1S7NA

Ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
177
structure length
177
Chain Sequence
VEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMYLIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyl transferase
publication title A novel dimeric structure of the RimL Nalpha-acetyltransferase from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 56
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1s7nA00
4HNWB 4OADA 2QIRA 2ZW6A 4X5KA 1NSLA 4K30A 3IGRA 4PK2A 2FSRA 2DXQA 1MK4A 2R98A 4RS2A 3CXQA 4FD6A 1NMTA 3GYAA 3GY9A 3FYNA 3DR6A 4EVYA 4KOSA 2O28A 1IICA 5IV0A 1Y9WA 3BJ8A 4AG9A 2B4BA 2QECA 3EFAA 2GANA 5KTAA 2VI7A 1QSTA 1V0CA 1XE4A 5HH1A 1IYLA 2P6FA 2RC4A 1GHEA 4QBJA 2G0BA 2PC1A 1VKCA 2OU2A 4KOTA 2B4DB 3WR7A 1N71A 3EC4A 4QVTA 3OWCA 4I49A 2C27A 2PRBA 4MY3A 4HKFA 3ZJ0A 2Q4VA 5C88A 1I21A 4U9YA 4B5PB 3MGDA 4NXYA 1PUAA 4B5PA 4F0YA 2Q04A 2ZXVA 2ATRA 3SXOA 4KOUA 1S60A 4M3SA 4IUSA 2J8NA 4PV6A 1KUYA 2Z0ZA 1Q2YA 4XPDC 1B87A 3SHPA 4YFJA 2Q0YA 4ZBGA 5KTDA 1Q2CA 4ORFA 3EY5A 4U5YA 3VWEA 2PR8A 1VHSA 1CJWA 2JDCA 2JLMA 4KUBA 4JLYA 5H86A 3TTHA 3VWDA 4DNCA 4XNHC 3R96A 2Q7BA 1BO4A 5KTCA 4KVXA 1P4NA 4CAWA 5IB0A 3TO9A 1TIQA 3TO7A 1Z9UA 1M1DA 3H4QA 4OAEA 4Y49C 3QAHA 4AVCA 1S7NA 2FL4A 4QUSA 4MHDA 1Y9KA 2Z10A 1MJ9A 4GS4A 4QB9A 4F6AA 2REFA 1CM0A 1Z4EA 4YRHA 3TOBA 2OZUA 1B6BA 3NE7A 3K9UA 1S3ZA 4NEXA 4HNYB 2OH1A 2VEZA 1YX0A 4PSWA 5JQ4A 2BUEA 2OB0A 4XPKA 2PR1A 4IF5A 4HNXB 3F0AA 2FE7A 5E96A 1MJBA 1MJAA 1S7LA 3PGPA 2VQYA 1I12A 5DWMA 4XPLA 3D8PA 4KORA 3FB3A 4KOWA 4U9ZA 4E0AA 2JDDA 2Z11A 3T90A 3G8WA 2AJ6A 2ZW7A 3GKRA 5H84A 4JXQA 4NCZA 4FD4A 5GCNA 1QSNA 1WK4A 1IIDA 1M4IA 2FIWA 2WPXA 3LD2A 5ISVA 2X7BA 2ARHA 4AB7A 2A4NA 2FS5A 2QMLA 2GE3A 1YGHA 2D4OA 1YREA 4MI4A 2HUZA 2JEVA 3UY5A 2GIVA 1KUVA 2ZW4A 3JUWA 2H5MA 1KZFA 4RI1A 4KOYA 3S6FA 4H6UA 3W6XA 2B3UA 2K5TA 4KZTA 1UFHA 1U6MA 4B5OA 2OZHA 4KLWA 3SXNA 4YGOA 2ZPAA 2R7HA 5EC4A 3LODA 5EBVA 1S5KA 4L8AA 4MY0A 1WWZA 3I3GA 5F46A 2REEA 4UA3A 2OZGA 4LX9A 3FBUA 4BMHA 2B5GB 4Y49B 3CXPA 4ONUA 1FY7A 3TT2A 4E2AA 2B5GA 1M4DA 4KVME 2J8MA 3CXSA 5C82A 2CNTA 1YK3A 3E0KA 4E8OA 1ON0A 2VZYA 2FT0A 1XIXA 1S7FA 5F49A 1R57A 1Q2DA 2G3AA 1IYKA 5IX3A 2P0WA 1KUXA 3QB8A 3W91A 2HQYA 2EUIA 4KVOE 4NSQA 4NF1A 2ZW5A 4OLLA 2D4PA 1M4GA 5FVJA 2P6GA 4R9MA 1NE9A 3EXNA 3V8IA 1S7KA 3JVNA 4UBRA 4FD7A 4R3KA 3C26A 4QC6A 1QSRA 5CNPA 5F48A 2CNMA 2Q44A 3EO4A 3D2PA 1I1DA 1RXTA 3PP9A 5J8CA 2BL1A 1YLEA 1Y7RA 2PQ8A 1YR0A 3R1KA 4R3LA 3DNSA 3I9SA 4FD5A 2VBQA 3FRMA 1QSMA 2I79A 3S6HA 2Y0MA 1XF8A 2CY2A 5F47A 2F5IA 1PU9A 2B58A 4JJXA 2BSWA 3S6GA 1LRZA 2PSWA 4KUAA 4LUAA 4MJ8A 1K4JA 3DDDA 3ZZIA 3DSBA 2Q4YA 2FXFA 4KOXA 3TE4A 5I0CA 4J3GA 3P2FA 3D2MA 3N7ZA 4CRYB 4XPDB 1RO5A 4UWJA 3P2HA 1M44A 3D3SA 2I00A 3PZJA 2B4DA 4MBUA 4H89A 3G3SA 1XEBA 5HMNA 1SQHA 4AVBA 2B3VA 4M85A 3S6KA 1Z4RA 2BEIA 4AVAA 2PDOA 1P0HA 4XNHB 2VZZA 1IB1E 4AG7A 1L0CA 3KKWA 3TCVA 5DWNA 2R8VA 3FIXA 2FCKA 3W6SA 1YVKA 4II9A 2AE6A 3FXTA 2VXKA 4PK3A 2G3TA 1XMTA 4PSXA 2J8RA 1J4JA 3IWGA 4JXRA 3F5BA 3TOAA 5JPHA 2CNSA 2P6EA 1BOBA 4CAXA 2IL4A 4L89A 3DR8A 4KOVA 4UWIA 4R87A 3B8GA 2WPWA 3T9YA 2KCWA 3R95A 4JWPA 3BJ7A 1OZPA 2EVNA 2R1IA 4CAVA 3R9FA 3BLNA 2HV2A 5J8FA 3TFYA 4CS0B 3F8KA 4KLVA 2FIAA 3R9GA 3R9EA 4JD6A 3FNCA 1YVOA 4R57A 3RYOA 3TO6A 2NMTA 1QSOA 4H6ZA 4CRZB
chains in the Genus database with same CATH superfamily
4HNWB 5JH9A 1F2PA 4OADA 4DYOA 2QIRA 1HDUA 2ZW6A 4X5KA 1QQ9A 4C2ZA 1NSLA 2ZOFA 4K30A 3RBUA 3IGRA 3SJXA 2EO8A 4PK2A 1Z8TA 2FSRA 1DE4C 2DXQA 1BAVA 1TF9A 7CPAA 1MK4A 1ARMA 1UWYA 2R98A 1GYTA 2BOAA 3CT9A 4RS2A 3CXQA 2I3CA 2V8GA 4FD6A 4A30A 1NMTA 3GYAA 2CTCA 3JRUA 4P6YA 3GY9A 4WWVA 5AGEA 5K8PA 1CPSA 3D68A 2Q4ZA 1Z5RA 3FYNA 5LRKA 2PJBA 3DR6A 3PB9X 4KOSA 4NJQA 4C7IA 4EVYA 2O28A 3B3WA 3IU2A 1IICA 1VHEA 2V77A 5IV0A 4G1PA 3VH9A 1Y9WA 3BJ8A 3SJGA 4AG9A 1F57A 2B4BA 1VGYA 2QECA 2PJ8A 3EFAA 3KZWA 1ZO0A 4B14A 2GANA 5KTAA 2VI7A 3CPXA 1QSTA 4ZY0A 1YLOA 1V0CA 1XE4A 5AG7A 5HH1A 1IYLA 2P6FA 1EE3P 2RC4A 1GHEA 4P4BA 4CYOA 4QBJA 2BO9A 2G0BA 2PC1A 3KASA 1YW4A 1DTDA 4B10A 2AFZA 1VKCA 1XJOA 2OU2A 4OIDA 4KOTA 3JTKA 1ZLHA 2PVWA 4UCNA 5LYFA 1CG2A 4MFPA 2B4DB 3WR7A 1N71A 2IJZA 3FECA 4A33A 1YMEA 4MHNA 3SI2A 3EC4A 3QAYA 1FNOA 4UFWA 4QVTA 5CPAA 3OWCA 4I49A 2C27A 2PRBA 4MY3A 4MHYA 4HKFA 3ZJ0A 4FUUA 2Q4VA 5C88A 1I21A 2QJ8A 3PB8X 2ODFA 1XRYA 4U9YA 4B5PB 3MGDA 4NXYA 1Y0RA 3PFEA 1PUAA 2Z3PA 3BI1A 4B5PA 3DLJA 3NH8A 4F0YA 2Q04A 3V7ZA 2ZXVA 2ATRA 3SXOA 4KOUA 5JM6A 1S60A 2HC9A 4IUSA 2CTBA 4M3SA 4CYPA 2J8NA 1QMUA 4PV6A 1KUYA 1LAMA 1PCAA 2RB7A 2Z0ZA 4CGOA 4P4JA 1Q2YA 4XPDC 1B87A 3SHPA 4YFJA 2Q0YA 1JQGA 2PJAA 3K9TA 4ZBGA 5KTDA 2PJ4A 1Q2CA 2AFMA 4ORFA 3A9LA 1Z2LA 3IU1A 4X2TA 3SI0A 2XEJA 3EY5A 4U5YA 4RN7A 3VWEA 4UEFA 2PR8A 3I1UA 4CYNA 2V8DA 1VHSA 1CJWA 4MFLA 4NGSA 4NGTA 2JDCA 1CP7A 3H8FA 2JLMA 4KUBA 3CDXA 4JLYA 5H86A 3TTHA 2DPTA 3VWDA 4Q38A 4XNHC 4DNCA 4GM5A 3FVLA 4A38A 3R96A 4MHPA 3H5ZA 5G1ZA 2GU2A 1BO4A 5AG5A 2Q7BA 2GREA 5KTCA 4KVXA 1P4NA 3VATA 4NGNA 4IAVA 1LAPA 4CAWA 1ZG9A 5IB0A 1ARLA 3TO9A 1TIQA 4B6ZA 3TO7A 2YNDA 1Z9UA 1M1DA 1TKFA 3H4QA 4OAEA 3QAHA 4OC0A 4Y49C 1S7NA 4AVCA 1TKJA 4P4IA 2PCUA 3ISZA 2FL4A 4B13A 4C2YA 4QUSA 3D7HA 3RAMA 4MHDA 1Y9KA 2Z10A 3H8GA 1MJ9A 3D4UA 4DUKA 2CF4A 4GS4A 2OR4A 4QB9A 3KI9A 4Z65A 4F6AA 2REFA 3CPAA 4P4DA 3T8WA 1CM0A 2O4HA 1Z4EA 4BBHA 4M6HA 3FMCA 4A39A 4ZGYB 2BCOA 2JEWA 4YRHA 4ZX8A 3TOBA 2OZUA 2ABZA 2PJ2A 1LFWA 2FVGA 1B6BA 4P4FA 3NE7A 4M6IA 2DF5A 3K9UA 4MCQA 1S3ZA 4NEXA 4EWTA 2OH1A 2VEZA 4HNYB 1YX0A 4MCRA 4PSWA 2BUEA 5JQ4A 3D7FA 5LYLA 2OB0A 3KHZA 4XPKA 2PR1A 4IF5A 4HNXB 1YW6A 3F0AA 2FE7A 5E96A 2AFOA 1MJBA 1MJAA 1Z8LA 4PQAA 1S7LA 3PGPA 4PPZA 5I4MA 2VQYA 3B3TA 3V38A 1I12A 3FJUA 5DWMA 4XPLA 1IOIA 3D8PA 4KORA 3FB3A 2ZEFA 3GLJA 3KQXA 4KOWA 4R8FA 4U9ZA 3SI1A 4BINA 5K8OA 3S9MA 4E0AA 2JDDA 5IB9A 3NFZA 2Z11A 4CPAA 3FEDA 1CP6A 3T90A 3FEEA 3G8WA 2AJ6A 2EK9A 4ZY2A 2ZW7A 3GKRA 1H8LA 4PXDA 5H84A 4JXQA 4NGRA 4FAIA 1TF8A 2Z3MA 4FD4A 4NCZA 5D29A 3B3SA 4EMEA 2PIYA 2PJ6A 5GCNA 4OC2A 3D66A 4HPSA 1QSNA 1WK4A 1IIDA 1M4IA 2F8HA 2FIWA 2PJ0A 2CXAA 2WPXA 4UEZA 4C68A 4UFXA 3B2YA 2ZEMA 3LD2A 1TKHA 4C7HA 5ISVA 2X7BA 2C6GA 3B3VA 5HVFA 2PJCA 4ZI6A 2ARHA 3IFEA 4AB7A 4OP4A 2IMOA 5HXDA 1BLLE 2A4NA 2FS5A 4TWEA 2QMLA 2GE3A 1YGHA 2D4OA 1YREA 3H8EA 4MI4A 2HUZA 5HVHA 3QNVA 2DEAA 1Z8XA 2JEVA 3UY5A 2GIVA 3LMSA 2PVVA 2WYRA 2V8VA 1KUVA 4NJRA 5LRGA 4O23A 2EWBA 4MMOA 2QVPA 2ZW4A 3JUWA 2H5MA 1KZFA 1XOVA 4KOYA 4RI1A 4H6UA 3S6FA 3W6XA 2Z3KA 5LYIA 4FWUA 4TNUA 2B3UA 1HDQA 2K5TA 4KZTA 2ZEEA 1PYTB 4P4EA 2Q51A 1UFHA 4MCPA 4WJBA 3PEIA 1U6MA 4OC1A 2J9AA 4B5OA 2OZHA 4H2KA 4GXHA 4DJLA 4ZY1A 1M4LA 1HEEA 4KLWA 3SXNA 4PXCA 2O53A 3D67A 2GLFA 3ISXA 4YGOA 2JBKA 2ZPAA 2R7HA 4R76A 5EC4A 4YWYA 2AFXA 4F9VA 3LODA 5EBVA 2XEGA 5DS0A 1S5KA 4L8AA 3GUXA 1WWZA 3FH4A 3I3GA 4MY0A 1IU8A 5ELYA 4UFVA 5F46A 2ZENA 2REEA 4CYQA 4UA3A 2OZGA 4LX9A 4UIAA 3FBUA 3K2KA 4A31A 4BMHA 2EK8A 2B5GB 3KGQA 3NH4A 4Y49B 3CXPA 4ONUA 1FY7A 3TT2A 4NGMA 2B5GA 1M4DA 3TX8A 4A95A 4E2AA 5J1QA 2C6PA 4KVME 5G21A 3L2NA 1ELMP 4ONWA 2J8MA 3GB0A 3CXSA 5C82A 2CNTA 4OIWA 1YK3A 3E0KA 4PXEA 2PE3A 3PB6X 4E8OA 1ON0A 2VZYA 4F8ZA 2FT0A 1LCPA 1XIXA 1S7FA 5F49A 1R57A 4MHZA 4NGPA 1LOKA 3FF3A 1Q2DA 2G3AA 4B12A 1IYKA 2YNCA 3IWEA 4P45A 4CAEA 1ZG7A 4W9YA 4MFJA 5AG4A 1Y7EA 5IX3A 2PJ9A 4A94A 4FBEA 2P0WA 4CGNA 2YNEA 1KUXA 3QB8A 3W91A 1R43A 2HQYA 2EUIA 4A37A 4KVOE 4NSQA 2C1CA 4NF1A 4Q7AA 2ZELA 1YSJA 4MRIA 4UEEA 2ZW5A 4OLLA 2D4PA 1M4GA 5FVJA 2P6GA 4R9MA 1NE9A 3EXNA 2WZNA 3V8IA 1S7KA 2XEIA 3S9NA 3JVNA 4UBRA 4FD7A 4R3KA 3C26A 4X8IA 4QC6A 1NSAA 3BHXA 4P10A 4PXBA 1QSRA 2CIJA 2QYVA 3PBEA 5CNPA 5A27A 3VARA 1VIXA 3MN8A 4P44A 2CNMA 1AMPA 4UCPA 5F48A 4OMEA 2Q44A 4Q36A 2F7VA 2WSAA 3PFOA 4CGPA 3EO4A 4IK2A 3D2PA 1I1DA 2C6CA 1RXTA 3PP9A 5J8CA 2BL1A 1YLEA 4LQGA 1Y7RA 2PQ8A 1YR0A 3R1KA 3LWUA 3DNSA 4OC4A 4R3LA 3NE8A 3SJEA 2OOTA 3I9SA 1IY7A 4FD5A 3B3CA 1A2ZA 2VBQA 3FRMA 1QSMA 3IWWA 2Z3LA 2EBJA 3N5FA 2I79A 3S6HA 4AXVA 1JWQA 1OBRA 2Q7SA 2Y0MA 1XF8A 2CY2A 1ZG8A 2G9DA 5F47A 4UIBA 4A32A 2F5IA 4K3NA 1PU9A 2B58A 5G20A 4JJXA 1LANA 4A2ZA 2AFSA 3GIUA 3PBBA 2YGWA 1RTQA 1XMBA 3IEHA 1F2OA 2BSWA 2PIZA 2ANPA 5THWA 4MFZA 3S6GA 4JZ0A 1LRZA 2PSWA 4KUAA 4LUAA 4MJ8A 1K4JA 3DDDA 3BI0A 3ZZIA 3DSBA 2Q4YA 2FXFA 3D7DA 4R6TA 5LYDA 3RZAA 4KOXA 4CGLA 5BWAB 5I0CA 4J3GA 3KQZA 3TE4A 3P2FA 3LACA 3D2MA 3DGVA 3N7ZA 2Q43A 4CRYB 4XPDB 3KR5A 4KSAA 1IOFA 1RO5A 4UWJA 2WUUA 3P2HA 2AFUA 4MCSA 2ZOGA 8CPAA 1M44A 3NA6A 3RNZA 5AG6A 4F0XA 3D3SA 3NH5A 2I00A 3PZJA 4F9UA 2B4DA 2PJ3A 4MBUA 4CGMA 4H89A 1ZLIA 3G3SA 3FX6A 4YU9A 5CBMA 1AYEA 1XEBA 5HMNA 1SQHA 4AVBA 3IJ3A 4MXUA 2B3VA 1CBXA 4M85A 3S6KA 1Z4RA 2BEIA 4AVAA 4NFRA 2GFQA 5EMIA 4BD9A 4MFQA 3IIBA 4KSFA 2PDOA 3S9LA 1P0HA 2PJ5A 2ZEOA 4XNHB 2VZZA 3KL9A 4UF4A 1IB1E 3HUVA 4AG7A 3PB4X 5A28A 1L0CA 4EFDA 4CAFA 5D8NA 3HLPA 4UCMA 1Y0YA 3KKWA 1IGBA 3TCVA 5DWNA 2R8VA 3FIXA 3WT4A 3BXMA 2FCKA 4OKOA 1YQEA 4LQ6A 3W6SA 4NGQA 3RO0A 1CX8A 3B35A 2NSMA 2ZEPA 2ZEHA 1YVKA 1CPXA 4II9A 2AE6A 4KS9A 2JBJA 6CPAA 3FXTA 2VXKA 4PK3A 2G3TA 1XMTA 4X3RA 2POKA 4PSXA 2J8RA 1J4JA 2Z3OA 3WC5A 3IWGA 5F09A 1VHOA 5K8NA 1AUGA 4JXRA 5LRJA 1R3NA 1Z8WA 2NYQA 2ZEGA 1XBUA 4C2XA 1FT7A 2GLJA 3F5BA 2PJ1A 3TOAA 3KHXA 4M6GA 3WABA 5JPHA 2CNSA 2P6EA 1BOBA 3PB7X 4CAXA 4ZYQA 2IL4A 4L89A 3DR8A 3SJFA 3KR4A 1BPNA 2RFHA 4KOVA 4UWIA 4OC3A 2HB6A 4B11A 4KSIA 4R87A 3B8GA 3CZXA 5HVGA 1KWMA 2XEFA 2WPWA 3IO1A 3T9YA 1XFOA 2KCWA 2AFWA 3D7GA 1Q7LA 3R95A 2Z3NA 3B7IA 4JWPA 1X12A 4RUHA 3BJ7A 1OZPA 4R7MA 2EVNA 4JYWA 3PRTA 2R1IA 2VL1A 2ZEDA 3IC1A 1TXRA 4ZX9A 3MRUA 3WC7A 4CAVA 3TC8A 2IQ6A 2PJ7A 4OC5A 3R9FA 3BLNA 2HV2A 5J8FA 5G22A 3TFYA 4IHMA 4CS0B 3F8KA 4KLVA 3WC6A 2FIAA 3R9GA 3R9EA 4JD6A 2V8HA 3FNCA 4MFKA 5K8MA 2DPSA 2PRQA 1YVOA 4R57A 3RYOA 1BPMA 1X10A 2NMTA 1QSOA 4H6ZA 3TO6A 2YNCC 4CRZB 5JGFA 1ELLP
chains in the Genus database with same CATH topology
4HNWB 4OADA 2QIRA 2ZW6A 4X5KA 4C2ZA 1NSLA 4K30A 3IGRA 4PK2A 2FSRA 2DXQA 1MK4A 2R98A 4RS2A 3CXQA 4FD6A 4A30A 1NMTA 3GYAA 3GY9A 5AGEA 3FYNA 3DR6A 4C7IA 4KOSA 4EVYA 2O28A 3IU2A 1IICA 5IV0A 1Y9WA 3BJ8A 4AG9A 2B4BA 2QECA 3EFAA 4B14A 1ZO0A 2GANA 5KTAA 2VI7A 1QSTA 1V0CA 1XE4A 5AG7A 5HH1A 1IYLA 2P6FA 2RC4A 1GHEA 4QBJA 4CYOA 2G0BA 2PC1A 4B10A 1VKCA 2OU2A 4KOTA 3JTKA 4UCNA 4MFPA 2B4DB 3WR7A 1N71A 4A33A 3EC4A 4UFWA 4QVTA 3OWCA 4I49A 2C27A 2PRBA 4MY3A 4HKFA 3ZJ0A 2Q4VA 5C88A 1I21A 4U9YA 4B5PB 3MGDA 4NXYA 1PUAA 2Z3PA 4B5PA 4F0YA 2Q04A 2ZXVA 2ATRA 3SXOA 4KOUA 1S60A 4CYPA 4IUSA 4M3SA 2J8NA 4PV6A 1KUYA 2Z0ZA 4CGOA 1Q2YA 4XPDC 1B87A 3SHPA 4YFJA 2Q0YA 4ZBGA 5KTDA 1Q2CA 4ORFA 3A9LA 3IU1A 3EY5A 4U5YA 3VWEA 2PR8A 4CYNA 1VHSA 1CJWA 4MFLA 2JDCA 2JLMA 4KUBA 4JLYA 5H86A 3TTHA 2DPTA 3VWDA 4Q38A 4XNHC 4DNCA 3R96A 3H5ZA 5G1ZA 5AG5A 1BO4A 2Q7BA 5KTCA 4KVXA 1P4NA 4CAWA 5IB0A 3TO9A 1TIQA 3TO7A 2YNDA 1Z9UA 1M1DA 3H4QA 4OAEA 4Y49C 3QAHA 4AVCA 1S7NA 2FL4A 4B13A 4C2YA 4QUSA 4MHDA 1Y9KA 2Z10A 1MJ9A 4GS4A 4QB9A 4F6AA 2REFA 1CM0A 1Z4EA 4BBHA 4ZGYB 4YRHA 3TOBA 2OZUA 1B6BA 3NE7A 3K9UA 1S3ZA 4NEXA 4HNYB 2OH1A 2VEZA 1YX0A 4PSWA 5JQ4A 2BUEA 2OB0A 4XPKA 2PR1A 4IF5A 4HNXB 3F0AA 2FE7A 5E96A 1MJBA 1MJAA 1S7LA 3PGPA 2VQYA 1I12A 5DWMA 4XPLA 3D8PA 4KORA 3FB3A 4KOWA 4U9ZA 4E0AA 2JDDA 2Z11A 3T90A 3G8WA 2AJ6A 2ZW7A 3GKRA 5H84A 4JXQA 2Z3MA 4FD4A 4NCZA 5GCNA 1QSNA 1WK4A 1IIDA 1M4IA 2FIWA 2WPXA 4C68A 2CXAA 4UFXA 4C7HA 3LD2A 5ISVA 2X7BA 2ARHA 4AB7A 2A4NA 2FS5A 2QMLA 2GE3A 1YGHA 2D4OA 1YREA 4MI4A 2HUZA 2JEVA 3UY5A 2GIVA 1KUVA 2ZW4A 3JUWA 2H5MA 1KZFA 4RI1A 4KOYA 3S6FA 4H6UA 3W6XA 2Z3KA 2B3UA 2K5TA 4KZTA 1UFHA 1U6MA 4B5OA 2OZHA 4KLWA 3SXNA 4YGOA 2ZPAA 2R7HA 5EC4A 3LODA 5EBVA 1S5KA 4L8AA 4MY0A 1WWZA 3I3GA 4UFVA 5F46A 2REEA 4CYQA 4UA3A 2OZGA 4LX9A 3FBUA 4A31A 4BMHA 2B5GB 4Y49B 3CXPA 4ONUA 1FY7A 3TT2A 4E2AA 2B5GA 1M4DA 4A95A 4KVME 5G21A 2J8MA 3CXSA 5C82A 2CNTA 1YK3A 3E0KA 4E8OA 1ON0A 2VZYA 2FT0A 1XIXA 1S7FA 5F49A 1R57A 1Q2DA 2G3AA 4B12A 1IYKA 2YNCA 3IWEA 4CAEA 4MFJA 5AG4A 5IX3A 2P0WA 4CGNA 2YNEA 1KUXA 3QB8A 3W91A 2HQYA 2EUIA 4KVOE 4NSQA 4NF1A 2ZW5A 4OLLA 2D4PA 1M4GA 5FVJA 2P6GA 4R9MA 1NE9A 3EXNA 3V8IA 1S7KA 3JVNA 4UBRA 4FD7A 4R3KA 3C26A 4QC6A 1QSRA 5CNPA 5A27A 5F48A 2CNMA 4UCPA 2Q44A 4Q36A 2WSAA 4CGPA 3EO4A 3D2PA 1I1DA 1RXTA 3PP9A 5J8CA 2BL1A 1YLEA 1Y7RA 2PQ8A 1YR0A 3R1KA 4R3LA 3DNSA 3I9SA 4FD5A 2VBQA 3FRMA 1QSMA 2Z3LA 2I79A 3S6HA 2Y0MA 1XF8A 2CY2A 5F47A 4A32A 2F5IA 1PU9A 2B58A 5G20A 4JJXA 4A2ZA 2YGWA 2BSWA 4MFZA 3S6GA 1LRZA 2PSWA 4KUAA 4LUAA 4MJ8A 1K4JA 3DDDA 3ZZIA 3DSBA 2Q4YA 2FXFA 4CGLA 4KOXA 5BWAB 3TE4A 5I0CA 4J3GA 3P2FA 3D2MA 3N7ZA 4CRYB 4XPDB 4KSAA 1RO5A 4UWJA 2WUUA 3P2HA 1M44A 5AG6A 4F0XA 3D3SA 2I00A 3PZJA 2B4DA 4MBUA 4CGMA 4H89A 3G3SA 1XEBA 5HMNA 1SQHA 4AVBA 2B3VA 4M85A 3S6KA 1Z4RA 2BEIA 4AVAA 4MFQA 4KSFA 2PDOA 1P0HA 4XNHB 2VZZA 1IB1E 4AG7A 5A28A 1L0CA 4CAFA 4UCMA 3KKWA 3TCVA 5DWNA 2R8VA 3FIXA 2FCKA 3W6SA 1YVKA 4II9A 2AE6A 4KS9A 3FXTA 2VXKA 4PK3A 2G3TA 1XMTA 4PSXA 2J8RA 1J4JA 2Z3OA 3IWGA 4JXRA 4C2XA 3F5BA 3TOAA 5JPHA 2CNSA 2P6EA 1BOBA 4CAXA 2IL4A 4L89A 3DR8A 4KOVA 4UWIA 4B11A 4R87A 3B8GA 2WPWA 3T9YA 2KCWA 3R95A 2Z3NA 4JWPA 3BJ7A 1OZPA 2EVNA 2R1IA 4CAVA 3R9FA 3BLNA 2HV2A 5J8FA 5G22A 3TFYA 4CS0B 3F8KA 4KLVA 2FIAA 3R9GA 3R9EA 4JD6A 3FNCA 4MFKA 2DPSA 1YVOA 4R57A 3RYOA 3TO6A 2NMTA 1QSOA 4H6ZA 4CRZB 2YNCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNW B;  4OAD A;  2QIR A;  2ZW6 A;  4X5K A;  1NSL A;  4K30 A;  3IGR A;  4PK2 A;  2FSR A;  2DXQ A;  1MK4 A;  2R98 A;  4RS2 A;  3CXQ A;  4FD6 A;  1NMT A;  3GYA A;  3GY9 A;  3FYN A;  3DR6 A;  4EVY A;  4KOS A;  2O28 A;  1IIC A;  5IV0 A;  1Y9W A;  3BJ8 A;  4AG9 A;  2B4B A;  2QEC A;  3EFA A;  2GAN A;  5KTA A;  2VI7 A;  1QST A;  1V0C A;  1XE4 A;  5HH1 A;  1IYL A;  2P6F A;  2RC4 A;  1GHE A;  4QBJ A;  2G0B A;  2PC1 A;  1VKC A;  2OU2 A;  4KOT A;  2B4D B;  3WR7 A;  1N71 A;  3EC4 A;  4QVT A;  3OWC A;  4I49 A;  2C27 A;  2PRB A;  4MY3 A;  4HKF A;  3ZJ0 A;  2Q4V A;  5C88 A;  1I21 A;  4U9Y A;  4B5P B;  3MGD A;  4NXY A;  1PUA A;  4B5P A;  4F0Y A;  2Q04 A;  2ZXV A;  2ATR A;  3SXO A;  4KOU A;  1S60 A;  4M3S A;  4IUS A;  2J8N A;  4PV6 A;  1KUY A;  2Z0Z A;  1Q2Y A;  4XPD C;  1B87 A;  3SHP A;  4YFJ A;  2Q0Y A;  4ZBG A;  5KTD A;  1Q2C A;  4ORF A;  3EY5 A;  4U5Y A;  3VWE A;  2PR8 A;  1VHS A;  1CJW A;  2JDC A;  2JLM A;  4KUB A;  4JLY A;  5H86 A;  3TTH A;  3VWD A;  4DNC A;  4XNH C;  3R96 A;  2Q7B A;  1BO4 A;  5KTC A;  4KVX A;  1P4N A;  4CAW A;  5IB0 A;  3TO9 A;  1TIQ A;  3TO7 A;  1Z9U A;  1M1D A;  3H4Q A;  4OAE A;  4Y49 C;  3QAH A;  4AVC A;  1S7N A;  2FL4 A;  4QUS A;  4MHD A;  1Y9K A;  2Z10 A;  1MJ9 A;  4GS4 A;  4QB9 A;  4F6A A;  2REF A;  1CM0 A;  1Z4E A;  4YRH A;  3TOB A;  2OZU A;  1B6B A;  3NE7 A;  3K9U A;  1S3Z A;  4NEX A;  4HNY B;  2OH1 A;  2VEZ A;  1YX0 A;  4PSW A;  5JQ4 A;  2BUE A;  2OB0 A;  4XPK A;  2PR1 A;  4IF5 A;  4HNX B;  3F0A A;  2FE7 A;  5E96 A;  1MJB A;  1MJA A;  1S7L A;  3PGP A;  2VQY A;  1I12 A;  5DWM A;  4XPL A;  3D8P A;  4KOR A;  3FB3 A;  4KOW A;  4U9Z A;  4E0A A;  2JDD A;  2Z11 A;  3T90 A;  3G8W A;  2AJ6 A;  2ZW7 A;  3GKR A;  5H84 A;  4JXQ A;  4NCZ A;  4FD4 A;  5GCN A;  1QSN A;  1WK4 A;  1IID A;  1M4I A;  2FIW A;  2WPX A;  3LD2 A;  5ISV A;  2X7B A;  2ARH A;  4AB7 A;  2A4N A;  2FS5 A;  2QML A;  2GE3 A;  1YGH A;  2D4O A;  1YRE A;  4MI4 A;  2HUZ A;  2JEV A;  3UY5 A;  2GIV A;  1KUV A;  2ZW4 A;  3JUW A;  2H5M A;  1KZF A;  4RI1 A;  4KOY A;  3S6F A;  4H6U A;  3W6X A;  2B3U A;  2K5T A;  4KZT A;  1UFH A;  1U6M A;  4B5O A;  2OZH A;  4KLW A;  3SXN A;  4YGO A;  2ZPA A;  2R7H A;  5EC4 A;  3LOD A;  5EBV A;  1S5K A;  4L8A A;  4MY0 A;  1WWZ A;  3I3G A;  5F46 A;  2REE A;  4UA3 A;  2OZG A;  4LX9 A;  3FBU A;  4BMH A;  2B5G B;  4Y49 B;  3CXP A;  4ONU A;  1FY7 A;  3TT2 A;  4E2A A;  2B5G A;  1M4D A;  4KVM E;  2J8M A;  3CXS A;  5C82 A;  2CNT A;  1YK3 A;  3E0K A;  4E8O A;  1ON0 A;  2VZY A;  2FT0 A;  1XIX A;  1S7F A;  5F49 A;  1R57 A;  1Q2D A;  2G3A A;  1IYK A;  5IX3 A;  2P0W A;  1KUX A;  3QB8 A;  3W91 A;  2HQY A;  2EUI A;  4KVO E;  4NSQ A;  4NF1 A;  2ZW5 A;  4OLL A;  2D4P A;  1M4G A;  5FVJ A;  2P6G A;  4R9M A;  1NE9 A;  3EXN A;  3V8I A;  1S7K A;  3JVN A;  4UBR A;  4FD7 A;  4R3K A;  3C26 A;  4QC6 A;  1QSR A;  5CNP A;  5F48 A;  2CNM A;  2Q44 A;  3EO4 A;  3D2P A;  1I1D A;  1RXT A;  3PP9 A;  5J8C A;  2BL1 A;  1YLE A;  1Y7R A;  2PQ8 A;  1YR0 A;  3R1K A;  4R3L A;  3DNS A;  3I9S A;  4FD5 A;  2VBQ A;  3FRM A;  1QSM A;  2I79 A;  3S6H A;  2Y0M A;  1XF8 A;  2CY2 A;  5F47 A;  2F5I A;  1PU9 A;  2B58 A;  4JJX A;  2BSW A;  3S6G A;  1LRZ A;  2PSW A;  4KUA A;  4LUA A;  4MJ8 A;  1K4J A;  3DDD A;  3ZZI A;  3DSB A;  2Q4Y A;  2FXF A;  4KOX A;  3TE4 A;  5I0C A;  4J3G A;  3P2F A;  3D2M A;  3N7Z A;  4CRY B;  4XPD B;  1RO5 A;  4UWJ A;  3P2H A;  1M44 A;  3D3S A;  2I00 A;  3PZJ A;  2B4D A;  4MBU A;  4H89 A;  3G3S A;  1XEB A;  5HMN A;  1SQH A;  4AVB A;  2B3V A;  4M85 A;  3S6K A;  1Z4R A;  2BEI A;  4AVA A;  2PDO A;  1P0H A;  4XNH B;  2VZZ A;  1IB1 E;  4AG7 A;  1L0C A;  3KKW A;  3TCV A;  5DWN A;  2R8V A;  3FIX A;  2FCK A;  3W6S A;  1YVK A;  4II9 A;  2AE6 A;  3FXT A;  2VXK A;  4PK3 A;  2G3T A;  1XMT A;  4PSX A;  2J8R A;  1J4J A;  3IWG A;  4JXR A;  3F5B A;  3TOA A;  5JPH A;  2CNS A;  2P6E A;  1BOB A;  4CAX A;  2IL4 A;  4L89 A;  3DR8 A;  4KOV A;  4UWI A;  4R87 A;  3B8G A;  2WPW A;  3T9Y A;  2KCW A;  3R95 A;  4JWP A;  3BJ7 A;  1OZP A;  2EVN A;  2R1I A;  4CAV A;  3R9F A;  3BLN A;  2HV2 A;  5J8F A;  3TFY A;  4CS0 B;  3F8K A;  4KLV A;  2FIA A;  3R9G A;  3R9E A;  4JD6 A;  3FNC A;  1YVO A;  4R57 A;  3RYO A;  3TO6 A;  2NMT A;  1QSO A;  4H6Z A;  4CRZ B; 
#chains in the Genus database with same CATH topology
 4HNW B;  5JH9 A;  1F2P A;  4OAD A;  4DYO A;  2QIR A;  1HDU A;  2ZW6 A;  4X5K A;  1QQ9 A;  4C2Z A;  1NSL A;  2ZOF A;  4K30 A;  3RBU A;  3IGR A;  3SJX A;  2EO8 A;  4PK2 A;  1Z8T A;  2FSR A;  1DE4 C;  2DXQ A;  1BAV A;  1TF9 A;  7CPA A;  1MK4 A;  1ARM A;  1UWY A;  2R98 A;  1GYT A;  2BOA A;  3CT9 A;  4RS2 A;  3CXQ A;  2I3C A;  2V8G A;  4FD6 A;  4A30 A;  1NMT A;  3GYA A;  2CTC A;  3JRU A;  4P6Y A;  3GY9 A;  4WWV A;  5AGE A;  5K8P A;  1CPS A;  3D68 A;  2Q4Z A;  1Z5R A;  3FYN A;  5LRK A;  2PJB A;  3DR6 A;  3PB9 X;  4KOS A;  4NJQ A;  4C7I A;  4EVY A;  2O28 A;  3B3W A;  3IU2 A;  1IIC A;  1VHE A;  2V77 A;  5IV0 A;  4G1P A;  3VH9 A;  1Y9W A;  3BJ8 A;  3SJG A;  4AG9 A;  1F57 A;  2B4B A;  1VGY A;  2QEC A;  2PJ8 A;  3EFA A;  3KZW A;  1ZO0 A;  4B14 A;  2GAN A;  5KTA A;  2VI7 A;  3CPX A;  1QST A;  4ZY0 A;  1YLO A;  1V0C A;  1XE4 A;  5AG7 A;  5HH1 A;  1IYL A;  2P6F A;  1EE3 P;  2RC4 A;  1GHE A;  4P4B A;  4CYO A;  4QBJ A;  2BO9 A;  2G0B A;  2PC1 A;  3KAS A;  1YW4 A;  1DTD A;  4B10 A;  2AFZ A;  1VKC A;  1XJO A;  2OU2 A;  4OID A;  4KOT A;  3JTK A;  1ZLH A;  2PVW A;  4UCN A;  5LYF A;  1CG2 A;  4MFP A;  2B4D B;  3WR7 A;  1N71 A;  2IJZ A;  3FEC A;  4A33 A;  1YME A;  4MHN A;  3SI2 A;  3EC4 A;  3QAY A;  1FNO A;  4UFW A;  4QVT A;  5CPA A;  3OWC A;  4I49 A;  2C27 A;  2PRB A;  4MY3 A;  4MHY A;  4HKF A;  3ZJ0 A;  4FUU A;  2Q4V A;  5C88 A;  1I21 A;  2QJ8 A;  3PB8 X;  2ODF A;  1XRY A;  4U9Y A;  4B5P B;  3MGD A;  4NXY A;  1Y0R A;  3PFE A;  1PUA A;  2Z3P A;  3BI1 A;  4B5P A;  3DLJ A;  3NH8 A;  4F0Y A;  2Q04 A;  3V7Z A;  2ZXV A;  2ATR A;  3SXO A;  4KOU A;  5JM6 A;  1S60 A;  2HC9 A;  4IUS A;  2CTB A;  4M3S A;  4CYP A;  2J8N A;  1QMU A;  4PV6 A;  1KUY A;  1LAM A;  1PCA A;  2RB7 A;  2Z0Z A;  4CGO A;  4P4J A;  1Q2Y A;  4XPD C;  1B87 A;  3SHP A;  4YFJ A;  2Q0Y A;  1JQG A;  2PJA A;  3K9T A;  4ZBG A;  5KTD A;  2PJ4 A;  1Q2C A;  2AFM A;  4ORF A;  3A9L A;  1Z2L A;  3IU1 A;  4X2T A;  3SI0 A;  2XEJ A;  3EY5 A;  4U5Y A;  4RN7 A;  3VWE A;  4UEF A;  2PR8 A;  3I1U A;  4CYN A;  2V8D A;  1VHS A;  1CJW A;  4MFL A;  4NGS A;  4NGT A;  2JDC A;  1CP7 A;  3H8F A;  2JLM A;  4KUB A;  3CDX A;  4JLY A;  5H86 A;  3TTH A;  2DPT A;  3VWD A;  4Q38 A;  4XNH C;  4DNC A;  4GM5 A;  3FVL A;  4A38 A;  3R96 A;  4MHP A;  3H5Z A;  5G1Z A;  2GU2 A;  1BO4 A;  5AG5 A;  2Q7B A;  2GRE A;  5KTC A;  4KVX A;  1P4N A;  3VAT A;  4NGN A;  4IAV A;  1LAP A;  4CAW A;  1ZG9 A;  5IB0 A;  1ARL A;  3TO9 A;  1TIQ A;  4B6Z A;  3TO7 A;  2YND A;  1Z9U A;  1M1D A;  1TKF A;  3H4Q A;  4OAE A;  3QAH A;  4OC0 A;  4Y49 C;  1S7N A;  4AVC A;  1TKJ A;  4P4I A;  2PCU A;  3ISZ A;  2FL4 A;  4B13 A;  4C2Y A;  4QUS A;  3D7H A;  3RAM A;  4MHD A;  1Y9K A;  2Z10 A;  3H8G A;  1MJ9 A;  3D4U A;  4DUK A;  2CF4 A;  4GS4 A;  2OR4 A;  4QB9 A;  3KI9 A;  4Z65 A;  4F6A A;  2REF A;  3CPA A;  4P4D A;  3T8W A;  1CM0 A;  2O4H A;  1Z4E A;  4BBH A;  4M6H A;  3FMC A;  4A39 A;  4ZGY B;  2BCO A;  2JEW A;  4YRH A;  4ZX8 A;  3TOB A;  2OZU A;  2ABZ A;  2PJ2 A;  1LFW A;  2FVG A;  1B6B A;  4P4F A;  3NE7 A;  4M6I A;  2DF5 A;  3K9U A;  4MCQ A;  1S3Z A;  4NEX A;  4EWT A;  2OH1 A;  2VEZ A;  4HNY B;  1YX0 A;  4MCR A;  4PSW A;  2BUE A;  5JQ4 A;  3D7F A;  5LYL A;  2OB0 A;  3KHZ A;  4XPK A;  2PR1 A;  4IF5 A;  4HNX B;  1YW6 A;  3F0A A;  2FE7 A;  5E96 A;  2AFO A;  1MJB A;  1MJA A;  1Z8L A;  4PQA A;  1S7L A;  3PGP A;  4PPZ A;  5I4M A;  2VQY A;  3B3T A;  3V38 A;  1I12 A;  3FJU A;  5DWM A;  4XPL A;  1IOI A;  3D8P A;  4KOR A;  3FB3 A;  2ZEF A;  3GLJ A;  3KQX A;  4KOW A;  4R8F A;  4U9Z A;  3SI1 A;  4BIN A;  5K8O A;  3S9M A;  4E0A A;  2JDD A;  5IB9 A;  3NFZ A;  2Z11 A;  4CPA A;  3FED A;  1CP6 A;  3T90 A;  3FEE A;  3G8W A;  2AJ6 A;  2EK9 A;  4ZY2 A;  2ZW7 A;  3GKR A;  1H8L A;  4PXD A;  5H84 A;  4JXQ A;  4NGR A;  4FAI A;  1TF8 A;  2Z3M A;  4FD4 A;  4NCZ A;  5D29 A;  3B3S A;  4EME A;  2PIY A;  2PJ6 A;  5GCN A;  4OC2 A;  3D66 A;  4HPS A;  1QSN A;  1WK4 A;  1IID A;  1M4I A;  2F8H A;  2FIW A;  2PJ0 A;  2CXA A;  2WPX A;  4UEZ A;  4C68 A;  4UFX A;  3B2Y A;  2ZEM A;  3LD2 A;  1TKH A;  4C7H A;  5ISV A;  2X7B A;  2C6G A;  3B3V A;  5HVF A;  2PJC A;  4ZI6 A;  2ARH A;  3IFE A;  4AB7 A;  4OP4 A;  2IMO A;  5HXD A;  1BLL E;  2A4N A;  2FS5 A;  4TWE A;  2QML A;  2GE3 A;  1YGH A;  2D4O A;  1YRE A;  3H8E A;  4MI4 A;  2HUZ A;  5HVH A;  3QNV A;  2DEA A;  1Z8X A;  2JEV A;  3UY5 A;  2GIV A;  3LMS A;  2PVV A;  2WYR A;  2V8V A;  1KUV A;  4NJR A;  5LRG A;  4O23 A;  2EWB A;  4MMO A;  2QVP A;  2ZW4 A;  3JUW A;  2H5M A;  1KZF A;  1XOV A;  4KOY A;  4RI1 A;  4H6U A;  3S6F A;  3W6X A;  2Z3K A;  5LYI A;  4FWU A;  4TNU A;  2B3U A;  1HDQ A;  2K5T A;  4KZT A;  2ZEE A;  1PYT B;  4P4E A;  2Q51 A;  1UFH A;  4MCP A;  4WJB A;  3PEI A;  1U6M A;  4OC1 A;  2J9A A;  4B5O A;  2OZH A;  4H2K A;  4GXH A;  4DJL A;  4ZY1 A;  1M4L A;  1HEE A;  4KLW A;  3SXN A;  4PXC A;  2O53 A;  3D67 A;  2GLF A;  3ISX A;  4YGO A;  2JBK A;  2ZPA A;  2R7H A;  4R76 A;  5EC4 A;  4YWY A;  2AFX A;  4F9V A;  3LOD A;  5EBV A;  2XEG A;  5DS0 A;  1S5K A;  4L8A A;  3GUX A;  1WWZ A;  3FH4 A;  3I3G A;  4MY0 A;  1IU8 A;  5ELY A;  4UFV A;  5F46 A;  2ZEN A;  2REE A;  4CYQ A;  4UA3 A;  2OZG A;  4LX9 A;  4UIA A;  3FBU A;  3K2K A;  4A31 A;  4BMH A;  2EK8 A;  2B5G B;  3KGQ A;  3NH4 A;  4Y49 B;  3CXP A;  4ONU A;  1FY7 A;  3TT2 A;  4NGM A;  2B5G A;  1M4D A;  3TX8 A;  4A95 A;  4E2A A;  5J1Q A;  2C6P A;  4KVM E;  5G21 A;  3L2N A;  1ELM P;  4ONW A;  2J8M A;  3GB0 A;  3CXS A;  5C82 A;  2CNT A;  4OIW A;  1YK3 A;  3E0K A;  4PXE A;  2PE3 A;  3PB6 X;  4E8O A;  1ON0 A;  2VZY A;  4F8Z A;  2FT0 A;  1LCP A;  1XIX A;  1S7F A;  5F49 A;  1R57 A;  4MHZ A;  4NGP A;  1LOK A;  3FF3 A;  1Q2D A;  2G3A A;  4B12 A;  1IYK A;  2YNC A;  3IWE A;  4P45 A;  4CAE A;  1ZG7 A;  4W9Y A;  4MFJ A;  5AG4 A;  1Y7E A;  5IX3 A;  2PJ9 A;  4A94 A;  4FBE A;  2P0W A;  4CGN A;  2YNE A;  1KUX A;  3QB8 A;  3W91 A;  1R43 A;  2HQY A;  2EUI A;  4A37 A;  4KVO E;  4NSQ A;  2C1C A;  4NF1 A;  4Q7A A;  2ZEL A;  1YSJ A;  4MRI A;  4UEE A;  2ZW5 A;  4OLL A;  2D4P A;  1M4G A;  5FVJ A;  2P6G A;  4R9M A;  1NE9 A;  3EXN A;  2WZN A;  3V8I A;  1S7K A;  2XEI A;  3S9N A;  3JVN A;  4UBR A;  4FD7 A;  4R3K A;  3C26 A;  4X8I A;  4QC6 A;  1NSA A;  3BHX A;  4P10 A;  4PXB A;  1QSR A;  2CIJ A;  2QYV A;  3PBE A;  5CNP A;  5A27 A;  3VAR A;  1VIX A;  3MN8 A;  4P44 A;  2CNM A;  1AMP A;  4UCP A;  5F48 A;  4OME A;  2Q44 A;  4Q36 A;  2F7V A;  2WSA A;  3PFO A;  4CGP A;  3EO4 A;  4IK2 A;  3D2P A;  1I1D A;  2C6C A;  1RXT A;  3PP9 A;  5J8C A;  2BL1 A;  1YLE A;  4LQG A;  1Y7R A;  2PQ8 A;  1YR0 A;  3R1K A;  3LWU A;  3DNS A;  4OC4 A;  4R3L A;  3NE8 A;  3SJE A;  2OOT A;  3I9S A;  1IY7 A;  4FD5 A;  3B3C A;  1A2Z A;  2VBQ A;  3FRM A;  1QSM A;  3IWW A;  2Z3L A;  2EBJ A;  3N5F A;  2I79 A;  3S6H A;  4AXV A;  1JWQ A;  1OBR A;  2Q7S A;  2Y0M A;  1XF8 A;  2CY2 A;  1ZG8 A;  2G9D A;  5F47 A;  4UIB A;  4A32 A;  2F5I A;  4K3N A;  1PU9 A;  2B58 A;  5G20 A;  4JJX A;  1LAN A;  4A2Z A;  2AFS A;  3GIU A;  3PBB A;  2YGW A;  1RTQ A;  1XMB A;  3IEH A;  1F2O A;  2BSW A;  2PIZ A;  2ANP A;  5THW A;  4MFZ A;  3S6G A;  4JZ0 A;  1LRZ A;  2PSW A;  4KUA A;  4LUA A;  4MJ8 A;  1K4J A;  3DDD A;  3BI0 A;  3ZZI A;  3DSB A;  2Q4Y A;  2FXF A;  3D7D A;  4R6T A;  5LYD A;  3RZA A;  4KOX A;  4CGL A;  5BWA B;  5I0C A;  4J3G A;  3KQZ A;  3TE4 A;  3P2F A;  3LAC A;  3D2M A;  3DGV A;  3N7Z A;  2Q43 A;  4CRY B;  4XPD B;  3KR5 A;  4KSA A;  1IOF A;  1RO5 A;  4UWJ A;  2WUU A;  3P2H A;  2AFU A;  4MCS A;  2ZOG A;  8CPA A;  1M44 A;  3NA6 A;  3RNZ A;  5AG6 A;  4F0X A;  3D3S A;  3NH5 A;  2I00 A;  3PZJ A;  4F9U A;  2B4D A;  2PJ3 A;  4MBU A;  4CGM A;  4H89 A;  1ZLI A;  3G3S A;  3FX6 A;  4YU9 A;  5CBM A;  1AYE A;  1XEB A;  5HMN A;  1SQH A;  4AVB A;  3IJ3 A;  4MXU A;  2B3V A;  1CBX A;  4M85 A;  3S6K A;  1Z4R A;  2BEI A;  4AVA A;  4NFR A;  2GFQ A;  5EMI A;  4BD9 A;  4MFQ A;  3IIB A;  4KSF A;  2PDO A;  3S9L A;  1P0H A;  2PJ5 A;  2ZEO A;  4XNH B;  2VZZ A;  3KL9 A;  4UF4 A;  1IB1 E;  3HUV A;  4AG7 A;  3PB4 X;  5A28 A;  1L0C A;  4EFD A;  4CAF A;  5D8N A;  3HLP A;  4UCM A;  1Y0Y A;  3KKW A;  1IGB A;  3TCV A;  5DWN A;  2R8V A;  3FIX A;  3WT4 A;  3BXM A;  2FCK A;  4OKO A;  1YQE A;  4LQ6 A;  3W6S A;  4NGQ A;  3RO0 A;  1CX8 A;  3B35 A;  2NSM A;  2ZEP A;  2ZEH A;  1YVK A;  1CPX A;  4II9 A;  2AE6 A;  4KS9 A;  2JBJ A;  6CPA A;  3FXT A;  2VXK A;  4PK3 A;  2G3T A;  1XMT A;  4X3R A;  2POK A;  4PSX A;  2J8R A;  1J4J A;  2Z3O A;  3WC5 A;  3IWG A;  5F09 A;  1VHO A;  5K8N A;  1AUG A;  4JXR A;  5LRJ A;  1R3N A;  1Z8W A;  2NYQ A;  2ZEG A;  1XBU A;  4C2X A;  1FT7 A;  2GLJ A;  3F5B A;  2PJ1 A;  3TOA A;  3KHX A;  4M6G A;  3WAB A;  5JPH A;  2CNS A;  2P6E A;  1BOB A;  3PB7 X;  4CAX A;  4ZYQ A;  2IL4 A;  4L89 A;  3DR8 A;  3SJF A;  3KR4 A;  1BPN A;  2RFH A;  4KOV A;  4UWI A;  4OC3 A;  2HB6 A;  4B11 A;  4KSI A;  4R87 A;  3B8G A;  3CZX A;  5HVG A;  1KWM A;  2XEF A;  2WPW A;  3IO1 A;  3T9Y A;  1XFO A;  2KCW A;  2AFW A;  3D7G A;  1Q7L A;  3R95 A;  2Z3N A;  3B7I A;  4JWP A;  1X12 A;  4RUH A;  3BJ7 A;  1OZP A;  4R7M A;  2EVN A;  4JYW A;  3PRT A;  2R1I A;  2VL1 A;  2ZED A;  3IC1 A;  1TXR A;  4ZX9 A;  3MRU A;  3WC7 A;  4CAV A;  3TC8 A;  2IQ6 A;  2PJ7 A;  4OC5 A;  3R9F A;  3BLN A;  2HV2 A;  5J8F A;  5G22 A;  3TFY A;  4IHM A;  4CS0 B;  3F8K A;  4KLV A;  3WC6 A;  2FIA A;  3R9G A;  3R9E A;  4JD6 A;  2V8H A;  3FNC A;  4MFK A;  5K8M A;  2DPS A;  2PRQ A;  1YVO A;  4R57 A;  3RYO A;  1BPM A;  1X10 A;  2NMT A;  1QSO A;  4H6Z A;  3TO6 A;  2YNC C;  4CRZ B;  5JGF A;  1ELL P; 
#chains in the Genus database with same CATH homology
 4HNW B;  4OAD A;  2QIR A;  2ZW6 A;  4X5K A;  4C2Z A;  1NSL A;  4K30 A;  3IGR A;  4PK2 A;  2FSR A;  2DXQ A;  1MK4 A;  2R98 A;  4RS2 A;  3CXQ A;  4FD6 A;  4A30 A;  1NMT A;  3GYA A;  3GY9 A;  5AGE A;  3FYN A;  3DR6 A;  4C7I A;  4KOS A;  4EVY A;  2O28 A;  3IU2 A;  1IIC A;  5IV0 A;  1Y9W A;  3BJ8 A;  4AG9 A;  2B4B A;  2QEC A;  3EFA A;  4B14 A;  1ZO0 A;  2GAN A;  5KTA A;  2VI7 A;  1QST A;  1V0C A;  1XE4 A;  5AG7 A;  5HH1 A;  1IYL A;  2P6F A;  2RC4 A;  1GHE A;  4QBJ A;  4CYO A;  2G0B A;  2PC1 A;  4B10 A;  1VKC A;  2OU2 A;  4KOT A;  3JTK A;  4UCN A;  4MFP A;  2B4D B;  3WR7 A;  1N71 A;  4A33 A;  3EC4 A;  4UFW A;  4QVT A;  3OWC A;  4I49 A;  2C27 A;  2PRB A;  4MY3 A;  4HKF A;  3ZJ0 A;  2Q4V A;  5C88 A;  1I21 A;  4U9Y A;  4B5P B;  3MGD A;  4NXY A;  1PUA A;  2Z3P A;  4B5P A;  4F0Y A;  2Q04 A;  2ZXV A;  2ATR A;  3SXO A;  4KOU A;  1S60 A;  4CYP A;  4IUS A;  4M3S A;  2J8N A;  4PV6 A;  1KUY A;  2Z0Z A;  4CGO A;  1Q2Y A;  4XPD C;  1B87 A;  3SHP A;  4YFJ A;  2Q0Y A;  4ZBG A;  5KTD A;  1Q2C A;  4ORF A;  3A9L A;  3IU1 A;  3EY5 A;  4U5Y A;  3VWE A;  2PR8 A;  4CYN A;  1VHS A;  1CJW A;  4MFL A;  2JDC A;  2JLM A;  4KUB A;  4JLY A;  5H86 A;  3TTH A;  2DPT A;  3VWD A;  4Q38 A;  4XNH C;  4DNC A;  3R96 A;  3H5Z A;  5G1Z A;  5AG5 A;  1BO4 A;  2Q7B A;  5KTC A;  4KVX A;  1P4N A;  4CAW A;  5IB0 A;  3TO9 A;  1TIQ A;  3TO7 A;  2YND A;  1Z9U A;  1M1D A;  3H4Q A;  4OAE A;  4Y49 C;  3QAH A;  4AVC A;  1S7N A;  2FL4 A;  4B13 A;  4C2Y A;  4QUS A;  4MHD A;  1Y9K A;  2Z10 A;  1MJ9 A;  4GS4 A;  4QB9 A;  4F6A A;  2REF A;  1CM0 A;  1Z4E A;  4BBH A;  4ZGY B;  4YRH A;  3TOB A;  2OZU A;  1B6B A;  3NE7 A;  3K9U A;  1S3Z A;  4NEX A;  4HNY B;  2OH1 A;  2VEZ A;  1YX0 A;  4PSW A;  5JQ4 A;  2BUE A;  2OB0 A;  4XPK A;  2PR1 A;  4IF5 A;  4HNX B;  3F0A A;  2FE7 A;  5E96 A;  1MJB A;  1MJA A;  1S7L A;  3PGP A;  2VQY A;  1I12 A;  5DWM A;  4XPL A;  3D8P A;  4KOR A;  3FB3 A;  4KOW A;  4U9Z A;  4E0A A;  2JDD A;  2Z11 A;  3T90 A;  3G8W A;  2AJ6 A;  2ZW7 A;  3GKR A;  5H84 A;  4JXQ A;  2Z3M A;  4FD4 A;  4NCZ A;  5GCN A;  1QSN A;  1WK4 A;  1IID A;  1M4I A;  2FIW A;  2WPX A;  4C68 A;  2CXA A;  4UFX A;  4C7H A;  3LD2 A;  5ISV A;  2X7B A;  2ARH A;  4AB7 A;  2A4N A;  2FS5 A;  2QML A;  2GE3 A;  1YGH A;  2D4O A;  1YRE A;  4MI4 A;  2HUZ A;  2JEV A;  3UY5 A;  2GIV A;  1KUV A;  2ZW4 A;  3JUW A;  2H5M A;  1KZF A;  4RI1 A;  4KOY A;  3S6F A;  4H6U A;  3W6X A;  2Z3K A;  2B3U A;  2K5T A;  4KZT A;  1UFH A;  1U6M A;  4B5O A;  2OZH A;  4KLW A;  3SXN A;  4YGO A;  2ZPA A;  2R7H A;  5EC4 A;  3LOD A;  5EBV A;  1S5K A;  4L8A A;  4MY0 A;  1WWZ A;  3I3G A;  4UFV A;  5F46 A;  2REE A;  4CYQ A;  4UA3 A;  2OZG A;  4LX9 A;  3FBU A;  4A31 A;  4BMH A;  2B5G B;  4Y49 B;  3CXP A;  4ONU A;  1FY7 A;  3TT2 A;  4E2A A;  2B5G A;  1M4D A;  4A95 A;  4KVM E;  5G21 A;  2J8M A;  3CXS A;  5C82 A;  2CNT A;  1YK3 A;  3E0K A;  4E8O A;  1ON0 A;  2VZY A;  2FT0 A;  1XIX A;  1S7F A;  5F49 A;  1R57 A;  1Q2D A;  2G3A A;  4B12 A;  1IYK A;  2YNC A;  3IWE A;  4CAE A;  4MFJ A;  5AG4 A;  5IX3 A;  2P0W A;  4CGN A;  2YNE A;  1KUX A;  3QB8 A;  3W91 A;  2HQY A;  2EUI A;  4KVO E;  4NSQ A;  4NF1 A;  2ZW5 A;  4OLL A;  2D4P A;  1M4G A;  5FVJ A;  2P6G A;  4R9M A;  1NE9 A;  3EXN A;  3V8I A;  1S7K A;  3JVN A;  4UBR A;  4FD7 A;  4R3K A;  3C26 A;  4QC6 A;  1QSR A;  5CNP A;  5A27 A;  5F48 A;  2CNM A;  4UCP A;  2Q44 A;  4Q36 A;  2WSA A;  4CGP A;  3EO4 A;  3D2P A;  1I1D A;  1RXT A;  3PP9 A;  5J8C A;  2BL1 A;  1YLE A;  1Y7R A;  2PQ8 A;  1YR0 A;  3R1K A;  4R3L A;  3DNS A;  3I9S A;  4FD5 A;  2VBQ A;  3FRM A;  1QSM A;  2Z3L A;  2I79 A;  3S6H A;  2Y0M A;  1XF8 A;  2CY2 A;  5F47 A;  4A32 A;  2F5I A;  1PU9 A;  2B58 A;  5G20 A;  4JJX A;  4A2Z A;  2YGW A;  2BSW A;  4MFZ A;  3S6G A;  1LRZ A;  2PSW A;  4KUA A;  4LUA A;  4MJ8 A;  1K4J A;  3DDD A;  3ZZI A;  3DSB A;  2Q4Y A;  2FXF A;  4CGL A;  4KOX A;  5BWA B;  3TE4 A;  5I0C A;  4J3G A;  3P2F A;  3D2M A;  3N7Z A;  4CRY B;  4XPD B;  4KSA A;  1RO5 A;  4UWJ A;  2WUU A;  3P2H A;  1M44 A;  5AG6 A;  4F0X A;  3D3S A;  2I00 A;  3PZJ A;  2B4D A;  4MBU A;  4CGM A;  4H89 A;  3G3S A;  1XEB A;  5HMN A;  1SQH A;  4AVB A;  2B3V A;  4M85 A;  3S6K A;  1Z4R A;  2BEI A;  4AVA A;  4MFQ A;  4KSF A;  2PDO A;  1P0H A;  4XNH B;  2VZZ A;  1IB1 E;  4AG7 A;  5A28 A;  1L0C A;  4CAF A;  4UCM A;  3KKW A;  3TCV A;  5DWN A;  2R8V A;  3FIX A;  2FCK A;  3W6S A;  1YVK A;  4II9 A;  2AE6 A;  4KS9 A;  3FXT A;  2VXK A;  4PK3 A;  2G3T A;  1XMT A;  4PSX A;  2J8R A;  1J4J A;  2Z3O A;  3IWG A;  4JXR A;  4C2X A;  3F5B A;  3TOA A;  5JPH A;  2CNS A;  2P6E A;  1BOB A;  4CAX A;  2IL4 A;  4L89 A;  3DR8 A;  4KOV A;  4UWI A;  4B11 A;  4R87 A;  3B8G A;  2WPW A;  3T9Y A;  2KCW A;  3R95 A;  2Z3N A;  4JWP A;  3BJ7 A;  1OZP A;  2EVN A;  2R1I A;  4CAV A;  3R9F A;  3BLN A;  2HV2 A;  5J8F A;  5G22 A;  3TFY A;  4CS0 B;  3F8K A;  4KLV A;  2FIA A;  3R9G A;  3R9E A;  4JD6 A;  3FNC A;  4MFK A;  2DPS A;  1YVO A;  4R57 A;  3RYO A;  3TO6 A;  2NMT A;  1QSO A;  4H6Z A;  4CRZ B;  2YNC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...