2HUZA

Crystal structure of gnpnat1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
182
structure length
182
Chain Sequence
PDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Crystal structure of glucosamine-phosphate N-acetyltransferase 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, transferase
total genus 41
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2huzA01
2WPXA 3DDDA 2Q4VA 3KKWA 3CXSA 3P2FA 4M85A 1M1DA 4KOYA 3TO9A 2QECA 4QUSA 3R95A 2J8NA 2JDCA 5JQ4A 1KZFA 3F0AA 1BOBA 4U5YA 1VKCA 3G8WA 1U6MA 1V0CA 2NMTA 2ZPAA 3R9FA 3NE7A 2A4NA 1S7LA 1YR0A 1XMTA 3T90A 4AVCA 5F48A 2ZW5A 1L0CA 2R98A 2FE7A 1NSLA 4UWJA 5F46A 3RYOA 5KTAA 3W6SA 4Y49B 1YLEA 3QB8A 2B4DB 4F0YA 1P4NA 4UA3A 4GS4A 4R3LA 1Y9KA 4AVBA 1KUVA 2Z10A 1IYKA 4XNHC 1YGHA 4NSQA 1IB1E 5H84A 3OWCA 4MI4A 3DR8A 2VQYA 4JD6A 3P2HA 4CRYB 4MJ8A 3R96A 2R8VA 1Q2CA 2JDDA 4MHDA 1NE9A 2B3UA 1YVOA 4HNWB 1IIDA 2FSRA 1S60A 3EC4A 3N7ZA 5IB0A 4M3SA 2QIRA 2PQ8A 3ZZIA 3CXQA 2FS5A 1IYLA 4UBRA 4H89A 2AE6A 3S6HA 4FD4A 1CJWA 2CY2A 4II9A 2Q44A 1QSNA 2PRBA 4MY0A 2EVNA 4IF5A 4LX9A 3R1KA 4FD6A 1RXTA 4KVXA 4KUBA 1CM0A 2G3AA 3EO4A 3TCVA 4HNYB 2J8MA 4XNHB 4MBUA 3GY9A 1GHEA 1QSOA 4KUAA 4YRHA 3FNCA 2O28A 4AG7A 3MGDA 3W6XA 4R3KA 3W91A 3GYAA 4CAVA 4B5OA 5H86A 4XPLA 2KCWA 4YFJA 3BLNA 3C26A 4R9MA 4XPDC 2FT0A 1S3ZA 2HQYA 1LRZA 3G3SA 4KOVA 3TO6A 1FY7A 1QSMA 1XE4A 2ARHA 4L89A 2H5MA 4NF1A 4HNXB 4L8AA 1Q2DA 4PV6A 1MK4A 3SHPA 4KVME 3D2PA 3SXOA 3IWGA 2G0BA 1ON0A 1WK4A 5KTDA 5EC4A 3EY5A 4NCZA 1Q2YA 2QMLA 3EXNA 5F49A 3IGRA 1I1DA 4OADA 3GKRA 4QB9A 1M4IA 1S7FA 2JEVA 3I9SA 3S6FA 3S6KA 2IL4A 4PSXA 4EVYA 1XEBA 1Y9WA 4ZBGA 2P6FA 2Z0ZA 2OH1A 4JWPA 4KOSA 3BJ8A 4E2AA 3FYNA 2D4PA 1Z4RA 2OZUA 2ZXVA 4X5KA 5HMNA 2I79A 1YREA 2FIWA 2RC4A 2VZYA 1YVKA 2I00A 1M44A 4KORA 4CAWA 1MJ9A 3QAHA 1BO4A 4KOUA 2C27A 4KLWA 4U9YA 4OAEA 2B58A 2Q0YA 3K9UA 3EFAA 2FL4A 4QC6A 3T9YA 1SQHA 2ZW7A 4JJXA 3DR6A 4U9ZA 2GANA 3BJ7A 3JVNA 4R87A 2BSWA 1N71A 2FIAA 1NMTA 3I3GA 3R9GA 2BEIA 2CNSA 4JXRA 4NEXA 1QSRA 2Q04A 4KZTA 3D8PA 5I0CA 4PK3A 4PSWA 3SXNA 4BMHA 2PR1A 5C82A 4QBJA 4KOWA 4HKFA 4RS2A 2VXKA 3R9EA 4DNCA 3JUWA 2REEA 2PDOA 2BUEA 4UWIA 2GIVA 4KOTA 2ZW4A 3TFYA 1Y7RA 2Q4YA 4E0AA 3FXTA 4MY3A 1PUAA 3VWDA 1KUYA 1YX0A 1Z4EA 4ONUA 3PP9A 1IICA 2F5IA 1MJBA 2PR8A 2VEZA 5EBVA 3PGPA 2P6GA 2B5GB 4CRZB 4QVTA 4F6AA 1I12A 2OZGA 2J8RA 5JPHA 4NXYA 2Y0MA 4KVOE 4JXQA 2P6EA 3TT2A 2R1IA 5IX3A 2PSWA 2B3VA 2DXQA 3FIXA 1I21A 5ISVA 1B87A 4KLVA 2X7BA 1K4JA 3FB3A 4YGOA 1S5KA 2OB0A 3TOAA 4H6UA 3LD2A 2GE3A 4IUSA 1KUXA 1XF8A 4CAXA 5HH1A 1PU9A 4OLLA 2VZZA 2FXFA 1M4GA 1P0HA 3TOBA 1S7KA 2CNTA 1XIXA 2G3TA 5DWNA 3V8IA 4XPDB 5IV0A 4ORFA 3E0KA 3B8GA 1QSTA 2FCKA 4R57A 2WPWA 1S7NA 5CNPA 1B6BA 3PZJA 4H6ZA 4RI1A 2D4OA 5GCNA 5E96A 2HUZA 3D3SA 3ZJ0A 1M4DA 1TIQA 2B5GA 4B5PB 3F5BA 2PC1A 2BL1A 3TE4A 2OZHA 2CNMA 3H4QA 4JLYA 5KTCA 4FD7A 2P0WA 3FBUA 2EUIA 1OZPA 1J4JA 4AG9A 5J8CA 3DNSA 4J3GA 3VWEA 2HV2A 2ATRA 2K5TA 5DWMA 1R57A 3CXPA 4LUAA 4E8OA 1WWZA 3D2MA 3DSBA 3S6GA 2REFA 3LODA 2AJ6A 5J8FA 2OU2A 1MJAA 1Z9UA 5FVJA 4AB7A 2B4DA 3F8KA 2Z11A 3TTHA 3FRMA 1YK3A 4FD5A 2JLMA 1UFHA 4XPKA 3WR7A 1RO5A 1VHSA 2VBQA 4Y49C 2B4BA 2R7HA 4B5PA 3TO7A 5F47A 4PK2A 5C88A 4KOXA 2Q7BA 3UY5A 4K30A 4CS0B 2ZW6A 2VI7A 4AVAA 4I49A
chains in the Genus database with same CATH superfamily
2WPXA 2EO8A 3DDDA 4UEZA 2BCOA 2Q4VA 3KKWA 3CXSA 3P2FA 1ZLHA 3IU1A 4M85A 5LRGA 4P4JA 1M1DA 1CP7A 1VIXA 4PXCA 3JRUA 4DUKA 4KOYA 3SI1A 4UCPA 3TO9A 3PFOA 1PCAA 2QECA 4QUSA 3CPAA 3R95A 1LFWA 2J8NA 2JDCA 4B6ZA 3BHXA 2ANPA 5JQ4A 4P10A 1KZFA 4F0XA 3F0AA 1BOBA 2PJ6A 3KHXA 2EK8A 2O4HA 4U5YA 1VKCA 1YW4A 2ODFA 3G8WA 1A2ZA 1U6MA 1V0CA 2NMTA 2ZPAA 3R9FA 4KSAA 1F2PA 3NE7A 2A4NA 4NJQA 5LYFA 1S7LA 1YR0A 3D7FA 1XMTA 3T90A 2OOTA 5F48A 4AVCA 2ZW5A 1L0CA 2R98A 2FE7A 1NSLA 4UWJA 3B3WA 1VHOA 1YQEA 3D7GA 5F46A 3RYOA 2IJZA 4FBEA 5KTAA 1IU8A 4OC2A 3W6SA 4A39A 4Y49B 4BD9A 4CPAA 4IAVA 1LAMA 2PJ0A 3I1UA 1YLEA 2Z3MA 3FH4A 3QB8A 2B4DB 4A95A 4AVAA 4CYQA 2V8VA 4MFJA 2PJ1A 4OC3A 1YW6A 4F0YA 1LANA 1X10A 1P4NA 3D4UA 1FNOA 2ZEGA 3NH4A 5JH9A 4C7IA 2AFXA 2ZEPA 4UA3A 4GS4A 4R3LA 1Y9KA 2Q43A 4MCSA 2NSMA 5THWA 4AVBA 1KUVA 2YNDA 2Z10A 4C2ZA 3IWWA 1IYKA 4MXUA 4P4FA 4XNHC 3D7HA 3SJFA 1YGHA 3RO0A 4NSQA 1IB1E 2PJAA 1XBUA 3FMCA 5H84A 2PVVA 1XJOA 3OWCA 1R43A 2PJCA 4OIDA 4MI4A 3DR8A 5K8MA 3IFEA 2VQYA 2F7VA 4JD6A 2I3CA 3NFZA 3P2HA 5K8OA 3DLJA 4UIAA 4MHPA 6CPAA 1Z8WA 4MJ8A 4YWYA 4CRYB 5IB9A 4CYPA 3R96A 2R8VA 1Q2CA 2JDDA 3KR4A 2EBJA 3MRUA 4MHDA 5HVGA 1DTDA 1NE9A 2B3UA 1YVOA 2WZNA 2O53A 4HNWB 1IIDA 4ZGYB 2ZOGA 2FSRA 4Q36A 1S60A 3EC4A 4M6GA 3H8GA 1R3NA 3KL9A 3D67A 3LMSA 1X12A 3N7ZA 3RBUA 4B13A 5IB0A 5LRJA 4FAIA 4M3SA 4CAEA 4W9YA 4CGNA 3FEEA 2BO9A 4C2YA 4O23A 4RN7A 2QIRA 2PQ8A 4TWEA 3ZZIA 3CXQA 1KWMA 2FS5A 1IYLA 5A27A 4NGRA 2JBJA 4H89A 4UBRA 2AE6A 3S6HA 4FD4A 1CJWA 2CY2A 4II9A 5G21A 1HEEA 3JTKA 3B3VA 4NGTA 2Q44A 2GLFA 4G1PA 3SI2A 1QSNA 2PJ3A 2PRBA 4OC1A 5LYLA 4MY0A 2EVNA 3KQZA 4JZ0A 2C6CA 2ZEHA 4IF5A 3R1KA 4LX9A 4FD6A 1ZO0A 1RXTA 4P4BA 4KVXA 3KQXA 3QAYA 4KUBA 1BLLE 1CM0A 2G3AA 3EO4A 3TCVA 4HNYB 2J8MA 4XNHB 4A38A 4MBUA 3S9LA 3HUVA 3GY9A 1GHEA 4DJLA 1QSOA 2G9DA 4KUAA 4AXVA 4YRHA 3FNCA 1QQ9A 2FVGA 2O28A 2YGWA 3GIUA 4AG7A 5K8PA 4UCMA 3KR5A 3PB4X 3MGDA 4BINA 3W6XA 4LQ6A 1ZLIA 4R3KA 4UFXA 1HDUA 3W91A 3GYAA 4CAVA 3QNVA 5HVHA 1ZG8A 4MMOA 4B5OA 2ZEOA 2AFMA 5J1QA 3KI9A 1NSAA 2Q7SA 1XFOA 1XRYA 4NGNA 4MFPA 5H86A 2JEWA 3BXMA 4XPLA 2KCWA 2ZEMA 4NFRA 4YFJA 1F57A 3BLNA 3C26A 4R9MA 1AUGA 4XPDC 2FT0A 1S3ZA 2PJ9A 4KSIA 3N5FA 2HQYA 2ZEFA 1LRZA 3G3SA 4KOVA 3TO6A 1ELMP 1FY7A 1QSMA 5I4MA 5A28A 1XE4A 2HB6A 2IMOA 2ARHA 4IHMA 4X8IA 4L89A 2QYVA 1Y0YA 5ELYA 2H5MA 4X2TA 1Q7LA 2Z3LA 5JGFA 2PRQA 1YMEA 3TC8A 2XEFA 2YNEA 5AGEA 4NF1A 4ZX9A 4ZY2A 3IU2A 2EK9A 4HNXB 1BPNA 2C1CA 1Q2DA 4L8AA 4PXDA 4MHYA 4PV6A 1MK4A 3SHPA 5HXDA 1JWQA 4KVME 2WYRA 3PB6X 4MHNA 3D2PA 3SXOA 3IWGA 2G0BA 3CZXA 4C68A 1ON0A 4IK2A 1WK4A 2F8HA 4KSFA 2GU2A 3PEIA 3IJ3A 5EC4A 3EY5A 1TKHA 1AYEA 5KTDA 1Y7EA 4NCZA 1Q2YA 2ZENA 1TKJA 2QMLA 3EXNA 5F49A 3SI0A 1IY7A 3IGRA 4A94A 1I1DA 1VGYA 5AG5A 3B3CA 4OADA 3GKRA 4QB9A 1M4IA 3PBEA 1S7FA 2JEVA 2PJ8A 2GREA 2DF5A 5EMIA 3I9SA 1PYTB 3S6FA 3S6KA 2IL4A 4PSXA 4EVYA 1XEBA 1Y9WA 3IIBA 4ZBGA 2P6FA 2Z0ZA 1Z8LA 2OH1A 4JWPA 4KOSA 3PB7X 2XEJA 3BJ8A 4A37A 4EWTA 4E2AA 3FYNA 2D4PA 1Z4RA 2OZUA 2ZXVA 4UEEA 4X5KA 5BWAB 4OC5A 4OMEA 3FEDA 5HMNA 2I79A 1YREA 2FIWA 4FWUA 2AFUA 4P44A 2RC4A 3K2KA 2VZYA 1YVKA 4R8FA 1H8LA 1M44A 2I00A 3KZWA 4KORA 2GLJA 4CAWA 1MJ9A 3QAHA 3K9TA 1BO4A 4CGMA 4HPSA 4KOUA 2C27A 2VL1A 3PB8X 1CX8A 4KLWA 4OAEA 2B58A 4U9YA 1TXRA 2Q0YA 4NGQA 3CPXA 3EFAA 3K9UA 1YLOA 2FL4A 3B3SA 4ZI6A 5G20A 4QC6A 3T9YA 1BAVA 3TX8A 2EWBA 1SQHA 3B7IA 5LYDA 1Y0RA 5DS0A 1TF8A 4OKOA 2ZW7A 1CPSA 4F9VA 3GUXA 3DR6A 2GFQA 2GANA 4JJXA 4U9ZA 3BJ7A 4GM5A 3JVNA 4R87A 2BSWA 2WUUA 1ZG9A 2PVWA 3H8FA 2NYQA 4LQGA 4PXBA 1N71A 1ARMA 1FT7A 2FIAA 1XOVA 5D29A 3IEHA 1NMTA 3CDXA 2HC9A 5CBMA 3I3GA 3R9GA 2BEIA 2CNSA 2CF4A 4JXRA 4NEXA 3FJUA 2PIYA 1QSRA 3NH8A 4KS9A 2DPTA 4UIBA 1OBRA 2YNCC 4PQAA 4Q38A 4Z65A 4TNUA 2Q04A 4MCPA 4B10A 1HDQA 4A33A 3WC6A 4KZTA 3S9MA 4DYOA 3D8PA 3WT4A 5I0CA 4CAFA 4PK3A 1JQGA 4PSWA 4P4DA 3SXNA 4BMHA 4NGSA 4CGOA 1M4LA 2Q4ZA 2PR1A 5JM6A 3BI1A 4A30A 3T8WA 5C82A 3GB0A 4QBJA 1ARLA 2ZEDA 3SJGA 4KOWA 1IOIA 2ZELA 3LACA 3HLPA 4HKFA 1ZG7A 4RS2A 3RZAA 1BPMA 2VXKA 3S9NA 2V8GA 2Z3PA 3ISZA 3R9EA 4PPZA 4MRIA 4DNCA 3B3TA 3D66A 3IO1A 3JUWA 2REEA 8CPAA 2CXAA 1Z2LA 4CYOA 4R76A 2PDOA 1VHEA 2BUEA 3DGVA 3ISXA 4UWIA 1IOFA 3FVLA 2GIVA 4KOTA 4ZY1A 1CG2A 2ZW4A 5LYIA 3TFYA 2V77A 3LWUA 1Y7RA 4CGPA 2Q4YA 4EMEA 4E0AA 1Z8XA 3FXTA 4M6HA 4PXEA 4ONWA 4F9UA 4MY3A 1PUAA 3VWDA 4GXHA 1KUYA 1YX0A 1Z4EA 3WC5A 4NGPA 2Z3KA 4MFKA 4ONUA 3PP9A 1TKFA 1GYTA 1IICA 4MFLA 4EFDA 2F5IA 1MJBA 2PR8A 2VEZA 5EBVA 3PGPA 2P6GA 1LCPA 2B5GB 4CRZB 4QVTA 4F6AA 1I12A 2OZGA 2J8RA 5JPHA 4NXYA 2RB7A 1RTQA 2Y0MA 2AFOA 4KVOE 4JXQA 3V38A 2P6EA 3TT2A 2R1IA 5IX3A 2CTCA 2PSWA 2B3VA 2DXQA 3FIXA 1I21A 4ZYQA 3WC7A 4ZY0A 5ISVA 1B87A 3D7DA 3KHZA 4KLVA 2X7BA 4NJRA 1K4JA 3FB3A 4UCNA 1S5KA 4YGOA 2OB0A 3VATA 2PJ7A 4CGLA 2ABZA 3TOAA 4H6UA 2QVPA 3LD2A 4P45A 4A31A 3H8EA 1ELLP 2IQ6A 2GE3A 4IUSA 2RFHA 1EE3P 1KUXA 4NGMA 1CBXA 1XF8A 4CAXA 2WSAA 5HH1A 1PU9A 4OLLA 2ZOFA 3A9LA 2FXFA 2VZZA 1M4GA 1P0HA 3RNZA 1S7KA 3TOBA 4A2ZA 2CNTA 2CIJA 4BBHA 3BI0A 4R7MA 1XIXA 2G3TA 1Z8TA 5DWNA 2PJ2A 2DEAA 4XPDB 3V8IA 5IV0A 3VARA 5HVFA 4ORFA 3E0KA 2C6PA 3B8GA 1QSTA 4F8ZA 3RAMA 2FCKA 4R57A 2WPWA 3NA6A 1S7NA 1DE4C 4WWVA 5CNPA 1B6BA 1UWYA 4A32A 5LRKA 2PJBA 4P4EA 3PZJA 1LOKA 3FECA 4H6ZA 4RUHA 2PJ5A 4RI1A 2D4OA 4MCQA 5GCNA 4C2XA 4MFQA 4OIWA 4C7HA 4OC0A 3SJEA 2PCUA 1Z5RA 5E96A 2HUZA 3KGQA 3D3SA 3PB9X 3ZJ0A 1M4DA 1TIQA 4K3NA 4OC4A 2B5GA 3SJXA 1YSJA 4B5PB 4H2KA 3H5ZA 2BOAA 2YNCA 3F5BA 2PC1A 2BL1A 3CT9A 2ZEEA 3TE4A 3MN8A 5D8NA 2OZHA 2CNMA 3H4QA 4JLYA 1LAPA 5KTCA 2PJ4A 3B2YA 2PE3A 4X3RA 2V8DA 2P0WA 4FD7A 3FBUA 2EUIA 1OZPA 1J4JA 4AG9A 5J8CA 3DNSA 3PRTA 4J3GA 4MHZA 4B11A 3VWEA 5CPAA 5AG7A 2J9AA 2CTBA 2HV2A 4YU9A 1XMBA 2ATRA 2K5TA 5DWMA 1QMUA 1R57A 3CXPA 3FX6A 4LUAA 4UEFA 4E8OA 2OR4A 4MFZA 1WWZA 3V7ZA 2C6GA 2XEGA 3D2MA 3DSBA 3S6GA 1TF9A 1CP6A 1IGBA 4Q7AA 2PIZA 2POKA 1CPXA 3FF3A 3NH5A 4P4IA 2REFA 5K8NA 3IC1A 2Z3NA 3LODA 2DPSA 2AJ6A 5AG4A 7CPAA 3PBBA 5J8FA 2OU2A 4OP4A 3D68A 1MJAA 1Z9UA 5FVJA 4AB7A 3IWEA 3GLJA 5G1ZA 5AG6A 3B35A 2B4DA 3F8KA 4ZX8A 2XEIA 2Z11A 2Z3OA 3FRMA 3TTHA 1YK3A 3NE8A 5G22A 4FUUA 4P6YA 2QJ8A 4R6TA 4FD5A 2JLMA 1UFHA 5F09A 3KASA 4UFWA 1F2OA 4WJBA 4XPKA 3WR7A 3WABA 1RO5A 1VHSA 4UFVA 2AFWA 4B12A 2VBQA 4Y49C 2B4BA 4JYWA 2R7HA 4B5PA 2JBKA 3TO7A 2Q51A 5F47A 4PK2A 5C88A 4M6IA 4KOXA 3PFEA 2Q7BA 2V8HA 3VH9A 3UY5A 4MCRA 4K30A 4UF4A 4CS0B 4B14A 4CYNA 2AFZA 2AFSA 2VI7A 2ZW6A 3L2NA 1AMPA 4I49A
chains in the Genus database with same CATH topology
2WPXA 3DDDA 2Q4VA 3KKWA 3CXSA 3P2FA 3IU1A 4M85A 1M1DA 4KOYA 4UCPA 3TO9A 2QECA 4QUSA 3R95A 2J8NA 2JDCA 5JQ4A 1KZFA 4F0XA 3F0AA 1BOBA 4U5YA 1VKCA 3G8WA 1U6MA 1V0CA 2NMTA 2ZPAA 3R9FA 4KSAA 3NE7A 2A4NA 1S7LA 1YR0A 1XMTA 3T90A 4AVCA 5F48A 2ZW5A 1L0CA 2R98A 2FE7A 1NSLA 4UWJA 5F46A 3RYOA 5KTAA 3W6SA 4Y49B 1YLEA 2Z3MA 3QB8A 2B4DB 4A95A 4CYQA 4F0YA 4MFJA 1P4NA 4C7IA 4UA3A 4GS4A 4R3LA 1Y9KA 4AVBA 1KUVA 2YNDA 2Z10A 4C2ZA 1IYKA 4XNHC 1YGHA 4NSQA 1IB1E 5H84A 3OWCA 4MI4A 3DR8A 2VQYA 4JD6A 3P2HA 4CRYB 4MJ8A 4CYPA 3R96A 2R8VA 1Q2CA 2JDDA 4MHDA 1NE9A 2B3UA 1YVOA 4HNWB 1IIDA 4ZGYB 2FSRA 4Q36A 1S60A 3EC4A 3N7ZA 5IB0A 4B13A 4M3SA 4CAEA 4CGNA 4C2YA 2QIRA 2PQ8A 3ZZIA 3CXQA 2FS5A 1IYLA 5A27A 4UBRA 4H89A 2AE6A 3S6HA 4FD4A 1CJWA 2CY2A 4II9A 5G21A 3JTKA 2Q44A 1QSNA 2PRBA 4MY0A 2EVNA 4IF5A 4LX9A 3R1KA 4FD6A 1ZO0A 1RXTA 4KVXA 4KUBA 1CM0A 2G3AA 3EO4A 3TCVA 4HNYB 2J8MA 4XNHB 4MBUA 3GY9A 1GHEA 1QSOA 4KUAA 4YRHA 3FNCA 2O28A 2YGWA 4AG7A 4UCMA 3MGDA 3W6XA 4R3KA 4UFXA 3W91A 3GYAA 4CAVA 4B5OA 5H86A 4MFPA 4XPLA 2KCWA 4YFJA 3BLNA 3C26A 4R9MA 4XPDC 2FT0A 1S3ZA 2HQYA 1LRZA 3G3SA 4KOVA 3TO6A 1FY7A 1QSMA 5A28A 1XE4A 2ARHA 4L89A 2H5MA 2Z3LA 2YNEA 5AGEA 4NF1A 3IU2A 4HNXB 4L8AA 1Q2DA 4PV6A 1MK4A 3SHPA 4KVME 3D2PA 3SXOA 3IWGA 2G0BA 4C68A 1ON0A 1WK4A 4KSFA 5KTDA 5EC4A 3EY5A 4NCZA 1Q2YA 2QMLA 3EXNA 5F49A 3IGRA 1I1DA 5AG5A 4OADA 3GKRA 4QB9A 1M4IA 1S7FA 2JEVA 3I9SA 3S6FA 3S6KA 2IL4A 4PSXA 4EVYA 1XEBA 1Y9WA 4ZBGA 2P6FA 2Z0ZA 2OH1A 4JWPA 4KOSA 3BJ8A 4E2AA 3FYNA 2D4PA 1Z4RA 2OZUA 2ZXVA 5BWAB 4X5KA 5HMNA 2I79A 1YREA 2FIWA 2RC4A 2VZYA 1YVKA 2I00A 1M44A 4KORA 4CAWA 1MJ9A 3QAHA 1BO4A 4CGMA 4KOUA 2C27A 4KLWA 4U9YA 4OAEA 2B58A 2Q0YA 3K9UA 3EFAA 2FL4A 5G20A 4QC6A 3T9YA 1SQHA 2ZW7A 4JJXA 3DR6A 4U9ZA 2GANA 3BJ7A 3JVNA 4R87A 2BSWA 2WUUA 1N71A 2FIAA 1NMTA 3I3GA 3R9GA 2BEIA 2CNSA 4JXRA 4NEXA 1QSRA 4KS9A 2DPTA 2YNCC 4Q38A 2Q04A 4B10A 4A33A 4KZTA 3D8PA 5I0CA 4CAFA 4PK3A 4PSWA 3SXNA 4BMHA 4CGOA 2PR1A 4A30A 5C82A 4QBJA 4KOWA 4HKFA 4RS2A 2VXKA 2Z3PA 3R9EA 4DNCA 3JUWA 2REEA 2CXAA 4CYOA 2PDOA 2BUEA 4UWIA 2GIVA 4KOTA 2ZW4A 3TFYA 1Y7RA 4CGPA 2Q4YA 4E0AA 3FXTA 4MY3A 1PUAA 3VWDA 1KUYA 1YX0A 1Z4EA 2Z3KA 4MFKA 4ONUA 3PP9A 1IICA 4MFLA 2F5IA 1MJBA 2PR8A 2VEZA 5EBVA 3PGPA 2P6GA 2B5GB 4CRZB 4QVTA 4F6AA 1I12A 2OZGA 2J8RA 5JPHA 4NXYA 2Y0MA 4KVOE 4JXQA 2P6EA 3TT2A 2R1IA 5IX3A 2PSWA 2B3VA 2DXQA 3FIXA 1I21A 5ISVA 1B87A 4KLVA 2X7BA 1K4JA 3FB3A 4UCNA 1S5KA 4YGOA 2OB0A 4CGLA 3TOAA 4H6UA 3LD2A 4A31A 2GE3A 4IUSA 1KUXA 1XF8A 4CAXA 2WSAA 5HH1A 1PU9A 4OLLA 3A9LA 2VZZA 2FXFA 1M4GA 1P0HA 3TOBA 1S7KA 4A2ZA 2CNTA 4BBHA 1XIXA 2G3TA 5DWNA 3V8IA 4XPDB 5IV0A 4ORFA 3E0KA 3B8GA 1QSTA 2FCKA 4R57A 2WPWA 1S7NA 5CNPA 1B6BA 4A32A 3PZJA 4H6ZA 4RI1A 2D4OA 5GCNA 4C2XA 4MFQA 4C7HA 5E96A 2HUZA 3D3SA 3ZJ0A 1M4DA 1TIQA 2B5GA 4B5PB 3H5ZA 2YNCA 3F5BA 2PC1A 2BL1A 3TE4A 2OZHA 2CNMA 3H4QA 4JLYA 5KTCA 4FD7A 2P0WA 3FBUA 2EUIA 1OZPA 1J4JA 4AG9A 5J8CA 3DNSA 4J3GA 4B11A 3VWEA 5AG7A 2HV2A 2ATRA 2K5TA 5DWMA 1R57A 3CXPA 4LUAA 4E8OA 4MFZA 1WWZA 3D2MA 3DSBA 3S6GA 2REFA 2Z3NA 3LODA 2DPSA 2AJ6A 5AG4A 5J8FA 2OU2A 1MJAA 1Z9UA 5FVJA 4AB7A 3IWEA 5G1ZA 5AG6A 3F8KA 2B4DA 2Z3OA 2Z11A 3TTHA 3FRMA 1YK3A 5G22A 4FD5A 2JLMA 1UFHA 4UFWA 4XPKA 3WR7A 1RO5A 1VHSA 4UFVA 4B12A 2VBQA 4Y49C 2B4BA 2R7HA 4B5PA 3TO7A 5F47A 4PK2A 5C88A 4KOXA 2Q7BA 3UY5A 4K30A 4CS0B 4B14A 4CYNA 2ZW6A 2VI7A 4AVAA 4I49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPX A;  3DDD A;  2Q4V A;  3KKW A;  3CXS A;  3P2F A;  4M85 A;  1M1D A;  4KOY A;  3TO9 A;  2QEC A;  4QUS A;  3R95 A;  2J8N A;  2JDC A;  5JQ4 A;  1KZF A;  3F0A A;  1BOB A;  4U5Y A;  1VKC A;  3G8W A;  1U6M A;  1V0C A;  2NMT A;  2ZPA A;  3R9F A;  3NE7 A;  2A4N A;  1S7L A;  1YR0 A;  1XMT A;  3T90 A;  4AVC A;  5F48 A;  2ZW5 A;  1L0C A;  2R98 A;  2FE7 A;  1NSL A;  4UWJ A;  5F46 A;  3RYO A;  5KTA A;  3W6S A;  4Y49 B;  1YLE A;  3QB8 A;  2B4D B;  4F0Y A;  1P4N A;  4UA3 A;  4GS4 A;  4R3L A;  1Y9K A;  4AVB A;  1KUV A;  2Z10 A;  1IYK A;  4XNH C;  1YGH A;  4NSQ A;  1IB1 E;  5H84 A;  3OWC A;  4MI4 A;  3DR8 A;  2VQY A;  4JD6 A;  3P2H A;  4CRY B;  4MJ8 A;  3R96 A;  2R8V A;  1Q2C A;  2JDD A;  4MHD A;  1NE9 A;  2B3U A;  1YVO A;  4HNW B;  1IID A;  2FSR A;  1S60 A;  3EC4 A;  3N7Z A;  5IB0 A;  4M3S A;  2QIR A;  2PQ8 A;  3ZZI A;  3CXQ A;  2FS5 A;  1IYL A;  4UBR A;  4H89 A;  2AE6 A;  3S6H A;  4FD4 A;  1CJW A;  2CY2 A;  4II9 A;  2Q44 A;  1QSN A;  2PRB A;  4MY0 A;  2EVN A;  4IF5 A;  4LX9 A;  3R1K A;  4FD6 A;  1RXT A;  4KVX A;  4KUB A;  1CM0 A;  2G3A A;  3EO4 A;  3TCV A;  4HNY B;  2J8M A;  4XNH B;  4MBU A;  3GY9 A;  1GHE A;  1QSO A;  4KUA A;  4YRH A;  3FNC A;  2O28 A;  4AG7 A;  3MGD A;  3W6X A;  4R3K A;  3W91 A;  3GYA A;  4CAV A;  4B5O A;  5H86 A;  4XPL A;  2KCW A;  4YFJ A;  3BLN A;  3C26 A;  4R9M A;  4XPD C;  2FT0 A;  1S3Z A;  2HQY A;  1LRZ A;  3G3S A;  4KOV A;  3TO6 A;  1FY7 A;  1QSM A;  1XE4 A;  2ARH A;  4L89 A;  2H5M A;  4NF1 A;  4HNX B;  4L8A A;  1Q2D A;  4PV6 A;  1MK4 A;  3SHP A;  4KVM E;  3D2P A;  3SXO A;  3IWG A;  2G0B A;  1ON0 A;  1WK4 A;  5KTD A;  5EC4 A;  3EY5 A;  4NCZ A;  1Q2Y A;  2QML A;  3EXN A;  5F49 A;  3IGR A;  1I1D A;  4OAD A;  3GKR A;  4QB9 A;  1M4I A;  1S7F A;  2JEV A;  3I9S A;  3S6F A;  3S6K A;  2IL4 A;  4PSX A;  4EVY A;  1XEB A;  1Y9W A;  4ZBG A;  2P6F A;  2Z0Z A;  2OH1 A;  4JWP A;  4KOS A;  3BJ8 A;  4E2A A;  3FYN A;  2D4P A;  1Z4R A;  2OZU A;  2ZXV A;  4X5K A;  5HMN A;  2I79 A;  1YRE A;  2FIW A;  2RC4 A;  2VZY A;  1YVK A;  2I00 A;  1M44 A;  4KOR A;  4CAW A;  1MJ9 A;  3QAH A;  1BO4 A;  4KOU A;  2C27 A;  4KLW A;  4U9Y A;  4OAE A;  2B58 A;  2Q0Y A;  3K9U A;  3EFA A;  2FL4 A;  4QC6 A;  3T9Y A;  1SQH A;  2ZW7 A;  4JJX A;  3DR6 A;  4U9Z A;  2GAN A;  3BJ7 A;  3JVN A;  4R87 A;  2BSW A;  1N71 A;  2FIA A;  1NMT A;  3I3G A;  3R9G A;  2BEI A;  2CNS A;  4JXR A;  4NEX A;  1QSR A;  2Q04 A;  4KZT A;  3D8P A;  5I0C A;  4PK3 A;  4PSW A;  3SXN A;  4BMH A;  2PR1 A;  5C82 A;  4QBJ A;  4KOW A;  4HKF A;  4RS2 A;  2VXK A;  3R9E A;  4DNC A;  3JUW A;  2REE A;  2PDO A;  2BUE A;  4UWI A;  2GIV A;  4KOT A;  2ZW4 A;  3TFY A;  1Y7R A;  2Q4Y A;  4E0A A;  3FXT A;  4MY3 A;  1PUA A;  3VWD A;  1KUY A;  1YX0 A;  1Z4E A;  4ONU A;  3PP9 A;  1IIC A;  2F5I A;  1MJB A;  2PR8 A;  2VEZ A;  5EBV A;  3PGP A;  2P6G A;  2B5G B;  4CRZ B;  4QVT A;  4F6A A;  1I12 A;  2OZG A;  2J8R A;  5JPH A;  4NXY A;  2Y0M A;  4KVO E;  4JXQ A;  2P6E A;  3TT2 A;  2R1I A;  5IX3 A;  2PSW A;  2B3V A;  2DXQ A;  3FIX A;  1I21 A;  5ISV A;  1B87 A;  4KLV A;  2X7B A;  1K4J A;  3FB3 A;  4YGO A;  1S5K A;  2OB0 A;  3TOA A;  4H6U A;  3LD2 A;  2GE3 A;  4IUS A;  1KUX A;  1XF8 A;  4CAX A;  5HH1 A;  1PU9 A;  4OLL A;  2VZZ A;  2FXF A;  1M4G A;  1P0H A;  3TOB A;  1S7K A;  2CNT A;  1XIX A;  2G3T A;  5DWN A;  3V8I A;  4XPD B;  5IV0 A;  4ORF A;  3E0K A;  3B8G A;  1QST A;  2FCK A;  4R57 A;  2WPW A;  1S7N A;  5CNP A;  1B6B A;  3PZJ A;  4H6Z A;  4RI1 A;  2D4O A;  5GCN A;  5E96 A;  2HUZ A;  3D3S A;  3ZJ0 A;  1M4D A;  1TIQ A;  2B5G A;  4B5P B;  3F5B A;  2PC1 A;  2BL1 A;  3TE4 A;  2OZH A;  2CNM A;  3H4Q A;  4JLY A;  5KTC A;  4FD7 A;  2P0W A;  3FBU A;  2EUI A;  1OZP A;  1J4J A;  4AG9 A;  5J8C A;  3DNS A;  4J3G A;  3VWE A;  2HV2 A;  2ATR A;  2K5T A;  5DWM A;  1R57 A;  3CXP A;  4LUA A;  4E8O A;  1WWZ A;  3D2M A;  3DSB A;  3S6G A;  2REF A;  3LOD A;  2AJ6 A;  5J8F A;  2OU2 A;  1MJA A;  1Z9U A;  5FVJ A;  4AB7 A;  2B4D A;  3F8K A;  2Z11 A;  3TTH A;  3FRM A;  1YK3 A;  4FD5 A;  2JLM A;  1UFH A;  4XPK A;  3WR7 A;  1RO5 A;  1VHS A;  2VBQ A;  4Y49 C;  2B4B A;  2R7H A;  4B5P A;  3TO7 A;  5F47 A;  4PK2 A;  5C88 A;  4KOX A;  2Q7B A;  3UY5 A;  4K30 A;  4CS0 B;  2ZW6 A;  2VI7 A;  4AVA A;  4I49 A; 
#chains in the Genus database with same CATH topology
 2WPX A;  2EO8 A;  3DDD A;  4UEZ A;  2BCO A;  2Q4V A;  3KKW A;  3CXS A;  3P2F A;  1ZLH A;  3IU1 A;  4M85 A;  5LRG A;  4P4J A;  1M1D A;  1CP7 A;  1VIX A;  4PXC A;  3JRU A;  4DUK A;  4KOY A;  3SI1 A;  4UCP A;  3TO9 A;  3PFO A;  1PCA A;  2QEC A;  4QUS A;  3CPA A;  3R95 A;  1LFW A;  2J8N A;  2JDC A;  4B6Z A;  3BHX A;  2ANP A;  5JQ4 A;  4P10 A;  1KZF A;  4F0X A;  3F0A A;  1BOB A;  2PJ6 A;  3KHX A;  2EK8 A;  2O4H A;  4U5Y A;  1VKC A;  1YW4 A;  2ODF A;  3G8W A;  1A2Z A;  1U6M A;  1V0C A;  2NMT A;  2ZPA A;  3R9F A;  4KSA A;  1F2P A;  3NE7 A;  2A4N A;  4NJQ A;  5LYF A;  1S7L A;  1YR0 A;  3D7F A;  1XMT A;  3T90 A;  2OOT A;  5F48 A;  4AVC A;  2ZW5 A;  1L0C A;  2R98 A;  2FE7 A;  1NSL A;  4UWJ A;  3B3W A;  1VHO A;  1YQE A;  3D7G A;  5F46 A;  3RYO A;  2IJZ A;  4FBE A;  5KTA A;  1IU8 A;  4OC2 A;  3W6S A;  4A39 A;  4Y49 B;  4BD9 A;  4CPA A;  4IAV A;  1LAM A;  2PJ0 A;  3I1U A;  1YLE A;  2Z3M A;  3FH4 A;  3QB8 A;  2B4D B;  4A95 A;  4AVA A;  4CYQ A;  2V8V A;  4MFJ A;  2PJ1 A;  4OC3 A;  1YW6 A;  4F0Y A;  1LAN A;  1X10 A;  1P4N A;  3D4U A;  1FNO A;  2ZEG A;  3NH4 A;  5JH9 A;  4C7I A;  2AFX A;  2ZEP A;  4UA3 A;  4GS4 A;  4R3L A;  1Y9K A;  2Q43 A;  4MCS A;  2NSM A;  5THW A;  4AVB A;  1KUV A;  2YND A;  2Z10 A;  4C2Z A;  3IWW A;  1IYK A;  4MXU A;  4P4F A;  4XNH C;  3D7H A;  3SJF A;  1YGH A;  3RO0 A;  4NSQ A;  1IB1 E;  2PJA A;  1XBU A;  3FMC A;  5H84 A;  2PVV A;  1XJO A;  3OWC A;  1R43 A;  2PJC A;  4OID A;  4MI4 A;  3DR8 A;  5K8M A;  3IFE A;  2VQY A;  2F7V A;  4JD6 A;  2I3C A;  3NFZ A;  3P2H A;  5K8O A;  3DLJ A;  4UIA A;  4MHP A;  6CPA A;  1Z8W A;  4MJ8 A;  4YWY A;  4CRY B;  5IB9 A;  4CYP A;  3R96 A;  2R8V A;  1Q2C A;  2JDD A;  3KR4 A;  2EBJ A;  3MRU A;  4MHD A;  5HVG A;  1DTD A;  1NE9 A;  2B3U A;  1YVO A;  2WZN A;  2O53 A;  4HNW B;  1IID A;  4ZGY B;  2ZOG A;  2FSR A;  4Q36 A;  1S60 A;  3EC4 A;  4M6G A;  3H8G A;  1R3N A;  3KL9 A;  3D67 A;  3LMS A;  1X12 A;  3N7Z A;  3RBU A;  4B13 A;  5IB0 A;  5LRJ A;  4FAI A;  4M3S A;  4CAE A;  4W9Y A;  4CGN A;  3FEE A;  2BO9 A;  4C2Y A;  4O23 A;  4RN7 A;  2QIR A;  2PQ8 A;  4TWE A;  3ZZI A;  3CXQ A;  1KWM A;  2FS5 A;  1IYL A;  5A27 A;  4NGR A;  2JBJ A;  4H89 A;  4UBR A;  2AE6 A;  3S6H A;  4FD4 A;  1CJW A;  2CY2 A;  4II9 A;  5G21 A;  1HEE A;  3JTK A;  3B3V A;  4NGT A;  2Q44 A;  2GLF A;  4G1P A;  3SI2 A;  1QSN A;  2PJ3 A;  2PRB A;  4OC1 A;  5LYL A;  4MY0 A;  2EVN A;  3KQZ A;  4JZ0 A;  2C6C A;  2ZEH A;  4IF5 A;  3R1K A;  4LX9 A;  4FD6 A;  1ZO0 A;  1RXT A;  4P4B A;  4KVX A;  3KQX A;  3QAY A;  4KUB A;  1BLL E;  1CM0 A;  2G3A A;  3EO4 A;  3TCV A;  4HNY B;  2J8M A;  4XNH B;  4A38 A;  4MBU A;  3S9L A;  3HUV A;  3GY9 A;  1GHE A;  4DJL A;  1QSO A;  2G9D A;  4KUA A;  4AXV A;  4YRH A;  3FNC A;  1QQ9 A;  2FVG A;  2O28 A;  2YGW A;  3GIU A;  4AG7 A;  5K8P A;  4UCM A;  3KR5 A;  3PB4 X;  3MGD A;  4BIN A;  3W6X A;  4LQ6 A;  1ZLI A;  4R3K A;  4UFX A;  1HDU A;  3W91 A;  3GYA A;  4CAV A;  3QNV A;  5HVH A;  1ZG8 A;  4MMO A;  4B5O A;  2ZEO A;  2AFM A;  5J1Q A;  3KI9 A;  1NSA A;  2Q7S A;  1XFO A;  1XRY A;  4NGN A;  4MFP A;  5H86 A;  2JEW A;  3BXM A;  4XPL A;  2KCW A;  2ZEM A;  4NFR A;  4YFJ A;  1F57 A;  3BLN A;  3C26 A;  4R9M A;  1AUG A;  4XPD C;  2FT0 A;  1S3Z A;  2PJ9 A;  4KSI A;  3N5F A;  2HQY A;  2ZEF A;  1LRZ A;  3G3S A;  4KOV A;  3TO6 A;  1ELM P;  1FY7 A;  1QSM A;  5I4M A;  5A28 A;  1XE4 A;  2HB6 A;  2IMO A;  2ARH A;  4IHM A;  4X8I A;  4L89 A;  2QYV A;  1Y0Y A;  5ELY A;  2H5M A;  4X2T A;  1Q7L A;  2Z3L A;  5JGF A;  2PRQ A;  1YME A;  3TC8 A;  2XEF A;  2YNE A;  5AGE A;  4NF1 A;  4ZX9 A;  4ZY2 A;  3IU2 A;  2EK9 A;  4HNX B;  1BPN A;  2C1C A;  1Q2D A;  4L8A A;  4PXD A;  4MHY A;  4PV6 A;  1MK4 A;  3SHP A;  5HXD A;  1JWQ A;  4KVM E;  2WYR A;  3PB6 X;  4MHN A;  3D2P A;  3SXO A;  3IWG A;  2G0B A;  3CZX A;  4C68 A;  1ON0 A;  4IK2 A;  1WK4 A;  2F8H A;  4KSF A;  2GU2 A;  3PEI A;  3IJ3 A;  5EC4 A;  3EY5 A;  1TKH A;  1AYE A;  5KTD A;  1Y7E A;  4NCZ A;  1Q2Y A;  2ZEN A;  1TKJ A;  2QML A;  3EXN A;  5F49 A;  3SI0 A;  1IY7 A;  3IGR A;  4A94 A;  1I1D A;  1VGY A;  5AG5 A;  3B3C A;  4OAD A;  3GKR A;  4QB9 A;  1M4I A;  3PBE A;  1S7F A;  2JEV A;  2PJ8 A;  2GRE A;  2DF5 A;  5EMI A;  3I9S A;  1PYT B;  3S6F A;  3S6K A;  2IL4 A;  4PSX A;  4EVY A;  1XEB A;  1Y9W A;  3IIB A;  4ZBG A;  2P6F A;  2Z0Z A;  1Z8L A;  2OH1 A;  4JWP A;  4KOS A;  3PB7 X;  2XEJ A;  3BJ8 A;  4A37 A;  4EWT A;  4E2A A;  3FYN A;  2D4P A;  1Z4R A;  2OZU A;  2ZXV A;  4UEE A;  4X5K A;  5BWA B;  4OC5 A;  4OME A;  3FED A;  5HMN A;  2I79 A;  1YRE A;  2FIW A;  4FWU A;  2AFU A;  4P44 A;  2RC4 A;  3K2K A;  2VZY A;  1YVK A;  4R8F A;  1H8L A;  1M44 A;  2I00 A;  3KZW A;  4KOR A;  2GLJ A;  4CAW A;  1MJ9 A;  3QAH A;  3K9T A;  1BO4 A;  4CGM A;  4HPS A;  4KOU A;  2C27 A;  2VL1 A;  3PB8 X;  1CX8 A;  4KLW A;  4OAE A;  2B58 A;  4U9Y A;  1TXR A;  2Q0Y A;  4NGQ A;  3CPX A;  3EFA A;  3K9U A;  1YLO A;  2FL4 A;  3B3S A;  4ZI6 A;  5G20 A;  4QC6 A;  3T9Y A;  1BAV A;  3TX8 A;  2EWB A;  1SQH A;  3B7I A;  5LYD A;  1Y0R A;  5DS0 A;  1TF8 A;  4OKO A;  2ZW7 A;  1CPS A;  4F9V A;  3GUX A;  3DR6 A;  2GFQ A;  2GAN A;  4JJX A;  4U9Z A;  3BJ7 A;  4GM5 A;  3JVN A;  4R87 A;  2BSW A;  2WUU A;  1ZG9 A;  2PVW A;  3H8F A;  2NYQ A;  4LQG A;  4PXB A;  1N71 A;  1ARM A;  1FT7 A;  2FIA A;  1XOV A;  5D29 A;  3IEH A;  1NMT A;  3CDX A;  2HC9 A;  5CBM A;  3I3G A;  3R9G A;  2BEI A;  2CNS A;  2CF4 A;  4JXR A;  4NEX A;  3FJU A;  2PIY A;  1QSR A;  3NH8 A;  4KS9 A;  2DPT A;  4UIB A;  1OBR A;  2YNC C;  4PQA A;  4Q38 A;  4Z65 A;  4TNU A;  2Q04 A;  4MCP A;  4B10 A;  1HDQ A;  4A33 A;  3WC6 A;  4KZT A;  3S9M A;  4DYO A;  3D8P A;  3WT4 A;  5I0C A;  4CAF A;  4PK3 A;  1JQG A;  4PSW A;  4P4D A;  3SXN A;  4BMH A;  4NGS A;  4CGO A;  1M4L A;  2Q4Z A;  2PR1 A;  5JM6 A;  3BI1 A;  4A30 A;  3T8W A;  5C82 A;  3GB0 A;  4QBJ A;  1ARL A;  2ZED A;  3SJG A;  4KOW A;  1IOI A;  2ZEL A;  3LAC A;  3HLP A;  4HKF A;  1ZG7 A;  4RS2 A;  3RZA A;  1BPM A;  2VXK A;  3S9N A;  2V8G A;  2Z3P A;  3ISZ A;  3R9E A;  4PPZ A;  4MRI A;  4DNC A;  3B3T A;  3D66 A;  3IO1 A;  3JUW A;  2REE A;  8CPA A;  2CXA A;  1Z2L A;  4CYO A;  4R76 A;  2PDO A;  1VHE A;  2BUE A;  3DGV A;  3ISX A;  4UWI A;  1IOF A;  3FVL A;  2GIV A;  4KOT A;  4ZY1 A;  1CG2 A;  2ZW4 A;  5LYI A;  3TFY A;  2V77 A;  3LWU A;  1Y7R A;  4CGP A;  2Q4Y A;  4EME A;  4E0A A;  1Z8X A;  3FXT A;  4M6H A;  4PXE A;  4ONW A;  4F9U A;  4MY3 A;  1PUA A;  3VWD A;  4GXH A;  1KUY A;  1YX0 A;  1Z4E A;  3WC5 A;  4NGP A;  2Z3K A;  4MFK A;  4ONU A;  3PP9 A;  1TKF A;  1GYT A;  1IIC A;  4MFL A;  4EFD A;  2F5I A;  1MJB A;  2PR8 A;  2VEZ A;  5EBV A;  3PGP A;  2P6G A;  1LCP A;  2B5G B;  4CRZ B;  4QVT A;  4F6A A;  1I12 A;  2OZG A;  2J8R A;  5JPH A;  4NXY A;  2RB7 A;  1RTQ A;  2Y0M A;  2AFO A;  4KVO E;  4JXQ A;  3V38 A;  2P6E A;  3TT2 A;  2R1I A;  5IX3 A;  2CTC A;  2PSW A;  2B3V A;  2DXQ A;  3FIX A;  1I21 A;  4ZYQ A;  3WC7 A;  4ZY0 A;  5ISV A;  1B87 A;  3D7D A;  3KHZ A;  4KLV A;  2X7B A;  4NJR A;  1K4J A;  3FB3 A;  4UCN A;  1S5K A;  4YGO A;  2OB0 A;  3VAT A;  2PJ7 A;  4CGL A;  2ABZ A;  3TOA A;  4H6U A;  2QVP A;  3LD2 A;  4P45 A;  4A31 A;  3H8E A;  1ELL P;  2IQ6 A;  2GE3 A;  4IUS A;  2RFH A;  1EE3 P;  1KUX A;  4NGM A;  1CBX A;  1XF8 A;  4CAX A;  2WSA A;  5HH1 A;  1PU9 A;  4OLL A;  2ZOF A;  3A9L A;  2FXF A;  2VZZ A;  1M4G A;  1P0H A;  3RNZ A;  1S7K A;  3TOB A;  4A2Z A;  2CNT A;  2CIJ A;  4BBH A;  3BI0 A;  4R7M A;  1XIX A;  2G3T A;  1Z8T A;  5DWN A;  2PJ2 A;  2DEA A;  4XPD B;  3V8I A;  5IV0 A;  3VAR A;  5HVF A;  4ORF A;  3E0K A;  2C6P A;  3B8G A;  1QST A;  4F8Z A;  3RAM A;  2FCK A;  4R57 A;  2WPW A;  3NA6 A;  1S7N A;  1DE4 C;  4WWV A;  5CNP A;  1B6B A;  1UWY A;  4A32 A;  5LRK A;  2PJB A;  4P4E A;  3PZJ A;  1LOK A;  3FEC A;  4H6Z A;  4RUH A;  2PJ5 A;  4RI1 A;  2D4O A;  4MCQ A;  5GCN A;  4C2X A;  4MFQ A;  4OIW A;  4C7H A;  4OC0 A;  3SJE A;  2PCU A;  1Z5R A;  5E96 A;  2HUZ A;  3KGQ A;  3D3S A;  3PB9 X;  3ZJ0 A;  1M4D A;  1TIQ A;  4K3N A;  4OC4 A;  2B5G A;  3SJX A;  1YSJ A;  4B5P B;  4H2K A;  3H5Z A;  2BOA A;  2YNC A;  3F5B A;  2PC1 A;  2BL1 A;  3CT9 A;  2ZEE A;  3TE4 A;  3MN8 A;  5D8N A;  2OZH A;  2CNM A;  3H4Q A;  4JLY A;  1LAP A;  5KTC A;  2PJ4 A;  3B2Y A;  2PE3 A;  4X3R A;  2V8D A;  2P0W A;  4FD7 A;  3FBU A;  2EUI A;  1OZP A;  1J4J A;  4AG9 A;  5J8C A;  3DNS A;  3PRT A;  4J3G A;  4MHZ A;  4B11 A;  3VWE A;  5CPA A;  5AG7 A;  2J9A A;  2CTB A;  2HV2 A;  4YU9 A;  1XMB A;  2ATR A;  2K5T A;  5DWM A;  1QMU A;  1R57 A;  3CXP A;  3FX6 A;  4LUA A;  4UEF A;  4E8O A;  2OR4 A;  4MFZ A;  1WWZ A;  3V7Z A;  2C6G A;  2XEG A;  3D2M A;  3DSB A;  3S6G A;  1TF9 A;  1CP6 A;  1IGB A;  4Q7A A;  2PIZ A;  2POK A;  1CPX A;  3FF3 A;  3NH5 A;  4P4I A;  2REF A;  5K8N A;  3IC1 A;  2Z3N A;  3LOD A;  2DPS A;  2AJ6 A;  5AG4 A;  7CPA A;  3PBB A;  5J8F A;  2OU2 A;  4OP4 A;  3D68 A;  1MJA A;  1Z9U A;  5FVJ A;  4AB7 A;  3IWE A;  3GLJ A;  5G1Z A;  5AG6 A;  3B35 A;  2B4D A;  3F8K A;  4ZX8 A;  2XEI A;  2Z11 A;  2Z3O A;  3FRM A;  3TTH A;  1YK3 A;  3NE8 A;  5G22 A;  4FUU A;  4P6Y A;  2QJ8 A;  4R6T A;  4FD5 A;  2JLM A;  1UFH A;  5F09 A;  3KAS A;  4UFW A;  1F2O A;  4WJB A;  4XPK A;  3WR7 A;  3WAB A;  1RO5 A;  1VHS A;  4UFV A;  2AFW A;  4B12 A;  2VBQ A;  4Y49 C;  2B4B A;  4JYW A;  2R7H A;  4B5P A;  2JBK A;  3TO7 A;  2Q51 A;  5F47 A;  4PK2 A;  5C88 A;  4M6I A;  4KOX A;  3PFE A;  2Q7B A;  2V8H A;  3VH9 A;  3UY5 A;  4MCR A;  4K30 A;  4UF4 A;  4CS0 B;  4B14 A;  4CYN A;  2AFZ A;  2AFS A;  2VI7 A;  2ZW6 A;  3L2N A;  1AMP A;  4I49 A; 
#chains in the Genus database with same CATH homology
 2WPX A;  3DDD A;  2Q4V A;  3KKW A;  3CXS A;  3P2F A;  3IU1 A;  4M85 A;  1M1D A;  4KOY A;  4UCP A;  3TO9 A;  2QEC A;  4QUS A;  3R95 A;  2J8N A;  2JDC A;  5JQ4 A;  1KZF A;  4F0X A;  3F0A A;  1BOB A;  4U5Y A;  1VKC A;  3G8W A;  1U6M A;  1V0C A;  2NMT A;  2ZPA A;  3R9F A;  4KSA A;  3NE7 A;  2A4N A;  1S7L A;  1YR0 A;  1XMT A;  3T90 A;  4AVC A;  5F48 A;  2ZW5 A;  1L0C A;  2R98 A;  2FE7 A;  1NSL A;  4UWJ A;  5F46 A;  3RYO A;  5KTA A;  3W6S A;  4Y49 B;  1YLE A;  2Z3M A;  3QB8 A;  2B4D B;  4A95 A;  4CYQ A;  4F0Y A;  4MFJ A;  1P4N A;  4C7I A;  4UA3 A;  4GS4 A;  4R3L A;  1Y9K A;  4AVB A;  1KUV A;  2YND A;  2Z10 A;  4C2Z A;  1IYK A;  4XNH C;  1YGH A;  4NSQ A;  1IB1 E;  5H84 A;  3OWC A;  4MI4 A;  3DR8 A;  2VQY A;  4JD6 A;  3P2H A;  4CRY B;  4MJ8 A;  4CYP A;  3R96 A;  2R8V A;  1Q2C A;  2JDD A;  4MHD A;  1NE9 A;  2B3U A;  1YVO A;  4HNW B;  1IID A;  4ZGY B;  2FSR A;  4Q36 A;  1S60 A;  3EC4 A;  3N7Z A;  5IB0 A;  4B13 A;  4M3S A;  4CAE A;  4CGN A;  4C2Y A;  2QIR A;  2PQ8 A;  3ZZI A;  3CXQ A;  2FS5 A;  1IYL A;  5A27 A;  4UBR A;  4H89 A;  2AE6 A;  3S6H A;  4FD4 A;  1CJW A;  2CY2 A;  4II9 A;  5G21 A;  3JTK A;  2Q44 A;  1QSN A;  2PRB A;  4MY0 A;  2EVN A;  4IF5 A;  4LX9 A;  3R1K A;  4FD6 A;  1ZO0 A;  1RXT A;  4KVX A;  4KUB A;  1CM0 A;  2G3A A;  3EO4 A;  3TCV A;  4HNY B;  2J8M A;  4XNH B;  4MBU A;  3GY9 A;  1GHE A;  1QSO A;  4KUA A;  4YRH A;  3FNC A;  2O28 A;  2YGW A;  4AG7 A;  4UCM A;  3MGD A;  3W6X A;  4R3K A;  4UFX A;  3W91 A;  3GYA A;  4CAV A;  4B5O A;  5H86 A;  4MFP A;  4XPL A;  2KCW A;  4YFJ A;  3BLN A;  3C26 A;  4R9M A;  4XPD C;  2FT0 A;  1S3Z A;  2HQY A;  1LRZ A;  3G3S A;  4KOV A;  3TO6 A;  1FY7 A;  1QSM A;  5A28 A;  1XE4 A;  2ARH A;  4L89 A;  2H5M A;  2Z3L A;  2YNE A;  5AGE A;  4NF1 A;  3IU2 A;  4HNX B;  4L8A A;  1Q2D A;  4PV6 A;  1MK4 A;  3SHP A;  4KVM E;  3D2P A;  3SXO A;  3IWG A;  2G0B A;  4C68 A;  1ON0 A;  1WK4 A;  4KSF A;  5KTD A;  5EC4 A;  3EY5 A;  4NCZ A;  1Q2Y A;  2QML A;  3EXN A;  5F49 A;  3IGR A;  1I1D A;  5AG5 A;  4OAD A;  3GKR A;  4QB9 A;  1M4I A;  1S7F A;  2JEV A;  3I9S A;  3S6F A;  3S6K A;  2IL4 A;  4PSX A;  4EVY A;  1XEB A;  1Y9W A;  4ZBG A;  2P6F A;  2Z0Z A;  2OH1 A;  4JWP A;  4KOS A;  3BJ8 A;  4E2A A;  3FYN A;  2D4P A;  1Z4R A;  2OZU A;  2ZXV A;  5BWA B;  4X5K A;  5HMN A;  2I79 A;  1YRE A;  2FIW A;  2RC4 A;  2VZY A;  1YVK A;  2I00 A;  1M44 A;  4KOR A;  4CAW A;  1MJ9 A;  3QAH A;  1BO4 A;  4CGM A;  4KOU A;  2C27 A;  4KLW A;  4U9Y A;  4OAE A;  2B58 A;  2Q0Y A;  3K9U A;  3EFA A;  2FL4 A;  5G20 A;  4QC6 A;  3T9Y A;  1SQH A;  2ZW7 A;  4JJX A;  3DR6 A;  4U9Z A;  2GAN A;  3BJ7 A;  3JVN A;  4R87 A;  2BSW A;  2WUU A;  1N71 A;  2FIA A;  1NMT A;  3I3G A;  3R9G A;  2BEI A;  2CNS A;  4JXR A;  4NEX A;  1QSR A;  4KS9 A;  2DPT A;  2YNC C;  4Q38 A;  2Q04 A;  4B10 A;  4A33 A;  4KZT A;  3D8P A;  5I0C A;  4CAF A;  4PK3 A;  4PSW A;  3SXN A;  4BMH A;  4CGO A;  2PR1 A;  4A30 A;  5C82 A;  4QBJ A;  4KOW A;  4HKF A;  4RS2 A;  2VXK A;  2Z3P A;  3R9E A;  4DNC A;  3JUW A;  2REE A;  2CXA A;  4CYO A;  2PDO A;  2BUE A;  4UWI A;  2GIV A;  4KOT A;  2ZW4 A;  3TFY A;  1Y7R A;  4CGP A;  2Q4Y A;  4E0A A;  3FXT A;  4MY3 A;  1PUA A;  3VWD A;  1KUY A;  1YX0 A;  1Z4E A;  2Z3K A;  4MFK A;  4ONU A;  3PP9 A;  1IIC A;  4MFL A;  2F5I A;  1MJB A;  2PR8 A;  2VEZ A;  5EBV A;  3PGP A;  2P6G A;  2B5G B;  4CRZ B;  4QVT A;  4F6A A;  1I12 A;  2OZG A;  2J8R A;  5JPH A;  4NXY A;  2Y0M A;  4KVO E;  4JXQ A;  2P6E A;  3TT2 A;  2R1I A;  5IX3 A;  2PSW A;  2B3V A;  2DXQ A;  3FIX A;  1I21 A;  5ISV A;  1B87 A;  4KLV A;  2X7B A;  1K4J A;  3FB3 A;  4UCN A;  1S5K A;  4YGO A;  2OB0 A;  4CGL A;  3TOA A;  4H6U A;  3LD2 A;  4A31 A;  2GE3 A;  4IUS A;  1KUX A;  1XF8 A;  4CAX A;  2WSA A;  5HH1 A;  1PU9 A;  4OLL A;  3A9L A;  2VZZ A;  2FXF A;  1M4G A;  1P0H A;  3TOB A;  1S7K A;  4A2Z A;  2CNT A;  4BBH A;  1XIX A;  2G3T A;  5DWN A;  3V8I A;  4XPD B;  5IV0 A;  4ORF A;  3E0K A;  3B8G A;  1QST A;  2FCK A;  4R57 A;  2WPW A;  1S7N A;  5CNP A;  1B6B A;  4A32 A;  3PZJ A;  4H6Z A;  4RI1 A;  2D4O A;  5GCN A;  4C2X A;  4MFQ A;  4C7H A;  5E96 A;  2HUZ A;  3D3S A;  3ZJ0 A;  1M4D A;  1TIQ A;  2B5G A;  4B5P B;  3H5Z A;  2YNC A;  3F5B A;  2PC1 A;  2BL1 A;  3TE4 A;  2OZH A;  2CNM A;  3H4Q A;  4JLY A;  5KTC A;  4FD7 A;  2P0W A;  3FBU A;  2EUI A;  1OZP A;  1J4J A;  4AG9 A;  5J8C A;  3DNS A;  4J3G A;  4B11 A;  3VWE A;  5AG7 A;  2HV2 A;  2ATR A;  2K5T A;  5DWM A;  1R57 A;  3CXP A;  4LUA A;  4E8O A;  4MFZ A;  1WWZ A;  3D2M A;  3DSB A;  3S6G A;  2REF A;  2Z3N A;  3LOD A;  2DPS A;  2AJ6 A;  5AG4 A;  5J8F A;  2OU2 A;  1MJA A;  1Z9U A;  5FVJ A;  4AB7 A;  3IWE A;  5G1Z A;  5AG6 A;  3F8K A;  2B4D A;  2Z3O A;  2Z11 A;  3TTH A;  3FRM A;  1YK3 A;  5G22 A;  4FD5 A;  2JLM A;  1UFH A;  4UFW A;  4XPK A;  3WR7 A;  1RO5 A;  1VHS A;  4UFV A;  4B12 A;  2VBQ A;  4Y49 C;  2B4B A;  2R7H A;  4B5P A;  3TO7 A;  5F47 A;  4PK2 A;  5C88 A;  4KOX A;  2Q7B A;  3UY5 A;  4K30 A;  4CS0 B;  4B14 A;  4CYN A;  2ZW6 A;  2VI7 A;  4AVA A;  4I49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...