2HUZA

Crystal structure of gnpnat1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glucosamine-phosphate N-acetyltransferase 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
total genus 41
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2huzA01
2REEA 4NEXA 1YX0A 1RO5A 1I1DA 4X5KA 3E0KA 5FVJA 4AG9A 3EY5A 3JVNA 4F0YA 1IIDA 4M3SA 4KVME 3TE4A 4ONUA 2WPXA 3GYAA 1WWZA 4KOUA 1KZFA 1YVKA 1WK4A 4YGOA 3VWEA 4PSWA 4B5PB 4CAVA 4HNWB 2WPWA 4RS2A 4NCZA 5IB0A 4K30A 1KUXA 1B87A 4KORA 3JUWA 3FXTA 4OADA 1Q2DA 3TO7A 2OU2A 4AG7A 5H86A 4B5PA 3V8IA 3LODA 3R9GA 2OB0A 1RXTA 4AVBA 2DXQA 1Y7RA 2QIRA 3TO9A 2I00A 5ISVA 4PK2A 2JDCA 4QVTA 3FIXA 4XPDC 5J8FA 3W6SA 4MBUA 2VZZA 3KKWA 2PR8A 5IX3A 4QB9A 5C82A 2Z0ZA 4AB7A 3QAHA 4LUAA 3N7ZA 3R9EA 3W6XA 1SQHA 4CAWA 5J8CA 1QSRA 1S7NA 4KOYA 4MI4A 1BOBA 1XF8A 1NMTA 1Y9WA 3TOAA 4XPDB 2FL4A 2B3UA 2D4PA 3FNCA 3EO4A 1V0CA 3CXSA 3PP9A 1I12A 2AJ6A 2B4DB 1MJBA 2FIWA 1YR0A 2CNMA 4KUAA 3SXNA 2FIAA 2CNSA 2VEZA 2JLMA 4XNHB 2B4BA 1CM0A 1N71A 2Z11A 1KUVA 3FRMA 5F48A 1Q2CA 3BJ8A 3PZJA 3I9SA 2R8VA 2PDOA 2PRBA 1TIQA 4NSQA 2Y0MA 4KVXA 1XEBA 4PV6A 1M4IA 2FT0A 2ZW5A 4GS4A 1FY7A 4BMHA 3S6HA 1QSTA 1NE9A 4E8OA 4U9YA 4FD7A 2BL1A 1M4GA 4KOSA 4XNHC 1QSMA 2Z10A 3T90A 1PU9A 3G3SA 4M85A 1B6BA 4YRHA 1P4NA 2OZHA 5DWNA 5F47A 1VKCA 4RI1A 1BO4A 3P2FA 2J8RA 2R7HA 1M44A 1MJAA 2GE3A 2ARHA 2RC4A 4FD5A 4UBRA 2J8MA 2PQ8A 4B5OA 3DR8A 4R3LA 3W91A 3QB8A 4CRZB 2BEIA 1YLEA 2R1IA 1J4JA 4NXYA 4OLLA 4I49A 2F5IA 4HKFA 1U6MA 5GCNA 2QECA 3K9UA 4KLWA 4KZTA 1QSNA 1OZPA 2FS5A 4U9ZA 4KOWA 4KUBA 2P6GA 5KTAA 2ZW7A 1UFHA 3D8PA 3T9YA 2QMLA 4J3GA 3I3GA 2X7BA 5IV0A 1KUYA 1S7LA 2JEVA 2O28A 4FD4A 2I79A 2GANA 1L0CA 3R1KA 3OWCA 4L8AA 3RYOA 2P6FA 4OAEA 1S60A 2PSWA 4MY3A 1Z4EA 3DDDA 3CXPA 1Q2YA 3R9FA 5DWMA 2PR1A 5EC4A 4H6ZA 2OH1A 2VBQA 2B3VA 2GIVA 5EBVA 4U5YA 3F0AA 2JDDA 2EVNA 2FSRA 2REFA 1IYKA 4L89A 5F49A 2HQYA 3DSBA 4UA3A 1S3ZA 1S7FA 1S5KA 3R95A 4H89A 5E96A 2B4DA 5I0CA 2IL4A 2CY2A 2Q04A 1YREA 2P0WA 3VWDA 4CAXA 3IWGA 2ZXVA 2OZGA 1K4JA 4II9A 3F8KA 2R98A 1VHSA 2BSWA 3GY9A 3EXNA 2ZW6A 1M4DA 4FD6A 3FB3A 2ZPAA 4JWPA 2ATRA 4F6AA 3TFYA 1P0HA 4E2AA 4JJXA 1IB1E 4ORFA 5HMNA 2FCKA 3ZJ0A 1I21A 3P2HA 3BJ7A 2G3TA 4PSXA 5F46A 4KOXA 5C88A 2Q4YA 4JXRA 3TCVA 2G3AA 4UWIA 3CXQA 3TTHA 3IGRA 5JQ4A 4PK3A 3TO6A 3FBUA 3TOBA 3GKRA 2K5TA 4KOTA 4XPLA 4QC6A 2Q4VA 2B5GA 4Y49C 4MJ8A 3S6GA 4JD6A 2Q44A 3WR7A 5KTCA 1Z4RA 1IYLA 3S6KA 2EUIA 3D2PA 4R57A 4JXQA 1M1DA 2G0BA 4HNYB 2HUZA 3D2MA 1Y9KA 4IUSA 2C27A 3ZZIA 3NE7A 3H4QA 1ON0A 2VXKA 2NMTA 4R3KA 4KVOE 5H84A 4MY0A 2VQYA 4AVCA 4AVAA 4UWJA 3FYNA 3SXOA 4CS0B 3LD2A 3EC4A 4E0AA 2KCWA 3S6FA 1PUAA 4NF1A 4HNXB 3UY5A 4ZBGA 1NSLA 3SHPA 2BUEA 2P6EA 2ZW4A 1XE4A 5JPHA 2AE6A 1GHEA 3R96A 1S7KA 2FXFA 4Y49B 3DNSA 3EFAA 4MHDA 4XPKA 3D3SA 2A4NA 2J8NA 5HH1A 4KOVA 2D4OA 3BLNA 1YGHA 4LX9A 2HV2A 4YFJA 1XMTA 4H6UA 2PC1A 1MJ9A 4DNCA 5KTDA 2CNTA 3C26A 3MGDA 4QBJA 3F5BA 4JLYA 1R57A 3G8WA 2VZYA 3B8GA 1CJWA 1XIXA 2Q0YA 1YK3A 3DR6A 4KLVA 4R87A 1LRZA 4EVYA 2B5GB 2H5MA 2Q7BA 3TT2A 5CNPA 1Z9UA 2B58A 1QSOA 1YVOA 3PGPA 4IF5A 2VI7A 4CRYB 2FE7A 1MK4A 1IICA 4R9MA 2OZUA 4QUSA
chains in the Genus database with same CATH superfamily
2REEA 3LACA 4NEXA 4MFJA 3KL9A 4Q7AA 1YX0A 1RO5A 4CGLA 1I1DA 4X5KA 3E0KA 3DLJA 5FVJA 1A2ZA 1Y7EA 4CYOA 4AG9A 3EY5A 3JVNA 2PJ3A 4F0YA 4TNUA 4Q36A 1IIDA 1Y0RA 2BCOA 4KVME 4M3SA 3TE4A 4ONUA 4CGPA 2WPXA 3GYAA 1WWZA 1TKFA 4KOUA 1BAVA 1KZFA 5THWA 1YVKA 5HVHA 2CTBA 2JBKA 3HUVA 4IHMA 2Z3KA 1WK4A 3LMSA 3KGQA 1LOKA 4YGOA 3VWEA 3CDXA 4PSWA 4B5PB 4CAVA 4HNWB 2WPWA 2C1CA 1XBUA 3SJEA 2V77A 1VHOA 4RS2A 2HB6A 2CIJA 4NCZA 5IB0A 3B3CA 2QVPA 4ZY0A 4K30A 1KUXA 4X8IA 3PB6X 1B87A 4KORA 2PJ4A 3QAYA 4ZX9A 3JUWA 4RUHA 3FXTA 2V8DA 2AFOA 4OADA 1Q2DA 4F0XA 1HEEA 1CX8A 2WSAA 2J9AA 2OU2A 3TO7A 3KHXA 4NJRA 5H86A 4AG7A 2Q4ZA 1TKHA 3JRUA 4TWEA 3V8IA 3DGVA 4B5PA 2ZEEA 3LODA 2VL1A 1IOIA 1NSAA 2OB0A 2GLJA 3R9GA 2GLFA 1RXTA 3VATA 4AVBA 2DXQA 1R3NA 1Y7RA 3D68A 3H5ZA 2QIRA 3TO9A 2I00A 5ISVA 4PK2A 2ABZA 2PVVA 2JDCA 4QVTA 2FVGA 3FIXA 4XPDC 5J8FA 3L2NA 3W6SA 4UFVA 3A9LA 3CT9A 1F57A 4MBUA 5K8PA 2CXAA 5LRGA 2VZZA 4AXVA 3KKWA 2PR8A 5AG6A 5IX3A 4QB9A 3SJFA 2Z3MA 5C82A 2Z0ZA 1YSJA 5G22A 3PB4X 4AB7A 4DUKA 3QAHA 4LUAA 4A2ZA 2ZENA 5LYIA 3N7ZA 3R9EA 3W6XA 3V38A 2ZELA 5K8OA 1SQHA 3RNZA 4CAWA 2QJ8A 2ZEOA 5J8CA 1QSRA 3QNVA 4GXHA 1S7NA 3WC5A 4KOYA 4MI4A 5IB9A 1BOBA 3T8WA 5AG4A 1XF8A 4MCSA 4CYNA 3WABA 4FWUA 1NMTA 1Y9WA 4C2ZA 3TOAA 4XPDB 2FL4A 2CTCA 2OOTA 4PQAA 4F9UA 4CAEA 2B3UA 4MCPA 4P44A 2D4PA 3FNCA 4UIBA 1TKJA 3IO1A 4CGOA 1M4LA 3HLPA 3EO4A 5J1QA 1V0CA 3CXSA 1GYTA 2ODFA 3PP9A 1I12A 2AJ6A 3D4UA 2B4DB 3KR4A 1JWQA 1MJBA 1TF9A 3FVLA 2FIWA 1YR0A 1Z8LA 1ARMA 2CNMA 3KASA 4KUAA 4B10A 4EMEA 2JBJA 3B3VA 3SXNA 2FIAA 2GU2A 2CNSA 5D29A 5G21A 3KQZA 2VEZA 1KWMA 2JLMA 4XNHB 2B4BA 1CM0A 4B6ZA 3GIUA 1N71A 3IJ3A 2Z11A 4DJLA 1F2OA 2NYQA 1KUVA 3FRMA 2HC9A 3BXMA 3SI1A 2I3CA 3NH4A 4MRIA 5F48A 4UIAA 1Q2CA 3BJ8A 4ZI6A 3IU2A 3PZJA 3I9SA 2R8VA 2PDOA 2PRBA 4FUUA 3S9NA 4MCRA 1TIQA 4MFZA 2RFHA 4NSQA 4OC1A 2Y0MA 4KVXA 1XEBA 4NGNA 1LCPA 2BOAA 2AFSA 2PJ6A 1M4IA 3BHXA 1YW4A 2DEAA 2Z3OA 4PV6A 2FT0A 4IAVA 4K3NA 1Z2LA 2WYRA 4GM5A 4MHZA 4NJQA 4RN7A 2ZW5A 2XEGA 3D66A 4GS4A 1IGBA 3D7GA 1FY7A 4BBHA 3GLJA 4WJBA 3MN8A 3I1UA 3RBUA 4BMHA 5D8NA 1XOVA 3S6HA 1YQEA 1QSTA 2AFZA 3FX6A 2PJAA 1NE9A 4KS9A 4E8OA 4U9YA 1CP6A 4FD7A 2BL1A 1M4GA 2BO9A 4KOSA 1FT7A 2AFWA 2QYVA 4XNHC 1QSMA 2Z10A 2ZEFA 4W9YA 3D7HA 3SJGA 2Q51A 4A95A 4F8ZA 1IU8A 3GUXA 3T90A 1PU9A 1QQ9A 4NGQA 4OC4A 3G3SA 3PB9X 1LFWA 4M85A 2YNCA 1B6BA 2PIYA 1CPXA 3D7DA 4YRHA 1Z8TA 3CPXA 4B13A 5A28A 1HDQA 2PJ8A 2Z3NA 4MFLA 2PJ0A 1P4NA 2OZHA 3KHZA 5DWNA 5F47A 1VKCA 4RI1A 1BO4A 2O4HA 2J8RA 3P2FA 4ZGYB 2R7HA 4P4FA 1IOFA 1Z5RA 1TF8A 2PCUA 1M44A 4M6IA 2ZOFA 1R43A 1MJAA 1ZG8A 2GE3A 2ARHA 4MFKA 2RC4A 4CPAA 4FD5A 4HPSA 2F8HA 4B12A 4FBEA 4UBRA 2J8MA 4PXDA 2PQ8A 4A33A 4B5OA 3DR8A 5EMIA 3D67A 3KI9A 4R3LA 3W91A 2YNCC 2EK8A 3FH4A 3IWEA 5HVGA 3QB8A 4CRZB 5K8NA 4C2XA 3D7FA 2BEIA 1AYEA 4UFWA 2G9DA 2XEFA 2PJ9A 1YLEA 4MMOA 2R1IA 4OKOA 4P4IA 5HVFA 1IY7A 1J4JA 4O23A 4C68A 1ZLIA 4NXYA 4OLLA 5CBMA 4I49A 2F5IA 3CZXA 1U6MA 4HKFA 2QECA 3K9UA 5GCNA 1HDUA 4KSFA 4OMEA 4UCNA 4KLWA 4KZTA 8CPAA 2ANPA 1QSNA 3PEIA 3NH8A 4PXEA 3FMCA 4YU9A 2PE3A 1OZPA 2FS5A 3FEEA 3GB0A 4U9ZA 1LAPA 2PJ1A 3KR5A 1YLOA 4KOWA 4KUBA 2P6GA 5KTAA 2YNDA 1UFHA 2ZW7A 3D8PA 3T9YA 2QMLA 6CPAA 1CBXA 1ELLP 4J3GA 1PCAA 3ISZA 3I3GA 2X7BA 5G1ZA 5IV0A 3SI0A 4UEFA 1KUYA 1S7LA 2JEVA 4OC3A 2O28A 3NH5A 3H8GA 4FD4A 2I79A 4X3RA 2GANA 1L0CA 3R1KA 3TX8A 4IK2A 3PFEA 3OWCA 4L8AA 2ZEGA 3RYOA 4A30A 2P6FA 4OAEA 4OC0A 1S60A 2PSWA 5I4MA 2GREA 4P4JA 4MY3A 1Z4EA 3DDDA 4R7MA 1UWYA 5CPAA 3CXPA 1Q2YA 1TXRA 3R9FA 5DWMA 2IJZA 3TC8A 2PR1A 5EC4A 4H6ZA 5LYFA 2OH1A 2EO8A 5JGFA 2V8HA 2VBQA 2B3VA 3IWWA 2GIVA 2AFMA 4U5YA 3F0AA 5EBVA 3V7ZA 4C2YA 2JDDA 2CF4A 2EVNA 2FSRA 1H8LA 1RTQA 2POKA 1IYKA 2REFA 3CPAA 4OIWA 3WC6A 5JM6A 4A32A 4L89A 5F49A 2HQYA 3DSBA 2WZNA 4UA3A 1S3ZA 1S7FA 1DTDA 2DF5A 4MFQA 1S5KA 3R95A 4M6GA 4H89A 2O53A 5AG7A 3ISXA 5E96A 1Y0YA 2B4DA 2RB7A 5AG5A 5I0CA 2IL4A 4C7IA 4MFPA 4MHPA 2CY2A 2Q04A 1YREA 3PBEA 2P0WA 3VWDA 4CAXA 4UCPA 1DE4C 3IWGA 2ZXVA 2EBJA 1Z8XA 2OZGA 4UCMA 5LRJA 1K4JA 4II9A 3F8KA 3IEHA 1VGYA 2PRQA 3B3TA 3FECA 4Q38A 2R98A 4A94A 4EFDA 1VHSA 2BSWA 3GY9A 3EXNA 2ZW6A 1M4DA 2PVWA 4FD6A 4UEZA 3FB3A 2ZPAA 4JWPA 3S9LA 4BINA 4ZY1A 4NGMA 4ONWA 1VHEA 4NGTA 4NGSA 2ATRA 2JEWA 4F6AA 2PJBA 4M6HA 1ARLA 3TFYA 1P0HA 4E2AA 4JJXA 2EK9A 1XRYA 3PFOA 3PBBA 1IB1E 4ORFA 5HMNA 5HXDA 2FCKA 3RO0A 4JYWA 3ZJ0A 1I21A 3WC7A 1YMEA 4F9VA 4KSIA 3P2HA 5LRKA 3BJ7A 2G3TA 4PSXA 5F46A 4KOXA 4Z65A 5C88A 4R76A 4X2TA 2Q4YA 1AMPA 4MHYA 4JXRA 3TCVA 2G3AA 4UWIA 3CXQA 3TTHA 3IGRA 5JQ4A 4PK3A 2Q7SA 3TO6A 4PXBA 4MCQA 3SI2A 2Z3LA 3FBUA 4CAFA 3TOBA 3GKRA 2K5TA 4KOTA 4XPLA 4QC6A 2Q4VA 2B5GA 4Y49C 3B3WA 1OBRA 3KZWA 5LYDA 4MJ8A 2PJ2A 4P4DA 3S6GA 4JD6A 2Q44A 1ZLHA 4CGMA 3K9TA 4UFXA 3WR7A 3SJXA 4CGNA 5KTCA 3VARA 1Z4RA 2NSMA 4P4EA 1IYLA 3S6KA 3IU1A 4LQGA 4C7HA 1JQGA 4NGRA 2EUIA 3D2PA 3KQXA 4R57A 4JXQA 1M1DA 2G0BA 4HNYB 2YNEA 2F7VA 2HUZA 4P10A 1Q7LA 3D2MA 3NFZA 1Y9KA 4OC2A 4IUSA 3H8EA 2C27A 2Z3PA 4KSAA 2OR4A 1PYTB 3H8FA 4YWYA 4B11A 3ZZIA 3NE7A 3FEDA 4R6TA 4UEEA 3H4QA 2ZEHA 1ON0A 4ZYQA 3MRUA 1BPMA 2VXKA 1BLLE 1XFOA 2NMTA 3NA6A 7CPAA 1CG2A 1LANA 4R3KA 4KVOE 5H84A 4ZX8A 2C6PA 3BI0A 2YGWA 4MY0A 2VQYA 4CYPA 4AVCA 4AVAA 3PB8X 3LWUA 1LAMA 4OIDA 4UWJA 2DPTA 3FYNA 3SXOA 4CS0B 2ZEPA 3LD2A 3EC4A 3PB7X 4PXCA 2AFUA 4E0AA 2KCWA 4MHNA 2PJCA 3S6FA 5K8MA 1PUAA 4NF1A 1XJOA 4HNXB 4BD9A 2XEIA 1ZG9A 2C6CA 4A37A 2AFXA 2ZEMA 2XEJA 5LYLA 3IC1A 4ZBGA 3UY5A 1NSLA 4CYQA 3BI1A 3WT4A 3SHPA 1YW6A 2PJ7A 5A27A 2BUEA 3B2YA 2P6EA 2ZW4A 1FNOA 1XE4A 4PPZA 5JPHA 3JTKA 2IMOA 2AE6A 2DPSA 1GHEA 2Q43A 2ZEDA 3R96A 1S7KA 4NGPA 2FXFA 4Y49B 1CP7A 3DNSA 3RZAA 3EFAA 2GFQA 1Z8WA 4P4BA 4FAIA 4MHDA 4OC5A 4XPKA 3D3SA 2A4NA 2J8NA 4R8FA 1QMUA 4KOVA 2D4OA 2V8GA 1YGHA 3BLNA 5HH1A 4A39A 5DS0A 4LX9A 2IQ6A 2HV2A 3B3SA 4G1PA 5ELYA 4YFJA 1XMTA 1X10A 4H6UA 2PC1A 5F09A 1MJ9A 1F2PA 4UF4A 2WUUA 4H2KA 4A31A 4DNCA 5KTDA 4EWTA 2CNTA 3C26A 3MGDA 4P45A 4WWVA 4QBJA 3F5BA 3NE8A 4JLYA 3VH9A 4DYOA 1R57A 4ZY2A 3G8WA 4P6YA 2VZYA 3B8GA 4NFRA 1CJWA 1XIXA 1X12A 3B7IA 2Q0YA 1YK3A 1CPSA 3DR6A 4KLVA 4R87A 1LRZA 2PJ5A 2PIZA 3S9MA 4EVYA 3FF3A 2B5GB 2H5MA 5AGEA 2Q7BA 3TT2A 3N5FA 2EWBA 5CNPA 5G20A 1Z9UA 4A38A 2B58A 2V8VA 5BWAB 1EE3P 1QSOA 3RAMA 1AUGA 1VIXA 1YVOA 4B14A 3IFEA 4LQ6A 3PRTA 3IIBA 1ZO0A 3PGPA 4MXUA 4IF5A 1BPNA 1ZG7A 2VI7A 4CRYB 3K2KA 3FJUA 2FE7A 4JZ0A 3B35A 4OP4A 1MK4A 1IICA 4R9MA 5JH9A 1XMBA 2ZOGA 2C6GA 2OZUA 1ELMP 4QUSA
chains in the Genus database with same CATH topology
2REEA 4NEXA 4MFJA 1YX0A 1RO5A 4CGLA 1I1DA 4X5KA 3E0KA 5FVJA 4CYOA 4AG9A 3EY5A 3JVNA 4F0YA 4Q36A 1IIDA 4M3SA 4KVME 3TE4A 4ONUA 4CGPA 2WPXA 3GYAA 1WWZA 4KOUA 1KZFA 1YVKA 2Z3KA 1WK4A 4YGOA 3VWEA 4PSWA 4B5PB 4CAVA 4HNWB 2WPWA 4RS2A 4NCZA 5IB0A 4K30A 1KUXA 1B87A 4KORA 3JUWA 3FXTA 4OADA 1Q2DA 4F0XA 2WSAA 3TO7A 2OU2A 4AG7A 5H86A 4B5PA 3V8IA 3LODA 3R9GA 2OB0A 1RXTA 4AVBA 2DXQA 1Y7RA 3H5ZA 2QIRA 3TO9A 2I00A 5ISVA 4PK2A 2JDCA 4QVTA 3FIXA 4XPDC 5J8FA 3W6SA 4UFVA 3A9LA 4MBUA 2CXAA 2VZZA 3KKWA 2PR8A 5AG6A 5IX3A 4QB9A 2Z3MA 5C82A 2Z0ZA 5G22A 4AB7A 3QAHA 4LUAA 4A2ZA 3N7ZA 3R9EA 3W6XA 1SQHA 4CAWA 5J8CA 1QSRA 1S7NA 4KOYA 4MI4A 1BOBA 5AG4A 1XF8A 4CYNA 1NMTA 1Y9WA 4C2ZA 3TOAA 4XPDB 2FL4A 4CAEA 2B3UA 2D4PA 3FNCA 4CGOA 3EO4A 1V0CA 3CXSA 3PP9A 1I12A 2AJ6A 2B4DB 1MJBA 2FIWA 1YR0A 2CNMA 4KUAA 4B10A 3SXNA 2FIAA 2CNSA 5G21A 2VEZA 2JLMA 4XNHB 2B4BA 1CM0A 1N71A 2Z11A 1KUVA 3FRMA 5F48A 1Q2CA 3BJ8A 3IU2A 3PZJA 3I9SA 2R8VA 2PDOA 2PRBA 1TIQA 4MFZA 4NSQA 2Y0MA 4KVXA 1XEBA 4PV6A 1M4IA 2Z3OA 2FT0A 2ZW5A 4GS4A 1FY7A 4BBHA 4BMHA 3S6HA 1QSTA 4KS9A 1NE9A 4E8OA 4U9YA 4FD7A 2BL1A 1M4GA 4KOSA 4XNHC 1QSMA 2Z10A 4A95A 3T90A 1PU9A 3G3SA 4M85A 2YNCA 1B6BA 4YRHA 4B13A 5A28A 4MFLA 2Z3NA 1P4NA 2OZHA 5DWNA 5F47A 1VKCA 4RI1A 1BO4A 3P2FA 2J8RA 4ZGYB 2R7HA 1M44A 1MJAA 2GE3A 2ARHA 4MFKA 2RC4A 4FD5A 4B12A 4UBRA 2J8MA 4A33A 2PQ8A 4B5OA 3DR8A 4R3LA 3W91A 2YNCC 3IWEA 3QB8A 4CRZB 4C2XA 2BEIA 4UFWA 1YLEA 2R1IA 4C68A 1J4JA 4NXYA 4OLLA 4I49A 2F5IA 4HKFA 1U6MA 5GCNA 2QECA 3K9UA 4KSFA 4UCNA 4KLWA 4KZTA 1QSNA 1OZPA 2FS5A 4U9ZA 4KOWA 4KUBA 2P6GA 5KTAA 2YNDA 1UFHA 2ZW7A 3D8PA 3T9YA 2QMLA 4J3GA 3I3GA 2X7BA 5G1ZA 5IV0A 1KUYA 1S7LA 2JEVA 2O28A 4FD4A 2I79A 2GANA 1L0CA 3R1KA 3OWCA 4L8AA 3RYOA 4A30A 2P6FA 4OAEA 1S60A 2PSWA 4MY3A 1Z4EA 3DDDA 3CXPA 1Q2YA 3R9FA 5DWMA 2PR1A 5EC4A 4H6ZA 2OH1A 2VBQA 2B3VA 2GIVA 5EBVA 4U5YA 3F0AA 4C2YA 2JDDA 2EVNA 2FSRA 2REFA 1IYKA 4A32A 4L89A 5F49A 2HQYA 3DSBA 4UA3A 1S3ZA 1S7FA 4MFQA 1S5KA 3R95A 4H89A 5AG7A 5E96A 2B4DA 5I0CA 5AG5A 2IL4A 4C7IA 4MFPA 2CY2A 2Q04A 1YREA 2P0WA 3VWDA 4CAXA 4UCPA 3IWGA 2ZXVA 2OZGA 4UCMA 1K4JA 4II9A 3F8KA 4Q38A 2R98A 1VHSA 2BSWA 3GY9A 3EXNA 2ZW6A 1M4DA 4FD6A 3FB3A 2ZPAA 4JWPA 2ATRA 4F6AA 3TFYA 1P0HA 4E2AA 4JJXA 1IB1E 4ORFA 5HMNA 2FCKA 3ZJ0A 1I21A 3P2HA 3BJ7A 2G3TA 4PSXA 5F46A 4KOXA 5C88A 2Q4YA 4JXRA 3TCVA 2G3AA 4UWIA 3CXQA 3TTHA 3IGRA 5JQ4A 4PK3A 3TO6A 2Z3LA 3FBUA 4CAFA 3TOBA 3GKRA 2K5TA 4KOTA 4XPLA 4QC6A 2Q4VA 2B5GA 4Y49C 4MJ8A 3S6GA 4JD6A 2Q44A 4CGMA 4UFXA 3WR7A 4CGNA 5KTCA 1Z4RA 1IYLA 3S6KA 3IU1A 4C7HA 2EUIA 3D2PA 4R57A 4JXQA 1M1DA 2G0BA 4HNYB 2YNEA 2HUZA 3D2MA 1Y9KA 4IUSA 2C27A 2Z3PA 4KSAA 4B11A 3ZZIA 3NE7A 3H4QA 1ON0A 2VXKA 2NMTA 4R3KA 4KVOE 5H84A 2YGWA 4MY0A 2VQYA 4CYPA 4AVCA 4AVAA 4UWJA 2DPTA 3FYNA 3SXOA 4CS0B 3LD2A 3EC4A 4E0AA 2KCWA 3S6FA 1PUAA 4NF1A 4HNXB 3UY5A 4ZBGA 4CYQA 1NSLA 3SHPA 5A27A 2BUEA 2P6EA 2ZW4A 1XE4A 5JPHA 3JTKA 2AE6A 2DPSA 1GHEA 3R96A 1S7KA 2FXFA 4Y49B 3DNSA 3EFAA 4MHDA 4XPKA 3D3SA 2A4NA 2J8NA 5HH1A 4KOVA 2D4OA 3BLNA 1YGHA 4LX9A 2HV2A 4YFJA 1XMTA 4H6UA 2PC1A 1MJ9A 2WUUA 4A31A 4DNCA 5KTDA 2CNTA 3C26A 3MGDA 4QBJA 3F5BA 4JLYA 1R57A 3G8WA 2VZYA 3B8GA 1CJWA 1XIXA 2Q0YA 1YK3A 3DR6A 4KLVA 4R87A 1LRZA 4EVYA 2B5GB 2H5MA 5AGEA 2Q7BA 3TT2A 5CNPA 5G20A 1Z9UA 2B58A 5BWAB 1QSOA 4B14A 1YVOA 1ZO0A 3PGPA 4IF5A 2VI7A 4CRYB 2FE7A 1MK4A 1IICA 4R9MA 2OZUA 4QUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2REE A;  4NEX A;  1YX0 A;  1RO5 A;  1I1D A;  4X5K A;  3E0K A;  5FVJ A;  4AG9 A;  3EY5 A;  3JVN A;  4F0Y A;  1IID A;  4M3S A;  4KVM E;  3TE4 A;  4ONU A;  2WPX A;  3GYA A;  1WWZ A;  4KOU A;  1KZF A;  1YVK A;  1WK4 A;  4YGO A;  3VWE A;  4PSW A;  4B5P B;  4CAV A;  4HNW B;  2WPW A;  4RS2 A;  4NCZ A;  5IB0 A;  4K30 A;  1KUX A;  1B87 A;  4KOR A;  3JUW A;  3FXT A;  4OAD A;  1Q2D A;  3TO7 A;  2OU2 A;  4AG7 A;  5H86 A;  4B5P A;  3V8I A;  3LOD A;  3R9G A;  2OB0 A;  1RXT A;  4AVB A;  2DXQ A;  1Y7R A;  2QIR A;  3TO9 A;  2I00 A;  5ISV A;  4PK2 A;  2JDC A;  4QVT A;  3FIX A;  4XPD C;  5J8F A;  3W6S A;  4MBU A;  2VZZ A;  3KKW A;  2PR8 A;  5IX3 A;  4QB9 A;  5C82 A;  2Z0Z A;  4AB7 A;  3QAH A;  4LUA A;  3N7Z A;  3R9E A;  3W6X A;  1SQH A;  4CAW A;  5J8C A;  1QSR A;  1S7N A;  4KOY A;  4MI4 A;  1BOB A;  1XF8 A;  1NMT A;  1Y9W A;  3TOA A;  4XPD B;  2FL4 A;  2B3U A;  2D4P A;  3FNC A;  3EO4 A;  1V0C A;  3CXS A;  3PP9 A;  1I12 A;  2AJ6 A;  2B4D B;  1MJB A;  2FIW A;  1YR0 A;  2CNM A;  4KUA A;  3SXN A;  2FIA A;  2CNS A;  2VEZ A;  2JLM A;  4XNH B;  2B4B A;  1CM0 A;  1N71 A;  2Z11 A;  1KUV A;  3FRM A;  5F48 A;  1Q2C A;  3BJ8 A;  3PZJ A;  3I9S A;  2R8V A;  2PDO A;  2PRB A;  1TIQ A;  4NSQ A;  2Y0M A;  4KVX A;  1XEB A;  4PV6 A;  1M4I A;  2FT0 A;  2ZW5 A;  4GS4 A;  1FY7 A;  4BMH A;  3S6H A;  1QST A;  1NE9 A;  4E8O A;  4U9Y A;  4FD7 A;  2BL1 A;  1M4G A;  4KOS A;  4XNH C;  1QSM A;  2Z10 A;  3T90 A;  1PU9 A;  3G3S A;  4M85 A;  1B6B A;  4YRH A;  1P4N A;  2OZH A;  5DWN A;  5F47 A;  1VKC A;  4RI1 A;  1BO4 A;  3P2F A;  2J8R A;  2R7H A;  1M44 A;  1MJA A;  2GE3 A;  2ARH A;  2RC4 A;  4FD5 A;  4UBR A;  2J8M A;  2PQ8 A;  4B5O A;  3DR8 A;  4R3L A;  3W91 A;  3QB8 A;  4CRZ B;  2BEI A;  1YLE A;  2R1I A;  1J4J A;  4NXY A;  4OLL A;  4I49 A;  2F5I A;  4HKF A;  1U6M A;  5GCN A;  2QEC A;  3K9U A;  4KLW A;  4KZT A;  1QSN A;  1OZP A;  2FS5 A;  4U9Z A;  4KOW A;  4KUB A;  2P6G A;  5KTA A;  2ZW7 A;  1UFH A;  3D8P A;  3T9Y A;  2QML A;  4J3G A;  3I3G A;  2X7B A;  5IV0 A;  1KUY A;  1S7L A;  2JEV A;  2O28 A;  4FD4 A;  2I79 A;  2GAN A;  1L0C A;  3R1K A;  3OWC A;  4L8A A;  3RYO A;  2P6F A;  4OAE A;  1S60 A;  2PSW A;  4MY3 A;  1Z4E A;  3DDD A;  3CXP A;  1Q2Y A;  3R9F A;  5DWM A;  2PR1 A;  5EC4 A;  4H6Z A;  2OH1 A;  2VBQ A;  2B3V A;  2GIV A;  5EBV A;  4U5Y A;  3F0A A;  2JDD A;  2EVN A;  2FSR A;  2REF A;  1IYK A;  4L89 A;  5F49 A;  2HQY A;  3DSB A;  4UA3 A;  1S3Z A;  1S7F A;  1S5K A;  3R95 A;  4H89 A;  5E96 A;  2B4D A;  5I0C A;  2IL4 A;  2CY2 A;  2Q04 A;  1YRE A;  2P0W A;  3VWD A;  4CAX A;  3IWG A;  2ZXV A;  2OZG A;  1K4J A;  4II9 A;  3F8K A;  2R98 A;  1VHS A;  2BSW A;  3GY9 A;  3EXN A;  2ZW6 A;  1M4D A;  4FD6 A;  3FB3 A;  2ZPA A;  4JWP A;  2ATR A;  4F6A A;  3TFY A;  1P0H A;  4E2A A;  4JJX A;  1IB1 E;  4ORF A;  5HMN A;  2FCK A;  3ZJ0 A;  1I21 A;  3P2H A;  3BJ7 A;  2G3T A;  4PSX A;  5F46 A;  4KOX A;  5C88 A;  2Q4Y A;  4JXR A;  3TCV A;  2G3A A;  4UWI A;  3CXQ A;  3TTH A;  3IGR A;  5JQ4 A;  4PK3 A;  3TO6 A;  3FBU A;  3TOB A;  3GKR A;  2K5T A;  4KOT A;  4XPL A;  4QC6 A;  2Q4V A;  2B5G A;  4Y49 C;  4MJ8 A;  3S6G A;  4JD6 A;  2Q44 A;  3WR7 A;  5KTC A;  1Z4R A;  1IYL A;  3S6K A;  2EUI A;  3D2P A;  4R57 A;  4JXQ A;  1M1D A;  2G0B A;  4HNY B;  2HUZ A;  3D2M A;  1Y9K A;  4IUS A;  2C27 A;  3ZZI A;  3NE7 A;  3H4Q A;  1ON0 A;  2VXK A;  2NMT A;  4R3K A;  4KVO E;  5H84 A;  4MY0 A;  2VQY A;  4AVC A;  4AVA A;  4UWJ A;  3FYN A;  3SXO A;  4CS0 B;  3LD2 A;  3EC4 A;  4E0A A;  2KCW A;  3S6F A;  1PUA A;  4NF1 A;  4HNX B;  3UY5 A;  4ZBG A;  1NSL A;  3SHP A;  2BUE A;  2P6E A;  2ZW4 A;  1XE4 A;  5JPH A;  2AE6 A;  1GHE A;  3R96 A;  1S7K A;  2FXF A;  4Y49 B;  3DNS A;  3EFA A;  4MHD A;  4XPK A;  3D3S A;  2A4N A;  2J8N A;  5HH1 A;  4KOV A;  2D4O A;  3BLN A;  1YGH A;  4LX9 A;  2HV2 A;  4YFJ A;  1XMT A;  4H6U A;  2PC1 A;  1MJ9 A;  4DNC A;  5KTD A;  2CNT A;  3C26 A;  3MGD A;  4QBJ A;  3F5B A;  4JLY A;  1R57 A;  3G8W A;  2VZY A;  3B8G A;  1CJW A;  1XIX A;  2Q0Y A;  1YK3 A;  3DR6 A;  4KLV A;  4R87 A;  1LRZ A;  4EVY A;  2B5G B;  2H5M A;  2Q7B A;  3TT2 A;  5CNP A;  1Z9U A;  2B58 A;  1QSO A;  1YVO A;  3PGP A;  4IF5 A;  2VI7 A;  4CRY B;  2FE7 A;  1MK4 A;  1IIC A;  4R9M A;  2OZU A;  4QUS A; 
#chains in the Genus database with same CATH topology
 2REE A;  3LAC A;  4NEX A;  4MFJ A;  3KL9 A;  4Q7A A;  1YX0 A;  1RO5 A;  4CGL A;  1I1D A;  4X5K A;  3E0K A;  3DLJ A;  5FVJ A;  1A2Z A;  1Y7E A;  4CYO A;  4AG9 A;  3EY5 A;  3JVN A;  2PJ3 A;  4F0Y A;  4TNU A;  4Q36 A;  1IID A;  1Y0R A;  2BCO A;  4KVM E;  4M3S A;  3TE4 A;  4ONU A;  4CGP A;  2WPX A;  3GYA A;  1WWZ A;  1TKF A;  4KOU A;  1BAV A;  1KZF A;  5THW A;  1YVK A;  5HVH A;  2CTB A;  2JBK A;  3HUV A;  4IHM A;  2Z3K A;  1WK4 A;  3LMS A;  3KGQ A;  1LOK A;  4YGO A;  3VWE A;  3CDX A;  4PSW A;  4B5P B;  4CAV A;  4HNW B;  2WPW A;  2C1C A;  1XBU A;  3SJE A;  2V77 A;  1VHO A;  4RS2 A;  2HB6 A;  2CIJ A;  4NCZ A;  5IB0 A;  3B3C A;  2QVP A;  4ZY0 A;  4K30 A;  1KUX A;  4X8I A;  3PB6 X;  1B87 A;  4KOR A;  2PJ4 A;  3QAY A;  4ZX9 A;  3JUW A;  4RUH A;  3FXT A;  2V8D A;  2AFO A;  4OAD A;  1Q2D A;  4F0X A;  1HEE A;  1CX8 A;  2WSA A;  2J9A A;  2OU2 A;  3TO7 A;  3KHX A;  4NJR A;  5H86 A;  4AG7 A;  2Q4Z A;  1TKH A;  3JRU A;  4TWE A;  3V8I A;  3DGV A;  4B5P A;  2ZEE A;  3LOD A;  2VL1 A;  1IOI A;  1NSA A;  2OB0 A;  2GLJ A;  3R9G A;  2GLF A;  1RXT A;  3VAT A;  4AVB A;  2DXQ A;  1R3N A;  1Y7R A;  3D68 A;  3H5Z A;  2QIR A;  3TO9 A;  2I00 A;  5ISV A;  4PK2 A;  2ABZ A;  2PVV A;  2JDC A;  4QVT A;  2FVG A;  3FIX A;  4XPD C;  5J8F A;  3L2N A;  3W6S A;  4UFV A;  3A9L A;  3CT9 A;  1F57 A;  4MBU A;  5K8P A;  2CXA A;  5LRG A;  2VZZ A;  4AXV A;  3KKW A;  2PR8 A;  5AG6 A;  5IX3 A;  4QB9 A;  3SJF A;  2Z3M A;  5C82 A;  2Z0Z A;  1YSJ A;  5G22 A;  3PB4 X;  4AB7 A;  4DUK A;  3QAH A;  4LUA A;  4A2Z A;  2ZEN A;  5LYI A;  3N7Z A;  3R9E A;  3W6X A;  3V38 A;  2ZEL A;  5K8O A;  1SQH A;  3RNZ A;  4CAW A;  2QJ8 A;  2ZEO A;  5J8C A;  1QSR A;  3QNV A;  4GXH A;  1S7N A;  3WC5 A;  4KOY A;  4MI4 A;  5IB9 A;  1BOB A;  3T8W A;  5AG4 A;  1XF8 A;  4MCS A;  4CYN A;  3WAB A;  4FWU A;  1NMT A;  1Y9W A;  4C2Z A;  3TOA A;  4XPD B;  2FL4 A;  2CTC A;  2OOT A;  4PQA A;  4F9U A;  4CAE A;  2B3U A;  4MCP A;  4P44 A;  2D4P A;  3FNC A;  4UIB A;  1TKJ A;  3IO1 A;  4CGO A;  1M4L A;  3HLP A;  3EO4 A;  5J1Q A;  1V0C A;  3CXS A;  1GYT A;  2ODF A;  3PP9 A;  1I12 A;  2AJ6 A;  3D4U A;  2B4D B;  3KR4 A;  1JWQ A;  1MJB A;  1TF9 A;  3FVL A;  2FIW A;  1YR0 A;  1Z8L A;  1ARM A;  2CNM A;  3KAS A;  4KUA A;  4B10 A;  4EME A;  2JBJ A;  3B3V A;  3SXN A;  2FIA A;  2GU2 A;  2CNS A;  5D29 A;  5G21 A;  3KQZ A;  2VEZ A;  1KWM A;  2JLM A;  4XNH B;  2B4B A;  1CM0 A;  4B6Z A;  3GIU A;  1N71 A;  3IJ3 A;  2Z11 A;  4DJL A;  1F2O A;  2NYQ A;  1KUV A;  3FRM A;  2HC9 A;  3BXM A;  3SI1 A;  2I3C A;  3NH4 A;  4MRI A;  5F48 A;  4UIA A;  1Q2C A;  3BJ8 A;  4ZI6 A;  3IU2 A;  3PZJ A;  3I9S A;  2R8V A;  2PDO A;  2PRB A;  4FUU A;  3S9N A;  4MCR A;  1TIQ A;  4MFZ A;  2RFH A;  4NSQ A;  4OC1 A;  2Y0M A;  4KVX A;  1XEB A;  4NGN A;  1LCP A;  2BOA A;  2AFS A;  2PJ6 A;  1M4I A;  3BHX A;  1YW4 A;  2DEA A;  2Z3O A;  4PV6 A;  2FT0 A;  4IAV A;  4K3N A;  1Z2L A;  2WYR A;  4GM5 A;  4MHZ A;  4NJQ A;  4RN7 A;  2ZW5 A;  2XEG A;  3D66 A;  4GS4 A;  1IGB A;  3D7G A;  1FY7 A;  4BBH A;  3GLJ A;  4WJB A;  3MN8 A;  3I1U A;  3RBU A;  4BMH A;  5D8N A;  1XOV A;  3S6H A;  1YQE A;  1QST A;  2AFZ A;  3FX6 A;  2PJA A;  1NE9 A;  4KS9 A;  4E8O A;  4U9Y A;  1CP6 A;  4FD7 A;  2BL1 A;  1M4G A;  2BO9 A;  4KOS A;  1FT7 A;  2AFW A;  2QYV A;  4XNH C;  1QSM A;  2Z10 A;  2ZEF A;  4W9Y A;  3D7H A;  3SJG A;  2Q51 A;  4A95 A;  4F8Z A;  1IU8 A;  3GUX A;  3T90 A;  1PU9 A;  1QQ9 A;  4NGQ A;  4OC4 A;  3G3S A;  3PB9 X;  1LFW A;  4M85 A;  2YNC A;  1B6B A;  2PIY A;  1CPX A;  3D7D A;  4YRH A;  1Z8T A;  3CPX A;  4B13 A;  5A28 A;  1HDQ A;  2PJ8 A;  2Z3N A;  4MFL A;  2PJ0 A;  1P4N A;  2OZH A;  3KHZ A;  5DWN A;  5F47 A;  1VKC A;  4RI1 A;  1BO4 A;  2O4H A;  2J8R A;  3P2F A;  4ZGY B;  2R7H A;  4P4F A;  1IOF A;  1Z5R A;  1TF8 A;  2PCU A;  1M44 A;  4M6I A;  2ZOF A;  1R43 A;  1MJA A;  1ZG8 A;  2GE3 A;  2ARH A;  4MFK A;  2RC4 A;  4CPA A;  4FD5 A;  4HPS A;  2F8H A;  4B12 A;  4FBE A;  4UBR A;  2J8M A;  4PXD A;  2PQ8 A;  4A33 A;  4B5O A;  3DR8 A;  5EMI A;  3D67 A;  3KI9 A;  4R3L A;  3W91 A;  2YNC C;  2EK8 A;  3FH4 A;  3IWE A;  5HVG A;  3QB8 A;  4CRZ B;  5K8N A;  4C2X A;  3D7F A;  2BEI A;  1AYE A;  4UFW A;  2G9D A;  2XEF A;  2PJ9 A;  1YLE A;  4MMO A;  2R1I A;  4OKO A;  4P4I A;  5HVF A;  1IY7 A;  1J4J A;  4O23 A;  4C68 A;  1ZLI A;  4NXY A;  4OLL A;  5CBM A;  4I49 A;  2F5I A;  3CZX A;  1U6M A;  4HKF A;  2QEC A;  3K9U A;  5GCN A;  1HDU A;  4KSF A;  4OME A;  4UCN A;  4KLW A;  4KZT A;  8CPA A;  2ANP A;  1QSN A;  3PEI A;  3NH8 A;  4PXE A;  3FMC A;  4YU9 A;  2PE3 A;  1OZP A;  2FS5 A;  3FEE A;  3GB0 A;  4U9Z A;  1LAP A;  2PJ1 A;  3KR5 A;  1YLO A;  4KOW A;  4KUB A;  2P6G A;  5KTA A;  2YND A;  1UFH A;  2ZW7 A;  3D8P A;  3T9Y A;  2QML A;  6CPA A;  1CBX A;  1ELL P;  4J3G A;  1PCA A;  3ISZ A;  3I3G A;  2X7B A;  5G1Z A;  5IV0 A;  3SI0 A;  4UEF A;  1KUY A;  1S7L A;  2JEV A;  4OC3 A;  2O28 A;  3NH5 A;  3H8G A;  4FD4 A;  2I79 A;  4X3R A;  2GAN A;  1L0C A;  3R1K A;  3TX8 A;  4IK2 A;  3PFE A;  3OWC A;  4L8A A;  2ZEG A;  3RYO A;  4A30 A;  2P6F A;  4OAE A;  4OC0 A;  1S60 A;  2PSW A;  5I4M A;  2GRE A;  4P4J A;  4MY3 A;  1Z4E A;  3DDD A;  4R7M A;  1UWY A;  5CPA A;  3CXP A;  1Q2Y A;  1TXR A;  3R9F A;  5DWM A;  2IJZ A;  3TC8 A;  2PR1 A;  5EC4 A;  4H6Z A;  5LYF A;  2OH1 A;  2EO8 A;  5JGF A;  2V8H A;  2VBQ A;  2B3V A;  3IWW A;  2GIV A;  2AFM A;  4U5Y A;  3F0A A;  5EBV A;  3V7Z A;  4C2Y A;  2JDD A;  2CF4 A;  2EVN A;  2FSR A;  1H8L A;  1RTQ A;  2POK A;  1IYK A;  2REF A;  3CPA A;  4OIW A;  3WC6 A;  5JM6 A;  4A32 A;  4L89 A;  5F49 A;  2HQY A;  3DSB A;  2WZN A;  4UA3 A;  1S3Z A;  1S7F A;  1DTD A;  2DF5 A;  4MFQ A;  1S5K A;  3R95 A;  4M6G A;  4H89 A;  2O53 A;  5AG7 A;  3ISX A;  5E96 A;  1Y0Y A;  2B4D A;  2RB7 A;  5AG5 A;  5I0C A;  2IL4 A;  4C7I A;  4MFP A;  4MHP A;  2CY2 A;  2Q04 A;  1YRE A;  3PBE A;  2P0W A;  3VWD A;  4CAX A;  4UCP A;  1DE4 C;  3IWG A;  2ZXV A;  2EBJ A;  1Z8X A;  2OZG A;  4UCM A;  5LRJ A;  1K4J A;  4II9 A;  3F8K A;  3IEH A;  1VGY A;  2PRQ A;  3B3T A;  3FEC A;  4Q38 A;  2R98 A;  4A94 A;  4EFD A;  1VHS A;  2BSW A;  3GY9 A;  3EXN A;  2ZW6 A;  1M4D A;  2PVW A;  4FD6 A;  4UEZ A;  3FB3 A;  2ZPA A;  4JWP A;  3S9L A;  4BIN A;  4ZY1 A;  4NGM A;  4ONW A;  1VHE A;  4NGT A;  4NGS A;  2ATR A;  2JEW A;  4F6A A;  2PJB A;  4M6H A;  1ARL A;  3TFY A;  1P0H A;  4E2A A;  4JJX A;  2EK9 A;  1XRY A;  3PFO A;  3PBB A;  1IB1 E;  4ORF A;  5HMN A;  5HXD A;  2FCK A;  3RO0 A;  4JYW A;  3ZJ0 A;  1I21 A;  3WC7 A;  1YME A;  4F9V A;  4KSI A;  3P2H A;  5LRK A;  3BJ7 A;  2G3T A;  4PSX A;  5F46 A;  4KOX A;  4Z65 A;  5C88 A;  4R76 A;  4X2T A;  2Q4Y A;  1AMP A;  4MHY A;  4JXR A;  3TCV A;  2G3A A;  4UWI A;  3CXQ A;  3TTH A;  3IGR A;  5JQ4 A;  4PK3 A;  2Q7S A;  3TO6 A;  4PXB A;  4MCQ A;  3SI2 A;  2Z3L A;  3FBU A;  4CAF A;  3TOB A;  3GKR A;  2K5T A;  4KOT A;  4XPL A;  4QC6 A;  2Q4V A;  2B5G A;  4Y49 C;  3B3W A;  1OBR A;  3KZW A;  5LYD A;  4MJ8 A;  2PJ2 A;  4P4D A;  3S6G A;  4JD6 A;  2Q44 A;  1ZLH A;  4CGM A;  3K9T A;  4UFX A;  3WR7 A;  3SJX A;  4CGN A;  5KTC A;  3VAR A;  1Z4R A;  2NSM A;  4P4E A;  1IYL A;  3S6K A;  3IU1 A;  4LQG A;  4C7H A;  1JQG A;  4NGR A;  2EUI A;  3D2P A;  3KQX A;  4R57 A;  4JXQ A;  1M1D A;  2G0B A;  4HNY B;  2YNE A;  2F7V A;  2HUZ A;  4P10 A;  1Q7L A;  3D2M A;  3NFZ A;  1Y9K A;  4OC2 A;  4IUS A;  3H8E A;  2C27 A;  2Z3P A;  4KSA A;  2OR4 A;  1PYT B;  3H8F A;  4YWY A;  4B11 A;  3ZZI A;  3NE7 A;  3FED A;  4R6T A;  4UEE A;  3H4Q A;  2ZEH A;  1ON0 A;  4ZYQ A;  3MRU A;  1BPM A;  2VXK A;  1BLL E;  1XFO A;  2NMT A;  3NA6 A;  7CPA A;  1CG2 A;  1LAN A;  4R3K A;  4KVO E;  5H84 A;  4ZX8 A;  2C6P A;  3BI0 A;  2YGW A;  4MY0 A;  2VQY A;  4CYP A;  4AVC A;  4AVA A;  3PB8 X;  3LWU A;  1LAM A;  4OID A;  4UWJ A;  2DPT A;  3FYN A;  3SXO A;  4CS0 B;  2ZEP A;  3LD2 A;  3EC4 A;  3PB7 X;  4PXC A;  2AFU A;  4E0A A;  2KCW A;  4MHN A;  2PJC A;  3S6F A;  5K8M A;  1PUA A;  4NF1 A;  1XJO A;  4HNX B;  4BD9 A;  2XEI A;  1ZG9 A;  2C6C A;  4A37 A;  2AFX A;  2ZEM A;  2XEJ A;  5LYL A;  3IC1 A;  4ZBG A;  3UY5 A;  1NSL A;  4CYQ A;  3BI1 A;  3WT4 A;  3SHP A;  1YW6 A;  2PJ7 A;  5A27 A;  2BUE A;  3B2Y A;  2P6E A;  2ZW4 A;  1FNO A;  1XE4 A;  4PPZ A;  5JPH A;  3JTK A;  2IMO A;  2AE6 A;  2DPS A;  1GHE A;  2Q43 A;  2ZED A;  3R96 A;  1S7K A;  4NGP A;  2FXF A;  4Y49 B;  1CP7 A;  3DNS A;  3RZA A;  3EFA A;  2GFQ A;  1Z8W A;  4P4B A;  4FAI A;  4MHD A;  4OC5 A;  4XPK A;  3D3S A;  2A4N A;  2J8N A;  4R8F A;  1QMU A;  4KOV A;  2D4O A;  2V8G A;  1YGH A;  3BLN A;  5HH1 A;  4A39 A;  5DS0 A;  4LX9 A;  2IQ6 A;  2HV2 A;  3B3S A;  4G1P A;  5ELY A;  4YFJ A;  1XMT A;  1X10 A;  4H6U A;  2PC1 A;  5F09 A;  1MJ9 A;  1F2P A;  4UF4 A;  2WUU A;  4H2K A;  4A31 A;  4DNC A;  5KTD A;  4EWT A;  2CNT A;  3C26 A;  3MGD A;  4P45 A;  4WWV A;  4QBJ A;  3F5B A;  3NE8 A;  4JLY A;  3VH9 A;  4DYO A;  1R57 A;  4ZY2 A;  3G8W A;  4P6Y A;  2VZY A;  3B8G A;  4NFR A;  1CJW A;  1XIX A;  1X12 A;  3B7I A;  2Q0Y A;  1YK3 A;  1CPS A;  3DR6 A;  4KLV A;  4R87 A;  1LRZ A;  2PJ5 A;  2PIZ A;  3S9M A;  4EVY A;  3FF3 A;  2B5G B;  2H5M A;  5AGE A;  2Q7B A;  3TT2 A;  3N5F A;  2EWB A;  5CNP A;  5G20 A;  1Z9U A;  4A38 A;  2B58 A;  2V8V A;  5BWA B;  1EE3 P;  1QSO A;  3RAM A;  1AUG A;  1VIX A;  1YVO A;  4B14 A;  3IFE A;  4LQ6 A;  3PRT A;  3IIB A;  1ZO0 A;  3PGP A;  4MXU A;  4IF5 A;  1BPN A;  1ZG7 A;  2VI7 A;  4CRY B;  3K2K A;  3FJU A;  2FE7 A;  4JZ0 A;  3B35 A;  4OP4 A;  1MK4 A;  1IIC A;  4R9M A;  5JH9 A;  1XMB A;  2ZOG A;  2C6G A;  2OZU A;  1ELM P;  4QUS A; 
#chains in the Genus database with same CATH homology
 2REE A;  4NEX A;  4MFJ A;  1YX0 A;  1RO5 A;  4CGL A;  1I1D A;  4X5K A;  3E0K A;  5FVJ A;  4CYO A;  4AG9 A;  3EY5 A;  3JVN A;  4F0Y A;  4Q36 A;  1IID A;  4M3S A;  4KVM E;  3TE4 A;  4ONU A;  4CGP A;  2WPX A;  3GYA A;  1WWZ A;  4KOU A;  1KZF A;  1YVK A;  2Z3K A;  1WK4 A;  4YGO A;  3VWE A;  4PSW A;  4B5P B;  4CAV A;  4HNW B;  2WPW A;  4RS2 A;  4NCZ A;  5IB0 A;  4K30 A;  1KUX A;  1B87 A;  4KOR A;  3JUW A;  3FXT A;  4OAD A;  1Q2D A;  4F0X A;  2WSA A;  3TO7 A;  2OU2 A;  4AG7 A;  5H86 A;  4B5P A;  3V8I A;  3LOD A;  3R9G A;  2OB0 A;  1RXT A;  4AVB A;  2DXQ A;  1Y7R A;  3H5Z A;  2QIR A;  3TO9 A;  2I00 A;  5ISV A;  4PK2 A;  2JDC A;  4QVT A;  3FIX A;  4XPD C;  5J8F A;  3W6S A;  4UFV A;  3A9L A;  4MBU A;  2CXA A;  2VZZ A;  3KKW A;  2PR8 A;  5AG6 A;  5IX3 A;  4QB9 A;  2Z3M A;  5C82 A;  2Z0Z A;  5G22 A;  4AB7 A;  3QAH A;  4LUA A;  4A2Z A;  3N7Z A;  3R9E A;  3W6X A;  1SQH A;  4CAW A;  5J8C A;  1QSR A;  1S7N A;  4KOY A;  4MI4 A;  1BOB A;  5AG4 A;  1XF8 A;  4CYN A;  1NMT A;  1Y9W A;  4C2Z A;  3TOA A;  4XPD B;  2FL4 A;  4CAE A;  2B3U A;  2D4P A;  3FNC A;  4CGO A;  3EO4 A;  1V0C A;  3CXS A;  3PP9 A;  1I12 A;  2AJ6 A;  2B4D B;  1MJB A;  2FIW A;  1YR0 A;  2CNM A;  4KUA A;  4B10 A;  3SXN A;  2FIA A;  2CNS A;  5G21 A;  2VEZ A;  2JLM A;  4XNH B;  2B4B A;  1CM0 A;  1N71 A;  2Z11 A;  1KUV A;  3FRM A;  5F48 A;  1Q2C A;  3BJ8 A;  3IU2 A;  3PZJ A;  3I9S A;  2R8V A;  2PDO A;  2PRB A;  1TIQ A;  4MFZ A;  4NSQ A;  2Y0M A;  4KVX A;  1XEB A;  4PV6 A;  1M4I A;  2Z3O A;  2FT0 A;  2ZW5 A;  4GS4 A;  1FY7 A;  4BBH A;  4BMH A;  3S6H A;  1QST A;  4KS9 A;  1NE9 A;  4E8O A;  4U9Y A;  4FD7 A;  2BL1 A;  1M4G A;  4KOS A;  4XNH C;  1QSM A;  2Z10 A;  4A95 A;  3T90 A;  1PU9 A;  3G3S A;  4M85 A;  2YNC A;  1B6B A;  4YRH A;  4B13 A;  5A28 A;  4MFL A;  2Z3N A;  1P4N A;  2OZH A;  5DWN A;  5F47 A;  1VKC A;  4RI1 A;  1BO4 A;  3P2F A;  2J8R A;  4ZGY B;  2R7H A;  1M44 A;  1MJA A;  2GE3 A;  2ARH A;  4MFK A;  2RC4 A;  4FD5 A;  4B12 A;  4UBR A;  2J8M A;  4A33 A;  2PQ8 A;  4B5O A;  3DR8 A;  4R3L A;  3W91 A;  2YNC C;  3IWE A;  3QB8 A;  4CRZ B;  4C2X A;  2BEI A;  4UFW A;  1YLE A;  2R1I A;  4C68 A;  1J4J A;  4NXY A;  4OLL A;  4I49 A;  2F5I A;  4HKF A;  1U6M A;  5GCN A;  2QEC A;  3K9U A;  4KSF A;  4UCN A;  4KLW A;  4KZT A;  1QSN A;  1OZP A;  2FS5 A;  4U9Z A;  4KOW A;  4KUB A;  2P6G A;  5KTA A;  2YND A;  1UFH A;  2ZW7 A;  3D8P A;  3T9Y A;  2QML A;  4J3G A;  3I3G A;  2X7B A;  5G1Z A;  5IV0 A;  1KUY A;  1S7L A;  2JEV A;  2O28 A;  4FD4 A;  2I79 A;  2GAN A;  1L0C A;  3R1K A;  3OWC A;  4L8A A;  3RYO A;  4A30 A;  2P6F A;  4OAE A;  1S60 A;  2PSW A;  4MY3 A;  1Z4E A;  3DDD A;  3CXP A;  1Q2Y A;  3R9F A;  5DWM A;  2PR1 A;  5EC4 A;  4H6Z A;  2OH1 A;  2VBQ A;  2B3V A;  2GIV A;  5EBV A;  4U5Y A;  3F0A A;  4C2Y A;  2JDD A;  2EVN A;  2FSR A;  2REF A;  1IYK A;  4A32 A;  4L89 A;  5F49 A;  2HQY A;  3DSB A;  4UA3 A;  1S3Z A;  1S7F A;  4MFQ A;  1S5K A;  3R95 A;  4H89 A;  5AG7 A;  5E96 A;  2B4D A;  5I0C A;  5AG5 A;  2IL4 A;  4C7I A;  4MFP A;  2CY2 A;  2Q04 A;  1YRE A;  2P0W A;  3VWD A;  4CAX A;  4UCP A;  3IWG A;  2ZXV A;  2OZG A;  4UCM A;  1K4J A;  4II9 A;  3F8K A;  4Q38 A;  2R98 A;  1VHS A;  2BSW A;  3GY9 A;  3EXN A;  2ZW6 A;  1M4D A;  4FD6 A;  3FB3 A;  2ZPA A;  4JWP A;  2ATR A;  4F6A A;  3TFY A;  1P0H A;  4E2A A;  4JJX A;  1IB1 E;  4ORF A;  5HMN A;  2FCK A;  3ZJ0 A;  1I21 A;  3P2H A;  3BJ7 A;  2G3T A;  4PSX A;  5F46 A;  4KOX A;  5C88 A;  2Q4Y A;  4JXR A;  3TCV A;  2G3A A;  4UWI A;  3CXQ A;  3TTH A;  3IGR A;  5JQ4 A;  4PK3 A;  3TO6 A;  2Z3L A;  3FBU A;  4CAF A;  3TOB A;  3GKR A;  2K5T A;  4KOT A;  4XPL A;  4QC6 A;  2Q4V A;  2B5G A;  4Y49 C;  4MJ8 A;  3S6G A;  4JD6 A;  2Q44 A;  4CGM A;  4UFX A;  3WR7 A;  4CGN A;  5KTC A;  1Z4R A;  1IYL A;  3S6K A;  3IU1 A;  4C7H A;  2EUI A;  3D2P A;  4R57 A;  4JXQ A;  1M1D A;  2G0B A;  4HNY B;  2YNE A;  2HUZ A;  3D2M A;  1Y9K A;  4IUS A;  2C27 A;  2Z3P A;  4KSA A;  4B11 A;  3ZZI A;  3NE7 A;  3H4Q A;  1ON0 A;  2VXK A;  2NMT A;  4R3K A;  4KVO E;  5H84 A;  2YGW A;  4MY0 A;  2VQY A;  4CYP A;  4AVC A;  4AVA A;  4UWJ A;  2DPT A;  3FYN A;  3SXO A;  4CS0 B;  3LD2 A;  3EC4 A;  4E0A A;  2KCW A;  3S6F A;  1PUA A;  4NF1 A;  4HNX B;  3UY5 A;  4ZBG A;  4CYQ A;  1NSL A;  3SHP A;  5A27 A;  2BUE A;  2P6E A;  2ZW4 A;  1XE4 A;  5JPH A;  3JTK A;  2AE6 A;  2DPS A;  1GHE A;  3R96 A;  1S7K A;  2FXF A;  4Y49 B;  3DNS A;  3EFA A;  4MHD A;  4XPK A;  3D3S A;  2A4N A;  2J8N A;  5HH1 A;  4KOV A;  2D4O A;  3BLN A;  1YGH A;  4LX9 A;  2HV2 A;  4YFJ A;  1XMT A;  4H6U A;  2PC1 A;  1MJ9 A;  2WUU A;  4A31 A;  4DNC A;  5KTD A;  2CNT A;  3C26 A;  3MGD A;  4QBJ A;  3F5B A;  4JLY A;  1R57 A;  3G8W A;  2VZY A;  3B8G A;  1CJW A;  1XIX A;  2Q0Y A;  1YK3 A;  3DR6 A;  4KLV A;  4R87 A;  1LRZ A;  4EVY A;  2B5G B;  2H5M A;  5AGE A;  2Q7B A;  3TT2 A;  5CNP A;  5G20 A;  1Z9U A;  2B58 A;  5BWA B;  1QSO A;  4B14 A;  1YVO A;  1ZO0 A;  3PGP A;  4IF5 A;  2VI7 A;  4CRY B;  2FE7 A;  1MK4 A;  1IIC A;  4R9M A;  2OZU A;  4QUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...