2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein aq_1966
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
4QBJA 1S3ZA 1S7KA 3N7ZA 4E8OA 2FXFA 1S5KA 2KCWA 5KTAA 1TIQA 2HUZA 1GHEA 4X5KA 3TFYA 3NE7A 4QB9A 3MGDA 4M3SA 1Y9WA 2VZYA 4U5YA 3LD2A 3GY9A 1VHSA 2P6EA 1M4DA 1IIDA 3DDDA 2GANA 3QAHA 5F48A 4FD5A 4PSXA 2Y0MA 4KORA 5IX3A 5IB0A 4HNXB 3BLNA 3S6KA 4F6AA 3DNSA 3F5BA 2FT0A 2I79A 3R9EA 1WWZA 3F8KA 3R9FA 1I12A 4R57A 1S7FA 1B6BA 4XPDC 1P0HA 2Z0ZA 3W91A 5KTDA 2CNMA 2PR1A 3E0KA 3S6FA 3H4QA 2VQYA 5ISVA 2ATRA 1XIXA 4KOUA 1YR0A 4UA3A 1IYKA 1XE4A 4ONUA 3TO9A 4EVYA 2P6FA 2PRBA 4XPDB 4YGOA 2X7BA 2JEVA 2J8MA 2C27A 2B4DA 3G8WA 2REEA 4JXQA 5J8CA 1ON0A 4PSWA 1QSTA 4CAVA 2Q7BA 3ZZIA 2JLMA 3EO4A 3FNCA 2FCKA 2FS5A 1Y7RA 2ZPAA 4JWPA 2QECA 2B5GA 2P0WA 5C82A 1KUXA 4GS4A 4YFJA 2VXKA 3VWDA 1M4IA 4LUAA 3V8IA 3BJ7A 1L0CA 4ZBGA 4NCZA 3S6GA 2FIWA 2OH1A 4L89A 1B87A 3R1KA 4JLYA 4J3GA 2FSRA 3P2HA 1Z4RA 5GCNA 1QSMA 4HKFA 1YLEA 2WPXA 1BO4A 1S60A 2B5GB 2BSWA 2K5TA 2WPWA 4CAWA 2ZW6A 2GIVA 2OZHA 2F5IA 2Q44A 4E2AA 4JD6A 5JQ4A 1VKCA 4MJ8A 5KTCA 5EC4A 3K9UA 3W6XA 1IICA 4II9A 2H5MA 1Q2YA 2BL1A 3BJ8A 2Q4VA 2QMLA 4XPKA 1MK4A 3UY5A 1XMTA 2OB0A 4KOTA 4RS2A 2VZZA 1N71A 3R96A 1QSOA 2ARHA 2I00A 3EFAA 3RYOA 1KUVA 4R87A 3FRMA 3TT2A 4XPLA 3TOBA 3FXTA 3SXNA 3F0AA 3FB3A 3I9SA 4B5PB 3CXQA 2D4OA 2JDDA 5F47A 2VBQA 1YGHA 4QVTA 4KLVA 4CS0B 2ZW4A 4CRZB 4IF5A 3G3SA 4DNCA 3TOAA 2R1IA 4FD6A 4L8AA 1R57A 4BMHA 3R95A 3C26A 3JUWA 3CXSA 4UWJA 1S7LA 4UBRA 4FD4A 2D4PA 2VI7A 4I49A 4AG7A 4KZTA 4AVCA 3PZJA 3IWGA 4NSQA 1YVOA 1XF8A 2DXQA 3LODA 4KVXA 3TE4A 4KLWA 4KVME 3P2FA 4CRYB 1Z4EA 3D2MA 4KOYA 4JJXA 5E96A 3T90A 3WR7A 2A4NA 2CNSA 4KUBA 2B58A 4H89A 4H6UA 3VWEA 2ZW5A 3EXNA 4OLLA 4KOXA 2P6GA 2HV2A 2G3TA 2J8RA 4KVOE 5H84A 1Q2DA 1M44A 1PU9A 5EBVA 3IGRA 1YX0A 3DR8A 2B3UA 2O28A 1YVKA 3FYNA 5F49A 2IL4A 2FIAA 2ZXVA 4K30A 4KUAA 1CJWA 2VEZA 2QIRA 3S6HA 2Z11A 4AVBA 1U6MA 3FBUA 1KZFA 2BUEA 1MJ9A 3T9YA 1CM0A 1RXTA 1QSRA 3GYAA 4JXRA 5DWNA 5J8FA 4PV6A 4OAEA 3DR6A 1PUAA 4QUSA 4RI1A 3FIXA 3OWCA 2B3VA 4R3KA 4IUSA 4U9YA 1FY7A 1XEBA 5JPHA 1S7NA 2Q04A 2PDOA 4HNYB 4AG9A 2G0BA 2CY2A 1KUYA 3B8GA 1M1DA 2NMTA 3GKRA 5IV0A 2R8VA 4AVAA 1YREA 1NMTA 1I21A 2B4DB 3TO7A 5F46A 5HMNA 1QSNA 3EY5A 1Y9KA 3W6SA 2ZW7A 3QB8A 4E0AA 4LX9A 1UFHA 5I0CA 4MBUA 1P4NA 1NSLA 4PK3A 5HH1A 3SHPA 4Y49B 1M4GA 3DSBA 3D3SA 2GE3A 4KOWA 2OZGA 1BOBA 2PQ8A 4F0YA 4XNHC 1J4JA 1MJAA 2R98A 3PP9A 4KOVA 1SQHA 4AB7A 4MY3A 2Z10A 4MI4A 1MJBA 2PC1A 4UWIA 4U9ZA 3CXPA 4H6ZA 3D2PA 2R7HA 3KKWA 1NE9A 4M85A 1IB1E 1I1DA 3PGPA 3D8PA 4XNHB 4R3LA 4CAXA 3I3GA 2HQYA 4Y49C 1WK4A 4ORFA 2Q0YA 4FD7A 1Q2CA 2EUIA 3TCVA 2AJ6A 4YRHA 1LRZA 3SXOA 2G3AA 1V0CA 1Z9UA 2FE7A 4OADA 1OZPA 2B4BA 4NF1A 5C88A 4PK2A 4B5OA 2PR8A 2FL4A 2BEIA 2OU2A 2JDCA 4MHDA 3TO6A 2AE6A 4KOSA 3R9GA 5CNPA 1YK3A 2PSWA 2EVNA 2Q4YA 1IYLA 2CNTA 4NEXA 2REFA 5FVJA 3ZJ0A 3JVNA 2RC4A 5DWMA 4B5PA 3TTHA 1RO5A 4HNWB 4QC6A 4MY0A 1K4JA 2OZUA 5H86A 2J8NA 4R9MA 3EC4A 4NXYA
chains in the Genus database with same CATH superfamily
2JK5C 4QBJA 1S3ZA 2ZNJA 4MVSA 1B06A 2QTSA 3K58A 4JI6O 3N7ZA 3LWUA 5B3SC 3LSQA 2ZD9A 3N27A 2PJ9A 5C93A 2CF4A 1LR1A 3BA9A 4KUMA 4X5KA 1G4YB 1OCOC 1YDXA 4JI5O 1E79G 2FB5A 3LACA 1IDSA 4QB9A 2GU2A 3ZMTA 4P4IA 1Y9WA 4QPJA 3PFOA 3LD2A 2BSKB 1XMOO 4JI3O 4LF5B 3G80A 1ZO0A 3M8AA 1TAEA 3CX5F 4I7ZB 4W9YA 2ZEDA 1VP7A 3VBBA 1R6KA 2ZDIA 4M6IA 2JBKA 4ABMA 5F48A 3DSQA 2QKAA 1OCOB 5LRGA 5IX3A 4IHJA 1NTZH 3BLNA 1EFRG 3F5BA 3JAKA 1MMMA 1YXBA 4P45A 4PXDA 1YEWA 2WSAA 3L72H 3E8FA 2UUCB 1WWZA 3PFEA 1Q6UA 4KP4A 4HBNA 2EO8A 4F6RA 2PJ4A 3KZWA 3OGCC 1I12A 2IU3A 1AI5A 2ZR3A 4R57A 1S7FA 3B35A 4G28B 4EFBA 4B7EA 1MA1A 1L0NH 4XPDC 2DYRB 2ZQMA 5EBLC 4IYIA 5AG2A 1OCZC 1Z5VA 2Z0ZA 4MTFA 2LW1A 1S5JA 3BHXA 1HNWO 4LFBB 2EK8A 5KHKA 3GIUA 2VQYA 2ATRA 2N05A 1YR0A 1HNZO 3GWOA 3EHBB 4P9OA 4DUYO 3S9NA 4EVYA 2ZEMA 2PRBA 4XPDB 1L1FA 1SF9A 1Q5OA 3NR7A 3ZRWB 4CC6A 5EK0A 1IXBA 4LFCO 2C27A 2J8MA 1DGSA 3CPWU 4R50A 2QM7A 1DF5A 2LJ2A 3F5TA 3K3WA 3W7WA 2Q4ZA 4P4DA 1HNXB 3MHSC 5CA0A 3AK2A 4O2AA 4B3SB 4CAVA 2ZNIA 2HJDA 4DYLA 2FS5A 2PJ5A 3P30A 4X65B 2PJCA 1UWYA 3OM3B 4W4KA 3JALB 1F7YA 4OMEA 1NTMH 2R9AA 2B5GA 5FPOA 5KHHA 1IU8A 2LW7A 2M6YA 4I4TB 5C82A 3H8EA 1KUXA 1ZG8A 2GUZA 1EM1A 4PV1B 3JSNA 2CTRA 4YFJA 4GCZA 2ZEFA 3MAQA 2Y4UA 1FNOA 1JR9A 4A31A 4CYNA 3ZMZA 4LUAA 3BJ7A 2AZ2A 3ZRSA 4OIDA 5IYZB 4X1YA 4NCZA 4ZBGA 1GTOA 5K8NA 2CK3G 4MVMA 1YJNV 2FIWA 3G6BA 3K5OA 4B14A 4K8ZA 2WLKA 2V7QG 4F9VA 2Q68A 1WPBA 2EIJC 5D5QA 2YXYA 4P2ZA 5GCNA 1M4UA 2HFEC 1CEZA 3A0RA 5JCOC 4CZZA 1E1QG 3PJSK 1XMQO 5E79Z 5BR8B 4A94A 3B4SA 4LNUB 4CS3A 3FB8C 2IMOA 3CPAA 2G38A 1OJHA 1WJZA 2GIVA 3P3NA 2WLJA 5LA6B 5BR8O 3KASA 5LXTA 3CD6V 1LAMA 2RNBA 1VQKV 3UCSC 1K73W 1Z8TA 4QE7A 1GN3A 4I0XA 4CPAA 3J81N 3W6XA 2GBOA 1CPSA 1ZLIA 2KKWA 3OMNB 1QHTA 4FPPA 3CCVV 4LF8B 1VQOV 3DC5A 2VQFB 3CJHA 5LHIA 4H13B 1VF7A 3I5DA 4NKGB 1GM8A 1AR4A 4RS2A 2GV9A 4TQFA 1BLLE 2B9ZA 2WUUA 3JYCA 1XNQO 4UCMA 1R3LC 3AG2C 3W7TA 3S3WA 2UXCB 3JSLA 2DYSC 3RYOA 2ZDIC 3AG1B 3FRMA 3H8FA 2F66C 1JVMA 4B3MO 1Z8LA 1LUVA 1YF2A 4U3JA 3AG4B 2ODMA 5EZYB 4BAYA 3CXQA 2HKOA 4PA4A 4FK5C 4QVTA 4DV2B 4IL6Z 1P49A 4K3NA 1FXKA 1XUQA 2HB6A 2YI9A 3J7AU 4DNCA 1SQGA 5K1PA 4WJBA 4I50B 1AP5A 2X0LA 2X6BA 1PM9A 5B1OA 1XNRO 5CN0A 2R1IA 4UCTA 4L8AA 5CBGA 4DUZB 3UKMA 4BMHA 3R95A 3C26A 3R65A 1A2ZA 5LMNO 1RM1B 2AZ0A 1S77D 1BZKA 3FH4A 4QPKA 4UBRA 2D4PA 4U3FH 1VARA 2DW4A 3K0GA 4I49A 3APOA 5GTIZ 2QTOA 4NSQA 4B6ZA 1YW4A 2UUBO 1XF8A 3JD1A 5LYJA 4BIOA 1B3QA 1ZG9A 3H9VA 4KOYA 3E8HA 3OTOB 3D36A 1AUGA 3ABTA 3SPCA 1KBHA 3T90A 3ABLC 3JD0A 2Z3NA 3T8WA 4H89A 4AQYO 4H6UA 3VWEA 4OLLA 2EULA 1US6A 4D7TA 1ELLP 2Z3MA 4ZX8A 3QO5A 3UM7A 2HV2A 4U7OA 2J8RA 4BINA 3I55V 1M44A 4OP4A 1PU9A 1CXZB 5EIBC 1RSOB 3SI0A 3CCQV 1VGYA 5EBVA 3FB5C 4UCRA 3F5WC 3G71V 2PJ1A 3T1HB 4QNHB 5EIBD 1YVKA 4J9ZB 5EC1C 1NKDA 3RVZA 4DR5B 4CGLA 4LF7B 4EKWA 2YGWA 2BOBC 5IJ0A 1Z2LA 1M93A 1VEWA 3K06A 2YNDA 4O4IA 4O4IB 3S6HA 4PA7A 1RSOA 4DXWA 1U6MA 3IJ3A 2Q6AA 2BCCH 2UXBO 2BUEA 1F57A 3F7YC 1CM0A 4P4BA 3A9LA 1QSRA 5GONA 2DEAA 1TUBB 3IC9A 4JXRA 2AFSA 1R1BA 2A79B 2Z0AA 4LF6O 4UVAA 5J8FA 1XILA 4CC5A 4NXMB 1GN6A 4PV6A 4WFFA 1ZG7A 4JYBA 4QUSA 4RI1A 4UEFA 1V54B 2B3VA 2GSMB 2QWPB 1KD1W 4IUSA 2ZR2A 1FY7A 3WU2Z 2Q04A 2PDOA 2L35A 4NGNA 4H33A 3NFZA 1YREA 1NMTA 1PL4A 2JEXA 4CYPA 3CZXA 5LOVB 4N23A 1ZTEA 3ETQA 3EY5A 4RN7A 3SR2C 2ZEHA 5L3GA 3PB4X 1RP3B 1RTQA 3QB8A 3TXQA 2EILC 4QJFB 5LL6Y 4MFPA 2PJ0A 2M7WA 3CMAV 5AG5A 3LNNA 3C90A 5IB9A 1D5AA 4NB5A 2AFXA 3THOA 4AILC 3M7MX 3ZHRA 4IGGA 1VQ5V 3WB0A 4L87A 4R7MA 4WFEA 4PK3A 4UV8A 4B3SO 4Y49B 4NTXA 1K5SA 3ZMVA 3OT7A 3RYCA 4X9QA 1PV0A 2OZGA 5DECA 2PQ8A 1FJGO 4XNHC 2WLIB 3I1UA 2IJIA 3E22B 4UIBA 3QO8A 3SI2A 2ABZA 4I9WA 4MY3A 2CTWA 5KA5A 4K0KB 4I0XB 3H1LH 4JI6B 2ZOGA 2ZENA 4U9ZA 2MK3A 2VWKA 3RYCB 1XL6A 4H6ZA 5B66Z 4YJ3A 3CCRV 1DK1A 3B40A 5LXTB 4B3RO 5KMGB 3K57A 4LF6B 2C1CA 4FM1A 4A32A 3K79A 1YTFB 2ZINA 4XNHB 3OW2U 1YW6A 4IIJA 3ABKC 1D5NA 4X66O 3AEIA 4CAXA 2LGQA 2L6LA 3SPGA 1Y6XA 1Z8WA 1DTOA 1EN4A 2BOCC 2YEVB 4X3RA 1OCCC 2EINC 2UXNA 4X1KA 2E5LB 3RWRD 2YIAA 1FFXA 1SS3A 4EB6A 3FVLA 4JI0O 2A9HA 5KX5B 2K9PA 1S76D 1TXRA 2GTSA 1G8MA 2IJKA 4UCPA 1OHHG 3JCUZ 2OCCB 2IH1C 1PL0A 4X62O 1BQ0A 2QSAA 4YRHA 2ZEGA 1SESA 2G3AA 1V0CA 2FTKA 2D2CB 2Q69A 5ELYA 4G27B 2EK9A 2FE7A 1YCIA 1BAVA 1ZLHA 2EINB 5LYFA 4NJRA 3KHZA 4MHZA 2JDCA 4MHDA 3D66A 1LFWA 5CNPA 2WYRA 1SERA 2ZM6B 1F23A 4JI7B 3B2YA 2RC4A 3AG3B 3SJEA 1XNQB 1TF8A 3OEEG 2FYUH 4EEQA 1PKXA 3SJAC 4MY0A 5LYDA 3K59A 4X64O 2IM9A 3DGEA 4DK1A 3EC4A 1BS3A 1NTKH 4GX1A 4DV0O 4NTYA 4K0KO 3OTFA 5I4MA 2RN9A 1OBRA 4MVRA 1Q82W 4JI1O 2FXFA 2YXHA 2KCWA 1M56C 3ZRWA 4X8AA 3LSUA 1TIQA 1Y67A 5J9PC 1ARMA 1XMBA 2HUZA 2QKSA 4UB6Z 3SPIA 3KKYA 4B08A 1SQBH 2W6JG 4LCUC 4ZHQB 3TFYA 3NE7A 5JH7A 3G4SV 4FLTA 3MGDA 3S9LA 3MRUA 1BHAA 4JI3B 4M3SA 4JF3A 4O4HA 1SQFA 1AR1B 1CP9A 2W0XA 1SQVH 3JALA 1FKAO 4U5YA 1P4RA 3GY9A 1K4DC 2CTCA 4Q6GA 5BMVA 4P44A 2ZE6A 1H8HG 3DDDA 2QE7G 5LP6A 4LF9B 4ZOLA 2GANA 3WFVA 5JQGB 3FF3A 5K8PA 3IEHA 3IAYA 2Y0MA 4PSXA 2ZEEA 3S6KA 3DNSA 4F0XA 5CA0B 2YNEA 5CBHA 3JAWA 2I79A 1GN2A 1THZA 4KL1A 4DV3O 3R9EA 1FXKB 3VH9A 3F8KA 3GLJA 1R3IC 4GYCB 2NLJC 3OFNG 1SA0A 5EBWC 2PJAA 1CX8A 4DV3B 4EMEA 1J95A 2P5OA 2X6AA 1P0HA 1BT8A 3D8CA 5B1BB 4R7CA 4OXSA 2RMKB 2ITCC 4DR3B 3H4QA 4TQDA 2B5UA 1XIXA 4KOUA 5L3DA 1MSWD 1R73A 1N33B 4UCNA 3SDLA 4DV5B 3TO9A 1JJOA 4J7JA 2P6FA 5JH9A 1FAFA 2AFUA 3JASA 2X7BA 3CB2A 4LF4O 2JEVA 3B3TA 2C6GA 3QAYA 2PZSA 2P7TC 1VQ7V 4JI2B 2B4DA 1QQ9A 5C8YA 4UVBA 2Z3OA 2REEA 2QM8A 2PF4E 4JXQA 4DR1O 3OGIB 5G1ZA 1Z5RA 4TUYB 5H2FZ 3JAKB 3ETDA 4DR5O 3L75H 4B3MB 2OTJV 4DV6B 3JRUA 4HNAA 3WG7B 2Q7BA 1F4NA 2R72A 2JLMA 4I5SA 1BL8A 3ZRVA 2PE3A 1IZ3A 3BEHA 3PEIA 2C6PA 5FNVB 3CRCA 3KL9A 3MN8A 1XOUA 4OC2A 4JWPA 1N32B 1KWMA 2Z5UA 1MZEA 3RYHB 5A2QN 1KQSU 2PGGA 2Y48A 4LR3A 2P0WA 3K9SA 2BTQA 3OD4A 3WC6A 2IBZH 5THWA 1X10A 3H1KH 1KMIZ 1E1RG 1HDQA 1SQQH 4UIAA 5LMUB 2P6JA 1M56B 1M4IA 1L0CA 1WB7A 1AJQA 3L73H 4X1YB 4DV6O 3KQZA 5CB4B 1R3KC 1XL4A 3CRRA 1GN4A 1H38A 4PD4F 4L89A 1IXMA 1QU7A 1ZUQA 2QA4V 4J3GA 4UF4A 2PYJA 2LFRA 4MVZA 1O9HA 4LF8O 5FNVA 2LQTA 1Z4RA 1QSMA 3P2HA 4MW8A 1YLEA 2PJ8A 4YIPA 2RJZA 4JI8O 1NI8A 4FLVA 2B5GB 2EJ7A 5DN6G 2LP7A 2PI4A 5HFMA 4CAWA 4KS9A 2F5IA 4JI8B 5JQGA 3RBZA 3JARA 4DW1A 4ZIBA 3KCYA 5J2TA 5JQ4A 3ABKB 3ZCCA 3TXSA 2JJ2G 5BMVB 5J2UB 3H1HH 3ZJZA 4GX5A 5KTCA 4LF7O 4IYHA 4PXBA 3AG3C 4J41A 4GZRB 1AI4A 2H5MA 1K4CC 1CG2A 4XDLA 5KHIA 5JH7B 1AILA 3FB7C 2QMLA 2OCCC 1XMTA 3CE2A 2ZELA 3K0DA 5D29A 5HVHA 3TJTA 3U0ZA 1L8DA 1QSOA 2KG7B 3B3WA 2I00A 4LWSA 1FD9A 5B1NA 1H8EG 1KUVA 4MMOA 2YNCC 2JS5A 4NJQA 1NVPB 1R6TA 2DYSB 3BI0A 4XPLA 4TV8A 1ZLZA 3FXTA 4DV1B 3SXNA 2OIGA 3JAWB 5J2TB 2JDDA 2YIBD 4H2KA 3JARB 4IAVA 4KSIA 2UXDO 4CS0B 3CCMV 4IHMA 1BPMA 4C2ZA 1GH6A 4FLYA 2V1DA 1J5EB 1NJIW 3G3SA 2BE3A 4I55B 3HKDA 4OPAA 2DF5A 2EBOA 3TOAA 3LMSA 2XAGA 1YZBA 2PVWA 4CBCA 5EBMC 2WA4A 4PI2A 4FD6A 5H5NA 4DR4O 2WLNA 1R57A 1BMFG 3AG2B 3HR0A 2IW5A 3FD9A 3CXSA 1TVKB 3IJ4A 4DR2O 1S7LA 4LWSB 4WWVA 4RAIA 2RB7A 3HPLC 1SQPH 2UUAO 4AG7A 4KZTA 3ZEDA 4AVCA 1I7FA 2P06A 1HDJA 3FFQA 4B7KA 2DXQA 2R9RB 3N2GB 1ZL8B 3C3TA 2BTQB 2PVVA 3NE8A 3TE4A 1Y74B 4R8FA 4LFAB 2BO9A 4MCRA 4UFZA 4CRYB 1RPOA 1Z4EA 3D2MA 4PPZA 4X20B 1QR8A 1AI7A 2UXXA 3JD2A 5E96A 4AQYB 2ILMA 1M4LA 3M99B 4UEZA 5KMGA 4JAUA 2CH7A 4E2LA 3QF7A 1BGYH 1Y0RA 2B58A 4LF5O 1AYEA 3KQXA 2WLHA 3EXNA 2HLDG 1QLNA 2P6GA 4Z2WA 1F2PA 2G3TA 4U7NA 2ZE7A 3A0HZ 3HKBB 4GX0A 3OE7G 5B1BC 5IT9N 1YX0A 4X2TA 1VQ9V 4CS2A 2IL4A 1QVFU 2Q7SA 2I3CA 4K30A 4UFVA 2O4HA 2IQ6A 4KUAA 4JTAB 2VEZA 1J5EO 1IVSA 5L3CA 1Y4MA 3Q4HB 4RO2A 4P4JA 2JGDA 3CXHF 2PCUA 2AGAA 1Y76B 3FX6A 1KZFA 4WFGA 1MJ9A 3T9YA 5FLXN 1IY7A 2PJBA 1QNMA 3U11A 1KUQA 4Q20A 4JAAA 3GYAA 5IJ9A 4ONWA 4GM5A 1OCZB 1S0VA 3EXAA 1JJ2U 4BW9A 2QVPA 3OWCA 5HVFA 3BHPA 4DRXB 4WBNA 2RCVA 3STLC 3BRCA 1KB9F 2LGWA 1S7NA 4X8IA 1X12A 1KECA 4HNYB 2OYQA 2CY2A 1KUYA 3VARA 1M1DA 2NMTA 1QCEA 4OPHA 5ITZA 5KA6A 2R8VA 4AVAA 2F23A 2J9AA 2VQEB 5K1XA 2B1GA 3QNVA 1YSJA 1Q8IA 2B4DB 3PB7X 3OR7C 4NTWA 1MABG 2Q7EA 3PRTA 1VF5B 5AG4A 3B2EE 3G67A 2ZW7A 3H1JH 1GM9A 2GLFA 3IWEA 3CSXA 3BY6A 4MTGA 2ADPA 3WB1A 2PYLA 4LBEC 1UJWB 4J7ZA 4PA6A 3IU1A 5I0CA 1F2OA 1EZJA 4AHCA 4G2KA 2Y4TA 3I56V 4OC4A 4CH4A 5EYPB 1NSLA 4NVPA 4X66B 1KYOF 3DTUB 3MHHC 3W7SA 4M6HA 1AJNA 1YVWA 3SYCA 1BHBA 2C6CA 5KUKA 2Z3LA 4JV5B 3D3SA 2V8DA 2GE3A 4X89A 2RQ6A 4KFMA 3T1CA 1WAZA 4F0YA 2AFMA 3DGVA 1WN7A 5LP6C 4KOVA 2Z10A 1PYTB 4IK2A 2PC1A 2DOSA 3HLPA 3NA6A 4MFKA 4UWIA 1I94O 1T5EA 3OUFA 2DQ0A 5BXZA 4X88A 3V38A 3UT5B 2R7HA 3N2KB 1NE9A 2QEXV 3ZN1A 4M85A 3KZIZ 1I1DA 1O9GA 3PGPA 2E75B 2VS0A 2O53A 3B8NA 3L74H 1YQEA 3W7XA 5GONB 1FFTB 1HNXO 3PBEA 4Y49C 2ODFA 5LRJA 4YHHO 1GYTA 2GLJA 4FFBB 5LYJB 4ORFA 4DV4B 4Z65A 5CMUA 2PI5A 2Q0YA 4FD7A 4JYAB 3TC8A 3DXRB 4R76A 4O4JB 5CBFA 1HEEA 4DR6O 3QNEA 1FFXB 3D7DA 4JZ2A 2ETNA 2YI8A 2H3OA 1LRZA 3B8MA 1K9MW 2DQ3A 3R66A 4LP8A 3UT5A 2GREA 1DLBA 3OUSA 4OX9O 3KHXA 3CCLV 2WAMA 3AK3A 4NF1A 5TISZ 4MCSA 1AP6A 1K7DA 2BEIA 3TO6A 3ZIAG 2AE6A 2Q73A 1SQXH 3LSSA 4WFHA 4KOSA 1YK3A 3GWKC 3K5LA 2CNTA 3ZJ0A 2JBJA 4U3JB 5EZYA 2JIZG 2YIBA 3TTHA 1QLEC 1K4JA 4ZI6A 2OZUA 4FUUA 1Z2GA 2PJ7A 3CCJV 4J9YB 3AG4C 1JQGA 3HUVA 2EZOA 4UEEA 1S7KA 1TF9A 1JPXA 4JI2O 4E8OA 4RUHA 1S5KA 1NU1H 3D3IA 3L2NA 4DR7O 3HB3B 1GHEA 1N0JA 1VQ6V 4UUJC 2XNDG 2Q51A 2F95B 1COWG 4WFAV 2LFSA 1F4MA 2YSUB 2XHBA 3RAMA 2EJRA 3HKEA 4GLXA 1IURA 5CBMA 3SJXA 4NXNB 2VZYA 3ZHSA 2P6EA 4QE9A 1M4DA 1IIDA 5L3FA 4PDMA 3TX8A 4GUNA 2NSMA 2VRZA 3VQWA 3QAHA 5CPAA 1I5YA 3VQXA 5IB0A 4F6AA 1TGOA 3OMIB 3HKEB 2FT0A 4PXEA 4CYOA 4QGPA 1IBKB 4JGSA 3R9FA 3RO0A 4DJLA 1IBMO 4UCSA 3ZHVA 2DWEC 3ETEA 4B11A 2DPSA 3QTCA 1YSCA 4PHZA 3W91A 5LGUA 2CNMA 2P22C 3VOUA 3S6FA 3FYIB 1VQMV 2PIYA 1TKJA 3CMEV 4MVOA 5A9GA 3SYPA 4K35A 4ZKIA 3GB0A 2CAZC 2JEUA 1H2NA 2B1IA 1LNQA 3O9OA 1V55B 3SJCC 2DE0X 3ASNC 4DUZO 1XE4A 4ONUA 1XFOA 1FT7A 4O2BB 2KSDA 5H6RA 3FB6C 2F1MA 3BVOA 1MSDA 5B3SB 4JTDB 2A3QA 2X6CA 1IBMB 3T1HO 4DK0A 2UUBB 4WFBV 8CPAA 4XDKA 1Q7YW 4WF9V 5HFLA 1OZ0A 4JTCB 2F43G 4NGQA 3K5NA 3HKDB 2IJJA 4F6EA 3FNCA 2FCKA 4NXNO 1Y7RA 3D7GA 2ZPAA 2IU0A 3MDSA 3SJFA 1ENVA 4FLXA 4BBHA 2VL1A 4O4JA 4CGOA 3RT3C 3DXRA 1YITV 1WPXA 4AXVA 4R8CA 2YIDA 4X1IB 1KP2A 1MZFA 2IJHA 4GS4A 1QQCA 4B12A 4C2XA 1UFIA 4MW3A 4J80A 3JD4A 1QVGU 3K03A 2VXKA 1ZAUA 2HP8A 1TUEB 3LNMB 3T1YB 4JPRA 5IJ0B 2N04A 5F2VO 5AG7A 3VWDA 3CRMA 3V8IA 3S6GA 4CS4A 3OTOO 4B10A 3B3VA 2QWQB 4I4TA 3N2KA 2OH1A 2OR4A 3FAVA 1VQLV 4OC3A 3JTKA 4JLYA 5DEDA 4M6GA 5IY5C 3SJBC 2WPXA 4MRIA 3CCUV 2OT5A 2GDSA 3OMAB 4HPSA 4MSWC 1M1KW 4XBFA 3B3SA 2WPWA 5FPRA 4DR2B 2JGUA 1VIBA 2UUAB 1ORQC 2VWJA 2Q44A 1Q6HA 1KKDA 4JD6A 2E76B 1XBUA 3QG5A 5BWAB 2EIMB 4CGPA 2ZE8A 1U97A 3WG7C 3JAMN 5EC4A 5JCOA 1ZWIC 4N21A 2AHYA 1IICA 1M5IA 4ZI7B 2QDOA 1Q2YA 2BL1A 1R3JC 4JZGA 1YTFD 2NYQA 1DF4A 3BJ8A 2Q4VA 1IX9A 3CEIA 1W59A 2OB0A 4KOTA 2HHHO 2PJ2A 1N71A 3T2MA 2EIMC 1MOFA 2ARHA 5J2UA 4FM2A 4F8ZA 1M57B 3UQ8A 1PNLA 2R70A 2X7RB 1OCRC 3TT2A 2ZOFA 2HG5C 3TOBA 5A28A 3F0AA 3FB3A 3I9SA 4ICGA 1XQ8A 4YXWG 1KKCA 3L71H 5DM6V 5F47A 2A06H 4NGPA 2VBQA 3PBBA 1AROP 2H94A 2E5LO 2ZW4A 4I9QA 4IF5A 3SJQC 1IGBA 2CH7B 1N34B 5JJNB 5KUMA 2OTLV 2YDEA 1H2SB 3EVKA 1OCRB 2V4DA 3RGBA 1U96A 2DN9A 4DV0B 2A0LA 4R6TA 1W2BU 3JATB 5DS0A 2CTQA 2XAQA 1SKVA 4E4EA 3KR5A 3Q4HA 1HWYA 1XEQA 2PUSA 3BXMA 3JUWA 3D36C 1JCHA 1V55C 5KHJA 2P4KA 2Q0OC 2Q7GA 2VI7A 1SRYA 1BSMA 5L3EA 1HDUA 3JASB 1XRYA 3PZJA 3IWGA 1AI6A 5BZBA 4BIZA 2WWWA 4LFAO 1Y74A 4H44B 1YVOA 3U10A 4JV5O 1GAXA 4ZYQA 4F9UA 1ZL8A 4KVXA 3LDCA 1HR0O 2EBJA 1WA8B 5LBQA 1JFFA 2ZM6O 3FEEA 4KVME 1L0LH 1EZVH 2A7WA 2VQEO 4MS2A 4TNUA 2Z3YA 2EZPA 4YY3B 2F4VB 3L70H 5LHGA 4TSFG 3TCUA 4FIPC 4UFXA 1MG1A 1OV9A 4BIUA 2WLLA 1CBXA 4UFWA 4TWKA 4PJ0Z 4B3RB 4Q38A 5JVDA 3CC7V 3BA8A 1XJOA 2ZW5A 1S3JA 4KOXA 4HYOA 2V77A 3GVMA 1BCCH 3BAAA 2XAHA 2BCOA 2XEGA 4MHYA 5EMIA 5H84A 4KVOE 4A5UB 3ZHUA 3ICXA 4YHHB 2W0FC 3CP1A 2XUMA 3D67A 3IFEA 5LP6B 4YJ2B 4J11A 2UUCO 5F49A 1SZXA 4A30A 2ZXVA 5IYZA 4MXUA 5K8OA 2RDCA 1CJWA 3E89A 2ZKOA 3B3CA 1VQNV 3K04A 3ASNB 3FBUA 1HW7A 3WABA 2GUZB 2KG7A 4CH5A 3ZMSA 4GKKO 2CTPA 2MW2B 4X1IA 2V8HA 1N0NA 1PNMA 2CGOA 2ITDC 1K3EA 4I55A 2YNCA 4YJ2A 2UU9B 3O65A 4DUYB 3ZBHA 3CYOA 4ZY0A 4BW5A 1Q3EA 4OAEA 3DR6A 1PUAA 3SPJA 4GKJO 2ZIMA 3SI1A 3FIXA 1H8LA 3UO2A 2AW9A 6CPAA 1XEBA 1Q81W 1BQZA 1JQ0A 1S5LZ 2Y69C 4AG9A 3G6EV 4TV8B 4C7UA 2Q0AA 4DV4O 3B8GA 3GKRA 2WLLB 4UXNA 2JS3A 5LMNB 1WA8A 4JAVA 5F46A 1G6UA 3CS5A 5CA1A 1XMQB 3ZHTA 3T4DA 4DW0A 1QSNA 2PJ6A 4PXCA 4K3AA 3W6SA 5A27A 2ZEPA 4P30A 4E0AA 2QJ1A 4FLWA 1BPNA 4HAMA 3FX7A 4J10A 1IOIA 4LX9A 1UFHA 4OKOA 3RNZA 1NQTA 1WP7A 2JDIG 4RUFA 3K5MA 5HH1A 4LQGA 4P9PA 4DR7B 5AG6A 5LMUO 3JD3A 3RVYA 3DSBA 2HVJC 3H1IH 3ZHQA 5KX5A 3IO1A 1XDCA 3IWWA 4MFJA 4KOWA 1FXKC 4LF9O 4D7SA 2GFQA 2IJZA 1A32A 4JI4B 1J4JA 2QWRB 1I94B 1FXVA 4ZI7A 2R98A 1QR9A 2E74B 4AB7A 4PDRA 4XDJA 4DR6B 5AGEA 3W7UA 4JI4O 4J42A 2JEWA 3CXPA 3FKSG 4JASA 3D2PA 4J7KA 3OAAG 4YJ3B 4LFCB 2EX3A 1N8RW 3ZN0A 3AK1A 3K9TA 3D8PA 1H2GA 2QKCA 3WT4A 3NH4A 3I3GA 3ABLB 2HQYA 4UCOA 4EB6B 1Q43A 3MD0A 3N2GA 4X1KB 1WK4A 1KP3A 2UXCO 2EIJB 1FXHA 5LRKA 5B1AB 3ZX6A 2Y0IA 3RYHA 3P32A 2QWNB 4OGQB 1VQ8V 1DTDA 5CA1B 3TCVA 5H6QA 3ZMUA 2VQFO 4FLZA 2AJ6A 4FFKA 1TVKA 1TKHA 3E83A 1TA8A 3SXOA 3T4ZA 3P3PA 5B5EZ 2CUGA 1GKFA 1Z9UA 2JVDA 1IBKO 3D7FA 1M90W 4PA9A 1H2KA 1V9PA 2Q8VA 2AHZA 4B3TO 4B5OA 4MCQA 4TUYA 4BD9A 1YJWV 7CPAA 5B1AC 4KHPO 1NH2D 2FL4A 2R9IA 1AJPA 3OR6C 1SA0B 3PN1A 2ZEOA 3LUTB 3E22A 4NXMO 5GW7A 3R9GA 2PSWA 1Y66A 1IYLA 4NEXA 1X59A 2REFA 2XOKG 2QYVA 5DWMA 4B5PA 4LH6A 1YLOA 4QC6A 3IFXA 1D2DA 5JGFA 1NZ6A 2CXAA 3STZC 1QLEB 3ZRXA 4O4HB 4ZOLB 1SC5B 2J8NA 2QR4A 4R9MA 2V8VA 4MVQA 1WP8A 3E2EA 5LGNA 3IU2A 4B3TB 5KTAA 4O4LA 3CCSV 1TUBA 4NGSA 1AMPA 5E1AC 1AR5A 2KB1A 1RPRA 2XEIA 4ZHQA 4UB8Z 5D8NA 2Q9LA 4CAFA 4C7HA 4NYKA 2YICA 4ZY2A 3TETA 4OC0A 2DWDC 3F7VC 1VHSA 5LYLA 4F4LA 2BOAA 2JRIA 3ABMC 4ASUG 2ZE5A 4DV7O 1FJGB 2BTOA 5IYCO 1PNKA 1XBLA 1GMGA 4FJCC 4FD5A 4A33A 4KORA 4CAEA 1BE3H 5LYIA 2P4VA 2WSSG 4HNXB 5J1QA 4C7IA 2NN4A 1B04A 1NBMG 3RFRA 1VHEA 1S5HC 1JFFB 3ZS8C 5IWAO 1IOFA 3FJUA 1LCPA 3KG2A 2GHYA 4UV9A 3CCEV 5IY5B 4DUKA 2AXTZ 1B6BA 1Y0YA 4HZ3A 3B09A 3ASOC 5IWAB 4O2BA 5CB4A 3FYEB 2WLMA 4EFEA 5KTDA 2P90A 2W6IG 3VQVA 4BWAA 2F4VO 2EIKC 2PR1A 3IC1A 3E0KA 4X62B 3V7ZA 5ISVA 1V54C 4UA3A 2Q4PA 3PB8X 3K2KA 3FECA 2XAJA 4ZX9A 1GM7A 1URFA 2RFHA 2XEFA 1IYKA 1ZX3A 2LO1A 5BY1A 5IE9A 4JZ0A 2PRQA 4YGOA 5KHGA 2N74A 2H8PC 4KSFA 4NR1A 2QJ8A 3CRAA 3N5FA 2CGNA 3G8WA 4ZGYB 3ISZA 2Q7HA 3VATA 4KSAA 4NGRA 1H2MA 4JYCA 4TV9B 1N34O 3C3SA 4UVCA 3B7IA 2XT9A 3FMCA 3RBUA 2HJFC 2XAFA 5J8CA 4IIJB 1ON0A 1PD3A 4PSWA 1QSTA 4I50A 3K08A 3ZZIA 3CWBH 1GO3F 5IYBO 2HHHB 2AFOA 3EO4A 2FMLA 3NH5A 2UXDB 1K92A 4DYOA 1VIXA 3WC5A 4Q36A 1XMOB 1VQPV 2QECA 4X65O 1NS1A 2WLIA 1WNSA 3A8TA 1Y7EA 2OOTA 2YEVA 1P7BA 2QM4A 4MT8A 3BABA 1HR0B 2FVGA 1SZTA 2Z3KA 4LQ6A 5K8MA 4JYYA 3QVNA 2G9DA 4FWUA 3SPHA 4FVMA 2ANPA 4IT5A 3CC2V 1Z5WA 4D6TH 2POKA 3GUXA 3RW0A 1B87A 3R1KA 1UPGA 3A0BZ 2FSRA 2ZT9B 3B77A 4HKFA 3X2QB 4NFRA 2CTBA 1AVMA 4MFZA 2DYRC 2OIEA 5FL7G 5KAFZ 1KC8W 1BO4A 1S60A 3NH8A 2BSWA 2K5TA 4PDLA 2Y0PA 4YY3O 4G1PA 2ZW6A 2QGNA 2UXBB 2OZHA 3TGUH 3DLJA 3SGIA 1XOVA 4E2AA 3FAVB 4CYQA 5G20A 1VKCA 2XTAA 4MJ8A 1P7GA 3PB9X 3IGAC 3K9UA 4FMTA 4JYAO 1S72V 4II9A 4GX2A 4C68A 2DMXA 1Q6IA 4A37A 4XPKA 1MK4A 3UY5A 2OCHA 4LC1A 1RM1C 3ML0A 2VZZA 3SJGA 1XHZA 1YJ9V 2PIZA 3R96A 2KQXA 4LH7A 3EFAA 4JI0B 2OWOA 2YXLA 2ZCEA 4R87A 2D3OW 3ABMB 4GKJB 1NT2B 2Z3PA 4Z1MG 5LA6A 4MFLA 4GT1A 4JI1B 1YI2V 1YIJV 2UU9O 4P4EA 4B5PB 2D4OA 4MCPA 4OX9B 4UCVA 1YGHA 1KU9A 4RQEA 4KLVA 1M9NA 2YUAA 4CRZB 4DR3O 1OCCB 4O23A 2XEJA 2CIJA 1I08A 3D7HA 2ADQB 3D3QA 4MFQA 4RUEA 2V8GA 1FPOA 1X4TA 1N33O 4DV5O 1AB3A 1TKFA 4WBNB 3KI9A 4MVUA 1K97A 4UWJA 3CPXA 2Y69B 3IC7A 4FD4A 1VMGA 3SYAA 2O57A 3PB6X 4O4LB 4WCEV 2ZIOA 2HC9A 4OC1A 1B6QA 1JX9A 2EIKB 4NGMA 3LODA 1WLEA 4AI8A 2WA3A 3APQA 4KLWA 3E8GA 4FZ0A 2ZXWC 3P2FA 2HVKC 3E35A 5ITZB 1LANA 1K5QA 4P4FA 3WB2A 1XNRB 1YHQV 1HNWB 4LFBO 3ETGA 1M57C 1ARLA 4RQFA 4JJXA 4ZY1A 3LDEA 5JJEB 1HNZB 4K8XA 1G1XB 2A4NA 3WR7A 1FS0G 2CNSA 4EFDA 4KUBA 5LHHA 5F09A 2C2AA 1WB8A 3S9MA 1JWQA 2AFWA 4CH3A 4OIWA 5IJ9B 4TV9A 2F93B 4A2ZA 4YWYA 1NR1A 4R6ZA 1Q2DA 4FLUA 1LUWA 1Y76A 3KCXA 3IGRA 5HXDA 3AG1C 3DC6A 3DR8A 2P67A 2B3UA 2O28A 3FYNA 4RWUA 4DO2A 5IDJA 2FIAA 1CPYA 4JI7O 1Q90D 4GKKB 1EN5A 2QIRA 1XHXA 4C2YA 3H01A 2Z11A 5HVGA 2ATKC 3CJHB 4AVBA 4KXRA 4UCUA 4TOIA 4F6RB 3E8BA 2Q5ZA 4X64B 1RXTA 5D5PA 2EILB 3BPZA 2DPTA 4DR1B 5DWNA 4IHJB 1HP8A 2F8HA 1ROPA 4W4LA 4YU9A 5LOVA 2AFZA 2FKXA 4FFBA 3FEDA 5G21A 4LF4B 4A39A 4R3KA 4U9YA 3HKCB 5JPHA 1Q7LA 4TWEA 1N36B 4H0LB 4HNAB 5L3BA 2BSKA 2G0BA 4TT3G 4FZ1A 1I0HA 2WPDG 5JWPA 3L9DA 5IV0A 1IBLB 2YS8A 1EE3P 2GTAA 1SETA 1N36O 2QWOB 1CP7A 1I21A 3JCZA 3BFRA 5GTHZ 5C8YB 3TO7A 2E3CA 4MTXA 1IBLO 2F7VA 5HMNA 4X20A 5IYDO 1Y9KA 1XI1A 3LDDA 3CHXA 3RN4A 5KLVH 3D4UA 2PTMA 4PELA 4OC5A 1N32O 3CT9A 3CXCU 5G22A 1VHOA 4CGMA 3ISXA 3AG7A 1FYJA 1Q86W 1XREA 4FAIA 4MBUA 1QBZA 4ZBMA 4YIOA 4BR6A 3ABUA 2HEPA 4H37A 5EYPA 1P4NA 5JM6A 3ASOB 4PI0A 3KGQA 4B13A 3SHPA 4Z1VA 1LOKA 1R3NA 3CC4V 3J80N 1I5XA 1VF6C 3QO7A 3T1YO 1M4GA 1GK9A 3WC7A 1YMEA 1N4CA 2NR5A 3E86A 3RYFA 2EWBA 1RFYA 1BOBA 3RYIA 1ZSPA 1EN6A 2K1EA 4JYWA 4LNUA 1MJAA 3PP9A 1SQHA 3CRQA 4MI4A 4FBEA 1MJBA 1R43A 4MHNA 1GRJA 2Q67A 3IIBA 5JVDB 3H8GA 3BCCH 1W0JG 1Z8XA 4P6YA 4DV7B 4FM0A 1F51A 2PJ3A 1VF6A 2Q43A 3KKWA 4CH6A 2JJ1G 3TK1A 4P10A 3UO3A 4A38A 4O2AB 1NVPD 1IB1E 4DV1O 1PPJH 4R3LA 1NSAA 1MNGA 4PQAA 3KR4A 4KHPB 3RZAA 1K33A 1W0KG 4DV2O 5EC2C 4NGTA 3RYIB 2NNUA 1R6NA 4GXHA 3SYOA 3S3XA 3RYFB 2CE4A 1Q2CA 2ZXWB 2CDYA 2XASA 2EUIA 4MTOA 1K8AW 5LGTA 3K9AA 5H9CA 4MHPA 4QIWF 4CGNA 3CDXA 3EFFK 1P84F 1CP6A 1NH2B 2WZNA 1QMUA 4OADA 3SYQA 2HR3A 3JATA 1OZPA 2B4BA 3BI1A 1ELMP 3A2FA 1VQ4V 3D68A 4PK2A 1PP9H 3OEHG 5C88A 2PR8A 4DRXA 1CPXA 1EBOA 5KAIZ 2PY5A 1H2LA 2OU2A 3H5ZA 1DE4C 4EWTA 3HKBA 4JI5B 2EVNA 2Q4YA 5CA3A 1JA8A 5FVJA 4A95A 4DR4B 4PA3A 3JVNA 1NR7A 1LAPA 4L8JA 1PCAA 1JOYA 1K34A 2IH3C 3X2QC 3NXSA 1RO5A 4PDVA 3VQYA 4HNWB 1JMKC 2YC0A 4Q7AA 5JJJB 3HKCA 5H86A 2DJVA 2JGDB 3GB7C 4NXYA
chains in the Genus database with same CATH topology
4QBJA 1S3ZA 1S7KA 3N7ZA 4E8OA 2FXFA 1S5KA 2KCWA 3IU2A 5KTAA 1TIQA 2HUZA 1GHEA 4X5KA 3TFYA 3NE7A 4CAFA 4QB9A 3MGDA 4M3SA 4C7HA 1Y9WA 2VZYA 4U5YA 3LD2A 3GY9A 1VHSA 2P6EA 1ZO0A 1M4DA 1IIDA 3DDDA 2GANA 3QAHA 5F48A 4FD5A 4PSXA 2Y0MA 4A33A 4KORA 4CAEA 5IX3A 5IB0A 4HNXB 3BLNA 3S6KA 4F6AA 3DNSA 4C7IA 4F0XA 2YNEA 3F5BA 2FT0A 2I79A 4CYOA 2WSAA 3R9EA 1WWZA 3F8KA 3R9FA 1I12A 4R57A 1S7FA 1B6BA 4B11A 2DPSA 4XPDC 1P0HA 2Z0ZA 3W91A 5KTDA 2CNMA 2PR1A 3E0KA 3S6FA 3H4QA 2VQYA 5ISVA 2ATRA 1XIXA 4KOUA 1YR0A 4UA3A 1IYKA 4UCNA 1XE4A 4ONUA 3TO9A 4EVYA 2P6FA 2PRBA 4XPDB 4YGOA 2X7BA 2JEVA 2J8MA 2C27A 4KSFA 2B4DA 2Z3OA 3G8WA 2REEA 4ZGYB 4JXQA 4KSAA 5G1ZA 5J8CA 1ON0A 4PSWA 1QSTA 4CAVA 2Q7BA 3ZZIA 2JLMA 3EO4A 3FNCA 2FCKA 2FS5A 1Y7RA 4Q36A 2ZPAA 4JWPA 4BBHA 2QECA 4CGOA 2B5GA 2P0WA 5C82A 1KUXA 4GS4A 4B12A 4C2XA 4YFJA 2Z3KA 2VXKA 4A31A 4CYNA 3VWDA 1M4IA 5AG7A 4LUAA 3V8IA 3BJ7A 1L0CA 4ZBGA 4NCZA 3S6GA 4B10A 2FIWA 2OH1A 4B14A 4L89A 3JTKA 1B87A 3R1KA 4JLYA 4J3GA 2FSRA 3P2HA 1Z4RA 5GCNA 1QSMA 4HKFA 1YLEA 2WPXA 4MFZA 1BO4A 1S60A 2B5GB 2BSWA 2K5TA 2WPWA 4CAWA 2ZW6A 2GIVA 2OZHA 4KS9A 2F5IA 2Q44A 4E2AA 4JD6A 4CYQA 5JQ4A 5G20A 1VKCA 5BWAB 4CGPA 4MJ8A 5KTCA 5EC4A 3K9UA 3W6XA 1IICA 4II9A 2H5MA 1Q2YA 2BL1A 4C68A 3BJ8A 2Q4VA 2QMLA 4XPKA 1MK4A 3UY5A 1XMTA 2OB0A 4KOTA 4RS2A 2VZZA 2WUUA 4UCMA 1N71A 3R96A 1QSOA 2ARHA 2I00A 3EFAA 3RYOA 1KUVA 4R87A 2YNCC 3FRMA 3TT2A 2Z3PA 4XPLA 4MFLA 3TOBA 5A28A 3FXTA 3SXNA 3F0AA 3FB3A 3I9SA 4B5PB 3CXQA 2D4OA 2JDDA 5F47A 2VBQA 1YGHA 4QVTA 4KLVA 4CS0B 2ZW4A 4CRZB 4C2ZA 4IF5A 3G3SA 4DNCA 3TOAA 4MFQA 2R1IA 4FD6A 4L8AA 1R57A 4BMHA 3R95A 3C26A 3JUWA 3CXSA 4UWJA 1S7LA 4UBRA 4FD4A 2D4PA 2VI7A 4I49A 4AG7A 4KZTA 4AVCA 3PZJA 3IWGA 4NSQA 1YVOA 1XF8A 2DXQA 3LODA 4KVXA 3TE4A 4KLWA 4KVME 3P2FA 4CRYB 1Z4EA 3D2MA 4KOYA 4JJXA 5E96A 3T90A 4UFXA 3WR7A 2A4NA 2Z3NA 4UFWA 2CNSA 4KUBA 2B58A 4H89A 4Q38A 4H6UA 3VWEA 2ZW5A 3EXNA 4OLLA 2Z3MA 4KOXA 2P6GA 2HV2A 4A2ZA 2G3TA 2J8RA 4KVOE 5H84A 1Q2DA 1M44A 1PU9A 5EBVA 3IGRA 1YX0A 3DR8A 2B3UA 2O28A 1YVKA 3FYNA 5F49A 2IL4A 4CGLA 2YGWA 2FIAA 2ZXVA 4A30A 4K30A 4UFVA 4KUAA 1CJWA 2VEZA 2QIRA 2YNDA 4C2YA 3S6HA 2Z11A 4AVBA 1U6MA 3FBUA 1KZFA 2BUEA 1MJ9A 3T9YA 1CM0A 3A9LA 1RXTA 1QSRA 3GYAA 2YNCA 2DPTA 4JXRA 5DWNA 5J8FA 4PV6A 4OAEA 3DR6A 1PUAA 4QUSA 5G21A 4RI1A 3FIXA 3OWCA 2B3VA 4R3KA 4IUSA 4U9YA 1FY7A 1XEBA 5JPHA 1S7NA 2Q04A 2PDOA 4HNYB 4AG9A 2G0BA 2CY2A 1KUYA 3B8GA 1M1DA 2NMTA 3GKRA 5IV0A 2R8VA 4AVAA 1YREA 1NMTA 4CYPA 1I21A 2B4DB 3TO7A 5F46A 5HMNA 1QSNA 3EY5A 5AG4A 1Y9KA 3W6SA 5A27A 2ZW7A 3QB8A 4MFPA 4E0AA 3IWEA 5AG5A 5G22A 4CGMA 4LX9A 1UFHA 3IU1A 5I0CA 4MBUA 1P4NA 1NSLA 4PK3A 4B13A 5HH1A 3SHPA 4Y49B 5AG6A 1M4GA 3DSBA 2Z3LA 3D3SA 4MFJA 2GE3A 4KOWA 2OZGA 1BOBA 2PQ8A 4F0YA 4XNHC 1J4JA 1MJAA 2R98A 3PP9A 4KOVA 1SQHA 4AB7A 4MY3A 2Z10A 4MI4A 1MJBA 5AGEA 2PC1A 4MFKA 4UWIA 4U9ZA 3CXPA 4H6ZA 3D2PA 2R7HA 3KKWA 1NE9A 4M85A 4A32A 1IB1E 1I1DA 3PGPA 3D8PA 4XNHB 4R3LA 4CAXA 3I3GA 2HQYA 4Y49C 1WK4A 4ORFA 2Q0YA 4FD7A 1Q2CA 4UCPA 2EUIA 3TCVA 2AJ6A 4YRHA 1LRZA 3SXOA 4CGNA 2G3AA 1V0CA 1Z9UA 2FE7A 4OADA 1OZPA 2B4BA 4NF1A 5C88A 4PK2A 4B5OA 2PR8A 2FL4A 2BEIA 2OU2A 2JDCA 3H5ZA 4MHDA 3TO6A 2AE6A 4KOSA 3R9GA 5CNPA 1YK3A 2PSWA 2EVNA 2Q4YA 1IYLA 2CNTA 4NEXA 2REFA 5FVJA 3ZJ0A 4A95A 3JVNA 2RC4A 5DWMA 4B5PA 3TTHA 1RO5A 4HNWB 4QC6A 4MY0A 1K4JA 2OZUA 2CXAA 5H86A 2J8NA 4R9MA 3EC4A 4NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QBJ A;  1S3Z A;  1S7K A;  3N7Z A;  4E8O A;  2FXF A;  1S5K A;  2KCW A;  5KTA A;  1TIQ A;  2HUZ A;  1GHE A;  4X5K A;  3TFY A;  3NE7 A;  4QB9 A;  3MGD A;  4M3S A;  1Y9W A;  2VZY A;  4U5Y A;  3LD2 A;  3GY9 A;  1VHS A;  2P6E A;  1M4D A;  1IID A;  3DDD A;  2GAN A;  3QAH A;  5F48 A;  4FD5 A;  4PSX A;  2Y0M A;  4KOR A;  5IX3 A;  5IB0 A;  4HNX B;  3BLN A;  3S6K A;  4F6A A;  3DNS A;  3F5B A;  2FT0 A;  2I79 A;  3R9E A;  1WWZ A;  3F8K A;  3R9F A;  1I12 A;  4R57 A;  1S7F A;  1B6B A;  4XPD C;  1P0H A;  2Z0Z A;  3W91 A;  5KTD A;  2CNM A;  2PR1 A;  3E0K A;  3S6F A;  3H4Q A;  2VQY A;  5ISV A;  2ATR A;  1XIX A;  4KOU A;  1YR0 A;  4UA3 A;  1IYK A;  1XE4 A;  4ONU A;  3TO9 A;  4EVY A;  2P6F A;  2PRB A;  4XPD B;  4YGO A;  2X7B A;  2JEV A;  2J8M A;  2C27 A;  2B4D A;  3G8W A;  2REE A;  4JXQ A;  5J8C A;  1ON0 A;  4PSW A;  1QST A;  4CAV A;  2Q7B A;  3ZZI A;  2JLM A;  3EO4 A;  3FNC A;  2FCK A;  2FS5 A;  1Y7R A;  2ZPA A;  4JWP A;  2QEC A;  2B5G A;  2P0W A;  5C82 A;  1KUX A;  4GS4 A;  4YFJ A;  2VXK A;  3VWD A;  1M4I A;  4LUA A;  3V8I A;  3BJ7 A;  1L0C A;  4ZBG A;  4NCZ A;  3S6G A;  2FIW A;  2OH1 A;  4L89 A;  1B87 A;  3R1K A;  4JLY A;  4J3G A;  2FSR A;  3P2H A;  1Z4R A;  5GCN A;  1QSM A;  4HKF A;  1YLE A;  2WPX A;  1BO4 A;  1S60 A;  2B5G B;  2BSW A;  2K5T A;  2WPW A;  4CAW A;  2ZW6 A;  2GIV A;  2OZH A;  2F5I A;  2Q44 A;  4E2A A;  4JD6 A;  5JQ4 A;  1VKC A;  4MJ8 A;  5KTC A;  5EC4 A;  3K9U A;  3W6X A;  1IIC A;  4II9 A;  2H5M A;  1Q2Y A;  2BL1 A;  3BJ8 A;  2Q4V A;  2QML A;  4XPK A;  1MK4 A;  3UY5 A;  1XMT A;  2OB0 A;  4KOT A;  4RS2 A;  2VZZ A;  1N71 A;  3R96 A;  1QSO A;  2ARH A;  2I00 A;  3EFA A;  3RYO A;  1KUV A;  4R87 A;  3FRM A;  3TT2 A;  4XPL A;  3TOB A;  3FXT A;  3SXN A;  3F0A A;  3FB3 A;  3I9S A;  4B5P B;  3CXQ A;  2D4O A;  2JDD A;  5F47 A;  2VBQ A;  1YGH A;  4QVT A;  4KLV A;  4CS0 B;  2ZW4 A;  4CRZ B;  4IF5 A;  3G3S A;  4DNC A;  3TOA A;  2R1I A;  4FD6 A;  4L8A A;  1R57 A;  4BMH A;  3R95 A;  3C26 A;  3JUW A;  3CXS A;  4UWJ A;  1S7L A;  4UBR A;  4FD4 A;  2D4P A;  2VI7 A;  4I49 A;  4AG7 A;  4KZT A;  4AVC A;  3PZJ A;  3IWG A;  4NSQ A;  1YVO A;  1XF8 A;  2DXQ A;  3LOD A;  4KVX A;  3TE4 A;  4KLW A;  4KVM E;  3P2F A;  4CRY B;  1Z4E A;  3D2M A;  4KOY A;  4JJX A;  5E96 A;  3T90 A;  3WR7 A;  2A4N A;  2CNS A;  4KUB A;  2B58 A;  4H89 A;  4H6U A;  3VWE A;  2ZW5 A;  3EXN A;  4OLL A;  4KOX A;  2P6G A;  2HV2 A;  2G3T A;  2J8R A;  4KVO E;  5H84 A;  1Q2D A;  1M44 A;  1PU9 A;  5EBV A;  3IGR A;  1YX0 A;  3DR8 A;  2B3U A;  2O28 A;  1YVK A;  3FYN A;  5F49 A;  2IL4 A;  2FIA A;  2ZXV A;  4K30 A;  4KUA A;  1CJW A;  2VEZ A;  2QIR A;  3S6H A;  2Z11 A;  4AVB A;  1U6M A;  3FBU A;  1KZF A;  2BUE A;  1MJ9 A;  3T9Y A;  1CM0 A;  1RXT A;  1QSR A;  3GYA A;  4JXR A;  5DWN A;  5J8F A;  4PV6 A;  4OAE A;  3DR6 A;  1PUA A;  4QUS A;  4RI1 A;  3FIX A;  3OWC A;  2B3V A;  4R3K A;  4IUS A;  4U9Y A;  1FY7 A;  1XEB A;  5JPH A;  1S7N A;  2Q04 A;  2PDO A;  4HNY B;  4AG9 A;  2G0B A;  2CY2 A;  1KUY A;  3B8G A;  1M1D A;  2NMT A;  3GKR A;  5IV0 A;  2R8V A;  4AVA A;  1YRE A;  1NMT A;  1I21 A;  2B4D B;  3TO7 A;  5F46 A;  5HMN A;  1QSN A;  3EY5 A;  1Y9K A;  3W6S A;  2ZW7 A;  3QB8 A;  4E0A A;  4LX9 A;  1UFH A;  5I0C A;  4MBU A;  1P4N A;  1NSL A;  4PK3 A;  5HH1 A;  3SHP A;  4Y49 B;  1M4G A;  3DSB A;  3D3S A;  2GE3 A;  4KOW A;  2OZG A;  1BOB A;  2PQ8 A;  4F0Y A;  4XNH C;  1J4J A;  1MJA A;  2R98 A;  3PP9 A;  4KOV A;  1SQH A;  4AB7 A;  4MY3 A;  2Z10 A;  4MI4 A;  1MJB A;  2PC1 A;  4UWI A;  4U9Z A;  3CXP A;  4H6Z A;  3D2P A;  2R7H A;  3KKW A;  1NE9 A;  4M85 A;  1IB1 E;  1I1D A;  3PGP A;  3D8P A;  4XNH B;  4R3L A;  4CAX A;  3I3G A;  2HQY A;  4Y49 C;  1WK4 A;  4ORF A;  2Q0Y A;  4FD7 A;  1Q2C A;  2EUI A;  3TCV A;  2AJ6 A;  4YRH A;  1LRZ A;  3SXO A;  2G3A A;  1V0C A;  1Z9U A;  2FE7 A;  4OAD A;  1OZP A;  2B4B A;  4NF1 A;  5C88 A;  4PK2 A;  4B5O A;  2PR8 A;  2FL4 A;  2BEI A;  2OU2 A;  2JDC A;  4MHD A;  3TO6 A;  2AE6 A;  4KOS A;  3R9G A;  5CNP A;  1YK3 A;  2PSW A;  2EVN A;  2Q4Y A;  1IYL A;  2CNT A;  4NEX A;  2REF A;  5FVJ A;  3ZJ0 A;  3JVN A;  2RC4 A;  5DWM A;  4B5P A;  3TTH A;  1RO5 A;  4HNW B;  4QC6 A;  4MY0 A;  1K4J A;  2OZU A;  5H86 A;  2J8N A;  4R9M A;  3EC4 A;  4NXY A; 
#chains in the Genus database with same CATH topology
 2JK5 C;  4QBJ A;  1S3Z A;  2ZNJ A;  4MVS A;  1B06 A;  2QTS A;  3K58 A;  4JI6 O;  3N7Z A;  3LWU A;  5B3S C;  3LSQ A;  2ZD9 A;  3N27 A;  2PJ9 A;  5C93 A;  2CF4 A;  1LR1 A;  3BA9 A;  4KUM A;  4X5K A;  1G4Y B;  1OCO C;  1YDX A;  4JI5 O;  1E79 G;  2FB5 A;  3LAC A;  1IDS A;  4QB9 A;  2GU2 A;  3ZMT A;  4P4I A;  1Y9W A;  4QPJ A;  3PFO A;  3LD2 A;  2BSK B;  1XMO O;  4JI3 O;  4LF5 B;  3G80 A;  1ZO0 A;  3M8A A;  1TAE A;  3CX5 F;  4I7Z B;  4W9Y A;  2ZED A;  1VP7 A;  3VBB A;  1R6K A;  2ZDI A;  4M6I A;  2JBK A;  4ABM A;  5F48 A;  3DSQ A;  2QKA A;  1OCO B;  5LRG A;  5IX3 A;  4IHJ A;  1NTZ H;  3BLN A;  1EFR G;  3F5B A;  3JAK A;  1MMM A;  1YXB A;  4P45 A;  4PXD A;  1YEW A;  2WSA A;  3L72 H;  3E8F A;  2UUC B;  1WWZ A;  3PFE A;  1Q6U A;  4KP4 A;  4HBN A;  2EO8 A;  4F6R A;  2PJ4 A;  3KZW A;  3OGC C;  1I12 A;  2IU3 A;  1AI5 A;  2ZR3 A;  4R57 A;  1S7F A;  3B35 A;  4G28 B;  4EFB A;  4B7E A;  1MA1 A;  1L0N H;  4XPD C;  2DYR B;  2ZQM A;  5EBL C;  4IYI A;  5AG2 A;  1OCZ C;  1Z5V A;  2Z0Z A;  4MTF A;  2LW1 A;  1S5J A;  3BHX A;  1HNW O;  4LFB B;  2EK8 A;  5KHK A;  3GIU A;  2VQY A;  2ATR A;  2N05 A;  1YR0 A;  1HNZ O;  3GWO A;  3EHB B;  4P9O A;  4DUY O;  3S9N A;  4EVY A;  2ZEM A;  2PRB A;  4XPD B;  1L1F A;  1SF9 A;  1Q5O A;  3NR7 A;  3ZRW B;  4CC6 A;  5EK0 A;  1IXB A;  4LFC O;  2C27 A;  2J8M A;  1DGS A;  3CPW U;  4R50 A;  2QM7 A;  1DF5 A;  2LJ2 A;  3F5T A;  3K3W A;  3W7W A;  2Q4Z A;  4P4D A;  1HNX B;  3MHS C;  5CA0 A;  3AK2 A;  4O2A A;  4B3S B;  4CAV A;  2ZNI A;  2HJD A;  4DYL A;  2FS5 A;  2PJ5 A;  3P30 A;  4X65 B;  2PJC A;  1UWY A;  3OM3 B;  4W4K A;  3JAL B;  1F7Y A;  4OME A;  1NTM H;  2R9A A;  2B5G A;  5FPO A;  5KHH A;  1IU8 A;  2LW7 A;  2M6Y A;  4I4T B;  5C82 A;  3H8E A;  1KUX A;  1ZG8 A;  2GUZ A;  1EM1 A;  4PV1 B;  3JSN A;  2CTR A;  4YFJ A;  4GCZ A;  2ZEF A;  3MAQ A;  2Y4U A;  1FNO A;  1JR9 A;  4A31 A;  4CYN A;  3ZMZ A;  4LUA A;  3BJ7 A;  2AZ2 A;  3ZRS A;  4OID A;  5IYZ B;  4X1Y A;  4NCZ A;  4ZBG A;  1GTO A;  5K8N A;  2CK3 G;  4MVM A;  1YJN V;  2FIW A;  3G6B A;  3K5O A;  4B14 A;  4K8Z A;  2WLK A;  2V7Q G;  4F9V A;  2Q68 A;  1WPB A;  2EIJ C;  5D5Q A;  2YXY A;  4P2Z A;  5GCN A;  1M4U A;  2HFE C;  1CEZ A;  3A0R A;  5JCO C;  4CZZ A;  1E1Q G;  3PJS K;  1XMQ O;  5E79 Z;  5BR8 B;  4A94 A;  3B4S A;  4LNU B;  4CS3 A;  3FB8 C;  2IMO A;  3CPA A;  2G38 A;  1OJH A;  1WJZ A;  2GIV A;  3P3N A;  2WLJ A;  5LA6 B;  5BR8 O;  3KAS A;  5LXT A;  3CD6 V;  1LAM A;  2RNB A;  1VQK V;  3UCS C;  1K73 W;  1Z8T A;  4QE7 A;  1GN3 A;  4I0X A;  4CPA A;  3J81 N;  3W6X A;  2GBO A;  1CPS A;  1ZLI A;  2KKW A;  3OMN B;  1QHT A;  4FPP A;  3CCV V;  4LF8 B;  1VQO V;  3DC5 A;  2VQF B;  3CJH A;  5LHI A;  4H13 B;  1VF7 A;  3I5D A;  4NKG B;  1GM8 A;  1AR4 A;  4RS2 A;  2GV9 A;  4TQF A;  1BLL E;  2B9Z A;  2WUU A;  3JYC A;  1XNQ O;  4UCM A;  1R3L C;  3AG2 C;  3W7T A;  3S3W A;  2UXC B;  3JSL A;  2DYS C;  3RYO A;  2ZDI C;  3AG1 B;  3FRM A;  3H8F A;  2F66 C;  1JVM A;  4B3M O;  1Z8L A;  1LUV A;  1YF2 A;  4U3J A;  3AG4 B;  2ODM A;  5EZY B;  4BAY A;  3CXQ A;  2HKO A;  4PA4 A;  4FK5 C;  4QVT A;  4DV2 B;  4IL6 Z;  1P49 A;  4K3N A;  1FXK A;  1XUQ A;  2HB6 A;  2YI9 A;  3J7A U;  4DNC A;  1SQG A;  5K1P A;  4WJB A;  4I50 B;  1AP5 A;  2X0L A;  2X6B A;  1PM9 A;  5B1O A;  1XNR O;  5CN0 A;  2R1I A;  4UCT A;  4L8A A;  5CBG A;  4DUZ B;  3UKM A;  4BMH A;  3R95 A;  3C26 A;  3R65 A;  1A2Z A;  5LMN O;  1RM1 B;  2AZ0 A;  1S77 D;  1BZK A;  3FH4 A;  4QPK A;  4UBR A;  2D4P A;  4U3F H;  1VAR A;  2DW4 A;  3K0G A;  4I49 A;  3APO A;  5GTI Z;  2QTO A;  4NSQ A;  4B6Z A;  1YW4 A;  2UUB O;  1XF8 A;  3JD1 A;  5LYJ A;  4BIO A;  1B3Q A;  1ZG9 A;  3H9V A;  4KOY A;  3E8H A;  3OTO B;  3D36 A;  1AUG A;  3ABT A;  3SPC A;  1KBH A;  3T90 A;  3ABL C;  3JD0 A;  2Z3N A;  3T8W A;  4H89 A;  4AQY O;  4H6U A;  3VWE A;  4OLL A;  2EUL A;  1US6 A;  4D7T A;  1ELL P;  2Z3M A;  4ZX8 A;  3QO5 A;  3UM7 A;  2HV2 A;  4U7O A;  2J8R A;  4BIN A;  3I55 V;  1M44 A;  4OP4 A;  1PU9 A;  1CXZ B;  5EIB C;  1RSO B;  3SI0 A;  3CCQ V;  1VGY A;  5EBV A;  3FB5 C;  4UCR A;  3F5W C;  3G71 V;  2PJ1 A;  3T1H B;  4QNH B;  5EIB D;  1YVK A;  4J9Z B;  5EC1 C;  1NKD A;  3RVZ A;  4DR5 B;  4CGL A;  4LF7 B;  4EKW A;  2YGW A;  2BOB C;  5IJ0 A;  1Z2L A;  1M93 A;  1VEW A;  3K06 A;  2YND A;  4O4I A;  4O4I B;  3S6H A;  4PA7 A;  1RSO A;  4DXW A;  1U6M A;  3IJ3 A;  2Q6A A;  2BCC H;  2UXB O;  2BUE A;  1F57 A;  3F7Y C;  1CM0 A;  4P4B A;  3A9L A;  1QSR A;  5GON A;  2DEA A;  1TUB B;  3IC9 A;  4JXR A;  2AFS A;  1R1B A;  2A79 B;  2Z0A A;  4LF6 O;  4UVA A;  5J8F A;  1XIL A;  4CC5 A;  4NXM B;  1GN6 A;  4PV6 A;  4WFF A;  1ZG7 A;  4JYB A;  4QUS A;  4RI1 A;  4UEF A;  1V54 B;  2B3V A;  2GSM B;  2QWP B;  1KD1 W;  4IUS A;  2ZR2 A;  1FY7 A;  3WU2 Z;  2Q04 A;  2PDO A;  2L35 A;  4NGN A;  4H33 A;  3NFZ A;  1YRE A;  1NMT A;  1PL4 A;  2JEX A;  4CYP A;  3CZX A;  5LOV B;  4N23 A;  1ZTE A;  3ETQ A;  3EY5 A;  4RN7 A;  3SR2 C;  2ZEH A;  5L3G A;  3PB4 X;  1RP3 B;  1RTQ A;  3QB8 A;  3TXQ A;  2EIL C;  4QJF B;  5LL6 Y;  4MFP A;  2PJ0 A;  2M7W A;  3CMA V;  5AG5 A;  3LNN A;  3C90 A;  5IB9 A;  1D5A A;  4NB5 A;  2AFX A;  3THO A;  4AIL C;  3M7M X;  3ZHR A;  4IGG A;  1VQ5 V;  3WB0 A;  4L87 A;  4R7M A;  4WFE A;  4PK3 A;  4UV8 A;  4B3S O;  4Y49 B;  4NTX A;  1K5S A;  3ZMV A;  3OT7 A;  3RYC A;  4X9Q A;  1PV0 A;  2OZG A;  5DEC A;  2PQ8 A;  1FJG O;  4XNH C;  2WLI B;  3I1U A;  2IJI A;  3E22 B;  4UIB A;  3QO8 A;  3SI2 A;  2ABZ A;  4I9W A;  4MY3 A;  2CTW A;  5KA5 A;  4K0K B;  4I0X B;  3H1L H;  4JI6 B;  2ZOG A;  2ZEN A;  4U9Z A;  2MK3 A;  2VWK A;  3RYC B;  1XL6 A;  4H6Z A;  5B66 Z;  4YJ3 A;  3CCR V;  1DK1 A;  3B40 A;  5LXT B;  4B3R O;  5KMG B;  3K57 A;  4LF6 B;  2C1C A;  4FM1 A;  4A32 A;  3K79 A;  1YTF B;  2ZIN A;  4XNH B;  3OW2 U;  1YW6 A;  4IIJ A;  3ABK C;  1D5N A;  4X66 O;  3AEI A;  4CAX A;  2LGQ A;  2L6L A;  3SPG A;  1Y6X A;  1Z8W A;  1DTO A;  1EN4 A;  2BOC C;  2YEV B;  4X3R A;  1OCC C;  2EIN C;  2UXN A;  4X1K A;  2E5L B;  3RWR D;  2YIA A;  1FFX A;  1SS3 A;  4EB6 A;  3FVL A;  4JI0 O;  2A9H A;  5KX5 B;  2K9P A;  1S76 D;  1TXR A;  2GTS A;  1G8M A;  2IJK A;  4UCP A;  1OHH G;  3JCU Z;  2OCC B;  2IH1 C;  1PL0 A;  4X62 O;  1BQ0 A;  2QSA A;  4YRH A;  2ZEG A;  1SES A;  2G3A A;  1V0C A;  2FTK A;  2D2C B;  2Q69 A;  5ELY A;  4G27 B;  2EK9 A;  2FE7 A;  1YCI A;  1BAV A;  1ZLH A;  2EIN B;  5LYF A;  4NJR A;  3KHZ A;  4MHZ A;  2JDC A;  4MHD A;  3D66 A;  1LFW A;  5CNP A;  2WYR A;  1SER A;  2ZM6 B;  1F23 A;  4JI7 B;  3B2Y A;  2RC4 A;  3AG3 B;  3SJE A;  1XNQ B;  1TF8 A;  3OEE G;  2FYU H;  4EEQ A;  1PKX A;  3SJA C;  4MY0 A;  5LYD A;  3K59 A;  4X64 O;  2IM9 A;  3DGE A;  4DK1 A;  3EC4 A;  1BS3 A;  1NTK H;  4GX1 A;  4DV0 O;  4NTY A;  4K0K O;  3OTF A;  5I4M A;  2RN9 A;  1OBR A;  4MVR A;  1Q82 W;  4JI1 O;  2FXF A;  2YXH A;  2KCW A;  1M56 C;  3ZRW A;  4X8A A;  3LSU A;  1TIQ A;  1Y67 A;  5J9P C;  1ARM A;  1XMB A;  2HUZ A;  2QKS A;  4UB6 Z;  3SPI A;  3KKY A;  4B08 A;  1SQB H;  2W6J G;  4LCU C;  4ZHQ B;  3TFY A;  3NE7 A;  5JH7 A;  3G4S V;  4FLT A;  3MGD A;  3S9L A;  3MRU A;  1BHA A;  4JI3 B;  4M3S A;  4JF3 A;  4O4H A;  1SQF A;  1AR1 B;  1CP9 A;  2W0X A;  1SQV H;  3JAL A;  1FKA O;  4U5Y A;  1P4R A;  3GY9 A;  1K4D C;  2CTC A;  4Q6G A;  5BMV A;  4P44 A;  2ZE6 A;  1H8H G;  3DDD A;  2QE7 G;  5LP6 A;  4LF9 B;  4ZOL A;  2GAN A;  3WFV A;  5JQG B;  3FF3 A;  5K8P A;  3IEH A;  3IAY A;  2Y0M A;  4PSX A;  2ZEE A;  3S6K A;  3DNS A;  4F0X A;  5CA0 B;  2YNE A;  5CBH A;  3JAW A;  2I79 A;  1GN2 A;  1THZ A;  4KL1 A;  4DV3 O;  3R9E A;  1FXK B;  3VH9 A;  3F8K A;  3GLJ A;  1R3I C;  4GYC B;  2NLJ C;  3OFN G;  1SA0 A;  5EBW C;  2PJA A;  1CX8 A;  4DV3 B;  4EME A;  1J95 A;  2P5O A;  2X6A A;  1P0H A;  1BT8 A;  3D8C A;  5B1B B;  4R7C A;  4OXS A;  2RMK B;  2ITC C;  4DR3 B;  3H4Q A;  4TQD A;  2B5U A;  1XIX A;  4KOU A;  5L3D A;  1MSW D;  1R73 A;  1N33 B;  4UCN A;  3SDL A;  4DV5 B;  3TO9 A;  1JJO A;  4J7J A;  2P6F A;  5JH9 A;  1FAF A;  2AFU A;  3JAS A;  2X7B A;  3CB2 A;  4LF4 O;  2JEV A;  3B3T A;  2C6G A;  3QAY A;  2PZS A;  2P7T C;  1VQ7 V;  4JI2 B;  2B4D A;  1QQ9 A;  5C8Y A;  4UVB A;  2Z3O A;  2REE A;  2QM8 A;  2PF4 E;  4JXQ A;  4DR1 O;  3OGI B;  5G1Z A;  1Z5R A;  4TUY B;  5H2F Z;  3JAK B;  3ETD A;  4DR5 O;  3L75 H;  4B3M B;  2OTJ V;  4DV6 B;  3JRU A;  4HNA A;  3WG7 B;  2Q7B A;  1F4N A;  2R72 A;  2JLM A;  4I5S A;  1BL8 A;  3ZRV A;  2PE3 A;  1IZ3 A;  3BEH A;  3PEI A;  2C6P A;  5FNV B;  3CRC A;  3KL9 A;  3MN8 A;  1XOU A;  4OC2 A;  4JWP A;  1N32 B;  1KWM A;  2Z5U A;  1MZE A;  3RYH B;  5A2Q N;  1KQS U;  2PGG A;  2Y48 A;  4LR3 A;  2P0W A;  3K9S A;  2BTQ A;  3OD4 A;  3WC6 A;  2IBZ H;  5THW A;  1X10 A;  3H1K H;  1KMI Z;  1E1R G;  1HDQ A;  1SQQ H;  4UIA A;  5LMU B;  2P6J A;  1M56 B;  1M4I A;  1L0C A;  1WB7 A;  1AJQ A;  3L73 H;  4X1Y B;  4DV6 O;  3KQZ A;  5CB4 B;  1R3K C;  1XL4 A;  3CRR A;  1GN4 A;  1H38 A;  4PD4 F;  4L89 A;  1IXM A;  1QU7 A;  1ZUQ A;  2QA4 V;  4J3G A;  4UF4 A;  2PYJ A;  2LFR A;  4MVZ A;  1O9H A;  4LF8 O;  5FNV A;  2LQT A;  1Z4R A;  1QSM A;  3P2H A;  4MW8 A;  1YLE A;  2PJ8 A;  4YIP A;  2RJZ A;  4JI8 O;  1NI8 A;  4FLV A;  2B5G B;  2EJ7 A;  5DN6 G;  2LP7 A;  2PI4 A;  5HFM A;  4CAW A;  4KS9 A;  2F5I A;  4JI8 B;  5JQG A;  3RBZ A;  3JAR A;  4DW1 A;  4ZIB A;  3KCY A;  5J2T A;  5JQ4 A;  3ABK B;  3ZCC A;  3TXS A;  2JJ2 G;  5BMV B;  5J2U B;  3H1H H;  3ZJZ A;  4GX5 A;  5KTC A;  4LF7 O;  4IYH A;  4PXB A;  3AG3 C;  4J41 A;  4GZR B;  1AI4 A;  2H5M A;  1K4C C;  1CG2 A;  4XDL A;  5KHI A;  5JH7 B;  1AIL A;  3FB7 C;  2QML A;  2OCC C;  1XMT A;  3CE2 A;  2ZEL A;  3K0D A;  5D29 A;  5HVH A;  3TJT A;  3U0Z A;  1L8D A;  1QSO A;  2KG7 B;  3B3W A;  2I00 A;  4LWS A;  1FD9 A;  5B1N A;  1H8E G;  1KUV A;  4MMO A;  2YNC C;  2JS5 A;  4NJQ A;  1NVP B;  1R6T A;  2DYS B;  3BI0 A;  4XPL A;  4TV8 A;  1ZLZ A;  3FXT A;  4DV1 B;  3SXN A;  2OIG A;  3JAW B;  5J2T B;  2JDD A;  2YIB D;  4H2K A;  3JAR B;  4IAV A;  4KSI A;  2UXD O;  4CS0 B;  3CCM V;  4IHM A;  1BPM A;  4C2Z A;  1GH6 A;  4FLY A;  2V1D A;  1J5E B;  1NJI W;  3G3S A;  2BE3 A;  4I55 B;  3HKD A;  4OPA A;  2DF5 A;  2EBO A;  3TOA A;  3LMS A;  2XAG A;  1YZB A;  2PVW A;  4CBC A;  5EBM C;  2WA4 A;  4PI2 A;  4FD6 A;  5H5N A;  4DR4 O;  2WLN A;  1R57 A;  1BMF G;  3AG2 B;  3HR0 A;  2IW5 A;  3FD9 A;  3CXS A;  1TVK B;  3IJ4 A;  4DR2 O;  1S7L A;  4LWS B;  4WWV A;  4RAI A;  2RB7 A;  3HPL C;  1SQP H;  2UUA O;  4AG7 A;  4KZT A;  3ZED A;  4AVC A;  1I7F A;  2P06 A;  1HDJ A;  3FFQ A;  4B7K A;  2DXQ A;  2R9R B;  3N2G B;  1ZL8 B;  3C3T A;  2BTQ B;  2PVV A;  3NE8 A;  3TE4 A;  1Y74 B;  4R8F A;  4LFA B;  2BO9 A;  4MCR A;  4UFZ A;  4CRY B;  1RPO A;  1Z4E A;  3D2M A;  4PPZ A;  4X20 B;  1QR8 A;  1AI7 A;  2UXX A;  3JD2 A;  5E96 A;  4AQY B;  2ILM A;  1M4L A;  3M99 B;  4UEZ A;  5KMG A;  4JAU A;  2CH7 A;  4E2L A;  3QF7 A;  1BGY H;  1Y0R A;  2B58 A;  4LF5 O;  1AYE A;  3KQX A;  2WLH A;  3EXN A;  2HLD G;  1QLN A;  2P6G A;  4Z2W A;  1F2P A;  2G3T A;  4U7N A;  2ZE7 A;  3A0H Z;  3HKB B;  4GX0 A;  3OE7 G;  5B1B C;  5IT9 N;  1YX0 A;  4X2T A;  1VQ9 V;  4CS2 A;  2IL4 A;  1QVF U;  2Q7S A;  2I3C A;  4K30 A;  4UFV A;  2O4H A;  2IQ6 A;  4KUA A;  4JTA B;  2VEZ A;  1J5E O;  1IVS A;  5L3C A;  1Y4M A;  3Q4H B;  4RO2 A;  4P4J A;  2JGD A;  3CXH F;  2PCU A;  2AGA A;  1Y76 B;  3FX6 A;  1KZF A;  4WFG A;  1MJ9 A;  3T9Y A;  5FLX N;  1IY7 A;  2PJB A;  1QNM A;  3U11 A;  1KUQ A;  4Q20 A;  4JAA A;  3GYA A;  5IJ9 A;  4ONW A;  4GM5 A;  1OCZ B;  1S0V A;  3EXA A;  1JJ2 U;  4BW9 A;  2QVP A;  3OWC A;  5HVF A;  3BHP A;  4DRX B;  4WBN A;  2RCV A;  3STL C;  3BRC A;  1KB9 F;  2LGW A;  1S7N A;  4X8I A;  1X12 A;  1KEC A;  4HNY B;  2OYQ A;  2CY2 A;  1KUY A;  3VAR A;  1M1D A;  2NMT A;  1QCE A;  4OPH A;  5ITZ A;  5KA6 A;  2R8V A;  4AVA A;  2F23 A;  2J9A A;  2VQE B;  5K1X A;  2B1G A;  3QNV A;  1YSJ A;  1Q8I A;  2B4D B;  3PB7 X;  3OR7 C;  4NTW A;  1MAB G;  2Q7E A;  3PRT A;  1VF5 B;  5AG4 A;  3B2E E;  3G67 A;  2ZW7 A;  3H1J H;  1GM9 A;  2GLF A;  3IWE A;  3CSX A;  3BY6 A;  4MTG A;  2ADP A;  3WB1 A;  2PYL A;  4LBE C;  1UJW B;  4J7Z A;  4PA6 A;  3IU1 A;  5I0C A;  1F2O A;  1EZJ A;  4AHC A;  4G2K A;  2Y4T A;  3I56 V;  4OC4 A;  4CH4 A;  5EYP B;  1NSL A;  4NVP A;  4X66 B;  1KYO F;  3DTU B;  3MHH C;  3W7S A;  4M6H A;  1AJN A;  1YVW A;  3SYC A;  1BHB A;  2C6C A;  5KUK A;  2Z3L A;  4JV5 B;  3D3S A;  2V8D A;  2GE3 A;  4X89 A;  2RQ6 A;  4KFM A;  3T1C A;  1WAZ A;  4F0Y A;  2AFM A;  3DGV A;  1WN7 A;  5LP6 C;  4KOV A;  2Z10 A;  1PYT B;  4IK2 A;  2PC1 A;  2DOS A;  3HLP A;  3NA6 A;  4MFK A;  4UWI A;  1I94 O;  1T5E A;  3OUF A;  2DQ0 A;  5BXZ A;  4X88 A;  3V38 A;  3UT5 B;  2R7H A;  3N2K B;  1NE9 A;  2QEX V;  3ZN1 A;  4M85 A;  3KZI Z;  1I1D A;  1O9G A;  3PGP A;  2E75 B;  2VS0 A;  2O53 A;  3B8N A;  3L74 H;  1YQE A;  3W7X A;  5GON B;  1FFT B;  1HNX O;  3PBE A;  4Y49 C;  2ODF A;  5LRJ A;  4YHH O;  1GYT A;  2GLJ A;  4FFB B;  5LYJ B;  4ORF A;  4DV4 B;  4Z65 A;  5CMU A;  2PI5 A;  2Q0Y A;  4FD7 A;  4JYA B;  3TC8 A;  3DXR B;  4R76 A;  4O4J B;  5CBF A;  1HEE A;  4DR6 O;  3QNE A;  1FFX B;  3D7D A;  4JZ2 A;  2ETN A;  2YI8 A;  2H3O A;  1LRZ A;  3B8M A;  1K9M W;  2DQ3 A;  3R66 A;  4LP8 A;  3UT5 A;  2GRE A;  1DLB A;  3OUS A;  4OX9 O;  3KHX A;  3CCL V;  2WAM A;  3AK3 A;  4NF1 A;  5TIS Z;  4MCS A;  1AP6 A;  1K7D A;  2BEI A;  3TO6 A;  3ZIA G;  2AE6 A;  2Q73 A;  1SQX H;  3LSS A;  4WFH A;  4KOS A;  1YK3 A;  3GWK C;  3K5L A;  2CNT A;  3ZJ0 A;  2JBJ A;  4U3J B;  5EZY A;  2JIZ G;  2YIB A;  3TTH A;  1QLE C;  1K4J A;  4ZI6 A;  2OZU A;  4FUU A;  1Z2G A;  2PJ7 A;  3CCJ V;  4J9Y B;  3AG4 C;  1JQG A;  3HUV A;  2EZO A;  4UEE A;  1S7K A;  1TF9 A;  1JPX A;  4JI2 O;  4E8O A;  4RUH A;  1S5K A;  1NU1 H;  3D3I A;  3L2N A;  4DR7 O;  3HB3 B;  1GHE A;  1N0J A;  1VQ6 V;  4UUJ C;  2XND G;  2Q51 A;  2F95 B;  1COW G;  4WFA V;  2LFS A;  1F4M A;  2YSU B;  2XHB A;  3RAM A;  2EJR A;  3HKE A;  4GLX A;  1IUR A;  5CBM A;  3SJX A;  4NXN B;  2VZY A;  3ZHS A;  2P6E A;  4QE9 A;  1M4D A;  1IID A;  5L3F A;  4PDM A;  3TX8 A;  4GUN A;  2NSM A;  2VRZ A;  3VQW A;  3QAH A;  5CPA A;  1I5Y A;  3VQX A;  5IB0 A;  4F6A A;  1TGO A;  3OMI B;  3HKE B;  2FT0 A;  4PXE A;  4CYO A;  4QGP A;  1IBK B;  4JGS A;  3R9F A;  3RO0 A;  4DJL A;  1IBM O;  4UCS A;  3ZHV A;  2DWE C;  3ETE A;  4B11 A;  2DPS A;  3QTC A;  1YSC A;  4PHZ A;  3W91 A;  5LGU A;  2CNM A;  2P22 C;  3VOU A;  3S6F A;  3FYI B;  1VQM V;  2PIY A;  1TKJ A;  3CME V;  4MVO A;  5A9G A;  3SYP A;  4K35 A;  4ZKI A;  3GB0 A;  2CAZ C;  2JEU A;  1H2N A;  2B1I A;  1LNQ A;  3O9O A;  1V55 B;  3SJC C;  2DE0 X;  3ASN C;  4DUZ O;  1XE4 A;  4ONU A;  1XFO A;  1FT7 A;  4O2B B;  2KSD A;  5H6R A;  3FB6 C;  2F1M A;  3BVO A;  1MSD A;  5B3S B;  4JTD B;  2A3Q A;  2X6C A;  1IBM B;  3T1H O;  4DK0 A;  2UUB B;  4WFB V;  8CPA A;  4XDK A;  1Q7Y W;  4WF9 V;  5HFL A;  1OZ0 A;  4JTC B;  2F43 G;  4NGQ A;  3K5N A;  3HKD B;  2IJJ A;  4F6E A;  3FNC A;  2FCK A;  4NXN O;  1Y7R A;  3D7G A;  2ZPA A;  2IU0 A;  3MDS A;  3SJF A;  1ENV A;  4FLX A;  4BBH A;  2VL1 A;  4O4J A;  4CGO A;  3RT3 C;  3DXR A;  1YIT V;  1WPX A;  4AXV A;  4R8C A;  2YID A;  4X1I B;  1KP2 A;  1MZF A;  2IJH A;  4GS4 A;  1QQC A;  4B12 A;  4C2X A;  1UFI A;  4MW3 A;  4J80 A;  3JD4 A;  1QVG U;  3K03 A;  2VXK A;  1ZAU A;  2HP8 A;  1TUE B;  3LNM B;  3T1Y B;  4JPR A;  5IJ0 B;  2N04 A;  5F2V O;  5AG7 A;  3VWD A;  3CRM A;  3V8I A;  3S6G A;  4CS4 A;  3OTO O;  4B10 A;  3B3V A;  2QWQ B;  4I4T A;  3N2K A;  2OH1 A;  2OR4 A;  3FAV A;  1VQL V;  4OC3 A;  3JTK A;  4JLY A;  5DED A;  4M6G A;  5IY5 C;  3SJB C;  2WPX A;  4MRI A;  3CCU V;  2OT5 A;  2GDS A;  3OMA B;  4HPS A;  4MSW C;  1M1K W;  4XBF A;  3B3S A;  2WPW A;  5FPR A;  4DR2 B;  2JGU A;  1VIB A;  2UUA B;  1ORQ C;  2VWJ A;  2Q44 A;  1Q6H A;  1KKD A;  4JD6 A;  2E76 B;  1XBU A;  3QG5 A;  5BWA B;  2EIM B;  4CGP A;  2ZE8 A;  1U97 A;  3WG7 C;  3JAM N;  5EC4 A;  5JCO A;  1ZWI C;  4N21 A;  2AHY A;  1IIC A;  1M5I A;  4ZI7 B;  2QDO A;  1Q2Y A;  2BL1 A;  1R3J C;  4JZG A;  1YTF D;  2NYQ A;  1DF4 A;  3BJ8 A;  2Q4V A;  1IX9 A;  3CEI A;  1W59 A;  2OB0 A;  4KOT A;  2HHH O;  2PJ2 A;  1N71 A;  3T2M A;  2EIM C;  1MOF A;  2ARH A;  5J2U A;  4FM2 A;  4F8Z A;  1M57 B;  3UQ8 A;  1PNL A;  2R70 A;  2X7R B;  1OCR C;  3TT2 A;  2ZOF A;  2HG5 C;  3TOB A;  5A28 A;  3F0A A;  3FB3 A;  3I9S A;  4ICG A;  1XQ8 A;  4YXW G;  1KKC A;  3L71 H;  5DM6 V;  5F47 A;  2A06 H;  4NGP A;  2VBQ A;  3PBB A;  1ARO P;  2H94 A;  2E5L O;  2ZW4 A;  4I9Q A;  4IF5 A;  3SJQ C;  1IGB A;  2CH7 B;  1N34 B;  5JJN B;  5KUM A;  2OTL V;  2YDE A;  1H2S B;  3EVK A;  1OCR B;  2V4D A;  3RGB A;  1U96 A;  2DN9 A;  4DV0 B;  2A0L A;  4R6T A;  1W2B U;  3JAT B;  5DS0 A;  2CTQ A;  2XAQ A;  1SKV A;  4E4E A;  3KR5 A;  3Q4H A;  1HWY A;  1XEQ A;  2PUS A;  3BXM A;  3JUW A;  3D36 C;  1JCH A;  1V55 C;  5KHJ A;  2P4K A;  2Q0O C;  2Q7G A;  2VI7 A;  1SRY A;  1BSM A;  5L3E A;  1HDU A;  3JAS B;  1XRY A;  3PZJ A;  3IWG A;  1AI6 A;  5BZB A;  4BIZ A;  2WWW A;  4LFA O;  1Y74 A;  4H44 B;  1YVO A;  3U10 A;  4JV5 O;  1GAX A;  4ZYQ A;  4F9U A;  1ZL8 A;  4KVX A;  3LDC A;  1HR0 O;  2EBJ A;  1WA8 B;  5LBQ A;  1JFF A;  2ZM6 O;  3FEE A;  4KVM E;  1L0L H;  1EZV H;  2A7W A;  2VQE O;  4MS2 A;  4TNU A;  2Z3Y A;  2EZP A;  4YY3 B;  2F4V B;  3L70 H;  5LHG A;  4TSF G;  3TCU A;  4FIP C;  4UFX A;  1MG1 A;  1OV9 A;  4BIU A;  2WLL A;  1CBX A;  4UFW A;  4TWK A;  4PJ0 Z;  4B3R B;  4Q38 A;  5JVD A;  3CC7 V;  3BA8 A;  1XJO A;  2ZW5 A;  1S3J A;  4KOX A;  4HYO A;  2V77 A;  3GVM A;  1BCC H;  3BAA A;  2XAH A;  2BCO A;  2XEG A;  4MHY A;  5EMI A;  5H84 A;  4KVO E;  4A5U B;  3ZHU A;  3ICX A;  4YHH B;  2W0F C;  3CP1 A;  2XUM A;  3D67 A;  3IFE A;  5LP6 B;  4YJ2 B;  4J11 A;  2UUC O;  5F49 A;  1SZX A;  4A30 A;  2ZXV A;  5IYZ A;  4MXU A;  5K8O A;  2RDC A;  1CJW A;  3E89 A;  2ZKO A;  3B3C A;  1VQN V;  3K04 A;  3ASN B;  3FBU A;  1HW7 A;  3WAB A;  2GUZ B;  2KG7 A;  4CH5 A;  3ZMS A;  4GKK O;  2CTP A;  2MW2 B;  4X1I A;  2V8H A;  1N0N A;  1PNM A;  2CGO A;  2ITD C;  1K3E A;  4I55 A;  2YNC A;  4YJ2 A;  2UU9 B;  3O65 A;  4DUY B;  3ZBH A;  3CYO A;  4ZY0 A;  4BW5 A;  1Q3E A;  4OAE A;  3DR6 A;  1PUA A;  3SPJ A;  4GKJ O;  2ZIM A;  3SI1 A;  3FIX A;  1H8L A;  3UO2 A;  2AW9 A;  6CPA A;  1XEB A;  1Q81 W;  1BQZ A;  1JQ0 A;  1S5L Z;  2Y69 C;  4AG9 A;  3G6E V;  4TV8 B;  4C7U A;  2Q0A A;  4DV4 O;  3B8G A;  3GKR A;  2WLL B;  4UXN A;  2JS3 A;  5LMN B;  1WA8 A;  4JAV A;  5F46 A;  1G6U A;  3CS5 A;  5CA1 A;  1XMQ B;  3ZHT A;  3T4D A;  4DW0 A;  1QSN A;  2PJ6 A;  4PXC A;  4K3A A;  3W6S A;  5A27 A;  2ZEP A;  4P30 A;  4E0A A;  2QJ1 A;  4FLW A;  1BPN A;  4HAM A;  3FX7 A;  4J10 A;  1IOI A;  4LX9 A;  1UFH A;  4OKO A;  3RNZ A;  1NQT A;  1WP7 A;  2JDI G;  4RUF A;  3K5M A;  5HH1 A;  4LQG A;  4P9P A;  4DR7 B;  5AG6 A;  5LMU O;  3JD3 A;  3RVY A;  3DSB A;  2HVJ C;  3H1I H;  3ZHQ A;  5KX5 A;  3IO1 A;  1XDC A;  3IWW A;  4MFJ A;  4KOW A;  1FXK C;  4LF9 O;  4D7S A;  2GFQ A;  2IJZ A;  1A32 A;  4JI4 B;  1J4J A;  2QWR B;  1I94 B;  1FXV A;  4ZI7 A;  2R98 A;  1QR9 A;  2E74 B;  4AB7 A;  4PDR A;  4XDJ A;  4DR6 B;  5AGE A;  3W7U A;  4JI4 O;  4J42 A;  2JEW A;  3CXP A;  3FKS G;  4JAS A;  3D2P A;  4J7K A;  3OAA G;  4YJ3 B;  4LFC B;  2EX3 A;  1N8R W;  3ZN0 A;  3AK1 A;  3K9T A;  3D8P A;  1H2G A;  2QKC A;  3WT4 A;  3NH4 A;  3I3G A;  3ABL B;  2HQY A;  4UCO A;  4EB6 B;  1Q43 A;  3MD0 A;  3N2G A;  4X1K B;  1WK4 A;  1KP3 A;  2UXC O;  2EIJ B;  1FXH A;  5LRK A;  5B1A B;  3ZX6 A;  2Y0I A;  3RYH A;  3P32 A;  2QWN B;  4OGQ B;  1VQ8 V;  1DTD A;  5CA1 B;  3TCV A;  5H6Q A;  3ZMU A;  2VQF O;  4FLZ A;  2AJ6 A;  4FFK A;  1TVK A;  1TKH A;  3E83 A;  1TA8 A;  3SXO A;  3T4Z A;  3P3P A;  5B5E Z;  2CUG A;  1GKF A;  1Z9U A;  2JVD A;  1IBK O;  3D7F A;  1M90 W;  4PA9 A;  1H2K A;  1V9P A;  2Q8V A;  2AHZ A;  4B3T O;  4B5O A;  4MCQ A;  4TUY A;  4BD9 A;  1YJW V;  7CPA A;  5B1A C;  4KHP O;  1NH2 D;  2FL4 A;  2R9I A;  1AJP A;  3OR6 C;  1SA0 B;  3PN1 A;  2ZEO A;  3LUT B;  3E22 A;  4NXM O;  5GW7 A;  3R9G A;  2PSW A;  1Y66 A;  1IYL A;  4NEX A;  1X59 A;  2REF A;  2XOK G;  2QYV A;  5DWM A;  4B5P A;  4LH6 A;  1YLO A;  4QC6 A;  3IFX A;  1D2D A;  5JGF A;  1NZ6 A;  2CXA A;  3STZ C;  1QLE B;  3ZRX A;  4O4H B;  4ZOL B;  1SC5 B;  2J8N A;  2QR4 A;  4R9M A;  2V8V A;  4MVQ A;  1WP8 A;  3E2E A;  5LGN A;  3IU2 A;  4B3T B;  5KTA A;  4O4L A;  3CCS V;  1TUB A;  4NGS A;  1AMP A;  5E1A C;  1AR5 A;  2KB1 A;  1RPR A;  2XEI A;  4ZHQ A;  4UB8 Z;  5D8N A;  2Q9L A;  4CAF A;  4C7H A;  4NYK A;  2YIC A;  4ZY2 A;  3TET A;  4OC0 A;  2DWD C;  3F7V C;  1VHS A;  5LYL A;  4F4L A;  2BOA A;  2JRI A;  3ABM C;  4ASU G;  2ZE5 A;  4DV7 O;  1FJG B;  2BTO A;  5IYC O;  1PNK A;  1XBL A;  1GMG A;  4FJC C;  4FD5 A;  4A33 A;  4KOR A;  4CAE A;  1BE3 H;  5LYI A;  2P4V A;  2WSS G;  4HNX B;  5J1Q A;  4C7I A;  2NN4 A;  1B04 A;  1NBM G;  3RFR A;  1VHE A;  1S5H C;  1JFF B;  3ZS8 C;  5IWA O;  1IOF A;  3FJU A;  1LCP A;  3KG2 A;  2GHY A;  4UV9 A;  3CCE V;  5IY5 B;  4DUK A;  2AXT Z;  1B6B A;  1Y0Y A;  4HZ3 A;  3B09 A;  3ASO C;  5IWA B;  4O2B A;  5CB4 A;  3FYE B;  2WLM A;  4EFE A;  5KTD A;  2P90 A;  2W6I G;  3VQV A;  4BWA A;  2F4V O;  2EIK C;  2PR1 A;  3IC1 A;  3E0K A;  4X62 B;  3V7Z A;  5ISV A;  1V54 C;  4UA3 A;  2Q4P A;  3PB8 X;  3K2K A;  3FEC A;  2XAJ A;  4ZX9 A;  1GM7 A;  1URF A;  2RFH A;  2XEF A;  1IYK A;  1ZX3 A;  2LO1 A;  5BY1 A;  5IE9 A;  4JZ0 A;  2PRQ A;  4YGO A;  5KHG A;  2N74 A;  2H8P C;  4KSF A;  4NR1 A;  2QJ8 A;  3CRA A;  3N5F A;  2CGN A;  3G8W A;  4ZGY B;  3ISZ A;  2Q7H A;  3VAT A;  4KSA A;  4NGR A;  1H2M A;  4JYC A;  4TV9 B;  1N34 O;  3C3S A;  4UVC A;  3B7I A;  2XT9 A;  3FMC A;  3RBU A;  2HJF C;  2XAF A;  5J8C A;  4IIJ B;  1ON0 A;  1PD3 A;  4PSW A;  1QST A;  4I50 A;  3K08 A;  3ZZI A;  3CWB H;  1GO3 F;  5IYB O;  2HHH B;  2AFO A;  3EO4 A;  2FML A;  3NH5 A;  2UXD B;  1K92 A;  4DYO A;  1VIX A;  3WC5 A;  4Q36 A;  1XMO B;  1VQP V;  2QEC A;  4X65 O;  1NS1 A;  2WLI A;  1WNS A;  3A8T A;  1Y7E A;  2OOT A;  2YEV A;  1P7B A;  2QM4 A;  4MT8 A;  3BAB A;  1HR0 B;  2FVG A;  1SZT A;  2Z3K A;  4LQ6 A;  5K8M A;  4JYY A;  3QVN A;  2G9D A;  4FWU A;  3SPH A;  4FVM A;  2ANP A;  4IT5 A;  3CC2 V;  1Z5W A;  4D6T H;  2POK A;  3GUX A;  3RW0 A;  1B87 A;  3R1K A;  1UPG A;  3A0B Z;  2FSR A;  2ZT9 B;  3B77 A;  4HKF A;  3X2Q B;  4NFR A;  2CTB A;  1AVM A;  4MFZ A;  2DYR C;  2OIE A;  5FL7 G;  5KAF Z;  1KC8 W;  1BO4 A;  1S60 A;  3NH8 A;  2BSW A;  2K5T A;  4PDL A;  2Y0P A;  4YY3 O;  4G1P A;  2ZW6 A;  2QGN A;  2UXB B;  2OZH A;  3TGU H;  3DLJ A;  3SGI A;  1XOV A;  4E2A A;  3FAV B;  4CYQ A;  5G20 A;  1VKC A;  2XTA A;  4MJ8 A;  1P7G A;  3PB9 X;  3IGA C;  3K9U A;  4FMT A;  4JYA O;  1S72 V;  4II9 A;  4GX2 A;  4C68 A;  2DMX A;  1Q6I A;  4A37 A;  4XPK A;  1MK4 A;  3UY5 A;  2OCH A;  4LC1 A;  1RM1 C;  3ML0 A;  2VZZ A;  3SJG A;  1XHZ A;  1YJ9 V;  2PIZ A;  3R96 A;  2KQX A;  4LH7 A;  3EFA A;  4JI0 B;  2OWO A;  2YXL A;  2ZCE A;  4R87 A;  2D3O W;  3ABM B;  4GKJ B;  1NT2 B;  2Z3P A;  4Z1M G;  5LA6 A;  4MFL A;  4GT1 A;  4JI1 B;  1YI2 V;  1YIJ V;  2UU9 O;  4P4E A;  4B5P B;  2D4O A;  4MCP A;  4OX9 B;  4UCV A;  1YGH A;  1KU9 A;  4RQE A;  4KLV A;  1M9N A;  2YUA A;  4CRZ B;  4DR3 O;  1OCC B;  4O23 A;  2XEJ A;  2CIJ A;  1I08 A;  3D7H A;  2ADQ B;  3D3Q A;  4MFQ A;  4RUE A;  2V8G A;  1FPO A;  1X4T A;  1N33 O;  4DV5 O;  1AB3 A;  1TKF A;  4WBN B;  3KI9 A;  4MVU A;  1K97 A;  4UWJ A;  3CPX A;  2Y69 B;  3IC7 A;  4FD4 A;  1VMG A;  3SYA A;  2O57 A;  3PB6 X;  4O4L B;  4WCE V;  2ZIO A;  2HC9 A;  4OC1 A;  1B6Q A;  1JX9 A;  2EIK B;  4NGM A;  3LOD A;  1WLE A;  4AI8 A;  2WA3 A;  3APQ A;  4KLW A;  3E8G A;  4FZ0 A;  2ZXW C;  3P2F A;  2HVK C;  3E35 A;  5ITZ B;  1LAN A;  1K5Q A;  4P4F A;  3WB2 A;  1XNR B;  1YHQ V;  1HNW B;  4LFB O;  3ETG A;  1M57 C;  1ARL A;  4RQF A;  4JJX A;  4ZY1 A;  3LDE A;  5JJE B;  1HNZ B;  4K8X A;  1G1X B;  2A4N A;  3WR7 A;  1FS0 G;  2CNS A;  4EFD A;  4KUB A;  5LHH A;  5F09 A;  2C2A A;  1WB8 A;  3S9M A;  1JWQ A;  2AFW A;  4CH3 A;  4OIW A;  5IJ9 B;  4TV9 A;  2F93 B;  4A2Z A;  4YWY A;  1NR1 A;  4R6Z A;  1Q2D A;  4FLU A;  1LUW A;  1Y76 A;  3KCX A;  3IGR A;  5HXD A;  3AG1 C;  3DC6 A;  3DR8 A;  2P67 A;  2B3U A;  2O28 A;  3FYN A;  4RWU A;  4DO2 A;  5IDJ A;  2FIA A;  1CPY A;  4JI7 O;  1Q90 D;  4GKK B;  1EN5 A;  2QIR A;  1XHX A;  4C2Y A;  3H01 A;  2Z11 A;  5HVG A;  2ATK C;  3CJH B;  4AVB A;  4KXR A;  4UCU A;  4TOI A;  4F6R B;  3E8B A;  2Q5Z A;  4X64 B;  1RXT A;  5D5P A;  2EIL B;  3BPZ A;  2DPT A;  4DR1 B;  5DWN A;  4IHJ B;  1HP8 A;  2F8H A;  1ROP A;  4W4L A;  4YU9 A;  5LOV A;  2AFZ A;  2FKX A;  4FFB A;  3FED A;  5G21 A;  4LF4 B;  4A39 A;  4R3K A;  4U9Y A;  3HKC B;  5JPH A;  1Q7L A;  4TWE A;  1N36 B;  4H0L B;  4HNA B;  5L3B A;  2BSK A;  2G0B A;  4TT3 G;  4FZ1 A;  1I0H A;  2WPD G;  5JWP A;  3L9D A;  5IV0 A;  1IBL B;  2YS8 A;  1EE3 P;  2GTA A;  1SET A;  1N36 O;  2QWO B;  1CP7 A;  1I21 A;  3JCZ A;  3BFR A;  5GTH Z;  5C8Y B;  3TO7 A;  2E3C A;  4MTX A;  1IBL O;  2F7V A;  5HMN A;  4X20 A;  5IYD O;  1Y9K A;  1XI1 A;  3LDD A;  3CHX A;  3RN4 A;  5KLV H;  3D4U A;  2PTM A;  4PEL A;  4OC5 A;  1N32 O;  3CT9 A;  3CXC U;  5G22 A;  1VHO A;  4CGM A;  3ISX A;  3AG7 A;  1FYJ A;  1Q86 W;  1XRE A;  4FAI A;  4MBU A;  1QBZ A;  4ZBM A;  4YIO A;  4BR6 A;  3ABU A;  2HEP A;  4H37 A;  5EYP A;  1P4N A;  5JM6 A;  3ASO B;  4PI0 A;  3KGQ A;  4B13 A;  3SHP A;  4Z1V A;  1LOK A;  1R3N A;  3CC4 V;  3J80 N;  1I5X A;  1VF6 C;  3QO7 A;  3T1Y O;  1M4G A;  1GK9 A;  3WC7 A;  1YME A;  1N4C A;  2NR5 A;  3E86 A;  3RYF A;  2EWB A;  1RFY A;  1BOB A;  3RYI A;  1ZSP A;  1EN6 A;  2K1E A;  4JYW A;  4LNU A;  1MJA A;  3PP9 A;  1SQH A;  3CRQ A;  4MI4 A;  4FBE A;  1MJB A;  1R43 A;  4MHN A;  1GRJ A;  2Q67 A;  3IIB A;  5JVD B;  3H8G A;  3BCC H;  1W0J G;  1Z8X A;  4P6Y A;  4DV7 B;  4FM0 A;  1F51 A;  2PJ3 A;  1VF6 A;  2Q43 A;  3KKW A;  4CH6 A;  2JJ1 G;  3TK1 A;  4P10 A;  3UO3 A;  4A38 A;  4O2A B;  1NVP D;  1IB1 E;  4DV1 O;  1PPJ H;  4R3L A;  1NSA A;  1MNG A;  4PQA A;  3KR4 A;  4KHP B;  3RZA A;  1K33 A;  1W0K G;  4DV2 O;  5EC2 C;  4NGT A;  3RYI B;  2NNU A;  1R6N A;  4GXH A;  3SYO A;  3S3X A;  3RYF B;  2CE4 A;  1Q2C A;  2ZXW B;  2CDY A;  2XAS A;  2EUI A;  4MTO A;  1K8A W;  5LGT A;  3K9A A;  5H9C A;  4MHP A;  4QIW F;  4CGN A;  3CDX A;  3EFF K;  1P84 F;  1CP6 A;  1NH2 B;  2WZN A;  1QMU A;  4OAD A;  3SYQ A;  2HR3 A;  3JAT A;  1OZP A;  2B4B A;  3BI1 A;  1ELM P;  3A2F A;  1VQ4 V;  3D68 A;  4PK2 A;  1PP9 H;  3OEH G;  5C88 A;  2PR8 A;  4DRX A;  1CPX A;  1EBO A;  5KAI Z;  2PY5 A;  1H2L A;  2OU2 A;  3H5Z A;  1DE4 C;  4EWT A;  3HKB A;  4JI5 B;  2EVN A;  2Q4Y A;  5CA3 A;  1JA8 A;  5FVJ A;  4A95 A;  4DR4 B;  4PA3 A;  3JVN A;  1NR7 A;  1LAP A;  4L8J A;  1PCA A;  1JOY A;  1K34 A;  2IH3 C;  3X2Q C;  3NXS A;  1RO5 A;  4PDV A;  3VQY A;  4HNW B;  1JMK C;  2YC0 A;  4Q7A A;  5JJJ B;  3HKC A;  5H86 A;  2DJV A;  2JGD B;  3GB7 C;  4NXY A; 
#chains in the Genus database with same CATH homology
 4QBJ A;  1S3Z A;  1S7K A;  3N7Z A;  4E8O A;  2FXF A;  1S5K A;  2KCW A;  3IU2 A;  5KTA A;  1TIQ A;  2HUZ A;  1GHE A;  4X5K A;  3TFY A;  3NE7 A;  4CAF A;  4QB9 A;  3MGD A;  4M3S A;  4C7H A;  1Y9W A;  2VZY A;  4U5Y A;  3LD2 A;  3GY9 A;  1VHS A;  2P6E A;  1ZO0 A;  1M4D A;  1IID A;  3DDD A;  2GAN A;  3QAH A;  5F48 A;  4FD5 A;  4PSX A;  2Y0M A;  4A33 A;  4KOR A;  4CAE A;  5IX3 A;  5IB0 A;  4HNX B;  3BLN A;  3S6K A;  4F6A A;  3DNS A;  4C7I A;  4F0X A;  2YNE A;  3F5B A;  2FT0 A;  2I79 A;  4CYO A;  2WSA A;  3R9E A;  1WWZ A;  3F8K A;  3R9F A;  1I12 A;  4R57 A;  1S7F A;  1B6B A;  4B11 A;  2DPS A;  4XPD C;  1P0H A;  2Z0Z A;  3W91 A;  5KTD A;  2CNM A;  2PR1 A;  3E0K A;  3S6F A;  3H4Q A;  2VQY A;  5ISV A;  2ATR A;  1XIX A;  4KOU A;  1YR0 A;  4UA3 A;  1IYK A;  4UCN A;  1XE4 A;  4ONU A;  3TO9 A;  4EVY A;  2P6F A;  2PRB A;  4XPD B;  4YGO A;  2X7B A;  2JEV A;  2J8M A;  2C27 A;  4KSF A;  2B4D A;  2Z3O A;  3G8W A;  2REE A;  4ZGY B;  4JXQ A;  4KSA A;  5G1Z A;  5J8C A;  1ON0 A;  4PSW A;  1QST A;  4CAV A;  2Q7B A;  3ZZI A;  2JLM A;  3EO4 A;  3FNC A;  2FCK A;  2FS5 A;  1Y7R A;  4Q36 A;  2ZPA A;  4JWP A;  4BBH A;  2QEC A;  4CGO A;  2B5G A;  2P0W A;  5C82 A;  1KUX A;  4GS4 A;  4B12 A;  4C2X A;  4YFJ A;  2Z3K A;  2VXK A;  4A31 A;  4CYN A;  3VWD A;  1M4I A;  5AG7 A;  4LUA A;  3V8I A;  3BJ7 A;  1L0C A;  4ZBG A;  4NCZ A;  3S6G A;  4B10 A;  2FIW A;  2OH1 A;  4B14 A;  4L89 A;  3JTK A;  1B87 A;  3R1K A;  4JLY A;  4J3G A;  2FSR A;  3P2H A;  1Z4R A;  5GCN A;  1QSM A;  4HKF A;  1YLE A;  2WPX A;  4MFZ A;  1BO4 A;  1S60 A;  2B5G B;  2BSW A;  2K5T A;  2WPW A;  4CAW A;  2ZW6 A;  2GIV A;  2OZH A;  4KS9 A;  2F5I A;  2Q44 A;  4E2A A;  4JD6 A;  4CYQ A;  5JQ4 A;  5G20 A;  1VKC A;  5BWA B;  4CGP A;  4MJ8 A;  5KTC A;  5EC4 A;  3K9U A;  3W6X A;  1IIC A;  4II9 A;  2H5M A;  1Q2Y A;  2BL1 A;  4C68 A;  3BJ8 A;  2Q4V A;  2QML A;  4XPK A;  1MK4 A;  3UY5 A;  1XMT A;  2OB0 A;  4KOT A;  4RS2 A;  2VZZ A;  2WUU A;  4UCM A;  1N71 A;  3R96 A;  1QSO A;  2ARH A;  2I00 A;  3EFA A;  3RYO A;  1KUV A;  4R87 A;  2YNC C;  3FRM A;  3TT2 A;  2Z3P A;  4XPL A;  4MFL A;  3TOB A;  5A28 A;  3FXT A;  3SXN A;  3F0A A;  3FB3 A;  3I9S A;  4B5P B;  3CXQ A;  2D4O A;  2JDD A;  5F47 A;  2VBQ A;  1YGH A;  4QVT A;  4KLV A;  4CS0 B;  2ZW4 A;  4CRZ B;  4C2Z A;  4IF5 A;  3G3S A;  4DNC A;  3TOA A;  4MFQ A;  2R1I A;  4FD6 A;  4L8A A;  1R57 A;  4BMH A;  3R95 A;  3C26 A;  3JUW A;  3CXS A;  4UWJ A;  1S7L A;  4UBR A;  4FD4 A;  2D4P A;  2VI7 A;  4I49 A;  4AG7 A;  4KZT A;  4AVC A;  3PZJ A;  3IWG A;  4NSQ A;  1YVO A;  1XF8 A;  2DXQ A;  3LOD A;  4KVX A;  3TE4 A;  4KLW A;  4KVM E;  3P2F A;  4CRY B;  1Z4E A;  3D2M A;  4KOY A;  4JJX A;  5E96 A;  3T90 A;  4UFX A;  3WR7 A;  2A4N A;  2Z3N A;  4UFW A;  2CNS A;  4KUB A;  2B58 A;  4H89 A;  4Q38 A;  4H6U A;  3VWE A;  2ZW5 A;  3EXN A;  4OLL A;  2Z3M A;  4KOX A;  2P6G A;  2HV2 A;  4A2Z A;  2G3T A;  2J8R A;  4KVO E;  5H84 A;  1Q2D A;  1M44 A;  1PU9 A;  5EBV A;  3IGR A;  1YX0 A;  3DR8 A;  2B3U A;  2O28 A;  1YVK A;  3FYN A;  5F49 A;  2IL4 A;  4CGL A;  2YGW A;  2FIA A;  2ZXV A;  4A30 A;  4K30 A;  4UFV A;  4KUA A;  1CJW A;  2VEZ A;  2QIR A;  2YND A;  4C2Y A;  3S6H A;  2Z11 A;  4AVB A;  1U6M A;  3FBU A;  1KZF A;  2BUE A;  1MJ9 A;  3T9Y A;  1CM0 A;  3A9L A;  1RXT A;  1QSR A;  3GYA A;  2YNC A;  2DPT A;  4JXR A;  5DWN A;  5J8F A;  4PV6 A;  4OAE A;  3DR6 A;  1PUA A;  4QUS A;  5G21 A;  4RI1 A;  3FIX A;  3OWC A;  2B3V A;  4R3K A;  4IUS A;  4U9Y A;  1FY7 A;  1XEB A;  5JPH A;  1S7N A;  2Q04 A;  2PDO A;  4HNY B;  4AG9 A;  2G0B A;  2CY2 A;  1KUY A;  3B8G A;  1M1D A;  2NMT A;  3GKR A;  5IV0 A;  2R8V A;  4AVA A;  1YRE A;  1NMT A;  4CYP A;  1I21 A;  2B4D B;  3TO7 A;  5F46 A;  5HMN A;  1QSN A;  3EY5 A;  5AG4 A;  1Y9K A;  3W6S A;  5A27 A;  2ZW7 A;  3QB8 A;  4MFP A;  4E0A A;  3IWE A;  5AG5 A;  5G22 A;  4CGM A;  4LX9 A;  1UFH A;  3IU1 A;  5I0C A;  4MBU A;  1P4N A;  1NSL A;  4PK3 A;  4B13 A;  5HH1 A;  3SHP A;  4Y49 B;  5AG6 A;  1M4G A;  3DSB A;  2Z3L A;  3D3S A;  4MFJ A;  2GE3 A;  4KOW A;  2OZG A;  1BOB A;  2PQ8 A;  4F0Y A;  4XNH C;  1J4J A;  1MJA A;  2R98 A;  3PP9 A;  4KOV A;  1SQH A;  4AB7 A;  4MY3 A;  2Z10 A;  4MI4 A;  1MJB A;  5AGE A;  2PC1 A;  4MFK A;  4UWI A;  4U9Z A;  3CXP A;  4H6Z A;  3D2P A;  2R7H A;  3KKW A;  1NE9 A;  4M85 A;  4A32 A;  1IB1 E;  1I1D A;  3PGP A;  3D8P A;  4XNH B;  4R3L A;  4CAX A;  3I3G A;  2HQY A;  4Y49 C;  1WK4 A;  4ORF A;  2Q0Y A;  4FD7 A;  1Q2C A;  4UCP A;  2EUI A;  3TCV A;  2AJ6 A;  4YRH A;  1LRZ A;  3SXO A;  4CGN A;  2G3A A;  1V0C A;  1Z9U A;  2FE7 A;  4OAD A;  1OZP A;  2B4B A;  4NF1 A;  5C88 A;  4PK2 A;  4B5O A;  2PR8 A;  2FL4 A;  2BEI A;  2OU2 A;  2JDC A;  3H5Z A;  4MHD A;  3TO6 A;  2AE6 A;  4KOS A;  3R9G A;  5CNP A;  1YK3 A;  2PSW A;  2EVN A;  2Q4Y A;  1IYL A;  2CNT A;  4NEX A;  2REF A;  5FVJ A;  3ZJ0 A;  4A95 A;  3JVN A;  2RC4 A;  5DWM A;  4B5P A;  3TTH A;  1RO5 A;  4HNW B;  4QC6 A;  4MY0 A;  1K4J A;  2OZU A;  2CXA A;  5H86 A;  2J8N A;  4R9M A;  3EC4 A;  4NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...