1U6M A;  1XOV A;  4QB9 A;  2WPX A;  2EWB A;  2ZEE A;  1YQE A;  3CPX A;  3FEE A;  4KOX A;  2PCU A;  2R98 A;  4Y49 B;  5EMI A;  3FJU A;  4A38 A;  2QYV A;  2Z0Z A;  1YLE A;  4MRI A;  4P6Y A;  3C26 A;  3TOB A;  1BAV A;  1IOF A;  2EBJ A;  1VHE A;  2Z10 A;  4H6Z A;  1Y7E A;  2C27 A;  3HUV A;  1GHE A;  2B5G B;  2FSR A;  3GYA A;  4PXB A;  5EC4 A;  4IHM A;  4UWJ A;  2J9A A;  2JDD A;  2YND A;  4NFR A;  2NMT A;  4Q7A A;  4Y49 C;  1CX8 A;  1Z4E A;  3BI1 A;  3CT9 A;  4JWP A;  3HLP A;  2CTB A;  2FT0 A;  1XFO A;  3CDX A;  4KSI A;  4FD4 A;  2Q51 A;  1HDQ A;  1M4L A;  3ISZ A;  3WT4 A;  2YNC C;  1J4J A;  1TXR A;  4II9 A;  2FXF A;  2Q4V A;  3KGQ A;  4A95 A;  5F09 A;  3CXQ A;  4R87 A;  5HH1 A;  4K30 A;  4DNC A;  2ZEO A;  5HXD A;  5LYD A;  5DS0 A;  2QVP A;  2R7H A;  4UIA A;  1I12 A;  4A39 A;  4Z65 A;  4NGS A;  2QML A;  3KQX A;  4A31 A;  1MJA A;  2VQY A;  1Y0R A;  1LAP A;  2PRB A;  4R7M A;  4B14 A;  4PXE A;  4FUU A;  4AG7 A;  3KAS A;  4GM5 A;  2ARH A;  4FBE A;  4Q36 A;  1P0H A;  3D2M A;  4H2K A;  1BPN A;  2O28 A;  4HNX B;  3D67 A;  1VGY A;  2OOT A;  4MCR A;  5AG4 A;  4P4F A;  2F8H A;  5CPA A;  3CPA A;  1LAN A;  4B6Z A;  4UCM A;  4AXV A;  4CAV A;  3KZW A;  4JJX A;  2GLJ A;  4KLV A;  4UEZ A;  3V38 A;  2VI7 A;  2PJ0 A;  3B3V A;  3B3T A;  1BPM A;  3FED A;  3F0A A;  2YNC A;  1M4I A;  1YX0 A;  2BUE A;  2B5G A;  2REF A;  3DR8 A;  3JRU A;  3N5F A;  3PB9 X;  4PK2 A;  4P10 A;  2ZEP A;  4UCN A;  4MHZ A;  3BJ7 A;  1Y7R A;  2G3A A;  4BIN A;  4CGO A;  3CZX A;  2B4D A;  3QNV A;  2D4O A;  1YVK A;  4M6G A;  4UWI A;  2FVG A;  4PSX A;  3JUW A;  3D8P A;  3MN8 A;  5DWN A;  1XMT A;  3LOD A;  1KUX A;  5G20 A;  4BD9 A;  1Z8X A;  4CRZ B;  4P4E A;  4MFK A;  1H8L A;  3EC4 A;  2PJ4 A;  4HNY B;  2ZOG A;  1YW4 A;  3LAC A;  3NH4 A;  5C88 A;  2P6E A;  3GUX A;  2K5T A;  3VH9 A;  1R3N A;  1TF9 A;  1TKH A;  4MFQ A;  3P2H A;  3T9Y A;  2Q04 A;  2DPS A;  3GB0 A;  3ZZI A;  3FB3 A;  2PJA A;  4ORF A;  2JBK A;  3V8I A;  5K8O A;  3SXO A;  2VEZ A;  4PSW A;  5A28 A;  2JEV A;  3KL9 A;  5K8M A;  2VBQ A;  3NH8 A;  3EFA A;  5JGF A;  4ZYQ A;  5THW A;  1Y9K A;  1YSJ A;  1V0C A;  1FNO A;  2CNM A;  3F8K A;  2PJ2 A;  4E8O A;  4AG9 A;  2ZOF A;  1IOI A;  2BOA A;  1CJW A;  3DSB A;  1UFH A;  4KUA A;  4L8A A;  3FBU A;  4MHN A;  4B5P A;  4E2A A;  5FVJ A;  4X2T A;  5JPH A;  2JDC A;  4F9U A;  4MHD A;  5KTD A;  2OU2 A;  1X12 A;  4BBH A;  1F2O A;  2CIJ A;  4KOY A;  3FRM A;  3D7G A;  4H6U A;  3NA6 A;  1K4J A;  1NMT A;  2F5I A;  3TC8 A;  1DE4 C;  3I3G A;  1YW6 A;  3RNZ A;  2Q4Y A;  3PB4 X;  1QSM A;  3TOA A;  1M4D A;  5LYL A;  4UBR A;  2QJ8 A;  4KSF A;  2QEC A;  2PIZ A;  4ZX8 A;  4AVC A;  5IB0 A;  2V77 A;  1SQH A;  3RZA A;  2AFS A;  2H5M A;  4XNH C;  3H4Q A;  4P4B A;  4CYP A;  4MBU A;  3K9U A;  1F2P A;  2AFU A;  2V8G A;  3PZJ A;  1R57 A;  1LAM A;  2BCO A;  3LWU A;  4YGO A;  5HMN A;  4U5Y A;  3TFY A;  2HV2 A;  1PUA A;  1QMU A;  1IIC A;  3SXN A;  3S6F A;  4B10 A;  4JXR A;  1M4G A;  3IC1 A;  4HKF A;  1CM0 A;  2PJ6 A;  4R6T A;  2GIV A;  2WZN A;  3WC6 A;  2ANP A;  4NGN A;  4C2Z A;  3R1K A;  4IUS A;  6CPA A;  1I21 A;  4JXQ A;  3WAB A;  1QST A;  1ON0 A;  2PR1 A;  4ZGY B;  1X10 A;  2IMO A;  4AVA A;  2ZXV A;  2C6C A;  4F0X A;  3CXS A;  3D4U A;  1F57 A;  1BLL E;  2FE7 A;  3S6H A;  3PB8 X;  3H5Z A;  5F48 A;  1ZG8 A;  2WYR A;  5J1Q A;  1S5K A;  5A27 A;  3B3W A;  3D7D A;  3DLJ A;  3E0K A;  5AG6 A;  3BI0 A;  3SI0 A;  3SJG A;  3IO1 A;  3S6K A;  4A32 A;  4FAI A;  5ISV A;  5H84 A;  4C7H A;  5I4M A;  3DGV A;  1S7N A;  1XE4 A;  4KS9 A;  4YFJ A;  4TWE A;  3K2K A;  2B4D B;  3H8F A;  4E0A A;  2XEG A;  1OBR A;  4AVB A;  2J8N A;  3TTH A;  2CF4 A;  4OLL A;  3S9L A;  1IU8 A;  3IWG A;  3NE7 A;  4A2Z A;  8CPA A;  4EWT A;  5J8F A;  5K8N A;  1ZG7 A;  1HDU A;  2VL1 A;  3UY5 A;  4QUS A;  1ELM P;  4KVO E;  1FT7 A;  1XRY A;  4UCP A;  4MHY A;  1JWQ A;  4A94 A;  3IEH A;  4HPS A;  3W6S A;  2P6G A;  4NF1 A;  4UIB A;  5LYI A;  2NSM A;  2PIY A;  4RN7 A;  2I79 A;  4P4D A;  3PGP A;  1Z8L A;  3B3C A;  2PSW A;  3WR7 A;  4UA3 A;  3TO6 A;  1VHO A;  2F7V A;  2O53 A;  3PP9 A;  4CAF A;  2XEF A;  1XIX A;  1RTQ A;  2G3T A;  3TE4 A;  2XEJ A;  3ISX A;  5H86 A;  4OKO A;  1XMB A;  2JEW A;  3LMS A;  4CYQ A;  1RXT A;  1LCP A;  2PJ7 A;  2RFH A;  3DR6 A;  4IK2 A;  1NSA A;  4FD7 A;  3RAM A;  4AB7 A;  5KTA A;  4MCS A;  3FMC A;  4G1P A;  1I1D A;  2GU2 A;  4I49 A;  4CYO A;  4B5P B;  1LFW A;  1TF8 A;  4KUB A;  4NJR A;  3FH4 A;  3FEC A;  2Q4Z A;  4FD6 A;  4FWU A;  1KWM A;  2IJZ A;  1LOK A;  4ZY1 A;  3B8G A;  2ZEN A;  4K3N A;  4L89 A;  2DF5 A;  3PRT A;  4PXC A;  4KOS A;  2ZEG A;  1QSO A;  3T8W A;  2B3U A;  3MRU A;  1LRZ A;  5JM6 A;  5IV0 A;  3R9E A;  2GE3 A;  1MJ9 A;  2P0W A;  5G21 A;  4A30 A;  1CPS A;  1S60 A;  2BO9 A;  2AFZ A;  2V8V A;  4RS2 A;  1XJO A;  2Z11 A;  4KOW A;  4CGN A;  2PJ1 A;  2ZED A;  3H8E A;  5G22 A;  3BHX A;  3TX8 A;  4CAX A;  3QAH A;  1VHS A;  4A37 A;  4F6A A;  2Q0Y A;  5F47 A;  4A33 A;  4DUK A;  4C2X A;  4KOR A;  5I0C A;  5F49 A;  2CY2 A;  4NCZ A;  4WJB A;  4LX9 A;  1B6B A;  3WC7 A;  3KHZ A;  2PJB A;  4LUA A;  1CP7 A;  3A9L A;  1ZO0 A;  4KZT A;  7CPA A;  4XPD B;  4CS0 B;  1IYL A;  3SHP A;  3FX6 A;  4NGT A;  1GYT A;  1B87 A;  3W91 A;  4EME A;  4CGP A;  4OIW A;  5LRK A;  4IAV A;  2EK9 A;  4OAD A;  2ODF A;  4XPD C;  4U9Y A;  2HC9 A;  2XEI A;  4F8Z A;  2Z3K A;  4ZBG A;  4ONW A;  2PRQ A;  4KSA A;  1VKC A;  3CXP A;  1PYT B;  2Z3M A;  2AJ6 A;  1IYK A;  3P2F A;  2R8V A;  2B3V A;  3KHX A;  3K9T A;  4XNH B;  4YWY A;  2I3C A;  2PJ5 A;  2R1I A;  3IWW A;  4JD6 A;  1ZLH A;  1CPX A;  1L0C A;  2V8H A;  2PVW A;  3PB7 X;  3MGD A;  1XBU A;  2FS5 A;  2Q43 A;  1TKJ A;  3B7I A;  4CGL A;  2EO8 A;  1BOB A;  1YLO A;  1PU9 A;  4MFJ A;  5LRJ A;  1MK4 A;  5AGE A;  2B58 A;  2CXA A;  2ZEF A;  4CPA A;  4OC0 A;  5JQ4 A;  3IJ3 A;  2Y0M A;  5DWM A;  4EFD A;  4P44 A;  3IU2 A;  4PXD A;  3PFO A;  4MCP A;  3PBE A;  5CNP A;  4B12 A;  2A4N A;  4B13 A;  4JZ0 A;  3S9M A;  3DDD A;  4NXY A;  3TT2 A;  3KR5 A;  4WWV A;  4CAW A;  3R96 A;  5C82 A;  2Z3P A;  3BLN A;  1KZF A;  1Y9W A;  2EK8 A;  3D3S A;  5HVH A;  4OC4 A;  4DJL A;  2VXK A;  4RI1 A;  4U9Z A;  2RB7 A;  2KCW A;  5D8N A;  3TCV A;  2HUZ A;  1QSN A;  2DPT A;  4HNW B;  2OR4 A;  3BJ8 A;  4OC5 A;  1Z5R A;  4KOU A;  4R3L A;  4QC6 A;  2GAN A;  4R57 A;  4MFP A;  3JVN A;  2Z3O A;  2J8M A;  1UWY A;  4JYW A;  1FY7 A;  4OME A;  3QAY A;  3R95 A;  3RO0 A;  2PDO A;  2GRE A;  3IU1 A;  3FNC A;  1DTD A;  4UFW A;  3B3S A;  1VIX A;  1Q2C A;  5AG5 A;  4M6I A;  3FIX A;  2JLM A;  2BL1 A;  4R9M A;  5EBV A;  1NSL A;  1IB1 E;  4P4J A;  2C6P A;  3I1U A;  3N7Z A;  4TNU A;  4R3K A;  3SI1 A;  2YNE A;  3KQZ A;  4YU9 A;  2Q7B A;  1OZP A;  4MFZ A;  2V8D A;  3I9S A;  1Z2L A;  4MY3 A;  2IQ6 A;  1S7F A;  4NGQ A;  3JTK A;  4MFL A;  2FCK A;  3EY5 A;  3IWE A;  3DNS A;  4ZI6 A;  4GXH A;  4MCQ A;  2PJ3 A;  3EO4 A;  4OAE A;  1QSR A;  5AG7 A;  1Z8W A;  2DEA A;  1NE9 A;  4LQ6 A;  2AE6 A;  5G1Z A;  4M6H A;  2EUI A;  2Z3N A;  2QIR A;  1WWZ A;  1QQ9 A;  4M3S A;  1Y0Y A;  2D4P A;  2OH1 A;  4X5K A;  3GKR A;  1S3Z A;  3RYO A;  4CGM A;  4MHP A;  3V7Z A;  3GLJ A;  1A2Z A;  1KUY A;  2ZW5 A;  3NFZ A;  2PJ9 A;  2REE A;  2X7B A;  4Q38 A;  2G0B A;  1Q2Y A;  2AFW A;  2PJC A;  4NGM A;  2NYQ A;  1R43 A;  2B4B A;  2DXQ A;  4ZY2 A;  3SJX A;  2IL4 A;  3R9F A;  3S9N A;  5KTC A;  1KUV A;  2ZW7 A;  3WC5 A;  5LYF A;  1IID A;  2WPW A;  2C1C A;  1S7K A;  3VAT A;  2BSW A;  1WK4 A;  3TO9 A;  1M44 A;  4J3G A;  4KOT A;  3W6X A;  2HQY A;  4X8I A;  4KOV A;  2PQ8 A;  2Q44 A;  4OC2 A;  4KVM E;  3GIU A;  4X3R A;  2FIA A;  2Z3L A;  4KVX A;  4MI4 A;  4OC1 A;  4ZY0 A;  1TIQ A;  1YGH A;  2VZY A;  2I00 A;  2ZPA A;  3OWC A;  1BO4 A;  2VZZ A;  3PBB A;  2RC4 A;  3S6G A;  2OZG A;  1M1D A;  4GS4 A;  3H8G A;  3L2N A;  2O4H A;  2ZEH A;  4DYO A;  5J8C A;  4LQG A;  4CAE A;  2C6G A;  2CNT A;  1XF8 A;  3RBU A;  4CRY B;  4F9V A;  3G8W A;  4RUH A;  2WSA A;  1YK3 A;  3D7F A;  1ZLI A;  2ABZ A;  3FF3 A;  1EE3 P;  3D7H A;  5LRG A;  4QBJ A;  2CTC A;  1RO5 A;  2AFX A;  4MXU A;  2YGW A;  4PQA A;  5BWA B;  3PFE A;  4KLW A;  5D29 A;  5JH9 A;  2GLF A;  2G9D A;  4C2Y A;  1AYE A;  1MJB A;  1P4N A;  3F5B A;  3B35 A;  3FVL A;  4MY0 A;  1Z8T A;  1ARM A;  1AMP A;  3KR4 A;  4P4I A;  3VWD A;  3NH5 A;  2ZEL A;  5HVF A;  2ZEM A;  3KKW A;  5HVG A;  1ARL A;  2PR8 A;  2GFQ A;  3QB8 A;  4P45 A;  3FYN A;  3D2P A;  4ZX9 A;  1YR0 A;  3R9G A;  4B11 A;  4XPK A;  5IX3 A;  4NGP A;  4NGR A;  2FIW A;  1TKF A;  4UEE A;  2OZU A;  4QVT A;  5E96 A;  5GCN A;  4BMH A;  3D68 A;  5F46 A;  4OID A;  4MMO A;  1ELL P;  2P6F A;  2OZH A;  1AUG A;  1Q2D A;  1Q7L A;  2JBJ A;  3IGR A;  4UF4 A;  4XPL A;  5ELY A;  2HB6 A;  3PB6 X;  3LD2 A;  1YVO A;  1CBX A;  4C68 A;  2POK A;  1CP6 A;  2J8R A;  3D66 A;  1S7L A;  4ONU A;  5K8P A;  1XEB A;  4PV6 A;  4YRH A;  4IF5 A;  3IFE A;  4O23 A;  2AFO A;  3SJE A;  4EVY A;  4F0Y A;  2ZW6 A;  4B5O A;  4CYN A;  5IB9 A;  4OP4 A;  4NJQ A;  1N71 A; 
#chains in the Genus database with same CATH homology
 4NEX A;  1YRE A;  4PK3 A;  2FL4 A;  3ZJ0 A;  2EVN A;  3TO7 A;  3T90 A;  4MJ8 A;  2BEI A;  4UFV A;  3FXT A;  4C7I A;  4M85 A;  2ZW4 A;  1Z4R A;  2PC1 A;  4FD5 A;  2ATR A;  3G3S A;  3VWE A;  4NSQ A;  2CNS A;  4UFX A;  1Z9U A;  2WUU A;  4H89 A;  3EXN A;  3GY9 A;  4JLY A;  2OB0 A;  1U6M A;  4QB9 A;  2WPX A;  4KOX A;  4Y49 B;  2R98 A;  2Z0Z A;  1YLE A;  3C26 A;  3TOB A;  2Z10 A;  4H6Z A;  5IX3 A;  2C27 A;  1GHE A;  2B5G B;  2FSR A;  3GYA A;  5EC4 A;  4UWJ A;  2JDD A;  2YND A;  2NMT A;  4Y49 C;  1Z4E A;  4JWP A;  2FT0 A;  4FD4 A;  2YNC C;  1J4J A;  4II9 A;  2FXF A;  2Q4V A;  4A95 A;  3CXQ A;  4R87 A;  5HH1 A;  4K30 A;  4DNC A;  2R7H A;  1I12 A;  4A31 A;  2QML A;  1MJA A;  2VQY A;  2PRB A;  4B14 A;  4AG7 A;  2ARH A;  4Q36 A;  1P0H A;  3D2M A;  2O28 A;  4HNX B;  5AG4 A;  4UCM A;  4CAV A;  4JJX A;  4KLV A;  2VI7 A;  3F0A A;  2YNC A;  1M4I A;  1YX0 A;  2BUE A;  2B5G A;  2REF A;  3DR8 A;  4PK2 A;  4UCN A;  3BJ7 A;  1Y7R A;  2G3A A;  4CGO A;  2B4D A;  2D4O A;  1YVK A;  4UWI A;  4PSX A;  3JUW A;  3D8P A;  5DWN A;  1XMT A;  3LOD A;  1KUX A;  5G20 A;  4CRZ B;  4MFK A;  3EC4 A;  4HNY B;  5C88 A;  2P6E A;  2K5T A;  4MFQ A;  3P2H A;  3T9Y A;  2Q04 A;  2DPS A;  3ZZI A;  3FB3 A;  4ORF A;  3V8I A;  3SXO A;  2VEZ A;  4PSW A;  5A28 A;  2JEV A;  2VBQ A;  3EFA A;  1Y9K A;  1V0C A;  2CNM A;  3F8K A;  4E8O A;  4AG9 A;  4L8A A;  3DSB A;  1CJW A;  1UFH A;  4KUA A;  3FBU A;  4B5P A;  4E2A A;  5FVJ A;  5JPH A;  2JDC A;  4MHD A;  5KTD A;  2OU2 A;  4BBH A;  4KOY A;  3FRM A;  4H6U A;  1K4J A;  1NMT A;  2F5I A;  3I3G A;  2Q4Y A;  1QSM A;  3TOA A;  1M4D A;  4UBR A;  4KSF A;  2QEC A;  4AVC A;  1SQH A;  2H5M A;  4XNH C;  3H4Q A;  4CYP A;  4MBU A;  3K9U A;  3PZJ A;  1R57 A;  4YGO A;  5HMN A;  4U5Y A;  3TFY A;  2HV2 A;  1PUA A;  1IIC A;  3SXN A;  3S6F A;  4B10 A;  4JXR A;  1M4G A;  4HKF A;  1CM0 A;  4C2Z A;  2GIV A;  3R1K A;  4IUS A;  1I21 A;  4JXQ A;  1QST A;  1ON0 A;  2PR1 A;  4ZGY B;  4AVA A;  2ZXV A;  4F0X A;  3CXS A;  2FE7 A;  3S6H A;  3H5Z A;  5F48 A;  1S5K A;  5A27 A;  4A32 A;  3E0K A;  5AG6 A;  5ISV A;  3S6K A;  5H84 A;  4C7H A;  1S7N A;  1XE4 A;  4KS9 A;  4YFJ A;  2B4D B;  4E0A A;  4AVB A;  2J8N A;  3TTH A;  4OLL A;  3IWG A;  3NE7 A;  4A2Z A;  5J8F A;  3UY5 A;  4QUS A;  4KVO E;  4UCP A;  3W6S A;  2P6G A;  4NF1 A;  2I79 A;  3PGP A;  3WR7 A;  2PSW A;  4UA3 A;  3TO6 A;  4CAF A;  3PP9 A;  1XIX A;  2G3T A;  3TE4 A;  5H86 A;  4CYQ A;  1RXT A;  3DR6 A;  4FD7 A;  5KTA A;  4CYO A;  4I49 A;  1I1D A;  4B5P B;  4KUB A;  4FD6 A;  3B8G A;  4L89 A;  4KOS A;  1QSO A;  2B3U A;  1LRZ A;  5IV0 A;  3R9E A;  2GE3 A;  1MJ9 A;  2P0W A;  5G21 A;  4A30 A;  1S60 A;  4RS2 A;  2Z11 A;  4KOW A;  4CGN A;  5G22 A;  4CAX A;  3QAH A;  1VHS A;  4F6A A;  2Q0Y A;  5F47 A;  4A33 A;  4C2X A;  4KOR A;  5I0C A;  5F49 A;  2CY2 A;  4NCZ A;  4LX9 A;  1B6B A;  4LUA A;  4KZT A;  3A9L A;  1ZO0 A;  4XPD B;  4CS0 B;  1IYL A;  3SHP A;  1B87 A;  3W91 A;  4CGP A;  4OAD A;  4XPD C;  4U9Y A;  2Z3K A;  4ZBG A;  4KSA A;  1VKC A;  3CXP A;  2Z3M A;  2AJ6 A;  1IYK A;  3P2F A;  2R8V A;  2B3V A;  4XNH B;  2R1I A;  4JD6 A;  1L0C A;  3MGD A;  2FS5 A;  4CGL A;  1BOB A;  1PU9 A;  4MFJ A;  1MK4 A;  5AGE A;  2B58 A;  2CXA A;  5JQ4 A;  2Y0M A;  5DWM A;  3IU2 A;  5CNP A;  4B12 A;  2A4N A;  4B13 A;  3DDD A;  4NXY A;  3TT2 A;  4CAW A;  3R96 A;  5C82 A;  2Z3P A;  3BLN A;  1KZF A;  1Y9W A;  3D3S A;  2VXK A;  4RI1 A;  4U9Z A;  2KCW A;  3TCV A;  2HUZ A;  1QSN A;  2DPT A;  4HNW B;  3BJ8 A;  4KOU A;  4R3L A;  4QC6 A;  2GAN A;  4R57 A;  4MFP A;  3JVN A;  2Z3O A;  2J8M A;  5IB0 A;  1FY7 A;  3R95 A;  2PDO A;  3IU1 A;  3FNC A;  4UFW A;  1Q2C A;  5AG5 A;  3FIX A;  2JLM A;  2BL1 A;  4R9M A;  5EBV A;  1NSL A;  1IB1 E;  3N7Z A;  4R3K A;  2YNE A;  2Q7B A;  1OZP A;  4MFZ A;  3I9S A;  4MY3 A;  1S7F A;  3JTK A;  4MFL A;  2FCK A;  3EY5 A;  3IWE A;  3DNS A;  3EO4 A;  4OAE A;  1QSR A;  5AG7 A;  1NE9 A;  2AE6 A;  5G1Z A;  2EUI A;  2Z3N A;  2QIR A;  1WWZ A;  4M3S A;  4X5K A;  2D4P A;  2OH1 A;  4CGM A;  3GKR A;  1S3Z A;  3RYO A;  1KUY A;  2ZW5 A;  2REE A;  2X7B A;  4Q38 A;  2G0B A;  1Q2Y A;  2B4B A;  2DXQ A;  2IL4 A;  3R9F A;  5KTC A;  1KUV A;  2ZW7 A;  1IID A;  2WPW A;  1S7K A;  2BSW A;  1WK4 A;  3TO9 A;  1M44 A;  4J3G A;  4KOT A;  3W6X A;  2HQY A;  4KOV A;  2PQ8 A;  2Q44 A;  4AB7 A;  4KVM E;  2FIA A;  2Z3L A;  4KVX A;  4MI4 A;  1TIQ A;  1YGH A;  2VZY A;  2I00 A;  2ZPA A;  3OWC A;  1BO4 A;  2VZZ A;  3S6G A;  2RC4 A;  2OZG A;  1M1D A;  4GS4 A;  5J8C A;  4CAE A;  2CNT A;  1XF8 A;  4CRY B;  3G8W A;  2WSA A;  1YK3 A;  4QBJ A;  1RO5 A;  5BWA B;  2YGW A;  4KLW A;  4C2Y A;  1MJB A;  1P4N A;  3F5B A;  4MY0 A;  3VWD A;  3KKW A;  2PR8 A;  3QB8 A;  3FYN A;  3D2P A;  4B11 A;  1YR0 A;  3R9G A;  4XPK A;  2FIW A;  2OZU A;  4QVT A;  5E96 A;  5GCN A;  4BMH A;  5F46 A;  2P6F A;  2OZH A;  1Q2D A;  3IGR A;  4XPL A;  3LD2 A;  1YVO A;  4C68 A;  2J8R A;  1S7L A;  4ONU A;  1XEB A;  4PV6 A;  4YRH A;  4IF5 A;  4EVY A;  4F0Y A;  2ZW6 A;  4B5O A;  4CYN A;  1N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...