1S7NA

Ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
VEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords acetyl transferase
total genus 56
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7nA00
4U9YA 4KVME 2DXQA 3H4QA 4L89A 1YLEA 2OZGA 3BJ7A 5F48A 1P0HA 4KVXA 3I9SA 3EFAA 3UY5A 3W6XA 3EXNA 2BEIA 4YGOA 1QSNA 4PK3A 4L8AA 4RS2A 3TE4A 1Z4RA 3FRMA 1CM0A 2ZW4A 2P0WA 5HMNA 3I3GA 4FD7A 3K9UA 2CNSA 4XNHB 2VEZA 5DWMA 4FD5A 1PU9A 1J4JA 4JXQA 1IYKA 1I12A 1Y9KA 2BSWA 5C82A 1S5KA 1S7NA 4AG7A 3W6SA 3IGRA 1L0CA 2Q4YA 2Q0YA 2F5IA 2FXFA 2D4OA 4AVBA 4LX9A 2Q44A 3R96A 1R57A 2I00A 1OZPA 2AJ6A 4YFJA 5J8CA 1BO4A 1S7FA 4FD6A 1N71A 1I21A 1KUYA 1P4NA 2A4NA 3TOBA 3D2MA 4EVYA 2VQYA 5IB0A 1BOBA 2P6FA 4H89A 1S7LA 4XPDB 2GIVA 1QSRA 1IB1E 2IL4A 2R1IA 3D3SA 3EC4A 2HQYA 4HNWB 1GHEA 2B4DB 2FS5A 2J8MA 1FY7A 2FIAA 3JUWA 1MJAA 1XEBA 5I0CA 1QSMA 2AE6A 2B4DA 3FIXA 4PSWA 5JPHA 3SXNA 1PUAA 4MBUA 3RYOA 4KLWA 5E96A 2R7HA 2WPWA 4BMHA 1Z4EA 3F0AA 2HUZA 4MI4A 2RC4A 1M4IA 2QMLA 2GE3A 5KTAA 5H86A 4R87A 1QSOA 2B4BA 4JLYA 4CAXA 5J8FA 1UFHA 4KVOE 2BUEA 3FXTA 2J8RA 4PK2A 2FT0A 2PRBA 3BLNA 4AG9A 4MJ8A 5C88A 2OZHA 2PDOA 3QB8A 4M3SA 4CAWA 3G8WA 1LRZA 4NCZA 3FYNA 1S60A 1MJ9A 4XPDC 2KCWA 1KUXA 4ZBGA 4QC6A 4GS4A 4OLLA 4R57A 4QVTA 4F6AA 1M4DA 3GY9A 1S3ZA 1SQHA 1Q2DA 1TIQA 4XNHC 4AVAA 4DNCA 2PC1A 3CXQA 3WR7A 4UWIA 2B3VA 2B58A 4R3LA 1NMTA 4E0AA 2B5GB 4NEXA 1Z9UA 2Y0MA 4MHDA 4AB7A 3R1KA 3DSBA 3C26A 3DDDA 3R95A 2ATRA 5ISVA 3FNCA 4B5PA 2P6GA 2BL1A 3F8KA 3T9YA 2G3AA 2B5GA 3TO9A 4H6UA 2R8VA 4LUAA 4KOXA 2FL4A 5F49A 3R9EA 2JEVA 3TTHA 2JLMA 1M1DA 1I1DA 4HKFA 4JXRA 3QAHA 4KOWA 1WWZA 4Y49B 3TO7A 1RXTA 4OADA 3JVNA 2X7BA 1KUVA 3BJ8A 4KLVA 2I79A 1U6MA 1YREA 4JD6A 1S7KA 1IIDA 1NSLA 3PGPA 4AVCA 4QBJA 2ARHA 1YGHA 1XF8A 2J8NA 2OH1A 2PSWA 4CRZB 2JDDA 4KUBA 2PR8A 3N7ZA 1B87A 1M44A 4IUSA 4CRYB 2PR1A 3TO6A 4X5KA 4UA3A 3DR6A 4E2AA 3GKRA 4UWJA 2VZZA 4R3KA 4B5PB 1XIXA 4KZTA 1M4GA 4KOTA 2PQ8A 3NE7A 4KORA 3GYAA 5IX3A 4KOYA 3TFYA 5EC4A 2FE7A 1IICA 4HNXB 3TCVA 5CNPA 3ZZIA 1MJBA 3KKWA 4K30A 5HH1A 1MK4A 2C27A 4XPKA 3MGDA 4M85A 1Q2CA 4II9A 5KTCA 3SHPA 2JDCA 2Z0ZA 5JQ4A 3W91A 5KTDA 4PV6A 3VWDA 5EBVA 3V8IA 2FIWA 1VHSA 2R98A 3ZJ0A 2WPXA 3S6KA 4KUAA 4ONUA 3G3SA 1XMTA 3LD2A 5DWNA 3D8PA 1CJWA 2CNTA 4NXYA 3R9GA 2VXKA 2ZW7A 2EVNA 2CY2A 1Q2YA 2G3TA 3S6HA 1K4JA 4OAEA 3VWEA 4XPLA 1RO5A 2P6EA 1IYLA 4QUSA 2REFA 1Y9WA 3CXPA 2FSRA 1B6BA 4JWPA 2GANA 3DNSA 4MY3A 2B3UA 4Y49C 2EUIA 3S6GA 2O28A 3F5BA 2ZW6A 5H84A 5F47A 1KZFA 3B8GA 2NMTA 4E8OA 4HNYB 5GCNA 4U9ZA 1V0CA 3TT2A 4F0YA 2QECA 4H6ZA 2K5TA 3FBUA 2H5MA 2CNMA 2Z11A 2G0BA 3S6FA 4CAVA 2HV2A 3P2HA 1QSTA 3PZJA 1YR0A 4YRHA 4IF5A 4U5YA 3EO4A 2VBQA 2OB0A 1Y7RA 4FD4A 2Z10A 4KOSA 1YVOA 2VI7A 3D2PA 4NSQA 3PP9A 2QIRA 4I49A 4MY0A 3E0KA 3P2FA 3LODA 3OWCA 2OZUA 1ON0A 4KOUA 4CS0B 4ORFA 2Q04A 4RI1A 3EY5A 4J3GA 1YVKA 5IV0A 2VZYA 1WK4A 3FB3A 4B5OA 2ZW5A 5FVJA 4KOVA 2D4PA 2REEA 4UBRA 1XE4A 4NF1A 3IWGA 2Q4VA 3T90A 2Q7BA 3TOAA 4PSXA 1YX0A 4QB9A 5F46A 4JJXA 4R9MA 3DR8A 1NE9A 1YK3A 2ZPAA 2OU2A 3CXSA 3SXOA 1VKCA 2ZXVA 3R9FA 2FCKA
chains in the Genus database with same CATH superfamily
4U9YA 5JM6A 3WC5A 5I4MA 2CIJA 2DXQA 4KVME 2EWBA 4NGSA 2NYQA 3H4QA 3FF3A 1DE4C 2Q43A 1R3NA 3PB4X 4L89A 4NJRA 3V7ZA 1YLEA 2OZGA 1F57A 3GLJA 3BJ7A 3FH4A 4UFVA 1P0HA 2QYVA 5F48A 4KVXA 4MCSA 3I9SA 3EFAA 1LOKA 3UY5A 1ZG7A 4UEZA 3W6XA 3EXNA 2BEIA 4YGOA 1QSNA 1TKJA 4PK3A 4L8AA 4WWVA 4CGNA 2OOTA 4OKOA 5G21A 3SJXA 3IJ3A 5A27A 1Z8XA 3KL9A 4RS2A 3BHXA 1LAMA 2ZEMA 3TE4A 3WABA 3TX8A 1Z4RA 3FRMA 1CM0A 2ZOFA 2ZW4A 2P0WA 1Y7EA 4KSIA 5HMNA 3I3GA 4FD7A 3H8EA 1YQEA 3K9UA 2CNSA 4XNHB 2Z3LA 2ZEGA 2DEAA 2VEZA 4FUUA 3MRUA 5DWMA 4FD5A 4AXVA 1TKHA 2ZEPA 3B7IA 1PU9A 4CYPA 1CPXA 1J4JA 2CF4A 3GUXA 4JXQA 4A31A 2PJ1A 1IYKA 1ZG8A 1I12A 1Y9KA 3WT4A 2BSWA 5C82A 1S5KA 1S7NA 4AG7A 1IY7A 1XJOA 3W6SA 3IGRA 1L0CA 2Q4YA 2RFHA 2EBJA 2Q0YA 2F5IA 3PB8X 4PXCA 2FXFA 1TF8A 4CYNA 4NGTA 2AFZA 2D4OA 4C68A 4AVBA 4LX9A 4LQGA 2XEGA 1Z5RA 3SJGA 2POKA 1BPNA 2Q44A 3R96A 4JYWA 1R57A 2I00A 1OZPA 2AJ6A 2F8HA 3BI1A 4YFJA 3I1UA 4OC4A 5J8CA 4MFZA 1BO4A 1S7FA 1Y0RA 4FD6A 1N71A 3NE8A 1I21A 1KUYA 3FMCA 2DPSA 4Q7AA 4F9VA 2CTCA 2Z3MA 1P4NA 2A4NA 1VGYA 3TOBA 3D2MA 3QNVA 4EVYA 2VQYA 3ISZA 5IB0A 1JQGA 1BOBA 3KHXA 2P6FA 4P4JA 5AG4A 4H89A 3DLJA 1S7LA 3S9MA 4P4DA 3SI2A 4CYQA 3WC6A 4H2KA 2PJ6A 4XPDB 2ZEFA 2GIVA 1QSRA 5D29A 2PJ9A 5HVHA 1IB1E 2IL4A 2R1IA 3D3SA 3EC4A 4NFRA 2HQYA 5IB9A 1YSJA 4HNWB 1GHEA 2B4DB 2FS5A 3IFEA 4MFKA 1Z8TA 2V8DA 2V8VA 4R6TA 2PJ7A 4P10A 2J8MA 4PXBA 1FY7A 2FIAA 3JUWA 1XEBA 1MJAA 5I0CA 4PXDA 1QSMA 4P4IA 2AE6A 5HVFA 2BO9A 2B4DA 3FIXA 4PSWA 4CGMA 4DYOA 5JPHA 1F2OA 4EMEA 3SXNA 4MHZA 1CG2A 3A9LA 4M6HA 1PUAA 4MBUA 2YNEA 3RYOA 4DUKA 3PBEA 4KLWA 4A2ZA 4FBEA 5E96A 4UFXA 3MN8A 2WZNA 4B12A 8CPAA 2R7HA 4P44A 2WPWA 1Y0YA 4P45A 4X8IA 4BMHA 1Z4EA 4C7IA 1Z8WA 4F8ZA 2GREA 2HUZA 3F0AA 2RC4A 4MI4A 1M4IA 2QMLA 2GE3A 2V8HA 4F9UA 4KSAA 5H86A 5KTAA 3PFOA 4MFPA 4R87A 5LYDA 1QSOA 2PJ0A 4UIBA 1CP6A 2B4BA 4A30A 4OC0A 3D7GA 4JLYA 4BD9A 4CAXA 1Q7LA 2YNCC 5J8FA 1XMBA 1UFHA 2C6CA 2Q7SA 4IHMA 4KVOE 4ONWA 2BUEA 3B3SA 3FXTA 3KR5A 5J1QA 3JRUA 2J8RA 4PK2A 3T8WA 3CZXA 2FT0A 2PRBA 3BLNA 4AG9A 4MJ8A 1IGBA 5C88A 1TXRA 2OZHA 4IAVA 2PDOA 3QB8A 1PCAA 4M3SA 1ZLHA 2ZELA 2ANPA 4CAWA 4ZI6A 2EO8A 2XEJA 1VIXA 2PJCA 1LRZA 3G8WA 4NCZA 1DTDA 3FYNA 1S60A 1MJ9A 3PFEA 4JZ0A 4XPDC 2KCWA 1KUXA 5EMIA 3B3WA 4ZBGA 4QC6A 4NGNA 4UCNA 2GU2A 4GS4A 1ZG9A 4OLLA 5LYFA 2AFOA 4R57A 4M6GA 4QVTA 4F6AA 4OC2A 1M4DA 1M4LA 3GY9A 1S3ZA 4X3RA 1SQHA 4A38A 3D67A 5HVGA 4MCQA 1Q2DA 1TIQA 4XNHC 4AVAA 1X10A 4DNCA 2PC1A 1AYEA 4KS9A 4PXEA 3CXQA 3WR7A 4UWIA 2B3VA 2B58A 2C6GA 2O53A 4R3LA 1ARMA 1NMTA 4E0AA 3S9LA 1VHEA 3CT9A 2B5GB 3CPAA 4CGLA 2ZOGA 4NEXA 3FECA 3S9NA 2PIZA 1ARLA 1Z9UA 4R76A 2DPTA 4OIDA 2Y0MA 4MHDA 4AB7A 2ZEDA 3R1KA 3N5FA 4ZX9A 3DSBA 1GYTA 3C26A 3DDDA 3ISXA 1KWMA 3R95A 3VATA 2ATRA 5ISVA 3FNCA 5LRGA 1IOIA 4ZY2A 4B5PA 2P6GA 1HDUA 2BL1A 2CXAA 4YWYA 3PB9X 2ABZA 1ZO0A 3F8KA 3T9YA 2WSAA 3BXMA 2BOAA 2G3AA 3RNZA 2FVGA 1Z8LA 4IK2A 2B5GA 3TO9A 4PQAA 4G1PA 4MXUA 3NA6A 4C2YA 2R8VA 4H6UA 3H5ZA 3D4UA 4LUAA 2Z3NA 4KOXA 2FL4A 2ZEEA 2ZENA 5AG5A 5F49A 3R9EA 4C2ZA 2JEVA 3PEIA 3TTHA 2EK9A 2JLMA 2GLJA 1M1DA 4NJQA 1I1DA 3FX6A 5G1ZA 1ELMP 4HKFA 3QAHA 3KZWA 4JXRA 3PBBA 4MMOA 3HLPA 3IWEA 4KOWA 1WWZA 2YNDA 4MCRA 4Q38A 4Y49B 3TO7A 4TWEA 3LMSA 1RXTA 3RBUA 4OADA 2GFQA 3JVNA 2RB7A 4A37A 4CGOA 2X7BA 1KUVA 3K2KA 2PJ3A 4FAIA 4A32A 3BJ8A 3LACA 4K3NA 4KLVA 4NGRA 4GXHA 2F7VA 2I79A 4MHNA 3NH5A 1U6MA 1CPSA 1YREA 3RZAA 2PVVA 4JD6A 5CPAA 2IMOA 5AGEA 2PJ8A 4GM5A 1S7KA 1TF9A 2PRQA 4UIAA 1IIDA 1NSLA 3PGPA 3VARA 4AVCA 4QBJA 2ARHA 1YGHA 2G9DA 3H8GA 2ZEOA 3GIUA 4ZX8A 1XF8A 2J8NA 1HEEA 2OH1A 2PSWA 4CRZB 3QAYA 1XFOA 2JDDA 3L2NA 4HPSA 4KUBA 5AG7A 3KR4A 4P4EA 2PR8A 2YGWA 4X2TA 5K8NA 3N7ZA 1UWYA 1B87A 1M44A 1X12A 3B35A 4IUSA 3SI0A 4CRYB 5JH9A 2PR1A 3TO6A 4X5KA 4UA3A 3DR6A 4E2AA 4CYOA 3KASA 3SJEA 3GKRA 3IWWA 3JTKA 2VZZA 4R8FA 4R3KA 4UWJA 5AG6A 4ZGYB 4B5PB 3B3VA 1EE3P 4WJBA 6CPAA 1XIXA 3FVLA 4KZTA 1M4GA 4KOTA 2PQ8A 2XEFA 5LRKA 1LCPA 4EFDA 4P4FA 1OBRA 2V8GA 4BINA 3D7FA 2C1CA 3NE7A 3D66A 2PJ2A 4KORA 3GYAA 4UEEA 5K8PA 4TNUA 5IX3A 4KOYA 1BPMA 4Q36A 3TFYA 4M6IA 2AFSA 5EC4A 4OMEA 3PB7X 2FE7A 2PJBA 5D8NA 1IICA 4MRIA 4HNXB 3PB6X 3TCVA 3FEDA 5CNPA 3ZZIA 2YNCA 4ZY1A 1MJBA 3KKWA 4K30A 4NGQA 1XRYA 3HUVA 4RN7A 3V38A 3RAMA 4B14A 5LRJA 2HB6A 3H8FA 4DJLA 4FWUA 5HH1A 4B10A 1MK4A 1AMPA 2C27A 4XPKA 3B3TA 3MGDA 3KGQA 4A39A 1YLOA 4M85A 5THWA 4LQ6A 4P4BA 1LAPA 1Q2CA 2Z3KA 2BCOA 4A94A 4II9A 5KTCA 3SHPA 3KHZA 2J9AA 2JDCA 2Z0ZA 4A95A 2AFXA 2AFWA 3NH8A 2WYRA 4OIWA 3W91A 5JQ4A 2GLFA 5KTDA 4PV6A 4A33A 5DS0A 3D7HA 3VWDA 5EBVA 3V8IA 2DF5A 2Q51A 2FIWA 1VHSA 1LANA 4OP4A 4CAFA 1CBXA 2R98A 2PIYA 3ZJ0A 1YW4A 2WPXA 3S6KA 4KUAA 2PJ4A 4ONUA 3SI1A 4C2XA 3NFZA 3G3SA 3D68A 3IU1A 1NSAA 3NH4A 4UEFA 1XMTA 1XBUA 3LD2A 5DWNA 2JBKA 3D8PA 1CJWA 2CNTA 2ODFA 4NXYA 3IC1A 2PVWA 4ZYQA 3R9GA 2VXKA 2ZW7A 2EVNA 2PE3A 2CY2A 4OC1A 1Q2YA 2G3TA 3S6HA 1K4JA 4OAEA 1IU8A 3VWEA 5A28A 5F09A 4XPLA 1RO5A 2P6EA 5LYIA 1LFWA 1IYLA 1VHOA 2REFA 1Y9WA 3CXPA 4QUSA 1FNOA 2FSRA 3TC8A 3FEEA 1B6BA 4JWPA 1ELLP 3KI9A 5JGFA 2GANA 3DNSA 4MY3A 1A2ZA 2B3UA 4Y49C 4EWTA 2EUIA 3GB0A 5K8OA 1YW6A 3IU2A 2AFMA 3S6GA 2Z3OA 4UFWA 4W9YA 1BAVA 2O28A 3F5BA 1FT7A 1CP7A 2ZW6A 5H84A 4B11A 5F47A 1AUGA 1KZFA 2AFUA 2Q4ZA 3B8GA 2NMTA 4E8OA 3KQXA 4MFJA 2Z3PA 4HNYB 2XEIA 3B3CA 2VL1A 5GCNA 4U9ZA 1V0CA 2C6PA 1QQ9A 3TT2A 4F0YA 1HDQA 2QECA 4H6ZA 4KSFA 2K5TA 3FBUA 2H5MA 2JEWA 2CNMA 3B2YA 2Z11A 2G0BA 4NGPA 1JWQA 3S6FA 4CAVA 1R43A 2HV2A 3RO0A 3P2HA 1QSTA 3PZJA 1YR0A 3D7DA 4B13A 4CPAA 4YRHA 1ZLIA 4IF5A 4U5YA 3EO4A 2VBQA 2OB0A 4CGPA 1Y7RA 4P6YA 3VH9A 4FD4A 2Z10A 2V77A 4KOSA 1YVOA 3K9TA 4BBHA 4ZY0A 5CBMA 2VI7A 4MFQA 3D2PA 4NSQA 5K8MA 3PP9A 2QIRA 2QVPA 4I49A 3KQZA 4MY0A 1RTQA 1QMUA 3WC7A 4B6ZA 3E0KA 2NSMA 3LODA 3OWCA 2OZUA 3BI0A 3CDXA 1ON0A 3P2FA 4KOUA 4OC3A 4CS0B 1H8LA 2Q04A 3DGVA 4MHYA 4ORFA 4RI1A 5HXDA 4C7HA 3EY5A 4J3GA 4PPZA 1YVKA 4YU9A 2QJ8A 5IV0A 2VZYA 3SJFA 4CAEA 2EK8A 1WK4A 4UCPA 3LWUA 2OR4A 2PCUA 3PRTA 3FB3A 4B5OA 2ZW5A 5FVJA 1F2PA 4KOVA 4UF4A 4Z65A 2D4PA 5ELYA 1IOFA 2REEA 4F0XA 4OC5A 1PYTB 4UBRA 7CPAA 5LYLA 4MHPA 1XE4A 2CTBA 2JBJA 3IEHA 2PJAA 1Z2LA 4NF1A 2IQ6A 3IWGA 2Q4VA 3CPXA 3T90A 5G22A 1BLLE 2Q7BA 4O23A 1CX8A 3TOAA 4PSXA 4RUHA 1YX0A 2I3CA 4QB9A 3IO1A 4R7MA 2IJZA 5BWAB 3IIBA 4NGMA 4MFLA 4JJXA 5F46A 1XOVA 1TKFA 4R9MA 1NE9A 1YK3A 2O4HA 2ZPAA 3DR8A 2OU2A 3CXSA 4MCPA 3SXOA 1VKCA 2ZXVA 3FJUA 4UCMA 5G20A 1YMEA 2WUUA 2HC9A 2ZEHA 3R9FA 2FCKA 2PJ5A
chains in the Genus database with same CATH topology
4U9YA 4KVME 2DXQA 3H4QA 4L89A 1YLEA 2OZGA 3BJ7A 4UFVA 5F48A 1P0HA 4KVXA 3I9SA 3EFAA 3UY5A 3W6XA 3EXNA 2BEIA 4YGOA 1QSNA 4PK3A 4L8AA 4CGNA 5G21A 5A27A 4RS2A 3TE4A 1Z4RA 3FRMA 1CM0A 2ZW4A 2P0WA 5HMNA 3I3GA 4FD7A 3K9UA 2CNSA 4XNHB 2Z3LA 2VEZA 5DWMA 4FD5A 1PU9A 4CYPA 1J4JA 4JXQA 4A31A 1IYKA 1I12A 1Y9KA 2BSWA 5C82A 1S5KA 1S7NA 4AG7A 3W6SA 3IGRA 1L0CA 2Q4YA 2Q0YA 2F5IA 2FXFA 4CYNA 2D4OA 4C68A 4AVBA 4LX9A 2Q44A 3R96A 1R57A 2I00A 1OZPA 2AJ6A 4YFJA 5J8CA 4MFZA 1BO4A 1S7FA 4FD6A 1N71A 1I21A 1KUYA 2DPSA 2Z3MA 1P4NA 2A4NA 3TOBA 3D2MA 4EVYA 2VQYA 5IB0A 1BOBA 2P6FA 5AG4A 4H89A 1S7LA 4CYQA 4XPDB 2GIVA 1QSRA 1IB1E 2IL4A 2R1IA 3D3SA 3EC4A 2HQYA 4HNWB 1GHEA 4MFKA 2B4DB 2FS5A 2J8MA 1FY7A 2FIAA 3JUWA 1MJAA 1XEBA 5I0CA 1QSMA 2AE6A 2B4DA 3FIXA 4PSWA 4CGMA 5JPHA 3SXNA 3A9LA 1PUAA 4MBUA 2YNEA 3RYOA 4KLWA 4A2ZA 5E96A 4UFXA 4B12A 2R7HA 2WPWA 4BMHA 1Z4EA 4C7IA 3F0AA 2HUZA 4MI4A 2RC4A 1M4IA 2QMLA 2GE3A 5KTAA 4KSAA 5H86A 4MFPA 4R87A 1QSOA 2B4BA 4A30A 4JLYA 4CAXA 2YNCC 5J8FA 1UFHA 4KVOE 2BUEA 3FXTA 2J8RA 4PK2A 2FT0A 2PRBA 3BLNA 4AG9A 4MJ8A 5C88A 2OZHA 2PDOA 3QB8A 4M3SA 4CAWA 3G8WA 1LRZA 4NCZA 3FYNA 1S60A 1MJ9A 4XPDC 2KCWA 1KUXA 4ZBGA 4QC6A 4UCNA 4GS4A 4OLLA 4R57A 4QVTA 4F6AA 1M4DA 3GY9A 1S3ZA 1SQHA 1Q2DA 1TIQA 4XNHC 4AVAA 4DNCA 2PC1A 4KS9A 3CXQA 3WR7A 4UWIA 2B3VA 2B58A 4R3LA 1NMTA 4E0AA 2B5GB 4CGLA 4NEXA 1Z9UA 2DPTA 2Y0MA 4MHDA 4AB7A 3R1KA 3DSBA 3C26A 3DDDA 3R95A 2ATRA 5ISVA 3FNCA 4B5PA 2P6GA 2BL1A 2CXAA 1ZO0A 3F8KA 3T9YA 2WSAA 2G3AA 2B5GA 3TO9A 4C2YA 4H6UA 2R8VA 3H5ZA 4LUAA 2Z3NA 4KOXA 2FL4A 5AG5A 5F49A 3R9EA 4C2ZA 2JEVA 3TTHA 2JLMA 1M1DA 1I1DA 5G1ZA 4HKFA 4JXRA 3QAHA 3IWEA 4KOWA 1WWZA 2YNDA 4Q38A 4Y49B 3TO7A 1RXTA 4OADA 3JVNA 4CGOA 2X7BA 1KUVA 4A32A 3BJ8A 4KLVA 2I79A 1U6MA 1YREA 4JD6A 5AGEA 1S7KA 1IIDA 1NSLA 3PGPA 4AVCA 4QBJA 2ARHA 1YGHA 1XF8A 2J8NA 2OH1A 2PSWA 4CRZB 2JDDA 4KUBA 5AG7A 2PR8A 2YGWA 3N7ZA 1B87A 1M44A 4IUSA 4CRYB 2PR1A 3TO6A 4X5KA 4UA3A 3DR6A 4E2AA 4CYOA 3GKRA 3JTKA 4UWJA 2VZZA 5AG6A 4R3KA 4ZGYB 4B5PB 1XIXA 4KZTA 1M4GA 4KOTA 2PQ8A 3NE7A 4KORA 3GYAA 5IX3A 4KOYA 4Q36A 3TFYA 5EC4A 2FE7A 1IICA 4HNXB 3TCVA 5CNPA 3ZZIA 2YNCA 1MJBA 3KKWA 4K30A 4B14A 5HH1A 4B10A 1MK4A 2C27A 4XPKA 3MGDA 4M85A 1Q2CA 2Z3KA 4II9A 5KTCA 3SHPA 2JDCA 2Z0ZA 4A95A 5JQ4A 3W91A 5KTDA 4PV6A 4A33A 3VWDA 5EBVA 3V8IA 2FIWA 1VHSA 4CAFA 2R98A 3ZJ0A 2WPXA 3S6KA 4KUAA 4ONUA 4C2XA 3G3SA 3IU1A 1XMTA 3LD2A 5DWNA 3D8PA 1CJWA 2CNTA 4NXYA 3R9GA 2VXKA 2ZW7A 2EVNA 2CY2A 1Q2YA 2G3TA 3S6HA 1K4JA 4OAEA 5A28A 3VWEA 4XPLA 1RO5A 2P6EA 1IYLA 4QUSA 2REFA 1Y9WA 3CXPA 2FSRA 1B6BA 4JWPA 2GANA 3DNSA 4MY3A 2B3UA 4Y49C 2EUIA 3IU2A 3S6GA 2Z3OA 4UFWA 2O28A 3F5BA 4B11A 2ZW6A 5H84A 5F47A 1KZFA 3B8GA 2NMTA 4E8OA 4MFJA 2Z3PA 4HNYB 5GCNA 4U9ZA 1V0CA 3TT2A 4F0YA 2QECA 4H6ZA 4KSFA 2K5TA 3FBUA 2H5MA 2CNMA 2Z11A 2G0BA 3S6FA 4CAVA 2HV2A 3P2HA 1QSTA 3PZJA 1YR0A 4B13A 4YRHA 4IF5A 4U5YA 3EO4A 2VBQA 2OB0A 4CGPA 1Y7RA 4FD4A 2Z10A 4KOSA 1YVOA 4BBHA 2VI7A 4MFQA 3D2PA 4NSQA 3PP9A 2QIRA 4I49A 4MY0A 3E0KA 3P2FA 3LODA 3OWCA 2OZUA 1ON0A 4KOUA 4CS0B 4ORFA 2Q04A 4RI1A 4C7HA 3EY5A 4J3GA 1YVKA 5IV0A 2VZYA 4CAEA 1WK4A 4UCPA 3FB3A 4B5OA 2ZW5A 5FVJA 4KOVA 2D4PA 2REEA 4F0XA 4UBRA 1XE4A 4NF1A 3IWGA 2Q4VA 3T90A 5G22A 2Q7BA 3TOAA 4PSXA 1YX0A 4QB9A 5BWAB 5F46A 4MFLA 4JJXA 4R9MA 2ZPAA 3DR8A 1NE9A 1YK3A 2OU2A 3CXSA 3SXOA 1VKCA 2ZXVA 4UCMA 5G20A 2WUUA 3R9FA 2FCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Y A;  4KVM E;  2DXQ A;  3H4Q A;  4L89 A;  1YLE A;  2OZG A;  3BJ7 A;  5F48 A;  1P0H A;  4KVX A;  3I9S A;  3EFA A;  3UY5 A;  3W6X A;  3EXN A;  2BEI A;  4YGO A;  1QSN A;  4PK3 A;  4L8A A;  4RS2 A;  3TE4 A;  1Z4R A;  3FRM A;  1CM0 A;  2ZW4 A;  2P0W A;  5HMN A;  3I3G A;  4FD7 A;  3K9U A;  2CNS A;  4XNH B;  2VEZ A;  5DWM A;  4FD5 A;  1PU9 A;  1J4J A;  4JXQ A;  1IYK A;  1I12 A;  1Y9K A;  2BSW A;  5C82 A;  1S5K A;  1S7N A;  4AG7 A;  3W6S A;  3IGR A;  1L0C A;  2Q4Y A;  2Q0Y A;  2F5I A;  2FXF A;  2D4O A;  4AVB A;  4LX9 A;  2Q44 A;  3R96 A;  1R57 A;  2I00 A;  1OZP A;  2AJ6 A;  4YFJ A;  5J8C A;  1BO4 A;  1S7F A;  4FD6 A;  1N71 A;  1I21 A;  1KUY A;  1P4N A;  2A4N A;  3TOB A;  3D2M A;  4EVY A;  2VQY A;  5IB0 A;  1BOB A;  2P6F A;  4H89 A;  1S7L A;  4XPD B;  2GIV A;  1QSR A;  1IB1 E;  2IL4 A;  2R1I A;  3D3S A;  3EC4 A;  2HQY A;  4HNW B;  1GHE A;  2B4D B;  2FS5 A;  2J8M A;  1FY7 A;  2FIA A;  3JUW A;  1MJA A;  1XEB A;  5I0C A;  1QSM A;  2AE6 A;  2B4D A;  3FIX A;  4PSW A;  5JPH A;  3SXN A;  1PUA A;  4MBU A;  3RYO A;  4KLW A;  5E96 A;  2R7H A;  2WPW A;  4BMH A;  1Z4E A;  3F0A A;  2HUZ A;  4MI4 A;  2RC4 A;  1M4I A;  2QML A;  2GE3 A;  5KTA A;  5H86 A;  4R87 A;  1QSO A;  2B4B A;  4JLY A;  4CAX A;  5J8F A;  1UFH A;  4KVO E;  2BUE A;  3FXT A;  2J8R A;  4PK2 A;  2FT0 A;  2PRB A;  3BLN A;  4AG9 A;  4MJ8 A;  5C88 A;  2OZH A;  2PDO A;  3QB8 A;  4M3S A;  4CAW A;  3G8W A;  1LRZ A;  4NCZ A;  3FYN A;  1S60 A;  1MJ9 A;  4XPD C;  2KCW A;  1KUX A;  4ZBG A;  4QC6 A;  4GS4 A;  4OLL A;  4R57 A;  4QVT A;  4F6A A;  1M4D A;  3GY9 A;  1S3Z A;  1SQH A;  1Q2D A;  1TIQ A;  4XNH C;  4AVA A;  4DNC A;  2PC1 A;  3CXQ A;  3WR7 A;  4UWI A;  2B3V A;  2B58 A;  4R3L A;  1NMT A;  4E0A A;  2B5G B;  4NEX A;  1Z9U A;  2Y0M A;  4MHD A;  4AB7 A;  3R1K A;  3DSB A;  3C26 A;  3DDD A;  3R95 A;  2ATR A;  5ISV A;  3FNC A;  4B5P A;  2P6G A;  2BL1 A;  3F8K A;  3T9Y A;  2G3A A;  2B5G A;  3TO9 A;  4H6U A;  2R8V A;  4LUA A;  4KOX A;  2FL4 A;  5F49 A;  3R9E A;  2JEV A;  3TTH A;  2JLM A;  1M1D A;  1I1D A;  4HKF A;  4JXR A;  3QAH A;  4KOW A;  1WWZ A;  4Y49 B;  3TO7 A;  1RXT A;  4OAD A;  3JVN A;  2X7B A;  1KUV A;  3BJ8 A;  4KLV A;  2I79 A;  1U6M A;  1YRE A;  4JD6 A;  1S7K A;  1IID A;  1NSL A;  3PGP A;  4AVC A;  4QBJ A;  2ARH A;  1YGH A;  1XF8 A;  2J8N A;  2OH1 A;  2PSW A;  4CRZ B;  2JDD A;  4KUB A;  2PR8 A;  3N7Z A;  1B87 A;  1M44 A;  4IUS A;  4CRY B;  2PR1 A;  3TO6 A;  4X5K A;  4UA3 A;  3DR6 A;  4E2A A;  3GKR A;  4UWJ A;  2VZZ A;  4R3K A;  4B5P B;  1XIX A;  4KZT A;  1M4G A;  4KOT A;  2PQ8 A;  3NE7 A;  4KOR A;  3GYA A;  5IX3 A;  4KOY A;  3TFY A;  5EC4 A;  2FE7 A;  1IIC A;  4HNX B;  3TCV A;  5CNP A;  3ZZI A;  1MJB A;  3KKW A;  4K30 A;  5HH1 A;  1MK4 A;  2C27 A;  4XPK A;  3MGD A;  4M85 A;  1Q2C A;  4II9 A;  5KTC A;  3SHP A;  2JDC A;  2Z0Z A;  5JQ4 A;  3W91 A;  5KTD A;  4PV6 A;  3VWD A;  5EBV A;  3V8I A;  2FIW A;  1VHS A;  2R98 A;  3ZJ0 A;  2WPX A;  3S6K A;  4KUA A;  4ONU A;  3G3S A;  1XMT A;  3LD2 A;  5DWN A;  3D8P A;  1CJW A;  2CNT A;  4NXY A;  3R9G A;  2VXK A;  2ZW7 A;  2EVN A;  2CY2 A;  1Q2Y A;  2G3T A;  3S6H A;  1K4J A;  4OAE A;  3VWE A;  4XPL A;  1RO5 A;  2P6E A;  1IYL A;  4QUS A;  2REF A;  1Y9W A;  3CXP A;  2FSR A;  1B6B A;  4JWP A;  2GAN A;  3DNS A;  4MY3 A;  2B3U A;  4Y49 C;  2EUI A;  3S6G A;  2O28 A;  3F5B A;  2ZW6 A;  5H84 A;  5F47 A;  1KZF A;  3B8G A;  2NMT A;  4E8O A;  4HNY B;  5GCN A;  4U9Z A;  1V0C A;  3TT2 A;  4F0Y A;  2QEC A;  4H6Z A;  2K5T A;  3FBU A;  2H5M A;  2CNM A;  2Z11 A;  2G0B A;  3S6F A;  4CAV A;  2HV2 A;  3P2H A;  1QST A;  3PZJ A;  1YR0 A;  4YRH A;  4IF5 A;  4U5Y A;  3EO4 A;  2VBQ A;  2OB0 A;  1Y7R A;  4FD4 A;  2Z10 A;  4KOS A;  1YVO A;  2VI7 A;  3D2P A;  4NSQ A;  3PP9 A;  2QIR A;  4I49 A;  4MY0 A;  3E0K A;  3P2F A;  3LOD A;  3OWC A;  2OZU A;  1ON0 A;  4KOU A;  4CS0 B;  4ORF A;  2Q04 A;  4RI1 A;  3EY5 A;  4J3G A;  1YVK A;  5IV0 A;  2VZY A;  1WK4 A;  3FB3 A;  4B5O A;  2ZW5 A;  5FVJ A;  4KOV A;  2D4P A;  2REE A;  4UBR A;  1XE4 A;  4NF1 A;  3IWG A;  2Q4V A;  3T90 A;  2Q7B A;  3TOA A;  4PSX A;  1YX0 A;  4QB9 A;  5F46 A;  4JJX A;  4R9M A;  3DR8 A;  1NE9 A;  1YK3 A;  2ZPA A;  2OU2 A;  3CXS A;  3SXO A;  1VKC A;  2ZXV A;  3R9F A;  2FCK A; 
#chains in the Genus database with same CATH topology
 4U9Y A;  5JM6 A;  3WC5 A;  5I4M A;  2CIJ A;  2DXQ A;  4KVM E;  2EWB A;  4NGS A;  2NYQ A;  3H4Q A;  3FF3 A;  1DE4 C;  2Q43 A;  1R3N A;  3PB4 X;  4L89 A;  4NJR A;  3V7Z A;  1YLE A;  2OZG A;  1F57 A;  3GLJ A;  3BJ7 A;  3FH4 A;  4UFV A;  1P0H A;  2QYV A;  5F48 A;  4KVX A;  4MCS A;  3I9S A;  3EFA A;  1LOK A;  3UY5 A;  1ZG7 A;  4UEZ A;  3W6X A;  3EXN A;  2BEI A;  4YGO A;  1QSN A;  1TKJ A;  4PK3 A;  4L8A A;  4WWV A;  4CGN A;  2OOT A;  4OKO A;  5G21 A;  3SJX A;  3IJ3 A;  5A27 A;  1Z8X A;  3KL9 A;  4RS2 A;  3BHX A;  1LAM A;  2ZEM A;  3TE4 A;  3WAB A;  3TX8 A;  1Z4R A;  3FRM A;  1CM0 A;  2ZOF A;  2ZW4 A;  2P0W A;  1Y7E A;  4KSI A;  5HMN A;  3I3G A;  4FD7 A;  3H8E A;  1YQE A;  3K9U A;  2CNS A;  4XNH B;  2Z3L A;  2ZEG A;  2DEA A;  2VEZ A;  4FUU A;  3MRU A;  5DWM A;  4FD5 A;  4AXV A;  1TKH A;  2ZEP A;  3B7I A;  1PU9 A;  4CYP A;  1CPX A;  1J4J A;  2CF4 A;  3GUX A;  4JXQ A;  4A31 A;  2PJ1 A;  1IYK A;  1ZG8 A;  1I12 A;  1Y9K A;  3WT4 A;  2BSW A;  5C82 A;  1S5K A;  1S7N A;  4AG7 A;  1IY7 A;  1XJO A;  3W6S A;  3IGR A;  1L0C A;  2Q4Y A;  2RFH A;  2EBJ A;  2Q0Y A;  2F5I A;  3PB8 X;  4PXC A;  2FXF A;  1TF8 A;  4CYN A;  4NGT A;  2AFZ A;  2D4O A;  4C68 A;  4AVB A;  4LX9 A;  4LQG A;  2XEG A;  1Z5R A;  3SJG A;  2POK A;  1BPN A;  2Q44 A;  3R96 A;  4JYW A;  1R57 A;  2I00 A;  1OZP A;  2AJ6 A;  2F8H A;  3BI1 A;  4YFJ A;  3I1U A;  4OC4 A;  5J8C A;  4MFZ A;  1BO4 A;  1S7F A;  1Y0R A;  4FD6 A;  1N71 A;  3NE8 A;  1I21 A;  1KUY A;  3FMC A;  2DPS A;  4Q7A A;  4F9V A;  2CTC A;  2Z3M A;  1P4N A;  2A4N A;  1VGY A;  3TOB A;  3D2M A;  3QNV A;  4EVY A;  2VQY A;  3ISZ A;  5IB0 A;  1JQG A;  1BOB A;  3KHX A;  2P6F A;  4P4J A;  5AG4 A;  4H89 A;  3DLJ A;  1S7L A;  3S9M A;  4P4D A;  3SI2 A;  4CYQ A;  3WC6 A;  4H2K A;  2PJ6 A;  4XPD B;  2ZEF A;  2GIV A;  1QSR A;  5D29 A;  2PJ9 A;  5HVH A;  1IB1 E;  2IL4 A;  2R1I A;  3D3S A;  3EC4 A;  4NFR A;  2HQY A;  5IB9 A;  1YSJ A;  4HNW B;  1GHE A;  2B4D B;  2FS5 A;  3IFE A;  4MFK A;  1Z8T A;  2V8D A;  2V8V A;  4R6T A;  2PJ7 A;  4P10 A;  2J8M A;  4PXB A;  1FY7 A;  2FIA A;  3JUW A;  1XEB A;  1MJA A;  5I0C A;  4PXD A;  1QSM A;  4P4I A;  2AE6 A;  5HVF A;  2BO9 A;  2B4D A;  3FIX A;  4PSW A;  4CGM A;  4DYO A;  5JPH A;  1F2O A;  4EME A;  3SXN A;  4MHZ A;  1CG2 A;  3A9L A;  4M6H A;  1PUA A;  4MBU A;  2YNE A;  3RYO A;  4DUK A;  3PBE A;  4KLW A;  4A2Z A;  4FBE A;  5E96 A;  4UFX A;  3MN8 A;  2WZN A;  4B12 A;  8CPA A;  2R7H A;  4P44 A;  2WPW A;  1Y0Y A;  4P45 A;  4X8I A;  4BMH A;  1Z4E A;  4C7I A;  1Z8W A;  4F8Z A;  2GRE A;  2HUZ A;  3F0A A;  2RC4 A;  4MI4 A;  1M4I A;  2QML A;  2GE3 A;  2V8H A;  4F9U A;  4KSA A;  5H86 A;  5KTA A;  3PFO A;  4MFP A;  4R87 A;  5LYD A;  1QSO A;  2PJ0 A;  4UIB A;  1CP6 A;  2B4B A;  4A30 A;  4OC0 A;  3D7G A;  4JLY A;  4BD9 A;  4CAX A;  1Q7L A;  2YNC C;  5J8F A;  1XMB A;  1UFH A;  2C6C A;  2Q7S A;  4IHM A;  4KVO E;  4ONW A;  2BUE A;  3B3S A;  3FXT A;  3KR5 A;  5J1Q A;  3JRU A;  2J8R A;  4PK2 A;  3T8W A;  3CZX A;  2FT0 A;  2PRB A;  3BLN A;  4AG9 A;  4MJ8 A;  1IGB A;  5C88 A;  1TXR A;  2OZH A;  4IAV A;  2PDO A;  3QB8 A;  1PCA A;  4M3S A;  1ZLH A;  2ZEL A;  2ANP A;  4CAW A;  4ZI6 A;  2EO8 A;  2XEJ A;  1VIX A;  2PJC A;  1LRZ A;  3G8W A;  4NCZ A;  1DTD A;  3FYN A;  1S60 A;  1MJ9 A;  3PFE A;  4JZ0 A;  4XPD C;  2KCW A;  1KUX A;  5EMI A;  3B3W A;  4ZBG A;  4QC6 A;  4NGN A;  4UCN A;  2GU2 A;  4GS4 A;  1ZG9 A;  4OLL A;  5LYF A;  2AFO A;  4R57 A;  4M6G A;  4QVT A;  4F6A A;  4OC2 A;  1M4D A;  1M4L A;  3GY9 A;  1S3Z A;  4X3R A;  1SQH A;  4A38 A;  3D67 A;  5HVG A;  4MCQ A;  1Q2D A;  1TIQ A;  4XNH C;  4AVA A;  1X10 A;  4DNC A;  2PC1 A;  1AYE A;  4KS9 A;  4PXE A;  3CXQ A;  3WR7 A;  4UWI A;  2B3V A;  2B58 A;  2C6G A;  2O53 A;  4R3L A;  1ARM A;  1NMT A;  4E0A A;  3S9L A;  1VHE A;  3CT9 A;  2B5G B;  3CPA A;  4CGL A;  2ZOG A;  4NEX A;  3FEC A;  3S9N A;  2PIZ A;  1ARL A;  1Z9U A;  4R76 A;  2DPT A;  4OID A;  2Y0M A;  4MHD A;  4AB7 A;  2ZED A;  3R1K A;  3N5F A;  4ZX9 A;  3DSB A;  1GYT A;  3C26 A;  3DDD A;  3ISX A;  1KWM A;  3R95 A;  3VAT A;  2ATR A;  5ISV A;  3FNC A;  5LRG A;  1IOI A;  4ZY2 A;  4B5P A;  2P6G A;  1HDU A;  2BL1 A;  2CXA A;  4YWY A;  3PB9 X;  2ABZ A;  1ZO0 A;  3F8K A;  3T9Y A;  2WSA A;  3BXM A;  2BOA A;  2G3A A;  3RNZ A;  2FVG A;  1Z8L A;  4IK2 A;  2B5G A;  3TO9 A;  4PQA A;  4G1P A;  4MXU A;  3NA6 A;  4C2Y A;  2R8V A;  4H6U A;  3H5Z A;  3D4U A;  4LUA A;  2Z3N A;  4KOX A;  2FL4 A;  2ZEE A;  2ZEN A;  5AG5 A;  5F49 A;  3R9E A;  4C2Z A;  2JEV A;  3PEI A;  3TTH A;  2EK9 A;  2JLM A;  2GLJ A;  1M1D A;  4NJQ A;  1I1D A;  3FX6 A;  5G1Z A;  1ELM P;  4HKF A;  3QAH A;  3KZW A;  4JXR A;  3PBB A;  4MMO A;  3HLP A;  3IWE A;  4KOW A;  1WWZ A;  2YND A;  4MCR A;  4Q38 A;  4Y49 B;  3TO7 A;  4TWE A;  3LMS A;  1RXT A;  3RBU A;  4OAD A;  2GFQ A;  3JVN A;  2RB7 A;  4A37 A;  4CGO A;  2X7B A;  1KUV A;  3K2K A;  2PJ3 A;  4FAI A;  4A32 A;  3BJ8 A;  3LAC A;  4K3N A;  4KLV A;  4NGR A;  4GXH A;  2F7V A;  2I79 A;  4MHN A;  3NH5 A;  1U6M A;  1CPS A;  1YRE A;  3RZA A;  2PVV A;  4JD6 A;  5CPA A;  2IMO A;  5AGE A;  2PJ8 A;  4GM5 A;  1S7K A;  1TF9 A;  2PRQ A;  4UIA A;  1IID A;  1NSL A;  3PGP A;  3VAR A;  4AVC A;  4QBJ A;  2ARH A;  1YGH A;  2G9D A;  3H8G A;  2ZEO A;  3GIU A;  4ZX8 A;  1XF8 A;  2J8N A;  1HEE A;  2OH1 A;  2PSW A;  4CRZ B;  3QAY A;  1XFO A;  2JDD A;  3L2N A;  4HPS A;  4KUB A;  5AG7 A;  3KR4 A;  4P4E A;  2PR8 A;  2YGW A;  4X2T A;  5K8N A;  3N7Z A;  1UWY A;  1B87 A;  1M44 A;  1X12 A;  3B35 A;  4IUS A;  3SI0 A;  4CRY B;  5JH9 A;  2PR1 A;  3TO6 A;  4X5K A;  4UA3 A;  3DR6 A;  4E2A A;  4CYO A;  3KAS A;  3SJE A;  3GKR A;  3IWW A;  3JTK A;  2VZZ A;  4R8F A;  4R3K A;  4UWJ A;  5AG6 A;  4ZGY B;  4B5P B;  3B3V A;  1EE3 P;  4WJB A;  6CPA A;  1XIX A;  3FVL A;  4KZT A;  1M4G A;  4KOT A;  2PQ8 A;  2XEF A;  5LRK A;  1LCP A;  4EFD A;  4P4F A;  1OBR A;  2V8G A;  4BIN A;  3D7F A;  2C1C A;  3NE7 A;  3D66 A;  2PJ2 A;  4KOR A;  3GYA A;  4UEE A;  5K8P A;  4TNU A;  5IX3 A;  4KOY A;  1BPM A;  4Q36 A;  3TFY A;  4M6I A;  2AFS A;  5EC4 A;  4OME A;  3PB7 X;  2FE7 A;  2PJB A;  5D8N A;  1IIC A;  4MRI A;  4HNX B;  3PB6 X;  3TCV A;  3FED A;  5CNP A;  3ZZI A;  2YNC A;  4ZY1 A;  1MJB A;  3KKW A;  4K30 A;  4NGQ A;  1XRY A;  3HUV A;  4RN7 A;  3V38 A;  3RAM A;  4B14 A;  5LRJ A;  2HB6 A;  3H8F A;  4DJL A;  4FWU A;  5HH1 A;  4B10 A;  1MK4 A;  1AMP A;  2C27 A;  4XPK A;  3B3T A;  3MGD A;  3KGQ A;  4A39 A;  1YLO A;  4M85 A;  5THW A;  4LQ6 A;  4P4B A;  1LAP A;  1Q2C A;  2Z3K A;  2BCO A;  4A94 A;  4II9 A;  5KTC A;  3SHP A;  3KHZ A;  2J9A A;  2JDC A;  2Z0Z A;  4A95 A;  2AFX A;  2AFW A;  3NH8 A;  2WYR A;  4OIW A;  3W91 A;  5JQ4 A;  2GLF A;  5KTD A;  4PV6 A;  4A33 A;  5DS0 A;  3D7H A;  3VWD A;  5EBV A;  3V8I A;  2DF5 A;  2Q51 A;  2FIW A;  1VHS A;  1LAN A;  4OP4 A;  4CAF A;  1CBX A;  2R98 A;  2PIY A;  3ZJ0 A;  1YW4 A;  2WPX A;  3S6K A;  4KUA A;  2PJ4 A;  4ONU A;  3SI1 A;  4C2X A;  3NFZ A;  3G3S A;  3D68 A;  3IU1 A;  1NSA A;  3NH4 A;  4UEF A;  1XMT A;  1XBU A;  3LD2 A;  5DWN A;  2JBK A;  3D8P A;  1CJW A;  2CNT A;  2ODF A;  4NXY A;  3IC1 A;  2PVW A;  4ZYQ A;  3R9G A;  2VXK A;  2ZW7 A;  2EVN A;  2PE3 A;  2CY2 A;  4OC1 A;  1Q2Y A;  2G3T A;  3S6H A;  1K4J A;  4OAE A;  1IU8 A;  3VWE A;  5A28 A;  5F09 A;  4XPL A;  1RO5 A;  2P6E A;  5LYI A;  1LFW A;  1IYL A;  1VHO A;  2REF A;  1Y9W A;  3CXP A;  4QUS A;  1FNO A;  2FSR A;  3TC8 A;  3FEE A;  1B6B A;  4JWP A;  1ELL P;  3KI9 A;  5JGF A;  2GAN A;  3DNS A;  4MY3 A;  1A2Z A;  2B3U A;  4Y49 C;  4EWT A;  2EUI A;  3GB0 A;  5K8O A;  1YW6 A;  3IU2 A;  2AFM A;  3S6G A;  2Z3O A;  4UFW A;  4W9Y A;  1BAV A;  2O28 A;  3F5B A;  1FT7 A;  1CP7 A;  2ZW6 A;  5H84 A;  4B11 A;  5F47 A;  1AUG A;  1KZF A;  2AFU A;  2Q4Z A;  3B8G A;  2NMT A;  4E8O A;  3KQX A;  4MFJ A;  2Z3P A;  4HNY B;  2XEI A;  3B3C A;  2VL1 A;  5GCN A;  4U9Z A;  1V0C A;  2C6P A;  1QQ9 A;  3TT2 A;  4F0Y A;  1HDQ A;  2QEC A;  4H6Z A;  4KSF A;  2K5T A;  3FBU A;  2H5M A;  2JEW A;  2CNM A;  3B2Y A;  2Z11 A;  2G0B A;  4NGP A;  1JWQ A;  3S6F A;  4CAV A;  1R43 A;  2HV2 A;  3RO0 A;  3P2H A;  1QST A;  3PZJ A;  1YR0 A;  3D7D A;  4B13 A;  4CPA A;  4YRH A;  1ZLI A;  4IF5 A;  4U5Y A;  3EO4 A;  2VBQ A;  2OB0 A;  4CGP A;  1Y7R A;  4P6Y A;  3VH9 A;  4FD4 A;  2Z10 A;  2V77 A;  4KOS A;  1YVO A;  3K9T A;  4BBH A;  4ZY0 A;  5CBM A;  2VI7 A;  4MFQ A;  3D2P A;  4NSQ A;  5K8M A;  3PP9 A;  2QIR A;  2QVP A;  4I49 A;  3KQZ A;  4MY0 A;  1RTQ A;  1QMU A;  3WC7 A;  4B6Z A;  3E0K A;  2NSM A;  3LOD A;  3OWC A;  2OZU A;  3BI0 A;  3CDX A;  1ON0 A;  3P2F A;  4KOU A;  4OC3 A;  4CS0 B;  1H8L A;  2Q04 A;  3DGV A;  4MHY A;  4ORF A;  4RI1 A;  5HXD A;  4C7H A;  3EY5 A;  4J3G A;  4PPZ A;  1YVK A;  4YU9 A;  2QJ8 A;  5IV0 A;  2VZY A;  3SJF A;  4CAE A;  2EK8 A;  1WK4 A;  4UCP A;  3LWU A;  2OR4 A;  2PCU A;  3PRT A;  3FB3 A;  4B5O A;  2ZW5 A;  5FVJ A;  1F2P A;  4KOV A;  4UF4 A;  4Z65 A;  2D4P A;  5ELY A;  1IOF A;  2REE A;  4F0X A;  4OC5 A;  1PYT B;  4UBR A;  7CPA A;  5LYL A;  4MHP A;  1XE4 A;  2CTB A;  2JBJ A;  3IEH A;  2PJA A;  1Z2L A;  4NF1 A;  2IQ6 A;  3IWG A;  2Q4V A;  3CPX A;  3T90 A;  5G22 A;  1BLL E;  2Q7B A;  4O23 A;  1CX8 A;  3TOA A;  4PSX A;  4RUH A;  1YX0 A;  2I3C A;  4QB9 A;  3IO1 A;  4R7M A;  2IJZ A;  5BWA B;  3IIB A;  4NGM A;  4MFL A;  4JJX A;  5F46 A;  1XOV A;  1TKF A;  4R9M A;  1NE9 A;  1YK3 A;  2O4H A;  2ZPA A;  3DR8 A;  2OU2 A;  3CXS A;  4MCP A;  3SXO A;  1VKC A;  2ZXV A;  3FJU A;  4UCM A;  5G20 A;  1YME A;  2WUU A;  2HC9 A;  2ZEH A;  3R9F A;  2FCK A;  2PJ5 A; 
#chains in the Genus database with same CATH homology
 4U9Y A;  4KVM E;  2DXQ A;  3H4Q A;  4L89 A;  1YLE A;  2OZG A;  3BJ7 A;  4UFV A;  5F48 A;  1P0H A;  4KVX A;  3I9S A;  3EFA A;  3UY5 A;  3W6X A;  3EXN A;  2BEI A;  4YGO A;  1QSN A;  4PK3 A;  4L8A A;  4CGN A;  5G21 A;  5A27 A;  4RS2 A;  3TE4 A;  1Z4R A;  3FRM A;  1CM0 A;  2ZW4 A;  2P0W A;  5HMN A;  3I3G A;  4FD7 A;  3K9U A;  2CNS A;  4XNH B;  2Z3L A;  2VEZ A;  5DWM A;  4FD5 A;  1PU9 A;  4CYP A;  1J4J A;  4JXQ A;  4A31 A;  1IYK A;  1I12 A;  1Y9K A;  2BSW A;  5C82 A;  1S5K A;  1S7N A;  4AG7 A;  3W6S A;  3IGR A;  1L0C A;  2Q4Y A;  2Q0Y A;  2F5I A;  2FXF A;  4CYN A;  2D4O A;  4C68 A;  4AVB A;  4LX9 A;  2Q44 A;  3R96 A;  1R57 A;  2I00 A;  1OZP A;  2AJ6 A;  4YFJ A;  5J8C A;  4MFZ A;  1BO4 A;  1S7F A;  4FD6 A;  1N71 A;  1I21 A;  1KUY A;  2DPS A;  2Z3M A;  1P4N A;  2A4N A;  3TOB A;  3D2M A;  4EVY A;  2VQY A;  5IB0 A;  1BOB A;  2P6F A;  5AG4 A;  4H89 A;  1S7L A;  4CYQ A;  4XPD B;  2GIV A;  1QSR A;  1IB1 E;  2IL4 A;  2R1I A;  3D3S A;  3EC4 A;  2HQY A;  4HNW B;  1GHE A;  4MFK A;  2B4D B;  2FS5 A;  2J8M A;  1FY7 A;  2FIA A;  3JUW A;  1MJA A;  1XEB A;  5I0C A;  1QSM A;  2AE6 A;  2B4D A;  3FIX A;  4PSW A;  4CGM A;  5JPH A;  3SXN A;  3A9L A;  1PUA A;  4MBU A;  2YNE A;  3RYO A;  4KLW A;  4A2Z A;  5E96 A;  4UFX A;  4B12 A;  2R7H A;  2WPW A;  4BMH A;  1Z4E A;  4C7I A;  3F0A A;  2HUZ A;  4MI4 A;  2RC4 A;  1M4I A;  2QML A;  2GE3 A;  5KTA A;  4KSA A;  5H86 A;  4MFP A;  4R87 A;  1QSO A;  2B4B A;  4A30 A;  4JLY A;  4CAX A;  2YNC C;  5J8F A;  1UFH A;  4KVO E;  2BUE A;  3FXT A;  2J8R A;  4PK2 A;  2FT0 A;  2PRB A;  3BLN A;  4AG9 A;  4MJ8 A;  5C88 A;  2OZH A;  2PDO A;  3QB8 A;  4M3S A;  4CAW A;  3G8W A;  1LRZ A;  4NCZ A;  3FYN A;  1S60 A;  1MJ9 A;  4XPD C;  2KCW A;  1KUX A;  4ZBG A;  4QC6 A;  4UCN A;  4GS4 A;  4OLL A;  4R57 A;  4QVT A;  4F6A A;  1M4D A;  3GY9 A;  1S3Z A;  1SQH A;  1Q2D A;  1TIQ A;  4XNH C;  4AVA A;  4DNC A;  2PC1 A;  4KS9 A;  3CXQ A;  3WR7 A;  4UWI A;  2B3V A;  2B58 A;  4R3L A;  1NMT A;  4E0A A;  2B5G B;  4CGL A;  4NEX A;  1Z9U A;  2DPT A;  2Y0M A;  4MHD A;  4AB7 A;  3R1K A;  3DSB A;  3C26 A;  3DDD A;  3R95 A;  2ATR A;  5ISV A;  3FNC A;  4B5P A;  2P6G A;  2BL1 A;  2CXA A;  1ZO0 A;  3F8K A;  3T9Y A;  2WSA A;  2G3A A;  2B5G A;  3TO9 A;  4C2Y A;  4H6U A;  2R8V A;  3H5Z A;  4LUA A;  2Z3N A;  4KOX A;  2FL4 A;  5AG5 A;  5F49 A;  3R9E A;  4C2Z A;  2JEV A;  3TTH A;  2JLM A;  1M1D A;  1I1D A;  5G1Z A;  4HKF A;  4JXR A;  3QAH A;  3IWE A;  4KOW A;  1WWZ A;  2YND A;  4Q38 A;  4Y49 B;  3TO7 A;  1RXT A;  4OAD A;  3JVN A;  4CGO A;  2X7B A;  1KUV A;  4A32 A;  3BJ8 A;  4KLV A;  2I79 A;  1U6M A;  1YRE A;  4JD6 A;  5AGE A;  1S7K A;  1IID A;  1NSL A;  3PGP A;  4AVC A;  4QBJ A;  2ARH A;  1YGH A;  1XF8 A;  2J8N A;  2OH1 A;  2PSW A;  4CRZ B;  2JDD A;  4KUB A;  5AG7 A;  2PR8 A;  2YGW A;  3N7Z A;  1B87 A;  1M44 A;  4IUS A;  4CRY B;  2PR1 A;  3TO6 A;  4X5K A;  4UA3 A;  3DR6 A;  4E2A A;  4CYO A;  3GKR A;  3JTK A;  4UWJ A;  2VZZ A;  5AG6 A;  4R3K A;  4ZGY B;  4B5P B;  1XIX A;  4KZT A;  1M4G A;  4KOT A;  2PQ8 A;  3NE7 A;  4KOR A;  3GYA A;  5IX3 A;  4KOY A;  4Q36 A;  3TFY A;  5EC4 A;  2FE7 A;  1IIC A;  4HNX B;  3TCV A;  5CNP A;  3ZZI A;  2YNC A;  1MJB A;  3KKW A;  4K30 A;  4B14 A;  5HH1 A;  4B10 A;  1MK4 A;  2C27 A;  4XPK A;  3MGD A;  4M85 A;  1Q2C A;  2Z3K A;  4II9 A;  5KTC A;  3SHP A;  2JDC A;  2Z0Z A;  4A95 A;  5JQ4 A;  3W91 A;  5KTD A;  4PV6 A;  4A33 A;  3VWD A;  5EBV A;  3V8I A;  2FIW A;  1VHS A;  4CAF A;  2R98 A;  3ZJ0 A;  2WPX A;  3S6K A;  4KUA A;  4ONU A;  4C2X A;  3G3S A;  3IU1 A;  1XMT A;  3LD2 A;  5DWN A;  3D8P A;  1CJW A;  2CNT A;  4NXY A;  3R9G A;  2VXK A;  2ZW7 A;  2EVN A;  2CY2 A;  1Q2Y A;  2G3T A;  3S6H A;  1K4J A;  4OAE A;  5A28 A;  3VWE A;  4XPL A;  1RO5 A;  2P6E A;  1IYL A;  4QUS A;  2REF A;  1Y9W A;  3CXP A;  2FSR A;  1B6B A;  4JWP A;  2GAN A;  3DNS A;  4MY3 A;  2B3U A;  4Y49 C;  2EUI A;  3IU2 A;  3S6G A;  2Z3O A;  4UFW A;  2O28 A;  3F5B A;  4B11 A;  2ZW6 A;  5H84 A;  5F47 A;  1KZF A;  3B8G A;  2NMT A;  4E8O A;  4MFJ A;  2Z3P A;  4HNY B;  5GCN A;  4U9Z A;  1V0C A;  3TT2 A;  4F0Y A;  2QEC A;  4H6Z A;  4KSF A;  2K5T A;  3FBU A;  2H5M A;  2CNM A;  2Z11 A;  2G0B A;  3S6F A;  4CAV A;  2HV2 A;  3P2H A;  1QST A;  3PZJ A;  1YR0 A;  4B13 A;  4YRH A;  4IF5 A;  4U5Y A;  3EO4 A;  2VBQ A;  2OB0 A;  4CGP A;  1Y7R A;  4FD4 A;  2Z10 A;  4KOS A;  1YVO A;  4BBH A;  2VI7 A;  4MFQ A;  3D2P A;  4NSQ A;  3PP9 A;  2QIR A;  4I49 A;  4MY0 A;  3E0K A;  3P2F A;  3LOD A;  3OWC A;  2OZU A;  1ON0 A;  4KOU A;  4CS0 B;  4ORF A;  2Q04 A;  4RI1 A;  4C7H A;  3EY5 A;  4J3G A;  1YVK A;  5IV0 A;  2VZY A;  4CAE A;  1WK4 A;  4UCP A;  3FB3 A;  4B5O A;  2ZW5 A;  5FVJ A;  4KOV A;  2D4P A;  2REE A;  4F0X A;  4UBR A;  1XE4 A;  4NF1 A;  3IWG A;  2Q4V A;  3T90 A;  5G22 A;  2Q7B A;  3TOA A;  4PSX A;  1YX0 A;  4QB9 A;  5BWA B;  5F46 A;  4MFL A;  4JJX A;  4R9M A;  2ZPA A;  3DR8 A;  1NE9 A;  1YK3 A;  2OU2 A;  3CXS A;  3SXO A;  1VKC A;  2ZXV A;  4UCM A;  5G20 A;  2WUU A;  3R9F A;  2FCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...