2HUZA

Crystal structure of gnpnat1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Crystal structure of glucosamine-phosphate N-acetyltransferase 1
rcsb
source organism Homo sapiens
total genus 41
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2huzA01
4LUAA 5H86A 3IGRA 4OAEA 2RC4A 2GE3A 5F46A 4MBUA 1XEBA 3EXNA 1I12A 1SQHA 4UA3A 1GHEA 3BLNA 1IB1E 3TTHA 1QSRA 2PC1A 5IB0A 4LX9A 4ONUA 2J8MA 1QSNA 2EUIA 4PK3A 3H4QA 3GY9A 1S5KA 3D2MA 3SHPA 2DXQA 3D3SA 3EY5A 1YVKA 2P6EA 3FB3A 4RI1A 5JPHA 5HMNA 2JEVA 3FXTA 1YGHA 4KZTA 4GS4A 4MJ8A 3R96A 2B4DA 1QSOA 4R3LA 4KOVA 2QIRA 1UFHA 3TFYA 4FD5A 2FIAA 3S6KA 2FIWA 4E8OA 4XNHB 2PSWA 2X7BA 4YRHA 3FYNA 1IYLA 3WR7A 3TT2A 3FIXA 2CY2A 4Y49C 1QSTA 1YVOA 4CAXA 5IX3A 2VZZA 4H6ZA 2Q0YA 3PZJA 1RXTA 3TOBA 5KTDA 4YFJA 2R7HA 1S7FA 4M3SA 4MY0A 2HV2A 4NF1A 1P4NA 2OZGA 4CAWA 4AVBA 1KUXA 2Q04A 1K4JA 3OWCA 2FXFA 3R9EA 2VQYA 3G8WA 1S7LA 1Y9KA 2OZUA 2ZW4A 3JUWA 3FBUA 3DNSA 4QBJA 5ISVA 3JVNA 5GCNA 1YK3A 4ORFA 4CS0B 1FY7A 4KOSA 3P2FA 4CRZB 1IYKA 5CNPA 2ZXVA 1B87A 2ATRA 2FCKA 2H5MA 4B5PB 1Q2DA 2G0BA 2EVNA 3CXPA 4F0YA 4AVCA 1LRZA 4KUBA 2I79A 1Y9WA 1Z9UA 2J8RA 1KUVA 2JDDA 2B58A 2Q7BA 1VHSA 4HNXB 1M1DA 4EVYA 3S6FA 2FSRA 2FE7A 3S6GA 5IV0A 2QECA 3DDDA 1XMTA 3TCVA 5FVJA 5J8FA 1B6BA 2G3AA 1S7NA 3I9SA 5C88A 2VZYA 2PQ8A 1Q2CA 2B5GA 2OU2A 1PUAA 4KVME 5KTAA 4IF5A 3UY5A 1YX0A 3TOAA 2J8NA 1TIQA 4R87A 4FD4A 4OADA 1Y7RA 4AG9A 3IWGA 4KVXA 1I1DA 4DNCA 4UWJA 1VKCA 1MK4A 4XPDB 2Z10A 2ZPAA 1V0CA 5E96A 5DWNA 5KTCA 3K9UA 4L89A 4U9YA 2PDOA 3TO9A 2KCWA 4E2AA 2Q44A 3F0AA 4PV6A 4L8AA 2OB0A 2BEIA 3CXSA 4U9ZA 2GANA 2HUZA 2FT0A 2K5TA 2B3VA 2BL1A 2VEZA 4JXRA 3DSBA 1Z4EA 2R98A 3SXNA 2AE6A 3FNCA 1CJWA 2BSWA 2G3TA 3P2HA 3TO7A 3R1KA 5EBVA 4AB7A 3I3GA 5EC4A 1BO4A 3VWEA 1NE9A 2REFA 4BMHA 3ZZIA 4H89A 2I00A 4KOXA 2Q4YA 4KORA 5F49A 1KUYA 3TO6A 2PR8A 2ZW7A 1KZFA 2R1IA 1M4GA 3D2PA 4XPLA 2VI7A 3PP9A 4U5YA 5F47A 5H84A 3R9GA 2D4OA 3EO4A 4R57A 4J3GA 2VBQA 4H6UA 2QMLA 3VWDA 2B4DB 4B5OA 2P6GA 2WPXA 1P0HA 5JQ4A 2R8VA 1IICA 3KKWA 3V8IA 4II9A 3R9FA 1S3ZA 4JWPA 1J4JA 2JDCA 3F5BA 4NXYA 2ZW5A 1MJAA 1Z4RA 4UBRA 4XNHC 5DWMA 1RO5A 4KVOE 3T9YA 3T90A 1MJBA 4K30A 1I21A 2A4NA 3C26A 3NE7A 4F6AA 1CM0A 3FRMA 1M4DA 1WK4A 3DR6A 3LODA 2AJ6A 4FD6A 3W6SA 4KOWA 2P6FA 2D4PA 4IUSA 1MJ9A 4HKFA 2Y0MA 3GYAA 4Y49B 3BJ7A 3ZJ0A 2FL4A 1XF8A 4CRYB 3W91A 3N7ZA 2CNTA 3D8PA 4MHDA 5I0CA 3G3SA 3EFAA 2HQYA 4KUAA 4JXQA 3GKRA 1N71A 1QSMA 3S6HA 3BJ8A 3E0KA 1ON0A 4X5KA 2OH1A 3CXQA 4PSWA 4QB9A 4AG7A 4KLWA 2B4BA 2CNMA 2Q4VA 2Z11A 5F48A 4PSXA 1OZPA 3F8KA 1WWZA 4NSQA 4PK2A 4UWIA 4KOTA 4JLYA 1M4IA 2B3UA 4B5PA 2ZW6A 4YGOA 1BOBA 2REEA 3EC4A 2WPWA 2B5GB 4KOYA 3MGDA 4E0AA 3QAHA 4QC6A 4R3KA 4HNWB 2BUEA 1Q2YA 4JJXA 1NMTA 2PR1A 1YREA 1PU9A 4MY3A 3SXOA 3R95A 3TE4A 2F5IA 4QVTA 4M85A 1M44A 4R9MA 4ZBGA 4XPDC 5C82A 1R57A 1S7KA 2OZHA 5J8CA 2NMTA 2GIVA 1NSLA 1L0CA 1S60A 2ARHA 2IL4A 4KOUA 4KLVA 2P0WA 4NCZA 4XPKA 1U6MA 4JD6A 3B8GA 4OLLA 3QB8A 5HH1A 4CAVA 3PGPA 3DR8A 1YR0A 1IIDA 2JLMA 3RYOA 1XIXA 3W6XA 2PRBA 2CNSA 1YLEA 1XE4A 2FS5A 4QUSA 4MI4A 4I49A 4AVAA 4NEXA 2C27A 2O28A 2VXKA 3LD2A 4HNYB 2Z0ZA 4FD7A 4RS2A
chains in the Genus database with same CATH superfamily
3KI9A 4LUAA 3IGRA 5H86A 4A95A 2PRQA 4OAEA 4C2ZA 3IWEA 2RC4A 5LYLA 2JBJA 2GE3A 3RZAA 4MBUA 5F46A 5J1QA 4CYQA 3PEIA 1XEBA 4P4BA 3D7HA 2V8VA 3EXNA 5AG7A 1KWMA 4UF4A 4ZX9A 1I12A 1SQHA 5D8NA 4PXDA 3TX8A 4UA3A 5DS0A 1GHEA 4OC1A 1ELLP 4P4FA 3BLNA 3NE8A 3SJXA 5HVHA 4NJRA 1IB1E 3TTHA 1QSRA 2GLFA 2PC1A 4LQ6A 5IB0A 2F7VA 3BI0A 1YQEA 4YWYA 3NH5A 4LX9A 4CPAA 4ONUA 3FEDA 2Z3PA 2J8MA 1HEEA 1QSNA 4BBHA 3LMSA 2EUIA 4B14A 4PK3A 2Q7SA 4UFVA 5JH9A 3H4QA 3GY9A 4PXCA 1S5KA 3D2MA 2ZEGA 2DXQA 1CX8A 1LOKA 3D3SA 2ZEEA 3SHPA 1IY7A 2PIZA 3EY5A 2Q4ZA 1ZG7A 1YVKA 2P6EA 2PJ3A 3FB3A 4OC5A 4RI1A 5JPHA 1Y0YA 3CDXA 5HMNA 2JEVA 3FXTA 4CGLA 1LAPA 3T8WA 1YGHA 4KZTA 4GS4A 4MJ8A 3R96A 3PBEA 4IHMA 2B4DA 1H8LA 1QSOA 2JBKA 4R3LA 4KOVA 1R43A 2QIRA 8CPAA 1UFHA 2PJ8A 4NGNA 3TC8A 3TFYA 4OIDA 1F2OA 2IJZA 1Z8XA 4FD5A 2FIAA 3HUVA 3QNVA 4P4IA 3WT4A 2ZOGA 1JWQA 3N5FA 2QJ8A 3S6KA 5IB9A 2FIWA 4E8OA 4XNHB 2PSWA 2X7BA 3ISXA 4YRHA 3FYNA 3D4UA 1IYLA 4PXBA 3WR7A 4PPZA 3TT2A 3FIXA 4UFXA 4MFZA 3KR5A 2PJ2A 2HC9A 2PJ6A 1QMUA 2O53A 3CZXA 1AMPA 1YLOA 4M6HA 2AFSA 4MHPA 2CY2A 4Q7AA 4Y49C 3D67A 1QSTA 3IEHA 4RUHA 5LYDA 1YVOA 4CAXA 2EWBA 5IX3A 2VZZA 2PJCA 4H6ZA 2Q0YA 3PZJA 1RXTA 3KZWA 2YNCC 3TOBA 4KSAA 3RAMA 2ZENA 4MFQA 5KTDA 3RNZA 2R7HA 4YFJA 1S7FA 1YW4A 4M3SA 4MY0A 4C2YA 2HV2A 4NF1A 1P4NA 2OZGA 4CAWA 4AVBA 1F2PA 2PJ5A 1OBRA 1KUXA 5AG4A 4MHZA 3QAYA 2Q04A 1K4JA 3OWCA 2FXFA 3R9EA 2AFZA 1ZLIA 2VQYA 3K9TA 1CPXA 3G8WA 1S7LA 1Y9KA 2OZUA 2YNCA 2ZW4A 3JUWA 4CGOA 1BPMA 3FBUA 4ZGYB 2AFWA 2IQ6A 3DNSA 4C7HA 4EMEA 4QBJA 5ISVA 4A37A 3JVNA 4M6GA 1VGYA 4ZY1A 5GCNA 1YK3A 4P4EA 4CYOA 2IMOA 4ORFA 2PJBA 4CS0B 2DPSA 3BI1A 1FY7A 3KR4A 5A28A 4KOSA 3P2FA 4O23A 2YNEA 4CRZB 1IYKA 5CNPA 3WC5A 2ZXVA 1B87A 2ATRA 2C6PA 2FCKA 2H5MA 2VL1A 4IK2A 4MFJA 4A38A 5LRJA 4B5PB 4CGPA 5AG5A 3CPAA 1Q2DA 2G0BA 2EVNA 3CXPA 4OC3A 4UCNA 4HPSA 3WC7A 3L2NA 3PB8X 1LRZA 2XEFA 2I79A 1Y9WA 3CT9A 3IFEA 4KUBA 1Z9UA 3PB9X 4OP4A 2J8RA 1KUVA 2JDDA 4ZY0A 2B58A 3FECA 2Q7BA 4X8IA 4TWEA 4F9VA 3FMCA 4F0XA 3GIUA 4X2TA 4DUKA 1VHSA 4HNXB 3D7FA 1CP7A 1ZG8A 1M1DA 1XJOA 4CGMA 4EVYA 3S6FA 4ZI6A 2FSRA 1ELMP 2FE7A 1M4LA 4MFKA 3S6GA 3IU2A 5IV0A 2XEGA 2C6CA 2QECA 1PYTB 3DDDA 1XMTA 3TCVA 1XMBA 2XEJA 1Z8WA 2OOTA 5FVJA 3NH4A 5J8FA 1B6BA 2G3AA 1S7NA 2ZEPA 3I9SA 5C88A 2VZYA 1CBXA 3IJ3A 2PQ8A 3RBUA 1Q2CA 2B5GA 1TF9A 4NFRA 1A2ZA 2OU2A 2Z3LA 1PUAA 5LRGA 2V8HA 4B6ZA 2YGWA 4KVME 1HDUA 4IF5A 4UEEA 3UY5A 1YX0A 3RO0A 5CBMA 5HXDA 3V38A 3VARA 4FUUA 3TOAA 2AFUA 2PJ4A 2J8NA 1TIQA 4R87A 2V77A 4FD4A 4OADA 2AFOA 4ZYQA 1Y7RA 4C7IA 4ZY2A 2ZEFA 4AG9A 5BWAB 1IOFA 3IWGA 4KVXA 4H2KA 4OMEA 3PRTA 1I1DA 4C68A 4A31A 4DNCA 4LQGA 2ZELA 4UWJA 1VKCA 1MK4A 4XPDB 1PCAA 4BD9A 4MCRA 5G20A 3FX6A 1CP6A 2Z10A 4OIWA 4P44A 3B3SA 1HDQA 2ZPAA 2PJAA 2PJ1A 5EMIA 1V0CA 3B35A 4Q36A 2NYQA 5E96A 5DWNA 5KTCA 3K9UA 3S9NA 4L89A 3B3VA 2RB7A 3LWUA 3NH8A 4U9YA 4A30A 2PDOA 3TO9A 5ELYA 3SJGA 2KCWA 4MCPA 4UEFA 4E2AA 2Q44A 3F0AA 4PV6A 4CGNA 4L8AA 4MHNA 2OB0A 2BEIA 3CXSA 4U9ZA 2GANA 4UCPA 2HUZA 2FT0A 2ANPA 2WSAA 2K5TA 3FEEA 4OC4A 2B3VA 2BL1A 2BO9A 2VEZA 4NGSA 5HVGA 4JXRA 2AFMA 2I3CA 3DSBA 4UCMA 1Z4EA 2R98A 2XEIA 3DGVA 3SXNA 3IWWA 1Q7LA 2AE6A 3FNCA 1CJWA 2BSWA 3FVLA 3JTKA 1FT7A 2G3TA 2YNDA 3P2HA 2GU2A 3TO7A 3R1KA 5EBVA 4DJLA 4AB7A 3I3GA 5EC4A 1BO4A 3VWEA 1NE9A 2REFA 1RTQA 4BMHA 3VATA 2CTCA 3PB6X 2JEWA 3ZZIA 5A27A 3D68A 2PJ9A 4H89A 2PE3A 2CIJA 2GFQA 4JZ0A 2I00A 3KQZA 1Z5RA 4KOXA 2Q4YA 2EBJA 3FF3A 4KORA 5F49A 5KTAA 1KUYA 3TO6A 3KHZA 3PB7X 2PR8A 4G1PA 4NGQA 2ZEOA 3MN8A 2WZNA 2ZW7A 2ZEHA 2OR4A 3A9LA 1KZFA 2R1IA 2GLJA 1CPSA 5LYFA 1M4GA 4FBEA 4K3NA 3D2PA 4NGTA 4XPLA 4EFDA 2VI7A 4MHYA 3PP9A 4U5YA 1VHEA 5F47A 5H84A 3R9GA 3GLJA 2Z3NA 3WABA 1VIXA 4FD7A 2D4OA 3EO4A 4R57A 4J3GA 2VBQA 4H6UA 4NGRA 1IU8A 4OC2A 2CXAA 4YU9A 4R76A 5K8MA 2RFHA 4X3RA 2QMLA 1ARMA 4OC0A 2Z3MA 4A33A 5I4MA 4ONWA 4CAEA 3VWDA 2B4DB 4B5OA 2P6GA 2WPXA 4GM5A 2O4HA 1TKJA 1P0HA 1JQGA 5JQ4A 2Q51A 2R8VA 1IICA 3KKWA 3V8IA 3KQXA 4EWTA 2PVVA 3R9FA 4II9A 1LCPA 1S3ZA 3DLJA 1AUGA 4JWPA 1J4JA 2JDCA 3F5BA 4R6TA 4NXYA 2ZW5A 1YMEA 4FWUA 1YSJA 1MJAA 2Z3KA 1Z4RA 4UBRA 4XNHC 5DWMA 1RO5A 3B3WA 4KVOE 3T9YA 3T90A 1MJBA 3B2YA 4K30A 1GYTA 4KS9A 1I21A 2A4NA 2WUUA 3C26A 3VH9A 3NE7A 4F6AA 2AFXA 2PCUA 1CM0A 3SI1A 3S9LA 1IOIA 3FRMA 3D66A 3H8EA 1LFWA 1M4DA 1WK4A 3DR6A 3HLPA 3IO1A 3LODA 4NGMA 1LAMA 2AJ6A 2BOAA 4FD6A 4UEZA 3W6SA 2C6GA 2ZOFA 4KOWA 2P6FA 2D4PA 4MFPA 3KL9A 3NA6A 4IUSA 1BAVA 1MJ9A 3D7DA 4W9YA 4HKFA 4NGPA 4B12A 2Y0MA 3GYAA 3KASA 4Y49B 4A94A 3BJ7A 1UWYA 1BLLE 2FL4A 1XF8A 2V8GA 4ZX8A 3S9MA 2ZEDA 3ZJ0A 4CRYB 4CYNA 3PFOA 4A32A 3W91A 3N7ZA 1F57A 2CNTA 5K8NA 3D8PA 1QQ9A 4MHDA 4RN7A 3LACA 5I0CA 3G3SA 4CYPA 3EFAA 2PJ0A 4P6YA 2HQYA 1LANA 2DPTA 4KUAA 4MMOA 4JXQA 3GKRA 1N71A 1QSMA 3S6HA 4GXHA 4MCSA 4MFLA 3BJ8A 4WJBA 3E0KA 5G21A 4A2ZA 1ON0A 1TKHA 4UIAA 4X5KA 2OH1A 2BCOA 5JM6A 3CXQA 4PSWA 3H8GA 3B3CA 6CPAA 4QB9A 2NSMA 4AG7A 4TNUA 4KLWA 2B4BA 3D7GA 2CNMA 5G22A 4AVCA 5K8PA 2Q4VA 3H8FA 2Z11A 2Z3OA 5G1ZA 5LYIA 5F48A 3BXMA 3SI2A 4UFWA 5THWA 3PB4X 2ZEMA 3ISZA 4PSXA 4R7MA 1ZLHA 1OZPA 4MRIA 3F8KA 3H5ZA 1WWZA 2Q43A 2QYVA 4B13A 3I1UA 4NSQA 4PK2A 4BINA 3FJUA 4UWIA 4KOTA 4JLYA 1M4IA 4MCQA 2DEAA 3IC1A 4KSIA 1ARLA 2B3UA 4B5PA 3B3TA 4B10A 2ZW6A 4YGOA 2ABZA 1BOBA 2REEA 5D29A 3GUXA 3SJEA 3EC4A 2WPWA 3PFEA 4A39A 2B5GB 3PBBA 3K2KA 4NJQA 5AGEA 4F8ZA 4OKOA 4KOYA 3GB0A 1Y7EA 2F8HA 3MGDA 1ZO0A 1CG2A 4E0AA 3QAHA 5K8OA 3IIBA 3FH4A 4QC6A 4R3KA 4HNWB 2BUEA 1Q2YA 2PIYA 2EK8A 1XFOA 4PQAA 4JJXA 4WWVA 2G9DA 4AXVA 3B7IA 3BHXA 4IAVA 4R8FA 1NMTA 2PR1A 3CPXA 4Q38A 3V7ZA 2ODFA 1YREA 1PU9A 4MY3A 3SXOA 3R95A 3TE4A 2PVWA 4FAIA 1TF8A 2F5IA 2GREA 2POKA 4QVTA 4M85A 1M44A 4C2XA 4R9MA 2J9AA 3KHXA 4PXEA 4ZBGA 4XPDC 4Z65A 5C82A 1R57A 1XOVA 1TKFA 4P45A 4B11A 4CAFA 1TXRA 2FVGA 4UIBA 2QVPA 2WYRA 3MRUA 2EK9A 3WC6A 1S7KA 1Z8TA 4P4JA 1XBUA 4MXUA 5LRKA 1EE3P 2OZHA 5J8CA 2NMTA 4DYOA 2GIVA 1NSLA 1L0CA 2CF4A 4P10A 1S60A 2ARHA 1AYEA 1Y0RA 2IL4A 5HVFA 4KSFA 4KOUA 4KLVA 1BPNA 2P0WA 4NCZA 2CTBA 4P4DA 4XPKA 5CPAA 1IGBA 2DF5A 2EO8A 4JD6A 3B8GA 3KGQA 5JGFA 1VHOA 4OLLA 4F9UA 3QB8A 3SI0A 5HH1A 3NFZA 1Z8LA 5F09A 4JYWA 5AG6A 1Z2LA 2C1CA 1DE4C 1NSAA 1X12A 1XRYA 1ZG9A 4CAVA 1FNOA 3PGPA 3DR8A 1DTDA 4F0YA 7CPAA 1YW6A 2JLMA 1YR0A 1IIDA 2V8DA 3IU1A 3RYOA 1XIXA 3W6XA 2PRBA 3JRUA 2CNSA 2HB6A 1YLEA 1XE4A 2FS5A 4QUSA 4MI4A 4I49A 4M6IA 4AVAA 3SJFA 2PJ7A 4NEXA 2C27A 2O28A 2VXKA 1X10A 3LD2A 4HNYB 2Z0ZA 1U6MA 1R3NA 4RS2A
chains in the Genus database with same CATH topology
4LUAA 5H86A 3IGRA 4A95A 4OAEA 4C2ZA 3IWEA 2RC4A 2GE3A 5F46A 4MBUA 4CYQA 1XEBA 3EXNA 5AG7A 1I12A 1SQHA 4UA3A 1GHEA 3BLNA 1IB1E 3TTHA 1QSRA 2PC1A 5IB0A 4LX9A 4ONUA 2Z3PA 2J8MA 1QSNA 4BBHA 2EUIA 4B14A 4PK3A 4UFVA 3H4QA 3GY9A 1S5KA 3D2MA 3SHPA 2DXQA 3D3SA 3EY5A 1YVKA 2P6EA 3FB3A 4RI1A 5JPHA 5HMNA 2JEVA 3FXTA 4CGLA 1YGHA 4KZTA 4GS4A 4MJ8A 3R96A 2B4DA 1QSOA 4R3LA 4KOVA 2QIRA 1UFHA 3TFYA 4FD5A 2FIAA 3S6KA 2FIWA 4E8OA 4XNHB 2PSWA 2X7BA 4YRHA 3FYNA 1IYLA 3WR7A 3TT2A 3FIXA 4UFXA 4MFZA 2CY2A 4Y49C 1QSTA 1YVOA 4CAXA 5IX3A 2VZZA 4H6ZA 2Q0YA 3PZJA 1RXTA 2YNCC 3TOBA 4KSAA 4MFQA 5KTDA 4YFJA 2R7HA 1S7FA 4M3SA 4MY0A 4C2YA 2HV2A 4NF1A 1P4NA 2OZGA 4CAWA 4AVBA 1KUXA 5AG4A 2Q04A 1K4JA 3OWCA 2FXFA 3R9EA 2VQYA 3G8WA 1S7LA 1Y9KA 2OZUA 2YNCA 2ZW4A 3JUWA 4CGOA 3FBUA 4ZGYB 3DNSA 4C7HA 4QBJA 5ISVA 3JVNA 5GCNA 1YK3A 4CYOA 4ORFA 4CS0B 2DPSA 1FY7A 5A28A 4KOSA 3P2FA 2YNEA 4CRZB 1IYKA 5CNPA 2ZXVA 1B87A 2ATRA 2FCKA 2H5MA 4B5PB 4MFJA 4CGPA 5AG5A 1Q2DA 2G0BA 2EVNA 3CXPA 4C2XA 4UCNA 4F0YA 4AVCA 1LRZA 4KUBA 2I79A 1Y9WA 1Z9UA 2J8RA 1KUVA 2JDDA 2B58A 2Q7BA 4F0XA 1VHSA 4HNXB 1M1DA 4CGMA 4EVYA 3S6FA 2FSRA 2FE7A 4MFKA 3S6GA 3IU2A 5IV0A 2QECA 3DDDA 1XMTA 3TCVA 5FVJA 5J8FA 1B6BA 2G3AA 1S7NA 3I9SA 5C88A 2VZYA 2PQ8A 1Q2CA 2B5GA 2Z3LA 2OU2A 1PUAA 2YGWA 4KVME 4IF5A 5KTAA 3UY5A 1YX0A 3TOAA 2J8NA 1TIQA 4R87A 4FD4A 4OADA 1Y7RA 4C7IA 4AG9A 5BWAB 3IWGA 4KVXA 1I1DA 4C68A 4A31A 4DNCA 4UWJA 1VKCA 1MK4A 4XPDB 5G20A 2Z10A 2ZPAA 1V0CA 4Q36A 5E96A 5DWNA 5KTCA 3K9UA 4L89A 4U9YA 4A30A 2PDOA 3TO9A 2KCWA 4E2AA 2Q44A 3F0AA 4PV6A 4CGNA 4L8AA 2OB0A 2BEIA 3CXSA 4U9ZA 2GANA 4UCPA 2HUZA 2FT0A 2WSAA 2K5TA 2B3VA 2BL1A 2VEZA 4JXRA 3DSBA 4UCMA 1Z4EA 2R98A 3SXNA 2AE6A 3FNCA 1CJWA 2BSWA 3JTKA 2YNDA 2G3TA 3P2HA 3TO7A 3R1KA 5EBVA 4AB7A 3I3GA 5EC4A 1BO4A 3VWEA 1NE9A 2REFA 4BMHA 3ZZIA 5A27A 4H89A 2I00A 4KOXA 2Q4YA 4KORA 5F49A 1KUYA 3TO6A 2PR8A 2ZW7A 3A9LA 1KZFA 2R1IA 1M4GA 3D2PA 4XPLA 2VI7A 3PP9A 4U5YA 5F47A 5H84A 3R9GA 2Z3NA 2D4OA 3EO4A 4R57A 4J3GA 2VBQA 4H6UA 2CXAA 2QMLA 2Z3MA 4A33A 4CAEA 3VWDA 2B4DB 4B5OA 2P6GA 2WPXA 1P0HA 5JQ4A 2R8VA 1IICA 3KKWA 3V8IA 4II9A 3R9FA 1S3ZA 4JWPA 1J4JA 2JDCA 3F5BA 4NXYA 2ZW5A 1MJAA 2Z3KA 1Z4RA 4UBRA 4XNHC 5DWMA 1RO5A 4KVOE 3T9YA 3T90A 1MJBA 4K30A 4KS9A 1I21A 2A4NA 2WUUA 3C26A 3NE7A 4F6AA 1CM0A 3FRMA 1M4DA 1WK4A 3DR6A 4A32A 3LODA 2AJ6A 4FD6A 3W6SA 4KOWA 2P6FA 2D4PA 4MFPA 4IUSA 1MJ9A 4HKFA 4B12A 2Y0MA 3GYAA 4Y49B 3BJ7A 3ZJ0A 2FL4A 1XF8A 4CRYB 4CYNA 3W91A 3N7ZA 2CNTA 3D8PA 4MHDA 5I0CA 3G3SA 4CYPA 3EFAA 2HQYA 4KUAA 2DPTA 4JXQA 3GKRA 1N71A 1QSMA 3S6HA 4MFLA 3BJ8A 3E0KA 5G21A 4A2ZA 1ON0A 4X5KA 2OH1A 3CXQA 4PSWA 4QB9A 4AG7A 4KLWA 2B4BA 5G22A 2CNMA 2Q4VA 2Z11A 2Z3OA 5G1ZA 5F48A 4UFWA 4PSXA 1OZPA 3F8KA 3H5ZA 1WWZA 4B13A 4NSQA 4PK2A 4UWIA 4KOTA 4JLYA 1M4IA 2B3UA 4B5PA 4B10A 2ZW6A 4YGOA 1BOBA 2REEA 3EC4A 2WPWA 2B5GB 5AGEA 4KOYA 3MGDA 1ZO0A 4E0AA 3QAHA 4QC6A 4R3KA 4HNWB 2BUEA 1Q2YA 4JJXA 1NMTA 2PR1A 4Q38A 1YREA 1PU9A 4MY3A 3SXOA 3R95A 3TE4A 2F5IA 4QVTA 4M85A 1M44A 4R9MA 4ZBGA 4XPDC 5C82A 1R57A 4B11A 4CAFA 1S7KA 2OZHA 5J8CA 2NMTA 2GIVA 1NSLA 1L0CA 1S60A 2ARHA 2IL4A 4KSFA 4KOUA 4KLVA 2P0WA 4NCZA 4XPKA 1U6MA 4JD6A 3B8GA 4OLLA 3QB8A 5HH1A 5AG6A 4CAVA 3PGPA 3DR8A 1YR0A 1IIDA 2JLMA 3IU1A 3RYOA 1XIXA 3W6XA 2PRBA 2CNSA 1YLEA 1XE4A 2FS5A 4QUSA 4MI4A 4I49A 4AVAA 4NEXA 2C27A 2O28A 2VXKA 3LD2A 4HNYB 2Z0ZA 4FD7A 4RS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUA A;  5H86 A;  3IGR A;  4OAE A;  2RC4 A;  2GE3 A;  5F46 A;  4MBU A;  1XEB A;  3EXN A;  1I12 A;  1SQH A;  4UA3 A;  1GHE A;  3BLN A;  1IB1 E;  3TTH A;  1QSR A;  2PC1 A;  5IB0 A;  4LX9 A;  4ONU A;  2J8M A;  1QSN A;  2EUI A;  4PK3 A;  3H4Q A;  3GY9 A;  1S5K A;  3D2M A;  3SHP A;  2DXQ A;  3D3S A;  3EY5 A;  1YVK A;  2P6E A;  3FB3 A;  4RI1 A;  5JPH A;  5HMN A;  2JEV A;  3FXT A;  1YGH A;  4KZT A;  4GS4 A;  4MJ8 A;  3R96 A;  2B4D A;  1QSO A;  4R3L A;  4KOV A;  2QIR A;  1UFH A;  3TFY A;  4FD5 A;  2FIA A;  3S6K A;  2FIW A;  4E8O A;  4XNH B;  2PSW A;  2X7B A;  4YRH A;  3FYN A;  1IYL A;  3WR7 A;  3TT2 A;  3FIX A;  2CY2 A;  4Y49 C;  1QST A;  1YVO A;  4CAX A;  5IX3 A;  2VZZ A;  4H6Z A;  2Q0Y A;  3PZJ A;  1RXT A;  3TOB A;  5KTD A;  4YFJ A;  2R7H A;  1S7F A;  4M3S A;  4MY0 A;  2HV2 A;  4NF1 A;  1P4N A;  2OZG A;  4CAW A;  4AVB A;  1KUX A;  2Q04 A;  1K4J A;  3OWC A;  2FXF A;  3R9E A;  2VQY A;  3G8W A;  1S7L A;  1Y9K A;  2OZU A;  2ZW4 A;  3JUW A;  3FBU A;  3DNS A;  4QBJ A;  5ISV A;  3JVN A;  5GCN A;  1YK3 A;  4ORF A;  4CS0 B;  1FY7 A;  4KOS A;  3P2F A;  4CRZ B;  1IYK A;  5CNP A;  2ZXV A;  1B87 A;  2ATR A;  2FCK A;  2H5M A;  4B5P B;  1Q2D A;  2G0B A;  2EVN A;  3CXP A;  4F0Y A;  4AVC A;  1LRZ A;  4KUB A;  2I79 A;  1Y9W A;  1Z9U A;  2J8R A;  1KUV A;  2JDD A;  2B58 A;  2Q7B A;  1VHS A;  4HNX B;  1M1D A;  4EVY A;  3S6F A;  2FSR A;  2FE7 A;  3S6G A;  5IV0 A;  2QEC A;  3DDD A;  1XMT A;  3TCV A;  5FVJ A;  5J8F A;  1B6B A;  2G3A A;  1S7N A;  3I9S A;  5C88 A;  2VZY A;  2PQ8 A;  1Q2C A;  2B5G A;  2OU2 A;  1PUA A;  4KVM E;  5KTA A;  4IF5 A;  3UY5 A;  1YX0 A;  3TOA A;  2J8N A;  1TIQ A;  4R87 A;  4FD4 A;  4OAD A;  1Y7R A;  4AG9 A;  3IWG A;  4KVX A;  1I1D A;  4DNC A;  4UWJ A;  1VKC A;  1MK4 A;  4XPD B;  2Z10 A;  2ZPA A;  1V0C A;  5E96 A;  5DWN A;  5KTC A;  3K9U A;  4L89 A;  4U9Y A;  2PDO A;  3TO9 A;  2KCW A;  4E2A A;  2Q44 A;  3F0A A;  4PV6 A;  4L8A A;  2OB0 A;  2BEI A;  3CXS A;  4U9Z A;  2GAN A;  2HUZ A;  2FT0 A;  2K5T A;  2B3V A;  2BL1 A;  2VEZ A;  4JXR A;  3DSB A;  1Z4E A;  2R98 A;  3SXN A;  2AE6 A;  3FNC A;  1CJW A;  2BSW A;  2G3T A;  3P2H A;  3TO7 A;  3R1K A;  5EBV A;  4AB7 A;  3I3G A;  5EC4 A;  1BO4 A;  3VWE A;  1NE9 A;  2REF A;  4BMH A;  3ZZI A;  4H89 A;  2I00 A;  4KOX A;  2Q4Y A;  4KOR A;  5F49 A;  1KUY A;  3TO6 A;  2PR8 A;  2ZW7 A;  1KZF A;  2R1I A;  1M4G A;  3D2P A;  4XPL A;  2VI7 A;  3PP9 A;  4U5Y A;  5F47 A;  5H84 A;  3R9G A;  2D4O A;  3EO4 A;  4R57 A;  4J3G A;  2VBQ A;  4H6U A;  2QML A;  3VWD A;  2B4D B;  4B5O A;  2P6G A;  2WPX A;  1P0H A;  5JQ4 A;  2R8V A;  1IIC A;  3KKW A;  3V8I A;  4II9 A;  3R9F A;  1S3Z A;  4JWP A;  1J4J A;  2JDC A;  3F5B A;  4NXY A;  2ZW5 A;  1MJA A;  1Z4R A;  4UBR A;  4XNH C;  5DWM A;  1RO5 A;  4KVO E;  3T9Y A;  3T90 A;  1MJB A;  4K30 A;  1I21 A;  2A4N A;  3C26 A;  3NE7 A;  4F6A A;  1CM0 A;  3FRM A;  1M4D A;  1WK4 A;  3DR6 A;  3LOD A;  2AJ6 A;  4FD6 A;  3W6S A;  4KOW A;  2P6F A;  2D4P A;  4IUS A;  1MJ9 A;  4HKF A;  2Y0M A;  3GYA A;  4Y49 B;  3BJ7 A;  3ZJ0 A;  2FL4 A;  1XF8 A;  4CRY B;  3W91 A;  3N7Z A;  2CNT A;  3D8P A;  4MHD A;  5I0C A;  3G3S A;  3EFA A;  2HQY A;  4KUA A;  4JXQ A;  3GKR A;  1N71 A;  1QSM A;  3S6H A;  3BJ8 A;  3E0K A;  1ON0 A;  4X5K A;  2OH1 A;  3CXQ A;  4PSW A;  4QB9 A;  4AG7 A;  4KLW A;  2B4B A;  2CNM A;  2Q4V A;  2Z11 A;  5F48 A;  4PSX A;  1OZP A;  3F8K A;  1WWZ A;  4NSQ A;  4PK2 A;  4UWI A;  4KOT A;  4JLY A;  1M4I A;  2B3U A;  4B5P A;  2ZW6 A;  4YGO A;  1BOB A;  2REE A;  3EC4 A;  2WPW A;  2B5G B;  4KOY A;  3MGD A;  4E0A A;  3QAH A;  4QC6 A;  4R3K A;  4HNW B;  2BUE A;  1Q2Y A;  4JJX A;  1NMT A;  2PR1 A;  1YRE A;  1PU9 A;  4MY3 A;  3SXO A;  3R95 A;  3TE4 A;  2F5I A;  4QVT A;  4M85 A;  1M44 A;  4R9M A;  4ZBG A;  4XPD C;  5C82 A;  1R57 A;  1S7K A;  2OZH A;  5J8C A;  2NMT A;  2GIV A;  1NSL A;  1L0C A;  1S60 A;  2ARH A;  2IL4 A;  4KOU A;  4KLV A;  2P0W A;  4NCZ A;  4XPK A;  1U6M A;  4JD6 A;  3B8G A;  4OLL A;  3QB8 A;  5HH1 A;  4CAV A;  3PGP A;  3DR8 A;  1YR0 A;  1IID A;  2JLM A;  3RYO A;  1XIX A;  3W6X A;  2PRB A;  2CNS A;  1YLE A;  1XE4 A;  2FS5 A;  4QUS A;  4MI4 A;  4I49 A;  4AVA A;  4NEX A;  2C27 A;  2O28 A;  2VXK A;  3LD2 A;  4HNY B;  2Z0Z A;  4FD7 A;  4RS2 A; 
#chains in the Genus database with same CATH topology
 3KI9 A;  4LUA A;  3IGR A;  5H86 A;  4A95 A;  2PRQ A;  4OAE A;  4C2Z A;  3IWE A;  2RC4 A;  5LYL A;  2JBJ A;  2GE3 A;  3RZA A;  4MBU A;  5F46 A;  5J1Q A;  4CYQ A;  3PEI A;  1XEB A;  4P4B A;  3D7H A;  2V8V A;  3EXN A;  5AG7 A;  1KWM A;  4UF4 A;  4ZX9 A;  1I12 A;  1SQH A;  5D8N A;  4PXD A;  3TX8 A;  4UA3 A;  5DS0 A;  1GHE A;  4OC1 A;  1ELL P;  4P4F A;  3BLN A;  3NE8 A;  3SJX A;  5HVH A;  4NJR A;  1IB1 E;  3TTH A;  1QSR A;  2GLF A;  2PC1 A;  4LQ6 A;  5IB0 A;  2F7V A;  3BI0 A;  1YQE A;  4YWY A;  3NH5 A;  4LX9 A;  4CPA A;  4ONU A;  3FED A;  2Z3P A;  2J8M A;  1HEE A;  1QSN A;  4BBH A;  3LMS A;  2EUI A;  4B14 A;  4PK3 A;  2Q7S A;  4UFV A;  5JH9 A;  3H4Q A;  3GY9 A;  4PXC A;  1S5K A;  3D2M A;  2ZEG A;  2DXQ A;  1CX8 A;  1LOK A;  3D3S A;  2ZEE A;  3SHP A;  1IY7 A;  2PIZ A;  3EY5 A;  2Q4Z A;  1ZG7 A;  1YVK A;  2P6E A;  2PJ3 A;  3FB3 A;  4OC5 A;  4RI1 A;  5JPH A;  1Y0Y A;  3CDX A;  5HMN A;  2JEV A;  3FXT A;  4CGL A;  1LAP A;  3T8W A;  1YGH A;  4KZT A;  4GS4 A;  4MJ8 A;  3R96 A;  3PBE A;  4IHM A;  2B4D A;  1H8L A;  1QSO A;  2JBK A;  4R3L A;  4KOV A;  1R43 A;  2QIR A;  8CPA A;  1UFH A;  2PJ8 A;  4NGN A;  3TC8 A;  3TFY A;  4OID A;  1F2O A;  2IJZ A;  1Z8X A;  4FD5 A;  2FIA A;  3HUV A;  3QNV A;  4P4I A;  3WT4 A;  2ZOG A;  1JWQ A;  3N5F A;  2QJ8 A;  3S6K A;  5IB9 A;  2FIW A;  4E8O A;  4XNH B;  2PSW A;  2X7B A;  3ISX A;  4YRH A;  3FYN A;  3D4U A;  1IYL A;  4PXB A;  3WR7 A;  4PPZ A;  3TT2 A;  3FIX A;  4UFX A;  4MFZ A;  3KR5 A;  2PJ2 A;  2HC9 A;  2PJ6 A;  1QMU A;  2O53 A;  3CZX A;  1AMP A;  1YLO A;  4M6H A;  2AFS A;  4MHP A;  2CY2 A;  4Q7A A;  4Y49 C;  3D67 A;  1QST A;  3IEH A;  4RUH A;  5LYD A;  1YVO A;  4CAX A;  2EWB A;  5IX3 A;  2VZZ A;  2PJC A;  4H6Z A;  2Q0Y A;  3PZJ A;  1RXT A;  3KZW A;  2YNC C;  3TOB A;  4KSA A;  3RAM A;  2ZEN A;  4MFQ A;  5KTD A;  3RNZ A;  2R7H A;  4YFJ A;  1S7F A;  1YW4 A;  4M3S A;  4MY0 A;  4C2Y A;  2HV2 A;  4NF1 A;  1P4N A;  2OZG A;  4CAW A;  4AVB A;  1F2P A;  2PJ5 A;  1OBR A;  1KUX A;  5AG4 A;  4MHZ A;  3QAY A;  2Q04 A;  1K4J A;  3OWC A;  2FXF A;  3R9E A;  2AFZ A;  1ZLI A;  2VQY A;  3K9T A;  1CPX A;  3G8W A;  1S7L A;  1Y9K A;  2OZU A;  2YNC A;  2ZW4 A;  3JUW A;  4CGO A;  1BPM A;  3FBU A;  4ZGY B;  2AFW A;  2IQ6 A;  3DNS A;  4C7H A;  4EME A;  4QBJ A;  5ISV A;  4A37 A;  3JVN A;  4M6G A;  1VGY A;  4ZY1 A;  5GCN A;  1YK3 A;  4P4E A;  4CYO A;  2IMO A;  4ORF A;  2PJB A;  4CS0 B;  2DPS A;  3BI1 A;  1FY7 A;  3KR4 A;  5A28 A;  4KOS A;  3P2F A;  4O23 A;  2YNE A;  4CRZ B;  1IYK A;  5CNP A;  3WC5 A;  2ZXV A;  1B87 A;  2ATR A;  2C6P A;  2FCK A;  2H5M A;  2VL1 A;  4IK2 A;  4MFJ A;  4A38 A;  5LRJ A;  4B5P B;  4CGP A;  5AG5 A;  3CPA A;  1Q2D A;  2G0B A;  2EVN A;  3CXP A;  4OC3 A;  4UCN A;  4HPS A;  3WC7 A;  3L2N A;  3PB8 X;  1LRZ A;  2XEF A;  2I79 A;  1Y9W A;  3CT9 A;  3IFE A;  4KUB A;  1Z9U A;  3PB9 X;  4OP4 A;  2J8R A;  1KUV A;  2JDD A;  4ZY0 A;  2B58 A;  3FEC A;  2Q7B A;  4X8I A;  4TWE A;  4F9V A;  3FMC A;  4F0X A;  3GIU A;  4X2T A;  4DUK A;  1VHS A;  4HNX B;  3D7F A;  1CP7 A;  1ZG8 A;  1M1D A;  1XJO A;  4CGM A;  4EVY A;  3S6F A;  4ZI6 A;  2FSR A;  1ELM P;  2FE7 A;  1M4L A;  4MFK A;  3S6G A;  3IU2 A;  5IV0 A;  2XEG A;  2C6C A;  2QEC A;  1PYT B;  3DDD A;  1XMT A;  3TCV A;  1XMB A;  2XEJ A;  1Z8W A;  2OOT A;  5FVJ A;  3NH4 A;  5J8F A;  1B6B A;  2G3A A;  1S7N A;  2ZEP A;  3I9S A;  5C88 A;  2VZY A;  1CBX A;  3IJ3 A;  2PQ8 A;  3RBU A;  1Q2C A;  2B5G A;  1TF9 A;  4NFR A;  1A2Z A;  2OU2 A;  2Z3L A;  1PUA A;  5LRG A;  2V8H A;  4B6Z A;  2YGW A;  4KVM E;  1HDU A;  4IF5 A;  4UEE A;  3UY5 A;  1YX0 A;  3RO0 A;  5CBM A;  5HXD A;  3V38 A;  3VAR A;  4FUU A;  3TOA A;  2AFU A;  2PJ4 A;  2J8N A;  1TIQ A;  4R87 A;  2V77 A;  4FD4 A;  4OAD A;  2AFO A;  4ZYQ A;  1Y7R A;  4C7I A;  4ZY2 A;  2ZEF A;  4AG9 A;  5BWA B;  1IOF A;  3IWG A;  4KVX A;  4H2K A;  4OME A;  3PRT A;  1I1D A;  4C68 A;  4A31 A;  4DNC A;  4LQG A;  2ZEL A;  4UWJ A;  1VKC A;  1MK4 A;  4XPD B;  1PCA A;  4BD9 A;  4MCR A;  5G20 A;  3FX6 A;  1CP6 A;  2Z10 A;  4OIW A;  4P44 A;  3B3S A;  1HDQ A;  2ZPA A;  2PJA A;  2PJ1 A;  5EMI A;  1V0C A;  3B35 A;  4Q36 A;  2NYQ A;  5E96 A;  5DWN A;  5KTC A;  3K9U A;  3S9N A;  4L89 A;  3B3V A;  2RB7 A;  3LWU A;  3NH8 A;  4U9Y A;  4A30 A;  2PDO A;  3TO9 A;  5ELY A;  3SJG A;  2KCW A;  4MCP A;  4UEF A;  4E2A A;  2Q44 A;  3F0A A;  4PV6 A;  4CGN A;  4L8A A;  4MHN A;  2OB0 A;  2BEI A;  3CXS A;  4U9Z A;  2GAN A;  4UCP A;  2HUZ A;  2FT0 A;  2ANP A;  2WSA A;  2K5T A;  3FEE A;  4OC4 A;  2B3V A;  2BL1 A;  2BO9 A;  2VEZ A;  4NGS A;  5HVG A;  4JXR A;  2AFM A;  2I3C A;  3DSB A;  4UCM A;  1Z4E A;  2R98 A;  2XEI A;  3DGV A;  3SXN A;  3IWW A;  1Q7L A;  2AE6 A;  3FNC A;  1CJW A;  2BSW A;  3FVL A;  3JTK A;  1FT7 A;  2G3T A;  2YND A;  3P2H A;  2GU2 A;  3TO7 A;  3R1K A;  5EBV A;  4DJL A;  4AB7 A;  3I3G A;  5EC4 A;  1BO4 A;  3VWE A;  1NE9 A;  2REF A;  1RTQ A;  4BMH A;  3VAT A;  2CTC A;  3PB6 X;  2JEW A;  3ZZI A;  5A27 A;  3D68 A;  2PJ9 A;  4H89 A;  2PE3 A;  2CIJ A;  2GFQ A;  4JZ0 A;  2I00 A;  3KQZ A;  1Z5R A;  4KOX A;  2Q4Y A;  2EBJ A;  3FF3 A;  4KOR A;  5F49 A;  5KTA A;  1KUY A;  3TO6 A;  3KHZ A;  3PB7 X;  2PR8 A;  4G1P A;  4NGQ A;  2ZEO A;  3MN8 A;  2WZN A;  2ZW7 A;  2ZEH A;  2OR4 A;  3A9L A;  1KZF A;  2R1I A;  2GLJ A;  1CPS A;  5LYF A;  1M4G A;  4FBE A;  4K3N A;  3D2P A;  4NGT A;  4XPL A;  4EFD A;  2VI7 A;  4MHY A;  3PP9 A;  4U5Y A;  1VHE A;  5F47 A;  5H84 A;  3R9G A;  3GLJ A;  2Z3N A;  3WAB A;  1VIX A;  4FD7 A;  2D4O A;  3EO4 A;  4R57 A;  4J3G A;  2VBQ A;  4H6U A;  4NGR A;  1IU8 A;  4OC2 A;  2CXA A;  4YU9 A;  4R76 A;  5K8M A;  2RFH A;  4X3R A;  2QML A;  1ARM A;  4OC0 A;  2Z3M A;  4A33 A;  5I4M A;  4ONW A;  4CAE A;  3VWD A;  2B4D B;  4B5O A;  2P6G A;  2WPX A;  4GM5 A;  2O4H A;  1TKJ A;  1P0H A;  1JQG A;  5JQ4 A;  2Q51 A;  2R8V A;  1IIC A;  3KKW A;  3V8I A;  3KQX A;  4EWT A;  2PVV A;  3R9F A;  4II9 A;  1LCP A;  1S3Z A;  3DLJ A;  1AUG A;  4JWP A;  1J4J A;  2JDC A;  3F5B A;  4R6T A;  4NXY A;  2ZW5 A;  1YME A;  4FWU A;  1YSJ A;  1MJA A;  2Z3K A;  1Z4R A;  4UBR A;  4XNH C;  5DWM A;  1RO5 A;  3B3W A;  4KVO E;  3T9Y A;  3T90 A;  1MJB A;  3B2Y A;  4K30 A;  1GYT A;  4KS9 A;  1I21 A;  2A4N A;  2WUU A;  3C26 A;  3VH9 A;  3NE7 A;  4F6A A;  2AFX A;  2PCU A;  1CM0 A;  3SI1 A;  3S9L A;  1IOI A;  3FRM A;  3D66 A;  3H8E A;  1LFW A;  1M4D A;  1WK4 A;  3DR6 A;  3HLP A;  3IO1 A;  3LOD A;  4NGM A;  1LAM A;  2AJ6 A;  2BOA A;  4FD6 A;  4UEZ A;  3W6S A;  2C6G A;  2ZOF A;  4KOW A;  2P6F A;  2D4P A;  4MFP A;  3KL9 A;  3NA6 A;  4IUS A;  1BAV A;  1MJ9 A;  3D7D A;  4W9Y A;  4HKF A;  4NGP A;  4B12 A;  2Y0M A;  3GYA A;  3KAS A;  4Y49 B;  4A94 A;  3BJ7 A;  1UWY A;  1BLL E;  2FL4 A;  1XF8 A;  2V8G A;  4ZX8 A;  3S9M A;  2ZED A;  3ZJ0 A;  4CRY B;  4CYN A;  3PFO A;  4A32 A;  3W91 A;  3N7Z A;  1F57 A;  2CNT A;  5K8N A;  3D8P A;  1QQ9 A;  4MHD A;  4RN7 A;  3LAC A;  5I0C A;  3G3S A;  4CYP A;  3EFA A;  2PJ0 A;  4P6Y A;  2HQY A;  1LAN A;  2DPT A;  4KUA A;  4MMO A;  4JXQ A;  3GKR A;  1N71 A;  1QSM A;  3S6H A;  4GXH A;  4MCS A;  4MFL A;  3BJ8 A;  4WJB A;  3E0K A;  5G21 A;  4A2Z A;  1ON0 A;  1TKH A;  4UIA A;  4X5K A;  2OH1 A;  2BCO A;  5JM6 A;  3CXQ A;  4PSW A;  3H8G A;  3B3C A;  6CPA A;  4QB9 A;  2NSM A;  4AG7 A;  4TNU A;  4KLW A;  2B4B A;  3D7G A;  2CNM A;  5G22 A;  4AVC A;  5K8P A;  2Q4V A;  3H8F A;  2Z11 A;  2Z3O A;  5G1Z A;  5LYI A;  5F48 A;  3BXM A;  3SI2 A;  4UFW A;  5THW A;  3PB4 X;  2ZEM A;  3ISZ A;  4PSX A;  4R7M A;  1ZLH A;  1OZP A;  4MRI A;  3F8K A;  3H5Z A;  1WWZ A;  2Q43 A;  2QYV A;  4B13 A;  3I1U A;  4NSQ A;  4PK2 A;  4BIN A;  3FJU A;  4UWI A;  4KOT A;  4JLY A;  1M4I A;  4MCQ A;  2DEA A;  3IC1 A;  4KSI A;  1ARL A;  2B3U A;  4B5P A;  3B3T A;  4B10 A;  2ZW6 A;  4YGO A;  2ABZ A;  1BOB A;  2REE A;  5D29 A;  3GUX A;  3SJE A;  3EC4 A;  2WPW A;  3PFE A;  4A39 A;  2B5G B;  3PBB A;  3K2K A;  4NJQ A;  5AGE A;  4F8Z A;  4OKO A;  4KOY A;  3GB0 A;  1Y7E A;  2F8H A;  3MGD A;  1ZO0 A;  1CG2 A;  4E0A A;  3QAH A;  5K8O A;  3IIB A;  3FH4 A;  4QC6 A;  4R3K A;  4HNW B;  2BUE A;  1Q2Y A;  2PIY A;  2EK8 A;  1XFO A;  4PQA A;  4JJX A;  4WWV A;  2G9D A;  4AXV A;  3B7I A;  3BHX A;  4IAV A;  4R8F A;  1NMT A;  2PR1 A;  3CPX A;  4Q38 A;  3V7Z A;  2ODF A;  1YRE A;  1PU9 A;  4MY3 A;  3SXO A;  3R95 A;  3TE4 A;  2PVW A;  4FAI A;  1TF8 A;  2F5I A;  2GRE A;  2POK A;  4QVT A;  4M85 A;  1M44 A;  4C2X A;  4R9M A;  2J9A A;  3KHX A;  4PXE A;  4ZBG A;  4XPD C;  4Z65 A;  5C82 A;  1R57 A;  1XOV A;  1TKF A;  4P45 A;  4B11 A;  4CAF A;  1TXR A;  2FVG A;  4UIB A;  2QVP A;  2WYR A;  3MRU A;  2EK9 A;  3WC6 A;  1S7K A;  1Z8T A;  4P4J A;  1XBU A;  4MXU A;  5LRK A;  1EE3 P;  2OZH A;  5J8C A;  2NMT A;  4DYO A;  2GIV A;  1NSL A;  1L0C A;  2CF4 A;  4P10 A;  1S60 A;  2ARH A;  1AYE A;  1Y0R A;  2IL4 A;  5HVF A;  4KSF A;  4KOU A;  4KLV A;  1BPN A;  2P0W A;  4NCZ A;  2CTB A;  4P4D A;  4XPK A;  5CPA A;  1IGB A;  2DF5 A;  2EO8 A;  4JD6 A;  3B8G A;  3KGQ A;  5JGF A;  1VHO A;  4OLL A;  4F9U A;  3QB8 A;  3SI0 A;  5HH1 A;  3NFZ A;  1Z8L A;  5F09 A;  4JYW A;  5AG6 A;  1Z2L A;  2C1C A;  1DE4 C;  1NSA A;  1X12 A;  1XRY A;  1ZG9 A;  4CAV A;  1FNO A;  3PGP A;  3DR8 A;  1DTD A;  4F0Y A;  7CPA A;  1YW6 A;  2JLM A;  1YR0 A;  1IID A;  2V8D A;  3IU1 A;  3RYO A;  1XIX A;  3W6X A;  2PRB A;  3JRU A;  2CNS A;  2HB6 A;  1YLE A;  1XE4 A;  2FS5 A;  4QUS A;  4MI4 A;  4I49 A;  4M6I A;  4AVA A;  3SJF A;  2PJ7 A;  4NEX A;  2C27 A;  2O28 A;  2VXK A;  1X10 A;  3LD2 A;  4HNY B;  2Z0Z A;  1U6M A;  1R3N A;  4RS2 A; 
#chains in the Genus database with same CATH homology
 4LUA A;  5H86 A;  3IGR A;  4A95 A;  4OAE A;  4C2Z A;  3IWE A;  2RC4 A;  2GE3 A;  5F46 A;  4MBU A;  4CYQ A;  1XEB A;  3EXN A;  5AG7 A;  1I12 A;  1SQH A;  4UA3 A;  1GHE A;  3BLN A;  1IB1 E;  3TTH A;  1QSR A;  2PC1 A;  5IB0 A;  4LX9 A;  4ONU A;  2Z3P A;  2J8M A;  1QSN A;  4BBH A;  2EUI A;  4B14 A;  4PK3 A;  4UFV A;  3H4Q A;  3GY9 A;  1S5K A;  3D2M A;  3SHP A;  2DXQ A;  3D3S A;  3EY5 A;  1YVK A;  2P6E A;  3FB3 A;  4RI1 A;  5JPH A;  5HMN A;  2JEV A;  3FXT A;  4CGL A;  1YGH A;  4KZT A;  4GS4 A;  4MJ8 A;  3R96 A;  2B4D A;  1QSO A;  4R3L A;  4KOV A;  2QIR A;  1UFH A;  3TFY A;  4FD5 A;  2FIA A;  3S6K A;  2FIW A;  4E8O A;  4XNH B;  2PSW A;  2X7B A;  4YRH A;  3FYN A;  1IYL A;  3WR7 A;  3TT2 A;  3FIX A;  4UFX A;  4MFZ A;  2CY2 A;  4Y49 C;  1QST A;  1YVO A;  4CAX A;  5IX3 A;  2VZZ A;  4H6Z A;  2Q0Y A;  3PZJ A;  1RXT A;  2YNC C;  3TOB A;  4KSA A;  4MFQ A;  5KTD A;  4YFJ A;  2R7H A;  1S7F A;  4M3S A;  4MY0 A;  4C2Y A;  2HV2 A;  4NF1 A;  1P4N A;  2OZG A;  4CAW A;  4AVB A;  1KUX A;  5AG4 A;  2Q04 A;  1K4J A;  3OWC A;  2FXF A;  3R9E A;  2VQY A;  3G8W A;  1S7L A;  1Y9K A;  2OZU A;  2YNC A;  2ZW4 A;  3JUW A;  4CGO A;  3FBU A;  4ZGY B;  3DNS A;  4C7H A;  4QBJ A;  5ISV A;  3JVN A;  5GCN A;  1YK3 A;  4CYO A;  4ORF A;  4CS0 B;  2DPS A;  1FY7 A;  5A28 A;  4KOS A;  3P2F A;  2YNE A;  4CRZ B;  1IYK A;  5CNP A;  2ZXV A;  1B87 A;  2ATR A;  2FCK A;  2H5M A;  4B5P B;  4MFJ A;  4CGP A;  5AG5 A;  1Q2D A;  2G0B A;  2EVN A;  3CXP A;  4C2X A;  4UCN A;  4F0Y A;  4AVC A;  1LRZ A;  4KUB A;  2I79 A;  1Y9W A;  1Z9U A;  2J8R A;  1KUV A;  2JDD A;  2B58 A;  2Q7B A;  4F0X A;  1VHS A;  4HNX B;  1M1D A;  4CGM A;  4EVY A;  3S6F A;  2FSR A;  2FE7 A;  4MFK A;  3S6G A;  3IU2 A;  5IV0 A;  2QEC A;  3DDD A;  1XMT A;  3TCV A;  5FVJ A;  5J8F A;  1B6B A;  2G3A A;  1S7N A;  3I9S A;  5C88 A;  2VZY A;  2PQ8 A;  1Q2C A;  2B5G A;  2Z3L A;  2OU2 A;  1PUA A;  2YGW A;  4KVM E;  4IF5 A;  5KTA A;  3UY5 A;  1YX0 A;  3TOA A;  2J8N A;  1TIQ A;  4R87 A;  4FD4 A;  4OAD A;  1Y7R A;  4C7I A;  4AG9 A;  5BWA B;  3IWG A;  4KVX A;  1I1D A;  4C68 A;  4A31 A;  4DNC A;  4UWJ A;  1VKC A;  1MK4 A;  4XPD B;  5G20 A;  2Z10 A;  2ZPA A;  1V0C A;  4Q36 A;  5E96 A;  5DWN A;  5KTC A;  3K9U A;  4L89 A;  4U9Y A;  4A30 A;  2PDO A;  3TO9 A;  2KCW A;  4E2A A;  2Q44 A;  3F0A A;  4PV6 A;  4CGN A;  4L8A A;  2OB0 A;  2BEI A;  3CXS A;  4U9Z A;  2GAN A;  4UCP A;  2HUZ A;  2FT0 A;  2WSA A;  2K5T A;  2B3V A;  2BL1 A;  2VEZ A;  4JXR A;  3DSB A;  4UCM A;  1Z4E A;  2R98 A;  3SXN A;  2AE6 A;  3FNC A;  1CJW A;  2BSW A;  3JTK A;  2YND A;  2G3T A;  3P2H A;  3TO7 A;  3R1K A;  5EBV A;  4AB7 A;  3I3G A;  5EC4 A;  1BO4 A;  3VWE A;  1NE9 A;  2REF A;  4BMH A;  3ZZI A;  5A27 A;  4H89 A;  2I00 A;  4KOX A;  2Q4Y A;  4KOR A;  5F49 A;  1KUY A;  3TO6 A;  2PR8 A;  2ZW7 A;  3A9L A;  1KZF A;  2R1I A;  1M4G A;  3D2P A;  4XPL A;  2VI7 A;  3PP9 A;  4U5Y A;  5F47 A;  5H84 A;  3R9G A;  2Z3N A;  2D4O A;  3EO4 A;  4R57 A;  4J3G A;  2VBQ A;  4H6U A;  2CXA A;  2QML A;  2Z3M A;  4A33 A;  4CAE A;  3VWD A;  2B4D B;  4B5O A;  2P6G A;  2WPX A;  1P0H A;  5JQ4 A;  2R8V A;  1IIC A;  3KKW A;  3V8I A;  4II9 A;  3R9F A;  1S3Z A;  4JWP A;  1J4J A;  2JDC A;  3F5B A;  4NXY A;  2ZW5 A;  1MJA A;  2Z3K A;  1Z4R A;  4UBR A;  4XNH C;  5DWM A;  1RO5 A;  4KVO E;  3T9Y A;  3T90 A;  1MJB A;  4K30 A;  4KS9 A;  1I21 A;  2A4N A;  2WUU A;  3C26 A;  3NE7 A;  4F6A A;  1CM0 A;  3FRM A;  1M4D A;  1WK4 A;  3DR6 A;  4A32 A;  3LOD A;  2AJ6 A;  4FD6 A;  3W6S A;  4KOW A;  2P6F A;  2D4P A;  4MFP A;  4IUS A;  1MJ9 A;  4HKF A;  4B12 A;  2Y0M A;  3GYA A;  4Y49 B;  3BJ7 A;  3ZJ0 A;  2FL4 A;  1XF8 A;  4CRY B;  4CYN A;  3W91 A;  3N7Z A;  2CNT A;  3D8P A;  4MHD A;  5I0C A;  3G3S A;  4CYP A;  3EFA A;  2HQY A;  4KUA A;  2DPT A;  4JXQ A;  3GKR A;  1N71 A;  1QSM A;  3S6H A;  4MFL A;  3BJ8 A;  3E0K A;  5G21 A;  4A2Z A;  1ON0 A;  4X5K A;  2OH1 A;  3CXQ A;  4PSW A;  4QB9 A;  4AG7 A;  4KLW A;  2B4B A;  5G22 A;  2CNM A;  2Q4V A;  2Z11 A;  2Z3O A;  5G1Z A;  5F48 A;  4UFW A;  4PSX A;  1OZP A;  3F8K A;  3H5Z A;  1WWZ A;  4B13 A;  4NSQ A;  4PK2 A;  4UWI A;  4KOT A;  4JLY A;  1M4I A;  2B3U A;  4B5P A;  4B10 A;  2ZW6 A;  4YGO A;  1BOB A;  2REE A;  3EC4 A;  2WPW A;  2B5G B;  5AGE A;  4KOY A;  3MGD A;  1ZO0 A;  4E0A A;  3QAH A;  4QC6 A;  4R3K A;  4HNW B;  2BUE A;  1Q2Y A;  4JJX A;  1NMT A;  2PR1 A;  4Q38 A;  1YRE A;  1PU9 A;  4MY3 A;  3SXO A;  3R95 A;  3TE4 A;  2F5I A;  4QVT A;  4M85 A;  1M44 A;  4R9M A;  4ZBG A;  4XPD C;  5C82 A;  1R57 A;  4B11 A;  4CAF A;  1S7K A;  2OZH A;  5J8C A;  2NMT A;  2GIV A;  1NSL A;  1L0C A;  1S60 A;  2ARH A;  2IL4 A;  4KSF A;  4KOU A;  4KLV A;  2P0W A;  4NCZ A;  4XPK A;  1U6M A;  4JD6 A;  3B8G A;  4OLL A;  3QB8 A;  5HH1 A;  5AG6 A;  4CAV A;  3PGP A;  3DR8 A;  1YR0 A;  1IID A;  2JLM A;  3IU1 A;  3RYO A;  1XIX A;  3W6X A;  2PRB A;  2CNS A;  1YLE A;  1XE4 A;  2FS5 A;  4QUS A;  4MI4 A;  4I49 A;  4AVA A;  4NEX A;  2C27 A;  2O28 A;  2VXK A;  3LD2 A;  4HNY B;  2Z0Z A;  4FD7 A;  4RS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...