2HUZA

Crystal structure of gnpnat1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glucosamine-phosphate N-acetyltransferase 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
total genus 41
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2huzA01
3V8IA 1R57A 1XF8A 2Q0YA 4XPKA 1YVOA 5KTCA 1QSTA 1S7FA 3H4QA 4GS4A 2ZW6A 4JXRA 4B5PA 5GCNA 3DNSA 1WWZA 4JWPA 4II9A 1IYLA 1VKCA 5EBVA 4QBJA 2R8VA 3W91A 1WK4A 4M3SA 3PZJA 2B58A 4I49A 1BO4A 1YVKA 4E2AA 3F5BA 3CXQA 5IV0A 3D2PA 3D8PA 5C88A 2EUIA 3BJ8A 2FIWA 4B5PB 1IIDA 1Z4EA 5I0CA 3DDDA 4PV6A 3RYOA 4XNHC 2BL1A 1NE9A 4MBUA 4R3KA 2P0WA 1Y9KA 1YGHA 2FXFA 3P2FA 4KOWA 1QSOA 2J8NA 4M85A 2J8MA 1XIXA 2Q4YA 1IB1E 4XPDB 4AG9A 5J8FA 4KUAA 3TO7A 2Z0ZA 4BMHA 2HUZA 3G8WA 2G3AA 1I21A 1VHSA 4ORFA 3F0AA 1Z4RA 1Q2DA 3FRMA 2PC1A 5CNPA 3SXNA 2WPXA 4MY0A 2CY2A 3TOBA 2P6EA 2VI7A 3ZZIA 2VEZA 4YFJA 2B3VA 2F5IA 4YGOA 1YK3A 4X5KA 3I3GA 4PK3A 2CNTA 2FSRA 4KOXA 1S60A 2ZW4A 5EC4A 1RO5A 2X7BA 3E0KA 1QSNA 1FY7A 2R98A 4KOTA 3EY5A 2QIRA 2I00A 4NXYA 3TT2A 1QSRA 2PR1A 2BUEA 1Q2CA 5HMNA 4UBRA 2OZUA 3ZJ0A 1XE4A 4J3GA 5E96A 4AVAA 4OLLA 1MK4A 3EFAA 3LD2A 5F49A 4F0YA 3FB3A 3R96A 3FBUA 5DWNA 3P2HA 1MJBA 2A4NA 2Q44A 4HNWB 4YRHA 1IYKA 1GHEA 2GE3A 2J8RA 1LRZA 4H6UA 1K4JA 1CM0A 2R7HA 4MI4A 2B5GA 2REFA 4Y49B 3GY9A 4E8OA 4PSXA 3IGRA 3S6KA 2FL4A 2CNSA 4QC6A 3GKRA 3FIXA 1RXTA 3PGPA 3VWDA 4KOSA 4HNYB 2GANA 2VXKA 3DR8A 2AJ6A 2OU2A 2FE7A 2ZW7A 2OZHA 2REEA 1TIQA 3CXPA 5F48A 2Z11A 3W6XA 4IF5A 2BEIA 1YLEA 3TFYA 3S6GA 4FD5A 4KOUA 2ATRA 4DNCA 4NF1A 1S7NA 3N7ZA 1YR0A 2VBQA 3DSBA 3SHPA 2B4DA 4PSWA 1B6BA 3TO9A 4NSQA 2HQYA 4HKFA 4CAXA 2GIVA 1M4DA 1Y7RA 3TTHA 4EVYA 4L8AA 1S5KA 4CS0B 3R9FA 2ZXVA 2Q4VA 5ISVA 3W6SA 4AVBA 3PP9A 5JPHA 4MJ8A 1M4GA 2IL4A 3F8KA 3UY5A 1N71A 3OWCA 4JD6A 2R1IA 1PU9A 1XEBA 2OH1A 4FD6A 4UWIA 4U9ZA 1S3ZA 4XNHB 2AE6A 5KTDA 1B87A 3D2MA 2ARHA 1I12A 4QVTA 3GYAA 4UWJA 3QAHA 4HNXB 4XPLA 5J8CA 2RC4A 1PUAA 3KKWA 1L0CA 2JDDA 4MY3A 3CXSA 4QUSA 3D3SA 4IUSA 3FNCA 3TOAA 1Z9UA 3EXNA 1NMTA 4JLYA 4F6AA 5KTAA 4FD4A 4LX9A 2ZPAA 4JJXA 1M1DA 4RS2A 4OAEA 1BOBA 2PQ8A 2O28A 4NCZA 1V0CA 1QSMA 3FXTA 1XMTA 3JUWA 3DR6A 2B5GB 4CRYB 4B5OA 3JVNA 4AG7A 1KUVA 1NSLA 3MGDA 4KORA 4AVCA 3EC4A 2PDOA 5C82A 4CAWA 4XPDC 2WPWA 2EVNA 5IB0A 4ONUA 1I1DA 3R1KA 2KCWA 1UFHA 4K30A 2G3TA 4KZTA 2FS5A 1KUYA 2BSWA 4KVOE 2JLMA 4U9YA 4R9MA 1Y9WA 2D4OA 1KUXA 4RI1A 4Y49C 4KLWA 4NEXA 1M4IA 4CRZB 2I79A 2P6FA 4UA3A 1KZFA 2CNMA 2OZGA 4H89A 3TE4A 4L89A 5F47A 4KOYA 4KLVA 3T9YA 1U6MA 4CAVA 2B3UA 2ZW5A 4PK2A 3T90A 4H6ZA 2HV2A 4OADA 5HH1A 4AB7A 3G3SA 4KVXA 5FVJA 4ZBGA 1M44A 2D4PA 2P6GA 1Q2YA 2PSWA 2B4DB 5H84A 2QMLA 3TCVA 3EO4A 2B4BA 4KOVA 2VZZA 1YREA 1SQHA 4KVME 5H86A 3WR7A 4JXQA 1IICA 3B8GA 3LODA 4QB9A 5JQ4A 2Z10A 2DXQA 1J4JA 5DWMA 2FCKA 2K5TA 3S6FA 2FIAA 3R95A 2PRBA 3C26A 4R87A 1ON0A 4FD7A 3QB8A 4KUBA 1S7LA 3VWEA 2JEVA 3BLNA 2Y0MA 3S6HA 3R9EA 3IWGA 1S7KA 4R57A 2VQYA 2FT0A 3K9UA 4U5YA 2QECA 3R9GA 2NMTA 4MHDA 2JDCA 3I9SA 1YX0A 4E0AA 2Q7BA 2C27A 1P4NA 4LUAA 2VZYA 3BJ7A 1P0HA 1CJWA 2Q04A 5F46A 3NE7A 2G0BA 3SXOA 1MJAA 4R3LA 5IX3A 2PR8A 1OZPA 3FYNA 1MJ9A 3TO6A 2H5MA 2OB0A
chains in the Genus database with same CATH superfamily
3V8IA 1R57A 1XF8A 3BXMA 5LRJA 2Q0YA 4OMEA 4XPKA 3KHXA 5J1QA 1YVOA 5KTCA 1ZO0A 3CDXA 5AG7A 2DEAA 2ODFA 3VARA 1F57A 1LAPA 1QSTA 1S7FA 3H4QA 4GS4A 2ZW6A 4JXRA 4WJBA 3V38A 4B5PA 4DJLA 3GIUA 5GCNA 3DNSA 4O23A 1IGBA 1WWZA 2AFZA 2YNDA 1R3NA 1DTDA 4G1PA 4CYPA 5HXDA 4M6GA 3JTKA 4JWPA 4M6IA 1ARMA 3FF3A 4NGMA 1IYLA 1VIXA 5HVFA 3SJXA 4FBEA 4II9A 1VKCA 3WABA 3IIBA 4KSAA 5EBVA 4QBJA 2PJ0A 1RTQA 2R8VA 2YNCC 3W91A 1Z5RA 1WK4A 2PJ6A 1YQEA 4M3SA 3PBBA 4UFXA 3PZJA 2B58A 3MRUA 2C6GA 4I49A 4MCRA 1IOIA 1BO4A 1YVKA 3CPAA 3FX6A 4OKOA 4ONWA 3RAMA 4AXVA 3BI0A 3F5BA 4CAVA 3CXQA 4EFDA 5IV0A 1PYTB 4MFPA 3D2PA 3D8PA 5C88A 4ZY1A 2EUIA 1BPMA 3BJ8A 2FIWA 1TKHA 4B5PB 2AFSA 1IU8A 1IIDA 1AMPA 3D4UA 2PRQA 1Z4EA 5I0CA 3DDDA 4PV6A 3RYOA 4P4FA 3KHZA 4XNHC 2PJAA 2BL1A 1NE9A 4MBUA 2CIJA 4R3KA 1Z8TA 2P0WA 1Y9KA 4A30A 4NGQA 1YGHA 2FXFA 3P2FA 1VHOA 1YSJA 1X12A 4UEZA 4KOWA 2PJBA 1QSOA 2J8NA 4MHNA 4M85A 3RZAA 1FT7A 2GLJA 2J8MA 1XIXA 4B14A 2Q4YA 4EMEA 3RBUA 1IB1E 2V8VA 4XPDB 4MFJA 4Q36A 4KUAA 4TWEA 3TO7A 2Z0ZA 2PJ5A 5THWA 4AG9A 4BMHA 4CGMA 2HUZA 2EK8A 3G8WA 2G3AA 1I21A 1VHSA 3ISXA 4ORFA 3F0AA 1Z4RA 1PCAA 1Q2DA 3FRMA 2PC1A 2V8DA 4X2TA 5CNPA 3SXNA 2WPXA 4MY0A 2CY2A 3I1UA 3TOBA 2P6EA 2VI7A 3ZZIA 1HEEA 2PIZA 3NA6A 4P4BA 2VEZA 2XEJA 4OC3A 4YFJA 2B3VA 2F5IA 4MCSA 4MXUA 1XMBA 4YGOA 3V7ZA 1YK3A 4X5KA 5D8NA 5D29A 3I3GA 4PK3A 2CNTA 2EBJA 2O4HA 5K8PA 4CAEA 2ZEOA 2FSRA 3D67A 4KOXA 1S60A 5LYIA 4NGTA 2ZW4A 5EC4A 1RO5A 2X7BA 3H8GA 3IU1A 3PRTA 4MHZA 2I3CA 1CBXA 3E0KA 3S9MA 1QSNA 2Q43A 4UIAA 1FY7A 2PJ8A 3KI9A 4YU9A 2R98A 4KOTA 4ZGYB 4P4JA 1BLLE 3EY5A 1LOKA 2QIRA 2I00A 4Q7AA 4NXYA 5DS0A 3WC6A 4OIDA 5CBMA 2CTBA 3TT2A 1QSRA 2ZEMA 5AG5A 2ZEGA 2PR1A 2BUEA 3PEIA 1QMUA 3WT4A 1OBRA 3B3WA 1FNOA 1CPXA 1Q2CA 5HMNA 4UBRA 2OZUA 3FMCA 3ZJ0A 1TXRA 3DLJA 1XE4A 2Q7SA 4J3GA 5LRKA 5AGEA 5E96A 3RO0A 4AVAA 2Z3KA 4OLLA 3VWEA 4OC0A 2F8HA 1MK4A 3EFAA 3IWWA 3LD2A 5F49A 4F0YA 3FB3A 1JQGA 3R96A 2ABZA 3FBUA 2PJ1A 5DWNA 3P2HA 1MJBA 2A4NA 2Q44A 3BI1A 4A95A 3D66A 4HNWB 3JRUA 4YRHA 4MCQA 1LCPA 1IYKA 2ZEHA 5K8NA 1GHEA 2GE3A 2J8RA 5AG4A 2Z3OA 1LRZA 4H6UA 1K4JA 2ZOGA 2J9AA 1CM0A 3LACA 4MFLA 2R7HA 1YMEA 4NGNA 4X8IA 4MI4A 1KWMA 4MMOA 3DGVA 4OP4A 2B5GA 5G20A 2REFA 4Y49B 1ZG9A 3GY9A 4E8OA 3A9LA 3IWEA 4H2KA 4PSXA 1ZLHA 3IGRA 1VGYA 4PQAA 3S6KA 2FL4A 2CNSA 4QC6A 3GKRA 3KASA 3FIXA 1RXTA 2G9DA 3H5ZA 3PGPA 3QNVA 4KOSA 4MFQA 4PXDA 4P4IA 4WWVA 4HNYB 3VWDA 4A31A 4B13A 2GANA 2VXKA 3DR8A 2Z3MA 2AJ6A 2OU2A 3B3SA 2FE7A 2ZW7A 5I4MA 2OZHA 2ZENA 4CPAA 1Z8XA 3LWUA 2O53A 4Z65A 4P6YA 4OC4A 2REEA 1TIQA 3CXPA 3NH4A 2Z11A 5F48A 1TF9A 3W6XA 4OC1A 2NSMA 4IF5A 2BEIA 2Q4ZA 1YLEA 3TFYA 4NJRA 3S6GA 4FD5A 4KOUA 3IC1A 5ELYA 3SI0A 2ATRA 4DNCA 4W9YA 3WC7A 5HVGA 4NF1A 4ZX8A 1S7NA 4A39A 3N7ZA 2POKA 1LAMA 1TF8A 1YR0A 3D7GA 2CXAA 2IJZA 2VBQA 3DSBA 2B4DA 2WZNA 3KQZA 1B6BA 4PSWA 3SHPA 5G22A 3TC8A 3TO9A 3CPXA 5BWAB 3CT9A 3D68A 2BOAA 4BD9A 3KZWA 3WC5A 4P45A 4A38A 4NSQA 4DYOA 3D7HA 3SI1A 4A2ZA 5AG6A 3NFZA 3PB8X 4C7IA 2HQYA 4HKFA 4CAXA 2Z3PA 2GIVA 1R43A 1M4DA 1Y7RA 2NYQA 2XEIA 3TTHA 4L8AA 4EVYA 1S5KA 4FUUA 3B3CA 4CS0B 2QVPA 4Q38A 3S9NA 4UIBA 3R9FA 2ZXVA 1XOVA 2Q4VA 4GXHA 2AFOA 5G1ZA 5ISVA 3W6SA 4AVBA 3PP9A 2Z3NA 5JPHA 1A2ZA 4MJ8A 2ZEFA 1M4GA 4UF4A 4M6HA 2IL4A 2WUUA 3F8KA 4NFRA 3TX8A 3UY5A 2OR4A 1Y0RA 1Z2LA 1N71A 3IO1A 3OWCA 4JD6A 4IK2A 4NGRA 1XRYA 3NH5A 4F8ZA 1ZLIA 2R1IA 2QJ8A 1PU9A 1XEBA 2OH1A 4FD6A 4UWIA 4JYWA 4U9ZA 1S3ZA 1YLOA 3B3TA 1GYTA 2PJ2A 2V77A 4XNHB 1CP7A 4C68A 2AE6A 4KS9A 3T8WA 5KTDA 1B87A 1ELLP 2ARHA 3D2MA 4BINA 1I12A 5IB9A 4QVTA 4B11A 3IJ3A 1Q7LA 3GYAA 4BBHA 2Z3LA 1Y0YA 3ISZA 2CTCA 2PJ3A 1CG2A 2F7VA 4OIWA 4UWJA 4TNUA 3QAHA 4HNXB 4XPLA 5J8CA 2VL1A 2RC4A 1PUAA 2HC9A 3KKWA 1L0CA 1Z8LA 4OC5A 4PXBA 2JDDA 4MY3A 1YW4A 3D7FA 3CXSA 4QUSA 4ZX9A 3D3SA 4IUSA 3KL9A 7CPAA 3FNCA 2JEWA 1Z8WA 3TOAA 4LQ6A 2CF4A 4NGSA 4B12A 1Z9UA 3EXNA 2YNCA 1NMTA 4JLYA 4UEFA 4F6AA 4ZYQA 5KTAA 2HB6A 4CGOA 3FEEA 4R7MA 4FD4A 6CPAA 2ZPAA 2C6CA 2GLFA 4LX9A 4DUKA 4JJXA 1M1DA 4RS2A 4CGNA 4OAEA 4YWYA 1BOBA 4C2XA 2PQ8A 2O28A 4NCZA 2Q51A 1Y7EA 2PJ4A 4UCMA 2IQ6A 3FECA 1TKJA 4X3RA 4E2AA 4KSIA 1V0CA 1QSMA 4NJQA 3CZXA 3FXTA 1XMTA 4ZI6A 4RN7A 3LMSA 3B35A 3H8FA 3JUWA 3DR6A 4F0XA 5A27A 2ZEDA 2B5GB 4PPZA 4CRYB 4B5OA 3JVNA 4AG7A 1KUVA 5JGFA 1NSLA 2PJCA 3MGDA 4EWTA 4KORA 4UEEA 4AVCA 3EC4A 2GFQA 4ZY2A 2PDOA 3IU2A 5C82A 4CAWA 5A28A 2WYRA 4CGPA 4XPDC 4R6TA 4C2ZA 5LYFA 2WPWA 2EVNA 5LYDA 3GLJA 5IB0A 2EWBA 2YGWA 1HDQA 4ONUA 1I1DA 2C6PA 3R1KA 4R8FA 1M4LA 4LQGA 3L2NA 2KCWA 1UFHA 2OOTA 4B6ZA 4K30A 2BO9A 2G3TA 5K8MA 3KR4A 4KZTA 3FVLA 2FS5A 5EMIA 1KUYA 4C2YA 2BSWA 2EK9A 4KVOE 4R76A 2ANPA 1XJOA 2JLMA 4U9YA 1F2PA 1H8LA 2ZEEA 2JBJA 4R9MA 1Y9WA 4K3NA 5JM6A 1BPNA 2D4OA 4UFVA 1QQ9A 4MHPA 4PXEA 1KUXA 3T90A 4RI1A 3HLPA 3GB0A 4B10A 4JZ0A 4Y49C 4KLWA 4NEXA 1M4IA 4CRZB 2DF5A 4F9UA 3N5FA 2I79A 2P6FA 3IEHA 4UA3A 1KZFA 1YW6A 2GU2A 2DPSA 2CNMA 2OZGA 3PBEA 4H89A 2XEGA 1DE4C 3TE4A 4L89A 1BAVA 5F47A 1ZG8A 4KLVA 4KOYA 1U6MA 3BHXA 4P4DA 3SJFA 3T9YA 3B2YA 1ELMP 2AFUA 2B3UA 2WSAA 2ZW5A 3FEDA 3K2KA 4H6ZA 2HV2A 4PK2A 4OADA 5HH1A 4UCNA 4AB7A 1NSAA 3G3SA 4KVXA 2YNEA 4PXCA 2AFXA 5FVJA 4ZBGA 1M44A 2PJ9A 3SI2A 4A33A 5JH9A 2D4PA 3H8EA 3RNZA 4CGLA 2PSWA 2P6GA 1Q2YA 2B4DB 2V8GA 2XEFA 3K9TA 4MRIA 4F9VA 2QYVA 3B3VA 4MFKA 5H84A 2EO8A 4ZY0A 4UFWA 1IY7A 1JWQA 2AFWA 3PFEA 1ZG7A 4UCPA 2QMLA 3TCVA 3EO4A 2JBKA 2B4BA 1XBUA 3KQXA 2DPTA 2RFHA 3FH4A 5LRGA 2GREA 4KOVA 3MN8A 2VZZA 3KR5A 1YREA 1XFOA 3GUXA 1SQHA 1IOFA 4KVME 5J8FA 2RB7A 4KSFA 4MHYA 2AFMA 1CPSA 5H86A 3WR7A 4JXQA 1IICA 1F2OA 3B8GA 3LODA 4QB9A 3SJGA 4CYOA 4CYNA 4A32A 5JQ4A 1AYEA 3PFOA 1HDUA 2Z10A 2ZOFA 5K8OA 3PB6X 1TKFA 2DXQA 1X10A 1J4JA 5DWMA 2FCKA 2K5TA 3IFEA 3S6FA 2FIAA 2ZELA 3R95A 2PRBA 2C1CA 3SJEA 3C26A 3NH8A 4R87A 5G21A 1ON0A 5LYLA 4FD7A 3QB8A 1UWYA 1S7LA 3B7IA 4IHMA 3FJUA 4KUBA 4MCPA 2JEVA 2BCOA 3BLNA 4CYQA 4OC2A 2Y0MA 3S6HA 3PB7X 4FAIA 3HUVA 3R9EA 2PIYA 3IWGA 1S7KA 2PVVA 1EE3P 2VQYA 2IMOA 3NE8A 1AUGA 2FT0A 4R57A 3VH9A 2V8HA 4C7HA 3K9UA 4U5YA 2QECA 3R9GA 2NMTA 3PB9X 4MHDA 3VATA 2JDCA 3I9SA 1YX0A 4E0AA 2Q7BA 4GM5A 3S9LA 4A37A 1CP6A 1P4NA 2C27A 3D7DA 4P4EA 4LUAA 2PE3A 2VZYA 4RUHA 2PCUA 4IAVA 3BJ7A 1P0HA 1CJWA 2Q04A 2ZEPA 3NE7A 4FWUA 5F46A 1CX8A 1LANA 2G0BA 2FVGA 3SXOA 5CPAA 4MFZA 1VHEA 1MJAA 2PJ7A 4R3LA 4A94A 5IX3A 5F09A 2PR8A 4HPSA 4P44A 4P10A 3QAYA 4NGPA 1OZPA 1ARLA 3FYNA 5HVHA 3KGQA 1MJ9A 1LFWA 3TO6A 2PVWA 8CPAA 4CAFA 3PB4X 2H5MA 2OB0A
chains in the Genus database with same CATH topology
3V8IA 1R57A 1XF8A 2Q0YA 4XPKA 1YVOA 5KTCA 1ZO0A 5AG7A 1QSTA 1S7FA 3H4QA 4GS4A 2ZW6A 4JXRA 4B5PA 5GCNA 3DNSA 1WWZA 2YNDA 4CYPA 3JTKA 4JWPA 4II9A 1IYLA 1VKCA 5EBVA 4KSAA 4QBJA 2R8VA 2YNCC 3W91A 1WK4A 4M3SA 4UFXA 3PZJA 2B58A 4I49A 1BO4A 1YVKA 4E2AA 3F5BA 3CXQA 5IV0A 4MFPA 3D2PA 3D8PA 5C88A 2EUIA 3BJ8A 2FIWA 4B5PB 1IIDA 1Z4EA 5I0CA 3DDDA 4PV6A 3RYOA 4XNHC 2BL1A 1NE9A 4MBUA 4R3KA 2P0WA 1Y9KA 4A30A 1YGHA 2FXFA 3P2FA 4KOWA 1QSOA 2J8NA 4M85A 2J8MA 1XIXA 4B14A 2Q4YA 1IB1E 4XPDB 4AG9A 4MFJA 4Q36A 4KUAA 3TO7A 5J8FA 2Z0ZA 4CGMA 4BMHA 2HUZA 3G8WA 2G3AA 1I21A 1VHSA 4ORFA 3F0AA 1Z4RA 1Q2DA 3FRMA 2PC1A 5CNPA 3SXNA 2WPXA 4MY0A 2CY2A 3TOBA 2P6EA 2VI7A 3ZZIA 2VEZA 4YFJA 2B3VA 2F5IA 4YGOA 1YK3A 4X5KA 3I3GA 4PK3A 2CNTA 4CAEA 2FSRA 4KOXA 1S60A 2ZW4A 5EC4A 1RO5A 2X7BA 3IU1A 3E0KA 1QSNA 1FY7A 2R98A 4KOTA 4ZGYB 3EY5A 2QIRA 2I00A 4NXYA 3TT2A 1QSRA 5AG5A 2PR1A 2BUEA 1Q2CA 5HMNA 4UBRA 2OZUA 3ZJ0A 1XE4A 4J3GA 5AGEA 5E96A 4AVAA 2Z3KA 4OLLA 1MK4A 3EFAA 3LD2A 5F49A 4F0YA 3FB3A 3R96A 3FBUA 5DWNA 3P2HA 1MJBA 2A4NA 2Q44A 4A95A 4HNWB 4YRHA 1IYKA 1GHEA 2GE3A 2J8RA 5AG4A 2Z3OA 1LRZA 4H6UA 1K4JA 1CM0A 4MFLA 2R7HA 4MI4A 2B5GA 5G20A 2REFA 4Y49B 3GY9A 4E8OA 3A9LA 3IWEA 4PSXA 3IGRA 3S6KA 2FL4A 2CNSA 4QC6A 3GKRA 3FIXA 1RXTA 3PGPA 3H5ZA 3VWDA 4KOSA 4MFQA 4A31A 4HNYB 4B13A 2GANA 2VXKA 3DR8A 2Z3MA 2AJ6A 2OU2A 2FE7A 2ZW7A 2OZHA 2REEA 1TIQA 3CXPA 5F48A 2Z11A 3W6XA 4IF5A 2BEIA 1YLEA 3TFYA 3S6GA 4FD5A 4KOUA 2ATRA 4DNCA 4NF1A 1S7NA 3N7ZA 1YR0A 2CXAA 2VBQA 3DSBA 3SHPA 2B4DA 4PSWA 1B6BA 5G22A 3TO9A 5BWAB 4NSQA 4A2ZA 5AG6A 4C7IA 2HQYA 4HKFA 4CAXA 2Z3PA 2GIVA 1M4DA 1Y7RA 3TTHA 4EVYA 4L8AA 1S5KA 4CS0B 4Q38A 3R9FA 2ZXVA 2Q4VA 5G1ZA 5ISVA 3W6SA 4AVBA 3PP9A 2Z3NA 5JPHA 4MJ8A 1M4GA 2IL4A 2WUUA 3F8KA 3UY5A 1N71A 3OWCA 4JD6A 2R1IA 1PU9A 1XEBA 2OH1A 4FD6A 4UWIA 4U9ZA 1S3ZA 4XNHB 4C68A 2AE6A 4KS9A 5KTDA 1B87A 3D2MA 2ARHA 1I12A 4QVTA 4B11A 3GYAA 4BBHA 2Z3LA 4UWJA 3QAHA 4HNXB 4XPLA 5J8CA 2RC4A 1PUAA 3KKWA 1L0CA 2JDDA 4MY3A 3CXSA 4QUSA 3D3SA 4IUSA 3FNCA 3TOAA 4B12A 1Z9UA 3EXNA 2YNCA 1NMTA 4JLYA 4F6AA 5KTAA 4CGOA 4FD4A 4LX9A 2ZPAA 4JJXA 1M1DA 4RS2A 4CGNA 4OAEA 4C2XA 1BOBA 2PQ8A 2O28A 4NCZA 4UCMA 1V0CA 1QSMA 3FXTA 1XMTA 3JUWA 3DR6A 4F0XA 5A27A 2B5GB 4CRYB 4B5OA 3JVNA 4AG7A 1KUVA 1NSLA 3MGDA 4KORA 4AVCA 3EC4A 2PDOA 3IU2A 5C82A 4CAWA 5A28A 4CGPA 4XPDC 4C2ZA 2WPWA 2EVNA 5IB0A 2YGWA 4ONUA 1I1DA 3R1KA 2KCWA 1UFHA 4K30A 2G3TA 4KZTA 4C2YA 2FS5A 1KUYA 2BSWA 4KVOE 2JLMA 4U9YA 4R9MA 1Y9WA 2D4OA 4UFVA 1KUXA 4RI1A 4B10A 4Y49C 4KLWA 4NEXA 1M4IA 4CRZB 2I79A 2P6FA 4UA3A 1KZFA 2DPSA 2CNMA 2OZGA 4H89A 3TE4A 4L89A 5F47A 4KOYA 4KLVA 3T9YA 1U6MA 4CAVA 2B3UA 2WSAA 2ZW5A 4PK2A 3T90A 4H6ZA 2HV2A 4OADA 5HH1A 4UCNA 4AB7A 3G3SA 4KVXA 5FVJA 2YNEA 4ZBGA 1M44A 4A33A 2D4PA 4CGLA 2P6GA 1Q2YA 2PSWA 2B4DB 4MFKA 5H84A 4UFWA 4UCPA 2QMLA 3TCVA 3EO4A 2B4BA 2DPTA 4KOVA 2VZZA 1YREA 1SQHA 4KVME 4KSFA 5H86A 3WR7A 4JXQA 1IICA 3B8GA 3LODA 4QB9A 4CYOA 4CYNA 4A32A 5JQ4A 2Z10A 2DXQA 1J4JA 5DWMA 2FCKA 2K5TA 3S6FA 2FIAA 3R95A 2PRBA 3C26A 4R87A 5G21A 1ON0A 4FD7A 3QB8A 4KUBA 1S7LA 3VWEA 2JEVA 3BLNA 4CYQA 2Y0MA 3S6HA 3R9EA 3IWGA 1S7KA 2VQYA 4R57A 2FT0A 4C7HA 3K9UA 4U5YA 2QECA 3R9GA 2NMTA 4MHDA 2JDCA 3I9SA 1YX0A 4E0AA 2Q7BA 2C27A 1P4NA 4LUAA 2VZYA 3BJ7A 1P0HA 1CJWA 2Q04A 5F46A 3NE7A 2G0BA 3SXOA 4MFZA 1MJAA 4R3LA 5IX3A 2PR8A 1OZPA 3FYNA 1MJ9A 3TO6A 4CAFA 2H5MA 2OB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8I A;  1R57 A;  1XF8 A;  2Q0Y A;  4XPK A;  1YVO A;  5KTC A;  1QST A;  1S7F A;  3H4Q A;  4GS4 A;  2ZW6 A;  4JXR A;  4B5P A;  5GCN A;  3DNS A;  1WWZ A;  4JWP A;  4II9 A;  1IYL A;  1VKC A;  5EBV A;  4QBJ A;  2R8V A;  3W91 A;  1WK4 A;  4M3S A;  3PZJ A;  2B58 A;  4I49 A;  1BO4 A;  1YVK A;  4E2A A;  3F5B A;  3CXQ A;  5IV0 A;  3D2P A;  3D8P A;  5C88 A;  2EUI A;  3BJ8 A;  2FIW A;  4B5P B;  1IID A;  1Z4E A;  5I0C A;  3DDD A;  4PV6 A;  3RYO A;  4XNH C;  2BL1 A;  1NE9 A;  4MBU A;  4R3K A;  2P0W A;  1Y9K A;  1YGH A;  2FXF A;  3P2F A;  4KOW A;  1QSO A;  2J8N A;  4M85 A;  2J8M A;  1XIX A;  2Q4Y A;  1IB1 E;  4XPD B;  4AG9 A;  5J8F A;  4KUA A;  3TO7 A;  2Z0Z A;  4BMH A;  2HUZ A;  3G8W A;  2G3A A;  1I21 A;  1VHS A;  4ORF A;  3F0A A;  1Z4R A;  1Q2D A;  3FRM A;  2PC1 A;  5CNP A;  3SXN A;  2WPX A;  4MY0 A;  2CY2 A;  3TOB A;  2P6E A;  2VI7 A;  3ZZI A;  2VEZ A;  4YFJ A;  2B3V A;  2F5I A;  4YGO A;  1YK3 A;  4X5K A;  3I3G A;  4PK3 A;  2CNT A;  2FSR A;  4KOX A;  1S60 A;  2ZW4 A;  5EC4 A;  1RO5 A;  2X7B A;  3E0K A;  1QSN A;  1FY7 A;  2R98 A;  4KOT A;  3EY5 A;  2QIR A;  2I00 A;  4NXY A;  3TT2 A;  1QSR A;  2PR1 A;  2BUE A;  1Q2C A;  5HMN A;  4UBR A;  2OZU A;  3ZJ0 A;  1XE4 A;  4J3G A;  5E96 A;  4AVA A;  4OLL A;  1MK4 A;  3EFA A;  3LD2 A;  5F49 A;  4F0Y A;  3FB3 A;  3R96 A;  3FBU A;  5DWN A;  3P2H A;  1MJB A;  2A4N A;  2Q44 A;  4HNW B;  4YRH A;  1IYK A;  1GHE A;  2GE3 A;  2J8R A;  1LRZ A;  4H6U A;  1K4J A;  1CM0 A;  2R7H A;  4MI4 A;  2B5G A;  2REF A;  4Y49 B;  3GY9 A;  4E8O A;  4PSX A;  3IGR A;  3S6K A;  2FL4 A;  2CNS A;  4QC6 A;  3GKR A;  3FIX A;  1RXT A;  3PGP A;  3VWD A;  4KOS A;  4HNY B;  2GAN A;  2VXK A;  3DR8 A;  2AJ6 A;  2OU2 A;  2FE7 A;  2ZW7 A;  2OZH A;  2REE A;  1TIQ A;  3CXP A;  5F48 A;  2Z11 A;  3W6X A;  4IF5 A;  2BEI A;  1YLE A;  3TFY A;  3S6G A;  4FD5 A;  4KOU A;  2ATR A;  4DNC A;  4NF1 A;  1S7N A;  3N7Z A;  1YR0 A;  2VBQ A;  3DSB A;  3SHP A;  2B4D A;  4PSW A;  1B6B A;  3TO9 A;  4NSQ A;  2HQY A;  4HKF A;  4CAX A;  2GIV A;  1M4D A;  1Y7R A;  3TTH A;  4EVY A;  4L8A A;  1S5K A;  4CS0 B;  3R9F A;  2ZXV A;  2Q4V A;  5ISV A;  3W6S A;  4AVB A;  3PP9 A;  5JPH A;  4MJ8 A;  1M4G A;  2IL4 A;  3F8K A;  3UY5 A;  1N71 A;  3OWC A;  4JD6 A;  2R1I A;  1PU9 A;  1XEB A;  2OH1 A;  4FD6 A;  4UWI A;  4U9Z A;  1S3Z A;  4XNH B;  2AE6 A;  5KTD A;  1B87 A;  3D2M A;  2ARH A;  1I12 A;  4QVT A;  3GYA A;  4UWJ A;  3QAH A;  4HNX B;  4XPL A;  5J8C A;  2RC4 A;  1PUA A;  3KKW A;  1L0C A;  2JDD A;  4MY3 A;  3CXS A;  4QUS A;  3D3S A;  4IUS A;  3FNC A;  3TOA A;  1Z9U A;  3EXN A;  1NMT A;  4JLY A;  4F6A A;  5KTA A;  4FD4 A;  4LX9 A;  2ZPA A;  4JJX A;  1M1D A;  4RS2 A;  4OAE A;  1BOB A;  2PQ8 A;  2O28 A;  4NCZ A;  1V0C A;  1QSM A;  3FXT A;  1XMT A;  3JUW A;  3DR6 A;  2B5G B;  4CRY B;  4B5O A;  3JVN A;  4AG7 A;  1KUV A;  1NSL A;  3MGD A;  4KOR A;  4AVC A;  3EC4 A;  2PDO A;  5C82 A;  4CAW A;  4XPD C;  2WPW A;  2EVN A;  5IB0 A;  4ONU A;  1I1D A;  3R1K A;  2KCW A;  1UFH A;  4K30 A;  2G3T A;  4KZT A;  2FS5 A;  1KUY A;  2BSW A;  4KVO E;  2JLM A;  4U9Y A;  4R9M A;  1Y9W A;  2D4O A;  1KUX A;  4RI1 A;  4Y49 C;  4KLW A;  4NEX A;  1M4I A;  4CRZ B;  2I79 A;  2P6F A;  4UA3 A;  1KZF A;  2CNM A;  2OZG A;  4H89 A;  3TE4 A;  4L89 A;  5F47 A;  4KOY A;  4KLV A;  3T9Y A;  1U6M A;  4CAV A;  2B3U A;  2ZW5 A;  4PK2 A;  3T90 A;  4H6Z A;  2HV2 A;  4OAD A;  5HH1 A;  4AB7 A;  3G3S A;  4KVX A;  5FVJ A;  4ZBG A;  1M44 A;  2D4P A;  2P6G A;  1Q2Y A;  2PSW A;  2B4D B;  5H84 A;  2QML A;  3TCV A;  3EO4 A;  2B4B A;  4KOV A;  2VZZ A;  1YRE A;  1SQH A;  4KVM E;  5H86 A;  3WR7 A;  4JXQ A;  1IIC A;  3B8G A;  3LOD A;  4QB9 A;  5JQ4 A;  2Z10 A;  2DXQ A;  1J4J A;  5DWM A;  2FCK A;  2K5T A;  3S6F A;  2FIA A;  3R95 A;  2PRB A;  3C26 A;  4R87 A;  1ON0 A;  4FD7 A;  3QB8 A;  4KUB A;  1S7L A;  3VWE A;  2JEV A;  3BLN A;  2Y0M A;  3S6H A;  3R9E A;  3IWG A;  1S7K A;  4R57 A;  2VQY A;  2FT0 A;  3K9U A;  4U5Y A;  2QEC A;  3R9G A;  2NMT A;  4MHD A;  2JDC A;  3I9S A;  1YX0 A;  4E0A A;  2Q7B A;  2C27 A;  1P4N A;  4LUA A;  2VZY A;  3BJ7 A;  1P0H A;  1CJW A;  2Q04 A;  5F46 A;  3NE7 A;  2G0B A;  3SXO A;  1MJA A;  4R3L A;  5IX3 A;  2PR8 A;  1OZP A;  3FYN A;  1MJ9 A;  3TO6 A;  2H5M A;  2OB0 A; 
#chains in the Genus database with same CATH topology
 3V8I A;  1R57 A;  1XF8 A;  3BXM A;  5LRJ A;  2Q0Y A;  4OME A;  4XPK A;  3KHX A;  5J1Q A;  1YVO A;  5KTC A;  1ZO0 A;  3CDX A;  5AG7 A;  2DEA A;  2ODF A;  3VAR A;  1F57 A;  1LAP A;  1QST A;  1S7F A;  3H4Q A;  4GS4 A;  2ZW6 A;  4JXR A;  4WJB A;  3V38 A;  4B5P A;  4DJL A;  3GIU A;  5GCN A;  3DNS A;  4O23 A;  1IGB A;  1WWZ A;  2AFZ A;  2YND A;  1R3N A;  1DTD A;  4G1P A;  4CYP A;  5HXD A;  4M6G A;  3JTK A;  4JWP A;  4M6I A;  1ARM A;  3FF3 A;  4NGM A;  1IYL A;  1VIX A;  5HVF A;  3SJX A;  4FBE A;  4II9 A;  1VKC A;  3WAB A;  3IIB A;  4KSA A;  5EBV A;  4QBJ A;  2PJ0 A;  1RTQ A;  2R8V A;  2YNC C;  3W91 A;  1Z5R A;  1WK4 A;  2PJ6 A;  1YQE A;  4M3S A;  3PBB A;  4UFX A;  3PZJ A;  2B58 A;  3MRU A;  2C6G A;  4I49 A;  4MCR A;  1IOI A;  1BO4 A;  1YVK A;  3CPA A;  3FX6 A;  4OKO A;  4ONW A;  3RAM A;  4AXV A;  3BI0 A;  3F5B A;  4CAV A;  3CXQ A;  4EFD A;  5IV0 A;  1PYT B;  4MFP A;  3D2P A;  3D8P A;  5C88 A;  4ZY1 A;  2EUI A;  1BPM A;  3BJ8 A;  2FIW A;  1TKH A;  4B5P B;  2AFS A;  1IU8 A;  1IID A;  1AMP A;  3D4U A;  2PRQ A;  1Z4E A;  5I0C A;  3DDD A;  4PV6 A;  3RYO A;  4P4F A;  3KHZ A;  4XNH C;  2PJA A;  2BL1 A;  1NE9 A;  4MBU A;  2CIJ A;  4R3K A;  1Z8T A;  2P0W A;  1Y9K A;  4A30 A;  4NGQ A;  1YGH A;  2FXF A;  3P2F A;  1VHO A;  1YSJ A;  1X12 A;  4UEZ A;  4KOW A;  2PJB A;  1QSO A;  2J8N A;  4MHN A;  4M85 A;  3RZA A;  1FT7 A;  2GLJ A;  2J8M A;  1XIX A;  4B14 A;  2Q4Y A;  4EME A;  3RBU A;  1IB1 E;  2V8V A;  4XPD B;  4MFJ A;  4Q36 A;  4KUA A;  4TWE A;  3TO7 A;  2Z0Z A;  2PJ5 A;  5THW A;  4AG9 A;  4BMH A;  4CGM A;  2HUZ A;  2EK8 A;  3G8W A;  2G3A A;  1I21 A;  1VHS A;  3ISX A;  4ORF A;  3F0A A;  1Z4R A;  1PCA A;  1Q2D A;  3FRM A;  2PC1 A;  2V8D A;  4X2T A;  5CNP A;  3SXN A;  2WPX A;  4MY0 A;  2CY2 A;  3I1U A;  3TOB A;  2P6E A;  2VI7 A;  3ZZI A;  1HEE A;  2PIZ A;  3NA6 A;  4P4B A;  2VEZ A;  2XEJ A;  4OC3 A;  4YFJ A;  2B3V A;  2F5I A;  4MCS A;  4MXU A;  1XMB A;  4YGO A;  3V7Z A;  1YK3 A;  4X5K A;  5D8N A;  5D29 A;  3I3G A;  4PK3 A;  2CNT A;  2EBJ A;  2O4H A;  5K8P A;  4CAE A;  2ZEO A;  2FSR A;  3D67 A;  4KOX A;  1S60 A;  5LYI A;  4NGT A;  2ZW4 A;  5EC4 A;  1RO5 A;  2X7B A;  3H8G A;  3IU1 A;  3PRT A;  4MHZ A;  2I3C A;  1CBX A;  3E0K A;  3S9M A;  1QSN A;  2Q43 A;  4UIA A;  1FY7 A;  2PJ8 A;  3KI9 A;  4YU9 A;  2R98 A;  4KOT A;  4ZGY B;  4P4J A;  1BLL E;  3EY5 A;  1LOK A;  2QIR A;  2I00 A;  4Q7A A;  4NXY A;  5DS0 A;  3WC6 A;  4OID A;  5CBM A;  2CTB A;  3TT2 A;  1QSR A;  2ZEM A;  5AG5 A;  2ZEG A;  2PR1 A;  2BUE A;  3PEI A;  1QMU A;  3WT4 A;  1OBR A;  3B3W A;  1FNO A;  1CPX A;  1Q2C A;  5HMN A;  4UBR A;  2OZU A;  3FMC A;  3ZJ0 A;  1TXR A;  3DLJ A;  1XE4 A;  2Q7S A;  4J3G A;  5LRK A;  5AGE A;  5E96 A;  3RO0 A;  4AVA A;  2Z3K A;  4OLL A;  3VWE A;  4OC0 A;  2F8H A;  1MK4 A;  3EFA A;  3IWW A;  3LD2 A;  5F49 A;  4F0Y A;  3FB3 A;  1JQG A;  3R96 A;  2ABZ A;  3FBU A;  2PJ1 A;  5DWN A;  3P2H A;  1MJB A;  2A4N A;  2Q44 A;  3BI1 A;  4A95 A;  3D66 A;  4HNW B;  3JRU A;  4YRH A;  4MCQ A;  1LCP A;  1IYK A;  2ZEH A;  5K8N A;  1GHE A;  2GE3 A;  2J8R A;  5AG4 A;  2Z3O A;  1LRZ A;  4H6U A;  1K4J A;  2ZOG A;  2J9A A;  1CM0 A;  3LAC A;  4MFL A;  2R7H A;  1YME A;  4NGN A;  4X8I A;  4MI4 A;  1KWM A;  4MMO A;  3DGV A;  4OP4 A;  2B5G A;  5G20 A;  2REF A;  4Y49 B;  1ZG9 A;  3GY9 A;  4E8O A;  3A9L A;  3IWE A;  4H2K A;  4PSX A;  1ZLH A;  3IGR A;  1VGY A;  4PQA A;  3S6K A;  2FL4 A;  2CNS A;  4QC6 A;  3GKR A;  3KAS A;  3FIX A;  1RXT A;  2G9D A;  3H5Z A;  3PGP A;  3QNV A;  4KOS A;  4MFQ A;  4PXD A;  4P4I A;  4WWV A;  4HNY B;  3VWD A;  4A31 A;  4B13 A;  2GAN A;  2VXK A;  3DR8 A;  2Z3M A;  2AJ6 A;  2OU2 A;  3B3S A;  2FE7 A;  2ZW7 A;  5I4M A;  2OZH A;  2ZEN A;  4CPA A;  1Z8X A;  3LWU A;  2O53 A;  4Z65 A;  4P6Y A;  4OC4 A;  2REE A;  1TIQ A;  3CXP A;  3NH4 A;  2Z11 A;  5F48 A;  1TF9 A;  3W6X A;  4OC1 A;  2NSM A;  4IF5 A;  2BEI A;  2Q4Z A;  1YLE A;  3TFY A;  4NJR A;  3S6G A;  4FD5 A;  4KOU A;  3IC1 A;  5ELY A;  3SI0 A;  2ATR A;  4DNC A;  4W9Y A;  3WC7 A;  5HVG A;  4NF1 A;  4ZX8 A;  1S7N A;  4A39 A;  3N7Z A;  2POK A;  1LAM A;  1TF8 A;  1YR0 A;  3D7G A;  2CXA A;  2IJZ A;  2VBQ A;  3DSB A;  2B4D A;  2WZN A;  3KQZ A;  1B6B A;  4PSW A;  3SHP A;  5G22 A;  3TC8 A;  3TO9 A;  3CPX A;  5BWA B;  3CT9 A;  3D68 A;  2BOA A;  4BD9 A;  3KZW A;  3WC5 A;  4P45 A;  4A38 A;  4NSQ A;  4DYO A;  3D7H A;  3SI1 A;  4A2Z A;  5AG6 A;  3NFZ A;  3PB8 X;  4C7I A;  2HQY A;  4HKF A;  4CAX A;  2Z3P A;  2GIV A;  1R43 A;  1M4D A;  1Y7R A;  2NYQ A;  2XEI A;  3TTH A;  4L8A A;  4EVY A;  1S5K A;  4FUU A;  3B3C A;  4CS0 B;  2QVP A;  4Q38 A;  3S9N A;  4UIB A;  3R9F A;  2ZXV A;  1XOV A;  2Q4V A;  4GXH A;  2AFO A;  5G1Z A;  5ISV A;  3W6S A;  4AVB A;  3PP9 A;  2Z3N A;  5JPH A;  1A2Z A;  4MJ8 A;  2ZEF A;  1M4G A;  4UF4 A;  4M6H A;  2IL4 A;  2WUU A;  3F8K A;  4NFR A;  3TX8 A;  3UY5 A;  2OR4 A;  1Y0R A;  1Z2L A;  1N71 A;  3IO1 A;  3OWC A;  4JD6 A;  4IK2 A;  4NGR A;  1XRY A;  3NH5 A;  4F8Z A;  1ZLI A;  2R1I A;  2QJ8 A;  1PU9 A;  1XEB A;  2OH1 A;  4FD6 A;  4UWI A;  4JYW A;  4U9Z A;  1S3Z A;  1YLO A;  3B3T A;  1GYT A;  2PJ2 A;  2V77 A;  4XNH B;  1CP7 A;  4C68 A;  2AE6 A;  4KS9 A;  3T8W A;  5KTD A;  1B87 A;  1ELL P;  2ARH A;  3D2M A;  4BIN A;  1I12 A;  5IB9 A;  4QVT A;  4B11 A;  3IJ3 A;  1Q7L A;  3GYA A;  4BBH A;  2Z3L A;  1Y0Y A;  3ISZ A;  2CTC A;  2PJ3 A;  1CG2 A;  2F7V A;  4OIW A;  4UWJ A;  4TNU A;  3QAH A;  4HNX B;  4XPL A;  5J8C A;  2VL1 A;  2RC4 A;  1PUA A;  2HC9 A;  3KKW A;  1L0C A;  1Z8L A;  4OC5 A;  4PXB A;  2JDD A;  4MY3 A;  1YW4 A;  3D7F A;  3CXS A;  4QUS A;  4ZX9 A;  3D3S A;  4IUS A;  3KL9 A;  7CPA A;  3FNC A;  2JEW A;  1Z8W A;  3TOA A;  4LQ6 A;  2CF4 A;  4NGS A;  4B12 A;  1Z9U A;  3EXN A;  2YNC A;  1NMT A;  4JLY A;  4UEF A;  4F6A A;  4ZYQ A;  5KTA A;  2HB6 A;  4CGO A;  3FEE A;  4R7M A;  4FD4 A;  6CPA A;  2ZPA A;  2C6C A;  2GLF A;  4LX9 A;  4DUK A;  4JJX A;  1M1D A;  4RS2 A;  4CGN A;  4OAE A;  4YWY A;  1BOB A;  4C2X A;  2PQ8 A;  2O28 A;  4NCZ A;  2Q51 A;  1Y7E A;  2PJ4 A;  4UCM A;  2IQ6 A;  3FEC A;  1TKJ A;  4X3R A;  4E2A A;  4KSI A;  1V0C A;  1QSM A;  4NJQ A;  3CZX A;  3FXT A;  1XMT A;  4ZI6 A;  4RN7 A;  3LMS A;  3B35 A;  3H8F A;  3JUW A;  3DR6 A;  4F0X A;  5A27 A;  2ZED A;  2B5G B;  4PPZ A;  4CRY B;  4B5O A;  3JVN A;  4AG7 A;  1KUV A;  5JGF A;  1NSL A;  2PJC A;  3MGD A;  4EWT A;  4KOR A;  4UEE A;  4AVC A;  3EC4 A;  2GFQ A;  4ZY2 A;  2PDO A;  3IU2 A;  5C82 A;  4CAW A;  5A28 A;  2WYR A;  4CGP A;  4XPD C;  4R6T A;  4C2Z A;  5LYF A;  2WPW A;  2EVN A;  5LYD A;  3GLJ A;  5IB0 A;  2EWB A;  2YGW A;  1HDQ A;  4ONU A;  1I1D A;  2C6P A;  3R1K A;  4R8F A;  1M4L A;  4LQG A;  3L2N A;  2KCW A;  1UFH A;  2OOT A;  4B6Z A;  4K30 A;  2BO9 A;  2G3T A;  5K8M A;  3KR4 A;  4KZT A;  3FVL A;  2FS5 A;  5EMI A;  1KUY A;  4C2Y A;  2BSW A;  2EK9 A;  4KVO E;  4R76 A;  2ANP A;  1XJO A;  2JLM A;  4U9Y A;  1F2P A;  1H8L A;  2ZEE A;  2JBJ A;  4R9M A;  1Y9W A;  4K3N A;  5JM6 A;  1BPN A;  2D4O A;  4UFV A;  1QQ9 A;  4MHP A;  4PXE A;  1KUX A;  3T90 A;  4RI1 A;  3HLP A;  3GB0 A;  4B10 A;  4JZ0 A;  4Y49 C;  4KLW A;  4NEX A;  1M4I A;  4CRZ B;  2DF5 A;  4F9U A;  3N5F A;  2I79 A;  2P6F A;  3IEH A;  4UA3 A;  1KZF A;  1YW6 A;  2GU2 A;  2DPS A;  2CNM A;  2OZG A;  3PBE A;  4H89 A;  2XEG A;  1DE4 C;  3TE4 A;  4L89 A;  1BAV A;  5F47 A;  1ZG8 A;  4KLV A;  4KOY A;  1U6M A;  3BHX A;  4P4D A;  3SJF A;  3T9Y A;  3B2Y A;  1ELM P;  2AFU A;  2B3U A;  2WSA A;  2ZW5 A;  3FED A;  3K2K A;  4H6Z A;  2HV2 A;  4PK2 A;  4OAD A;  5HH1 A;  4UCN A;  4AB7 A;  1NSA A;  3G3S A;  4KVX A;  2YNE A;  4PXC A;  2AFX A;  5FVJ A;  4ZBG A;  1M44 A;  2PJ9 A;  3SI2 A;  4A33 A;  5JH9 A;  2D4P A;  3H8E A;  3RNZ A;  4CGL A;  2PSW A;  2P6G A;  1Q2Y A;  2B4D B;  2V8G A;  2XEF A;  3K9T A;  4MRI A;  4F9V A;  2QYV A;  3B3V A;  4MFK A;  5H84 A;  2EO8 A;  4ZY0 A;  4UFW A;  1IY7 A;  1JWQ A;  2AFW A;  3PFE A;  1ZG7 A;  4UCP A;  2QML A;  3TCV A;  3EO4 A;  2JBK A;  2B4B A;  1XBU A;  3KQX A;  2DPT A;  2RFH A;  3FH4 A;  5LRG A;  2GRE A;  4KOV A;  3MN8 A;  2VZZ A;  3KR5 A;  1YRE A;  1XFO A;  3GUX A;  1SQH A;  1IOF A;  4KVM E;  5J8F A;  2RB7 A;  4KSF A;  4MHY A;  2AFM A;  1CPS A;  5H86 A;  3WR7 A;  4JXQ A;  1IIC A;  1F2O A;  3B8G A;  3LOD A;  4QB9 A;  3SJG A;  4CYO A;  4CYN A;  4A32 A;  5JQ4 A;  1AYE A;  3PFO A;  1HDU A;  2Z10 A;  2ZOF A;  5K8O A;  3PB6 X;  1TKF A;  2DXQ A;  1X10 A;  1J4J A;  5DWM A;  2FCK A;  2K5T A;  3IFE A;  3S6F A;  2FIA A;  2ZEL A;  3R95 A;  2PRB A;  2C1C A;  3SJE A;  3C26 A;  3NH8 A;  4R87 A;  5G21 A;  1ON0 A;  5LYL A;  4FD7 A;  3QB8 A;  1UWY A;  1S7L A;  3B7I A;  4IHM A;  3FJU A;  4KUB A;  4MCP A;  2JEV A;  2BCO A;  3BLN A;  4CYQ A;  4OC2 A;  2Y0M A;  3S6H A;  3PB7 X;  4FAI A;  3HUV A;  3R9E A;  2PIY A;  3IWG A;  1S7K A;  2PVV A;  1EE3 P;  2VQY A;  2IMO A;  3NE8 A;  1AUG A;  2FT0 A;  4R57 A;  3VH9 A;  2V8H A;  4C7H A;  3K9U A;  4U5Y A;  2QEC A;  3R9G A;  2NMT A;  3PB9 X;  4MHD A;  3VAT A;  2JDC A;  3I9S A;  1YX0 A;  4E0A A;  2Q7B A;  4GM5 A;  3S9L A;  4A37 A;  1CP6 A;  1P4N A;  2C27 A;  3D7D A;  4P4E A;  4LUA A;  2PE3 A;  2VZY A;  4RUH A;  2PCU A;  4IAV A;  3BJ7 A;  1P0H A;  1CJW A;  2Q04 A;  2ZEP A;  3NE7 A;  4FWU A;  5F46 A;  1CX8 A;  1LAN A;  2G0B A;  2FVG A;  3SXO A;  5CPA A;  4MFZ A;  1VHE A;  1MJA A;  2PJ7 A;  4R3L A;  4A94 A;  5IX3 A;  5F09 A;  2PR8 A;  4HPS A;  4P44 A;  4P10 A;  3QAY A;  4NGP A;  1OZP A;  1ARL A;  3FYN A;  5HVH A;  3KGQ A;  1MJ9 A;  1LFW A;  3TO6 A;  2PVW A;  8CPA A;  4CAF A;  3PB4 X;  2H5M A;  2OB0 A; 
#chains in the Genus database with same CATH homology
 3V8I A;  1R57 A;  1XF8 A;  2Q0Y A;  4XPK A;  1YVO A;  5KTC A;  1ZO0 A;  5AG7 A;  1QST A;  1S7F A;  3H4Q A;  4GS4 A;  2ZW6 A;  4JXR A;  4B5P A;  5GCN A;  3DNS A;  1WWZ A;  2YND A;  4CYP A;  3JTK A;  4JWP A;  4II9 A;  1IYL A;  1VKC A;  5EBV A;  4KSA A;  4QBJ A;  2R8V A;  2YNC C;  3W91 A;  1WK4 A;  4M3S A;  4UFX A;  3PZJ A;  2B58 A;  4I49 A;  1BO4 A;  1YVK A;  4E2A A;  3F5B A;  3CXQ A;  5IV0 A;  4MFP A;  3D2P A;  3D8P A;  5C88 A;  2EUI A;  3BJ8 A;  2FIW A;  4B5P B;  1IID A;  1Z4E A;  5I0C A;  3DDD A;  4PV6 A;  3RYO A;  4XNH C;  2BL1 A;  1NE9 A;  4MBU A;  4R3K A;  2P0W A;  1Y9K A;  4A30 A;  1YGH A;  2FXF A;  3P2F A;  4KOW A;  1QSO A;  2J8N A;  4M85 A;  2J8M A;  1XIX A;  4B14 A;  2Q4Y A;  1IB1 E;  4XPD B;  4AG9 A;  4MFJ A;  4Q36 A;  4KUA A;  3TO7 A;  5J8F A;  2Z0Z A;  4CGM A;  4BMH A;  2HUZ A;  3G8W A;  2G3A A;  1I21 A;  1VHS A;  4ORF A;  3F0A A;  1Z4R A;  1Q2D A;  3FRM A;  2PC1 A;  5CNP A;  3SXN A;  2WPX A;  4MY0 A;  2CY2 A;  3TOB A;  2P6E A;  2VI7 A;  3ZZI A;  2VEZ A;  4YFJ A;  2B3V A;  2F5I A;  4YGO A;  1YK3 A;  4X5K A;  3I3G A;  4PK3 A;  2CNT A;  4CAE A;  2FSR A;  4KOX A;  1S60 A;  2ZW4 A;  5EC4 A;  1RO5 A;  2X7B A;  3IU1 A;  3E0K A;  1QSN A;  1FY7 A;  2R98 A;  4KOT A;  4ZGY B;  3EY5 A;  2QIR A;  2I00 A;  4NXY A;  3TT2 A;  1QSR A;  5AG5 A;  2PR1 A;  2BUE A;  1Q2C A;  5HMN A;  4UBR A;  2OZU A;  3ZJ0 A;  1XE4 A;  4J3G A;  5AGE A;  5E96 A;  4AVA A;  2Z3K A;  4OLL A;  1MK4 A;  3EFA A;  3LD2 A;  5F49 A;  4F0Y A;  3FB3 A;  3R96 A;  3FBU A;  5DWN A;  3P2H A;  1MJB A;  2A4N A;  2Q44 A;  4A95 A;  4HNW B;  4YRH A;  1IYK A;  1GHE A;  2GE3 A;  2J8R A;  5AG4 A;  2Z3O A;  1LRZ A;  4H6U A;  1K4J A;  1CM0 A;  4MFL A;  2R7H A;  4MI4 A;  2B5G A;  5G20 A;  2REF A;  4Y49 B;  3GY9 A;  4E8O A;  3A9L A;  3IWE A;  4PSX A;  3IGR A;  3S6K A;  2FL4 A;  2CNS A;  4QC6 A;  3GKR A;  3FIX A;  1RXT A;  3PGP A;  3H5Z A;  3VWD A;  4KOS A;  4MFQ A;  4A31 A;  4HNY B;  4B13 A;  2GAN A;  2VXK A;  3DR8 A;  2Z3M A;  2AJ6 A;  2OU2 A;  2FE7 A;  2ZW7 A;  2OZH A;  2REE A;  1TIQ A;  3CXP A;  5F48 A;  2Z11 A;  3W6X A;  4IF5 A;  2BEI A;  1YLE A;  3TFY A;  3S6G A;  4FD5 A;  4KOU A;  2ATR A;  4DNC A;  4NF1 A;  1S7N A;  3N7Z A;  1YR0 A;  2CXA A;  2VBQ A;  3DSB A;  3SHP A;  2B4D A;  4PSW A;  1B6B A;  5G22 A;  3TO9 A;  5BWA B;  4NSQ A;  4A2Z A;  5AG6 A;  4C7I A;  2HQY A;  4HKF A;  4CAX A;  2Z3P A;  2GIV A;  1M4D A;  1Y7R A;  3TTH A;  4EVY A;  4L8A A;  1S5K A;  4CS0 B;  4Q38 A;  3R9F A;  2ZXV A;  2Q4V A;  5G1Z A;  5ISV A;  3W6S A;  4AVB A;  3PP9 A;  2Z3N A;  5JPH A;  4MJ8 A;  1M4G A;  2IL4 A;  2WUU A;  3F8K A;  3UY5 A;  1N71 A;  3OWC A;  4JD6 A;  2R1I A;  1PU9 A;  1XEB A;  2OH1 A;  4FD6 A;  4UWI A;  4U9Z A;  1S3Z A;  4XNH B;  4C68 A;  2AE6 A;  4KS9 A;  5KTD A;  1B87 A;  3D2M A;  2ARH A;  1I12 A;  4QVT A;  4B11 A;  3GYA A;  4BBH A;  2Z3L A;  4UWJ A;  3QAH A;  4HNX B;  4XPL A;  5J8C A;  2RC4 A;  1PUA A;  3KKW A;  1L0C A;  2JDD A;  4MY3 A;  3CXS A;  4QUS A;  3D3S A;  4IUS A;  3FNC A;  3TOA A;  4B12 A;  1Z9U A;  3EXN A;  2YNC A;  1NMT A;  4JLY A;  4F6A A;  5KTA A;  4CGO A;  4FD4 A;  4LX9 A;  2ZPA A;  4JJX A;  1M1D A;  4RS2 A;  4CGN A;  4OAE A;  4C2X A;  1BOB A;  2PQ8 A;  2O28 A;  4NCZ A;  4UCM A;  1V0C A;  1QSM A;  3FXT A;  1XMT A;  3JUW A;  3DR6 A;  4F0X A;  5A27 A;  2B5G B;  4CRY B;  4B5O A;  3JVN A;  4AG7 A;  1KUV A;  1NSL A;  3MGD A;  4KOR A;  4AVC A;  3EC4 A;  2PDO A;  3IU2 A;  5C82 A;  4CAW A;  5A28 A;  4CGP A;  4XPD C;  4C2Z A;  2WPW A;  2EVN A;  5IB0 A;  2YGW A;  4ONU A;  1I1D A;  3R1K A;  2KCW A;  1UFH A;  4K30 A;  2G3T A;  4KZT A;  4C2Y A;  2FS5 A;  1KUY A;  2BSW A;  4KVO E;  2JLM A;  4U9Y A;  4R9M A;  1Y9W A;  2D4O A;  4UFV A;  1KUX A;  4RI1 A;  4B10 A;  4Y49 C;  4KLW A;  4NEX A;  1M4I A;  4CRZ B;  2I79 A;  2P6F A;  4UA3 A;  1KZF A;  2DPS A;  2CNM A;  2OZG A;  4H89 A;  3TE4 A;  4L89 A;  5F47 A;  4KOY A;  4KLV A;  3T9Y A;  1U6M A;  4CAV A;  2B3U A;  2WSA A;  2ZW5 A;  4PK2 A;  3T90 A;  4H6Z A;  2HV2 A;  4OAD A;  5HH1 A;  4UCN A;  4AB7 A;  3G3S A;  4KVX A;  5FVJ A;  2YNE A;  4ZBG A;  1M44 A;  4A33 A;  2D4P A;  4CGL A;  2P6G A;  1Q2Y A;  2PSW A;  2B4D B;  4MFK A;  5H84 A;  4UFW A;  4UCP A;  2QML A;  3TCV A;  3EO4 A;  2B4B A;  2DPT A;  4KOV A;  2VZZ A;  1YRE A;  1SQH A;  4KVM E;  4KSF A;  5H86 A;  3WR7 A;  4JXQ A;  1IIC A;  3B8G A;  3LOD A;  4QB9 A;  4CYO A;  4CYN A;  4A32 A;  5JQ4 A;  2Z10 A;  2DXQ A;  1J4J A;  5DWM A;  2FCK A;  2K5T A;  3S6F A;  2FIA A;  3R95 A;  2PRB A;  3C26 A;  4R87 A;  5G21 A;  1ON0 A;  4FD7 A;  3QB8 A;  4KUB A;  1S7L A;  3VWE A;  2JEV A;  3BLN A;  4CYQ A;  2Y0M A;  3S6H A;  3R9E A;  3IWG A;  1S7K A;  2VQY A;  4R57 A;  2FT0 A;  4C7H A;  3K9U A;  4U5Y A;  2QEC A;  3R9G A;  2NMT A;  4MHD A;  2JDC A;  3I9S A;  1YX0 A;  4E0A A;  2Q7B A;  2C27 A;  1P4N A;  4LUA A;  2VZY A;  3BJ7 A;  1P0H A;  1CJW A;  2Q04 A;  5F46 A;  3NE7 A;  2G0B A;  3SXO A;  4MFZ A;  1MJA A;  4R3L A;  5IX3 A;  2PR8 A;  1OZP A;  3FYN A;  1MJ9 A;  3TO6 A;  4CAF A;  2H5M A;  2OB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...