2HUZA

Crystal structure of gnpnat1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
182
Chain Sequence
b'PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Crystal structure of glucosamine-phosphate N-acetyltransferase 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, transferase
total genus 41
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2huzA01
1TIQA 3TT2A 3FB3A 1I12A 3R9FA 2FIAA 3F8KA 2BUEA 4R87A 3R96A 2H5MA 3W91A 3FNCA 2BL1A 1RO5A 1M4DA 3CXPA 4DNCA 4MI4A 3D8PA 2CNTA 1KUXA 3N7ZA 4KZTA 5C88A 4M85A 2WPWA 1LRZA 5JQ4A 1V0CA 5EC4A 1FY7A 2HV2A 2CNMA 3VWDA 1KUYA 3GKRA 2PR1A 3UY5A 4KOYA 4HNWB 4L89A 1Y9WA 3SHPA 4XPKA 1YX0A 1YVOA 4QVTA 5C82A 1IICA 4E8OA 1P4NA 4NXYA 3IGRA 4YGOA 3EFAA 4AB7A 2FS5A 2FSRA 4HNYB 5EBVA 4KUAA 3KKWA 2JDDA 4PV6A 3VWEA 2G3AA 5F49A 4XPDB 2CY2A 1CJWA 1XF8A 1I21A 2B5GA 3BLNA 4OADA 4KOWA 2VQYA 1S7NA 2FIWA 4MBUA 3SXNA 2VEZA 1P0HA 2PRBA 2ZW6A 4KVXA 4XPLA 1IB1E 2Z10A 4MY0A 3C26A 2Z0ZA 2GANA 1B6BA 1Z9UA 2ARHA 4KUBA 2K5TA 4AG9A 3S6HA 3LD2A 1YLEA 4R3KA 2REEA 3ZJ0A 2ZPAA 2GE3A 3S6GA 1KZFA 5J8FA 2G3TA 1L0CA 2B58A 2R8VA 3H4QA 2WPXA 2QECA 3TOBA 3G3SA 4KOXA 2J8RA 4B5PB 4PSXA 2VBQA 4YRHA 1S5KA 2B3UA 2ZXVA 4MJ8A 2I79A 2OH1A 2Q44A 2D4PA 3I9SA 1YGHA 3W6XA 3T90A 3G8WA 4U9YA 1S60A 4II9A 1WK4A 4KVOE 3CXQA 1MJ9A 3OWCA 5IV0A 4IUSA 4B5OA 4RI1A 4ZBGA 4JLYA 4KVME 1CM0A 2HUZA 4LUAA 2FE7A 3PGPA 3RYOA 4I49A 4ONUA 4ORFA 1NE9A 2Z11A 4UBRA 3P2HA 2Q0YA 3F0AA 3TO9A 3GY9A 5H86A 5DWMA 3R95A 4F0YA 4FD6A 3FBUA 2NMTA 1XMTA 1VHSA 1NMTA 4AVCA 4Y49C 1Z4EA 2R98A 2OU2A 2OZUA 2AJ6A 2RC4A 4NEXA 2J8NA 3WR7A 3SXOA 1NSLA 3FIXA 3EY5A 3ZZIA 2JEVA 4KOSA 4UWJA 1M4GA 5J8CA 4MY3A 4FD7A 3W6SA 4XNHC 4R57A 2I00A 2O28A 4JJXA 2ATRA 2BSWA 5KTCA 2C27A 5H84A 3EC4A 2B4DA 1RXTA 1N71A 3EO4A 2REFA 2JLMA 2PDOA 1XE4A 2GIVA 2VXKA 5KTAA 4KOVA 4R9MA 4EVYA 4K30A 4QBJA 2VI7A 1YREA 2FXFA 2VZYA 5GCNA 3D3SA 1IYKA 1BO4A 1QSNA 4UA3A 3LODA 2QIRA 2ZW4A 5F48A 4MHDA 4CRZB 2F5IA 2B3VA 4H89A 1YK3A 3JUWA 1GHEA 2PC1A 4KOUA 4CAXA 2Q7BA 4JWPA 2G0BA 3FXTA 4H6ZA 4XPDC 4KORA 4F6AA 3TFYA 4NF1A 4NSQA 1U6MA 1MK4A 2VZZA 3R9EA 2P6GA 1S3ZA 3R1KA 4OAEA 5E96A 2EVNA 2Q04A 5FVJA 1S7FA 2EUIA 2B5GB 2AE6A 3IWGA 3GYAA 1M4IA 2OZGA 3T9YA 2FL4A 4KLWA 4FD4A 4NCZA 3TE4A 2J8MA 3DR6A 4GS4A 3TO7A 4LX9A 4CAVA 1S7LA 1Y7RA 4E0AA 4PSWA 1SQHA 1IYLA 3EXNA 1PU9A 1QSOA 4QUSA 1YVKA 1WWZA 3DSBA 4KOTA 3D2PA 3TOAA 1QSTA 5F47A 1IIDA 5CNPA 2R7HA 5HH1A 1VKCA 1XIXA 3QB8A 4HNXB 1Z4RA 4HKFA 1BOBA 2PR8A 2CNSA 3DNSA 1Q2CA 3R9GA 4XNHB 2X7BA 4JXQA 2DXQA 3DR8A 4AG7A 4OLLA 4QC6A 5I0CA 3MGDA 4UWIA 1K4JA 5IX3A 1MJBA 3BJ7A 2IL4A 2D4OA 3E0KA 5IB0A 4H6UA 2B4BA 2P6FA 2Y0MA 3JVNA 4FD5A 5ISVA 1I1DA 4IF5A 1Y9KA 4AVBA 1M1DA 1QSRA 2JDCA 3PZJA 3NE7A 4YFJA 1ON0A 2P0WA 1M44A 3F5BA 2KCWA 2Q4YA 1UFHA 4B5PA 5HMNA 3K9UA 3TCVA 2QMLA 1XEBA 4R3LA 5F46A 5DWNA 2P6EA 2PSWA 3V8IA 3QAHA 2Q4VA 3P2FA 4L8AA 3DDDA 1KUVA 4CRYB 2FT0A 1QSMA 2B4DB 3B8GA 1J4JA 4AVAA 4KLVA 2ZW7A 4PK3A 1S7KA 2A4NA 4J3GA 2PQ8A 4X5KA 4PK2A 3TTHA 3S6KA 4M3SA 2BEIA 3I3GA 1R57A 4U5YA 4JD6A 2FCKA 4QB9A 1Q2DA 4BMHA 2OZHA 3PP9A 3FYNA 2R1IA 2OB0A 4CAWA 4CS0B 3D2MA 1MJAA 3TO6A 4JXRA 5KTDA 2HQYA 4U9ZA 1PUAA 3FRMA 2ZW5A 4RS2A 3CXSA 3S6FA 1B87A 1OZPA 4E2AA 1Q2YA 5JPHA 3BJ8A 1YR0A 4Y49B
chains in the Genus database with same CATH superfamily
1LCPA 2J9AA 1HDUA 4F8ZA 1TIQA 3MRUA 3TT2A 1KWMA 3WC5A 1TF8A 4NGMA 3IFEA 4TNUA 4CYNA 2Z3MA 3FB3A 1HDQA 2ZENA 1VIXA 1I12A 1LOKA 3IIBA 2PIYA 3FF3A 3R9FA 3TX8A 1ZG8A 2FIAA 3F8KA 2BUEA 4R87A 3R96A 4MMOA 2H5MA 2ABZA 3W91A 2PJ8A 4YWYA 3FNCA 4CGPA 4NGTA 4CGLA 3D67A 2BL1A 1RO5A 1M4DA 3CXPA 4B12A 5BWAB 1LFWA 4C2ZA 4P4FA 4CYQA 4DNCA 2PRQA 3DLJA 3PBEA 4MI4A 3D8PA 2CNTA 3D68A 3SI2A 3SI0A 1KUXA 2EBJA 2V8VA 3N7ZA 4KZTA 4M85A 3KL9A 4FBEA 2WPWA 3IU2A 5C88A 1BPMA 4FAIA 3FMCA 3HUVA 1ARMA 1LRZA 5JQ4A 3SJFA 1V0CA 2Z3NA 2PJ3A 1FY7A 5EC4A 2HV2A 2CNMA 3VWDA 2ODFA 2Q7SA 1KUYA 3D7GA 2PJBA 2PR1A 2YNDA 3GKRA 4UFXA 3UY5A 5AG5A 4KOYA 4HNWB 4L89A 1Y9WA 3BXMA 5A28A 3SHPA 3GUXA 4XPKA 2V77A 1YX0A 1YVOA 4NGSA 2ZEDA 4OC0A 4QVTA 5C82A 1IICA 4E8OA 1YSJA 5ELYA 1P4NA 2YNCC 4NXYA 3IGRA 1AYEA 4PXCA 2PJAA 4YGOA 2ZEHA 3EFAA 7CPAA 4AB7A 2FS5A 2FSRA 4HNYB 5EBVA 4MCQA 4LQGA 4KUAA 1ZG9A 2AFWA 1IU8A 3FEDA 3KKWA 2JDDA 4PV6A 4PPZA 4HPSA 3PBBA 3VWEA 2G3AA 2IQ6A 4KSIA 2DEAA 5F49A 4XPDB 2CY2A 1CJWA 1XF8A 4O23A 1I21A 2V8DA 2ZEEA 4R6TA 2B5GA 4NGQA 3BLNA 3SI1A 2PVWA 1VGYA 4OADA 2FVGA 4GXHA 4KOWA 2C6PA 2VQYA 1S7NA 2Z3OA 3KQZA 2FIWA 4MBUA 3LWUA 2ZEFA 4LQ6A 3SXNA 2VEZA 3IEHA 1P0HA 4OIDA 2PRBA 2ZW6A 4KVXA 2CIJA 1IB1E 4MCSA 4XPLA 2DPTA 3B35A 1ZG7A 4MHNA 2ZEMA 5LYFA 2Z10A 4MY0A 4A33A 1GYTA 4IAVA 4CGMA 4G1PA 2GLFA 4P4DA 1Z2LA 3WT4A 4P44A 3C26A 3A9LA 2Z0ZA 2PJ6A 4ZYQA 1XOVA 2GANA 1B6BA 1Z9UA 2ARHA 2CTBA 4KUBA 4UIAA 2K5TA 3K2KA 3WC7A 3IO1A 1CPSA 3LD2A 3S6HA 4AG9A 1YLEA 4B14A 4R3KA 2REEA 3ZJ0A 2ZPAA 4CAFA 2ZOFA 3B7IA 2BCOA 1PYTB 3VH9A 4BINA 5K8PA 2GE3A 4RN7A 3S6GA 3KR4A 1KZFA 5J8FA 3SJGA 2G3TA 4UEEA 1L0CA 3IU1A 4OP4A 2B58A 2NSMA 2R8VA 2OOTA 2GLJA 3H4QA 4FWUA 4R8FA 2IMOA 2QECA 2WPXA 3G3SA 4KOXA 3TOBA 3V7ZA 2J8RA 2O4HA 2ZEPA 4PSXA 1TKFA 2VBQA 3B3WA 1S5KA 2B3UA 4YRHA 1AUGA 2F8HA 2ZXVA 4MJ8A 1ARLA 2I79A 2OH1A 2PJ4A 2Z3KA 3IJ3A 2WSAA 2Q44A 2D4PA 3I9SA 1YGHA 3CDXA 2XEJA 3T90A 3W6XA 4A94A 2WUUA 3GB0A 3G8WA 1NSAA 2YNCA 2HB6A 5G1ZA 4OKOA 4U9YA 1S60A 3FX6A 4II9A 3QNVA 1WK4A 4KVOE 3CXQA 1MJ9A 3OWCA 5IV0A 2AFZA 4IUSA 4H2KA 3GLJA 2XEIA 3KI9A 3RZAA 4B5OA 4BBHA 4RI1A 4ZBGA 4JLYA 4KVME 1XJOA 1YR0A 1CM0A 3I1UA 2HUZA 2IJZA 4LUAA 3PFEA 2FE7A 3FVLA 3PGPA 3RYOA 8CPAA 4I49A 4ONUA 1DTDA 4ORFA 3L2NA 1NE9A 2Z11A 4PQAA 1UWYA 2EO8A 4IK2A 4UBRA 3P2HA 2Q0YA 3F0AA 4X3RA 1VHEA 2BO9A 3TO9A 2RB7A 3RBUA 1Z5RA 3GY9A 2WZNA 5H86A 2DPSA 3WC6A 4ZX9A 1RTQA 5CPAA 3CPAA 3DGVA 5DWMA 4FUUA 2ZEOA 2YGWA 3R95A 4A31A 4F0YA 2EK9A 3S9LA 4FD6A 1DE4C 1PCAA 3FBUA 2NMTA 2AFUA 3D7HA 1XMTA 1VHSA 5K8MA 5LYLA 1CP7A 1YW4A 1NMTA 4AVCA 2DF5A 4Y49C 1Z4EA 5A27A 2WYRA 2R98A 1FNOA 4RUHA 4ZY0A 1XRYA 3GIUA 2OU2A 2OZUA 2AJ6A 5K8OA 2RC4A 3NA6A 3N5FA 4NEXA 4A95A 1Y0RA 2J8NA 3WR7A 3SXOA 1Z8TA 3SJEA 4WWVA 5HVHA 1NSLA 3FIXA 3EY5A 4OC3A 2JEVA 3ZZIA 5THWA 1BAVA 4KOSA 2PJ1A 4UWJA 1M4GA 2CF4A 2PIZA 3TC8A 5J8CA 3H8GA 4MY3A 1F57A 2I3CA 4FD7A 1ZLIA 4P10A 4XNHC 5LYDA 4OMEA 3W6SA 2V8HA 5LRKA 4R57A 2I00A 4X8IA 2O28A 1M4LA 3KASA 3WABA 4JJXA 2ATRA 2AFOA 2BSWA 5KTCA 1FT7A 5JH9A 3FECA 2C27A 1JQGA 5H84A 1R3NA 5AG7A 2PJ0A 3EC4A 1XMBA 4R76A 3B2YA 2B4DA 3CPXA 4F0XA 2V8GA 1RXTA 5K8NA 1N71A 2CXAA 1IOIA 1JWQA 3EO4A 2REFA 3CZXA 4CPAA 4CYOA 2JLMA 4EFDA 3NH8A 2PDOA 1XE4A 4A30A 4MFKA 3FEEA 2GIVA 2VXKA 4MFPA 4Q36A 5KTAA 4KOVA 1XBUA 4R9MA 2HC9A 2QJ8A 4EVYA 2CTCA 2VL1A 4K30A 1H8LA 4QBJA 2ZOGA 3IWEA 2PJ2A 2VI7A 3RO0A 4A38A 1YREA 3D66A 2FXFA 4MHZA 2BOAA 2AFMA 2VZYA 5GCNA 5DS0A 3B3CA 3D3SA 1IYKA 1BO4A 1QSNA 2PJ7A 4UA3A 1ZLHA 3LODA 2QIRA 1A2ZA 2ZW4A 5F48A 3B3SA 3B3VA 4MHDA 4CRZB 2F5IA 2B3VA 2AFXA 1LANA 1TKHA 2GREA 4H89A 4UIBA 5AG6A 5HVFA 4ZI6A 1YK3A 5HVGA 4UEFA 3JUWA 4UEZA 4EMEA 1GHEA 2PC1A 3H5ZA 4OC5A 4Z65A 4KOUA 5G20A 4CAXA 5JM6A 4AXVA 1Q7LA 2Q7BA 4JWPA 1YQEA 2G0BA 3FXTA 4UFVA 3JRUA 4CGOA 3PB6X 1CBXA 3ISXA 4UFWA 5D8NA 4H6ZA 4XPDC 4Q38A 1Y7EA 2F7VA 4JZ0A 1R43A 4KORA 4F6AA 3PB8X 3TFYA 4NF1A 4NSQA 1U6MA 1MK4A 2G9DA 2VZZA 3ISZA 3R9EA 2P6GA 4M6GA 4P4IA 1X10A 3T8WA 5J1QA 1S3ZA 3R1KA 4OAEA 5E96A 4B10A 2EVNA 2Q04A 5FVJA 2YNEA 1S7FA 2EUIA 4C7IA 2PCUA 5G21A 3QAYA 4NJRA 2B5GB 1ELMP 4W9YA 2AE6A 4DYOA 3IWGA 4PXDA 3GYAA 1M4IA 2Q43A 4R7MA 3PB9X 2OR4A 2OZGA 3T9YA 2RFHA 2FL4A 4OC1A 4ZX8A 4MXUA 4KLWA 1YW6A 1LAPA 4FD4A 4NCZA 4DUKA 4MCRA 2J8MA 3KZWA 3TE4A 4P6YA 4F9UA 3DR6A 4GS4A 3TO7A 2JEWA 4B5PB 4LX9A 4CAVA 1S7LA 1YLOA 3NH5A 1LAMA 1Y7RA 4E0AA 4PSWA 1SQHA 1IYLA 3H8FA 3EXNA 4NGPA 2POKA 4C68A 1PU9A 1QSOA 4QUSA 1YVKA 4ZY2A 1WWZA 3DSBA 4KOTA 5D29A 1IY7A 3NFZA 4JYWA 1IGBA 3D2PA 4ZGYB 3TOAA 3RAMA 1QSTA 1X12A 3SJXA 1QQ9A 5F47A 1IIDA 5LRJA 5CNPA 1Z8WA 2R7HA 5HH1A 1VKCA 1XIXA 3QB8A 3NE8A 4HNXB 1Z4RA 4HKFA 1BOBA 2PR8A 2CNSA 3DNSA 4OC4A 4NJQA 5LRGA 1Q2CA 3R9GA 1TF9A 3NH4A 4CYPA 3JTKA 4XNHB 2Z3PA 5AG4A 2X7BA 4JXQA 4NGRA 5CBMA 4WJBA 4YU9A 4UF4A 2DXQA 3DR8A 4AG7A 3BI0A 4OLLA 4QC6A 5I0CA 4TWEA 3MGDA 2C1CA 4KS9A 4UWIA 1K4JA 1Z8XA 4A37A 3KQXA 4B11A 2QYVA 4EWTA 5IB9A 3S9NA 5IX3A 5EMIA 2QVPA 1MJBA 1TKJA 3BJ7A 1Z8LA 2IL4A 5I4MA 2D4OA 3BHXA 4A32A 3E0KA 4OIWA 3KHXA 1HEEA 5IB0A 4H6UA 4X2TA 2B4BA 4NFRA 2P6FA 4MFJA 2JBKA 2ANPA 2Y0MA 4MHPA 3JVNA 4FD5A 4MFLA 1BLLE 3B3TA 4B6ZA 1IOFA 1EE3P 5JGFA 5ISVA 1I1DA 3VARA 4IF5A 1Y9KA 4AVBA 4KSFA 3LMSA 1M1DA 3HLPA 1CX8A 1QSRA 5AGEA 1TXRA 2JDCA 3PZJA 1BPNA 1ELLP 5LYIA 3NE7A 3PRTA 4YFJA 1ON0A 2P0WA 4A39A 2XEFA 4C7HA 1M44A 4B13A 3F5BA 1YMEA 2PJCA 5HXDA 2KCWA 2Q4ZA 2Q4YA 1UFHA 4UCMA 4OC2A 4B5PA 5HMNA 3FJUA 3K9UA 3H8EA 4MFZA 3TCVA 2QMLA 4BD9A 3S9MA 3PFOA 1QMUA 2O53A 2PJ5A 3PEIA 1XEBA 4R3LA 5F46A 5DWNA 6CPAA 4P45A 2P6EA 2EWBA 1CG2A 2PSWA 4ZY1A 3V8IA 3QAHA 4F9VA 2PE3A 3MN8A 3D7FA 4P4EA 2Q4VA 3CT9A 3P2FA 4L8AA 3DDDA 1KUVA 4CRYB 2FT0A 4MFQA 1QSMA 4Q7AA 2ZEGA 4GM5A 2EK8A 2B4DB 4C2XA 1CPXA 3B8GA 3IWWA 1J4JA 4UCNA 4IHMA 4AVAA 4KSAA 4KLVA 2Z3LA 2JBJA 2ZW7A 4A2ZA 4PK3A 1S7KA 5F09A 2A4NA 4J3GA 2PQ8A 3IC1A 1XFOA 4X5KA 4PK2A 3TTHA 3S6KA 4M3SA 2BEIA 3FH4A 2PVVA 2XEGA 4MCPA 3I3GA 1R57A 4U5YA 4JD6A 4ONWA 2C6GA 2FCKA 4QB9A 4CAEA 1Q2DA 2GFQA 1F2OA 3RNZA 2OZHA 3D7DA 4BMHA 3PP9A 3FYNA 2R1IA 4UCPA 2GU2A 2OB0A 4K3NA 4CAWA 4CS0B 3D2MA 1MJAA 3TO6A 2NYQA 4JXRA 1OBRA 3K9TA 4NGNA 4C2YA 4P4JA 5KTDA 4P4BA 3V38A 2PJ9A 2Q51A 4MRIA 4PXEA 2AFSA 3D4UA 4M6IA 4MHYA 3VATA 1VHOA 1AMPA 2HQYA 4U9ZA 1PUAA 3FRMA 2ZW5A 3KGQA 3LACA 1CP6A 2C6CA 3BI1A 4RS2A 3CXSA 3KR5A 3S6FA 1B87A 1OZPA 4PXBA 4CGNA 2ZELA 4DJLA 1F2PA 4E2AA 4M6HA 5G22A 1Q2YA 3PB7X 3PB4X 5JPHA 3BJ8A 1Y0YA 1ZO0A 4Y49B 3KHZA
chains in the Genus database with same CATH topology
1TIQA 3TT2A 4CYNA 2Z3MA 3FB3A 1I12A 3R9FA 2FIAA 3F8KA 2BUEA 4R87A 3R96A 2H5MA 3W91A 3FNCA 4CGPA 4CGLA 2BL1A 1RO5A 1M4DA 3CXPA 4B12A 5BWAB 4C2ZA 4CYQA 4DNCA 4MI4A 3D8PA 2CNTA 1KUXA 3N7ZA 4KZTA 5C88A 4M85A 2WPWA 3IU2A 1LRZA 5JQ4A 1V0CA 2Z3NA 5EC4A 1FY7A 2HV2A 2CNMA 3VWDA 1KUYA 3GKRA 2PR1A 2YNDA 4UFXA 3UY5A 5AG5A 4KOYA 4HNWB 4L89A 1Y9WA 5A28A 3SHPA 4XPKA 1YX0A 1YVOA 4QVTA 5C82A 1IICA 4E8OA 1P4NA 2YNCC 4NXYA 3IGRA 4YGOA 3EFAA 4AB7A 2FS5A 2FSRA 4HNYB 5EBVA 4KUAA 3KKWA 2JDDA 4PV6A 3VWEA 2G3AA 5F49A 4XPDB 2CY2A 1CJWA 1XF8A 1I21A 2B5GA 3BLNA 4OADA 4KOWA 2VQYA 1S7NA 2Z3OA 2FIWA 4MBUA 3SXNA 2VEZA 1P0HA 2PRBA 2ZW6A 4KVXA 4XPLA 1IB1E 2DPTA 2Z10A 4MY0A 4A33A 4CGMA 3C26A 3A9LA 2Z0ZA 2GANA 1B6BA 1Z9UA 2ARHA 4KUBA 2K5TA 4B14A 4AG9A 3S6HA 3LD2A 1YLEA 4R3KA 2REEA 3ZJ0A 2ZPAA 4CAFA 2GE3A 3S6GA 1KZFA 5J8FA 2G3TA 1L0CA 3IU1A 2B58A 2R8VA 3H4QA 2WPXA 2QECA 3TOBA 3G3SA 4KOXA 2J8RA 4B5PB 4PSXA 2VBQA 4YRHA 1S5KA 2B3UA 2ZXVA 4MJ8A 2I79A 2OH1A 2Z3KA 2WSAA 2Q44A 2D4PA 3I9SA 1YGHA 3W6XA 3T90A 2WUUA 3G8WA 2YNCA 5G1ZA 4U9YA 1S60A 4II9A 1WK4A 4KVOE 3CXQA 1MJ9A 3OWCA 5IV0A 4IUSA 4B5OA 4BBHA 4RI1A 4ZBGA 4JLYA 4KVME 1YR0A 1CM0A 2HUZA 4LUAA 2FE7A 3PGPA 3RYOA 4I49A 4ONUA 4ORFA 1NE9A 2Z11A 4UBRA 3P2HA 2Q0YA 3F0AA 3TO9A 3GY9A 5H86A 2DPSA 5DWMA 3R95A 2YGWA 4A31A 4F0YA 4FD6A 3FBUA 2NMTA 1XMTA 1VHSA 1NMTA 4AVCA 4Y49C 5A27A 1Z4EA 2R98A 2OU2A 2OZUA 2AJ6A 2RC4A 4NEXA 4A95A 2J8NA 3WR7A 3SXOA 1NSLA 3FIXA 3EY5A 3ZZIA 2JEVA 4KOSA 4UWJA 1M4GA 5J8CA 4MY3A 4FD7A 3W6SA 4XNHC 4R57A 2I00A 2O28A 4JJXA 2ATRA 2BSWA 5KTCA 2C27A 5H84A 5AG7A 3EC4A 2B4DA 4F0XA 1RXTA 1N71A 2CXAA 3EO4A 4CYOA 2REFA 2JLMA 2PDOA 1XE4A 4A30A 4MFKA 2GIVA 2VXKA 4MFPA 4Q36A 5KTAA 4KOVA 4R9MA 4EVYA 4K30A 4QBJA 3IWEA 2VI7A 1YREA 2FXFA 2VZYA 5GCNA 3D3SA 1IYKA 1BO4A 1QSNA 4UA3A 3LODA 2QIRA 2ZW4A 5F48A 4MHDA 4CRZB 2F5IA 2B3VA 4H89A 5AG6A 1YK3A 3JUWA 1GHEA 2PC1A 3H5ZA 4KOUA 5G20A 4CAXA 2Q7BA 4JWPA 2G0BA 3FXTA 4UFVA 4CGOA 4UFWA 4H6ZA 4XPDC 4Q38A 4KORA 4F6AA 3TFYA 4NF1A 4NSQA 1U6MA 1MK4A 2VZZA 3R9EA 2P6GA 1S3ZA 3R1KA 4OAEA 5E96A 4B10A 2EVNA 2Q04A 5FVJA 2YNEA 1S7FA 2EUIA 4C7IA 5G21A 2B5GB 2AE6A 3IWGA 3GYAA 1M4IA 2OZGA 3T9YA 2FL4A 4KLWA 4FD4A 4NCZA 3TE4A 2J8MA 3DR6A 4GS4A 3TO7A 4LX9A 4CAVA 1S7LA 1Y7RA 4E0AA 4PSWA 1SQHA 1IYLA 3EXNA 4C68A 1PU9A 1QSOA 4QUSA 1YVKA 1WWZA 3DSBA 4KOTA 3D2PA 4ZGYB 3TOAA 1QSTA 5F47A 1IIDA 5CNPA 2R7HA 5HH1A 1VKCA 1XIXA 3QB8A 4HNXB 1Z4RA 4HKFA 1BOBA 2PR8A 2CNSA 3DNSA 1Q2CA 3R9GA 4CYPA 3JTKA 4XNHB 2Z3PA 5AG4A 2X7BA 4JXQA 2DXQA 3DR8A 4AG7A 4OLLA 4QC6A 5I0CA 3MGDA 4KS9A 4UWIA 1K4JA 4B11A 5IX3A 1MJBA 3BJ7A 2IL4A 2D4OA 4A32A 3E0KA 5IB0A 4H6UA 2B4BA 2P6FA 4MFJA 2Y0MA 3JVNA 4FD5A 4MFLA 5ISVA 1I1DA 4IF5A 1Y9KA 4AVBA 4KSFA 1M1DA 1QSRA 5AGEA 2JDCA 3PZJA 3NE7A 4YFJA 1ON0A 2P0WA 4C7HA 1M44A 4B13A 3F5BA 2KCWA 2Q4YA 1UFHA 4UCMA 4B5PA 5HMNA 3K9UA 4MFZA 3TCVA 2QMLA 1XEBA 4R3LA 5F46A 5DWNA 2P6EA 2PSWA 3V8IA 3QAHA 2Q4VA 3P2FA 4L8AA 3DDDA 1KUVA 4CRYB 2FT0A 4MFQA 1QSMA 2B4DB 4C2XA 3B8GA 1J4JA 4UCNA 4AVAA 4KSAA 4KLVA 2Z3LA 2ZW7A 4A2ZA 4PK3A 1S7KA 2A4NA 4J3GA 2PQ8A 4X5KA 4PK2A 3TTHA 3S6KA 4M3SA 2BEIA 3I3GA 1R57A 4U5YA 4JD6A 2FCKA 4QB9A 4CAEA 1Q2DA 4BMHA 2OZHA 3PP9A 3FYNA 2R1IA 4UCPA 2OB0A 4CAWA 4CS0B 3D2MA 1MJAA 3TO6A 4JXRA 5KTDA 4C2YA 2HQYA 4U9ZA 1PUAA 3FRMA 2ZW5A 4RS2A 3CXSA 3S6FA 1B87A 1OZPA 4CGNA 4E2AA 5G22A 1Q2YA 5JPHA 3BJ8A 1ZO0A 4Y49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIQ A;  3TT2 A;  3FB3 A;  1I12 A;  3R9F A;  2FIA A;  3F8K A;  2BUE A;  4R87 A;  3R96 A;  2H5M A;  3W91 A;  3FNC A;  2BL1 A;  1RO5 A;  1M4D A;  3CXP A;  4DNC A;  4MI4 A;  3D8P A;  2CNT A;  1KUX A;  3N7Z A;  4KZT A;  5C88 A;  4M85 A;  2WPW A;  1LRZ A;  5JQ4 A;  1V0C A;  5EC4 A;  1FY7 A;  2HV2 A;  2CNM A;  3VWD A;  1KUY A;  3GKR A;  2PR1 A;  3UY5 A;  4KOY A;  4HNW B;  4L89 A;  1Y9W A;  3SHP A;  4XPK A;  1YX0 A;  1YVO A;  4QVT A;  5C82 A;  1IIC A;  4E8O A;  1P4N A;  4NXY A;  3IGR A;  4YGO A;  3EFA A;  4AB7 A;  2FS5 A;  2FSR A;  4HNY B;  5EBV A;  4KUA A;  3KKW A;  2JDD A;  4PV6 A;  3VWE A;  2G3A A;  5F49 A;  4XPD B;  2CY2 A;  1CJW A;  1XF8 A;  1I21 A;  2B5G A;  3BLN A;  4OAD A;  4KOW A;  2VQY A;  1S7N A;  2FIW A;  4MBU A;  3SXN A;  2VEZ A;  1P0H A;  2PRB A;  2ZW6 A;  4KVX A;  4XPL A;  1IB1 E;  2Z10 A;  4MY0 A;  3C26 A;  2Z0Z A;  2GAN A;  1B6B A;  1Z9U A;  2ARH A;  4KUB A;  2K5T A;  4AG9 A;  3S6H A;  3LD2 A;  1YLE A;  4R3K A;  2REE A;  3ZJ0 A;  2ZPA A;  2GE3 A;  3S6G A;  1KZF A;  5J8F A;  2G3T A;  1L0C A;  2B58 A;  2R8V A;  3H4Q A;  2WPX A;  2QEC A;  3TOB A;  3G3S A;  4KOX A;  2J8R A;  4B5P B;  4PSX A;  2VBQ A;  4YRH A;  1S5K A;  2B3U A;  2ZXV A;  4MJ8 A;  2I79 A;  2OH1 A;  2Q44 A;  2D4P A;  3I9S A;  1YGH A;  3W6X A;  3T90 A;  3G8W A;  4U9Y A;  1S60 A;  4II9 A;  1WK4 A;  4KVO E;  3CXQ A;  1MJ9 A;  3OWC A;  5IV0 A;  4IUS A;  4B5O A;  4RI1 A;  4ZBG A;  4JLY A;  4KVM E;  1CM0 A;  2HUZ A;  4LUA A;  2FE7 A;  3PGP A;  3RYO A;  4I49 A;  4ONU A;  4ORF A;  1NE9 A;  2Z11 A;  4UBR A;  3P2H A;  2Q0Y A;  3F0A A;  3TO9 A;  3GY9 A;  5H86 A;  5DWM A;  3R95 A;  4F0Y A;  4FD6 A;  3FBU A;  2NMT A;  1XMT A;  1VHS A;  1NMT A;  4AVC A;  4Y49 C;  1Z4E A;  2R98 A;  2OU2 A;  2OZU A;  2AJ6 A;  2RC4 A;  4NEX A;  2J8N A;  3WR7 A;  3SXO A;  1NSL A;  3FIX A;  3EY5 A;  3ZZI A;  2JEV A;  4KOS A;  4UWJ A;  1M4G A;  5J8C A;  4MY3 A;  4FD7 A;  3W6S A;  4XNH C;  4R57 A;  2I00 A;  2O28 A;  4JJX A;  2ATR A;  2BSW A;  5KTC A;  2C27 A;  5H84 A;  3EC4 A;  2B4D A;  1RXT A;  1N71 A;  3EO4 A;  2REF A;  2JLM A;  2PDO A;  1XE4 A;  2GIV A;  2VXK A;  5KTA A;  4KOV A;  4R9M A;  4EVY A;  4K30 A;  4QBJ A;  2VI7 A;  1YRE A;  2FXF A;  2VZY A;  5GCN A;  3D3S A;  1IYK A;  1BO4 A;  1QSN A;  4UA3 A;  3LOD A;  2QIR A;  2ZW4 A;  5F48 A;  4MHD A;  4CRZ B;  2F5I A;  2B3V A;  4H89 A;  1YK3 A;  3JUW A;  1GHE A;  2PC1 A;  4KOU A;  4CAX A;  2Q7B A;  4JWP A;  2G0B A;  3FXT A;  4H6Z A;  4XPD C;  4KOR A;  4F6A A;  3TFY A;  4NF1 A;  4NSQ A;  1U6M A;  1MK4 A;  2VZZ A;  3R9E A;  2P6G A;  1S3Z A;  3R1K A;  4OAE A;  5E96 A;  2EVN A;  2Q04 A;  5FVJ A;  1S7F A;  2EUI A;  2B5G B;  2AE6 A;  3IWG A;  3GYA A;  1M4I A;  2OZG A;  3T9Y A;  2FL4 A;  4KLW A;  4FD4 A;  4NCZ A;  3TE4 A;  2J8M A;  3DR6 A;  4GS4 A;  3TO7 A;  4LX9 A;  4CAV A;  1S7L A;  1Y7R A;  4E0A A;  4PSW A;  1SQH A;  1IYL A;  3EXN A;  1PU9 A;  1QSO A;  4QUS A;  1YVK A;  1WWZ A;  3DSB A;  4KOT A;  3D2P A;  3TOA A;  1QST A;  5F47 A;  1IID A;  5CNP A;  2R7H A;  5HH1 A;  1VKC A;  1XIX A;  3QB8 A;  4HNX B;  1Z4R A;  4HKF A;  1BOB A;  2PR8 A;  2CNS A;  3DNS A;  1Q2C A;  3R9G A;  4XNH B;  2X7B A;  4JXQ A;  2DXQ A;  3DR8 A;  4AG7 A;  4OLL A;  4QC6 A;  5I0C A;  3MGD A;  4UWI A;  1K4J A;  5IX3 A;  1MJB A;  3BJ7 A;  2IL4 A;  2D4O A;  3E0K A;  5IB0 A;  4H6U A;  2B4B A;  2P6F A;  2Y0M A;  3JVN A;  4FD5 A;  5ISV A;  1I1D A;  4IF5 A;  1Y9K A;  4AVB A;  1M1D A;  1QSR A;  2JDC A;  3PZJ A;  3NE7 A;  4YFJ A;  1ON0 A;  2P0W A;  1M44 A;  3F5B A;  2KCW A;  2Q4Y A;  1UFH A;  4B5P A;  5HMN A;  3K9U A;  3TCV A;  2QML A;  1XEB A;  4R3L A;  5F46 A;  5DWN A;  2P6E A;  2PSW A;  3V8I A;  3QAH A;  2Q4V A;  3P2F A;  4L8A A;  3DDD A;  1KUV A;  4CRY B;  2FT0 A;  1QSM A;  2B4D B;  3B8G A;  1J4J A;  4AVA A;  4KLV A;  2ZW7 A;  4PK3 A;  1S7K A;  2A4N A;  4J3G A;  2PQ8 A;  4X5K A;  4PK2 A;  3TTH A;  3S6K A;  4M3S A;  2BEI A;  3I3G A;  1R57 A;  4U5Y A;  4JD6 A;  2FCK A;  4QB9 A;  1Q2D A;  4BMH A;  2OZH A;  3PP9 A;  3FYN A;  2R1I A;  2OB0 A;  4CAW A;  4CS0 B;  3D2M A;  1MJA A;  3TO6 A;  4JXR A;  5KTD A;  2HQY A;  4U9Z A;  1PUA A;  3FRM A;  2ZW5 A;  4RS2 A;  3CXS A;  3S6F A;  1B87 A;  1OZP A;  4E2A A;  1Q2Y A;  5JPH A;  3BJ8 A;  1YR0 A;  4Y49 B; 
#chains in the Genus database with same CATH topology
 1LCP A;  2J9A A;  1HDU A;  4F8Z A;  1TIQ A;  3MRU A;  3TT2 A;  1KWM A;  3WC5 A;  1TF8 A;  4NGM A;  3IFE A;  4TNU A;  4CYN A;  2Z3M A;  3FB3 A;  1HDQ A;  2ZEN A;  1VIX A;  1I12 A;  1LOK A;  3IIB A;  2PIY A;  3FF3 A;  3R9F A;  3TX8 A;  1ZG8 A;  2FIA A;  3F8K A;  2BUE A;  4R87 A;  3R96 A;  4MMO A;  2H5M A;  2ABZ A;  3W91 A;  2PJ8 A;  4YWY A;  3FNC A;  4CGP A;  4NGT A;  4CGL A;  3D67 A;  2BL1 A;  1RO5 A;  1M4D A;  3CXP A;  4B12 A;  5BWA B;  1LFW A;  4C2Z A;  4P4F A;  4CYQ A;  4DNC A;  2PRQ A;  3DLJ A;  3PBE A;  4MI4 A;  3D8P A;  2CNT A;  3D68 A;  3SI2 A;  3SI0 A;  1KUX A;  2EBJ A;  2V8V A;  3N7Z A;  4KZT A;  4M85 A;  3KL9 A;  4FBE A;  2WPW A;  3IU2 A;  5C88 A;  1BPM A;  4FAI A;  3FMC A;  3HUV A;  1ARM A;  1LRZ A;  5JQ4 A;  3SJF A;  1V0C A;  2Z3N A;  2PJ3 A;  1FY7 A;  5EC4 A;  2HV2 A;  2CNM A;  3VWD A;  2ODF A;  2Q7S A;  1KUY A;  3D7G A;  2PJB A;  2PR1 A;  2YND A;  3GKR A;  4UFX A;  3UY5 A;  5AG5 A;  4KOY A;  4HNW B;  4L89 A;  1Y9W A;  3BXM A;  5A28 A;  3SHP A;  3GUX A;  4XPK A;  2V77 A;  1YX0 A;  1YVO A;  4NGS A;  2ZED A;  4OC0 A;  4QVT A;  5C82 A;  1IIC A;  4E8O A;  1YSJ A;  5ELY A;  1P4N A;  2YNC C;  4NXY A;  3IGR A;  1AYE A;  4PXC A;  2PJA A;  4YGO A;  2ZEH A;  3EFA A;  7CPA A;  4AB7 A;  2FS5 A;  2FSR A;  4HNY B;  5EBV A;  4MCQ A;  4LQG A;  4KUA A;  1ZG9 A;  2AFW A;  1IU8 A;  3FED A;  3KKW A;  2JDD A;  4PV6 A;  4PPZ A;  4HPS A;  3PBB A;  3VWE A;  2G3A A;  2IQ6 A;  4KSI A;  2DEA A;  5F49 A;  4XPD B;  2CY2 A;  1CJW A;  1XF8 A;  4O23 A;  1I21 A;  2V8D A;  2ZEE A;  4R6T A;  2B5G A;  4NGQ A;  3BLN A;  3SI1 A;  2PVW A;  1VGY A;  4OAD A;  2FVG A;  4GXH A;  4KOW A;  2C6P A;  2VQY A;  1S7N A;  2Z3O A;  3KQZ A;  2FIW A;  4MBU A;  3LWU A;  2ZEF A;  4LQ6 A;  3SXN A;  2VEZ A;  3IEH A;  1P0H A;  4OID A;  2PRB A;  2ZW6 A;  4KVX A;  2CIJ A;  1IB1 E;  4MCS A;  4XPL A;  2DPT A;  3B35 A;  1ZG7 A;  4MHN A;  2ZEM A;  5LYF A;  2Z10 A;  4MY0 A;  4A33 A;  1GYT A;  4IAV A;  4CGM A;  4G1P A;  2GLF A;  4P4D A;  1Z2L A;  3WT4 A;  4P44 A;  3C26 A;  3A9L A;  2Z0Z A;  2PJ6 A;  4ZYQ A;  1XOV A;  2GAN A;  1B6B A;  1Z9U A;  2ARH A;  2CTB A;  4KUB A;  4UIA A;  2K5T A;  3K2K A;  3WC7 A;  3IO1 A;  1CPS A;  3LD2 A;  3S6H A;  4AG9 A;  1YLE A;  4B14 A;  4R3K A;  2REE A;  3ZJ0 A;  2ZPA A;  4CAF A;  2ZOF A;  3B7I A;  2BCO A;  1PYT B;  3VH9 A;  4BIN A;  5K8P A;  2GE3 A;  4RN7 A;  3S6G A;  3KR4 A;  1KZF A;  5J8F A;  3SJG A;  2G3T A;  4UEE A;  1L0C A;  3IU1 A;  4OP4 A;  2B58 A;  2NSM A;  2R8V A;  2OOT A;  2GLJ A;  3H4Q A;  4FWU A;  4R8F A;  2IMO A;  2QEC A;  2WPX A;  3G3S A;  4KOX A;  3TOB A;  3V7Z A;  2J8R A;  2O4H A;  2ZEP A;  4PSX A;  1TKF A;  2VBQ A;  3B3W A;  1S5K A;  2B3U A;  4YRH A;  1AUG A;  2F8H A;  2ZXV A;  4MJ8 A;  1ARL A;  2I79 A;  2OH1 A;  2PJ4 A;  2Z3K A;  3IJ3 A;  2WSA A;  2Q44 A;  2D4P A;  3I9S A;  1YGH A;  3CDX A;  2XEJ A;  3T90 A;  3W6X A;  4A94 A;  2WUU A;  3GB0 A;  3G8W A;  1NSA A;  2YNC A;  2HB6 A;  5G1Z A;  4OKO A;  4U9Y A;  1S60 A;  3FX6 A;  4II9 A;  3QNV A;  1WK4 A;  4KVO E;  3CXQ A;  1MJ9 A;  3OWC A;  5IV0 A;  2AFZ A;  4IUS A;  4H2K A;  3GLJ A;  2XEI A;  3KI9 A;  3RZA A;  4B5O A;  4BBH A;  4RI1 A;  4ZBG A;  4JLY A;  4KVM E;  1XJO A;  1YR0 A;  1CM0 A;  3I1U A;  2HUZ A;  2IJZ A;  4LUA A;  3PFE A;  2FE7 A;  3FVL A;  3PGP A;  3RYO A;  8CPA A;  4I49 A;  4ONU A;  1DTD A;  4ORF A;  3L2N A;  1NE9 A;  2Z11 A;  4PQA A;  1UWY A;  2EO8 A;  4IK2 A;  4UBR A;  3P2H A;  2Q0Y A;  3F0A A;  4X3R A;  1VHE A;  2BO9 A;  3TO9 A;  2RB7 A;  3RBU A;  1Z5R A;  3GY9 A;  2WZN A;  5H86 A;  2DPS A;  3WC6 A;  4ZX9 A;  1RTQ A;  5CPA A;  3CPA A;  3DGV A;  5DWM A;  4FUU A;  2ZEO A;  2YGW A;  3R95 A;  4A31 A;  4F0Y A;  2EK9 A;  3S9L A;  4FD6 A;  1DE4 C;  1PCA A;  3FBU A;  2NMT A;  2AFU A;  3D7H A;  1XMT A;  1VHS A;  5K8M A;  5LYL A;  1CP7 A;  1YW4 A;  1NMT A;  4AVC A;  2DF5 A;  4Y49 C;  1Z4E A;  5A27 A;  2WYR A;  2R98 A;  1FNO A;  4RUH A;  4ZY0 A;  1XRY A;  3GIU A;  2OU2 A;  2OZU A;  2AJ6 A;  5K8O A;  2RC4 A;  3NA6 A;  3N5F A;  4NEX A;  4A95 A;  1Y0R A;  2J8N A;  3WR7 A;  3SXO A;  1Z8T A;  3SJE A;  4WWV A;  5HVH A;  1NSL A;  3FIX A;  3EY5 A;  4OC3 A;  2JEV A;  3ZZI A;  5THW A;  1BAV A;  4KOS A;  2PJ1 A;  4UWJ A;  1M4G A;  2CF4 A;  2PIZ A;  3TC8 A;  5J8C A;  3H8G A;  4MY3 A;  1F57 A;  2I3C A;  4FD7 A;  1ZLI A;  4P10 A;  4XNH C;  5LYD A;  4OME A;  3W6S A;  2V8H A;  5LRK A;  4R57 A;  2I00 A;  4X8I A;  2O28 A;  1M4L A;  3KAS A;  3WAB A;  4JJX A;  2ATR A;  2AFO A;  2BSW A;  5KTC A;  1FT7 A;  5JH9 A;  3FEC A;  2C27 A;  1JQG A;  5H84 A;  1R3N A;  5AG7 A;  2PJ0 A;  3EC4 A;  1XMB A;  4R76 A;  3B2Y A;  2B4D A;  3CPX A;  4F0X A;  2V8G A;  1RXT A;  5K8N A;  1N71 A;  2CXA A;  1IOI A;  1JWQ A;  3EO4 A;  2REF A;  3CZX A;  4CPA A;  4CYO A;  2JLM A;  4EFD A;  3NH8 A;  2PDO A;  1XE4 A;  4A30 A;  4MFK A;  3FEE A;  2GIV A;  2VXK A;  4MFP A;  4Q36 A;  5KTA A;  4KOV A;  1XBU A;  4R9M A;  2HC9 A;  2QJ8 A;  4EVY A;  2CTC A;  2VL1 A;  4K30 A;  1H8L A;  4QBJ A;  2ZOG A;  3IWE A;  2PJ2 A;  2VI7 A;  3RO0 A;  4A38 A;  1YRE A;  3D66 A;  2FXF A;  4MHZ A;  2BOA A;  2AFM A;  2VZY A;  5GCN A;  5DS0 A;  3B3C A;  3D3S A;  1IYK A;  1BO4 A;  1QSN A;  2PJ7 A;  4UA3 A;  1ZLH A;  3LOD A;  2QIR A;  1A2Z A;  2ZW4 A;  5F48 A;  3B3S A;  3B3V A;  4MHD A;  4CRZ B;  2F5I A;  2B3V A;  2AFX A;  1LAN A;  1TKH A;  2GRE A;  4H89 A;  4UIB A;  5AG6 A;  5HVF A;  4ZI6 A;  1YK3 A;  5HVG A;  4UEF A;  3JUW A;  4UEZ A;  4EME A;  1GHE A;  2PC1 A;  3H5Z A;  4OC5 A;  4Z65 A;  4KOU A;  5G20 A;  4CAX A;  5JM6 A;  4AXV A;  1Q7L A;  2Q7B A;  4JWP A;  1YQE A;  2G0B A;  3FXT A;  4UFV A;  3JRU A;  4CGO A;  3PB6 X;  1CBX A;  3ISX A;  4UFW A;  5D8N A;  4H6Z A;  4XPD C;  4Q38 A;  1Y7E A;  2F7V A;  4JZ0 A;  1R43 A;  4KOR A;  4F6A A;  3PB8 X;  3TFY A;  4NF1 A;  4NSQ A;  1U6M A;  1MK4 A;  2G9D A;  2VZZ A;  3ISZ A;  3R9E A;  2P6G A;  4M6G A;  4P4I A;  1X10 A;  3T8W A;  5J1Q A;  1S3Z A;  3R1K A;  4OAE A;  5E96 A;  4B10 A;  2EVN A;  2Q04 A;  5FVJ A;  2YNE A;  1S7F A;  2EUI A;  4C7I A;  2PCU A;  5G21 A;  3QAY A;  4NJR A;  2B5G B;  1ELM P;  4W9Y A;  2AE6 A;  4DYO A;  3IWG A;  4PXD A;  3GYA A;  1M4I A;  2Q43 A;  4R7M A;  3PB9 X;  2OR4 A;  2OZG A;  3T9Y A;  2RFH A;  2FL4 A;  4OC1 A;  4ZX8 A;  4MXU A;  4KLW A;  1YW6 A;  1LAP A;  4FD4 A;  4NCZ A;  4DUK A;  4MCR A;  2J8M A;  3KZW A;  3TE4 A;  4P6Y A;  4F9U A;  3DR6 A;  4GS4 A;  3TO7 A;  2JEW A;  4B5P B;  4LX9 A;  4CAV A;  1S7L A;  1YLO A;  3NH5 A;  1LAM A;  1Y7R A;  4E0A A;  4PSW A;  1SQH A;  1IYL A;  3H8F A;  3EXN A;  4NGP A;  2POK A;  4C68 A;  1PU9 A;  1QSO A;  4QUS A;  1YVK A;  4ZY2 A;  1WWZ A;  3DSB A;  4KOT A;  5D29 A;  1IY7 A;  3NFZ A;  4JYW A;  1IGB A;  3D2P A;  4ZGY B;  3TOA A;  3RAM A;  1QST A;  1X12 A;  3SJX A;  1QQ9 A;  5F47 A;  1IID A;  5LRJ A;  5CNP A;  1Z8W A;  2R7H A;  5HH1 A;  1VKC A;  1XIX A;  3QB8 A;  3NE8 A;  4HNX B;  1Z4R A;  4HKF A;  1BOB A;  2PR8 A;  2CNS A;  3DNS A;  4OC4 A;  4NJQ A;  5LRG A;  1Q2C A;  3R9G A;  1TF9 A;  3NH4 A;  4CYP A;  3JTK A;  4XNH B;  2Z3P A;  5AG4 A;  2X7B A;  4JXQ A;  4NGR A;  5CBM A;  4WJB A;  4YU9 A;  4UF4 A;  2DXQ A;  3DR8 A;  4AG7 A;  3BI0 A;  4OLL A;  4QC6 A;  5I0C A;  4TWE A;  3MGD A;  2C1C A;  4KS9 A;  4UWI A;  1K4J A;  1Z8X A;  4A37 A;  3KQX A;  4B11 A;  2QYV A;  4EWT A;  5IB9 A;  3S9N A;  5IX3 A;  5EMI A;  2QVP A;  1MJB A;  1TKJ A;  3BJ7 A;  1Z8L A;  2IL4 A;  5I4M A;  2D4O A;  3BHX A;  4A32 A;  3E0K A;  4OIW A;  3KHX A;  1HEE A;  5IB0 A;  4H6U A;  4X2T A;  2B4B A;  4NFR A;  2P6F A;  4MFJ A;  2JBK A;  2ANP A;  2Y0M A;  4MHP A;  3JVN A;  4FD5 A;  4MFL A;  1BLL E;  3B3T A;  4B6Z A;  1IOF A;  1EE3 P;  5JGF A;  5ISV A;  1I1D A;  3VAR A;  4IF5 A;  1Y9K A;  4AVB A;  4KSF A;  3LMS A;  1M1D A;  3HLP A;  1CX8 A;  1QSR A;  5AGE A;  1TXR A;  2JDC A;  3PZJ A;  1BPN A;  1ELL P;  5LYI A;  3NE7 A;  3PRT A;  4YFJ A;  1ON0 A;  2P0W A;  4A39 A;  2XEF A;  4C7H A;  1M44 A;  4B13 A;  3F5B A;  1YME A;  2PJC A;  5HXD A;  2KCW A;  2Q4Z A;  2Q4Y A;  1UFH A;  4UCM A;  4OC2 A;  4B5P A;  5HMN A;  3FJU A;  3K9U A;  3H8E A;  4MFZ A;  3TCV A;  2QML A;  4BD9 A;  3S9M A;  3PFO A;  1QMU A;  2O53 A;  2PJ5 A;  3PEI A;  1XEB A;  4R3L A;  5F46 A;  5DWN A;  6CPA A;  4P45 A;  2P6E A;  2EWB A;  1CG2 A;  2PSW A;  4ZY1 A;  3V8I A;  3QAH A;  4F9V A;  2PE3 A;  3MN8 A;  3D7F A;  4P4E A;  2Q4V A;  3CT9 A;  3P2F A;  4L8A A;  3DDD A;  1KUV A;  4CRY B;  2FT0 A;  4MFQ A;  1QSM A;  4Q7A A;  2ZEG A;  4GM5 A;  2EK8 A;  2B4D B;  4C2X A;  1CPX A;  3B8G A;  3IWW A;  1J4J A;  4UCN A;  4IHM A;  4AVA A;  4KSA A;  4KLV A;  2Z3L A;  2JBJ A;  2ZW7 A;  4A2Z A;  4PK3 A;  1S7K A;  5F09 A;  2A4N A;  4J3G A;  2PQ8 A;  3IC1 A;  1XFO A;  4X5K A;  4PK2 A;  3TTH A;  3S6K A;  4M3S A;  2BEI A;  3FH4 A;  2PVV A;  2XEG A;  4MCP A;  3I3G A;  1R57 A;  4U5Y A;  4JD6 A;  4ONW A;  2C6G A;  2FCK A;  4QB9 A;  4CAE A;  1Q2D A;  2GFQ A;  1F2O A;  3RNZ A;  2OZH A;  3D7D A;  4BMH A;  3PP9 A;  3FYN A;  2R1I A;  4UCP A;  2GU2 A;  2OB0 A;  4K3N A;  4CAW A;  4CS0 B;  3D2M A;  1MJA A;  3TO6 A;  2NYQ A;  4JXR A;  1OBR A;  3K9T A;  4NGN A;  4C2Y A;  4P4J A;  5KTD A;  4P4B A;  3V38 A;  2PJ9 A;  2Q51 A;  4MRI A;  4PXE A;  2AFS A;  3D4U A;  4M6I A;  4MHY A;  3VAT A;  1VHO A;  1AMP A;  2HQY A;  4U9Z A;  1PUA A;  3FRM A;  2ZW5 A;  3KGQ A;  3LAC A;  1CP6 A;  2C6C A;  3BI1 A;  4RS2 A;  3CXS A;  3KR5 A;  3S6F A;  1B87 A;  1OZP A;  4PXB A;  4CGN A;  2ZEL A;  4DJL A;  1F2P A;  4E2A A;  4M6H A;  5G22 A;  1Q2Y A;  3PB7 X;  3PB4 X;  5JPH A;  3BJ8 A;  1Y0Y A;  1ZO0 A;  4Y49 B;  3KHZ A; 
#chains in the Genus database with same CATH homology
 1TIQ A;  3TT2 A;  4CYN A;  2Z3M A;  3FB3 A;  1I12 A;  3R9F A;  2FIA A;  3F8K A;  2BUE A;  4R87 A;  3R96 A;  2H5M A;  3W91 A;  3FNC A;  4CGP A;  4CGL A;  2BL1 A;  1RO5 A;  1M4D A;  3CXP A;  4B12 A;  5BWA B;  4C2Z A;  4CYQ A;  4DNC A;  4MI4 A;  3D8P A;  2CNT A;  1KUX A;  3N7Z A;  4KZT A;  5C88 A;  4M85 A;  2WPW A;  3IU2 A;  1LRZ A;  5JQ4 A;  1V0C A;  2Z3N A;  5EC4 A;  1FY7 A;  2HV2 A;  2CNM A;  3VWD A;  1KUY A;  3GKR A;  2PR1 A;  2YND A;  4UFX A;  3UY5 A;  5AG5 A;  4KOY A;  4HNW B;  4L89 A;  1Y9W A;  5A28 A;  3SHP A;  4XPK A;  1YX0 A;  1YVO A;  4QVT A;  5C82 A;  1IIC A;  4E8O A;  1P4N A;  2YNC C;  4NXY A;  3IGR A;  4YGO A;  3EFA A;  4AB7 A;  2FS5 A;  2FSR A;  4HNY B;  5EBV A;  4KUA A;  3KKW A;  2JDD A;  4PV6 A;  3VWE A;  2G3A A;  5F49 A;  4XPD B;  2CY2 A;  1CJW A;  1XF8 A;  1I21 A;  2B5G A;  3BLN A;  4OAD A;  4KOW A;  2VQY A;  1S7N A;  2Z3O A;  2FIW A;  4MBU A;  3SXN A;  2VEZ A;  1P0H A;  2PRB A;  2ZW6 A;  4KVX A;  4XPL A;  1IB1 E;  2DPT A;  2Z10 A;  4MY0 A;  4A33 A;  4CGM A;  3C26 A;  3A9L A;  2Z0Z A;  2GAN A;  1B6B A;  1Z9U A;  2ARH A;  4KUB A;  2K5T A;  4B14 A;  4AG9 A;  3S6H A;  3LD2 A;  1YLE A;  4R3K A;  2REE A;  3ZJ0 A;  2ZPA A;  4CAF A;  2GE3 A;  3S6G A;  1KZF A;  5J8F A;  2G3T A;  1L0C A;  3IU1 A;  2B58 A;  2R8V A;  3H4Q A;  2WPX A;  2QEC A;  3TOB A;  3G3S A;  4KOX A;  2J8R A;  4B5P B;  4PSX A;  2VBQ A;  4YRH A;  1S5K A;  2B3U A;  2ZXV A;  4MJ8 A;  2I79 A;  2OH1 A;  2Z3K A;  2WSA A;  2Q44 A;  2D4P A;  3I9S A;  1YGH A;  3W6X A;  3T90 A;  2WUU A;  3G8W A;  2YNC A;  5G1Z A;  4U9Y A;  1S60 A;  4II9 A;  1WK4 A;  4KVO E;  3CXQ A;  1MJ9 A;  3OWC A;  5IV0 A;  4IUS A;  4B5O A;  4BBH A;  4RI1 A;  4ZBG A;  4JLY A;  4KVM E;  1YR0 A;  1CM0 A;  2HUZ A;  4LUA A;  2FE7 A;  3PGP A;  3RYO A;  4I49 A;  4ONU A;  4ORF A;  1NE9 A;  2Z11 A;  4UBR A;  3P2H A;  2Q0Y A;  3F0A A;  3TO9 A;  3GY9 A;  5H86 A;  2DPS A;  5DWM A;  3R95 A;  2YGW A;  4A31 A;  4F0Y A;  4FD6 A;  3FBU A;  2NMT A;  1XMT A;  1VHS A;  1NMT A;  4AVC A;  4Y49 C;  5A27 A;  1Z4E A;  2R98 A;  2OU2 A;  2OZU A;  2AJ6 A;  2RC4 A;  4NEX A;  4A95 A;  2J8N A;  3WR7 A;  3SXO A;  1NSL A;  3FIX A;  3EY5 A;  3ZZI A;  2JEV A;  4KOS A;  4UWJ A;  1M4G A;  5J8C A;  4MY3 A;  4FD7 A;  3W6S A;  4XNH C;  4R57 A;  2I00 A;  2O28 A;  4JJX A;  2ATR A;  2BSW A;  5KTC A;  2C27 A;  5H84 A;  5AG7 A;  3EC4 A;  2B4D A;  4F0X A;  1RXT A;  1N71 A;  2CXA A;  3EO4 A;  4CYO A;  2REF A;  2JLM A;  2PDO A;  1XE4 A;  4A30 A;  4MFK A;  2GIV A;  2VXK A;  4MFP A;  4Q36 A;  5KTA A;  4KOV A;  4R9M A;  4EVY A;  4K30 A;  4QBJ A;  3IWE A;  2VI7 A;  1YRE A;  2FXF A;  2VZY A;  5GCN A;  3D3S A;  1IYK A;  1BO4 A;  1QSN A;  4UA3 A;  3LOD A;  2QIR A;  2ZW4 A;  5F48 A;  4MHD A;  4CRZ B;  2F5I A;  2B3V A;  4H89 A;  5AG6 A;  1YK3 A;  3JUW A;  1GHE A;  2PC1 A;  3H5Z A;  4KOU A;  5G20 A;  4CAX A;  2Q7B A;  4JWP A;  2G0B A;  3FXT A;  4UFV A;  4CGO A;  4UFW A;  4H6Z A;  4XPD C;  4Q38 A;  4KOR A;  4F6A A;  3TFY A;  4NF1 A;  4NSQ A;  1U6M A;  1MK4 A;  2VZZ A;  3R9E A;  2P6G A;  1S3Z A;  3R1K A;  4OAE A;  5E96 A;  4B10 A;  2EVN A;  2Q04 A;  5FVJ A;  2YNE A;  1S7F A;  2EUI A;  4C7I A;  5G21 A;  2B5G B;  2AE6 A;  3IWG A;  3GYA A;  1M4I A;  2OZG A;  3T9Y A;  2FL4 A;  4KLW A;  4FD4 A;  4NCZ A;  3TE4 A;  2J8M A;  3DR6 A;  4GS4 A;  3TO7 A;  4LX9 A;  4CAV A;  1S7L A;  1Y7R A;  4E0A A;  4PSW A;  1SQH A;  1IYL A;  3EXN A;  4C68 A;  1PU9 A;  1QSO A;  4QUS A;  1YVK A;  1WWZ A;  3DSB A;  4KOT A;  3D2P A;  4ZGY B;  3TOA A;  1QST A;  5F47 A;  1IID A;  5CNP A;  2R7H A;  5HH1 A;  1VKC A;  1XIX A;  3QB8 A;  4HNX B;  1Z4R A;  4HKF A;  1BOB A;  2PR8 A;  2CNS A;  3DNS A;  1Q2C A;  3R9G A;  4CYP A;  3JTK A;  4XNH B;  2Z3P A;  5AG4 A;  2X7B A;  4JXQ A;  2DXQ A;  3DR8 A;  4AG7 A;  4OLL A;  4QC6 A;  5I0C A;  3MGD A;  4KS9 A;  4UWI A;  1K4J A;  4B11 A;  5IX3 A;  1MJB A;  3BJ7 A;  2IL4 A;  2D4O A;  4A32 A;  3E0K A;  5IB0 A;  4H6U A;  2B4B A;  2P6F A;  4MFJ A;  2Y0M A;  3JVN A;  4FD5 A;  4MFL A;  5ISV A;  1I1D A;  4IF5 A;  1Y9K A;  4AVB A;  4KSF A;  1M1D A;  1QSR A;  5AGE A;  2JDC A;  3PZJ A;  3NE7 A;  4YFJ A;  1ON0 A;  2P0W A;  4C7H A;  1M44 A;  4B13 A;  3F5B A;  2KCW A;  2Q4Y A;  1UFH A;  4UCM A;  4B5P A;  5HMN A;  3K9U A;  4MFZ A;  3TCV A;  2QML A;  1XEB A;  4R3L A;  5F46 A;  5DWN A;  2P6E A;  2PSW A;  3V8I A;  3QAH A;  2Q4V A;  3P2F A;  4L8A A;  3DDD A;  1KUV A;  4CRY B;  2FT0 A;  4MFQ A;  1QSM A;  2B4D B;  4C2X A;  3B8G A;  1J4J A;  4UCN A;  4AVA A;  4KSA A;  4KLV A;  2Z3L A;  2ZW7 A;  4A2Z A;  4PK3 A;  1S7K A;  2A4N A;  4J3G A;  2PQ8 A;  4X5K A;  4PK2 A;  3TTH A;  3S6K A;  4M3S A;  2BEI A;  3I3G A;  1R57 A;  4U5Y A;  4JD6 A;  2FCK A;  4QB9 A;  4CAE A;  1Q2D A;  4BMH A;  2OZH A;  3PP9 A;  3FYN A;  2R1I A;  4UCP A;  2OB0 A;  4CAW A;  4CS0 B;  3D2M A;  1MJA A;  3TO6 A;  4JXR A;  5KTD A;  4C2Y A;  2HQY A;  4U9Z A;  1PUA A;  3FRM A;  2ZW5 A;  4RS2 A;  3CXS A;  3S6F A;  1B87 A;  1OZP A;  4CGN A;  4E2A A;  5G22 A;  1Q2Y A;  5JPH A;  3BJ8 A;  1ZO0 A;  4Y49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...