2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein aq_1966
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
4JJXA 4KOUA 4U9ZA 4X5KA 1Y7RA 2FSRA 4KUBA 2ATRA 2QECA 2FE7A 4YGOA 4FD7A 1YK3A 2Q4YA 2F5IA 1MJBA 3G3SA 2CY2A 4RI1A 2B5GA 1YVKA 4J3GA 3EO4A 3W91A 5EBVA 3V8IA 5IB0A 4KZTA 3F0AA 2Q0YA 1V0CA 2Z10A 3TO9A 5J8FA 2C27A 3C26A 2Z0ZA 2CNSA 3JUWA 2B5GB 2PDOA 4UBRA 5DWMA 2HUZA 4MJ8A 4XPDB 2ZPAA 3D2MA 4AVCA 3D8PA 1M1DA 2R1IA 2VQYA 4PK2A 3ZZIA 4IUSA 4HNYB 4UWIA 1QSRA 1YVOA 2DXQA 3DR8A 5KTCA 1KZFA 3I3GA 3EFAA 1CM0A 3TO7A 1S7KA 2REFA 1P0HA 1M4IA 2AJ6A 4R57A 2Y0MA 5C88A 2PC1A 4CAWA 4E8OA 2OH1A 3EY5A 4CAVA 4PV6A 2ZW6A 4YFJA 5F47A 4KOTA 4KOYA 3S6KA 4QB9A 2KCWA 4HKFA 4CRZB 1MJ9A 3DR6A 2H5MA 4R9MA 2PSWA 2B4DA 4MI4A 1RO5A 3FNCA 4JWPA 4R87A 2FIAA 2WPXA 3GKRA 5IX3A 3WR7A 2P6EA 2B3UA 3DDDA 4DNCA 2G3AA 1XF8A 1VKCA 2D4OA 4XPDC 2B4DB 2VEZA 1PU9A 3TTHA 4GS4A 3P2HA 2PR8A 4AVBA 3R9GA 2JLMA 3DSBA 1I12A 1S3ZA 1TIQA 3T9YA 4KVOE 4KLWA 2Q44A 4L8AA 4OLLA 1KUVA 2HQYA 3R9FA 4B5PA 4L89A 2BUEA 2D4PA 1QSNA 1QSMA 3N7ZA 1Q2DA 2I79A 1Z9UA 3P2FA 2JDDA 1N71A 3KKWA 4ZBGA 3VWEA 4NEXA 5JPHA 1S7NA 4KOWA 2ZW4A 3GY9A 3I9SA 2R98A 4H6ZA 4FD4A 4B5PB 1LRZA 3H4QA 3EXNA 4H6UA 1VHSA 3CXPA 2OZHA 1OZPA 1Y9WA 1WK4A 2FL4A 2JDCA 5EC4A 2B58A 1ON0A 4EVYA 1IB1E 1NE9A 4QVTA 4E0AA 5H84A 5KTAA 2B3VA 2FCKA 2RC4A 4NF1A 3TOBA 2QIRA 4KVXA 3K9UA 4AVAA 3LODA 4BMHA 3PZJA 2VI7A 2FS5A 5KTDA 1M4DA 2FT0A 2ZXVA 4QUSA 3NE7A 2BSWA 4QBJA 3TO6A 3TE4A 4CRYB 3TFYA 4CAXA 1GHEA 4KVME 2OU2A 4Y49B 1BO4A 1RXTA 3GYAA 4IF5A 3BJ8A 1I21A 2I00A 2CNMA 1S7LA 3ZJ0A 4QC6A 2X7BA 3QB8A 3MGDA 1PUAA 4I49A 3D3SA 1Q2CA 3F5BA 1R57A 2OB0A 2ZW5A 3D2PA 2REEA 1XIXA 1S7FA 4B5OA 4RS2A 3EC4A 1KUYA 4ONUA 4FD6A 1MJAA 2BL1A 1YX0A 3FIXA 4F0YA 1P4NA 3VWDA 1U6MA 3SXOA 4HNXB 2P0WA 4U5YA 2HV2A 2CNTA 1NMTA 4AB7A 3R9EA 1Z4RA 3CXSA 3FYNA 1WWZA 4R3KA 3E0KA 4MBUA 2P6FA 3DNSA 4U9YA 4MY0A 4KOVA 1YLEA 1UFHA 3JVNA 4PK3A 3FRMA 4XPKA 2J8RA 2K5TA 5JQ4A 2VZZA 4HNWB 1S60A 2A4NA 2OZUA 4JXRA 4II9A 2PQ8A 2FXFA 2P6GA 4PSXA 3FBUA 4E2AA 2GANA 3CXQA 4PSWA 1QSTA 2JEVA 3TOAA 2VXKA 4KUAA 3B8GA 1YREA 4CS0B 1IYKA 4KORA 3S6FA 1S5KA 3RYOA 4NSQA 2VZYA 3BLNA 5F49A 1M4GA 1L0CA 2R8VA 3R1KA 3QAHA 4OAEA 4JXQA 2Z11A 1KUXA 1I1DA 2Q7BA 3SXNA 2PR1A 1IIDA 4JD6A 1XE4A 2B4BA 2PRBA 3FXTA 5J8CA 1XEBA 1NSLA 5C82A 1IYLA 2J8MA 3S6GA 3F8KA 1YGHA 3IGRA 3TCVA 4M3SA 3R95A 2ZW7A 5H86A 5FVJA 1XMTA 2WPWA 2GIVA 3SHPA 3UY5A 3R96A 2VBQA 1B6BA 4XNHB 4KOXA 1CJWA 4AG7A 4AG9A 2OZGA 4LX9A 1Q2YA 4OADA 3W6SA 1FY7A 4F6AA 4YRHA 5HMNA 4K30A 2NMTA 2QMLA 4KOSA 5HH1A 1QSOA 4XPLA 2EUIA 2O28A 4LUAA 2AE6A 1J4JA 3FB3A 1Y9KA 1M44A 5IV0A 2Q4VA 4FD5A 1YR0A 1B87A 1SQHA 3IWGA 5DWNA 4M85A 3S6HA 3T90A 3PGPA 4UA3A 1BOBA 5GCNA 2FIWA 2GE3A 4JLYA 2IL4A 3OWCA 2G3TA 3BJ7A 2BEIA 2EVNA 5I0CA 2Q04A 4NCZA 2J8NA 5E96A 5F46A 3G8WA 4MHDA 4UWJA 2R7HA 4MY3A 3PP9A 3TT2A 2G0BA 4H89A 4ORFA 2ARHA 3W6XA 5ISVA 4R3LA 1MK4A 3LD2A 1K4JA 4XNHC 4Y49C 1IICA 4NXYA 1Z4EA 5F48A 4KLVA 5CNPA
chains in the Genus database with same CATH superfamily
2Q68A 4JZ0A 4JJXA 3MHSC 4KOUA 4JI3B 1M56B 4LQGA 1P84F 3L75H 1M9NA 2F4VB 3ASOC 3RBUA 3Q4HA 2Q7SA 2PJ3A 2BSKA 1GMGA 3G3SA 3NH8A 1RP3B 4UVAA 3WB1A 4ICGA 3AG1C 5IDJA 3CD6V 4PI0A 4JI0B 3EO4A 4FLUA 5LHGA 2XASA 5EBVA 3V8IA 1P4RA 5KAFZ 4OMEA 2GHYA 3D7HA 3QVNA 3F0AA 4X89A 3FB6C 3OMAB 5LA6A 4UFVA 2PGGA 3W7UA 2E5LB 3DXRA 4DR1O 4DR7B 1TUEB 2JVDA 1ZG7A 1Q7YW 3K0GA 4ONWA 4XPDB 3ZX6A 3D2MA 1R3KC 2HP8A 1NKDA 4AVCA 1M1DA 2R1IA 1IBLB 4UCVA 1BSMA 4IUSA 2EJRA 1CP7A 2OIEA 2HR3A 1JR9A 4O4LB 4EFDA 3N2KB 3ZJZA 1K4DC 1W59A 3BABA 1LOKA 4JI6O 5CBGA 4UB6Z 3LUTB 3TJTA 2HEPA 5D5PA 4LWSB 1M4IA 3KCXA 1Z8LA 4MFZA 4JI4O 2P06A 1NZ6A 3ZEDA 1IY7A 2OH1A 4B3MO 3EY5A 4MRIA 2JBKA 2XOKG 3ABMB 5L3GA 2EIJB 3KQXA 4KOTA 3VQXA 1XNRO 4JI8O 3ZHSA 5J9PC 2H5MA 4R9MA 2PSWA 5IYCO 2ZENA 1FPOA 2AXTZ 3DGEA 4DK0A 3RYHA 1VQLV 2QKCA 5JH7B 4IL6Z 1N36O 2FB5A 3FB5C 4FBEA 2ZXWB 4MTGA 1SESA 3GKRA 1NTZH 3JD0A 3BEHA 2P6EA 2JS5A 4Z65A 5IT9N 3FX6A 1I94B 1XUQA 4W9YA 1IBMB 1SS3A 4MW3A 4JZGA 2HJFC 4PXBA 2WLLB 2D4OA 4X88A 4JI2B 4R7CA 4DV2O 3SJBC 3MDSA 1SC5B 1WPBA 4NR1A 2V8VA 4D6TH 3JSNA 4JTDB 2HFEC 1GN2A 3B8NA 3K9SA 5LYIA 2PJCA 3TK1A 3DSBA 1FYJA 4YXWG 5LYJA 1HR0O 3A8TA 3JD1A 1RM1B 3L74H 4TUYB 3RYIA 1R43A 1BHAA 3NH5A 4MCQA 4LH6A 1FFTB 4L89A 4C7UA 3ABLB 2BUEA 1XHXA 5D5QA 4AI8A 4ZBMA 3RGBA 4NGMA 3JASB 2E75B 2OTLV 2WSAA 4LF4O 3GWOA 3QO8A 5G22A 3U11A 3WG7C 4K8ZA 4YU9A 4JYYA 2QA4V 4L8JA 4NEXA 5JPHA 1F7YA 2Q43A 4KOWA 4PD4F 3CJHA 2ZW4A 2Z0AA 3GY9A 4LH7A 3FAVA 4E4EA 2UUBB 4CH4A 2R98A 1G4YB 3RO0A 1LRZA 4ZX9A 3H4QA 4I0XB 3FD9A 4GKJB 3D36A 1HNXO 4DXWA 2AFOA 1VHSA 3E22A 2ZIOA 3TCUA 4NB5A 1WAZA 5B1NA 3TXSA 4UB8Z 4MSWC 1Y9WA 1VHEA 4B3RB 4NGPA 2JDCA 5EIBC 5EC4A 1KQSU 4YJ3B 4KUMA 3B7IA 2Y69B 1BS3A 2JK5C 1JQGA 4UCRA 3GB0A 3L9DA 1Y74A 1JX9A 5LYDA 2IJJA 3CCLV 2WPDG 1Q6HA 4I7ZB 3MRUA 2P6JA 2B3VA 2F7VA 2IM9A 5ITZA 2QJ8A 2EX3A 2PJ0A 4MFQA 4R7MA 2DQ3A 1S5JA 4GCZA 1KKDA 4R76A 5KAIZ 4WF9V 2BO9A 1SZTA 4LNUB 4UCUA 1OCOC 2YIBA 2VI7A 2FS5A 5LYFA 2A79B 5KX5A 5EC1C 4LF6O 4K3NA 4LF5O 4LF7B 2YNCA 2ZXVA 3PB9X 4YHHO 3T1YB 3QO7A 1LAMA 4CPAA 5FL7G 3TX8A 3TO6A 4TOIA 4HYOA 3JD2A 1F4NA 2KQXA 4CRYB 4CAXA 2XAGA 1G6UA 3K79A 1M1KW 2DQ0A 4JI7O 3E83A 2NLJC 2QE7G 2YIAA 4J42A 4JTCB 2GSMB 2HC9A 3ZHQA 4IF5A 5KHJA 1M4LA 2I00A 3W7WA 5IE9A 2PYJA 4UFZA 1Y0YA 2DE0X 3ZJ0A 2X0LA 4QC6A 4DV7O 1ZLIA 2Z3NA 1PUAA 4UCOA 2WAMA 4PA6A 4H37A 3F5BA 3AG1B 2Q69A 3RWRD 1XIXA 3DGVA 2K9PA 2MW2B 3MAQA 3KR5A 3CPWU 3KR4A 4J11A 4FZ0A 4YIPA 2O53A 4RS2A 3JALA 1FXKB 4O2BB 4JPRA 5C8YA 3G6BA 3E8HA 2YIBD 2RCVA 4AILC 5EZYA 4F6RB 2RB7A 3KQZA 4IAVA 2BL1A 4ZI7A 4LFBB 1VIXA 2OTJV 2X6CA 3H1KH 5BZBA 3CMAV 3HUVA 1MG1A 3A2FA 3K03A 2UXBO 2P90A 1PNLA 1TKJA 3H01A 2YDEA 4FVMA 3B3TA 5F09A 1VMGA 1BAVA 4KOVA 1H2SB 4I50B 2AFWA 2EWBA 4XPKA 2LP7A 1SZXA 2K5TA 4DV5B 1A32A 2VZZA 2Z3OA 5JVDB 2OIGA 1N32O 1S60A 2A4NA 4CS2A 4PA3A 2HKOA 3IIBA 4UEFA 2ZDIA 2P6GA 1IVSA 4PSXA 2EINC 1THZA 4J80A 1M90W 1BQZA 2V1DA 5EYPB 1CPSA 1EBOA 1Z8TA 3ZMUA 2JEVA 3CB2A 5JM6A 2VXKA 2ZINA 2VQEB 2ZE7A 3NA6A 3DLJA 3RBZA 3LDCA 3SYAA 1S5KA 3T2MA 4KSAA 3AK3A 1DF5A 2VZYA 4NSQA 4P4FA 5F49A 3H1LH 2Q73A 2NN4A 3R1KA 4FK5C 2ZOFA 4OAEA 4JXQA 3WT4A 4DRXA 4A5UB 1KUXA 1I1DA 4IHJA 5CBFA 1K3EA 3GWKC 5B3SB 2G38A 3WU2Z 4TV9B 3BVOA 2W0FC 1W2BU 2EZOA 1J95A 1PV0A 5J2UB 4P10A 2B4BA 5LGUA 2ZR3A 5LMUB 4O23A 4I9WA 4IYHA 3AG4C 1YCIA 1HEEA 1YLOA 1V54C 5IY5C 1VGYA 2IJIA 1XEBA 5C82A 3IWEA 2QEXV 5JJJB 3M99B 1BLLE 1XBUA 1F4MA 4W4LA 5LP6C 1QQCA 2ZW7A 5LL6Y 5IJ9B 3SR2C 1XMQO 4JI3O 4OP4A 1YMEA 2ZE5A 2YEVB 3BHXA 5C93A 2Q7HA 1K5QA 1GO3F 3E8BA 2DJVA 2BCOA 4JI0O 4DUZO 2RDCA 3CE2A 1PL4A 5HVFA 1OCZB 1G8MA 4DR2B 4UCSA 5TISZ 3WG7B 5J2TA 3FB7C 3OTOB 7CPAA 5K8OA 2KB1A 1BQ0A 1TUBB 5LHHA 3CSXA 5HH1A 1QSOA 3GUXA 4Q7AA 2EUIA 2O28A 4MTOA 2E5LO 2JS3A 4LUAA 3EVKA 1J4JA 1S0VA 4P9PA 2CH7B 1AILA 4B13A 3T1HB 4X8AA 2B9ZA 1Y76A 5K1XA 2IH3C 3JCUZ 4J10A 4PA9A 5A27A 4CH6A 1HP8A 2CK3G 1ZX3A 4NKGB 1SQXH 3WC7A 3JYCA 1QLNA 3RVYA 3B2EE 5FNVB 3PBEA 2FIWA 1RPOA 2WLIA 3V38A 4DUYO 1FS0G 5LGNA 3H8FA 2FKXA 4CC6A 3HKDA 3BJ7A 2EVNA 5I0CA 2Q04A 1CX8A 4WFHA 1HNZO 3TETA 1XNQB 5F46A 1AR1B 4X1IA 2XAFA 4NGQA 1MA1A 2R7HA 3CRRA 2DW4A 1YDXA 4OKOA 4N23A 1YJ9V 3W6XA 1XI1A 1SQPH 3PBBA 1Q5OA 3W7SA 1TKHA 2GUZB 2F8HA 3OGCC 3LDEA 4GXHA 4NXYA 1F2PA 1PKXA 1Z4EA 5F48A 2A06H 1OV9A 2CGNA 1KB9F 2ZQMA 1K92A 1X4TA 2AHYA 2YNCC 5KHIA 4G1PA 4X5KA 4KUBA 2UXCB 4LF8B 3VARA 1TKFA 4GZRB 2QECA 4FD7A 2Q4YA 2F5IA 3ZBHA 2PI4A 3FEEA 2GLFA 3JATA 2PJAA 1K34A 4RI1A 2B5GA 2PIYA 3LWUA 4LP8A 4J3GA 5CBMA 3J80N 1N34B 2NSMA 1GRJA 5KMGA 4P4DA 1IXBA 5BR8B 1BGYH 1M57B 2QM8A 1ORQC 3ZRWA 2ZOGA 4WFFA 4DV6B 2Q4PA 4R8CA 1NVPB 2CXAA 2XAQA 2Z3PA 3FB8C 5EK0A 4A94A 5G21A 4JI2O 4EWTA 4OIWA 5J8FA 3HKBA 1ARMA 2CIJA 2DF5A 4CS4A 3Q4HB 3WABA 3BCCH 3JAKA 2BSKB 4PI2A 1BE3H 4UV9A 4CYPA 4ZYQA 3HPLC 4O4JB 2XNDG 4X1KA 3C3SA 3ASNC 4MT8A 5DWMA 5JH9A 2ODFA 2PZSA 1Q81W 4K35A 5IYZA 4GUNA 2ZPAA 2M7WA 1F57A 3D8PA 1Z8WA 4I4TA 1N33B 4GM5A 2HJDA 3TGUH 5LA6B 1TGOA 4PK2A 3ZZIA 4QE9A 2PJBA 4PA7A 4FZ1A 4HNYB 3LSQA 4RUHA 3DXRB 1JFFB 4JYAB 4WFAV 2Z3LA 1YVOA 1M4UA 4BIUA 5IWAO 4Q6GA 3B40A 4P2ZA 1JPXA 1JA8A 2UUBO 3EFAA 2QM4A 1RTQA 4NVPA 1S7KA 1O9HA 4GKJO 1BMFG 1P0HA 3E2EA 4WWVA 3RFRA 3ZS8C 2Y0MA 4QGPA 4DR4O 4B3SB 4I55A 2BOBC 3IC7A 3PB4X 3JAWA 3I55V 4KHPB 3WC5A 1XL4A 2UXDB 2K1EA 4YFJA 4B3RO 4KOYA 4ZY1A 1Z5VA 2XAJA 4HKFA 3IJ4A 4GT1A 2PVVA 4BBHA 4JTAB 2B4DA 5H2FZ 5D8NA 2YI9A 1UJWB 3AEIA 4B7EA 4R87A 2LO1A 4GX2A 5CA3A 1P49A 1LFWA 4OC3A 2C1CA 4HPSA 2PVWA 2H94A 1M5IA 1GM8A 4YIOA 3UM7A 1R73A 3A0HZ 4KL1A 4RUFA 2CTWA 4NGTA 1VQKV 1GH6A 3K08A 4MTFA 1H8LA 2YICA 1R3LC 4LF7O 4LC1A 1K9MW 1VARA 1PL0A 4OGQB 2VEZA 4B14A 4PDMA 3RYHB 4X64B 4GS4A 3LACA 3CRAA 4FAIA 4IGGA 2PR8A 3AG4B 2ZE6A 3R9GA 2EBJA 1V54B 4EB6A 3T9YA 4U7OA 4KVOE 1MABG 1FXVA 4UCNA 4KLWA 2W0XA 4TT3G 4L8AA 2BOAA 3K5MA 3RZAA 3QG5A 1QU7A 4O2AA 4B5PA 5FPOA 2IBZH 4LBEC 4LR3A 4DR6B 1QSNA 1Q2DA 3N7ZA 4CGOA 1NR1A 2ATKC 3CC2V 1VQNV 1FT7A 2EK9A 3K57A 3F7VC 2ZEEA 3T4ZA 1OCCB 2ITDC 2QKAA 5CA1A 3OD4A 1ZAUA 4B3TB 3KKYA 1H2GA 4DV0B 5LYJB 2OT5A 1Q3EA 2Y4TA 5BWAB 1WB8A 4FWUA 2GTSA 4PDRA 3RYIB 5IJ0A 2YI8A 3S9LA 3I9SA 4H6ZA 1QR9A 2RN9A 2QWOB 1NTKH 4DO2A 2PUSA 1SRYA 4PELA 2NR5A 1W0KG 1XHZA 3CCQV 5LMNB 1PCAA 1IXMA 5AG2A 2Q51A 5K8NA 2M6YA 2OCCB 1OZPA 1CP9A 4LFBO 2FL4A 3SI0A 5I4MA 2J9AA 2B58A 3D7DA 1HNWO 5BMVA 4ZY0A 3SI1A 2VL1A 1OCRC 3FAVB 2OWOA 4X20A 3L70H 1NE9A 5KA5A 4ABMA 4NXMB 5H84A 3B09A 2FCKA 2NNUA 2DYRB 3E22B 1IU8A 3SJFA 3UT5A 1NVPD 5B1AB 2QIRA 4OX9B 1RSOA 1VQ5V 3M8AA 4BMHA 3NR7A 4DV5O 2PJ8A 4DV1B 2C6PA 1HW7A 2QTOA 3G67A 4ZKIA 1Y74B 2R9AA 4ZX8A 1TA8A 4I5SA 2ZNIA 4AQYB 5LRKA 1MNGA 4QUSA 2V8DA 5H5NA 4MVQA 3NE7A 1S76D 2Q8VA 5ITZB 3BA9A 3CX5F 2P5OA 4MFKA 1GAXA 4LFCO 2VQEO 1DTOA 5LGTA 1NS1A 2UUCB 2PJ1A 3VQVA 4KVME 2KSDA 2EIMB 1RXTA 4P44A 3KG2A 1VHOA 5KX5B 4LFAO 3X2QC 3BI0A 3QAYA 4FLWA 5E79Z 5CB4A 3QNEA 3P3PA 1JVMA 3SJQC 2P4KA 2AFSA 4IK2A 5LMUO 4I49A 4K0KO 3ZMVA 4LF9B 1AYEA 3D3SA 2VRZA 4Q36A 5KHKA 5B1BB 3I56V 4GLXA 1VQ4V 1R57A 2OB0A 2ZW5A 1PYTB 2REEA 3VQWA 3H9VA 1S7FA 3FYIB 2EJ7A 2JEXA 5LP6A 5EBMC 3CCMV 2FVGA 1NJIW 2QWRB 3ETDA 1EM1A 4EMEA 3ZHTA 4ONUA 1XMOB 1NTMH 1MJAA 1H2LA 1Q90D 3TXQA 3CCJV 1YX0A 1EZJA 4RWUA 4F0YA 2QVPA 4EFEA 4F4LA 2VQFO 1YTFB 2EIKB 2HHHB 4HNXB 2P4VA 4NGNA 4MS2A 4FLVA 4X65B 2R9RB 3SJXA 3R9EA 1QCEA 4MFPA 1XILA 3CXSA 4TV8A 3ZN1A 4FLZA 4DV3O 3JALB 1ZG8A 2JRIA 5C8YB 2EO8A 2P6FA 3E0KA 4MBUA 2BCCH 2DYSB 1IURA 4DR2O 1RFYA 3A9LA 1GKFA 3OTOO 3H5ZA 2CTRA 5EZYB 4NJRA 5JQGA 4ZI7B 2Z3KA 2AFZA 1H8HG 4B11A 3VOUA 5JQ4A 2HVKC 4J7ZA 4F6EA 2AZ0A 3QNVA 4II9A 2FXFA 4H13B 3LNNA 2CTCA 2IU0A 3B8MA 3FBUA 1GTOA 2QTSA 3CRQA 2WSSG 3SDLA 4PSWA 1IBKB 1AJPA 3TOAA 4CBCA 2WA3A 3UO3A 3GLJA 2ADQB 4CS0B 2C6CA 1QMUA 1ZL8A 2ABZA 1XFOA 3D8CA 1XBLA 2CE4A 3S3WA 2R8VA 4C2XA 4QIWF 3AG3C 4X66O 2ZM6O 2YSUB 4FMTA 3SXNA 3FYEB 2PR1A 1NI8A 1ZWIC 4JD6A 1BL8A 4DR3B 2EILC 3CXCU 1P7BA 1SQVH 2ADPA 4LCUC 4JAUA 1NSLA 1IYLA 3CMEV 2J8MA 3RW0A 2WUUA 3F8KA 5LHIA 1YGHA 2IU3A 2XT9A 4L87A 4DRXB 4BIOA 3EHBB 4IHJB 4BINA 4M3SA 3R95A 5A28A 4A33A 3K2KA 1Z8XA 3FVLA 4C2ZA 4H2KA 2VBQA 2PRQA 3N27A 4KOXA 1CJWA 4AG7A 1S5LZ 4C68A 3ZRSA 1TVKB 4OADA 3W6SA 1FY7A 3JRUA 4NYKA 3ASOB 3ZHUA 4KOSA 2V77A 2YGWA 1CBXA 4XPLA 1N0JA 2KKWA 2LW1A 2WLNA 1LR1A 5JWPA 3HKEA 1WNSA 3RVZA 1EFRG 2YNDA 2YS8A 1ELLP 1D5NA 1SQHA 3S6HA 3T90A 2BE3A 5HVHA 3PB6X 4UVBA 1BOBA 4ASUG 1VQ6V 3LNMB 5J2TB 3JARA 4JLYA 4A30A 4JV5B 2RJZA 4X62B 3KL9A 4JYAO 5GW7A 1Y76B 2J8NA 5E96A 4NXNB 4PDLA 5F2VO 2UU9B 3B2YA 4P6YA 5LOVA 2F1MA 1SF9A 2UUAB 4MHPA 4MY3A 2YXLA 4DR5O 3TT2A 4H89A 2QJ1A 3DSQA 4ORFA 2WLIB 2L35A 4HBNA 5ISVA 2JJ2G 3HKDB 4R3LA 1R3NA 1ZTEA 4DJLA 3LD2A 1K4JA 2UXDO 4CYOA 4XNHC 2UXXA 4J7JA 1CPXA 1COWG 4Y49C 1IICA 3SYOA 4KLVA 4BW9A 2JGUA 1BT8A 2Q6AA 4G27B 4X1IB 3QF7A 3W7XA 2WLJA 1YTFD 4U9ZA 2ZIMA 1Y7RA 1J5EO 2FSRA 1K8AW 2ATRA 5HXDA 1YK3A 4P45A 2KG7A 2DWDC 1MJBA 3CDXA 2EULA 1YVKA 3T8WA 2LFRA 5FLXN 5JJNB 5KUMA 3W91A 2X7RB 1OZ0A 3D7GA 1PNMA 4KZTA 4XDLA 2MK3A 2EZPA 1TF8A 2Q0YA 1V0CA 2Z10A 1I5YA 4X64O 2C27A 4B3MB 4P30A 3U0ZA 2ZD9A 3UO2A 4PXCA 4B6ZA 1LUWA 3JATB 2CNSA 4TQDA 2B5GB 2PDOA 1XNRB 4UBRA 1US6A 5KMGB 1QBZA 3ZRWB 1LUVA 2Y4UA 3APOA 4DR6O 5D29A 4O4IA 1NH2B 5CMUA 1N36B 2OYQA 3ISXA 3T4DA 2VQYA 3O65A 2F4VO 4WJBA 3HKBB 2CGOA 4UIAA 4UWIA 3BHPA 4B3TO 2IQ6A 3NFZA 1MSDA 2DWEC 3JAKB 4J9ZB 4DV0O 4X2TA 1XQ8A 4MTXA 2ZT9B 5DEDA 2LGWA 4X1KB 4HNAA 4CZZA 3L71H 1VF5B 4MVRA 3VH9A 3DR8A 5KTCA 4NTWA 5JCOA 1JWQA 1URFA 1KZFA 1X59A 1QQ9A 3TO7A 3VQYA 5IYZB 4DV2B 1XL6A 2REFA 1KP3A 4EEQA 1QVFU 5DM6V 2AJ6A 4I4TB 4R57A 1M56C 1YIJV 4Q38A 3OGIB 2PC1A 1NBMG 5LMNO 4CAWA 2WYRA 4CAVA 2ETNA 4N21A 4A37A 4RQFA 3EFFK 5GONA 1HR0B 3FF3A 4DR7O 3SPIA 4ZOLA 4H44B 2QM7A 1TAEA 5F47A 2JDIG 2RMKB 1WA8A 3S6KA 1H2MA 4QB9A 2HB6A 4CRZB 1YXBA 1PD3A 3DR6A 1GK9A 1SQQH 1SQFA 3SPJA 4MI4A 3FNCA 3N2GA 2RNBA 4NXMO 1KBHA 5DECA 3C3TA 3APQA 1IBLO 2HVJC 3I1UA 2PF4E 1BHBA 1BPMA 1IX9A 4I55B 3H8EA 3ETEA 5IX3A 3WR7A 3JAWB 4OX9O 1AP5A 1AR4A 2ZELA 1K5SA 4XBFA 4OC5A 2B3UA 3DDDA 1AROP 3RAMA 4JGSA 2G3AA 1SQBH 2Q7GA 5L3CA 3K06A 1KP2A 2XEIA 2AFMA 4U3JA 1EZVH 3RYFA 5ELYA 4XPDC 5EMIA 4AQYO 2B4DB 5G20A 2Q7EA 1CEZA 3TTHA 3OUFA 1HDUA 5G1ZA 3E8GA 2AGAA 1S3ZA 1OCOB 2JGDA 4CH3A 2WZNA 1H8EG 3FH4A 2Q44A 4OLLA 4O4HA 3CCVV 3B77A 2HQYA 1OHHG 2R72A 3OAAG 5CPAA 5LBQA 4M6IA 2F43G 2OR4A 3OTFA 3P2FA 4EKWA 1AMPA 2Z5UA 2P67A 2RQ6A 5B66Z 2JDDA 5AG7A 1N71A 1M93A 3STZC 3FMCA 3G6EV 1XDCA 1E1QG 4LF9O 4U3FH 4YWYA 5BY1A 4KSIA 4R8FA 2VWKA 4EB6B 1VF7A 4ZY2A 1I94O 1RPRA 1S7NA 3STLC 4LF6B 1K33A 1IBMO 4MCRA 4LF5B 4X8IA 3HKCA 4B5PB 4DYOA 1I08A 3EXNA 3JAMN 4H6UA 3PB7X 2PCUA 1VQ9V 1PPJH 2Q0OC 2P7TC 2QSAA 2JIZG 4Z1MG 5CA1B 1XMOO 3CXPA 3PB8X 4MHNA 1OJHA 4FFBA 1PM9A 3D3IA 2ZXWC 4JI7B 2BTQA 3PJSK 4G2KA 2HHHO 4F9UA 1IZ3A 2YXYA 5IJ0B 2H3OA 4MVOA 3U10A 4R50A 2IJKA 2X6AA 3F5TA 1ON0A 4F0XA 4PXEA 4CGMA 4EVYA 1GN3A 1IB1E 4QVTA 3IFXA 1SA0A 3HR0A 3ML0A 5KTAA 1R6NA 4OPHA 4TWKA 4DV7B 4H0LB 3WC6A 2IMOA 4NF1A 3B3CA 1F51A 2CTQA 2A7WA 3UCSC 4OXSA 4AVAA 3RYCA 1YJNV 1DGSA 3B3SA 5BMVB 1L0NH 1NR7A 2WLHA 1RM1C 1R1BA 5KTDA 1M4DA 3K9TA 2FT0A 3ABKC 2GTAA 2N05A 3ABLC 4X20B 3OMIB 1DE4C 4QBJA 1IOIA 3TE4A 1VQ8V 3AG2C 3TFYA 3UT5B 2IW5A 2B1GA 4CH5A 2L6LA 3DC5A 1GHEA 3KASA 2JEUA 5EBWC 1NH2D 2OU2A 3LSUA 1Z2LA 4Y49B 3K9AA 2EINB 3SI2A 2ZR2A 1WPXA 3L73H 3BJ8A 3E86A 2XUMA 1I21A 4D7SA 4P4BA 3QB8A 3MGDA 4DR3O 4H33A 4QPJA 2XTAA 5KLVH 4WBNA 1Q2CA 1EN4A 5CA0A 4DW0A 2ZEPA 3D2PA 5CN0A 3OFNG 4J7KA 4JAVA 2GV9A 1N32B 2FYUH 4U7NA 2E74B 3CCEV 2P22C 1YW4A 5DS0A 2IJHA 4G28B 4IIJA 1U97A 5CB4B 4FM1A 3T1YO 3EC4A 3NH4A 4TNUA 4AXVA 2GDSA 3PFEA 4Q20A 4ZIBA 1N4CA 1KUYA 3FECA 1FJGB 1A2ZA 4FD6A 4DUKA 3DTUB 2CUGA 3AK2A 5B1OA 4B12A 5IY5B 3FIXA 1ZLHA 3VWDA 1U6MA 1XRYA 3SXOA 2P0WA 5JGFA 1FNOA 2HV2A 1NMTA 4AB7A 3KI9A 1Z4RA 1EN5A 5LP6B 5EIBD 3G80A 1H2NA 3WB2A 2Y0IA 1ELMP 4ZHQA 4MY0A 4E2LA 4KXRA 2QGNA 1Z2GA 1DTDA 1W0JG 1XOUA 1UFHA 3SPCA 3JVNA 3FRMA 4FUUA 4PK3A 2PE3A 2PYLA 4C7HA 3F5WC 2J8RA 1NT2B 4UF4A 4HNWB 1EE3P 4JXRA 1KC8W 1VQOV 2AFXA 2PY5A 1VEWA 4TV8B 5JCOC 3FX7A 1XMQB 2F95B 2GANA 2PIZA 3IJ3A 1QSTA 1Y7EA 2W6IG 1ZSPA 1VP7A 6CPAA 1YREA 1AB3A 4JV5O 4O4JA 5JQGB 4KORA 4X62O 3BLNA 4HZ3A 5H9CA 4DUZB 1V55C 3CJHB 3NXSA 1YHQV 2AFUA 2ZEHA 4RUEA 4NXNO 3ZRVA 4JI1B 4B7KA 1LAPA 3CCSV 2Z11A 3GVMA 1I0HA 5EBLC 1JJ2U 1AR5A 2UU9O 4P4IA 1FXKC 2QWQB 1IIDA 3KHXA 3UQ8A 2UUAO 1YITV 4UEEA 3VATA 3JSLA 1R3IC 2ZEOA 2PRBA 3FXTA 3S3XA 3OEHG 3CRCA 4DV4B 1JFFA 5K1PA 1HDJA 4GKKB 4ZGYB 4JYBA 5LRJA 1ZL8B 3IO1A 3FFQA 4UFXA 4YJ2A 3S6GA 1VQPV 3BXMA 3ISZA 4CC5A 3CC4V 4QPKA 1F23A 3TCVA 4OC4A 3D67A 4WFBV 1YEWA 1D5AA 4KFMA 2XHBA 3CC7V 5FVJA 2WPWA 2GIVA 2CF4A 1DF4A 1XMBA 3SHPA 1R6KA 4FM0A 5HVGA 3E35A 4DUYB 3R96A 3P30A 3NE8A 4K3AA 1B6BA 4JAAA 4FLTA 1S77D 4AG9A 1HNZB 4GX0A 1KKCA 1MMMA 2QDOA 1F2OA 2GU2A 1Q2YA 3R66A 1MZFA 4JI5B 4F6AA 4X1YA 5HMNA 4CS3A 3FJUA 3OR6C 2QMLA 3B3VA 1K4CC 4MCSA 1NQTA 3AG7A 3K3WA 1HWYA 2E76B 3FB3A 3K04A 1M44A 2AW9A 3VBBA 3WB0A 1NSAA 5J1QA 2PJ2A 1VF6C 4FJCC 4CAEA 1VQ7V 3SJAC 3V7ZA 4PJ0Z 5DWNA 2C6GA 5LXTA 1XJOA 4M85A 2N74A 4PHZA 3G71V 3IFEA 1YSJA 4GX1A 1Q7LA 2IJZA 4UEZA 1FFXA 2ZEGA 3PGPA 5B3SC 2GBOA 5CBHA 1GM9A 1AVMA 3OWCA 2A3QA 2G3TA 3ASNB 2BEIA 3HKEB 3H1IH 1KMIZ 4J9YB 3ZCCA 5GTIZ 4OC2A 4NCZA 5LYLA 3HLPA 1IGBA 2DN9A 3G8WA 1SQGA 2IH1C 4MHDA 4MVSA 4QE7A 4EFBA 4NGSA 3JARB 2ARHA 4PV1B 2DPSA 1MK4A 3CZXA 3OE7G 1I5XA 3T1HO 1Z5WA 2ZEFA 1BZKA 1WLEA 3ABKB 4RN7A 4JF3A 4CGLA 8CPAA 2LW7A 5CNPA 4PQAA 4UCMA 1OCZC 4CGPA 1R3JC 1AJQA 5LOVB 3AG2B 3ZMZA 1K7DA 2FE7A 4YGOA 1XOVA 4WFGA 2X6BA 2CY2A 1WP8A 2ZNJA 3F7YC 1VIBA 4B08A 5IWAB 2Y0PA 5IYDO 4NTYA 1XNQO 4HAMA 4IT5A 3OEEG 5IB0A 5K8MA 4JASA 4MVZA 2B5UA 1Q86W 3TO9A 4DR4B 4BWAA 2DEAA 1GN6A 3C26A 2Z0ZA 3A0RA 2V7QG 4A31A 1S5HC 4WCEV 2XEGA 4IHMA 2KG7B 3SJCC 3JD3A 3JUWA 2CAZC 3JTKA 4O4LA 4NGRA 3N2KA 5THWA 1Y6XA 4RO2A 3S9NA 4JZ2A 2EK8A 1SERA 2HUZA 1GN4A 4MJ8A 4OPAA 3D3QA 2Q5ZA 2Q9LA 3R65A 4MCPA 1JCHA 4LWSA 4Z2WA 4YY3B 3OUSA 3QO5A 1DLBA 4UVCA 3OT7A 2UXCO 4LF8O 4UIBA 3ABUA 4MW8A 1AI7A 3BY6A 1QSRA 3SYQA 2YNEA 3DC6A 2DXQA 1WP7A 3CWBH 1N34O 3B4SA 4R6TA 5H6QA 3ETQA 3PFOA 5BR8O 1UPGA 1R6TA 3I3GA 1CM0A 1MOFA 4DV6O 1QLEC 3GIUA 1CPYA 5KHGA 1SKVA 3H1JH 4P9OA 1YJWV 2QYVA 2XAHA 4O4IB 5JH7A 3BFRA 4MVUA 3RN4A 2PJ9A 5H6RA 5C88A 2FMLA 4E8OA 4PV6A 2AZ2A 5KHHA 1FXHA 3CCRV 1ARLA 1LNQA 2ZW6A 2F66C 4UFWA 1AI5A 3SJGA 4UUJC 5FPRA 3K59A 4HNAB 3P3NA 3RT3C 2PJ4A 2KCWA 3TC8A 3J81N 2CTPA 1M57C 2WLLA 1AI4A 1MJ9A 3QTCA 1N8RW 1TF9A 2PJ5A 4BIZA 4W4KA 4MMOA 1U96A 1RO5A 3P32A 3IAYA 1YF2A 3THOA 1N33O 4JWPA 4J41A 2FIAA 4A38A 2WPXA 2F93B 4BD9A 5GONB 1B06A 5EC2C 4TQFA 1V55B 2UXNA 4TUYA 4ZOLB 4WFEA 4NJQA 1OCRB 1QHTA 2F23A 3BI1A 1WA8B 4BW5A 4DNCA 1XF8A 2YXHA 3OMNB 1VKCA 3LDDA 3JASA 5K8PA 4JYCA 3N2GB 1PU9A 4PXDA 3L72H 3CRMA 3P2HA 2O4HA 3IEHA 3PN1A 4AVBA 4B3SO 1CG2A 2QKSA 3E8FA 2H8PC 4DR1B 2JLMA 1I12A 1TIQA 4KHPO 3I5DA 1KU9A 2QWNB 4GX5A 3CP1A 3K5NA 2C2AA 3CEIA 1HNWB 3AK1A 1CP6A 1KUVA 3R9FA 4FIPC 4I0XA 3FEDA 2D4PA 4U3JB 1QSMA 3RYFB 4B10A 1YSCA 4M6HA 2CTBA 2I79A 5L3EA 3K0DA 1Z9UA 4A2ZA 3M7MX 3L2NA 2JJ1G 5AGEA 3RNZA 1EN6A 2GLJA 2QWPB 3WFVA 1JJOA 3KKWA 4KS9A 4ZBGA 3E89A 1T5EA 4FLXA 4MFLA 3VWEA 1GYTA 4PA4A 1D2DA 4F8ZA 2ZEMA 4YJ3A 1IOFA 2JGDB 3X2QB 2Y48A 2V8GA 4FD4A 2VS0A 4O4HB 4C7IA 4JI6B 1BPNA 1PNKA 3PEIA 1ZO0A 3KHZA 2WA4A 4QNHB 4JI4B 5A2QN 1E1RG 1L8DA 3B35A 1FJGO 2B1IA 3CS5A 4LFCB 2OZHA 3MN8A 1MZEA 1WK4A 2V4DA 4LNUA 4XDKA 3UKMA 4JI8B 1KUQA 1H2KA 1JQ0A 1B04A 4LFAB 4P4EA 3A0BZ 3MD0A 3HKCB 3BPZA 4E0AA 4GYCB 1OBRA 2Z3MA 1H38A 4QJFB 4BR6A 2RC4A 2ITCC 4K0KB 3TOBA 4RAIA 2JEWA 2EBOA 4KVXA 1Q8IA 4FFBB 3K9UA 5AG4A 3SYPA 2BTQB 1FAFA 3LODA 3PZJA 3BRCA 1P7GA 4MXUA 2XEFA 1AP6A 1PP9H 4DK1A 1YI2V 1TVKA 5KUKA 4X3RA 2DMXA 3BAAA 1WB7A 4A95A 2DPTA 1ZG9A 1SA0B 1Q6IA 3D68A 2BSWA 1AI6A 2FTKA 2VWJA 2Z3YA 1KYOF 4FPPA 2O57A 1KWMA 3CCUV 1OCCC 2WLKA 2ANPA 2I3CA 5B5EZ 1VQMV 5JJEB 3ETGA 2D3OW 2VQFB 3RYCB 1BO4A 3GB7C 4D7TA 3GYAA 2NYQA 2W6JG 2BOCC 2Q0AA 1ZLZA 4JI1O 1B6QA 1FXKA 4O2BA 4XDJA 4DV3B 1S7LA 2CNMA 1GM7A 4TSFG 4LF4B 3D66A 1G1XB 1Q6UA 2Q67A 2X7BA 4F6RA 4MHYA 4CYNA 4MFJA 4DV4O 5AG5A 4X9QA 3H1HH 4CYQA 2OCCC 4GKKO 1S3JA 3HB3B 3G4SV 3IC9A 3AG3B 4DV1O 2V8HA 3O9OA 3ZMSA 1Y66A 4B5OA 4A39A 4C2YA 3ZHRA 3LSSA 1HNXB 4UV8A 4OC0A 3PRTA 3T1CA 3ZIAG 1K73W 2EILB 5IYBO 1Q43A 2RFHA 2DYRC 3D36C 3K5OA 4P4JA 5L3BA 4I50A 2GREA 2OCHA 4WBNB 1Y0RA 3ZRXA 1P4NA 5B1AC 2UUCO 3ZN0A 5CA0B 3CXHF 5JVDA 3S9MA 1UFIA 4U5YA 2BTOA 1O9GA 4X66B 2CNTA 2ZM6B 1Y4MA 2HG5C 4CGNA 3FYNA 4JI5O 1WWZA 1XEQA 4IIJB 4R3KA 1HDQA 3SYCA 4ZI6A 5EYPA 4DYLA 3DNSA 4U9YA 4Z1VA 1YLEA 1I7FA 3KCYA 1AUGA 4F9VA 2HLDG 1VF6A 3ABMC 2EIJC 2QR4A 3KZWA 3H8GA 1QVGU 2OZUA 3CHXA 2PQ8A 2EIMC 1NU1H 1ENVA 1QLEB 1QNMA 4O2AB 1L0LH 4YHHB 4E2AA 3K58A 3J7AU 2LGQA 5L3DA 4TV9A 2POKA 5J2UA 1YVWA 3CXQA 3D4UA 3IU1A 4LQ6A 2ILMA 4ZHQB 5DN6G 5GTHZ 2AHZA 4KUAA 3B8GA 1IYKA 3SPGA 1JOYA 3S6FA 3RYOA 4NFRA 2A0LA 5B1BC 1M4GA 1KECA 1L0CA 4KSFA 1V9PA 4I9QA 5A9GA 3QAHA 3CPXA 3EXAA 4X65O 1WJZA 3IWWA 2DOSA 2Q7BA 5IJ9A 1WN7A 2E3CA 3C90A 3JCZA 4UCPA 4PDVA 1XE4A 3FKSG 2PI5A 3B3WA 2YEVA 5J8CA 4DW1A 3KZIZ 5HFMA 4R6ZA 4A32A 1E79G 4UXNA 1ZUQA 3SGIA 1TXRA 2EIKC 3IGAC 2PJ6A 4JYWA 3ABTA 2ZKOA 2Q4ZA 3IGRA 3IU2A 3KGQA 2LQTA 4FM2A 5LRGA 1AJNA 5H86A 3CPAA 1XMTA 3UY5A 2GFQA 4KP4A 2DYSC 1TUBA 1IBKO 1YZBA 4MVMA 1B3QA 1MSWD 2CH7A 3LMSA 4XNHB 1RSOB 1K97A 1ROPA 4NTXA 2OZGA 4BAYA 4LX9A 4RQEA 4YJ2B 3CYOA 2UXBB 3MHHC 2ZE8A 2PTMA 1FD9A 3D7FA 4CAFA 5AG6A 3SPHA 3N5FA 1CXZB 4YRHA 2WWWA 4M6GA 2ODMA 4K30A 1FKAO 3OM3B 2NMTA 5FNVA 2YUAA 2XEJA 4DR5B 4AHCA 2WLMA 2LFSA 5IB9A 2AE6A 2PJ7A 1LCPA 1Y9KA 1QR8A 2YIDA 1BCCH 5IV0A 3OR7C 2YC0A 1KD1W 1UWYA 2Q4VA 4FD5A 3ICXA 2Y69C 4PPZA 2OOTA 1X10A 2R70A 1YR0A 3IC1A 1B87A 3IWGA 2N04A 1SETA 2G9DA 4X1YB 2ZDIC 5E1AC 1YW6A 1IDSA 3JD4A 5L3FA 4YY3O 1J5EB 2A9HA 4UA3A 1Y67A 5GCNA 3SJEA 5BXZA 2GE3A 2ZCEA 2JBJA 2LJ2A 4OIDA 4TWEA 2IL4A 2R9IA 1L1FA 1YQEA 4MHZA 2GUZA 1JMKC 5KA6A 3OW2U 1XREA 2D2CB 3K5LA 2ZEDA 3W7TA 1LANA 1Q82W 1S72V 2CDYA 5LXTB 4UWJA 5HFLA 1DK1A 1FFXB 3CT9A 3PP9A 2G0BA 4OC1A 4IYIA 4FFKA 3ZMTA 4K8XA 4FLYA 4UCTA 1Z5RA 3ZHVA 1N0NA 1X12A 3BA8A
chains in the Genus database with same CATH topology
4JJXA 4UCMA 4KOUA 4U9ZA 2YNCC 4X5KA 4CGPA 1Y7RA 2FSRA 4KUBA 2ATRA 2QECA 2FE7A 4YGOA 4FD7A 1YK3A 2Q4YA 2F5IA 1MJBA 3G3SA 2CY2A 4RI1A 2B5GA 1YVKA 4J3GA 3EO4A 3W91A 2CXAA 5EBVA 3V8IA 2Z3PA 5IB0A 5G21A 4KZTA 3F0AA 2Q0YA 1V0CA 2Z10A 3TO9A 5J8FA 4UFVA 2C27A 3C26A 2Z0ZA 4A31A 4CYPA 2CNSA 3JTKA 3JUWA 2B5GB 2PDOA 4UBRA 5DWMA 2HUZA 4MJ8A 4XPDB 2ZPAA 3D2MA 4AVCA 3D8PA 1M1DA 2R1IA 2VQYA 4PK2A 3ZZIA 4IUSA 4HNYB 4UWIA 1QSRA 2Z3LA 1YVOA 2YNEA 2DXQA 3DR8A 5KTCA 1KZFA 3I3GA 3EFAA 1CM0A 3TO7A 1S7KA 2REFA 1P0HA 1M4IA 4MFZA 2AJ6A 4R57A 2Y0MA 5C88A 4Q38A 2PC1A 4CAWA 4E8OA 2OH1A 3EY5A 4CAVA 4PV6A 2ZW6A 4UFWA 4YFJA 5F47A 4KOTA 4KOYA 3S6KA 4QB9A 2KCWA 4HKFA 4CRZB 1MJ9A 3DR6A 2H5MA 4R9MA 4BBHA 2PSWA 2B4DA 4MI4A 1RO5A 3FNCA 4JWPA 4R87A 2FIAA 2WPXA 3GKRA 5IX3A 3WR7A 2P6EA 2B3UA 3DDDA 4DNCA 2G3AA 1XF8A 1VKCA 2D4OA 4XPDC 2B4DB 2VEZA 1PU9A 5G20A 4B14A 3TTHA 4GS4A 3P2HA 2PR8A 4AVBA 3R9GA 5G1ZA 2JLMA 3DSBA 1I12A 1S3ZA 1TIQA 3T9YA 4KVOE 4UCNA 4KLWA 2Q44A 4L8AA 4OLLA 1KUVA 2HQYA 3R9FA 4B5PA 4L89A 2BUEA 2D4PA 1QSNA 1QSMA 3N7ZA 1Q2DA 4B10A 4CGOA 4A2ZA 2I79A 1Z9UA 3P2FA 2WSAA 5G22A 2JDDA 5AG7A 5AGEA 1N71A 3KKWA 4KS9A 4ZBGA 4MFLA 3VWEA 4NEXA 5JPHA 5BWAB 1S7NA 4KOWA 2ZW4A 3GY9A 3I9SA 2R98A 4H6ZA 4FD4A 4C7IA 4B5PB 1LRZA 3H4QA 1ZO0A 3EXNA 4H6UA 1VHSA 3CXPA 2OZHA 1OZPA 1Y9WA 1WK4A 2FL4A 2JDCA 5EC4A 2B58A 1ON0A 4F0XA 4EVYA 4CGMA 1IB1E 1NE9A 4QVTA 4E0AA 5H84A 5KTAA 2B3VA 2FCKA 2Z3MA 2RC4A 4NF1A 4MFQA 3TOBA 2QIRA 4KVXA 3K9UA 4AVAA 5AG4A 3LODA 4BMHA 3PZJA 2VI7A 2FS5A 5KTDA 1M4DA 2FT0A 2YNCA 2ZXVA 4A95A 4QUSA 2DPTA 3NE7A 2BSWA 4QBJA 3TO6A 3TE4A 4MFKA 4CRYB 3TFYA 4CAXA 1GHEA 4KVME 2OU2A 4Y49B 1BO4A 1RXTA 3GYAA 4IF5A 3BJ8A 1I21A 2I00A 2CNMA 1S7LA 3ZJ0A 4QC6A 2Z3NA 2X7BA 3QB8A 3MGDA 1PUAA 4CYNA 4I49A 4MFJA 3D3SA 1Q2CA 3F5BA 5AG5A 4Q36A 4CYQA 1R57A 2OB0A 2ZW5A 3D2PA 2REEA 1XIXA 1S7FA 4B5OA 4C2YA 4RS2A 3EC4A 1KUYA 4ONUA 4FD6A 1MJAA 2BL1A 1YX0A 4B12A 3FIXA 4F0YA 1P4NA 3VWDA 1U6MA 3SXOA 4HNXB 2P0WA 4U5YA 2HV2A 2CNTA 1NMTA 4AB7A 3R9EA 1Z4RA 4MFPA 4CGNA 3CXSA 3FYNA 1WWZA 4R3KA 3E0KA 4MBUA 2P6FA 3DNSA 3A9LA 4U9YA 4MY0A 3H5ZA 4KOVA 1YLEA 1UFHA 3JVNA 4PK3A 3FRMA 2Z3KA 4XPKA 4C7HA 2J8RA 4B11A 2K5TA 5JQ4A 2VZZA 2Z3OA 4HNWB 1S60A 4JXRA 2A4NA 2OZUA 4II9A 2PQ8A 2FXFA 2P6GA 4PSXA 3FBUA 4E2AA 2GANA 3CXQA 4PSWA 3IU1A 1QSTA 2JEVA 3TOAA 2VXKA 4KUAA 3B8GA 1YREA 4CS0B 1IYKA 4KORA 3S6FA 1S5KA 4KSAA 4NSQA 2VZYA 3BLNA 3RYOA 5F49A 1M4GA 4KSFA 1L0CA 2R8VA 4C2XA 3R1KA 3QAHA 4OAEA 4JXQA 2Z11A 1KUXA 1I1DA 2Q7BA 3SXNA 2PR1A 1IIDA 4UCPA 4JD6A 1XE4A 2B4BA 2PRBA 3FXTA 5J8CA 4A32A 4ZGYB 1XEBA 4UFXA 1NSLA 1IYLA 3IWEA 5C82A 2J8MA 3S6GA 2WUUA 3F8KA 1YGHA 3IGRA 3IU2A 3TCVA 4M3SA 3R95A 2ZW7A 5A28A 5H86A 5FVJA 1XMTA 2WPWA 2GIVA 3SHPA 3UY5A 4A33A 3R96A 4C2ZA 2VBQA 1B6BA 4XNHB 4KOXA 1CJWA 4AG7A 4AG9A 2OZGA 4LX9A 4C68A 1Q2YA 4OADA 3W6SA 4CAFA 1FY7A 5AG6A 4F6AA 4YRHA 5HMNA 4K30A 2NMTA 2QMLA 4KOSA 2YGWA 5HH1A 1QSOA 4XPLA 2EUIA 2O28A 4LUAA 2AE6A 1J4JA 3FB3A 1Y9KA 1M44A 4B13A 5IV0A 2YNDA 4CAEA 2Q4VA 4FD5A 5A27A 1YR0A 1B87A 1SQHA 3IWGA 5DWNA 4M85A 3S6HA 3T90A 3PGPA 4UA3A 1BOBA 5GCNA 2FIWA 2GE3A 4JLYA 2IL4A 3OWCA 4A30A 2G3TA 3BJ7A 2BEIA 2EVNA 5I0CA 2Q04A 4NCZA 2J8NA 5E96A 5F46A 3G8WA 4MHDA 4UWJA 2R7HA 4MY3A 3PP9A 3TT2A 2G0BA 4H89A 4ORFA 2ARHA 2DPSA 3W6XA 5ISVA 4R3LA 1MK4A 3LD2A 1K4JA 4CYOA 4XNHC 4Y49C 1IICA 4NXYA 4CGLA 1Z4EA 5F48A 4KLVA 5CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJX A;  4KOU A;  4U9Z A;  4X5K A;  1Y7R A;  2FSR A;  4KUB A;  2ATR A;  2QEC A;  2FE7 A;  4YGO A;  4FD7 A;  1YK3 A;  2Q4Y A;  2F5I A;  1MJB A;  3G3S A;  2CY2 A;  4RI1 A;  2B5G A;  1YVK A;  4J3G A;  3EO4 A;  3W91 A;  5EBV A;  3V8I A;  5IB0 A;  4KZT A;  3F0A A;  2Q0Y A;  1V0C A;  2Z10 A;  3TO9 A;  5J8F A;  2C27 A;  3C26 A;  2Z0Z A;  2CNS A;  3JUW A;  2B5G B;  2PDO A;  4UBR A;  5DWM A;  2HUZ A;  4MJ8 A;  4XPD B;  2ZPA A;  3D2M A;  4AVC A;  3D8P A;  1M1D A;  2R1I A;  2VQY A;  4PK2 A;  3ZZI A;  4IUS A;  4HNY B;  4UWI A;  1QSR A;  1YVO A;  2DXQ A;  3DR8 A;  5KTC A;  1KZF A;  3I3G A;  3EFA A;  1CM0 A;  3TO7 A;  1S7K A;  2REF A;  1P0H A;  1M4I A;  2AJ6 A;  4R57 A;  2Y0M A;  5C88 A;  2PC1 A;  4CAW A;  4E8O A;  2OH1 A;  3EY5 A;  4CAV A;  4PV6 A;  2ZW6 A;  4YFJ A;  5F47 A;  4KOT A;  4KOY A;  3S6K A;  4QB9 A;  2KCW A;  4HKF A;  4CRZ B;  1MJ9 A;  3DR6 A;  2H5M A;  4R9M A;  2PSW A;  2B4D A;  4MI4 A;  1RO5 A;  3FNC A;  4JWP A;  4R87 A;  2FIA A;  2WPX A;  3GKR A;  5IX3 A;  3WR7 A;  2P6E A;  2B3U A;  3DDD A;  4DNC A;  2G3A A;  1XF8 A;  1VKC A;  2D4O A;  4XPD C;  2B4D B;  2VEZ A;  1PU9 A;  3TTH A;  4GS4 A;  3P2H A;  2PR8 A;  4AVB A;  3R9G A;  2JLM A;  3DSB A;  1I12 A;  1S3Z A;  1TIQ A;  3T9Y A;  4KVO E;  4KLW A;  2Q44 A;  4L8A A;  4OLL A;  1KUV A;  2HQY A;  3R9F A;  4B5P A;  4L89 A;  2BUE A;  2D4P A;  1QSN A;  1QSM A;  3N7Z A;  1Q2D A;  2I79 A;  1Z9U A;  3P2F A;  2JDD A;  1N71 A;  3KKW A;  4ZBG A;  3VWE A;  4NEX A;  5JPH A;  1S7N A;  4KOW A;  2ZW4 A;  3GY9 A;  3I9S A;  2R98 A;  4H6Z A;  4FD4 A;  4B5P B;  1LRZ A;  3H4Q A;  3EXN A;  4H6U A;  1VHS A;  3CXP A;  2OZH A;  1OZP A;  1Y9W A;  1WK4 A;  2FL4 A;  2JDC A;  5EC4 A;  2B58 A;  1ON0 A;  4EVY A;  1IB1 E;  1NE9 A;  4QVT A;  4E0A A;  5H84 A;  5KTA A;  2B3V A;  2FCK A;  2RC4 A;  4NF1 A;  3TOB A;  2QIR A;  4KVX A;  3K9U A;  4AVA A;  3LOD A;  4BMH A;  3PZJ A;  2VI7 A;  2FS5 A;  5KTD A;  1M4D A;  2FT0 A;  2ZXV A;  4QUS A;  3NE7 A;  2BSW A;  4QBJ A;  3TO6 A;  3TE4 A;  4CRY B;  3TFY A;  4CAX A;  1GHE A;  4KVM E;  2OU2 A;  4Y49 B;  1BO4 A;  1RXT A;  3GYA A;  4IF5 A;  3BJ8 A;  1I21 A;  2I00 A;  2CNM A;  1S7L A;  3ZJ0 A;  4QC6 A;  2X7B A;  3QB8 A;  3MGD A;  1PUA A;  4I49 A;  3D3S A;  1Q2C A;  3F5B A;  1R57 A;  2OB0 A;  2ZW5 A;  3D2P A;  2REE A;  1XIX A;  1S7F A;  4B5O A;  4RS2 A;  3EC4 A;  1KUY A;  4ONU A;  4FD6 A;  1MJA A;  2BL1 A;  1YX0 A;  3FIX A;  4F0Y A;  1P4N A;  3VWD A;  1U6M A;  3SXO A;  4HNX B;  2P0W A;  4U5Y A;  2HV2 A;  2CNT A;  1NMT A;  4AB7 A;  3R9E A;  1Z4R A;  3CXS A;  3FYN A;  1WWZ A;  4R3K A;  3E0K A;  4MBU A;  2P6F A;  3DNS A;  4U9Y A;  4MY0 A;  4KOV A;  1YLE A;  1UFH A;  3JVN A;  4PK3 A;  3FRM A;  4XPK A;  2J8R A;  2K5T A;  5JQ4 A;  2VZZ A;  4HNW B;  1S60 A;  2A4N A;  2OZU A;  4JXR A;  4II9 A;  2PQ8 A;  2FXF A;  2P6G A;  4PSX A;  3FBU A;  4E2A A;  2GAN A;  3CXQ A;  4PSW A;  1QST A;  2JEV A;  3TOA A;  2VXK A;  4KUA A;  3B8G A;  1YRE A;  4CS0 B;  1IYK A;  4KOR A;  3S6F A;  1S5K A;  3RYO A;  4NSQ A;  2VZY A;  3BLN A;  5F49 A;  1M4G A;  1L0C A;  2R8V A;  3R1K A;  3QAH A;  4OAE A;  4JXQ A;  2Z11 A;  1KUX A;  1I1D A;  2Q7B A;  3SXN A;  2PR1 A;  1IID A;  4JD6 A;  1XE4 A;  2B4B A;  2PRB A;  3FXT A;  5J8C A;  1XEB A;  1NSL A;  5C82 A;  1IYL A;  2J8M A;  3S6G A;  3F8K A;  1YGH A;  3IGR A;  3TCV A;  4M3S A;  3R95 A;  2ZW7 A;  5H86 A;  5FVJ A;  1XMT A;  2WPW A;  2GIV A;  3SHP A;  3UY5 A;  3R96 A;  2VBQ A;  1B6B A;  4XNH B;  4KOX A;  1CJW A;  4AG7 A;  4AG9 A;  2OZG A;  4LX9 A;  1Q2Y A;  4OAD A;  3W6S A;  1FY7 A;  4F6A A;  4YRH A;  5HMN A;  4K30 A;  2NMT A;  2QML A;  4KOS A;  5HH1 A;  1QSO A;  4XPL A;  2EUI A;  2O28 A;  4LUA A;  2AE6 A;  1J4J A;  3FB3 A;  1Y9K A;  1M44 A;  5IV0 A;  2Q4V A;  4FD5 A;  1YR0 A;  1B87 A;  1SQH A;  3IWG A;  5DWN A;  4M85 A;  3S6H A;  3T90 A;  3PGP A;  4UA3 A;  1BOB A;  5GCN A;  2FIW A;  2GE3 A;  4JLY A;  2IL4 A;  3OWC A;  2G3T A;  3BJ7 A;  2BEI A;  2EVN A;  5I0C A;  2Q04 A;  4NCZ A;  2J8N A;  5E96 A;  5F46 A;  3G8W A;  4MHD A;  4UWJ A;  2R7H A;  4MY3 A;  3PP9 A;  3TT2 A;  2G0B A;  4H89 A;  4ORF A;  2ARH A;  3W6X A;  5ISV A;  4R3L A;  1MK4 A;  3LD2 A;  1K4J A;  4XNH C;  4Y49 C;  1IIC A;  4NXY A;  1Z4E A;  5F48 A;  4KLV A;  5CNP A; 
#chains in the Genus database with same CATH topology
 2Q68 A;  4JZ0 A;  4JJX A;  3MHS C;  4KOU A;  4JI3 B;  1M56 B;  4LQG A;  1P84 F;  3L75 H;  1M9N A;  2F4V B;  3ASO C;  3RBU A;  3Q4H A;  2Q7S A;  2PJ3 A;  2BSK A;  1GMG A;  3G3S A;  3NH8 A;  1RP3 B;  4UVA A;  3WB1 A;  4ICG A;  3AG1 C;  5IDJ A;  3CD6 V;  4PI0 A;  4JI0 B;  3EO4 A;  4FLU A;  5LHG A;  2XAS A;  5EBV A;  3V8I A;  1P4R A;  5KAF Z;  4OME A;  2GHY A;  3D7H A;  3QVN A;  3F0A A;  4X89 A;  3FB6 C;  3OMA B;  5LA6 A;  4UFV A;  2PGG A;  3W7U A;  2E5L B;  3DXR A;  4DR1 O;  4DR7 B;  1TUE B;  2JVD A;  1ZG7 A;  1Q7Y W;  3K0G A;  4ONW A;  4XPD B;  3ZX6 A;  3D2M A;  1R3K C;  2HP8 A;  1NKD A;  4AVC A;  1M1D A;  2R1I A;  1IBL B;  4UCV A;  1BSM A;  4IUS A;  2EJR A;  1CP7 A;  2OIE A;  2HR3 A;  1JR9 A;  4O4L B;  4EFD A;  3N2K B;  3ZJZ A;  1K4D C;  1W59 A;  3BAB A;  1LOK A;  4JI6 O;  5CBG A;  4UB6 Z;  3LUT B;  3TJT A;  2HEP A;  5D5P A;  4LWS B;  1M4I A;  3KCX A;  1Z8L A;  4MFZ A;  4JI4 O;  2P06 A;  1NZ6 A;  3ZED A;  1IY7 A;  2OH1 A;  4B3M O;  3EY5 A;  4MRI A;  2JBK A;  2XOK G;  3ABM B;  5L3G A;  2EIJ B;  3KQX A;  4KOT A;  3VQX A;  1XNR O;  4JI8 O;  3ZHS A;  5J9P C;  2H5M A;  4R9M A;  2PSW A;  5IYC O;  2ZEN A;  1FPO A;  2AXT Z;  3DGE A;  4DK0 A;  3RYH A;  1VQL V;  2QKC A;  5JH7 B;  4IL6 Z;  1N36 O;  2FB5 A;  3FB5 C;  4FBE A;  2ZXW B;  4MTG A;  1SES A;  3GKR A;  1NTZ H;  3JD0 A;  3BEH A;  2P6E A;  2JS5 A;  4Z65 A;  5IT9 N;  3FX6 A;  1I94 B;  1XUQ A;  4W9Y A;  1IBM B;  1SS3 A;  4MW3 A;  4JZG A;  2HJF C;  4PXB A;  2WLL B;  2D4O A;  4X88 A;  4JI2 B;  4R7C A;  4DV2 O;  3SJB C;  3MDS A;  1SC5 B;  1WPB A;  4NR1 A;  2V8V A;  4D6T H;  3JSN A;  4JTD B;  2HFE C;  1GN2 A;  3B8N A;  3K9S A;  5LYI A;  2PJC A;  3TK1 A;  3DSB A;  1FYJ A;  4YXW G;  5LYJ A;  1HR0 O;  3A8T A;  3JD1 A;  1RM1 B;  3L74 H;  4TUY B;  3RYI A;  1R43 A;  1BHA A;  3NH5 A;  4MCQ A;  4LH6 A;  1FFT B;  4L89 A;  4C7U A;  3ABL B;  2BUE A;  1XHX A;  5D5Q A;  4AI8 A;  4ZBM A;  3RGB A;  4NGM A;  3JAS B;  2E75 B;  2OTL V;  2WSA A;  4LF4 O;  3GWO A;  3QO8 A;  5G22 A;  3U11 A;  3WG7 C;  4K8Z A;  4YU9 A;  4JYY A;  2QA4 V;  4L8J A;  4NEX A;  5JPH A;  1F7Y A;  2Q43 A;  4KOW A;  4PD4 F;  3CJH A;  2ZW4 A;  2Z0A A;  3GY9 A;  4LH7 A;  3FAV A;  4E4E A;  2UUB B;  4CH4 A;  2R98 A;  1G4Y B;  3RO0 A;  1LRZ A;  4ZX9 A;  3H4Q A;  4I0X B;  3FD9 A;  4GKJ B;  3D36 A;  1HNX O;  4DXW A;  2AFO A;  1VHS A;  3E22 A;  2ZIO A;  3TCU A;  4NB5 A;  1WAZ A;  5B1N A;  3TXS A;  4UB8 Z;  4MSW C;  1Y9W A;  1VHE A;  4B3R B;  4NGP A;  2JDC A;  5EIB C;  5EC4 A;  1KQS U;  4YJ3 B;  4KUM A;  3B7I A;  2Y69 B;  1BS3 A;  2JK5 C;  1JQG A;  4UCR A;  3GB0 A;  3L9D A;  1Y74 A;  1JX9 A;  5LYD A;  2IJJ A;  3CCL V;  2WPD G;  1Q6H A;  4I7Z B;  3MRU A;  2P6J A;  2B3V A;  2F7V A;  2IM9 A;  5ITZ A;  2QJ8 A;  2EX3 A;  2PJ0 A;  4MFQ A;  4R7M A;  2DQ3 A;  1S5J A;  4GCZ A;  1KKD A;  4R76 A;  5KAI Z;  4WF9 V;  2BO9 A;  1SZT A;  4LNU B;  4UCU A;  1OCO C;  2YIB A;  2VI7 A;  2FS5 A;  5LYF A;  2A79 B;  5KX5 A;  5EC1 C;  4LF6 O;  4K3N A;  4LF5 O;  4LF7 B;  2YNC A;  2ZXV A;  3PB9 X;  4YHH O;  3T1Y B;  3QO7 A;  1LAM A;  4CPA A;  5FL7 G;  3TX8 A;  3TO6 A;  4TOI A;  4HYO A;  3JD2 A;  1F4N A;  2KQX A;  4CRY B;  4CAX A;  2XAG A;  1G6U A;  3K79 A;  1M1K W;  2DQ0 A;  4JI7 O;  3E83 A;  2NLJ C;  2QE7 G;  2YIA A;  4J42 A;  4JTC B;  2GSM B;  2HC9 A;  3ZHQ A;  4IF5 A;  5KHJ A;  1M4L A;  2I00 A;  3W7W A;  5IE9 A;  2PYJ A;  4UFZ A;  1Y0Y A;  2DE0 X;  3ZJ0 A;  2X0L A;  4QC6 A;  4DV7 O;  1ZLI A;  2Z3N A;  1PUA A;  4UCO A;  2WAM A;  4PA6 A;  4H37 A;  3F5B A;  3AG1 B;  2Q69 A;  3RWR D;  1XIX A;  3DGV A;  2K9P A;  2MW2 B;  3MAQ A;  3KR5 A;  3CPW U;  3KR4 A;  4J11 A;  4FZ0 A;  4YIP A;  2O53 A;  4RS2 A;  3JAL A;  1FXK B;  4O2B B;  4JPR A;  5C8Y A;  3G6B A;  3E8H A;  2YIB D;  2RCV A;  4AIL C;  5EZY A;  4F6R B;  2RB7 A;  3KQZ A;  4IAV A;  2BL1 A;  4ZI7 A;  4LFB B;  1VIX A;  2OTJ V;  2X6C A;  3H1K H;  5BZB A;  3CMA V;  3HUV A;  1MG1 A;  3A2F A;  3K03 A;  2UXB O;  2P90 A;  1PNL A;  1TKJ A;  3H01 A;  2YDE A;  4FVM A;  3B3T A;  5F09 A;  1VMG A;  1BAV A;  4KOV A;  1H2S B;  4I50 B;  2AFW A;  2EWB A;  4XPK A;  2LP7 A;  1SZX A;  2K5T A;  4DV5 B;  1A32 A;  2VZZ A;  2Z3O A;  5JVD B;  2OIG A;  1N32 O;  1S60 A;  2A4N A;  4CS2 A;  4PA3 A;  2HKO A;  3IIB A;  4UEF A;  2ZDI A;  2P6G A;  1IVS A;  4PSX A;  2EIN C;  1THZ A;  4J80 A;  1M90 W;  1BQZ A;  2V1D A;  5EYP B;  1CPS A;  1EBO A;  1Z8T A;  3ZMU A;  2JEV A;  3CB2 A;  5JM6 A;  2VXK A;  2ZIN A;  2VQE B;  2ZE7 A;  3NA6 A;  3DLJ A;  3RBZ A;  3LDC A;  3SYA A;  1S5K A;  3T2M A;  4KSA A;  3AK3 A;  1DF5 A;  2VZY A;  4NSQ A;  4P4F A;  5F49 A;  3H1L H;  2Q73 A;  2NN4 A;  3R1K A;  4FK5 C;  2ZOF A;  4OAE A;  4JXQ A;  3WT4 A;  4DRX A;  4A5U B;  1KUX A;  1I1D A;  4IHJ A;  5CBF A;  1K3E A;  3GWK C;  5B3S B;  2G38 A;  3WU2 Z;  4TV9 B;  3BVO A;  2W0F C;  1W2B U;  2EZO A;  1J95 A;  1PV0 A;  5J2U B;  4P10 A;  2B4B A;  5LGU A;  2ZR3 A;  5LMU B;  4O23 A;  4I9W A;  4IYH A;  3AG4 C;  1YCI A;  1HEE A;  1YLO A;  1V54 C;  5IY5 C;  1VGY A;  2IJI A;  1XEB A;  5C82 A;  3IWE A;  2QEX V;  5JJJ B;  3M99 B;  1BLL E;  1XBU A;  1F4M A;  4W4L A;  5LP6 C;  1QQC A;  2ZW7 A;  5LL6 Y;  5IJ9 B;  3SR2 C;  1XMQ O;  4JI3 O;  4OP4 A;  1YME A;  2ZE5 A;  2YEV B;  3BHX A;  5C93 A;  2Q7H A;  1K5Q A;  1GO3 F;  3E8B A;  2DJV A;  2BCO A;  4JI0 O;  4DUZ O;  2RDC A;  3CE2 A;  1PL4 A;  5HVF A;  1OCZ B;  1G8M A;  4DR2 B;  4UCS A;  5TIS Z;  3WG7 B;  5J2T A;  3FB7 C;  3OTO B;  7CPA A;  5K8O A;  2KB1 A;  1BQ0 A;  1TUB B;  5LHH A;  3CSX A;  5HH1 A;  1QSO A;  3GUX A;  4Q7A A;  2EUI A;  2O28 A;  4MTO A;  2E5L O;  2JS3 A;  4LUA A;  3EVK A;  1J4J A;  1S0V A;  4P9P A;  2CH7 B;  1AIL A;  4B13 A;  3T1H B;  4X8A A;  2B9Z A;  1Y76 A;  5K1X A;  2IH3 C;  3JCU Z;  4J10 A;  4PA9 A;  5A27 A;  4CH6 A;  1HP8 A;  2CK3 G;  1ZX3 A;  4NKG B;  1SQX H;  3WC7 A;  3JYC A;  1QLN A;  3RVY A;  3B2E E;  5FNV B;  3PBE A;  2FIW A;  1RPO A;  2WLI A;  3V38 A;  4DUY O;  1FS0 G;  5LGN A;  3H8F A;  2FKX A;  4CC6 A;  3HKD A;  3BJ7 A;  2EVN A;  5I0C A;  2Q04 A;  1CX8 A;  4WFH A;  1HNZ O;  3TET A;  1XNQ B;  5F46 A;  1AR1 B;  4X1I A;  2XAF A;  4NGQ A;  1MA1 A;  2R7H A;  3CRR A;  2DW4 A;  1YDX A;  4OKO A;  4N23 A;  1YJ9 V;  3W6X A;  1XI1 A;  1SQP H;  3PBB A;  1Q5O A;  3W7S A;  1TKH A;  2GUZ B;  2F8H A;  3OGC C;  3LDE A;  4GXH A;  4NXY A;  1F2P A;  1PKX A;  1Z4E A;  5F48 A;  2A06 H;  1OV9 A;  2CGN A;  1KB9 F;  2ZQM A;  1K92 A;  1X4T A;  2AHY A;  2YNC C;  5KHI A;  4G1P A;  4X5K A;  4KUB A;  2UXC B;  4LF8 B;  3VAR A;  1TKF A;  4GZR B;  2QEC A;  4FD7 A;  2Q4Y A;  2F5I A;  3ZBH A;  2PI4 A;  3FEE A;  2GLF A;  3JAT A;  2PJA A;  1K34 A;  4RI1 A;  2B5G A;  2PIY A;  3LWU A;  4LP8 A;  4J3G A;  5CBM A;  3J80 N;  1N34 B;  2NSM A;  1GRJ A;  5KMG A;  4P4D A;  1IXB A;  5BR8 B;  1BGY H;  1M57 B;  2QM8 A;  1ORQ C;  3ZRW A;  2ZOG A;  4WFF A;  4DV6 B;  2Q4P A;  4R8C A;  1NVP B;  2CXA A;  2XAQ A;  2Z3P A;  3FB8 C;  5EK0 A;  4A94 A;  5G21 A;  4JI2 O;  4EWT A;  4OIW A;  5J8F A;  3HKB A;  1ARM A;  2CIJ A;  2DF5 A;  4CS4 A;  3Q4H B;  3WAB A;  3BCC H;  3JAK A;  2BSK B;  4PI2 A;  1BE3 H;  4UV9 A;  4CYP A;  4ZYQ A;  3HPL C;  4O4J B;  2XND G;  4X1K A;  3C3S A;  3ASN C;  4MT8 A;  5DWM A;  5JH9 A;  2ODF A;  2PZS A;  1Q81 W;  4K35 A;  5IYZ A;  4GUN A;  2ZPA A;  2M7W A;  1F57 A;  3D8P A;  1Z8W A;  4I4T A;  1N33 B;  4GM5 A;  2HJD A;  3TGU H;  5LA6 B;  1TGO A;  4PK2 A;  3ZZI A;  4QE9 A;  2PJB A;  4PA7 A;  4FZ1 A;  4HNY B;  3LSQ A;  4RUH A;  3DXR B;  1JFF B;  4JYA B;  4WFA V;  2Z3L A;  1YVO A;  1M4U A;  4BIU A;  5IWA O;  4Q6G A;  3B40 A;  4P2Z A;  1JPX A;  1JA8 A;  2UUB O;  3EFA A;  2QM4 A;  1RTQ A;  4NVP A;  1S7K A;  1O9H A;  4GKJ O;  1BMF G;  1P0H A;  3E2E A;  4WWV A;  3RFR A;  3ZS8 C;  2Y0M A;  4QGP A;  4DR4 O;  4B3S B;  4I55 A;  2BOB C;  3IC7 A;  3PB4 X;  3JAW A;  3I55 V;  4KHP B;  3WC5 A;  1XL4 A;  2UXD B;  2K1E A;  4YFJ A;  4B3R O;  4KOY A;  4ZY1 A;  1Z5V A;  2XAJ A;  4HKF A;  3IJ4 A;  4GT1 A;  2PVV A;  4BBH A;  4JTA B;  2B4D A;  5H2F Z;  5D8N A;  2YI9 A;  1UJW B;  3AEI A;  4B7E A;  4R87 A;  2LO1 A;  4GX2 A;  5CA3 A;  1P49 A;  1LFW A;  4OC3 A;  2C1C A;  4HPS A;  2PVW A;  2H94 A;  1M5I A;  1GM8 A;  4YIO A;  3UM7 A;  1R73 A;  3A0H Z;  4KL1 A;  4RUF A;  2CTW A;  4NGT A;  1VQK V;  1GH6 A;  3K08 A;  4MTF A;  1H8L A;  2YIC A;  1R3L C;  4LF7 O;  4LC1 A;  1K9M W;  1VAR A;  1PL0 A;  4OGQ B;  2VEZ A;  4B14 A;  4PDM A;  3RYH B;  4X64 B;  4GS4 A;  3LAC A;  3CRA A;  4FAI A;  4IGG A;  2PR8 A;  3AG4 B;  2ZE6 A;  3R9G A;  2EBJ A;  1V54 B;  4EB6 A;  3T9Y A;  4U7O A;  4KVO E;  1MAB G;  1FXV A;  4UCN A;  4KLW A;  2W0X A;  4TT3 G;  4L8A A;  2BOA A;  3K5M A;  3RZA A;  3QG5 A;  1QU7 A;  4O2A A;  4B5P A;  5FPO A;  2IBZ H;  4LBE C;  4LR3 A;  4DR6 B;  1QSN A;  1Q2D A;  3N7Z A;  4CGO A;  1NR1 A;  2ATK C;  3CC2 V;  1VQN V;  1FT7 A;  2EK9 A;  3K57 A;  3F7V C;  2ZEE A;  3T4Z A;  1OCC B;  2ITD C;  2QKA A;  5CA1 A;  3OD4 A;  1ZAU A;  4B3T B;  3KKY A;  1H2G A;  4DV0 B;  5LYJ B;  2OT5 A;  1Q3E A;  2Y4T A;  5BWA B;  1WB8 A;  4FWU A;  2GTS A;  4PDR A;  3RYI B;  5IJ0 A;  2YI8 A;  3S9L A;  3I9S A;  4H6Z A;  1QR9 A;  2RN9 A;  2QWO B;  1NTK H;  4DO2 A;  2PUS A;  1SRY A;  4PEL A;  2NR5 A;  1W0K G;  1XHZ A;  3CCQ V;  5LMN B;  1PCA A;  1IXM A;  5AG2 A;  2Q51 A;  5K8N A;  2M6Y A;  2OCC B;  1OZP A;  1CP9 A;  4LFB O;  2FL4 A;  3SI0 A;  5I4M A;  2J9A A;  2B58 A;  3D7D A;  1HNW O;  5BMV A;  4ZY0 A;  3SI1 A;  2VL1 A;  1OCR C;  3FAV B;  2OWO A;  4X20 A;  3L70 H;  1NE9 A;  5KA5 A;  4ABM A;  4NXM B;  5H84 A;  3B09 A;  2FCK A;  2NNU A;  2DYR B;  3E22 B;  1IU8 A;  3SJF A;  3UT5 A;  1NVP D;  5B1A B;  2QIR A;  4OX9 B;  1RSO A;  1VQ5 V;  3M8A A;  4BMH A;  3NR7 A;  4DV5 O;  2PJ8 A;  4DV1 B;  2C6P A;  1HW7 A;  2QTO A;  3G67 A;  4ZKI A;  1Y74 B;  2R9A A;  4ZX8 A;  1TA8 A;  4I5S A;  2ZNI A;  4AQY B;  5LRK A;  1MNG A;  4QUS A;  2V8D A;  5H5N A;  4MVQ A;  3NE7 A;  1S76 D;  2Q8V A;  5ITZ B;  3BA9 A;  3CX5 F;  2P5O A;  4MFK A;  1GAX A;  4LFC O;  2VQE O;  1DTO A;  5LGT A;  1NS1 A;  2UUC B;  2PJ1 A;  3VQV A;  4KVM E;  2KSD A;  2EIM B;  1RXT A;  4P44 A;  3KG2 A;  1VHO A;  5KX5 B;  4LFA O;  3X2Q C;  3BI0 A;  3QAY A;  4FLW A;  5E79 Z;  5CB4 A;  3QNE A;  3P3P A;  1JVM A;  3SJQ C;  2P4K A;  2AFS A;  4IK2 A;  5LMU O;  4I49 A;  4K0K O;  3ZMV A;  4LF9 B;  1AYE A;  3D3S A;  2VRZ A;  4Q36 A;  5KHK A;  5B1B B;  3I56 V;  4GLX A;  1VQ4 V;  1R57 A;  2OB0 A;  2ZW5 A;  1PYT B;  2REE A;  3VQW A;  3H9V A;  1S7F A;  3FYI B;  2EJ7 A;  2JEX A;  5LP6 A;  5EBM C;  3CCM V;  2FVG A;  1NJI W;  2QWR B;  3ETD A;  1EM1 A;  4EME A;  3ZHT A;  4ONU A;  1XMO B;  1NTM H;  1MJA A;  1H2L A;  1Q90 D;  3TXQ A;  3CCJ V;  1YX0 A;  1EZJ A;  4RWU A;  4F0Y A;  2QVP A;  4EFE A;  4F4L A;  2VQF O;  1YTF B;  2EIK B;  2HHH B;  4HNX B;  2P4V A;  4NGN A;  4MS2 A;  4FLV A;  4X65 B;  2R9R B;  3SJX A;  3R9E A;  1QCE A;  4MFP A;  1XIL A;  3CXS A;  4TV8 A;  3ZN1 A;  4FLZ A;  4DV3 O;  3JAL B;  1ZG8 A;  2JRI A;  5C8Y B;  2EO8 A;  2P6F A;  3E0K A;  4MBU A;  2BCC H;  2DYS B;  1IUR A;  4DR2 O;  1RFY A;  3A9L A;  1GKF A;  3OTO O;  3H5Z A;  2CTR A;  5EZY B;  4NJR A;  5JQG A;  4ZI7 B;  2Z3K A;  2AFZ A;  1H8H G;  4B11 A;  3VOU A;  5JQ4 A;  2HVK C;  4J7Z A;  4F6E A;  2AZ0 A;  3QNV A;  4II9 A;  2FXF A;  4H13 B;  3LNN A;  2CTC A;  2IU0 A;  3B8M A;  3FBU A;  1GTO A;  2QTS A;  3CRQ A;  2WSS G;  3SDL A;  4PSW A;  1IBK B;  1AJP A;  3TOA A;  4CBC A;  2WA3 A;  3UO3 A;  3GLJ A;  2ADQ B;  4CS0 B;  2C6C A;  1QMU A;  1ZL8 A;  2ABZ A;  1XFO A;  3D8C A;  1XBL A;  2CE4 A;  3S3W A;  2R8V A;  4C2X A;  4QIW F;  3AG3 C;  4X66 O;  2ZM6 O;  2YSU B;  4FMT A;  3SXN A;  3FYE B;  2PR1 A;  1NI8 A;  1ZWI C;  4JD6 A;  1BL8 A;  4DR3 B;  2EIL C;  3CXC U;  1P7B A;  1SQV H;  2ADP A;  4LCU C;  4JAU A;  1NSL A;  1IYL A;  3CME V;  2J8M A;  3RW0 A;  2WUU A;  3F8K A;  5LHI A;  1YGH A;  2IU3 A;  2XT9 A;  4L87 A;  4DRX B;  4BIO A;  3EHB B;  4IHJ B;  4BIN A;  4M3S A;  3R95 A;  5A28 A;  4A33 A;  3K2K A;  1Z8X A;  3FVL A;  4C2Z A;  4H2K A;  2VBQ A;  2PRQ A;  3N27 A;  4KOX A;  1CJW A;  4AG7 A;  1S5L Z;  4C68 A;  3ZRS A;  1TVK B;  4OAD A;  3W6S A;  1FY7 A;  3JRU A;  4NYK A;  3ASO B;  3ZHU A;  4KOS A;  2V77 A;  2YGW A;  1CBX A;  4XPL A;  1N0J A;  2KKW A;  2LW1 A;  2WLN A;  1LR1 A;  5JWP A;  3HKE A;  1WNS A;  3RVZ A;  1EFR G;  2YND A;  2YS8 A;  1ELL P;  1D5N A;  1SQH A;  3S6H A;  3T90 A;  2BE3 A;  5HVH A;  3PB6 X;  4UVB A;  1BOB A;  4ASU G;  1VQ6 V;  3LNM B;  5J2T B;  3JAR A;  4JLY A;  4A30 A;  4JV5 B;  2RJZ A;  4X62 B;  3KL9 A;  4JYA O;  5GW7 A;  1Y76 B;  2J8N A;  5E96 A;  4NXN B;  4PDL A;  5F2V O;  2UU9 B;  3B2Y A;  4P6Y A;  5LOV A;  2F1M A;  1SF9 A;  2UUA B;  4MHP A;  4MY3 A;  2YXL A;  4DR5 O;  3TT2 A;  4H89 A;  2QJ1 A;  3DSQ A;  4ORF A;  2WLI B;  2L35 A;  4HBN A;  5ISV A;  2JJ2 G;  3HKD B;  4R3L A;  1R3N A;  1ZTE A;  4DJL A;  3LD2 A;  1K4J A;  2UXD O;  4CYO A;  4XNH C;  2UXX A;  4J7J A;  1CPX A;  1COW G;  4Y49 C;  1IIC A;  3SYO A;  4KLV A;  4BW9 A;  2JGU A;  1BT8 A;  2Q6A A;  4G27 B;  4X1I B;  3QF7 A;  3W7X A;  2WLJ A;  1YTF D;  4U9Z A;  2ZIM A;  1Y7R A;  1J5E O;  2FSR A;  1K8A W;  2ATR A;  5HXD A;  1YK3 A;  4P45 A;  2KG7 A;  2DWD C;  1MJB A;  3CDX A;  2EUL A;  1YVK A;  3T8W A;  2LFR A;  5FLX N;  5JJN B;  5KUM A;  3W91 A;  2X7R B;  1OZ0 A;  3D7G A;  1PNM A;  4KZT A;  4XDL A;  2MK3 A;  2EZP A;  1TF8 A;  2Q0Y A;  1V0C A;  2Z10 A;  1I5Y A;  4X64 O;  2C27 A;  4B3M B;  4P30 A;  3U0Z A;  2ZD9 A;  3UO2 A;  4PXC A;  4B6Z A;  1LUW A;  3JAT B;  2CNS A;  4TQD A;  2B5G B;  2PDO A;  1XNR B;  4UBR A;  1US6 A;  5KMG B;  1QBZ A;  3ZRW B;  1LUV A;  2Y4U A;  3APO A;  4DR6 O;  5D29 A;  4O4I A;  1NH2 B;  5CMU A;  1N36 B;  2OYQ A;  3ISX A;  3T4D A;  2VQY A;  3O65 A;  2F4V O;  4WJB A;  3HKB B;  2CGO A;  4UIA A;  4UWI A;  3BHP A;  4B3T O;  2IQ6 A;  3NFZ A;  1MSD A;  2DWE C;  3JAK B;  4J9Z B;  4DV0 O;  4X2T A;  1XQ8 A;  4MTX A;  2ZT9 B;  5DED A;  2LGW A;  4X1K B;  4HNA A;  4CZZ A;  3L71 H;  1VF5 B;  4MVR A;  3VH9 A;  3DR8 A;  5KTC A;  4NTW A;  5JCO A;  1JWQ A;  1URF A;  1KZF A;  1X59 A;  1QQ9 A;  3TO7 A;  3VQY A;  5IYZ B;  4DV2 B;  1XL6 A;  2REF A;  1KP3 A;  4EEQ A;  1QVF U;  5DM6 V;  2AJ6 A;  4I4T B;  4R57 A;  1M56 C;  1YIJ V;  4Q38 A;  3OGI B;  2PC1 A;  1NBM G;  5LMN O;  4CAW A;  2WYR A;  4CAV A;  2ETN A;  4N21 A;  4A37 A;  4RQF A;  3EFF K;  5GON A;  1HR0 B;  3FF3 A;  4DR7 O;  3SPI A;  4ZOL A;  4H44 B;  2QM7 A;  1TAE A;  5F47 A;  2JDI G;  2RMK B;  1WA8 A;  3S6K A;  1H2M A;  4QB9 A;  2HB6 A;  4CRZ B;  1YXB A;  1PD3 A;  3DR6 A;  1GK9 A;  1SQQ H;  1SQF A;  3SPJ A;  4MI4 A;  3FNC A;  3N2G A;  2RNB A;  4NXM O;  1KBH A;  5DEC A;  3C3T A;  3APQ A;  1IBL O;  2HVJ C;  3I1U A;  2PF4 E;  1BHB A;  1BPM A;  1IX9 A;  4I55 B;  3H8E A;  3ETE A;  5IX3 A;  3WR7 A;  3JAW B;  4OX9 O;  1AP5 A;  1AR4 A;  2ZEL A;  1K5S A;  4XBF A;  4OC5 A;  2B3U A;  3DDD A;  1ARO P;  3RAM A;  4JGS A;  2G3A A;  1SQB H;  2Q7G A;  5L3C A;  3K06 A;  1KP2 A;  2XEI A;  2AFM A;  4U3J A;  1EZV H;  3RYF A;  5ELY A;  4XPD C;  5EMI A;  4AQY O;  2B4D B;  5G20 A;  2Q7E A;  1CEZ A;  3TTH A;  3OUF A;  1HDU A;  5G1Z A;  3E8G A;  2AGA A;  1S3Z A;  1OCO B;  2JGD A;  4CH3 A;  2WZN A;  1H8E G;  3FH4 A;  2Q44 A;  4OLL A;  4O4H A;  3CCV V;  3B77 A;  2HQY A;  1OHH G;  2R72 A;  3OAA G;  5CPA A;  5LBQ A;  4M6I A;  2F43 G;  2OR4 A;  3OTF A;  3P2F A;  4EKW A;  1AMP A;  2Z5U A;  2P67 A;  2RQ6 A;  5B66 Z;  2JDD A;  5AG7 A;  1N71 A;  1M93 A;  3STZ C;  3FMC A;  3G6E V;  1XDC A;  1E1Q G;  4LF9 O;  4U3F H;  4YWY A;  5BY1 A;  4KSI A;  4R8F A;  2VWK A;  4EB6 B;  1VF7 A;  4ZY2 A;  1I94 O;  1RPR A;  1S7N A;  3STL C;  4LF6 B;  1K33 A;  1IBM O;  4MCR A;  4LF5 B;  4X8I A;  3HKC A;  4B5P B;  4DYO A;  1I08 A;  3EXN A;  3JAM N;  4H6U A;  3PB7 X;  2PCU A;  1VQ9 V;  1PPJ H;  2Q0O C;  2P7T C;  2QSA A;  2JIZ G;  4Z1M G;  5CA1 B;  1XMO O;  3CXP A;  3PB8 X;  4MHN A;  1OJH A;  4FFB A;  1PM9 A;  3D3I A;  2ZXW C;  4JI7 B;  2BTQ A;  3PJS K;  4G2K A;  2HHH O;  4F9U A;  1IZ3 A;  2YXY A;  5IJ0 B;  2H3O A;  4MVO A;  3U10 A;  4R50 A;  2IJK A;  2X6A A;  3F5T A;  1ON0 A;  4F0X A;  4PXE A;  4CGM A;  4EVY A;  1GN3 A;  1IB1 E;  4QVT A;  3IFX A;  1SA0 A;  3HR0 A;  3ML0 A;  5KTA A;  1R6N A;  4OPH A;  4TWK A;  4DV7 B;  4H0L B;  3WC6 A;  2IMO A;  4NF1 A;  3B3C A;  1F51 A;  2CTQ A;  2A7W A;  3UCS C;  4OXS A;  4AVA A;  3RYC A;  1YJN V;  1DGS A;  3B3S A;  5BMV B;  1L0N H;  1NR7 A;  2WLH A;  1RM1 C;  1R1B A;  5KTD A;  1M4D A;  3K9T A;  2FT0 A;  3ABK C;  2GTA A;  2N05 A;  3ABL C;  4X20 B;  3OMI B;  1DE4 C;  4QBJ A;  1IOI A;  3TE4 A;  1VQ8 V;  3AG2 C;  3TFY A;  3UT5 B;  2IW5 A;  2B1G A;  4CH5 A;  2L6L A;  3DC5 A;  1GHE A;  3KAS A;  2JEU A;  5EBW C;  1NH2 D;  2OU2 A;  3LSU A;  1Z2L A;  4Y49 B;  3K9A A;  2EIN B;  3SI2 A;  2ZR2 A;  1WPX A;  3L73 H;  3BJ8 A;  3E86 A;  2XUM A;  1I21 A;  4D7S A;  4P4B A;  3QB8 A;  3MGD A;  4DR3 O;  4H33 A;  4QPJ A;  2XTA A;  5KLV H;  4WBN A;  1Q2C A;  1EN4 A;  5CA0 A;  4DW0 A;  2ZEP A;  3D2P A;  5CN0 A;  3OFN G;  4J7K A;  4JAV A;  2GV9 A;  1N32 B;  2FYU H;  4U7N A;  2E74 B;  3CCE V;  2P22 C;  1YW4 A;  5DS0 A;  2IJH A;  4G28 B;  4IIJ A;  1U97 A;  5CB4 B;  4FM1 A;  3T1Y O;  3EC4 A;  3NH4 A;  4TNU A;  4AXV A;  2GDS A;  3PFE A;  4Q20 A;  4ZIB A;  1N4C A;  1KUY A;  3FEC A;  1FJG B;  1A2Z A;  4FD6 A;  4DUK A;  3DTU B;  2CUG A;  3AK2 A;  5B1O A;  4B12 A;  5IY5 B;  3FIX A;  1ZLH A;  3VWD A;  1U6M A;  1XRY A;  3SXO A;  2P0W A;  5JGF A;  1FNO A;  2HV2 A;  1NMT A;  4AB7 A;  3KI9 A;  1Z4R A;  1EN5 A;  5LP6 B;  5EIB D;  3G80 A;  1H2N A;  3WB2 A;  2Y0I A;  1ELM P;  4ZHQ A;  4MY0 A;  4E2L A;  4KXR A;  2QGN A;  1Z2G A;  1DTD A;  1W0J G;  1XOU A;  1UFH A;  3SPC A;  3JVN A;  3FRM A;  4FUU A;  4PK3 A;  2PE3 A;  2PYL A;  4C7H A;  3F5W C;  2J8R A;  1NT2 B;  4UF4 A;  4HNW B;  1EE3 P;  4JXR A;  1KC8 W;  1VQO V;  2AFX A;  2PY5 A;  1VEW A;  4TV8 B;  5JCO C;  3FX7 A;  1XMQ B;  2F95 B;  2GAN A;  2PIZ A;  3IJ3 A;  1QST A;  1Y7E A;  2W6I G;  1ZSP A;  1VP7 A;  6CPA A;  1YRE A;  1AB3 A;  4JV5 O;  4O4J A;  5JQG B;  4KOR A;  4X62 O;  3BLN A;  4HZ3 A;  5H9C A;  4DUZ B;  1V55 C;  3CJH B;  3NXS A;  1YHQ V;  2AFU A;  2ZEH A;  4RUE A;  4NXN O;  3ZRV A;  4JI1 B;  4B7K A;  1LAP A;  3CCS V;  2Z11 A;  3GVM A;  1I0H A;  5EBL C;  1JJ2 U;  1AR5 A;  2UU9 O;  4P4I A;  1FXK C;  2QWQ B;  1IID A;  3KHX A;  3UQ8 A;  2UUA O;  1YIT V;  4UEE A;  3VAT A;  3JSL A;  1R3I C;  2ZEO A;  2PRB A;  3FXT A;  3S3X A;  3OEH G;  3CRC A;  4DV4 B;  1JFF A;  5K1P A;  1HDJ A;  4GKK B;  4ZGY B;  4JYB A;  5LRJ A;  1ZL8 B;  3IO1 A;  3FFQ A;  4UFX A;  4YJ2 A;  3S6G A;  1VQP V;  3BXM A;  3ISZ A;  4CC5 A;  3CC4 V;  4QPK A;  1F23 A;  3TCV A;  4OC4 A;  3D67 A;  4WFB V;  1YEW A;  1D5A A;  4KFM A;  2XHB A;  3CC7 V;  5FVJ A;  2WPW A;  2GIV A;  2CF4 A;  1DF4 A;  1XMB A;  3SHP A;  1R6K A;  4FM0 A;  5HVG A;  3E35 A;  4DUY B;  3R96 A;  3P30 A;  3NE8 A;  4K3A A;  1B6B A;  4JAA A;  4FLT A;  1S77 D;  4AG9 A;  1HNZ B;  4GX0 A;  1KKC A;  1MMM A;  2QDO A;  1F2O A;  2GU2 A;  1Q2Y A;  3R66 A;  1MZF A;  4JI5 B;  4F6A A;  4X1Y A;  5HMN A;  4CS3 A;  3FJU A;  3OR6 C;  2QML A;  3B3V A;  1K4C C;  4MCS A;  1NQT A;  3AG7 A;  3K3W A;  1HWY A;  2E76 B;  3FB3 A;  3K04 A;  1M44 A;  2AW9 A;  3VBB A;  3WB0 A;  1NSA A;  5J1Q A;  2PJ2 A;  1VF6 C;  4FJC C;  4CAE A;  1VQ7 V;  3SJA C;  3V7Z A;  4PJ0 Z;  5DWN A;  2C6G A;  5LXT A;  1XJO A;  4M85 A;  2N74 A;  4PHZ A;  3G71 V;  3IFE A;  1YSJ A;  4GX1 A;  1Q7L A;  2IJZ A;  4UEZ A;  1FFX A;  2ZEG A;  3PGP A;  5B3S C;  2GBO A;  5CBH A;  1GM9 A;  1AVM A;  3OWC A;  2A3Q A;  2G3T A;  3ASN B;  2BEI A;  3HKE B;  3H1I H;  1KMI Z;  4J9Y B;  3ZCC A;  5GTI Z;  4OC2 A;  4NCZ A;  5LYL A;  3HLP A;  1IGB A;  2DN9 A;  3G8W A;  1SQG A;  2IH1 C;  4MHD A;  4MVS A;  4QE7 A;  4EFB A;  4NGS A;  3JAR B;  2ARH A;  4PV1 B;  2DPS A;  1MK4 A;  3CZX A;  3OE7 G;  1I5X A;  3T1H O;  1Z5W A;  2ZEF A;  1BZK A;  1WLE A;  3ABK B;  4RN7 A;  4JF3 A;  4CGL A;  8CPA A;  2LW7 A;  5CNP A;  4PQA A;  4UCM A;  1OCZ C;  4CGP A;  1R3J C;  1AJQ A;  5LOV B;  3AG2 B;  3ZMZ A;  1K7D A;  2FE7 A;  4YGO A;  1XOV A;  4WFG A;  2X6B A;  2CY2 A;  1WP8 A;  2ZNJ A;  3F7Y C;  1VIB A;  4B08 A;  5IWA B;  2Y0P A;  5IYD O;  4NTY A;  1XNQ O;  4HAM A;  4IT5 A;  3OEE G;  5IB0 A;  5K8M A;  4JAS A;  4MVZ A;  2B5U A;  1Q86 W;  3TO9 A;  4DR4 B;  4BWA A;  2DEA A;  1GN6 A;  3C26 A;  2Z0Z A;  3A0R A;  2V7Q G;  4A31 A;  1S5H C;  4WCE V;  2XEG A;  4IHM A;  2KG7 B;  3SJC C;  3JD3 A;  3JUW A;  2CAZ C;  3JTK A;  4O4L A;  4NGR A;  3N2K A;  5THW A;  1Y6X A;  4RO2 A;  3S9N A;  4JZ2 A;  2EK8 A;  1SER A;  2HUZ A;  1GN4 A;  4MJ8 A;  4OPA A;  3D3Q A;  2Q5Z A;  2Q9L A;  3R65 A;  4MCP A;  1JCH A;  4LWS A;  4Z2W A;  4YY3 B;  3OUS A;  3QO5 A;  1DLB A;  4UVC A;  3OT7 A;  2UXC O;  4LF8 O;  4UIB A;  3ABU A;  4MW8 A;  1AI7 A;  3BY6 A;  1QSR A;  3SYQ A;  2YNE A;  3DC6 A;  2DXQ A;  1WP7 A;  3CWB H;  1N34 O;  3B4S A;  4R6T A;  5H6Q A;  3ETQ A;  3PFO A;  5BR8 O;  1UPG A;  1R6T A;  3I3G A;  1CM0 A;  1MOF A;  4DV6 O;  1QLE C;  3GIU A;  1CPY A;  5KHG A;  1SKV A;  3H1J H;  4P9O A;  1YJW V;  2QYV A;  2XAH A;  4O4I B;  5JH7 A;  3BFR A;  4MVU A;  3RN4 A;  2PJ9 A;  5H6R A;  5C88 A;  2FML A;  4E8O A;  4PV6 A;  2AZ2 A;  5KHH A;  1FXH A;  3CCR V;  1ARL A;  1LNQ A;  2ZW6 A;  2F66 C;  4UFW A;  1AI5 A;  3SJG A;  4UUJ C;  5FPR A;  3K59 A;  4HNA B;  3P3N A;  3RT3 C;  2PJ4 A;  2KCW A;  3TC8 A;  3J81 N;  2CTP A;  1M57 C;  2WLL A;  1AI4 A;  1MJ9 A;  3QTC A;  1N8R W;  1TF9 A;  2PJ5 A;  4BIZ A;  4W4K A;  4MMO A;  1U96 A;  1RO5 A;  3P32 A;  3IAY A;  1YF2 A;  3THO A;  1N33 O;  4JWP A;  4J41 A;  2FIA A;  4A38 A;  2WPX A;  2F93 B;  4BD9 A;  5GON B;  1B06 A;  5EC2 C;  4TQF A;  1V55 B;  2UXN A;  4TUY A;  4ZOL B;  4WFE A;  4NJQ A;  1OCR B;  1QHT A;  2F23 A;  3BI1 A;  1WA8 B;  4BW5 A;  4DNC A;  1XF8 A;  2YXH A;  3OMN B;  1VKC A;  3LDD A;  3JAS A;  5K8P A;  4JYC A;  3N2G B;  1PU9 A;  4PXD A;  3L72 H;  3CRM A;  3P2H A;  2O4H A;  3IEH A;  3PN1 A;  4AVB A;  4B3S O;  1CG2 A;  2QKS A;  3E8F A;  2H8P C;  4DR1 B;  2JLM A;  1I12 A;  1TIQ A;  4KHP O;  3I5D A;  1KU9 A;  2QWN B;  4GX5 A;  3CP1 A;  3K5N A;  2C2A A;  3CEI A;  1HNW B;  3AK1 A;  1CP6 A;  1KUV A;  3R9F A;  4FIP C;  4I0X A;  3FED A;  2D4P A;  4U3J B;  1QSM A;  3RYF B;  4B10 A;  1YSC A;  4M6H A;  2CTB A;  2I79 A;  5L3E A;  3K0D A;  1Z9U A;  4A2Z A;  3M7M X;  3L2N A;  2JJ1 G;  5AGE A;  3RNZ A;  1EN6 A;  2GLJ A;  2QWP B;  3WFV A;  1JJO A;  3KKW A;  4KS9 A;  4ZBG A;  3E89 A;  1T5E A;  4FLX A;  4MFL A;  3VWE A;  1GYT A;  4PA4 A;  1D2D A;  4F8Z A;  2ZEM A;  4YJ3 A;  1IOF A;  2JGD B;  3X2Q B;  2Y48 A;  2V8G A;  4FD4 A;  2VS0 A;  4O4H B;  4C7I A;  4JI6 B;  1BPN A;  1PNK A;  3PEI A;  1ZO0 A;  3KHZ A;  2WA4 A;  4QNH B;  4JI4 B;  5A2Q N;  1E1R G;  1L8D A;  3B35 A;  1FJG O;  2B1I A;  3CS5 A;  4LFC B;  2OZH A;  3MN8 A;  1MZE A;  1WK4 A;  2V4D A;  4LNU A;  4XDK A;  3UKM A;  4JI8 B;  1KUQ A;  1H2K A;  1JQ0 A;  1B04 A;  4LFA B;  4P4E A;  3A0B Z;  3MD0 A;  3HKC B;  3BPZ A;  4E0A A;  4GYC B;  1OBR A;  2Z3M A;  1H38 A;  4QJF B;  4BR6 A;  2RC4 A;  2ITC C;  4K0K B;  3TOB A;  4RAI A;  2JEW A;  2EBO A;  4KVX A;  1Q8I A;  4FFB B;  3K9U A;  5AG4 A;  3SYP A;  2BTQ B;  1FAF A;  3LOD A;  3PZJ A;  3BRC A;  1P7G A;  4MXU A;  2XEF A;  1AP6 A;  1PP9 H;  4DK1 A;  1YI2 V;  1TVK A;  5KUK A;  4X3R A;  2DMX A;  3BAA A;  1WB7 A;  4A95 A;  2DPT A;  1ZG9 A;  1SA0 B;  1Q6I A;  3D68 A;  2BSW A;  1AI6 A;  2FTK A;  2VWJ A;  2Z3Y A;  1KYO F;  4FPP A;  2O57 A;  1KWM A;  3CCU V;  1OCC C;  2WLK A;  2ANP A;  2I3C A;  5B5E Z;  1VQM V;  5JJE B;  3ETG A;  2D3O W;  2VQF B;  3RYC B;  1BO4 A;  3GB7 C;  4D7T A;  3GYA A;  2NYQ A;  2W6J G;  2BOC C;  2Q0A A;  1ZLZ A;  4JI1 O;  1B6Q A;  1FXK A;  4O2B A;  4XDJ A;  4DV3 B;  1S7L A;  2CNM A;  1GM7 A;  4TSF G;  4LF4 B;  3D66 A;  1G1X B;  1Q6U A;  2Q67 A;  2X7B A;  4F6R A;  4MHY A;  4CYN A;  4MFJ A;  4DV4 O;  5AG5 A;  4X9Q A;  3H1H H;  4CYQ A;  2OCC C;  4GKK O;  1S3J A;  3HB3 B;  3G4S V;  3IC9 A;  3AG3 B;  4DV1 O;  2V8H A;  3O9O A;  3ZMS A;  1Y66 A;  4B5O A;  4A39 A;  4C2Y A;  3ZHR A;  3LSS A;  1HNX B;  4UV8 A;  4OC0 A;  3PRT A;  3T1C A;  3ZIA G;  1K73 W;  2EIL B;  5IYB O;  1Q43 A;  2RFH A;  2DYR C;  3D36 C;  3K5O A;  4P4J A;  5L3B A;  4I50 A;  2GRE A;  2OCH A;  4WBN B;  1Y0R A;  3ZRX A;  1P4N A;  5B1A C;  2UUC O;  3ZN0 A;  5CA0 B;  3CXH F;  5JVD A;  3S9M A;  1UFI A;  4U5Y A;  2BTO A;  1O9G A;  4X66 B;  2CNT A;  2ZM6 B;  1Y4M A;  2HG5 C;  4CGN A;  3FYN A;  4JI5 O;  1WWZ A;  1XEQ A;  4IIJ B;  4R3K A;  1HDQ A;  3SYC A;  4ZI6 A;  5EYP A;  4DYL A;  3DNS A;  4U9Y A;  4Z1V A;  1YLE A;  1I7F A;  3KCY A;  1AUG A;  4F9V A;  2HLD G;  1VF6 A;  3ABM C;  2EIJ C;  2QR4 A;  3KZW A;  3H8G A;  1QVG U;  2OZU A;  3CHX A;  2PQ8 A;  2EIM C;  1NU1 H;  1ENV A;  1QLE B;  1QNM A;  4O2A B;  1L0L H;  4YHH B;  4E2A A;  3K58 A;  3J7A U;  2LGQ A;  5L3D A;  4TV9 A;  2POK A;  5J2U A;  1YVW A;  3CXQ A;  3D4U A;  3IU1 A;  4LQ6 A;  2ILM A;  4ZHQ B;  5DN6 G;  5GTH Z;  2AHZ A;  4KUA A;  3B8G A;  1IYK A;  3SPG A;  1JOY A;  3S6F A;  3RYO A;  4NFR A;  2A0L A;  5B1B C;  1M4G A;  1KEC A;  1L0C A;  4KSF A;  1V9P A;  4I9Q A;  5A9G A;  3QAH A;  3CPX A;  3EXA A;  4X65 O;  1WJZ A;  3IWW A;  2DOS A;  2Q7B A;  5IJ9 A;  1WN7 A;  2E3C A;  3C90 A;  3JCZ A;  4UCP A;  4PDV A;  1XE4 A;  3FKS G;  2PI5 A;  3B3W A;  2YEV A;  5J8C A;  4DW1 A;  3KZI Z;  5HFM A;  4R6Z A;  4A32 A;  1E79 G;  4UXN A;  1ZUQ A;  3SGI A;  1TXR A;  2EIK C;  3IGA C;  2PJ6 A;  4JYW A;  3ABT A;  2ZKO A;  2Q4Z A;  3IGR A;  3IU2 A;  3KGQ A;  2LQT A;  4FM2 A;  5LRG A;  1AJN A;  5H86 A;  3CPA A;  1XMT A;  3UY5 A;  2GFQ A;  4KP4 A;  2DYS C;  1TUB A;  1IBK O;  1YZB A;  4MVM A;  1B3Q A;  1MSW D;  2CH7 A;  3LMS A;  4XNH B;  1RSO B;  1K97 A;  1ROP A;  4NTX A;  2OZG A;  4BAY A;  4LX9 A;  4RQE A;  4YJ2 B;  3CYO A;  2UXB B;  3MHH C;  2ZE8 A;  2PTM A;  1FD9 A;  3D7F A;  4CAF A;  5AG6 A;  3SPH A;  3N5F A;  1CXZ B;  4YRH A;  2WWW A;  4M6G A;  2ODM A;  4K30 A;  1FKA O;  3OM3 B;  2NMT A;  5FNV A;  2YUA A;  2XEJ A;  4DR5 B;  4AHC A;  2WLM A;  2LFS A;  5IB9 A;  2AE6 A;  2PJ7 A;  1LCP A;  1Y9K A;  1QR8 A;  2YID A;  1BCC H;  5IV0 A;  3OR7 C;  2YC0 A;  1KD1 W;  1UWY A;  2Q4V A;  4FD5 A;  3ICX A;  2Y69 C;  4PPZ A;  2OOT A;  1X10 A;  2R70 A;  1YR0 A;  3IC1 A;  1B87 A;  3IWG A;  2N04 A;  1SET A;  2G9D A;  4X1Y B;  2ZDI C;  5E1A C;  1YW6 A;  1IDS A;  3JD4 A;  5L3F A;  4YY3 O;  1J5E B;  2A9H A;  4UA3 A;  1Y67 A;  5GCN A;  3SJE A;  5BXZ A;  2GE3 A;  2ZCE A;  2JBJ A;  2LJ2 A;  4OID A;  4TWE A;  2IL4 A;  2R9I A;  1L1F A;  1YQE A;  4MHZ A;  2GUZ A;  1JMK C;  5KA6 A;  3OW2 U;  1XRE A;  2D2C B;  3K5L A;  2ZED A;  3W7T A;  1LAN A;  1Q82 W;  1S72 V;  2CDY A;  5LXT B;  4UWJ A;  5HFL A;  1DK1 A;  1FFX B;  3CT9 A;  3PP9 A;  2G0B A;  4OC1 A;  4IYI A;  4FFK A;  3ZMT A;  4K8X A;  4FLY A;  4UCT A;  1Z5R A;  3ZHV A;  1N0N A;  1X12 A;  3BA8 A; 
#chains in the Genus database with same CATH homology
 4JJX A;  4UCM A;  4KOU A;  4U9Z A;  2YNC C;  4X5K A;  4CGP A;  1Y7R A;  2FSR A;  4KUB A;  2ATR A;  2QEC A;  2FE7 A;  4YGO A;  4FD7 A;  1YK3 A;  2Q4Y A;  2F5I A;  1MJB A;  3G3S A;  2CY2 A;  4RI1 A;  2B5G A;  1YVK A;  4J3G A;  3EO4 A;  3W91 A;  2CXA A;  5EBV A;  3V8I A;  2Z3P A;  5IB0 A;  5G21 A;  4KZT A;  3F0A A;  2Q0Y A;  1V0C A;  2Z10 A;  3TO9 A;  5J8F A;  4UFV A;  2C27 A;  3C26 A;  2Z0Z A;  4A31 A;  4CYP A;  2CNS A;  3JTK A;  3JUW A;  2B5G B;  2PDO A;  4UBR A;  5DWM A;  2HUZ A;  4MJ8 A;  4XPD B;  2ZPA A;  3D2M A;  4AVC A;  3D8P A;  1M1D A;  2R1I A;  2VQY A;  4PK2 A;  3ZZI A;  4IUS A;  4HNY B;  4UWI A;  1QSR A;  2Z3L A;  1YVO A;  2YNE A;  2DXQ A;  3DR8 A;  5KTC A;  1KZF A;  3I3G A;  3EFA A;  1CM0 A;  3TO7 A;  1S7K A;  2REF A;  1P0H A;  1M4I A;  4MFZ A;  2AJ6 A;  4R57 A;  2Y0M A;  5C88 A;  4Q38 A;  2PC1 A;  4CAW A;  4E8O A;  2OH1 A;  3EY5 A;  4CAV A;  4PV6 A;  2ZW6 A;  4UFW A;  4YFJ A;  5F47 A;  4KOT A;  4KOY A;  3S6K A;  4QB9 A;  2KCW A;  4HKF A;  4CRZ B;  1MJ9 A;  3DR6 A;  2H5M A;  4R9M A;  4BBH A;  2PSW A;  2B4D A;  4MI4 A;  1RO5 A;  3FNC A;  4JWP A;  4R87 A;  2FIA A;  2WPX A;  3GKR A;  5IX3 A;  3WR7 A;  2P6E A;  2B3U A;  3DDD A;  4DNC A;  2G3A A;  1XF8 A;  1VKC A;  2D4O A;  4XPD C;  2B4D B;  2VEZ A;  1PU9 A;  5G20 A;  4B14 A;  3TTH A;  4GS4 A;  3P2H A;  2PR8 A;  4AVB A;  3R9G A;  5G1Z A;  2JLM A;  3DSB A;  1I12 A;  1S3Z A;  1TIQ A;  3T9Y A;  4KVO E;  4UCN A;  4KLW A;  2Q44 A;  4L8A A;  4OLL A;  1KUV A;  2HQY A;  3R9F A;  4B5P A;  4L89 A;  2BUE A;  2D4P A;  1QSN A;  1QSM A;  3N7Z A;  1Q2D A;  4B10 A;  4CGO A;  4A2Z A;  2I79 A;  1Z9U A;  3P2F A;  2WSA A;  5G22 A;  2JDD A;  5AG7 A;  5AGE A;  1N71 A;  3KKW A;  4KS9 A;  4ZBG A;  4MFL A;  3VWE A;  4NEX A;  5JPH A;  5BWA B;  1S7N A;  4KOW A;  2ZW4 A;  3GY9 A;  3I9S A;  2R98 A;  4H6Z A;  4FD4 A;  4C7I A;  4B5P B;  1LRZ A;  3H4Q A;  1ZO0 A;  3EXN A;  4H6U A;  1VHS A;  3CXP A;  2OZH A;  1OZP A;  1Y9W A;  1WK4 A;  2FL4 A;  2JDC A;  5EC4 A;  2B58 A;  1ON0 A;  4F0X A;  4EVY A;  4CGM A;  1IB1 E;  1NE9 A;  4QVT A;  4E0A A;  5H84 A;  5KTA A;  2B3V A;  2FCK A;  2Z3M A;  2RC4 A;  4NF1 A;  4MFQ A;  3TOB A;  2QIR A;  4KVX A;  3K9U A;  4AVA A;  5AG4 A;  3LOD A;  4BMH A;  3PZJ A;  2VI7 A;  2FS5 A;  5KTD A;  1M4D A;  2FT0 A;  2YNC A;  2ZXV A;  4A95 A;  4QUS A;  2DPT A;  3NE7 A;  2BSW A;  4QBJ A;  3TO6 A;  3TE4 A;  4MFK A;  4CRY B;  3TFY A;  4CAX A;  1GHE A;  4KVM E;  2OU2 A;  4Y49 B;  1BO4 A;  1RXT A;  3GYA A;  4IF5 A;  3BJ8 A;  1I21 A;  2I00 A;  2CNM A;  1S7L A;  3ZJ0 A;  4QC6 A;  2Z3N A;  2X7B A;  3QB8 A;  3MGD A;  1PUA A;  4CYN A;  4I49 A;  4MFJ A;  3D3S A;  1Q2C A;  3F5B A;  5AG5 A;  4Q36 A;  4CYQ A;  1R57 A;  2OB0 A;  2ZW5 A;  3D2P A;  2REE A;  1XIX A;  1S7F A;  4B5O A;  4C2Y A;  4RS2 A;  3EC4 A;  1KUY A;  4ONU A;  4FD6 A;  1MJA A;  2BL1 A;  1YX0 A;  4B12 A;  3FIX A;  4F0Y A;  1P4N A;  3VWD A;  1U6M A;  3SXO A;  4HNX B;  2P0W A;  4U5Y A;  2HV2 A;  2CNT A;  1NMT A;  4AB7 A;  3R9E A;  1Z4R A;  4MFP A;  4CGN A;  3CXS A;  3FYN A;  1WWZ A;  4R3K A;  3E0K A;  4MBU A;  2P6F A;  3DNS A;  3A9L A;  4U9Y A;  4MY0 A;  3H5Z A;  4KOV A;  1YLE A;  1UFH A;  3JVN A;  4PK3 A;  3FRM A;  2Z3K A;  4XPK A;  4C7H A;  2J8R A;  4B11 A;  2K5T A;  5JQ4 A;  2VZZ A;  2Z3O A;  4HNW B;  1S60 A;  4JXR A;  2A4N A;  2OZU A;  4II9 A;  2PQ8 A;  2FXF A;  2P6G A;  4PSX A;  3FBU A;  4E2A A;  2GAN A;  3CXQ A;  4PSW A;  3IU1 A;  1QST A;  2JEV A;  3TOA A;  2VXK A;  4KUA A;  3B8G A;  1YRE A;  4CS0 B;  1IYK A;  4KOR A;  3S6F A;  1S5K A;  4KSA A;  4NSQ A;  2VZY A;  3BLN A;  3RYO A;  5F49 A;  1M4G A;  4KSF A;  1L0C A;  2R8V A;  4C2X A;  3R1K A;  3QAH A;  4OAE A;  4JXQ A;  2Z11 A;  1KUX A;  1I1D A;  2Q7B A;  3SXN A;  2PR1 A;  1IID A;  4UCP A;  4JD6 A;  1XE4 A;  2B4B A;  2PRB A;  3FXT A;  5J8C A;  4A32 A;  4ZGY B;  1XEB A;  4UFX A;  1NSL A;  1IYL A;  3IWE A;  5C82 A;  2J8M A;  3S6G A;  2WUU A;  3F8K A;  1YGH A;  3IGR A;  3IU2 A;  3TCV A;  4M3S A;  3R95 A;  2ZW7 A;  5A28 A;  5H86 A;  5FVJ A;  1XMT A;  2WPW A;  2GIV A;  3SHP A;  3UY5 A;  4A33 A;  3R96 A;  4C2Z A;  2VBQ A;  1B6B A;  4XNH B;  4KOX A;  1CJW A;  4AG7 A;  4AG9 A;  2OZG A;  4LX9 A;  4C68 A;  1Q2Y A;  4OAD A;  3W6S A;  4CAF A;  1FY7 A;  5AG6 A;  4F6A A;  4YRH A;  5HMN A;  4K30 A;  2NMT A;  2QML A;  4KOS A;  2YGW A;  5HH1 A;  1QSO A;  4XPL A;  2EUI A;  2O28 A;  4LUA A;  2AE6 A;  1J4J A;  3FB3 A;  1Y9K A;  1M44 A;  4B13 A;  5IV0 A;  2YND A;  4CAE A;  2Q4V A;  4FD5 A;  5A27 A;  1YR0 A;  1B87 A;  1SQH A;  3IWG A;  5DWN A;  4M85 A;  3S6H A;  3T90 A;  3PGP A;  4UA3 A;  1BOB A;  5GCN A;  2FIW A;  2GE3 A;  4JLY A;  2IL4 A;  3OWC A;  4A30 A;  2G3T A;  3BJ7 A;  2BEI A;  2EVN A;  5I0C A;  2Q04 A;  4NCZ A;  2J8N A;  5E96 A;  5F46 A;  3G8W A;  4MHD A;  4UWJ A;  2R7H A;  4MY3 A;  3PP9 A;  3TT2 A;  2G0B A;  4H89 A;  4ORF A;  2ARH A;  2DPS A;  3W6X A;  5ISV A;  4R3L A;  1MK4 A;  3LD2 A;  1K4J A;  4CYO A;  4XNH C;  4Y49 C;  1IIC A;  4NXY A;  4CGL A;  1Z4E A;  5F48 A;  4KLV A;  5CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...