2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein aq_1966
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
1BOBA 3FRMA 2GE3A 3DR8A 5C82A 5H86A 1MJ9A 2P0WA 3G8WA 1YGHA 3TO6A 1M44A 2B5GB 4PSXA 2PR1A 4RS2A 3S6FA 4HNXB 4H6UA 4KOXA 2HQYA 2CNSA 4KOUA 4MHDA 2VZZA 4IF5A 4H6ZA 4R3KA 4PV6A 1Z9UA 1OZPA 1S7NA 5J8FA 2PC1A 4QB9A 4EVYA 4LX9A 2FS5A 2BL1A 3RYOA 4AG9A 4Y49C 2BUEA 4ZBGA 1YVKA 3CXPA 3I3GA 2F5IA 4J3GA 3V8IA 2RC4A 2QMLA 3CXSA 4KVME 3R95A 4KVXA 2FSRA 2B3VA 5HMNA 5DWNA 4MJ8A 3GY9A 3S6HA 4AVBA 3DDDA 1Y9KA 4YFJA 4NXYA 3TOAA 4I49A 2HV2A 2ZXVA 4AB7A 2O28A 3LD2A 1S60A 1QSOA 2OH1A 2OZUA 2REFA 1QSMA 4CRZB 2Q0YA 4U5YA 4KOYA 2PSWA 1VHSA 1YX0A 4OADA 3QB8A 1YK3A 3FBUA 2VZYA 1I21A 4JJXA 2VQYA 2J8MA 1QSTA 2GIVA 3EO4A 4NEXA 1M4DA 5HH1A 4KOVA 1P0HA 3BJ8A 1S7KA 4UWJA 4L8AA 5GCNA 3R9EA 2JLMA 1IIDA 2ZW6A 4AG7A 4E0AA 3MGDA 2EUIA 4F6AA 3KKWA 4BMHA 2H5MA 4KLVA 4IUSA 3E0KA 4QBJA 4K30A 4PK3A 2G3AA 4X5KA 2P6FA 3TO9A 2FIWA 3TOBA 1CM0A 2Z10A 5IB0A 3W6XA 2ZW7A 1P4NA 3DNSA 4FD4A 3VWDA 4UBRA 4KOSA 5I0CA 5IV0A 4JD6A 1Q2CA 3PP9A 1Z4RA 2ZPAA 1Y7RA 4E2AA 1N71A 1S5KA 4PSWA 4CAVA 2JDDA 4AVCA 1Q2DA 3ZJ0A 3SXNA 3UY5A 3EC4A 1IYLA 2HUZA 2G3TA 4R9MA 1NMTA 1MK4A 4RI1A 2CNMA 2PRBA 2B3UA 4GS4A 2Q7BA 2R98A 2FIAA 5FVJA 3TCVA 2OB0A 2I79A 4OAEA 1KUYA 4KOTA 4U9ZA 3FYNA 4M3SA 2CNTA 4KLWA 4XPKA 4LUAA 5EBVA 2JEVA 2R7HA 1I1DA 5F49A 2B4DA 1Y9WA 2ZW4A 4HNWB 2QECA 4U9YA 5EC4A 4NF1A 2ZW5A 4M85A 2DXQA 2Q4VA 3G3SA 1PU9A 2K5TA 1MJAA 1KZFA 3FNCA 4UWIA 1XF8A 3EXNA 3S6GA 3F8KA 2A4NA 3K9UA 2Z11A 5F48A 2B4BA 1MJBA 5JPHA 3DR6A 4QVTA 3DSBA 4B5OA 4NSQA 3R96A 1IICA 4KORA 4R87A 2PQ8A 1WK4A 5KTAA 2D4PA 1L0CA 2WPWA 3D8PA 3TTHA 2AE6A 2P6EA 3H4QA 1FY7A 4F0YA 3VWEA 1M4GA 4CAXA 1PUAA 4HNYB 2PDOA 2BSWA 3FXTA 2D4OA 5H84A 4AVAA 3IGRA 2WPXA 4R3LA 1Q2YA 2FT0A 4JLYA 2Y0MA 3IWGA 4UA3A 3R9GA 5JQ4A 2X7BA 2OZHA 3R9FA 1RXTA 1YREA 3JUWA 4JWPA 3T9YA 3LODA 1YVOA 4R57A 3F0AA 1Z4EA 3TO7A 1R57A 3ZZIA 3QAHA 4FD6A 2QIRA 4HKFA 2B5GA 2R8VA 3C26A 1IYKA 4FD7A 3BLNA 4XNHB 1RO5A 3B8GA 1NE9A 2B58A 4CAWA 2VEZA 2C27A 2IL4A 2R1IA 3I9SA 2Q44A 1XIXA 2FL4A 4ORFA 4L89A 5F47A 5KTCA 4MBUA 2EVNA 4MY0A 5CNPA 3SXOA 3D2MA 3EY5A 3FB3A 1GHEA 3GYAA 4II9A 4B5PA 4XPDC 3P2HA 4QC6A 4DNCA 4B5PB 4QUSA 3PGPA 2FCKA 5F46A 2JDCA 4JXRA 5IX3A 1LRZA 2ATRA 2J8RA 1I12A 2J8NA 2Z0ZA 3R1KA 5E96A 1KUVA 2PR8A 2REEA 4KOWA 4Y49B 2AJ6A 4CS0B 1UFHA 2FE7A 4YRHA 1S7FA 3D2PA 2NMTA 1KUXA 1IB1E 3TE4A 3OWCA 4YGOA 4KZTA 1BO4A 2B4DB 4OLLA 3CXQA 3FIXA 4XNHC 5C88A 4XPLA 4JXQA 3P2FA 4ONUA 1XMTA 4KUAA 2KCWA 1QSNA 3T90A 2GANA 1QSRA 3JVNA 4E8OA 1J4JA 2I00A 4FD5A 1TIQA 3W6SA 1SQHA 1XE4A 1WWZA 3GKRA 4XPDB 1CJWA 2Q4YA 1NSLA 3N7ZA 5ISVA 4MY3A 3W91A 3NE7A 1S7LA 5DWMA 4MI4A 1ON0A 2OZGA 2P6GA 3F5BA 2FXFA 2OU2A 5J8CA 1K4JA 3TFYA 1V0CA 2VBQA 1U6MA 3PZJA 1B6BA 4KUBA 2VI7A 1YLEA 1M1DA 2ARHA 1S3ZA 1B87A 3BJ7A 4PK2A 1M4IA 3D3SA 2G0BA 3S6KA 3WR7A 1XEBA 2VXKA 1YR0A 5KTDA 3TT2A 3SHPA 2BEIA 2CY2A 2Q04A 4KVOE 4CRYB 4NCZA 1VKCA 4H89A 3EFAA
chains in the Genus database with same CATH superfamily
1S76D 2WA3A 2YNCA 1BOBA 2AFUA 3DR8A 1VQNV 2ZEMA 1P7BA 2RJZA 1RTQA 2N04A 2ZIMA 3G8WA 5A2QN 4PSXA 1EN5A 2ZOFA 5LYDA 1WB7A 2LFSA 1F2OA 1MSWD 1OCZB 4H6UA 3KG2A 5DECA 2HQYA 1WP8A 3OE7G 1ELMP 2EK8A 2ZEDA 2HP8A 4B3SO 2JBKA 3SPGA 1AP6A 3CHXA 5K8NA 3VQWA 2PJ1A 4R3KA 4K0KB 4PV6A 1YIJV 4PXEA 1S7NA 5KA6A 5J8FA 4DUZB 4NTWA 2CH7B 4ZI7A 3BHPA 5DS0A 2CH7A 2OIGA 3OMNB 4TV8A 1KBHA 3JSNA 2JGDB 4DUYO 4PD4F 3RYOA 3ZN0A 4FM0A 1K4CC 1M57C 1UFIA 3CEIA 2ZT9B 3E8FA 3ZIAG 2BUEA 1Q90D 3CRQA 4WFGA 3MRUA 5CBHA 2I3CA 1AMPA 3CXPA 3I3GA 5D29A 3KZIZ 4MCRA 1FXHA 4A33A 2V8HA 1E79G 4C2XA 3OT7A 1V54B 2A7WA 4A38A 4B7KA 2QMLA 1NVPB 3CXSA 3R95A 2HEPA 4KVXA 1XILA 4QJFB 3D7HA 4MVQA 3B3CA 3K0GA 1QR9A 3VQVA 2CTCA 4AVBA 3WU2Z 3FB7C 1TKFA 1Q7YW 4JV5B 1BHAA 4NGRA 4RUFA 4G1PA 1NH2D 2HV2A 2PJ4A 2YXYA 1QLEB 3OW2U 2B9ZA 4GKKB 3G6EV 3BHXA 3UO3A 5CBFA 4EKWA 2XEJA 3LD2A 2VS0A 2WSAA 1S60A 3E8GA 5J9PC 3GB0A 4ZX9A 3WB2A 4PA4A 3G4SV 2A06H 2KSDA 3T1YO 2OR4A 5H6RA 3CMEV 2Q0YA 5EMIA 3D7FA 3QF7A 4IAVA 3VQXA 3ICXA 3QO7A 2CAZC 1VHSA 4JI1O 4CBCA 2UXBB 2Q7GA 1MSDA 3D36A 1VQOV 4TWKA 2QWOB 3LNMB 2EX3A 1WNSA 1FYJA 2ZEGA 1M4LA 4CGNA 4JI0B 1IXBA 3VOUA 1LAPA 1Q8IA 4B08A 2J8MA 2GIVA 1IX9A 2W0XA 5CA3A 3SI0A 4LWSA 3BJ8A 2EJ7A 4L8AA 5GCNA 2EZPA 3C90A 3OTFA 2ZW6A 3QNVA 4CYQA 4JI8O 3RYFA 2V1DA 3ABMC 3BPZA 5BR8B 3KKWA 3D66A 1OCCB 1PNKA 3ABLB 2Z3YA 2P90A 4K30A 3NA6A 2UUCB 4OPAA 1FXVA 1D5NA 3ZMUA 3ZHSA 4X5KA 3TO9A 5JQGA 2Z10A 5IB0A 2ZW7A 1XI1A 1JQGA 2EJRA 1FNOA 1AI4A 2YXLA 4DR4B 3DNSA 5I0CA 4KOSA 5IV0A 3B40A 4JD6A 3K08A 2X0LA 2YGWA 4B3TO 5K8MA 4KHPO 1OZ0A 2ZPAA 2Q67A 1QLEC 2IBZH 3RO0A 5G21A 4ZHQA 1N71A 4E2AA 4TQDA 2CGNA 1KU9A 2LP7A 3WFVA 3RBZA 5HFMA 1TXRA 1GKFA 1JA8A 3JARB 2WA4A 2IU0A 3UY5A 4HNAB 3CCJV 5EBMC 2CE4A 4IIJB 4HNAA 2P06A 1NMTA 1SS3A 5CB4A 4IIJA 5J2UA 2ZCEA 1RSOA 2GSMB 5LYJB 4ONWA 3RGBA 2OTLV 4RI1A 4UIAA 5IJ9B 4ZX8A 5IY5B 2FIAA 3CMAV 2RQ6A 3HB3B 4WF9V 2HFEC 4OC0A 3FYNA 4M3SA 2HLDG 4AI8A 4P9OA 1QNMA 5L3FA 4JGSA 4LUAA 1NTKH 4O4JA 2YS8A 4HYOA 3ISXA 3N2GB 4NKGB 3FX7A 2CUGA 3N2KA 3FMCA 1QR8A 1VQKV 5IYCO 1Y9WA 2Q4PA 4DK0A 2ZE8A 4HNWB 2XAGA 4PA3A 4X3RA 3PB7X 2WAMA 4NF1A 1S72V 2ETNA 1Q6HA 1H2NA 2IMOA 2IQ6A 3DC6A 3VQYA 5B3SB 4FUUA 4WBNB 1NZ6A 4QE7A 4QNHB 4ZKIA 1Z5VA 2OCHA 2WLJA 1GYTA 1KZFA 4TUYB 2EINB 1F2PA 1XRYA 3FNCA 2HVKC 3EXNA 1V55B 4KP4A 4M6HA 2P67A 2IJKA 1AUGA 1SERA 3ETQA 2ZOGA 4JI2O 5LMNB 3SI2A 1HDQA 2B4BA 2ABZA 3G71V 1MJBA 5JPHA 2QM7A 4QVTA 3JAKB 3TX8A 4B5OA 1SETA 3R96A 2DOSA 3QTCA 4R87A 3AK1A 4KS9A 2LGWA 1UPGA 4J42A 3D8PA 4I7ZB 3AG3C 5L3CA 4BAYA 3H8EA 4Z65A 2DWDC 4H13B 4UEEA 4CH5A 4JYWA 3STLC 4CAXA 1FXKC 4DK1A 2PJ5A 2PDOA 4RAIA 1YJNV 3RYHA 1BLLE 3WC6A 2ZE5A 3OTOB 5H84A 4PXCA 2H94A 3IGRA 1AJPA 3D7DA 3QO8A 5K1PA 3UQ8A 4CAEA 1FS0G 2GTSA 3LUTB 5LHGA 4MFKA 1LUWA 3E35A 3IWGA 3R9GA 1YSCA 1YQEA 4UB6Z 1YHQV 2M7WA 2DPTA 2OZHA 5I4MA 1PL4A 3CC7V 1Q3EA 3LODA 2E5LB 3ZCCA 1AILA 2CXAA 1Z4EA 3TO7A 3FD9A 3B3WA 2PRQA 1F51A 2YNCC 3QAHA 2ZEPA 2OT5A 1VQMV 4PXDA 5FNVA 4CS2A 4UVBA 1J5EO 2PJ6A 4HKFA 1MA1A 1AI6A 3HKBA 1SQPH 4KXRA 1O9GA 5K8PA 3TC8A 3BLNA 2HJFC 3RYFB 1GN2A 3ZHUA 2V8DA 3X2QB 4AQYB 4DO2A 2Q0AA 2VEZA 1AROP 4NYKA 1H8LA 3B2YA 1YXBA 2C27A 2IL4A 1ZLZA 2FTKA 1H2LA 1XIXA 3FVLA 1S5HC 3AG3B 4CGMA 3THOA 4XDLA 4ORFA 4L89A 4MY0A 2YIDA 3SXOA 2Y0PA 3FB3A 1HNXO 4DR6O 2JJ2G 4LF6B 3OAAG 4C2ZA 4X8AA 4Z1MG 4L8JA 4OP4A 3PGPA 4DR7O 4IGGA 2JDCA 2EK9A 4OIDA 1KB9F 2Y48A 2PF4E 1HNXB 1YLOA 4P45A 4FFBA 1I12A 2JEUA 3CE2A 5AG6A 2HB6A 3SGIA 4JF3A 4KOWA 4UCOA 4TSFG 3CXCU 4Y49B 2A9HA 1K92A 1EZVH 2IM9A 3ZX6A 4ZBMA 5CA1A 1K8AW 2POKA 1RP3B 1N34O 2NMTA 4DR3B 1YDXA 4YGOA 1YEWA 3N2KB 4KZTA 3C3TA 5KUMA 1BO4A 1XBLA 2EIMB 2H3OA 3J80N 2B4DB 4OLLA 2XOKG 3BEHA 3CXQA 2WLKA 3MHSC 4LCUC 3K06A 3ZN1A 1DTOA 1JX9A 3V7ZA 4G27B 4R6TA 2AZ2A 1KP3A 4MHZA 4OC4A 3IC1A 2F66C 3TCUA 4X1KB 1RFYA 1YI2V 2WLIA 1OCZC 1N8RW 4DR1O 3QO5A 1BS3A 4P4FA 4HZ3A 4B3MB 3T90A 4TWEA 5THWA 2BCOA 4ASUG 2LW1A 2VRZA 4CZZA 1QSRA 1XREA 2YDEA 4MCSA 4WCEV 4FD5A 5LGTA 4NJRA 4JI5B 1SZTA 3R66A 1E1RG 1B6QA 4DR6B 1IDSA 4IYHA 4FLWA 2Z3OA 3GKRA 4DV0B 3N7ZA 4FWUA 4NGQA 3J7AU 4MXUA 3JD2A 1IURA 2DEAA 3H1HH 2OZGA 4LF4B 2QKSA 4UB8Z 3L70H 4DV7B 2C2AA 4YJ3B 3CS5A 4Z2WA 1BQZA 1RM1C 4K3NA 1K4JA 2JDIG 3UM7A 4AQYO 5JQGB 1JWQA 2NSMA 3IO1A 2XAFA 3K5OA 1H2GA 1V54C 3IEHA 3KI9A 5AG2A 4DV5O 1U6MA 1VGYA 3SJBC 2ZNIA 3P30A 2XEGA 1B6BA 4LR3A 3ZRWA 2ZR2A 4EWTA 5JJEB 4F0XA 1BMFG 2ARHA 1S3ZA 1H2SB 3FB8C 4DR4O 1G4YB 3E83A 1A2ZA 5HFLA 1KUQA 2QJ8A 1PNLA 3UKMA 2JS3A 1XEQA 1XEBA 2KB1A 4NTYA 2F1MA 1YR0A 3CZXA 2F4VO 3SHPA 1K9MW 4LF4O 4UCNA 3E8HA 2Q0OC 4UCTA 5EK0A 4JYYA 1VQPV 1M90W 2BEIA 3H1KH 4CRYB 2UXNA 1QCEA 4FLUA 5CN0A 2PJ9A 1E1QG 2WLNA 1R3NA 3R65A 2DQ3A 1MNGA 3LSQA 4JTDB 4TQFA 3B8NA 3FRMA 3SR2C 1PNMA 5KHKA 3F5WC 3JCZA 2ZXWB 4PDLA 1VEWA 1QQCA 2B5GB 3FX6A 4DR3O 1NT2B 5TISZ 1L0NH 2PJ8A 2V7QG 4M6GA 3SJXA 4N23A 3UCSC 4MHDA 3KHXA 5LMUO 1Q86W 2QM8A 2CTPA 2VZZA 1JFFA 1NU1H 1HR0B 1O9HA 4DR2O 3RN4A 4RO2A 4GUNA 4PV1B 1OZPA 3SJFA 5B66Z 4UXNA 1PPJH 4FLYA 2PC1A 3L75H 1SQFA 4FLXA 3W7TA 1TUBA 4GKKO 4LX9A 2X6BA 4U3JA 2FS5A 5B1BC 4LQGA 2BL1A 1JVMA 4LF9B 4AG9A 3NH4A 3A8TA 2QM4A 4LNUA 4X20A 4JZ2A 2F5IA 3FECA 4M6IA 3V8IA 3IFXA 2YSUB 2RC4A 3GVMA 1N36B 4J80A 1V55C 2PVVA 3CRRA 1ZL8B 2FSRA 1MMMA 1OHHG 3ASNC 2C1CA 4G2KA 2CF4A 4MCPA 4DYLA 2B3VA 3K58A 5B1NA 4MFLA 4MJ8A 1NI8A 3GY9A 4EEQA 4XDKA 2GUZB 1Y9KA 2YC0A 4I49A 4PA7A 4DV3B 2ZNJA 2ZXVA 4MVMA 1IBMO 4AB7A 3BI0A 4I4TB 4JAUA 2O28A 3RYHB 4JYCA 1FAFA 5GONA 1X4TA 5LA6B 3L74H 2EULA 4XDJA 1QSOA 2REFA 2R9AA 1QSMA 4KFMA 2YEVA 1W2BU 4CRZB 1Q5OA 1XMBA 4I55B 2AW9A 4KOYA 1PKXA 1XQ8A 2L35A 2PSWA 2GHYA 4PI0A 3SJGA 1NQTA 3CJHB 1GN4A 1SQGA 3Q4HB 4UEZA 3SYPA 2V8VA 3CJHA 1Q43A 4OADA 3KCYA 1R3LC 3SJQC 2BOCC 3QB8A 1XNQB 5C8YB 4LF6O 3FBUA 2CTWA 1I21A 5KMGB 4JJXA 4YIOA 3K9TA 1QSTA 1WA8B 3OGCC 4TT3G 4JTCB 4I0XB 3H01A 3R9EA 1IIDA 3I55V 4FK5C 3PEIA 5HVFA 5C93A 3WC5A 4CPAA 3B3TA 5KA5A 2FYUH 3WB1A 3ZRVA 3HR0A 1R6KA 4UIBA 3AG4C 4KLVA 4IUSA 3PRTA 3E0KA 4R8CA 2ZIOA 1IZ3A 3KR4A 4A94A 3FKSG 4DV1O 2GFQA 1XUQA 1ZUQA 5A27A 3N27A 2E75B 3CCSV 1LFWA 2JRIA 3VWDA 1VF7A 5B1AC 3OTOO 2W0FC 3AK2A 1JJ2U 1I94O 5BWAB 3S9LA 3PP9A 1B04A 3D3QA 5IJ0A 1Q7LA 2IJHA 4WWVA 5CBGA 3JALA 3FF3A 2GBOA 4WFBV 4JZ0A 2JDDA 2BTQB 1Q2DA 5JM6A 1VQ5V 3A2FA 1IYLA 2ZE7A 2G3TA 2PGGA 3OR7C 2PJCA 5EC1C 4UVAA 4BIUA 3JTKA 4FLZA 4P44A 2RMKB 4NXMO 1VHOA 4JI6B 1GRJA 3TXQA 2Y69C 2B3UA 2PRBA 2R98A 4GS4A 4OGQB 3CPXA 5FVJA 3RYCA 3M99B 3TCVA 3H8FA 2ILMA 1YTFD 4K8ZA 3H9VA 4LC1A 4NB5A 2CNTA 2RFHA 3KQXA 4O4JB 5EBVA 2JIZG 1P84F 3BAAA 4LFAO 1R6TA 2R7HA 3T2MA 4BIZA 2G9DA 1AI5A 2PCUA 3PFOA 4J9YB 4DR1B 4UEFA 2B4DA 1K34A 5KAIZ 4R7CA 1YJWV 2QECA 4U9YA 2PI4A 1FJGO 4OPHA 4FVMA 4X1KA 2Z3PA 2EILC 1FD9A 1PU9A 4MTFA 1GAXA 1MJAA 4IL6Z 1VQLV 2Y4TA 2EIMC 1MZFA 4I5SA 5LRKA 3JD3A 4TV8B 3S6GA 2A4NA 2ZDIC 1SESA 3MDSA 4ZIBA 2Z11A 2PJAA 5J2TA 1K5SA 3CCQV 1YCIA 3DSBA 1PM9A 4NR1A 2LGQA 3O9OA 5H2FZ 4F9UA 4UVCA 4I9WA 2BTOA 4DV5B 4YY3O 1WK4A 1VQ8V 1TVKB 5KTAA 1L0CA 2EIKB 4MTGA 2P22C 3H4QA 1FY7A 1UWYA 4H33A 1OCOB 3IAYA 3IU1A 1PUAA 4JI4B 1KYOF 3HLPA 2HG5C 4DV2O 3DSQA 2YICA 4OKOA 1PCAA 2Q5ZA 2AZ0A 2Q69A 4PELA 1XOUA 3ETEA 1YSJA 5LXTB 5BY1A 4C68A 3JASB 4AHCA 2D4OA 4EMEA 3ZMSA 2WPXA 4TOIA 2X6AA 4R3LA 1US6A 2Y0MA 4J41A 1PP9H 3JAMN 2X7BA 5F09A 4LFBO 3BABA 3R9FA 3QG5A 2VWJA 4YJ2A 1X59A 3OMIB 1KKDA 4JWPA 4DRXA 5JVDA 2ZEFA 1HW7A 3T1CA 4RQEA 2DYSC 4E2LA 1YVOA 4JI8B 3ZZIA 1R57A 1R43A 4X1YB 1SF9A 5LHIA 2CIJA 2Q4ZA 5KMGA 4YY3B 3HKDB 3MN8A 4FLVA 4H0LB 1CP7A 4FM2A 5JJNB 5FNVB 3CRCA 4NGSA 1VF5B 2B5GA 1MZEA 1N34B 2GLJA 2DN9A 1K7DA 3VATA 2L6LA 1W0JG 1EN4A 4CC5A 5EC2C 4J9ZB 1N0NA 3RZAA 1CPYA 2ITDC 3E89A 2XHBA 5KLVH 1OBRA 2Q44A 3I9SA 4MVOA 2LFRA 4NJQA 1HEEA 4D6TH 2EIJC 4X65B 4GKJO 5H5NA 5LP6B 5D5QA 3CCUV 2EVNA 1M9NA 3EY5A 2CGOA 5EYPB 3LDEA 1HNWB 3U10A 2AFSA 2AGAA 4B5PB 2JGDA 1DE4C 1FT7A 1DF5A 3U11A 3JAKA 1TKJA 4BWAA 5IX3A 2LJ2A 2UXDO 5IYDO 1LRZA 4N21A 5DM6V 3FYEB 4X66O 3U0ZA 3QAYA 4DUZO 2X6CA 1IY7A 1CG2A 4U3FH 4I9QA 4LQ6A 4UFWA 3BVOA 2J8NA 2Z0ZA 3IWEA 3R1KA 4YHHB 4GYCB 2PR8A 2QTSA 3CWBH 4J7JA 1JOYA 3GIUA 6CPAA 4CH3A 2ZEOA 8CPAA 5KUKA 5LBQA 4P6YA 2FE7A 1S7FA 3BRCA 2UUAB 3D2PA 3KGQA 1IB1E 2WYRA 3CX5F 1ENVA 3VBBA 2ZM6O 2XEIA 5LYIA 2PYLA 5JH9A 3ASNB 4R50A 2D3OW 3FIXA 3DXRA 3CPAA 4CS3A 3S9NA 3IJ3A 3EVKA 4XNHC 2DYSB 4IT5A 1N32B 2GLFA 2ZENA 4ONUA 4QIWF 2HKOA 1Y0RA 1XMTA 1XNRO 5EBWC 3RVYA 5JVDB 1BPNA 2AFOA 5C8YA 5EZYA 3ABKB 1LOKA 2F8HA 5AG5A 3D4UA 2GANA 1CX8A 1A32A 1Y7EA 4E8OA 1OJHA 5DN6G 1KD1W 2I00A 4GX1A 4LF9O 1IOIA 2AHZA 4I0XA 2R70A 3B3SA 3W6SA 1JQ0A 3JATA 4MT8A 5KHIA 1HNWO 1F7YA 1CBXA 3L2NA 4MHYA 3TXSA 1CJWA 1NSLA 3HKBB 4YHHO 3PB4X 4UUJC 4UV8A 1XMOO 5LYLA 3NE7A 2CK3G 3ML0A 3BI1A 5DWMA 2P6GA 3F5BA 2EO8A 4X66B 2FXFA 2OU2A 1N4CA 4AILC 2QKCA 4PXBA 1ELLP 4EB6B 2DPSA 5H6QA 4OX9O 4EB6A 2FVGA 3WT4A 5B1BB 4LFBB 3K2KA 2OIEA 3GB7C 1N32O 2WLLA 1LCPA 2YNEA 2GTAA 2VI7A 3FFQA 3W7XA 1JCHA 1YLEA 5GONB 3JASA 3LDDA 1SKVA 2NN4A 3P3NA 4DV4B 2PVWA 5LXTA 1GMGA 2XEFA 2Q9LA 1S5LZ 4FMTA 2EBJA 2IJZA 3ISZA 3SI1A 4JI7O 4I55A 5L3EA 2G0BA 3WR7A 1AJQA 2UU9B 1V9PA 2F4VB 2VXKA 1IBKO 1Y74A 4P4IA 4O2BB 2P5OA 1RSOB 1YVWA 4B10A 1AJNA 2NLJC 3RYCB 2CY2A 3A0BZ 2XT9A 1H8HG 3H1LH 1GTOA 4KL1A 3ABLC 1VKCA 4NVPA 2DE0X 4WFFA 1FPOA 2OOTA 3SDLA 3LSUA 1N36O 2IH3C 3TJTA 4LWSB 2GE3A 1QQ9A 4G28B 5C82A 1XL4A 3HKEB 4LF5O 3OM3B 4DV2B 1M1KW 4PPZA 2OWOA 4ZOLB 3W7UA 1YGHA 4JI1B 2UXBO 2BOAA 1SQQH 1NKDA 2RB7A 1XBUA 2ZINA 4KOXA 2CNSA 4KOUA 3CCVV 1GH6A 3SYAA 2GU2A 3E2EA 3ZHVA 3GWOA 4MSWC 4A32A 5EZYB 4OC3A 4X64B 1HP8A 4JAVA 5LP6A 2F7VA 3OGIB 4NXMB 4J7ZA 4MFJA 1TUBB 1Y4MA 2OTJV 2W6IG 4QB9A 4U3JB 1Z8XA 1GN3A 2WPDG 3RWRD 4OIWA 4JI3B 4Y49C 4ZBGA 4PQAA 4DV4O 4KHPB 2ZD9A 3W7WA 4MVZA 4X20B 4J3GA 4LH7A 5JJJB 2YI9A 2PIZA 2RDCA 4MCQA 2PTMA 1LR1A 5KHJA 4KVME 1ZSPA 1F4NA 3ASOC 2DJVA 5IJ9A 4PI2A 4J11A 4JI3O 5HMNA 4OX9B 5DWNA 3RBUA 1BCCH 3DDDA 4NXYA 4MS2A 1CEZA 2KG7B 2W6JG 5D8NA 3MAQA 2AHYA 1G1XB 3H1IH 1HWYA 3D3IA 2DWEC 3AG2C 2OH1A 3SPJA 1FFTB 1CPSA 3S3WA 1MG1A 3IFEA 4OC2A 4GT1A 1OCOC 2D2CB 1P7GA 2PUSA 3M7MX 2Z0AA 2WSSG 1K4DC 2Q7SA 2KQXA 1K3EA 4NXNO 4DXWA 3ETDA 3LMSA 4DRXB 1VIXA 2Z3NA 3RYIA 4I50B 4EFEA 5JH7B 4NFRA 3L71H 2VZYA 1R73A 2VQYA 3C3SA 3EO4A 4IYIA 1NTMH 3K57A 2C6PA 1M4DA 3T8WA 4KOVA 1F57A 4P4BA 3EHBB 3ETGA 4XBFA 4LH6A 4CH4A 2JLMA 4JI6O 2QTOA 4YWYA 1Q6UA 4DUKA 2FMLA 3DLJA 2PJ7A 4AG7A 1XHZA 3NH8A 1AB3A 3DTUB 4KSFA 4F6AA 2YIAA 4RQFA 2H5MA 4MW8A 1N33B 4JI7B 2EILB 4DV6B 2V77A 1QVGU 2G38A 4LF8O 1ZAUA 4BW5A 2G3AA 2P6FA 3TOBA 3L9DA 1CM0A 3W6XA 4ZY0A 2GV9A 2ZEHA 1DLBA 4FD4A 4YIPA 3PJSK 3K5MA 1T5EA 1AR1B 3ZMTA 2K1EA 1ARMA 1Q2CA 2VL1A 5IB9A 5GTHZ 3JALB 1WN7A 1Y7RA 2ZELA 2P7TC 3JCUZ 5IJ0B 4CYPA 1NVPD 1S5KA 4WFAV 4PSWA 4CAVA 1M93A 4F4LA 4B6ZA 2PY5A 3SXNA 2V4DA 3EC4A 2YUAA 2HUZA 4UV9A 3K59A 3ZHTA 1ZX3A 4JYAO 2BE3A 2JVDA 4K0KO 1BT8A 1M56B 4FFBB 4CYNA 1MK4A 2CNMA 4DW0A 2JGUA 2HHHB 1ZG9A 1WPBA 2Q7BA 5AG4A 3ZJZA 2MK3A 1BPMA 2ANPA 2OB0A 2I79A 4A2ZA 1FJGB 1CPXA 3FYIB 4ABMA 1KUYA 4U9ZA 2UXDB 3APQA 1WAZA 1AYEA 5K1XA 4PDVA 4KLWA 5D5PA 4JI4O 5LP6C 1XJOA 2JEVA 1NS1A 5F49A 4EFBA 2ZW4A 3PFEA 1H2MA 4X88A 1LUVA 2B1GA 4B3MO 4B7EA 3NH5A 1ROPA 4UCSA 2ZR3A 4OC5A 3E8BA 4MVUA 1DGSA 2B5UA 4GKJB 5CA0B 3ZRSA 4BR6A 1R6NA 1AI7A 2Z3LA 2ZW5A 1JFFB 2DXQA 3GUXA 3G3SA 1IBKB 4FJCC 5HVHA 3OMAB 4X1IB 3CCEV 4UWIA 1SRYA 5EYPA 1XF8A 4Q20A 3NFZA 1TKHA 2M6YA 3K9UA 4C7UA 2RNBA 4AXVA 1Y76A 3OFNG 4LP8A 2IW5A 3H5ZA 5GTIZ 4NSQA 3PBEA 4KORA 4P4DA 1THZA 1I08A 3D68A 4PDRA 3FAVA 1SQVH 1IBLB 1LAMA 2D4PA 2WPWA 3TTHA 1ZL8A 4C7IA 3SYQA 4E4EA 1HNZO 4DV1B 4MMOA 3VWEA 3T4DA 3SPIA 1I5XA 4Q6GA 3ABTA 1M4GA 4NGMA 3H8GA 3KKYA 5KX5B 4HNYB 1SZXA 3FXTA 3ZEDA 5G22A 1ZWIC 3FEDA 3O65A 3AG4B 4DJLA 4AVAA 1L8DA 4ZY2A 2PE3A 1GM8A 2AFMA 3CYOA 3SPHA 4LF7O 4UA3A 1AR5A 5JQ4A 5JCOC 1RXTA 1FFXA 3JRUA 4K35A 2GDSA 2QVPA 3T9YA 2N05A 3BFRA 2ATKC 2VWKA 3SYCA 4K8XA 2HJDA 4P2ZA 2R9RB 1LNQA 1HNZB 1RPRA 1XDCA 4F6EA 3AG7A 3I5DA 3B2EE 4FD6A 4MRIA 2OCCB 2C6CA 2QIRA 4P10A 3A9LA 3HKDA 4ZGYB 5GW7A 1ZTEA 5IT9N 2AFXA 3OEEG 4OMEA 4Q7AA 4PHZA 4UCPA 4FIPC 1JPXA 3C26A 2UXXA 1IYKA 4FD7A 4QPJA 4YXWG 3K79A 1U97A 4XNHB 1Q81W 4RUHA 1G6UA 4DV3O 3B8GA 1NE9A 2CDYA 3D36C 2Q43A 4X9QA 3BY6A 1H8EG 5FLXN 4X89A 4P4JA 2E76B 4BINA 5H9CA 3K9AA 5IYZB 2BSKA 3CP1A 1B06A 5ELYA 2BSKB 1KKCA 1Y67A 2QWRB 2NR5A 4UFVA 2FL4A 1B3QA 1VP7A 4L87A 4TUYA 3CC2V 5F47A 1J5EB 3G80A 1PYTB 4GCZA 1FXKB 1D5AA 1R3JC 2N74A 3OD4A 4B5PA 4IK2A 2P4VA 4GXHA 4XPDC 2QJ1A 4QC6A 1AP5A 3LNNA 2R72A 1U96A 2Y4UA 3B7IA 1S77D 4QUSA 5AGEA 4CGLA 1Y76B 4LFAB 1JJOA 3B35A 4JXRA 3IGAC 1FKAO 4FZ0A 5JWPA 4C7HA 2P4KA 5B3SC 4B3RB 1Z5WA 2ATRA 1BSMA 1Y74B 3ZRXA 1S3JA 3JAWB 1TVKA 2F95B 5J2UB 1VQ9V 3OUFA 2JEXA 5E96A 4DW1A 4CS4A 5FPOA 3V38A 2J9AA 2REEA 2HHHO 2ZKOA 5LMUB 1ZG8A 1YZBA 2AJ6A 3CD6V 2QWNB 4CS0B 3PB8X 4JI2B 4JTAB 1KWMA 1K5QA 4YRHA 3CT9A 3HUVA 5ITZA 1XMQO 3HKEA 1KUXA 1TF8A 3TE4A 2OCCC 3E86A 4ZOLA 1K97A 3AK3A 3B09A 3SJEA 3GWKC 1KMIZ 2ZXWC 5C88A 4JXQA 3P2FA 5J1QA 4FBEA 4KUAA 1SQBH 4GLXA 2NNUA 1D2DA 4DYOA 2ZQMA 3G67A 2YXHA 1PV0A 4IHJB 4LBEC 3CCRV 1TF9A 4EFDA 1AR4A 3NXSA 2FB5A 4GZRB 3JVNA 5JGFA 3DGEA 1H38A 4UCVA 4CYOA 4F8ZA 1TIQA 1NJIW 1WWZA 5LOVA 2QYVA 1SA0A 1CXZB 2A0LA 2Q4YA 3D67A 1QBZA 1YJ9V 2QEXV 2DW4A 4FFKA 1NSAA 2Q7HA 5ISVA 4MY3A 1BAVA 3W91A 2LQTA 3CCLV 4MI4A 3NR7A 1ON0A 1IXMA 3T1HO 3A0RA 3K3WA 2O53A 2IJIA 3F7VC 4HBNA 3K5NA 3LDCA 1W0KG 3EFFK 3FAVB 4P9PA 2ZEEA 1WPXA 3IU2A 2NYQA 2VBQA 5LRGA 3AEIA 3HKCB 4R8FA 4NGTA 2Q6AA 4FLTA 3ZMZA 3ASOB 4J10A 1VHEA 3CRMA 4LF5B 1OCRB 2QGNA 4KUBA 3E22A 4MTOA 4ZI6A 2HVJC 3ZRWB 5KX5A 3PBBA 4P4EA 1M4UA 3ZHQA 3M8AA 3UO2A 4W4LA 1J95A 1QHTA 3IC9A 3GLJA 2EWBA 3CC4V 4A31A 1R1BA 2H8PC 4RWUA 2WUUA 1EBOA 2Q73A 3BJ7A 4PK2A 1NR7A 5BXZA 1M4IA 1ZO0A 3D7GA 1Z2GA 4ZYQA 1VQ4V 3D3SA 1VARA 4JI5O 3S6KA 5KHGA 3IWWA 3UT5B 2HR3A 4WFEA 2DYRC 5KTDA 1FFXB 1YITV 1VIBA 1IGBA 4O2AB 1XOVA 3RYIB 2Q04A 1BGYH 4KVOE 1W59A 4NCZA 4MFZA 5L3BA 4PDMA 4H89A 1NBMG 1Q82W 5KHHA 3EFAA 4X62O 4J7KA 4X8IA 2PI5A 1Z8TA 2DF5A 1GM7A 5ITZB 1NTZH 5H86A 2WZNA 1MJ9A 4B13A 1LANA 2P0WA 4MHPA 3TO6A 1M44A 3RNZA 2XAQA 5CPAA 3VH9A 2BOBC 2PR1A 4RS2A 2XNDG 4UFZA 5G20A 4A37A 3S6FA 3BA8A 4HNXB 5IY5C 5IWAB 5K8OA 3ZBHA 3ABKC 4JZGA 3T1HB 1CP6A 4A5UB 4OXSA 4R76A 4MVSA 3JD4A 1EN6A 4IF5A 4H6ZA 5DEDA 4MW3A 5IYBO 2BCCH 1XMOB 1Z9UA 4UCUA 1IBMB 1JR9A 3L73H 4KUMA 4ZI7B 4B3SB 4B3RO 3FJUA 1TGOA 5IWAO 4EVYA 1BL8A 1XFOA 5LOVB 1IU8A 4BD9A 4MFQA 1YVKA 4F9VA 1I94B 5LRJA 2BTQA 1G8MA 1HDJA 4YJ3A 3APOA 3F7YC 1K73W 3CPWU 5CB4B 3RFRA 3JAWA 2QR4A 1WJZA 3KCXA 4NGNA 2EBOA 2R9IA 2E5LO 1XMQB 3K0DA 3S6HA 3I56V 4JYAB 1I7FA 2UUCO 3KL9A 5BMVB 1AVMA 3D8CA 4YFJA 3TOAA 2QDOA 1QLNA 4JAAA 1N33O 4JV5O 3B4SA 4NTXA 3N5FA 2LW7A 1S0VA 1HR0O 2Q8VA 2OZUA 3PB9X 2WWWA 3H1JH 4U5YA 3ABUA 4B14A 1IOFA 4CGPA 3P32A 1YX0A 1KC8W 2F93B 3TETA 4F6RA 1WP7A 1YK3A 3ZS8C 5A28A 3K03A 2Z3KA 4FM1A 5JH7A 1RM1B 4X62B 2V8GA 4NEXA 1YF2A 4TV9A 2O4HA 5CMUA 4MTXA 5HH1A 1P0HA 4UWJA 5HXDA 1S7KA 1SA0B 1I0HA 2XAJA 4X64O 2UUBB 2PJ0A 1TAEA 2PYJA 4BBHA 3K04A 1Y66A 4E0AA 4BIOA 3MGDA 4TNUA 2EUIA 3ZMVA 4BMHA 2F43G 2OYQA 2E74B 4QBJA 1I5YA 3B3VA 4LF7B 5LL6Y 3JSLA 4D7SA 2WLMA 4PK3A 2FIWA 3FH4A 2UXCO 1P4NA 3JD1A 2ZDIA 3HKCA 4UBRA 3CCMV 1RPOA 2JEWA 1YMEA 3X2QC 4MHNA 3T1YB 1ZLHA 1Z4RA 5EIBD 2XTAA 4DR7B 2ZM6B 4UFXA 3OUSA 1PL0A 4HAMA 3PB6X 1DK1A 5B1OA 1BE3H 1R3KC 2XASA 4DV6O 4AVCA 4GX0A 1VF6C 2IU3A 4DUYB 4DV7O 3ZJ0A 2CTBA 1IBLO 3KR5A 2UU9O 4UCMA 4R9MA 1BHBA 2JK5C 3CB2A 3VARA 5IE9A 4O4IB 3BA9A 4C2YA 4DV0O 4O2AA 5LHHA 1M57B 3STZC 1K33A 3OR6C 4OAEA 4KOTA 4O23A 2C6GA 2KG7A 5CA1B 4XPKA 1QVFU 1SC5B 4I4TA 3N2GA 4OC1A 1YW4A 3OEHG 3JYCA 1I1DA 1UJWB 1DF4A 3LACA 3RT3C 4KSAA 1F23A 2QKAA 2RCVA 3DGVA 1WB8A 5EC4A 2AFZA 2AXTZ 3KASA 1XHXA 4B3TB 1KP2A 2WLIB 3CRAA 3WABA 4RN7A 3Q4HA 4M85A 2Z5UA 4F6RB 2Q4VA 1EFRG 4IHMA 2YIBD 2K5TA 4I50A 1HDUA 3B77A 4WBNA 2Z3MA 2F23A 2XUMA 2PZSA 1Z8WA 3F8KA 3ZHRA 5BR8O 3F5TA 5KAFZ 4LFCO 2ADPA 2ZE6A 5JCOA 5F48A 2BO9A 2ODFA 1Z5RA 3DR6A 5LGUA 4A39A 1OCCC 2P6JA 4WJBA 2O57A 1IICA 4JASA 2DMXA 1TA8A 5FL7G 3QNEA 2PQ8A 3AG1B 4A30A 3LSSA 2AE6A 2P6EA 1BZKA 4FAIA 3G6BA 4F0YA 1H2KA 1M56C 4Z1VA 3E22B 2BSWA 5EIBC 1NR1A 5L3GA 4GM5A 4CC6A 4QPKA 2LO1A 2ITCC 4JYBA 4R7MA 4A95A 5LMNO 1Q2YA 4CH6A 2FT0A 4JLYA 2HC9A 3SPCA 2YEVB 4D7TA 4H44B 1YREA 1PD3A 4O2BA 2Q68A 3EXAA 4JI0O 1YTFB 2GREA 2PJBA 3JUWA 3LWUA 4FZ1A 4W4KA 2QWPB 3SJAC 4R57A 3F0AA 4UF4A 1EZJA 2K9PA 1WA8A 1M5IA 1YW6A 4K3AA 3NE8A 1JMKC 4TV9B 2CTRA 5LGNA 2MW2B 4U7NA 4HPSA 2Y0IA 2DYRB 1KECA 4UCRA 5G1ZA 2R8VA 2UXCB 2CTQA 2AFWA 1NH2B 4MVRA 2PIYA 4ZY1A 1RO5A 4GX5A 2VQEO 2B58A 2A79B 4CAWA 2Y69B 3FB6C 1IVSA 4WFHA 5LYFA 2EINC 5AG7A 4QE9A 2R1IA 1WLEA 3MHHC 4R6ZA 1VF6A 5IYZA 1GK9A 2EIKC 3S3XA 1QMUA 1XNRB 3FEEA 2X7RB 4W9YA 2PJ3A 5KTCA 1BQ0A 3K5LA 4MBUA 5CNPA 4KSIA 3D2MA 3QVNA 2JS5A 1S5JA 1GHEA 3GYAA 4II9A 3IIBA 1L0LH 3P2HA 4DNCA 2WLHA 3A0HZ 2IH1C 1QU7A 2Q7EA 3WB0A 3JD0A 1OCRC 5CBMA 2DQ0A 2PJ2A 2FCKA 5F46A 4ZHQB 4CAFA 3IJ4A 1VQ7V 4NGPA 1GN6A 4PJ0Z 4X2TA 3UT5A 4BW9A 2J8RA 3HPLC 4QGPA 4O4IA 3P3PA 4X65O 1KUVA 5BMVA 5LYJA 1R3IC 1XL6A 2GUZA 3CSXA 1X12A 1N0JA 2YI8A 4Q38A 1DTDA 1OV9A 5L3DA 5A9GA 5F2VO 2Q51A 4O4HB 2E3CA 1UFHA 4RUEA 4H37A 1EE3P 4O4HA 5IDJA 2EZOA 1ZLIA 4H2KA 3OWCA 1MABG 5LA6A 3DXRB 4YU9A 2FKXA 3RW0A 1GO3F 1TUEB 1COWG 2KKWA 2B1IA 1URFA 3KZWA 3W7SA 4XPLA 4GX2A 4YJ2B 5B5EZ 3CDXA 2KCWA 5CA0A 4DR5B 1GM9A 2YNDA 4LF8B 1QSNA 2IJJA 4IHJA 1Y6XA 3WG7B 1P49A 3I1UA 3BCCH 3SYOA 1Q6IA 5E1AC 4MFPA 2UUAO 1J4JA 3AG1C 4X1YA 5HVGA 2EIJB 5E79Z 3JATB 5FPRA 4X1IA 2VQFO 3TGUH 1P4RA 1SQHA 1XE4A 1MOFA 4XPDB 4LNUB 1Z8LA 1KQSU 1SQXH 5J2TB 1VQ6V 3FB5C 4FPPA 3PN1A 2QSAA 3KQZA 4DR2B 1ZG7A 3BXMA 1S7LA 1Z2LA 4P30A 2XAHA 3AG2B 3S9MA 2QA4V 2VQFB 2JBJA 5J8CA 2VQEB 3TFYA 1V0CA 4CGOA 1X10A 1L1FA 3T4ZA 3IC7A 1XNQO 3WC7A 4NXNB 3MD0A 3SJCC 3DC5A 2ADQB 3PZJA 3B8MA 1FXKA 3CXHF 2WLLB 5EBLC 2JJ1G 1M1DA 4PA6A 3J81N 2YIBA 1F4MA 1B87A 2QWQB 3L72H 4O4LB 5BZBA 3RAMA 4PA9A 1EM1A 4O4LA 3KHZA 4ICGA 4LFCB 7CPAA 2RN9A 1ORQC 3JARA 5B1AB 4B11A 3TK1A 3TT2A 1Y0YA 3ABMB 1VMGA 1ARLA 3RVZA 4DR5O 2QE7G 4U7OA 3K9SA 4JPRA 4Q36A 4B12A 1CP9A 2A3QA 2UUBO 3WG7C 2ODMA
chains in the Genus database with same CATH topology
2YNCA 1BOBA 3FRMA 2GE3A 3DR8A 5C82A 5H86A 1MJ9A 4B13A 2P0WA 3G8WA 1YGHA 3TO6A 1M44A 2B5GB 4PSXA 2PR1A 4RS2A 5G20A 3S6FA 4HNXB 4H6UA 4KOXA 2HQYA 2CNSA 4KOUA 4MHDA 2VZZA 4IF5A 4A32A 4H6ZA 4R3KA 4PV6A 1Z9UA 1OZPA 1S7NA 4MFJA 5J8FA 2PC1A 4QB9A 4EVYA 4LX9A 2FS5A 2BL1A 3RYOA 4AG9A 4Y49C 2BUEA 4ZBGA 4MFQA 1YVKA 3CXPA 3I3GA 4A33A 2F5IA 4J3GA 3V8IA 4C2XA 2RC4A 2QMLA 3CXSA 4KVME 3R95A 4KVXA 2FSRA 2B3VA 5HMNA 5DWNA 4MFLA 4MJ8A 3GY9A 3S6HA 4AVBA 3DDDA 1Y9KA 4YFJA 4NXYA 3TOAA 4I49A 2HV2A 2ZXVA 4AB7A 2O28A 3LD2A 2WSAA 1S60A 1QSOA 2OH1A 2OZUA 2REFA 1QSMA 4CRZB 2Q0YA 4KOYA 4U5YA 2PSWA 4B14A 4CGPA 1VHSA 1YX0A 2Z3NA 4OADA 3QB8A 1YK3A 4CGNA 5A28A 3FBUA 2Z3KA 2VZYA 1I21A 4JJXA 2VQYA 2J8MA 1QSTA 2GIVA 3EO4A 4NEXA 1M4DA 5HH1A 4KOVA 1P0HA 3BJ8A 1S7KA 4UWJA 4L8AA 5GCNA 3R9EA 2JLMA 1IIDA 2ZW6A 4BBHA 4CYQA 4AG7A 4E0AA 3MGDA 4KSFA 2EUIA 4F6AA 3KKWA 4BMHA 2H5MA 4KLVA 4IUSA 3E0KA 4QBJA 4K30A 4PK3A 2G3AA 4X5KA 2P6FA 3TO9A 2FIWA 3TOBA 1CM0A 2Z10A 5IB0A 3W6XA 2ZW7A 5A27A 1P4NA 3DNSA 4FD4A 3VWDA 4UBRA 4KOSA 5I0CA 5IV0A 4JD6A 1Q2CA 2YGWA 5BWAB 3PP9A 1Z4RA 2ZPAA 1Y7RA 5G21A 1N71A 4E2AA 4CYPA 1S5KA 4UFXA 4PSWA 4CAVA 2JDDA 4AVCA 1Q2DA 3ZJ0A 3SXNA 3UY5A 3EC4A 1IYLA 2HUZA 4UCMA 2G3TA 4R9MA 3JTKA 1NMTA 4CYNA 1MK4A 4RI1A 2CNMA 4C2YA 2PRBA 2B3UA 4GS4A 2Q7BA 2R98A 5AG4A 2FIAA 5FVJA 3TCVA 2OB0A 2I79A 4A2ZA 4OAEA 1KUYA 4KOTA 4U9ZA 3FYNA 4M3SA 2CNTA 4KLWA 4XPKA 4LUAA 5EBVA 2JEVA 2R7HA 1I1DA 5F49A 2B4DA 1Y9WA 4KSAA 2ZW4A 4HNWB 2QECA 4U9YA 5EC4A 4NF1A 2Z3LA 2ZW5A 2Z3PA 4M85A 2DXQA 2Q4VA 3G3SA 1PU9A 2K5TA 1MJAA 1KZFA 2Z3MA 3FNCA 4UWIA 1XF8A 3EXNA 3S6GA 3F8KA 2A4NA 3K9UA 2Z11A 5F48A 2B4BA 1MJBA 5JPHA 3DR6A 4QVTA 3H5ZA 3DSBA 4B5OA 4NSQA 3R96A 1IICA 4KORA 4R87A 4KS9A 2PQ8A 1WK4A 5KTAA 2D4PA 1L0CA 2WPWA 3D8PA 3TTHA 4A30A 4C7IA 2AE6A 2P6EA 3H4QA 1FY7A 4F0YA 3VWEA 1M4GA 3IU1A 4CAXA 1PUAA 4HNYB 2PDOA 2BSWA 3FXTA 5G22A 4C68A 2D4OA 5H84A 4AVAA 3IGRA 2WPXA 4A95A 4CAEA 4R3LA 1Q2YA 2FT0A 4JLYA 2Y0MA 4MFKA 3IWGA 4UA3A 3R9GA 5JQ4A 2X7BA 2DPTA 2OZHA 1RXTA 1YREA 3R9FA 3JUWA 4JWPA 3T9YA 3LODA 1YVOA 2CXAA 3F0AA 4R57A 1Z4EA 3TO7A 1R57A 3ZZIA 2YNCC 3QAHA 4FD6A 2QIRA 4HKFA 3A9LA 4ZGYB 2B5GA 4UCPA 5G1ZA 2R8VA 3C26A 1IYKA 4FD7A 3BLNA 4XNHB 1RO5A 3B8GA 1NE9A 2B58A 4CAWA 2VEZA 2C27A 2IL4A 5AG7A 2R1IA 3I9SA 2Q44A 1XIXA 4CGMA 4UFVA 2FL4A 4ORFA 4L89A 5F47A 5KTCA 4MBUA 2EVNA 4MY0A 5CNPA 3SXOA 3D2MA 3EY5A 3FB3A 1GHEA 3GYAA 4II9A 4B5PA 4XPDC 3P2HA 4QC6A 4DNCA 4B5PB 4QUSA 5AGEA 4C2ZA 4CGLA 3PGPA 2FCKA 5F46A 4CAFA 2JDCA 4JXRA 5IX3A 1LRZA 4C7HA 2ATRA 2J8RA 4UFWA 1I12A 2J8NA 2Z0ZA 3IWEA 3R1KA 5E96A 5AG6A 1KUVA 2PR8A 2REEA 4KOWA 4Y49B 2AJ6A 4CS0B 4Q38A 1UFHA 2FE7A 4YRHA 1S7FA 3D2PA 2NMTA 1KUXA 1IB1E 3TE4A 3OWCA 4YGOA 4KZTA 1BO4A 2B4DB 4OLLA 3CXQA 3FIXA 4XNHC 5C88A 4XPLA 4JXQA 3P2FA 4ONUA 1XMTA 4KUAA 2KCWA 2YNDA 1QSNA 5AG5A 3T90A 2GANA 1QSRA 3JVNA 4MFPA 4E8OA 1J4JA 2I00A 4FD5A 4CYOA 1TIQA 3W6SA 1SQHA 1XE4A 1WWZA 2Z3OA 3GKRA 4XPDB 1CJWA 2Q4YA 1NSLA 3N7ZA 5ISVA 4MY3A 3W91A 3NE7A 1S7LA 5DWMA 4MI4A 1ON0A 2OZGA 2P6GA 3F5BA 2FXFA 2OU2A 5J8CA 1K4JA 3TFYA 1V0CA 4CGOA 2DPSA 3IU2A 2VBQA 1U6MA 3PZJA 1B6BA 2YNEA 4KUBA 4F0XA 2VI7A 1YLEA 1M1DA 2ARHA 1S3ZA 4A31A 2WUUA 1B87A 3BJ7A 4PK2A 1M4IA 1ZO0A 3D3SA 2G0BA 3S6KA 3WR7A 1XEBA 2VXKA 1YR0A 4B11A 5KTDA 3TT2A 3SHPA 4UCNA 4B10A 2BEIA 2CY2A 2Q04A 4KVOE 4CRYB 4NCZA 4MFZA 4Q36A 1VKCA 4B12A 4H89A 3EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOB A;  3FRM A;  2GE3 A;  3DR8 A;  5C82 A;  5H86 A;  1MJ9 A;  2P0W A;  3G8W A;  1YGH A;  3TO6 A;  1M44 A;  2B5G B;  4PSX A;  2PR1 A;  4RS2 A;  3S6F A;  4HNX B;  4H6U A;  4KOX A;  2HQY A;  2CNS A;  4KOU A;  4MHD A;  2VZZ A;  4IF5 A;  4H6Z A;  4R3K A;  4PV6 A;  1Z9U A;  1OZP A;  1S7N A;  5J8F A;  2PC1 A;  4QB9 A;  4EVY A;  4LX9 A;  2FS5 A;  2BL1 A;  3RYO A;  4AG9 A;  4Y49 C;  2BUE A;  4ZBG A;  1YVK A;  3CXP A;  3I3G A;  2F5I A;  4J3G A;  3V8I A;  2RC4 A;  2QML A;  3CXS A;  4KVM E;  3R95 A;  4KVX A;  2FSR A;  2B3V A;  5HMN A;  5DWN A;  4MJ8 A;  3GY9 A;  3S6H A;  4AVB A;  3DDD A;  1Y9K A;  4YFJ A;  4NXY A;  3TOA A;  4I49 A;  2HV2 A;  2ZXV A;  4AB7 A;  2O28 A;  3LD2 A;  1S60 A;  1QSO A;  2OH1 A;  2OZU A;  2REF A;  1QSM A;  4CRZ B;  2Q0Y A;  4U5Y A;  4KOY A;  2PSW A;  1VHS A;  1YX0 A;  4OAD A;  3QB8 A;  1YK3 A;  3FBU A;  2VZY A;  1I21 A;  4JJX A;  2VQY A;  2J8M A;  1QST A;  2GIV A;  3EO4 A;  4NEX A;  1M4D A;  5HH1 A;  4KOV A;  1P0H A;  3BJ8 A;  1S7K A;  4UWJ A;  4L8A A;  5GCN A;  3R9E A;  2JLM A;  1IID A;  2ZW6 A;  4AG7 A;  4E0A A;  3MGD A;  2EUI A;  4F6A A;  3KKW A;  4BMH A;  2H5M A;  4KLV A;  4IUS A;  3E0K A;  4QBJ A;  4K30 A;  4PK3 A;  2G3A A;  4X5K A;  2P6F A;  3TO9 A;  2FIW A;  3TOB A;  1CM0 A;  2Z10 A;  5IB0 A;  3W6X A;  2ZW7 A;  1P4N A;  3DNS A;  4FD4 A;  3VWD A;  4UBR A;  4KOS A;  5I0C A;  5IV0 A;  4JD6 A;  1Q2C A;  3PP9 A;  1Z4R A;  2ZPA A;  1Y7R A;  4E2A A;  1N71 A;  1S5K A;  4PSW A;  4CAV A;  2JDD A;  4AVC A;  1Q2D A;  3ZJ0 A;  3SXN A;  3UY5 A;  3EC4 A;  1IYL A;  2HUZ A;  2G3T A;  4R9M A;  1NMT A;  1MK4 A;  4RI1 A;  2CNM A;  2PRB A;  2B3U A;  4GS4 A;  2Q7B A;  2R98 A;  2FIA A;  5FVJ A;  3TCV A;  2OB0 A;  2I79 A;  4OAE A;  1KUY A;  4KOT A;  4U9Z A;  3FYN A;  4M3S A;  2CNT A;  4KLW A;  4XPK A;  4LUA A;  5EBV A;  2JEV A;  2R7H A;  1I1D A;  5F49 A;  2B4D A;  1Y9W A;  2ZW4 A;  4HNW B;  2QEC A;  4U9Y A;  5EC4 A;  4NF1 A;  2ZW5 A;  4M85 A;  2DXQ A;  2Q4V A;  3G3S A;  1PU9 A;  2K5T A;  1MJA A;  1KZF A;  3FNC A;  4UWI A;  1XF8 A;  3EXN A;  3S6G A;  3F8K A;  2A4N A;  3K9U A;  2Z11 A;  5F48 A;  2B4B A;  1MJB A;  5JPH A;  3DR6 A;  4QVT A;  3DSB A;  4B5O A;  4NSQ A;  3R96 A;  1IIC A;  4KOR A;  4R87 A;  2PQ8 A;  1WK4 A;  5KTA A;  2D4P A;  1L0C A;  2WPW A;  3D8P A;  3TTH A;  2AE6 A;  2P6E A;  3H4Q A;  1FY7 A;  4F0Y A;  3VWE A;  1M4G A;  4CAX A;  1PUA A;  4HNY B;  2PDO A;  2BSW A;  3FXT A;  2D4O A;  5H84 A;  4AVA A;  3IGR A;  2WPX A;  4R3L A;  1Q2Y A;  2FT0 A;  4JLY A;  2Y0M A;  3IWG A;  4UA3 A;  3R9G A;  5JQ4 A;  2X7B A;  2OZH A;  3R9F A;  1RXT A;  1YRE A;  3JUW A;  4JWP A;  3T9Y A;  3LOD A;  1YVO A;  4R57 A;  3F0A A;  1Z4E A;  3TO7 A;  1R57 A;  3ZZI A;  3QAH A;  4FD6 A;  2QIR A;  4HKF A;  2B5G A;  2R8V A;  3C26 A;  1IYK A;  4FD7 A;  3BLN A;  4XNH B;  1RO5 A;  3B8G A;  1NE9 A;  2B58 A;  4CAW A;  2VEZ A;  2C27 A;  2IL4 A;  2R1I A;  3I9S A;  2Q44 A;  1XIX A;  2FL4 A;  4ORF A;  4L89 A;  5F47 A;  5KTC A;  4MBU A;  2EVN A;  4MY0 A;  5CNP A;  3SXO A;  3D2M A;  3EY5 A;  3FB3 A;  1GHE A;  3GYA A;  4II9 A;  4B5P A;  4XPD C;  3P2H A;  4QC6 A;  4DNC A;  4B5P B;  4QUS A;  3PGP A;  2FCK A;  5F46 A;  2JDC A;  4JXR A;  5IX3 A;  1LRZ A;  2ATR A;  2J8R A;  1I12 A;  2J8N A;  2Z0Z A;  3R1K A;  5E96 A;  1KUV A;  2PR8 A;  2REE A;  4KOW A;  4Y49 B;  2AJ6 A;  4CS0 B;  1UFH A;  2FE7 A;  4YRH A;  1S7F A;  3D2P A;  2NMT A;  1KUX A;  1IB1 E;  3TE4 A;  3OWC A;  4YGO A;  4KZT A;  1BO4 A;  2B4D B;  4OLL A;  3CXQ A;  3FIX A;  4XNH C;  5C88 A;  4XPL A;  4JXQ A;  3P2F A;  4ONU A;  1XMT A;  4KUA A;  2KCW A;  1QSN A;  3T90 A;  2GAN A;  1QSR A;  3JVN A;  4E8O A;  1J4J A;  2I00 A;  4FD5 A;  1TIQ A;  3W6S A;  1SQH A;  1XE4 A;  1WWZ A;  3GKR A;  4XPD B;  1CJW A;  2Q4Y A;  1NSL A;  3N7Z A;  5ISV A;  4MY3 A;  3W91 A;  3NE7 A;  1S7L A;  5DWM A;  4MI4 A;  1ON0 A;  2OZG A;  2P6G A;  3F5B A;  2FXF A;  2OU2 A;  5J8C A;  1K4J A;  3TFY A;  1V0C A;  2VBQ A;  1U6M A;  3PZJ A;  1B6B A;  4KUB A;  2VI7 A;  1YLE A;  1M1D A;  2ARH A;  1S3Z A;  1B87 A;  3BJ7 A;  4PK2 A;  1M4I A;  3D3S A;  2G0B A;  3S6K A;  3WR7 A;  1XEB A;  2VXK A;  1YR0 A;  5KTD A;  3TT2 A;  3SHP A;  2BEI A;  2CY2 A;  2Q04 A;  4KVO E;  4CRY B;  4NCZ A;  1VKC A;  4H89 A;  3EFA A; 
#chains in the Genus database with same CATH topology
 1S76 D;  2WA3 A;  2YNC A;  1BOB A;  2AFU A;  3DR8 A;  1VQN V;  2ZEM A;  1P7B A;  2RJZ A;  1RTQ A;  2N04 A;  2ZIM A;  3G8W A;  5A2Q N;  4PSX A;  1EN5 A;  2ZOF A;  5LYD A;  1WB7 A;  2LFS A;  1F2O A;  1MSW D;  1OCZ B;  4H6U A;  3KG2 A;  5DEC A;  2HQY A;  1WP8 A;  3OE7 G;  1ELM P;  2EK8 A;  2ZED A;  2HP8 A;  4B3S O;  2JBK A;  3SPG A;  1AP6 A;  3CHX A;  5K8N A;  3VQW A;  2PJ1 A;  4R3K A;  4K0K B;  4PV6 A;  1YIJ V;  4PXE A;  1S7N A;  5KA6 A;  5J8F A;  4DUZ B;  4NTW A;  2CH7 B;  4ZI7 A;  3BHP A;  5DS0 A;  2CH7 A;  2OIG A;  3OMN B;  4TV8 A;  1KBH A;  3JSN A;  2JGD B;  4DUY O;  4PD4 F;  3RYO A;  3ZN0 A;  4FM0 A;  1K4C C;  1M57 C;  1UFI A;  3CEI A;  2ZT9 B;  3E8F A;  3ZIA G;  2BUE A;  1Q90 D;  3CRQ A;  4WFG A;  3MRU A;  5CBH A;  2I3C A;  1AMP A;  3CXP A;  3I3G A;  5D29 A;  3KZI Z;  4MCR A;  1FXH A;  4A33 A;  2V8H A;  1E79 G;  4C2X A;  3OT7 A;  1V54 B;  2A7W A;  4A38 A;  4B7K A;  2QML A;  1NVP B;  3CXS A;  3R95 A;  2HEP A;  4KVX A;  1XIL A;  4QJF B;  3D7H A;  4MVQ A;  3B3C A;  3K0G A;  1QR9 A;  3VQV A;  2CTC A;  4AVB A;  3WU2 Z;  3FB7 C;  1TKF A;  1Q7Y W;  4JV5 B;  1BHA A;  4NGR A;  4RUF A;  4G1P A;  1NH2 D;  2HV2 A;  2PJ4 A;  2YXY A;  1QLE B;  3OW2 U;  2B9Z A;  4GKK B;  3G6E V;  3BHX A;  3UO3 A;  5CBF A;  4EKW A;  2XEJ A;  3LD2 A;  2VS0 A;  2WSA A;  1S60 A;  3E8G A;  5J9P C;  3GB0 A;  4ZX9 A;  3WB2 A;  4PA4 A;  3G4S V;  2A06 H;  2KSD A;  3T1Y O;  2OR4 A;  5H6R A;  3CME V;  2Q0Y A;  5EMI A;  3D7F A;  3QF7 A;  4IAV A;  3VQX A;  3ICX A;  3QO7 A;  2CAZ C;  1VHS A;  4JI1 O;  4CBC A;  2UXB B;  2Q7G A;  1MSD A;  3D36 A;  1VQO V;  4TWK A;  2QWO B;  3LNM B;  2EX3 A;  1WNS A;  1FYJ A;  2ZEG A;  1M4L A;  4CGN A;  4JI0 B;  1IXB A;  3VOU A;  1LAP A;  1Q8I A;  4B08 A;  2J8M A;  2GIV A;  1IX9 A;  2W0X A;  5CA3 A;  3SI0 A;  4LWS A;  3BJ8 A;  2EJ7 A;  4L8A A;  5GCN A;  2EZP A;  3C90 A;  3OTF A;  2ZW6 A;  3QNV A;  4CYQ A;  4JI8 O;  3RYF A;  2V1D A;  3ABM C;  3BPZ A;  5BR8 B;  3KKW A;  3D66 A;  1OCC B;  1PNK A;  3ABL B;  2Z3Y A;  2P90 A;  4K30 A;  3NA6 A;  2UUC B;  4OPA A;  1FXV A;  1D5N A;  3ZMU A;  3ZHS A;  4X5K A;  3TO9 A;  5JQG A;  2Z10 A;  5IB0 A;  2ZW7 A;  1XI1 A;  1JQG A;  2EJR A;  1FNO A;  1AI4 A;  2YXL A;  4DR4 B;  3DNS A;  5I0C A;  4KOS A;  5IV0 A;  3B40 A;  4JD6 A;  3K08 A;  2X0L A;  2YGW A;  4B3T O;  5K8M A;  4KHP O;  1OZ0 A;  2ZPA A;  2Q67 A;  1QLE C;  2IBZ H;  3RO0 A;  5G21 A;  4ZHQ A;  1N71 A;  4E2A A;  4TQD A;  2CGN A;  1KU9 A;  2LP7 A;  3WFV A;  3RBZ A;  5HFM A;  1TXR A;  1GKF A;  1JA8 A;  3JAR B;  2WA4 A;  2IU0 A;  3UY5 A;  4HNA B;  3CCJ V;  5EBM C;  2CE4 A;  4IIJ B;  4HNA A;  2P06 A;  1NMT A;  1SS3 A;  5CB4 A;  4IIJ A;  5J2U A;  2ZCE A;  1RSO A;  2GSM B;  5LYJ B;  4ONW A;  3RGB A;  2OTL V;  4RI1 A;  4UIA A;  5IJ9 B;  4ZX8 A;  5IY5 B;  2FIA A;  3CMA V;  2RQ6 A;  3HB3 B;  4WF9 V;  2HFE C;  4OC0 A;  3FYN A;  4M3S A;  2HLD G;  4AI8 A;  4P9O A;  1QNM A;  5L3F A;  4JGS A;  4LUA A;  1NTK H;  4O4J A;  2YS8 A;  4HYO A;  3ISX A;  3N2G B;  4NKG B;  3FX7 A;  2CUG A;  3N2K A;  3FMC A;  1QR8 A;  1VQK V;  5IYC O;  1Y9W A;  2Q4P A;  4DK0 A;  2ZE8 A;  4HNW B;  2XAG A;  4PA3 A;  4X3R A;  3PB7 X;  2WAM A;  4NF1 A;  1S72 V;  2ETN A;  1Q6H A;  1H2N A;  2IMO A;  2IQ6 A;  3DC6 A;  3VQY A;  5B3S B;  4FUU A;  4WBN B;  1NZ6 A;  4QE7 A;  4QNH B;  4ZKI A;  1Z5V A;  2OCH A;  2WLJ A;  1GYT A;  1KZF A;  4TUY B;  2EIN B;  1F2P A;  1XRY A;  3FNC A;  2HVK C;  3EXN A;  1V55 B;  4KP4 A;  4M6H A;  2P67 A;  2IJK A;  1AUG A;  1SER A;  3ETQ A;  2ZOG A;  4JI2 O;  5LMN B;  3SI2 A;  1HDQ A;  2B4B A;  2ABZ A;  3G71 V;  1MJB A;  5JPH A;  2QM7 A;  4QVT A;  3JAK B;  3TX8 A;  4B5O A;  1SET A;  3R96 A;  2DOS A;  3QTC A;  4R87 A;  3AK1 A;  4KS9 A;  2LGW A;  1UPG A;  4J42 A;  3D8P A;  4I7Z B;  3AG3 C;  5L3C A;  4BAY A;  3H8E A;  4Z65 A;  2DWD C;  4H13 B;  4UEE A;  4CH5 A;  4JYW A;  3STL C;  4CAX A;  1FXK C;  4DK1 A;  2PJ5 A;  2PDO A;  4RAI A;  1YJN V;  3RYH A;  1BLL E;  3WC6 A;  2ZE5 A;  3OTO B;  5H84 A;  4PXC A;  2H94 A;  3IGR A;  1AJP A;  3D7D A;  3QO8 A;  5K1P A;  3UQ8 A;  4CAE A;  1FS0 G;  2GTS A;  3LUT B;  5LHG A;  4MFK A;  1LUW A;  3E35 A;  3IWG A;  3R9G A;  1YSC A;  1YQE A;  4UB6 Z;  1YHQ V;  2M7W A;  2DPT A;  2OZH A;  5I4M A;  1PL4 A;  3CC7 V;  1Q3E A;  3LOD A;  2E5L B;  3ZCC A;  1AIL A;  2CXA A;  1Z4E A;  3TO7 A;  3FD9 A;  3B3W A;  2PRQ A;  1F51 A;  2YNC C;  3QAH A;  2ZEP A;  2OT5 A;  1VQM V;  4PXD A;  5FNV A;  4CS2 A;  4UVB A;  1J5E O;  2PJ6 A;  4HKF A;  1MA1 A;  1AI6 A;  3HKB A;  1SQP H;  4KXR A;  1O9G A;  5K8P A;  3TC8 A;  3BLN A;  2HJF C;  3RYF B;  1GN2 A;  3ZHU A;  2V8D A;  3X2Q B;  4AQY B;  4DO2 A;  2Q0A A;  2VEZ A;  1ARO P;  4NYK A;  1H8L A;  3B2Y A;  1YXB A;  2C27 A;  2IL4 A;  1ZLZ A;  2FTK A;  1H2L A;  1XIX A;  3FVL A;  1S5H C;  3AG3 B;  4CGM A;  3THO A;  4XDL A;  4ORF A;  4L89 A;  4MY0 A;  2YID A;  3SXO A;  2Y0P A;  3FB3 A;  1HNX O;  4DR6 O;  2JJ2 G;  4LF6 B;  3OAA G;  4C2Z A;  4X8A A;  4Z1M G;  4L8J A;  4OP4 A;  3PGP A;  4DR7 O;  4IGG A;  2JDC A;  2EK9 A;  4OID A;  1KB9 F;  2Y48 A;  2PF4 E;  1HNX B;  1YLO A;  4P45 A;  4FFB A;  1I12 A;  2JEU A;  3CE2 A;  5AG6 A;  2HB6 A;  3SGI A;  4JF3 A;  4KOW A;  4UCO A;  4TSF G;  3CXC U;  4Y49 B;  2A9H A;  1K92 A;  1EZV H;  2IM9 A;  3ZX6 A;  4ZBM A;  5CA1 A;  1K8A W;  2POK A;  1RP3 B;  1N34 O;  2NMT A;  4DR3 B;  1YDX A;  4YGO A;  1YEW A;  3N2K B;  4KZT A;  3C3T A;  5KUM A;  1BO4 A;  1XBL A;  2EIM B;  2H3O A;  3J80 N;  2B4D B;  4OLL A;  2XOK G;  3BEH A;  3CXQ A;  2WLK A;  3MHS C;  4LCU C;  3K06 A;  3ZN1 A;  1DTO A;  1JX9 A;  3V7Z A;  4G27 B;  4R6T A;  2AZ2 A;  1KP3 A;  4MHZ A;  4OC4 A;  3IC1 A;  2F66 C;  3TCU A;  4X1K B;  1RFY A;  1YI2 V;  2WLI A;  1OCZ C;  1N8R W;  4DR1 O;  3QO5 A;  1BS3 A;  4P4F A;  4HZ3 A;  4B3M B;  3T90 A;  4TWE A;  5THW A;  2BCO A;  4ASU G;  2LW1 A;  2VRZ A;  4CZZ A;  1QSR A;  1XRE A;  2YDE A;  4MCS A;  4WCE V;  4FD5 A;  5LGT A;  4NJR A;  4JI5 B;  1SZT A;  3R66 A;  1E1R G;  1B6Q A;  4DR6 B;  1IDS A;  4IYH A;  4FLW A;  2Z3O A;  3GKR A;  4DV0 B;  3N7Z A;  4FWU A;  4NGQ A;  3J7A U;  4MXU A;  3JD2 A;  1IUR A;  2DEA A;  3H1H H;  2OZG A;  4LF4 B;  2QKS A;  4UB8 Z;  3L70 H;  4DV7 B;  2C2A A;  4YJ3 B;  3CS5 A;  4Z2W A;  1BQZ A;  1RM1 C;  4K3N A;  1K4J A;  2JDI G;  3UM7 A;  4AQY O;  5JQG B;  1JWQ A;  2NSM A;  3IO1 A;  2XAF A;  3K5O A;  1H2G A;  1V54 C;  3IEH A;  3KI9 A;  5AG2 A;  4DV5 O;  1U6M A;  1VGY A;  3SJB C;  2ZNI A;  3P30 A;  2XEG A;  1B6B A;  4LR3 A;  3ZRW A;  2ZR2 A;  4EWT A;  5JJE B;  4F0X A;  1BMF G;  2ARH A;  1S3Z A;  1H2S B;  3FB8 C;  4DR4 O;  1G4Y B;  3E83 A;  1A2Z A;  5HFL A;  1KUQ A;  2QJ8 A;  1PNL A;  3UKM A;  2JS3 A;  1XEQ A;  1XEB A;  2KB1 A;  4NTY A;  2F1M A;  1YR0 A;  3CZX A;  2F4V O;  3SHP A;  1K9M W;  4LF4 O;  4UCN A;  3E8H A;  2Q0O C;  4UCT A;  5EK0 A;  4JYY A;  1VQP V;  1M90 W;  2BEI A;  3H1K H;  4CRY B;  2UXN A;  1QCE A;  4FLU A;  5CN0 A;  2PJ9 A;  1E1Q G;  2WLN A;  1R3N A;  3R65 A;  2DQ3 A;  1MNG A;  3LSQ A;  4JTD B;  4TQF A;  3B8N A;  3FRM A;  3SR2 C;  1PNM A;  5KHK A;  3F5W C;  3JCZ A;  2ZXW B;  4PDL A;  1VEW A;  1QQC A;  2B5G B;  3FX6 A;  4DR3 O;  1NT2 B;  5TIS Z;  1L0N H;  2PJ8 A;  2V7Q G;  4M6G A;  3SJX A;  4N23 A;  3UCS C;  4MHD A;  3KHX A;  5LMU O;  1Q86 W;  2QM8 A;  2CTP A;  2VZZ A;  1JFF A;  1NU1 H;  1HR0 B;  1O9H A;  4DR2 O;  3RN4 A;  4RO2 A;  4GUN A;  4PV1 B;  1OZP A;  3SJF A;  5B66 Z;  4UXN A;  1PPJ H;  4FLY A;  2PC1 A;  3L75 H;  1SQF A;  4FLX A;  3W7T A;  1TUB A;  4GKK O;  4LX9 A;  2X6B A;  4U3J A;  2FS5 A;  5B1B C;  4LQG A;  2BL1 A;  1JVM A;  4LF9 B;  4AG9 A;  3NH4 A;  3A8T A;  2QM4 A;  4LNU A;  4X20 A;  4JZ2 A;  2F5I A;  3FEC A;  4M6I A;  3V8I A;  3IFX A;  2YSU B;  2RC4 A;  3GVM A;  1N36 B;  4J80 A;  1V55 C;  2PVV A;  3CRR A;  1ZL8 B;  2FSR A;  1MMM A;  1OHH G;  3ASN C;  2C1C A;  4G2K A;  2CF4 A;  4MCP A;  4DYL A;  2B3V A;  3K58 A;  5B1N A;  4MFL A;  4MJ8 A;  1NI8 A;  3GY9 A;  4EEQ A;  4XDK A;  2GUZ B;  1Y9K A;  2YC0 A;  4I49 A;  4PA7 A;  4DV3 B;  2ZNJ A;  2ZXV A;  4MVM A;  1IBM O;  4AB7 A;  3BI0 A;  4I4T B;  4JAU A;  2O28 A;  3RYH B;  4JYC A;  1FAF A;  5GON A;  1X4T A;  5LA6 B;  3L74 H;  2EUL A;  4XDJ A;  1QSO A;  2REF A;  2R9A A;  1QSM A;  4KFM A;  2YEV A;  1W2B U;  4CRZ B;  1Q5O A;  1XMB A;  4I55 B;  2AW9 A;  4KOY A;  1PKX A;  1XQ8 A;  2L35 A;  2PSW A;  2GHY A;  4PI0 A;  3SJG A;  1NQT A;  3CJH B;  1GN4 A;  1SQG A;  3Q4H B;  4UEZ A;  3SYP A;  2V8V A;  3CJH A;  1Q43 A;  4OAD A;  3KCY A;  1R3L C;  3SJQ C;  2BOC C;  3QB8 A;  1XNQ B;  5C8Y B;  4LF6 O;  3FBU A;  2CTW A;  1I21 A;  5KMG B;  4JJX A;  4YIO A;  3K9T A;  1QST A;  1WA8 B;  3OGC C;  4TT3 G;  4JTC B;  4I0X B;  3H01 A;  3R9E A;  1IID A;  3I55 V;  4FK5 C;  3PEI A;  5HVF A;  5C93 A;  3WC5 A;  4CPA A;  3B3T A;  5KA5 A;  2FYU H;  3WB1 A;  3ZRV A;  3HR0 A;  1R6K A;  4UIB A;  3AG4 C;  4KLV A;  4IUS A;  3PRT A;  3E0K A;  4R8C A;  2ZIO A;  1IZ3 A;  3KR4 A;  4A94 A;  3FKS G;  4DV1 O;  2GFQ A;  1XUQ A;  1ZUQ A;  5A27 A;  3N27 A;  2E75 B;  3CCS V;  1LFW A;  2JRI A;  3VWD A;  1VF7 A;  5B1A C;  3OTO O;  2W0F C;  3AK2 A;  1JJ2 U;  1I94 O;  5BWA B;  3S9L A;  3PP9 A;  1B04 A;  3D3Q A;  5IJ0 A;  1Q7L A;  2IJH A;  4WWV A;  5CBG A;  3JAL A;  3FF3 A;  2GBO A;  4WFB V;  4JZ0 A;  2JDD A;  2BTQ B;  1Q2D A;  5JM6 A;  1VQ5 V;  3A2F A;  1IYL A;  2ZE7 A;  2G3T A;  2PGG A;  3OR7 C;  2PJC A;  5EC1 C;  4UVA A;  4BIU A;  3JTK A;  4FLZ A;  4P44 A;  2RMK B;  4NXM O;  1VHO A;  4JI6 B;  1GRJ A;  3TXQ A;  2Y69 C;  2B3U A;  2PRB A;  2R98 A;  4GS4 A;  4OGQ B;  3CPX A;  5FVJ A;  3RYC A;  3M99 B;  3TCV A;  3H8F A;  2ILM A;  1YTF D;  4K8Z A;  3H9V A;  4LC1 A;  4NB5 A;  2CNT A;  2RFH A;  3KQX A;  4O4J B;  5EBV A;  2JIZ G;  1P84 F;  3BAA A;  4LFA O;  1R6T A;  2R7H A;  3T2M A;  4BIZ A;  2G9D A;  1AI5 A;  2PCU A;  3PFO A;  4J9Y B;  4DR1 B;  4UEF A;  2B4D A;  1K34 A;  5KAI Z;  4R7C A;  1YJW V;  2QEC A;  4U9Y A;  2PI4 A;  1FJG O;  4OPH A;  4FVM A;  4X1K A;  2Z3P A;  2EIL C;  1FD9 A;  1PU9 A;  4MTF A;  1GAX A;  1MJA A;  4IL6 Z;  1VQL V;  2Y4T A;  2EIM C;  1MZF A;  4I5S A;  5LRK A;  3JD3 A;  4TV8 B;  3S6G A;  2A4N A;  2ZDI C;  1SES A;  3MDS A;  4ZIB A;  2Z11 A;  2PJA A;  5J2T A;  1K5S A;  3CCQ V;  1YCI A;  3DSB A;  1PM9 A;  4NR1 A;  2LGQ A;  3O9O A;  5H2F Z;  4F9U A;  4UVC A;  4I9W A;  2BTO A;  4DV5 B;  4YY3 O;  1WK4 A;  1VQ8 V;  1TVK B;  5KTA A;  1L0C A;  2EIK B;  4MTG A;  2P22 C;  3H4Q A;  1FY7 A;  1UWY A;  4H33 A;  1OCO B;  3IAY A;  3IU1 A;  1PUA A;  4JI4 B;  1KYO F;  3HLP A;  2HG5 C;  4DV2 O;  3DSQ A;  2YIC A;  4OKO A;  1PCA A;  2Q5Z A;  2AZ0 A;  2Q69 A;  4PEL A;  1XOU A;  3ETE A;  1YSJ A;  5LXT B;  5BY1 A;  4C68 A;  3JAS B;  4AHC A;  2D4O A;  4EME A;  3ZMS A;  2WPX A;  4TOI A;  2X6A A;  4R3L A;  1US6 A;  2Y0M A;  4J41 A;  1PP9 H;  3JAM N;  2X7B A;  5F09 A;  4LFB O;  3BAB A;  3R9F A;  3QG5 A;  2VWJ A;  4YJ2 A;  1X59 A;  3OMI B;  1KKD A;  4JWP A;  4DRX A;  5JVD A;  2ZEF A;  1HW7 A;  3T1C A;  4RQE A;  2DYS C;  4E2L A;  1YVO A;  4JI8 B;  3ZZI A;  1R57 A;  1R43 A;  4X1Y B;  1SF9 A;  5LHI A;  2CIJ A;  2Q4Z A;  5KMG A;  4YY3 B;  3HKD B;  3MN8 A;  4FLV A;  4H0L B;  1CP7 A;  4FM2 A;  5JJN B;  5FNV B;  3CRC A;  4NGS A;  1VF5 B;  2B5G A;  1MZE A;  1N34 B;  2GLJ A;  2DN9 A;  1K7D A;  3VAT A;  2L6L A;  1W0J G;  1EN4 A;  4CC5 A;  5EC2 C;  4J9Z B;  1N0N A;  3RZA A;  1CPY A;  2ITD C;  3E89 A;  2XHB A;  5KLV H;  1OBR A;  2Q44 A;  3I9S A;  4MVO A;  2LFR A;  4NJQ A;  1HEE A;  4D6T H;  2EIJ C;  4X65 B;  4GKJ O;  5H5N A;  5LP6 B;  5D5Q A;  3CCU V;  2EVN A;  1M9N A;  3EY5 A;  2CGO A;  5EYP B;  3LDE A;  1HNW B;  3U10 A;  2AFS A;  2AGA A;  4B5P B;  2JGD A;  1DE4 C;  1FT7 A;  1DF5 A;  3U11 A;  3JAK A;  1TKJ A;  4BWA A;  5IX3 A;  2LJ2 A;  2UXD O;  5IYD O;  1LRZ A;  4N21 A;  5DM6 V;  3FYE B;  4X66 O;  3U0Z A;  3QAY A;  4DUZ O;  2X6C A;  1IY7 A;  1CG2 A;  4U3F H;  4I9Q A;  4LQ6 A;  4UFW A;  3BVO A;  2J8N A;  2Z0Z A;  3IWE A;  3R1K A;  4YHH B;  4GYC B;  2PR8 A;  2QTS A;  3CWB H;  4J7J A;  1JOY A;  3GIU A;  6CPA A;  4CH3 A;  2ZEO A;  8CPA A;  5KUK A;  5LBQ A;  4P6Y A;  2FE7 A;  1S7F A;  3BRC A;  2UUA B;  3D2P A;  3KGQ A;  1IB1 E;  2WYR A;  3CX5 F;  1ENV A;  3VBB A;  2ZM6 O;  2XEI A;  5LYI A;  2PYL A;  5JH9 A;  3ASN B;  4R50 A;  2D3O W;  3FIX A;  3DXR A;  3CPA A;  4CS3 A;  3S9N A;  3IJ3 A;  3EVK A;  4XNH C;  2DYS B;  4IT5 A;  1N32 B;  2GLF A;  2ZEN A;  4ONU A;  4QIW F;  2HKO A;  1Y0R A;  1XMT A;  1XNR O;  5EBW C;  3RVY A;  5JVD B;  1BPN A;  2AFO A;  5C8Y A;  5EZY A;  3ABK B;  1LOK A;  2F8H A;  5AG5 A;  3D4U A;  2GAN A;  1CX8 A;  1A32 A;  1Y7E A;  4E8O A;  1OJH A;  5DN6 G;  1KD1 W;  2I00 A;  4GX1 A;  4LF9 O;  1IOI A;  2AHZ A;  4I0X A;  2R70 A;  3B3S A;  3W6S A;  1JQ0 A;  3JAT A;  4MT8 A;  5KHI A;  1HNW O;  1F7Y A;  1CBX A;  3L2N A;  4MHY A;  3TXS A;  1CJW A;  1NSL A;  3HKB B;  4YHH O;  3PB4 X;  4UUJ C;  4UV8 A;  1XMO O;  5LYL A;  3NE7 A;  2CK3 G;  3ML0 A;  3BI1 A;  5DWM A;  2P6G A;  3F5B A;  2EO8 A;  4X66 B;  2FXF A;  2OU2 A;  1N4C A;  4AIL C;  2QKC A;  4PXB A;  1ELL P;  4EB6 B;  2DPS A;  5H6Q A;  4OX9 O;  4EB6 A;  2FVG A;  3WT4 A;  5B1B B;  4LFB B;  3K2K A;  2OIE A;  3GB7 C;  1N32 O;  2WLL A;  1LCP A;  2YNE A;  2GTA A;  2VI7 A;  3FFQ A;  3W7X A;  1JCH A;  1YLE A;  5GON B;  3JAS A;  3LDD A;  1SKV A;  2NN4 A;  3P3N A;  4DV4 B;  2PVW A;  5LXT A;  1GMG A;  2XEF A;  2Q9L A;  1S5L Z;  4FMT A;  2EBJ A;  2IJZ A;  3ISZ A;  3SI1 A;  4JI7 O;  4I55 A;  5L3E A;  2G0B A;  3WR7 A;  1AJQ A;  2UU9 B;  1V9P A;  2F4V B;  2VXK A;  1IBK O;  1Y74 A;  4P4I A;  4O2B B;  2P5O A;  1RSO B;  1YVW A;  4B10 A;  1AJN A;  2NLJ C;  3RYC B;  2CY2 A;  3A0B Z;  2XT9 A;  1H8H G;  3H1L H;  1GTO A;  4KL1 A;  3ABL C;  1VKC A;  4NVP A;  2DE0 X;  4WFF A;  1FPO A;  2OOT A;  3SDL A;  3LSU A;  1N36 O;  2IH3 C;  3TJT A;  4LWS B;  2GE3 A;  1QQ9 A;  4G28 B;  5C82 A;  1XL4 A;  3HKE B;  4LF5 O;  3OM3 B;  4DV2 B;  1M1K W;  4PPZ A;  2OWO A;  4ZOL B;  3W7U A;  1YGH A;  4JI1 B;  2UXB O;  2BOA A;  1SQQ H;  1NKD A;  2RB7 A;  1XBU A;  2ZIN A;  4KOX A;  2CNS A;  4KOU A;  3CCV V;  1GH6 A;  3SYA A;  2GU2 A;  3E2E A;  3ZHV A;  3GWO A;  4MSW C;  4A32 A;  5EZY B;  4OC3 A;  4X64 B;  1HP8 A;  4JAV A;  5LP6 A;  2F7V A;  3OGI B;  4NXM B;  4J7Z A;  4MFJ A;  1TUB B;  1Y4M A;  2OTJ V;  2W6I G;  4QB9 A;  4U3J B;  1Z8X A;  1GN3 A;  2WPD G;  3RWR D;  4OIW A;  4JI3 B;  4Y49 C;  4ZBG A;  4PQA A;  4DV4 O;  4KHP B;  2ZD9 A;  3W7W A;  4MVZ A;  4X20 B;  4J3G A;  4LH7 A;  5JJJ B;  2YI9 A;  2PIZ A;  2RDC A;  4MCQ A;  2PTM A;  1LR1 A;  5KHJ A;  4KVM E;  1ZSP A;  1F4N A;  3ASO C;  2DJV A;  5IJ9 A;  4PI2 A;  4J11 A;  4JI3 O;  5HMN A;  4OX9 B;  5DWN A;  3RBU A;  1BCC H;  3DDD A;  4NXY A;  4MS2 A;  1CEZ A;  2KG7 B;  2W6J G;  5D8N A;  3MAQ A;  2AHY A;  1G1X B;  3H1I H;  1HWY A;  3D3I A;  2DWE C;  3AG2 C;  2OH1 A;  3SPJ A;  1FFT B;  1CPS A;  3S3W A;  1MG1 A;  3IFE A;  4OC2 A;  4GT1 A;  1OCO C;  2D2C B;  1P7G A;  2PUS A;  3M7M X;  2Z0A A;  2WSS G;  1K4D C;  2Q7S A;  2KQX A;  1K3E A;  4NXN O;  4DXW A;  3ETD A;  3LMS A;  4DRX B;  1VIX A;  2Z3N A;  3RYI A;  4I50 B;  4EFE A;  5JH7 B;  4NFR A;  3L71 H;  2VZY A;  1R73 A;  2VQY A;  3C3S A;  3EO4 A;  4IYI A;  1NTM H;  3K57 A;  2C6P A;  1M4D A;  3T8W A;  4KOV A;  1F57 A;  4P4B A;  3EHB B;  3ETG A;  4XBF A;  4LH6 A;  4CH4 A;  2JLM A;  4JI6 O;  2QTO A;  4YWY A;  1Q6U A;  4DUK A;  2FML A;  3DLJ A;  2PJ7 A;  4AG7 A;  1XHZ A;  3NH8 A;  1AB3 A;  3DTU B;  4KSF A;  4F6A A;  2YIA A;  4RQF A;  2H5M A;  4MW8 A;  1N33 B;  4JI7 B;  2EIL B;  4DV6 B;  2V77 A;  1QVG U;  2G38 A;  4LF8 O;  1ZAU A;  4BW5 A;  2G3A A;  2P6F A;  3TOB A;  3L9D A;  1CM0 A;  3W6X A;  4ZY0 A;  2GV9 A;  2ZEH A;  1DLB A;  4FD4 A;  4YIP A;  3PJS K;  3K5M A;  1T5E A;  1AR1 B;  3ZMT A;  2K1E A;  1ARM A;  1Q2C A;  2VL1 A;  5IB9 A;  5GTH Z;  3JAL B;  1WN7 A;  1Y7R A;  2ZEL A;  2P7T C;  3JCU Z;  5IJ0 B;  4CYP A;  1NVP D;  1S5K A;  4WFA V;  4PSW A;  4CAV A;  1M93 A;  4F4L A;  4B6Z A;  2PY5 A;  3SXN A;  2V4D A;  3EC4 A;  2YUA A;  2HUZ A;  4UV9 A;  3K59 A;  3ZHT A;  1ZX3 A;  4JYA O;  2BE3 A;  2JVD A;  4K0K O;  1BT8 A;  1M56 B;  4FFB B;  4CYN A;  1MK4 A;  2CNM A;  4DW0 A;  2JGU A;  2HHH B;  1ZG9 A;  1WPB A;  2Q7B A;  5AG4 A;  3ZJZ A;  2MK3 A;  1BPM A;  2ANP A;  2OB0 A;  2I79 A;  4A2Z A;  1FJG B;  1CPX A;  3FYI B;  4ABM A;  1KUY A;  4U9Z A;  2UXD B;  3APQ A;  1WAZ A;  1AYE A;  5K1X A;  4PDV A;  4KLW A;  5D5P A;  4JI4 O;  5LP6 C;  1XJO A;  2JEV A;  1NS1 A;  5F49 A;  4EFB A;  2ZW4 A;  3PFE A;  1H2M A;  4X88 A;  1LUV A;  2B1G A;  4B3M O;  4B7E A;  3NH5 A;  1ROP A;  4UCS A;  2ZR3 A;  4OC5 A;  3E8B A;  4MVU A;  1DGS A;  2B5U A;  4GKJ B;  5CA0 B;  3ZRS A;  4BR6 A;  1R6N A;  1AI7 A;  2Z3L A;  2ZW5 A;  1JFF B;  2DXQ A;  3GUX A;  3G3S A;  1IBK B;  4FJC C;  5HVH A;  3OMA B;  4X1I B;  3CCE V;  4UWI A;  1SRY A;  5EYP A;  1XF8 A;  4Q20 A;  3NFZ A;  1TKH A;  2M6Y A;  3K9U A;  4C7U A;  2RNB A;  4AXV A;  1Y76 A;  3OFN G;  4LP8 A;  2IW5 A;  3H5Z A;  5GTI Z;  4NSQ A;  3PBE A;  4KOR A;  4P4D A;  1THZ A;  1I08 A;  3D68 A;  4PDR A;  3FAV A;  1SQV H;  1IBL B;  1LAM A;  2D4P A;  2WPW A;  3TTH A;  1ZL8 A;  4C7I A;  3SYQ A;  4E4E A;  1HNZ O;  4DV1 B;  4MMO A;  3VWE A;  3T4D A;  3SPI A;  1I5X A;  4Q6G A;  3ABT A;  1M4G A;  4NGM A;  3H8G A;  3KKY A;  5KX5 B;  4HNY B;  1SZX A;  3FXT A;  3ZED A;  5G22 A;  1ZWI C;  3FED A;  3O65 A;  3AG4 B;  4DJL A;  4AVA A;  1L8D A;  4ZY2 A;  2PE3 A;  1GM8 A;  2AFM A;  3CYO A;  3SPH A;  4LF7 O;  4UA3 A;  1AR5 A;  5JQ4 A;  5JCO C;  1RXT A;  1FFX A;  3JRU A;  4K35 A;  2GDS A;  2QVP A;  3T9Y A;  2N05 A;  3BFR A;  2ATK C;  2VWK A;  3SYC A;  4K8X A;  2HJD A;  4P2Z A;  2R9R B;  1LNQ A;  1HNZ B;  1RPR A;  1XDC A;  4F6E A;  3AG7 A;  3I5D A;  3B2E E;  4FD6 A;  4MRI A;  2OCC B;  2C6C A;  2QIR A;  4P10 A;  3A9L A;  3HKD A;  4ZGY B;  5GW7 A;  1ZTE A;  5IT9 N;  2AFX A;  3OEE G;  4OME A;  4Q7A A;  4PHZ A;  4UCP A;  4FIP C;  1JPX A;  3C26 A;  2UXX A;  1IYK A;  4FD7 A;  4QPJ A;  4YXW G;  3K79 A;  1U97 A;  4XNH B;  1Q81 W;  4RUH A;  1G6U A;  4DV3 O;  3B8G A;  1NE9 A;  2CDY A;  3D36 C;  2Q43 A;  4X9Q A;  3BY6 A;  1H8E G;  5FLX N;  4X89 A;  4P4J A;  2E76 B;  4BIN A;  5H9C A;  3K9A A;  5IYZ B;  2BSK A;  3CP1 A;  1B06 A;  5ELY A;  2BSK B;  1KKC A;  1Y67 A;  2QWR B;  2NR5 A;  4UFV A;  2FL4 A;  1B3Q A;  1VP7 A;  4L87 A;  4TUY A;  3CC2 V;  5F47 A;  1J5E B;  3G80 A;  1PYT B;  4GCZ A;  1FXK B;  1D5A A;  1R3J C;  2N74 A;  3OD4 A;  4B5P A;  4IK2 A;  2P4V A;  4GXH A;  4XPD C;  2QJ1 A;  4QC6 A;  1AP5 A;  3LNN A;  2R72 A;  1U96 A;  2Y4U A;  3B7I A;  1S77 D;  4QUS A;  5AGE A;  4CGL A;  1Y76 B;  4LFA B;  1JJO A;  3B35 A;  4JXR A;  3IGA C;  1FKA O;  4FZ0 A;  5JWP A;  4C7H A;  2P4K A;  5B3S C;  4B3R B;  1Z5W A;  2ATR A;  1BSM A;  1Y74 B;  3ZRX A;  1S3J A;  3JAW B;  1TVK A;  2F95 B;  5J2U B;  1VQ9 V;  3OUF A;  2JEX A;  5E96 A;  4DW1 A;  4CS4 A;  5FPO A;  3V38 A;  2J9A A;  2REE A;  2HHH O;  2ZKO A;  5LMU B;  1ZG8 A;  1YZB A;  2AJ6 A;  3CD6 V;  2QWN B;  4CS0 B;  3PB8 X;  4JI2 B;  4JTA B;  1KWM A;  1K5Q A;  4YRH A;  3CT9 A;  3HUV A;  5ITZ A;  1XMQ O;  3HKE A;  1KUX A;  1TF8 A;  3TE4 A;  2OCC C;  3E86 A;  4ZOL A;  1K97 A;  3AK3 A;  3B09 A;  3SJE A;  3GWK C;  1KMI Z;  2ZXW C;  5C88 A;  4JXQ A;  3P2F A;  5J1Q A;  4FBE A;  4KUA A;  1SQB H;  4GLX A;  2NNU A;  1D2D A;  4DYO A;  2ZQM A;  3G67 A;  2YXH A;  1PV0 A;  4IHJ B;  4LBE C;  3CCR V;  1TF9 A;  4EFD A;  1AR4 A;  3NXS A;  2FB5 A;  4GZR B;  3JVN A;  5JGF A;  3DGE A;  1H38 A;  4UCV A;  4CYO A;  4F8Z A;  1TIQ A;  1NJI W;  1WWZ A;  5LOV A;  2QYV A;  1SA0 A;  1CXZ B;  2A0L A;  2Q4Y A;  3D67 A;  1QBZ A;  1YJ9 V;  2QEX V;  2DW4 A;  4FFK A;  1NSA A;  2Q7H A;  5ISV A;  4MY3 A;  1BAV A;  3W91 A;  2LQT A;  3CCL V;  4MI4 A;  3NR7 A;  1ON0 A;  1IXM A;  3T1H O;  3A0R A;  3K3W A;  2O53 A;  2IJI A;  3F7V C;  4HBN A;  3K5N A;  3LDC A;  1W0K G;  3EFF K;  3FAV B;  4P9P A;  2ZEE A;  1WPX A;  3IU2 A;  2NYQ A;  2VBQ A;  5LRG A;  3AEI A;  3HKC B;  4R8F A;  4NGT A;  2Q6A A;  4FLT A;  3ZMZ A;  3ASO B;  4J10 A;  1VHE A;  3CRM A;  4LF5 B;  1OCR B;  2QGN A;  4KUB A;  3E22 A;  4MTO A;  4ZI6 A;  2HVJ C;  3ZRW B;  5KX5 A;  3PBB A;  4P4E A;  1M4U A;  3ZHQ A;  3M8A A;  3UO2 A;  4W4L A;  1J95 A;  1QHT A;  3IC9 A;  3GLJ A;  2EWB A;  3CC4 V;  4A31 A;  1R1B A;  2H8P C;  4RWU A;  2WUU A;  1EBO A;  2Q73 A;  3BJ7 A;  4PK2 A;  1NR7 A;  5BXZ A;  1M4I A;  1ZO0 A;  3D7G A;  1Z2G A;  4ZYQ A;  1VQ4 V;  3D3S A;  1VAR A;  4JI5 O;  3S6K A;  5KHG A;  3IWW A;  3UT5 B;  2HR3 A;  4WFE A;  2DYR C;  5KTD A;  1FFX B;  1YIT V;  1VIB A;  1IGB A;  4O2A B;  1XOV A;  3RYI B;  2Q04 A;  1BGY H;  4KVO E;  1W59 A;  4NCZ A;  4MFZ A;  5L3B A;  4PDM A;  4H89 A;  1NBM G;  1Q82 W;  5KHH A;  3EFA A;  4X62 O;  4J7K A;  4X8I A;  2PI5 A;  1Z8T A;  2DF5 A;  1GM7 A;  5ITZ B;  1NTZ H;  5H86 A;  2WZN A;  1MJ9 A;  4B13 A;  1LAN A;  2P0W A;  4MHP A;  3TO6 A;  1M44 A;  3RNZ A;  2XAQ A;  5CPA A;  3VH9 A;  2BOB C;  2PR1 A;  4RS2 A;  2XND G;  4UFZ A;  5G20 A;  4A37 A;  3S6F A;  3BA8 A;  4HNX B;  5IY5 C;  5IWA B;  5K8O A;  3ZBH A;  3ABK C;  4JZG A;  3T1H B;  1CP6 A;  4A5U B;  4OXS A;  4R76 A;  4MVS A;  3JD4 A;  1EN6 A;  4IF5 A;  4H6Z A;  5DED A;  4MW3 A;  5IYB O;  2BCC H;  1XMO B;  1Z9U A;  4UCU A;  1IBM B;  1JR9 A;  3L73 H;  4KUM A;  4ZI7 B;  4B3S B;  4B3R O;  3FJU A;  1TGO A;  5IWA O;  4EVY A;  1BL8 A;  1XFO A;  5LOV B;  1IU8 A;  4BD9 A;  4MFQ A;  1YVK A;  4F9V A;  1I94 B;  5LRJ A;  2BTQ A;  1G8M A;  1HDJ A;  4YJ3 A;  3APO A;  3F7Y C;  1K73 W;  3CPW U;  5CB4 B;  3RFR A;  3JAW A;  2QR4 A;  1WJZ A;  3KCX A;  4NGN A;  2EBO A;  2R9I A;  2E5L O;  1XMQ B;  3K0D A;  3S6H A;  3I56 V;  4JYA B;  1I7F A;  2UUC O;  3KL9 A;  5BMV B;  1AVM A;  3D8C A;  4YFJ A;  3TOA A;  2QDO A;  1QLN A;  4JAA A;  1N33 O;  4JV5 O;  3B4S A;  4NTX A;  3N5F A;  2LW7 A;  1S0V A;  1HR0 O;  2Q8V A;  2OZU A;  3PB9 X;  2WWW A;  3H1J H;  4U5Y A;  3ABU A;  4B14 A;  1IOF A;  4CGP A;  3P32 A;  1YX0 A;  1KC8 W;  2F93 B;  3TET A;  4F6R A;  1WP7 A;  1YK3 A;  3ZS8 C;  5A28 A;  3K03 A;  2Z3K A;  4FM1 A;  5JH7 A;  1RM1 B;  4X62 B;  2V8G A;  4NEX A;  1YF2 A;  4TV9 A;  2O4H A;  5CMU A;  4MTX A;  5HH1 A;  1P0H A;  4UWJ A;  5HXD A;  1S7K A;  1SA0 B;  1I0H A;  2XAJ A;  4X64 O;  2UUB B;  2PJ0 A;  1TAE A;  2PYJ A;  4BBH A;  3K04 A;  1Y66 A;  4E0A A;  4BIO A;  3MGD A;  4TNU A;  2EUI A;  3ZMV A;  4BMH A;  2F43 G;  2OYQ A;  2E74 B;  4QBJ A;  1I5Y A;  3B3V A;  4LF7 B;  5LL6 Y;  3JSL A;  4D7S A;  2WLM A;  4PK3 A;  2FIW A;  3FH4 A;  2UXC O;  1P4N A;  3JD1 A;  2ZDI A;  3HKC A;  4UBR A;  3CCM V;  1RPO A;  2JEW A;  1YME A;  3X2Q C;  4MHN A;  3T1Y B;  1ZLH A;  1Z4R A;  5EIB D;  2XTA A;  4DR7 B;  2ZM6 B;  4UFX A;  3OUS A;  1PL0 A;  4HAM A;  3PB6 X;  1DK1 A;  5B1O A;  1BE3 H;  1R3K C;  2XAS A;  4DV6 O;  4AVC A;  4GX0 A;  1VF6 C;  2IU3 A;  4DUY B;  4DV7 O;  3ZJ0 A;  2CTB A;  1IBL O;  3KR5 A;  2UU9 O;  4UCM A;  4R9M A;  1BHB A;  2JK5 C;  3CB2 A;  3VAR A;  5IE9 A;  4O4I B;  3BA9 A;  4C2Y A;  4DV0 O;  4O2A A;  5LHH A;  1M57 B;  3STZ C;  1K33 A;  3OR6 C;  4OAE A;  4KOT A;  4O23 A;  2C6G A;  2KG7 A;  5CA1 B;  4XPK A;  1QVF U;  1SC5 B;  4I4T A;  3N2G A;  4OC1 A;  1YW4 A;  3OEH G;  3JYC A;  1I1D A;  1UJW B;  1DF4 A;  3LAC A;  3RT3 C;  4KSA A;  1F23 A;  2QKA A;  2RCV A;  3DGV A;  1WB8 A;  5EC4 A;  2AFZ A;  2AXT Z;  3KAS A;  1XHX A;  4B3T B;  1KP2 A;  2WLI B;  3CRA A;  3WAB A;  4RN7 A;  3Q4H A;  4M85 A;  2Z5U A;  4F6R B;  2Q4V A;  1EFR G;  4IHM A;  2YIB D;  2K5T A;  4I50 A;  1HDU A;  3B77 A;  4WBN A;  2Z3M A;  2F23 A;  2XUM A;  2PZS A;  1Z8W A;  3F8K A;  3ZHR A;  5BR8 O;  3F5T A;  5KAF Z;  4LFC O;  2ADP A;  2ZE6 A;  5JCO A;  5F48 A;  2BO9 A;  2ODF A;  1Z5R A;  3DR6 A;  5LGU A;  4A39 A;  1OCC C;  2P6J A;  4WJB A;  2O57 A;  1IIC A;  4JAS A;  2DMX A;  1TA8 A;  5FL7 G;  3QNE A;  2PQ8 A;  3AG1 B;  4A30 A;  3LSS A;  2AE6 A;  2P6E A;  1BZK A;  4FAI A;  3G6B A;  4F0Y A;  1H2K A;  1M56 C;  4Z1V A;  3E22 B;  2BSW A;  5EIB C;  1NR1 A;  5L3G A;  4GM5 A;  4CC6 A;  4QPK A;  2LO1 A;  2ITC C;  4JYB A;  4R7M A;  4A95 A;  5LMN O;  1Q2Y A;  4CH6 A;  2FT0 A;  4JLY A;  2HC9 A;  3SPC A;  2YEV B;  4D7T A;  4H44 B;  1YRE A;  1PD3 A;  4O2B A;  2Q68 A;  3EXA A;  4JI0 O;  1YTF B;  2GRE A;  2PJB A;  3JUW A;  3LWU A;  4FZ1 A;  4W4K A;  2QWP B;  3SJA C;  4R57 A;  3F0A A;  4UF4 A;  1EZJ A;  2K9P A;  1WA8 A;  1M5I A;  1YW6 A;  4K3A A;  3NE8 A;  1JMK C;  4TV9 B;  2CTR A;  5LGN A;  2MW2 B;  4U7N A;  4HPS A;  2Y0I A;  2DYR B;  1KEC A;  4UCR A;  5G1Z A;  2R8V A;  2UXC B;  2CTQ A;  2AFW A;  1NH2 B;  4MVR A;  2PIY A;  4ZY1 A;  1RO5 A;  4GX5 A;  2VQE O;  2B58 A;  2A79 B;  4CAW A;  2Y69 B;  3FB6 C;  1IVS A;  4WFH A;  5LYF A;  2EIN C;  5AG7 A;  4QE9 A;  2R1I A;  1WLE A;  3MHH C;  4R6Z A;  1VF6 A;  5IYZ A;  1GK9 A;  2EIK C;  3S3X A;  1QMU A;  1XNR B;  3FEE A;  2X7R B;  4W9Y A;  2PJ3 A;  5KTC A;  1BQ0 A;  3K5L A;  4MBU A;  5CNP A;  4KSI A;  3D2M A;  3QVN A;  2JS5 A;  1S5J A;  1GHE A;  3GYA A;  4II9 A;  3IIB A;  1L0L H;  3P2H A;  4DNC A;  2WLH A;  3A0H Z;  2IH1 C;  1QU7 A;  2Q7E A;  3WB0 A;  3JD0 A;  1OCR C;  5CBM A;  2DQ0 A;  2PJ2 A;  2FCK A;  5F46 A;  4ZHQ B;  4CAF A;  3IJ4 A;  1VQ7 V;  4NGP A;  1GN6 A;  4PJ0 Z;  4X2T A;  3UT5 A;  4BW9 A;  2J8R A;  3HPL C;  4QGP A;  4O4I A;  3P3P A;  4X65 O;  1KUV A;  5BMV A;  5LYJ A;  1R3I C;  1XL6 A;  2GUZ A;  3CSX A;  1X12 A;  1N0J A;  2YI8 A;  4Q38 A;  1DTD A;  1OV9 A;  5L3D A;  5A9G A;  5F2V O;  2Q51 A;  4O4H B;  2E3C A;  1UFH A;  4RUE A;  4H37 A;  1EE3 P;  4O4H A;  5IDJ A;  2EZO A;  1ZLI A;  4H2K A;  3OWC A;  1MAB G;  5LA6 A;  3DXR B;  4YU9 A;  2FKX A;  3RW0 A;  1GO3 F;  1TUE B;  1COW G;  2KKW A;  2B1I A;  1URF A;  3KZW A;  3W7S A;  4XPL A;  4GX2 A;  4YJ2 B;  5B5E Z;  3CDX A;  2KCW A;  5CA0 A;  4DR5 B;  1GM9 A;  2YND A;  4LF8 B;  1QSN A;  2IJJ A;  4IHJ A;  1Y6X A;  3WG7 B;  1P49 A;  3I1U A;  3BCC H;  3SYO A;  1Q6I A;  5E1A C;  4MFP A;  2UUA O;  1J4J A;  3AG1 C;  4X1Y A;  5HVG A;  2EIJ B;  5E79 Z;  3JAT B;  5FPR A;  4X1I A;  2VQF O;  3TGU H;  1P4R A;  1SQH A;  1XE4 A;  1MOF A;  4XPD B;  4LNU B;  1Z8L A;  1KQS U;  1SQX H;  5J2T B;  1VQ6 V;  3FB5 C;  4FPP A;  3PN1 A;  2QSA A;  3KQZ A;  4DR2 B;  1ZG7 A;  3BXM A;  1S7L A;  1Z2L A;  4P30 A;  2XAH A;  3AG2 B;  3S9M A;  2QA4 V;  2VQF B;  2JBJ A;  5J8C A;  2VQE B;  3TFY A;  1V0C A;  4CGO A;  1X10 A;  1L1F A;  3T4Z A;  3IC7 A;  1XNQ O;  3WC7 A;  4NXN B;  3MD0 A;  3SJC C;  3DC5 A;  2ADQ B;  3PZJ A;  3B8M A;  1FXK A;  3CXH F;  2WLL B;  5EBL C;  2JJ1 G;  1M1D A;  4PA6 A;  3J81 N;  2YIB A;  1F4M A;  1B87 A;  2QWQ B;  3L72 H;  4O4L B;  5BZB A;  3RAM A;  4PA9 A;  1EM1 A;  4O4L A;  3KHZ A;  4ICG A;  4LFC B;  7CPA A;  2RN9 A;  1ORQ C;  3JAR A;  5B1A B;  4B11 A;  3TK1 A;  3TT2 A;  1Y0Y A;  3ABM B;  1VMG A;  1ARL A;  3RVZ A;  4DR5 O;  2QE7 G;  4U7O A;  3K9S A;  4JPR A;  4Q36 A;  4B12 A;  1CP9 A;  2A3Q A;  2UUB O;  3WG7 C;  2ODM A; 
#chains in the Genus database with same CATH homology
 2YNC A;  1BOB A;  3FRM A;  2GE3 A;  3DR8 A;  5C82 A;  5H86 A;  1MJ9 A;  4B13 A;  2P0W A;  3G8W A;  1YGH A;  3TO6 A;  1M44 A;  2B5G B;  4PSX A;  2PR1 A;  4RS2 A;  5G20 A;  3S6F A;  4HNX B;  4H6U A;  4KOX A;  2HQY A;  2CNS A;  4KOU A;  4MHD A;  2VZZ A;  4IF5 A;  4A32 A;  4H6Z A;  4R3K A;  4PV6 A;  1Z9U A;  1OZP A;  1S7N A;  4MFJ A;  5J8F A;  2PC1 A;  4QB9 A;  4EVY A;  4LX9 A;  2FS5 A;  2BL1 A;  3RYO A;  4AG9 A;  4Y49 C;  2BUE A;  4ZBG A;  4MFQ A;  1YVK A;  3CXP A;  3I3G A;  4A33 A;  2F5I A;  4J3G A;  3V8I A;  4C2X A;  2RC4 A;  2QML A;  3CXS A;  4KVM E;  3R95 A;  4KVX A;  2FSR A;  2B3V A;  5HMN A;  5DWN A;  4MFL A;  4MJ8 A;  3GY9 A;  3S6H A;  4AVB A;  3DDD A;  1Y9K A;  4YFJ A;  4NXY A;  3TOA A;  4I49 A;  2HV2 A;  2ZXV A;  4AB7 A;  2O28 A;  3LD2 A;  2WSA A;  1S60 A;  1QSO A;  2OH1 A;  2OZU A;  2REF A;  1QSM A;  4CRZ B;  2Q0Y A;  4KOY A;  4U5Y A;  2PSW A;  4B14 A;  4CGP A;  1VHS A;  1YX0 A;  2Z3N A;  4OAD A;  3QB8 A;  1YK3 A;  4CGN A;  5A28 A;  3FBU A;  2Z3K A;  2VZY A;  1I21 A;  4JJX A;  2VQY A;  2J8M A;  1QST A;  2GIV A;  3EO4 A;  4NEX A;  1M4D A;  5HH1 A;  4KOV A;  1P0H A;  3BJ8 A;  1S7K A;  4UWJ A;  4L8A A;  5GCN A;  3R9E A;  2JLM A;  1IID A;  2ZW6 A;  4BBH A;  4CYQ A;  4AG7 A;  4E0A A;  3MGD A;  4KSF A;  2EUI A;  4F6A A;  3KKW A;  4BMH A;  2H5M A;  4KLV A;  4IUS A;  3E0K A;  4QBJ A;  4K30 A;  4PK3 A;  2G3A A;  4X5K A;  2P6F A;  3TO9 A;  2FIW A;  3TOB A;  1CM0 A;  2Z10 A;  5IB0 A;  3W6X A;  2ZW7 A;  5A27 A;  1P4N A;  3DNS A;  4FD4 A;  3VWD A;  4UBR A;  4KOS A;  5I0C A;  5IV0 A;  4JD6 A;  1Q2C A;  2YGW A;  5BWA B;  3PP9 A;  1Z4R A;  2ZPA A;  1Y7R A;  5G21 A;  1N71 A;  4E2A A;  4CYP A;  1S5K A;  4UFX A;  4PSW A;  4CAV A;  2JDD A;  4AVC A;  1Q2D A;  3ZJ0 A;  3SXN A;  3UY5 A;  3EC4 A;  1IYL A;  2HUZ A;  4UCM A;  2G3T A;  4R9M A;  3JTK A;  1NMT A;  4CYN A;  1MK4 A;  4RI1 A;  2CNM A;  4C2Y A;  2PRB A;  2B3U A;  4GS4 A;  2Q7B A;  2R98 A;  5AG4 A;  2FIA A;  5FVJ A;  3TCV A;  2OB0 A;  2I79 A;  4A2Z A;  4OAE A;  1KUY A;  4KOT A;  4U9Z A;  3FYN A;  4M3S A;  2CNT A;  4KLW A;  4XPK A;  4LUA A;  5EBV A;  2JEV A;  2R7H A;  1I1D A;  5F49 A;  2B4D A;  1Y9W A;  4KSA A;  2ZW4 A;  4HNW B;  2QEC A;  4U9Y A;  5EC4 A;  4NF1 A;  2Z3L A;  2ZW5 A;  2Z3P A;  4M85 A;  2DXQ A;  2Q4V A;  3G3S A;  1PU9 A;  2K5T A;  1MJA A;  1KZF A;  2Z3M A;  3FNC A;  4UWI A;  1XF8 A;  3EXN A;  3S6G A;  3F8K A;  2A4N A;  3K9U A;  2Z11 A;  5F48 A;  2B4B A;  1MJB A;  5JPH A;  3DR6 A;  4QVT A;  3H5Z A;  3DSB A;  4B5O A;  4NSQ A;  3R96 A;  1IIC A;  4KOR A;  4R87 A;  4KS9 A;  2PQ8 A;  1WK4 A;  5KTA A;  2D4P A;  1L0C A;  2WPW A;  3D8P A;  3TTH A;  4A30 A;  4C7I A;  2AE6 A;  2P6E A;  3H4Q A;  1FY7 A;  4F0Y A;  3VWE A;  1M4G A;  3IU1 A;  4CAX A;  1PUA A;  4HNY B;  2PDO A;  2BSW A;  3FXT A;  5G22 A;  4C68 A;  2D4O A;  5H84 A;  4AVA A;  3IGR A;  2WPX A;  4A95 A;  4CAE A;  4R3L A;  1Q2Y A;  2FT0 A;  4JLY A;  2Y0M A;  4MFK A;  3IWG A;  4UA3 A;  3R9G A;  5JQ4 A;  2X7B A;  2DPT A;  2OZH A;  1RXT A;  1YRE A;  3R9F A;  3JUW A;  4JWP A;  3T9Y A;  3LOD A;  1YVO A;  2CXA A;  3F0A A;  4R57 A;  1Z4E A;  3TO7 A;  1R57 A;  3ZZI A;  2YNC C;  3QAH A;  4FD6 A;  2QIR A;  4HKF A;  3A9L A;  4ZGY B;  2B5G A;  4UCP A;  5G1Z A;  2R8V A;  3C26 A;  1IYK A;  4FD7 A;  3BLN A;  4XNH B;  1RO5 A;  3B8G A;  1NE9 A;  2B58 A;  4CAW A;  2VEZ A;  2C27 A;  2IL4 A;  5AG7 A;  2R1I A;  3I9S A;  2Q44 A;  1XIX A;  4CGM A;  4UFV A;  2FL4 A;  4ORF A;  4L89 A;  5F47 A;  5KTC A;  4MBU A;  2EVN A;  4MY0 A;  5CNP A;  3SXO A;  3D2M A;  3EY5 A;  3FB3 A;  1GHE A;  3GYA A;  4II9 A;  4B5P A;  4XPD C;  3P2H A;  4QC6 A;  4DNC A;  4B5P B;  4QUS A;  5AGE A;  4C2Z A;  4CGL A;  3PGP A;  2FCK A;  5F46 A;  4CAF A;  2JDC A;  4JXR A;  5IX3 A;  1LRZ A;  4C7H A;  2ATR A;  2J8R A;  4UFW A;  1I12 A;  2J8N A;  2Z0Z A;  3IWE A;  3R1K A;  5E96 A;  5AG6 A;  1KUV A;  2PR8 A;  2REE A;  4KOW A;  4Y49 B;  2AJ6 A;  4CS0 B;  4Q38 A;  1UFH A;  2FE7 A;  4YRH A;  1S7F A;  3D2P A;  2NMT A;  1KUX A;  1IB1 E;  3TE4 A;  3OWC A;  4YGO A;  4KZT A;  1BO4 A;  2B4D B;  4OLL A;  3CXQ A;  3FIX A;  4XNH C;  5C88 A;  4XPL A;  4JXQ A;  3P2F A;  4ONU A;  1XMT A;  4KUA A;  2KCW A;  2YND A;  1QSN A;  5AG5 A;  3T90 A;  2GAN A;  1QSR A;  3JVN A;  4MFP A;  4E8O A;  1J4J A;  2I00 A;  4FD5 A;  4CYO A;  1TIQ A;  3W6S A;  1SQH A;  1XE4 A;  1WWZ A;  2Z3O A;  3GKR A;  4XPD B;  1CJW A;  2Q4Y A;  1NSL A;  3N7Z A;  5ISV A;  4MY3 A;  3W91 A;  3NE7 A;  1S7L A;  5DWM A;  4MI4 A;  1ON0 A;  2OZG A;  2P6G A;  3F5B A;  2FXF A;  2OU2 A;  5J8C A;  1K4J A;  3TFY A;  1V0C A;  4CGO A;  2DPS A;  3IU2 A;  2VBQ A;  1U6M A;  3PZJ A;  1B6B A;  2YNE A;  4KUB A;  4F0X A;  2VI7 A;  1YLE A;  1M1D A;  2ARH A;  1S3Z A;  4A31 A;  2WUU A;  1B87 A;  3BJ7 A;  4PK2 A;  1M4I A;  1ZO0 A;  3D3S A;  2G0B A;  3S6K A;  3WR7 A;  1XEB A;  2VXK A;  1YR0 A;  4B11 A;  5KTD A;  3TT2 A;  3SHP A;  4UCN A;  4B10 A;  2BEI A;  2CY2 A;  2Q04 A;  4KVO E;  4CRY B;  4NCZ A;  4MFZ A;  4Q36 A;  1VKC A;  4B12 A;  4H89 A;  3EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...