2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
b'DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein aq_1966
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
3TT2A 1S7LA 1IYKA 3EFAA 1B6BA 1Q2DA 1YREA 4AVAA 4R3LA 2REEA 4M85A 5F48A 1YGHA 2Z10A 4DNCA 2JDDA 4XPKA 3FXTA 4H89A 1WWZA 2Z0ZA 5IV0A 2B4DB 4KOVA 4AG9A 3G3SA 4M3SA 5C82A 1YVKA 1B87A 2WPXA 3DR8A 2AJ6A 4H6ZA 4CAWA 1Y9WA 1XEBA 2PSWA 3DR6A 1FY7A 4OADA 2VQYA 4E2AA 3TO9A 1PUAA 3SHPA 2A4NA 2BUEA 4K30A 2B5GB 3D2PA 1MJBA 2B5GA 3VWDA 2ZW4A 5FVJA 1TIQA 2GIVA 4JXRA 2O28A 2FE7A 1YK3A 2JEVA 4UA3A 3GKRA 4KOXA 4CRYB 4KZTA 1MJAA 2HV2A 2OZHA 2PRBA 4KOWA 4JXQA 3H4QA 4LUAA 2WPWA 3G8WA 5F47A 2PQ8A 3VWEA 4QC6A 3D8PA 2FIWA 4NCZA 4FD5A 2OU2A 3PZJA 4MY3A 4XPDB 1Z4EA 3LD2A 2FCKA 3BJ8A 1Q2CA 1MJ9A 1Y9KA 2IL4A 1GHEA 2R98A 1CM0A 4R57A 4KLWA 1K4JA 4HNWB 4YFJA 2PR1A 2REFA 3TFYA 4PSXA 4KVXA 3P2FA 2ZPAA 4XPDC 3GYAA 4F0YA 1IB1E 2AE6A 1S60A 3T9YA 1S7KA 3N7ZA 5DWMA 2ZXVA 3TOBA 4ZBGA 2Q0YA 3EY5A 3FBUA 4CAXA 5H86A 3R9FA 2R7HA 2G3AA 4GS4A 2R1IA 4NF1A 2PDOA 1IIDA 2HQYA 5C88A 3EXNA 2I00A 3W6XA 4RS2A 4JD6A 3W6SA 3FRMA 4MBUA 5I0CA 2QMLA 3MGDA 2CNTA 1VHSA 2GANA 2Q4YA 3UY5A 2P6FA 1QSNA 2P6GA 4PV6A 3V8IA 4BMHA 5H84A 2Y0MA 4CAVA 2FXFA 2JLMA 1CJWA 1KUVA 3PGPA 3W91A 4IF5A 1I12A 4L8AA 2B4BA 4UBRA 4R9MA 2Q44A 4I49A 3R9GA 1Z4RA 2VI7A 5EBVA 3IGRA 2B58A 3QB8A 2CNSA 3FB3A 3DDDA 1BOBA 2JDCA 4B5OA 5CNPA 3F0AA 3CXPA 3B8GA 1LRZA 1M44A 1I21A 1M4GA 2VBQA 4II9A 1YLEA 4KOTA 2BEIA 4FD6A 4CRZB 2B3VA 4E8OA 4KVOE 1XMTA 4UWIA 5F49A 4CS0B 1NSLA 3BLNA 3RYOA 4KOYA 3TOAA 3PP9A 1RXTA 2F5IA 5IB0A 2OZGA 4MY0A 3NE7A 4UWJA 3TCVA 2J8RA 1S7FA 5E96A 2GE3A 4KUBA 3R95A 2FL4A 2PR8A 1NE9A 1VKCA 3ZJ0A 2VEZA 2G0BA 2H5MA 2D4PA 4NEXA 4HNYB 1MK4A 2EVNA 2CY2A 3DSBA 5F46A 4X5KA 1QSOA 1IYLA 4L89A 3CXQA 4EVYA 1M4DA 2Q4VA 4KVME 1XF8A 1SQHA 4YGOA 3KKWA 1L0CA 1WK4A 4KUAA 2PC1A 3TO7A 1NMTA 4FD7A 1QSRA 4RI1A 1UFHA 3R96A 4HNXB 5JPHA 3ZZIA 1S7NA 4E0AA 4NXYA 5GCNA 4MJ8A 3QAHA 4J3GA 5JQ4A 4PK3A 4XNHB 4U5YA 4HKFA 1QSTA 3S6KA 5ISVA 1P0HA 1BO4A 1OZPA 4QBJA 4JJXA 1KZFA 3E0KA 1KUYA 4XNHC 3R9EA 1N71A 2FS5A 1U6MA 2VXKA 3I9SA 3EC4A 3S6HA 1QSMA 3SXOA 5KTCA 4R87A 3FIXA 2FSRA 1P4NA 1R57A 1S5KA 3TTHA 1YR0A 2QECA 2J8NA 4H6UA 3I3GA 3SXNA 4JLYA 5KTDA 3IWGA 5KTAA 5J8FA 4B5PB 1YX0A 4AVCA 4B5PA 2B4DA 1IICA 2QIRA 4LX9A 2OB0A 3CXSA 1J4JA 5DWNA 4OLLA 2D4OA 2K5TA 2J8MA 4ORFA 1Y7RA 1M4IA 2ATRA 4AG7A 3JUWA 4PK2A 3GY9A 4AVBA 2G3TA 4Y49B 4QUSA 4KOSA 2I79A 1ON0A 2FIAA 3OWCA 4YRHA 3TO6A 2EUIA 2BSWA 3DNSA 4QB9A 1M1DA 4Y49C 3S6FA 3WR7A 2CNMA 1Q2YA 2VZYA 2ZW7A 1PU9A 2OH1A 3T90A 3D2MA 2ARHA 5EC4A 4NSQA 3D3SA 2P0WA 4IUSA 1I1DA 4XPLA 2B3UA 4PSWA 2OZUA 1XE4A 3P2HA 5J8CA 2Q04A 3S6GA 1Z9UA 1S3ZA 2C27A 2X7BA 4AB7A 3LODA 4OAEA 2ZW5A 4QVTA 4MHDA 3C26A 3F5BA 2KCWA 3FNCA 3FYNA 4ONUA 2R8VA 4MI4A 1XIXA 2NMTA 2FT0A 4KLVA 3JVNA 5IX3A 4F6AA 3EO4A 1YVOA 4R3KA 4KORA 5HMNA 4U9ZA 1KUXA 3F8KA 2DXQA 3BJ7A 4JWPA 2HUZA 4KOUA 1RO5A 2VZZA 2Z11A 2P6EA 3R1KA 2RC4A 2ZW6A 5HH1A 2BL1A 3K9UA 3TE4A 4FD4A 4U9YA 1V0CA 2Q7BA
chains in the Genus database with same CATH superfamily
1S7LA 5IE9A 3E22B 1NBMG 2DPSA 4LF4O 3ZJZA 1QHTA 1TA8A 4OC5A 4R3LA 2REEA 2VQEO 2Z10A 5CBGA 4DNCA 1FXKA 3A8TA 3K58A 1X12A 4H89A 1WWZA 5LMUB 3HKBA 4UUJC 3AK1A 3AG1C 2XEIA 4R76A 4KOVA 1N34O 3OW2U 4M3SA 4XDJA 2ZEPA 1L0LH 1Z8XA 3VOUA 1B87A 4D7TA 4GCZA 4RO2A 2CH7A 4H6ZA 2X6AA 4HNAA 2AHYA 4UFZA 4GLXA 2JK5C 2P5OA 2CK3G 1IXBA 1Z2GA 1FY7A 2C2AA 4OADA 3BI1A 5IYCO 2VQYA 4E2AA 3I55V 1TF8A 2PY5A 3SHPA 4CGMA 1W0KG 4PDMA 1SQFA 4UEZA 1S76D 1N32B 4MCSA 4QPKA 4UCUA 1IBKB 4FFKA 4DR1O 2AZ2A 3DSQA 3DLJA 4JXRA 5CN0A 4CAEA 4DRXA 3ZRWB 4DR2O 4K3AA 5LOVB 2JEVA 4OPHA 4WWVA 4AILC 2ZIMA 4KSFA 1Z5RA 3GKRA 4CRYB 4KZTA 1MJAA 2EK8A 3KQZA 1OCOB 1K7DA 4X8IA 5CA0B 3VATA 1D5AA 4P9PA 1CP6A 3K5NA 3KGQA 5JVDA 4JXQA 4LUAA 2WPWA 4F0XA 3ASOB 2PQ8A 4IL6Z 2HC9A 1MZEA 1JJOA 1XL4A 1UPGA 1YEWA 1BPMA 2V8GA 4NVPA 3B3CA 4OMEA 4LF5O 3TXQA 3ZN0A 4AQYB 1MSWD 4JYAB 1K4CC 2WUUA 3BJ8A 1TVKB 3K0GA 2JS5A 1F7YA 1MA1A 1CM0A 3F5TA 1DF5A 4LWSB 4YFJA 4J11A 2PR1A 2QM8A 2X6BA 3TFYA 1KB9F 1Y7EA 3D67A 2EO8A 3GB7C 3CCQV 2Z5UA 4F0YA 1TF9A 5EIBD 4K0KO 1LUWA 1JVMA 1HDQA 3K59A 1ZO0A 2C6CA 2AE6A 2WPDG 2JDIG 2Y4TA 4HAMA 1Q82W 1S7KA 5JGFA 3N7ZA 3UO3A 3GIUA 2Q0YA 2ZENA 4JI3B 1YI2V 4JI8B 5KMGB 4P4JA 5H86A 2G3AA 3RYIA 2IM9A 4F6EA 1N0JA 2PDOA 1YJ9V 1WPXA 3CPAA 3L71H 4QIWF 4DV0B 2V8HA 3CMAV 2IBZH 4RS2A 1LNQA 4XDLA 4JD6A 3FB5C 3B09A 2PIYA 2KKWA 4DV6O 3CC4V 5I0CA 4XDKA 2Z3NA 2XUMA 4UFWA 2ZELA 4LF7B 3KI9A 3F7YC 4MCPA 1VHSA 4DXWA 5TISZ 5KUKA 4R6ZA 3E2EA 5EK0A 3BA9A 4DV2O 1FJGO 1V54B 4G28B 2LO1A 1E1RG 1K8AW 1UWYA 1V55C 3JALA 3PB6X 3CCUV 3H8EA 3K03A 4JTDB 4IGGA 3HKBB 1E1QG 1CJWA 2POKA 4CGNA 1KUVA 1Z8TA 1AJNA 3DC6A 2UUBB 4G27B 4PA3A 1QU7A 4J10A 2Q44A 4J41A 3BA8A 3RFRA 2CH7B 1HWYA 2F23A 3ABUA 2VI7A 5LP6C 4BINA 3RO0A 5EBWC 3IGRA 1GRJA 2RQ6A 2CNSA 1XI1A 5LXTB 1FPOA 2WLHA 1BOBA 2ZEGA 4UFVA 4UF4A 4MFJA 4B5OA 3JRUA 5CNPA 3ML0A 4FVMA 2FMLA 4U3JA 2WAMA 3QTCA 3CXPA 3B8GA 4GX0A 2JBKA 4IYIA 1YTFB 2ZE7A 1WN7A 3CWBH 4DRXB 1VF6A 1XFOA 2VBQA 2UXXA 1RM1C 5LYFA 3FX7A 1K92A 4II9A 4EFBA 4MHYA 1TUEB 2JS3A 4CRZB 1Z8LA 2WLLB 2CAZC 2CDYA 4GZRB 4F4LA 1XMTA 4CS0B 2RMKB 4CS3A 5IJ0A 3TOAA 2RNBA 4FUUA 1U96A 2F5IA 5CPAA 4ZOLA 4J80A 3BHXA 1ORQC 3NE7A 5D5QA 1K97A 3AK2A 4DR6B 3B3SA 5B3SC 3CEIA 3B2EE 2QA4V 5GONB 3L2NA 1VKCA 3T8WA 1GM9A 3OD4A 4PQAA 4ZI7A 3ZJ0A 2JEXA 2OCCC 3BABA 4NKGB 4TUYA 2VEZA 4P4FA 4BD9A 2IJIA 2H5MA 4JI5O 4ZHQB 2ZEOA 4PA6A 3VQWA 4DV7O 4LF8B 4TNUA 4IIJA 1GAXA 1JQ0A 1WAZA 1YIJV 2YIDA 1QSOA 3K5LA 2Y0PA 2EIKB 1PCAA 5IDJA 1L8DA 2AGAA 2BE3A 4PHZA 4TV9A 5L3BA 2AFOA 1YDXA 3KKWA 1ZSPA 4L8JA 5BXZA 5J2UB 3B77A 3ZEDA 3BEHA 4G2KA 4KUAA 1AR4A 1EN6A 2IMOA 4DR5O 4DW1A 2PC1A 4UV9A 2QM7A 5KAFZ 2RB7A 2Z3MA 2DWDC 4RUHA 2OWOA 1UFHA 4YJ2B 5CA1B 4LNUA 4MJ8A 3ABMC 4JI4B 3QAHA 4FM2A 1F51A 4FM1A 3G80A 2JBJA 4R8FA 4XNHB 1RPRA 3M99B 4U5YA 5C93A 3N2KA 4CS4A 1EZVH 4OC3A 4UV8A 2V77A 2WZNA 4MTXA 2LW1A 2QWPB 1BO4A 1P0HA 3ABLC 2ITDC 2G9DA 4DO2A 2GDSA 3W7TA 4LR3A 4JJXA 3E0KA 5L3CA 1KUYA 5ITZB 1N33O 2WWWA 3BFRA 1XRYA 4FZ0A 2FS5A 2CIJA 1XMQO 1W2BU 4KFMA 2O53A 2VXKA 2YXYA 2Q0AA 3X2QB 4LF9O 4FLXA 2DYSC 3LDEA 3WB0A 4PA7A 1P4NA 1S5KA 1JA8A 3BAAA 2B9ZA 3SPIA 4DV3B 1PNLA 4B7EA 2J8NA 4H6UA 1K73W 3SXNA 4JLYA 2Q43A 1IVSA 1YTFD 2GSMB 4B5PB 1YX0A 4GX2A 4D7SA 2P7TC 3ABTA 2QIRA 4LX9A 2HJFC 1S0VA 3CXSA 5FPOA 2QWOB 1Y7RA 4I4TA 4MTOA 3PB8X 2PJ4A 3QNVA 1S77D 2BOCC 1VQ6V 5IJ0B 2F4VB 1E79G 4MFLA 3JCUZ 2IJHA 4B3MB 1U97A 2YI8A 1VQ8V 4QE9A 2YXHA 5JQGA 2D3OW 3LWUA 3ZRSA 4AVBA 5THWA 1IBLO 2IH3C 3FB8C 3ASNB 2WLJA 3JD2A 3MHHC 4X8AA 2I79A 4I55A 4OIWA 4M6GA 3VH9A 1CPXA 2ZOFA 4KHPO 2QR4A 3CDXA 4IYHA 2OOTA 2BSWA 4QB9A 1NU1H 4CYQA 1I94O 2PJ1A 4X62B 4Y49C 3KHZA 1IOFA 2BSKA 4PI0A 3SYOA 3IC9A 3RBZA 4A2ZA 1PPJH 2ZW7A 1FKAO 1YSCA 3MRUA 1GK9A 4B3SB 3D36C 2OH1A 3LACA 4CAFA 4P4EA 2LGQA 2ARHA 1A32A 2XAQA 3UKMA 1IBKO 4U7OA 3CCVV 2OYQA 3B3TA 3SJCC 1KQSU 2QTSA 5J8CA 1O9HA 3S6GA 3PN1A 3ZMTA 3L72H 1SC5B 2C27A 4X1YB 1KP2A 2ZEEA 5K8NA 2XOKG 4EWTA 1FFTB 2YEVA 1A2ZA 1Z8WA 1QMUA 1AP6A 1Z5WA 2A79B 1XJOA 2PJ9A 3MN8A 3WABA 3Q4HA 3C26A 3PB9X 3D68A 2KCWA 1BS3A 2YXLA 3TC8A 3PB7X 1SZTA 2JIZG 4X65B 4ONUA 2WLIA 1XIXA 2NMTA 2K9PA 3H1JH 3SYQA 4GYCB 3KCYA 4JYAO 1YQEA 3PFEA 4GUNA 1BL8A 1QLEC 2C1CA 3D3QA 4U9ZA 5HMNA 4I7ZB 1LAPA 4FFBA 4B6ZA 2HUZA 4GKKB 1RO5A 2VZZA 1KUQA 4PD4F 4IK2A 1TKFA 2P6EA 2QWNB 1EZJA 3U10A 3RYFB 2DMXA 3CC2V 4ICGA 3KHXA 2UUAB 2CE4A 3B40A 4P6YA 2DYRB 1Y0YA 4ZKIA 4FD4A 1R6TA 4YY3B 4FWUA 3TT2A 1ZL8A 3I1UA 1AYEA 1IYKA 4X1IB 3E22A 4NGQA 3RVZA 3BRCA 3TCUA 3UT5A 2QWRB 1VEWA 4JPRA 4B3TB 4M85A 5F48A 1YGHA 4BIOA 3HKDB 4JZ2A 2Z3OA 3S9MA 3C3SA 3FECA 3WT4A 4RUEA 3CZXA 4G1PA 1Q6HA 3KL9A 2A9HA 5B1AB 3B2YA 4CH3A 3V7ZA 3P30A 5C82A 3ZRVA 4P4BA 4ZX8A 1SS3A 2AJ6A 1FXKC 4QE7A 1B06A 4I4TB 1Y9WA 2PSWA 2QJ8A 3JASB 4LF6B 3CPXA 1TKHA 3EXAA 3VARA 1XDCA 1WPBA 1Q3EA 3H1IH 3MAQA 1PUAA 1NSAA 4K30A 2B5GB 3D2PA 1JR9A 3FH4A 4FLWA 5JQGB 1VQLV 1TIQA 2QKAA 2DWEC 3EHBB 5AG4A 2O28A 3S3XA 2F43G 2X7RB 3ZRWA 5LOVA 4M6HA 3L9DA 1YITV 5EZYB 3FKSG 1AUGA 5JCOA 5L3EA 3PBEA 2Z3YA 4I5SA 2ZXWC 3OEHG 4RQFA 2V8DA 2KG7B 2BSKB 1ZAUA 2CXAA 3FJUA 3VWEA 2XAHA 5HVFA 5F47A 3LDCA 1M57C 2FIWA 2ODMA 4NCZA 3OFNG 2OU2A 1XMOO 3L75H 2IU0A 3FAVB 2ZD9A 1IOIA 3BHPA 2HHHO 1Q6UA 1H8EG 2FCKA 3W7XA 2GLJA 1Q2CA 3T1HB 5DECA 1IBMB 1S72V 3BY6A 1OCZB 4NTWA 2ZEHA 4R57A 1XMBA 4KLWA 4MCQA 1QBZA 1YVWA 4HNWB 2HVKC 4LWSA 4UVCA 4FMTA 4Z2WA 2GREA 1XILA 3J7AU 4XPDC 1HNXO 4B13A 3SJFA 2NN4A 3IFXA 4UVBA 1TKJA 1CBXA 2P4KA 4JF3A 2WLIB 4J7KA 5CBHA 1SA0A 4J9ZB 1J5EO 2ZXVA 1H38A 4DR6O 4WF9V 4BR6A 3FBUA 4CAXA 2XEJA 1XL6A 3R9FA 1PNMA 2EILB 1QQCA 2W6JG 1NQTA 4FJCC 5KMGA 5LYIA 2Y69B 4NF1A 5EC2C 4D6TH 1AI6A 3BI0A 1KP3A 3H5ZA 2JJ2G 3O65A 4MHPA 5LMNB 1CG2A 1X4TA 3FRMA 4DV1B 3RZAA 4NR1A 2QMLA 4JI2B 4OX9B 1WB8A 2LGWA 4Q6GA 2ZDIA 1H2SB 4OIDA 3SYPA 3UT5B 3T1YO 3CB2A 4HPSA 4NJRA 1SF9A 5J2TB 3FMCA 2JRIA 4PDRA 2WYRA 1K9MW 5K8PA 1QSNA 4PV6A 4GM5A 4Q36A 3NFZA 2PI4A 1FXVA 4BIUA 4MVOA 4WFGA 4NJQA 3OTFA 2EZPA 4OC2A 4GKJB 2FXFA 2UXDO 1M56C 1OCCB 4DR4B 2V7QG 5EYPB 1I12A 5J1QA 2B4BA 4NGPA 3G6BA 4R9MA 2F7VA 5H2FZ 1S3JA 1I5YA 4JI4O 3ZCCA 2BTQB 3R9GA 5H9CA 2XASA 1K5SA 4K3NA 1CPYA 3CP1A 4TOIA 4JV5O 1QR9A 4A5UB 2QKSA 3DDDA 1SQGA 4K8ZA 2JDCA 5LXTA 4TWKA 1YSJA 5G20A 4MVQA 1LRZA 4OXSA 2DW4A 3FB7C 3K3WA 2Q4ZA 3JAMN 1BGYH 1M4GA 4CZZA 1PYTB 3PB4X 1VGYA 3OT7A 2B3VA 2RCVA 4X88A 2WLLA 4ZY2A 2GU2A 1FFXA 2ZEDA 1YLOA 1R3KC 5AG5A 3BLNA 2OCHA 3RYOA 5DEDA 3PP9A 4TV8A 3IC7A 4E2LA 3ZMSA 5E79Z 1VQ5V 2PF4E 2EX3A 3RYHB 3TCVA 3H1HH 3RGBA 1ZLHA 4NXNB 4KUBA 2OT5A 3ETGA 4UIAA 4CYPA 3N27A 2YNCA 1Q90D 3RNZA 5GONA 2G0BA 3KASA 2D4PA 3IO1A 4ZHQA 5JH9A 1MK4A 1VF7A 2VL1A 4I0XA 1BCCH 3CCJV 5F46A 3AG4B 1IYLA 3CXQA 1SA0B 1XF8A 4OGQB 3CYOA 5D5PA 1SQHA 5IY5B 4U7NA 1DTDA 4JI0O 4MTFA 1L0CA 4LCUC 2HP8A 4UCSA 1GN6A 5B1BB 1M9NA 5J2UA 1SZXA 4JYWA 4X3RA 1MG1A 5KAIZ 5FL7G 3QO7A 2JVDA 5FPRA 1HNWB 1DE4C 4LFCO 2DEAA 1AILA 4LQGA 3B4SA 4JASA 1RFYA 1G1XB 1SRYA 1Y67A 1QSRA 3KR5A 3AG2C 4JI6O 5JPHA 4B3SO 3ZZIA 1WA8B 4YJ2A 1S7NA 4DR7B 2DJVA 1QVFU 4B3RB 4PELA 4W4KA 5CA1A 1F2OA 3MDSA 4UCVA 4X66O 3D4UA 4NGMA 2XAJA 3RN4A 1G4YB 5ISVA 1I08A 1JCHA 4JZGA 4RQEA 4Z65A 2LQTA 5J9PC 1SQXH 2Q9LA 3GUXA 1AP5A 1YF2A 3STZC 3K2KA 5ELYA 5ITZA 2IJZA 4JI7O 1SETA 1Y4MA 3SPCA 3IJ3A 3D7GA 3EC4A 3K9SA 3S6HA 4DYOA 3ETDA 2ODFA 5KTCA 3JD0A 3AG3B 2IQ6A 5LL6Y 2FSRA 3E8GA 3D7DA 1BZKA 3SR2C 3TTHA 2EBOA 1BT8A 1MABG 2QECA 1H2MA 4NYKA 1Z5VA 2QYVA 4B14A 4GKKO 1HP8A 2H94A 4OPAA 1WB7A 1NR1A 3THOA 4LFBB 1WP7A 3JSNA 4AI8A 3OGCC 3CRQA 2OTLV 5J8FA 3R66A 5KTAA 4OC4A 4NXMB 4AVCA 4B5PA 3NR7A 3ABKC 3H8FA 4UCPA 3CXHF 4LH6A 4RUFA 4R50A 2OB0A 2JGDA 3QO8A 5EBLC 1J4JA 2R9AA 4OLLA 4RN7A 3A0BZ 1ARLA 4JI1O 2K5TA 4ORFA 4UCNA 1HW7A 1FFXB 2QE7G 4PXEA 2Q4PA 3N2GB 4UEEA 2EIMC 1LAMA 3KZIZ 4ZI6A 3WC7A 3RWRD 4MT8A 2XAGA 4B3TO 1PL0A 3LUTB 4JAUA 4TV8B 3ZN1A 3P3NA 4B10A 3F5WC 1GTOA 2G3TA 1XHXA 3IWWA 3ETEA 4QUSA 4H0LB 3GWOA 3OMAB 3FVLA 4XBFA 1OCRB 2FIAA 4KS9A 4A30A 4YRHA 5KUMA 3TO6A 7CPAA 1SQVH 2EINC 2CTWA 3JD1A 3DNSA 1N4CA 4MW3A 3CD6V 1M1DA 1EN4A 3B3VA 4EB6B 4MFZA 3G67A 1O9GA 5GTHZ 3S6FA 2PJ8A 2E74B 4BW9A 2CNMA 1Q2YA 4C2ZA 3FF3A 4DYLA 4Z1VA 4P4IA 3H8GA 4I0XB 5F2VO 2PI5A 1Q5OA 1F23A 4FM0A 3SJBC 1Q43A 3WC6A 4FPPA 2A7WA 3HKEB 5G1ZA 1ZLZA 3FB6C 4IUSA 1I1DA 3VQXA 2OZUA 3ZMUA 1HR0B 1VIXA 1XNQB 1XE4A 3G71V 3CC7V 2NYQA 1F2PA 5LHGA 2H8PC 1NS1A 1Z9UA 2RFHA 1FT7A 1ELMP 4AB7A 3LODA 4X1YA 4WBNB 1AVMA 1PV0A 4QVTA 4X2TA 1IXMA 3OTOB 4CBCA 3RVYA 3F5BA 2NLJC 5JH7A 3FNCA 1OCZC 4B7KA 4FLUA 3SPGA 3SJEA 4BIZA 2ZM6B 4KLVA 5LYDA 3JVNA 3N5FA 2QM4A 4GX1A 4F6AA 4YJ3B 4J7ZA 4LF4B 3B7IA 3T1HO 4R3KA 4DR3O 1IBMO 4ASUG 1KUXA 1K4DC 4A37A 3F8KA 3BJ7A 4LFAO 4JWPA 5EIBC 2OIGA 2Z11A 4X64O 3F7VC 2ETNA 4PXCA 3RYFA 2E5LB 5K1PA 1NTMH 3OUSA 4KP4A 3GWKC 1XEQA 2ZW6A 1OHHG 2ZINA 2BL1A 1FD9A 4DV4O 2UXBO 5A28A 1KU9A 1WP8A 3TX8A 3MHSC 3EFAA 1B6BA 1GN2A 4N21A 3AG1B 1Q2DA 4X1IA 2YC0A 2CUGA 5L3FA 4TT3G 2YSUB 4AVAA 5KHIA 1YZBA 3WG7B 1F57A 1VQOV 5JM6A 4DV5O 2VRZA 2JDDA 1ZG9A 4XPKA 3OMIB 4DR1B 3FXTA 3HKDA 4PA4A 5IT9N 2ZR2A 1RPOA 2Z0ZA 4DR2B 1Y66A 1KD1W 3K9TA 3ZIAG 4B12A 1M4LA 1KYOF 4AG9A 3G3SA 4MTGA 3RBUA 1LR1A 2PTMA 2B1GA 2JGDB 2Z0AA 4JI2O 4OX9O 1K34A 2VQFO 2WPXA 4QNHB 2X0LA 2CGOA 1SKVA 4AHCA 5IJ9B 4O23A 4WFHA 5B1OA 1BPNA 3JASA 4FLTA 3TO9A 3KZWA 1NT2B 4B11A 5LYJA 2BUEA 2HLDG 1Y0RA 4LF5B 2P06A 4F9UA 2B5GA 1NI8A 2KB1A 4K8XA 2ZW4A 5FVJA 4I9QA 2LP7A 2GIVA 4O4IA 3CRAA 4H33A 5LMUO 4DR4O 1NVPD 2RN9A 4TQFA 2FE7A 4WCEV 1YK3A 3D7FA 3JAWA 2EBJA 2Q0OC 3FX6A 4P4DA 5B66Z 4N23A 1CX8A 3K9AA 2IW5A 5JJEB 5EZYA 3B35A 3SJXA 4TSFG 4DK1A 5I4MA 2XNDG 2HV2A 3MD0A 3A2FA 4K0KB 3CCLV 2KG7A 3H4QA 4KOWA 3TK1A 2D2CB 4KXRA 2Z3PA 3PEIA 1JMKC 3D8PA 4CGLA 4ZGYB 2BCCH 4FD5A 5LGNA 3NH4A 4MY3A 1OCOC 1OV9A 3FAVA 1N32O 1TXRA 4O2AA 1M93A 1Z4EA 4CH5A 1CPSA 1MJ9A 3CRRA 1Y9KA 3M7MX 4Z1MG 3ASOC 4JAVA 3K57A 2Z3KA 5B5EZ 3NH8A 1AI5A 1M1KW 1NKDA 1IZ3A 3P2FA 3PJSK 1VQ4V 2R9RB 2YGWA 2ZPAA 2UXNA 1F4MA 3OGIB 3GYAA 2A0LA 1IDSA 3LNMB 3GB0A 1YW6A 5JH7B 4DV6B 2J9AA 3DGEA 4C2YA 2UU9B 3AG7A 5H5NA 5H6RA 5DWMA 1VP7A 3TOBA 4ZBGA 4AQYO 1VQ7V 3EY5A 1UFIA 3K5MA 1NJIW 1PL4A 4A33A 5BR8B 4GS4A 5A9GA 4DV2B 1FJGB 1FS0G 3O9OA 1YJNV 2NNUA 4UCTA 1F4NA 2R1IA 1WNSA 4H44B 2GFQA 3SDLA 1IIDA 2HQYA 5C88A 2N04A 2JGUA 5FLXN 4UVAA 1JJ2U 3W6XA 3W6SA 1LANA 5K8MA 1GH6A 1B3QA 1IGBA 2WA3A 4Q20A 2ILMA 4MHNA 1QQ9A 4NGTA 4ZIBA 1V55B 1K33A 3DXRA 4DK0A 2CNTA 1MOFA 1PM9A 3ZS8C 2DE0X 2AHZA 2GANA 1MMMA 1P7BA 4JI3O 4JI8O 2Q4YA 3UY5A 4JYYA 1K5QA 5AG2A 5KHHA 2AFZA 3IU2A 5J2TA 2P6GA 4ABMA 2M6YA 1HNWO 4BMHA 5LP6B 5H84A 2AZ0A 1IURA 3RT3C 2ZDIC 2ZOGA 2Y0MA 1P7GA 3D8CA 3K79A 3QG5A 4LH7A 3D3IA 3VQVA 4DV0O 2JLMA 3PGPA 1UJWB 4WFFA 1VHOA 1I0HA 4A39A 1W0JG 2QDOA 4KUMA 4DR7O 5EYPA 4B3RO 5K8OA 1DK1A 1AR1B 4MFPA 1V54C 5JJNB 4I49A 4LF7O 1Z4RA 2BTQA 5EBVA 1KKCA 4RWUA 4JGSA 4X20A 3ETQA 3QB8A 2P4VA 4JYBA 1RM1B 2YUAA 3FB3A 4YU9A 4UCRA 5LYJB 5JJJB 3OR6C 1Q8IA 4QJFB 3W7SA 1TGOA 2EIJB 3TGUH 3CE2A 1FAFA 5HXDA 1BQ0A 4O4IB 4W9YA 3OUFA 4PXBA 2F1MA 1H2KA 3JAWB 2HVJC 2UUBO 2BEIA 5E1AC 1DTOA 2QGNA 3PBBA 1Q6IA 1VIBA 4O4JA 1FYJA 1HDUA 4E8OA 4KVOE 4FLZA 2ZIOA 1JFFB 2V4DA 3WB1A 4CGOA 4DV7B 5B3SB 5F49A 3IEHA 3CSXA 2DOSA 4FLYA 4P45A 4KOYA 1RXTA 5IB0A 2OCCB 3APQA 3W7WA 2OZGA 4MY0A 4W4LA 2BTOA 4O2AB 4UWJA 5LHIA 3RYHA 2J8RA 2PVVA 4H13B 4NXMO 1S7FA 5E96A 1VQPV 2GE3A 3JCZA 4AXVA 3R95A 4F6RA 4PA9A 2FL4A 3RYCB 2PR8A 3HB3B 4DR5B 1AI7A 5LA6B 3VQYA 3FYIB 4IT5A 4NEXA 1B04A 4DUYB 2ZE8A 2LFSA 4CH4A 2WSAA 1CEZA 2EVNA 3DSBA 2FYUH 4X5KA 2W0FC 5IWAB 4L89A 1ZX3A 4YGOA 2ZKOA 1Z2LA 2UXCB 1WK4A 5K1XA 4IHJB 3IJ4A 2ADQB 1H2NA 3WFVA 3ABMB 3LMSA 3JARB 2EWBA 2EIKC 5LRKA 2F66C 2ATKC 1KECA 3JAKB 4L87A 3BCCH 1DGSA 4FD7A 3E86A 4LF8O 3R96A 4QPJA 4HNXB 2WLKA 3ABLB 3ZHTA 1L1FA 4E0AA 4LF9B 4F8ZA 4NXYA 3SYAA 2ZE6A 1WA8A 3A0RA 1B6QA 4YHHB 3CCMV 1AI4A 4P30A 1Y74B 3DXRB 1KWMA 1HR0O 1ROPA 3JATB 1YJWV 1QSTA 3S6KA 4CS2A 4DJLA 3E8BA 1OZPA 2DYSB 2ABZA 4UEFA 3CCRV 1GYTA 4QBJA 4JTAB 2L35A 1JQGA 4R6TA 4XNHC 3FYEB 3R9EA 2YI9A 1N71A 1TUBB 3QAYA 3GVMA 1L0NH 1QSMA 1GO3F 3SXOA 3SJQC 3CHXA 2UUCB 4FZ1A 4EKWA 3SYCA 3HR0A 3U11A 2PZSA 3FIXA 1LFWA 2R70A 1R57A 1GM7A 3J80N 1KC8W 3W7UA 4X20B 3LDDA 2HKOA 4R8CA 1IU8A 1YR0A 4DUZB 1SQQH 4YIPA 1KBHA 3HUVA 3FFQA 3X2QC 1IBLB 1CXZB 2OTJV 3BPZA 3GLJA 2E5LO 5KTDA 2A06H 3DTUB 2LJ2A 4WFBV 4MVRA 1ARMA 3CJHA 5DS0A 2B4DA 1IICA 4K35A 1JX9A 4IAVA 1I5XA 4KHPB 1W59A 4MVZA 1BLLE 3WG7C 4O4JB 5L3GA 1P49A 2ZNIA 2J8MA 1I94B 1LCPA 2DQ3A 1M4IA 2NSMA 2ATRA 4MVSA 1VQNV 2F8HA 4MFKA 2Q5ZA 4AG7A 4DV3O 1VF6C 3JUWA 3H1LH 3N2GA 1Q81W 3K04A 1ZG8A 3WB2A 1VF5B 3E8HA 4JTCB 4U3FH 4LQ6A 1QNMA 1GMGA 2Q51A 3LSUA 4Y49B 1XBUA 1XHZA 4A32A 3OWCA 5EBMC 4MW8A 4UCOA 1M90W 1H2LA 1NZ6A 1R73A 3OR7C 3OE7G 3JYCA 4F6RB 1GKFA 3S9NA 2YICA 5BZBA 3AK3A 2ZNJA 2HB6A 1KKDA 4NFRA 2PJ5A 4UCMA 3D66A 4EB6A 3ASNC 4QGPA 5KX5B 4YXWG 3JTKA 1XNRB 3WR7A 2VZYA 1RSOA 2F4VO 3B8MA 4UB8Z 5JWPA 1PU9A 4B3MO 4LC1A 3D2MA 3T90A 5EC4A 3D3SA 3HKEA 1AR5A 2B3UA 4PSWA 5HVHA 2GTSA 2IH1C 5KHJA 3K06A 2Q04A 2CTRA 1XOVA 3IU1A 1S3ZA 3BVOA 2Q7HA 2VS0A 5LGTA 1SESA 2KSDA 4J7JA 2R72A 3ISZA 3H9VA 3CS5A 4X62O 5LRGA 4WBNA 1QLEB 4NGRA 4OC0A 3ZBHA 4NTYA 1N8RW 2C6PA 4MSWC 2IJJA 2FT0A 4O4HB 1EBOA 2WLMA 5IX3A 1XUQA 4DUKA 4P44A 2ADPA 2ZE5A 3L73H 1AJPA 1YVOA 4YJ3A 1X59A 3V38A 2IU3A 2PCUA 3LSQA 2OR4A 5CB4B 1NTZH 2PRQA 4PXDA 4ZY1A 1G8MA 4FIPC 4MVUA 4CC5A 5BMVA 1RTQA 2Q7SA 3NA6A 2XEFA 4KOUA 1R3NA 2Q7EA 1N36B 4R7MA 1ZWIC 4MRIA 1NTKH 4NGNA 3STLC 3R1KA 4Q38A 2P90A 5FNVB 4C68A 4CH6A 2HEPA 3TE4A 3SGIA 4X65O 3G4SV 2CF4A 1ZTEA 2UU9O 2LFRA 1VQKV 1K3EA 2Q7BA 2B1IA 2MW2B 1YCIA 2Q7GA 4X1KA 5DM6V 2YIAA 5LHHA 1SERA 5BR8O 5H6QA 1YREA 2E75B 3VBBA 2KQXA 4CPAA 2ITCC 2DYRC 3CRMA 2MK3A 1FXKB 2B5UA 3HPLC 1YHQV 3I56V 3C90A 4R7CA 2UUAO 1RP3B 3CJHB 4ZY0A 5IV0A 2Q73A 3J81N 4O4LA 2B4DB 2BCOA 4A38A 1MSDA 5IB9A 3OMNB 3S3WA 1YVKA 3TXSA 2Q67A 3DR8A 2PIZA 4HNAB 4YY3O 4CAWA 1XEBA 3KR4A 3DR6A 1R3IC 3T4ZA 5IJ9A 1VHEA 5LYLA 3K0DA 5B1AC 1R43A 2A4NA 2YIBD 1XMOB 3QF7A 1MJBA 2HHHB 4P9OA 1R6NA 3VWDA 2ZXWB 3KCXA 4NB5A 1NR7A 3ZHQA 3CCSV 4M6IA 4B08A 3H1KH 2JEWA 1M57B 4ZX9A 5AG7A 3NH5A 4OP4A 4UA3A 4KOXA 1NVPB 2EIJC 1OJHA 4BBHA 3G6EV 1BHAA 1HNXB 5KHKA 2O57A 4JYCA 5JVDB 2OZHA 3B3WA 1FNOA 2PRBA 4LF6O 2Q6AA 1HNZB 2HG5C 1J95A 1Q86W 3G8WA 4KSIA 4QC6A 1RSOB 4CC6A 1GN4A 5A27A 5G21A 2A3QA 3PZJA 1J5EB 5AGEA 1S5LZ 4XPDB 3RW0A 1AJQA 2DPTA 3LD2A 3LSSA 1FXHA 2IL4A 1GHEA 2R98A 2GTAA 2EULA 3T2MA 4FBEA 2QSAA 3A9LA 3EFFK 1K4JA 1DLBA 3ZX6A 2W6IG 5LGUA 5IYBO 1ZLIA 2FVGA 2REFA 4PSXA 4PPZA 2PJ0A 4KVXA 2Q8VA 1H2GA 2PGGA 5IYDO 4UFXA 1VQMV 5CMUA 4CYOA 1XQ8A 1IB1E 4FAIA 4WFAV 3T9YA 1S60A 4A95A 5IYZA 4CYNA 1Y6XA 5EC1C 2OIEA 3T1YB 1BMFG 2GUZA 2PYJA 4MFQA 2R7HA 3RYIB 5BMVB 3APOA 1D2DA 3CMEV 1EFRG 3KQXA 3H01A 2VQEB 1KMIZ 3EXNA 2P67A 2UXDB 1ENVA 2I00A 4NGSA 1QR8A 2L6LA 4DUYO 1I7FA 2AFSA 1US6A 4C7HA 1EE3P 5LRJA 4MBUA 1R3LC 2Y48A 3E83A 3I5DA 1N34B 2EILC 4J9YB 1SQPH 5IWAO 2EJRA 2Y69C 3MGDA 1IY7A 4GXHA 3OEEG 4X1KB 4JV5B 1M56B 4O2BA 4RAIA 2UXCO 1VQ9V 1WJZA 2P22C 4PDVA 3ZHRA 3SI0A 3LNNA 2P6FA 1TAEA 4EMEA 3JALB 3V8IA 4JZ0A 5G22A 1DF4A 3ZMVA 1GN3A 5LP6A 4LBEC 2CTCA 4CAVA 2JEUA 3CCEV 3W91A 4IF5A 5LMNO 4O4LB 2AFMA 2QVPA 3JD3A 4L8AA 4UBRA 4DV1O 2V1DA 3IWEA 2O4HA 3UM7A 4YHHO 1NH2B 1MZFA 3NE8A 4MVMA 2XEGA 2B58A 2Q69A 1OCCC 5C8YA 2AFUA 3CXCU 2PJ7A 3K08A 4ONWA 4U3JB 6CPAA 3M8AA 4TQDA 3F0AA 2FTKA 4I50A 3SJAC 3QNEA 5HVGA 1M44A 1COWG 1R1BA 4PJ0Z 3SJGA 4GKJO 4BWAA 4PDLA 1I21A 1Y76A 2GHYA 1YLEA 4KOTA 4FD6A 1PNKA 3HKCA 3JD4A 2DQ0A 2UUCO 3ZHVA 1JWQA 5DN6G 3E89A 3U0ZA 3K5OA 1JFFA 2ZEFA 4UWIA 3E35A 3ZHSA 4DUZO 1NSLA 2QWQB 2PJ3A 2E76B 1S5HC 4ZOLB 5L3DA 4P2ZA 5KA6A 2PVWA 1P4RA 1OBRA 4P10A 1PKXA 1BSMA 5D29A 5JCOC 4JI0B 2XT9A 2N05A 2H3OA 2N74A 2AFXA 2Y0IA 3A0HZ 2QKCA 3SPJA 4ZI7B 3HLPA 3T1CA 4TUYB 3RYCA 1NE9A 2GBOA 2PJAA 3B8NA 2ZT9B 3WU2Z 1LOKA 4LFCB 2ZR3A 3EVKA 5LA6A 2M7WA 2R9IA 1BQZA 2PE3A 4HNYB 4IIJB 4FLVA 1AMPA 4MS2A 2F93B 4JI6B 4OC1A 2K1EA 2CY2A 1XOUA 2YS8A 5IYZB 1VARA 1YMEA 4EVYA 3DGVA 4TV9B 1M4DA 3L74H 2PJBA 2Q4VA 4KVME 3KKYA 4X66B 2W0XA 5CBFA 1PD3A 3T4DA 2EK9A 8CPAA 1LUVA 2BOBC 2GUZB 5LBQA 3AG2B 2YNEA 4NXNO 3SI2A 2FB5A 1VMGA 3OM3B 4IHJA 3AG4C 1D5NA 2XTAA 3JARA 1R6KA 1OZ0A 4PI2A 5A2QN 3TO7A 3CPWU 5IY5C 4JI7B 1XNRO 1NMTA 5HFLA 2YNDA 3JAKA 2Z3LA 3FEEA 4RI1A 3KG2A 2NR5A 4LNUB 4TWEA 5B1BC 3IAYA 3AEIA 5GCNA 1ZUQA 4A94A 1YW4A 3L70H 5AG6A 4HZ3A 3SPHA 4J3GA 4EFDA 1BHBA 2X6CA 4PK3A 5JQ4A 5B1NA 5BWAB 3N2KB 1Y74A 2QJ1A 4O2BB 4HKFA 2HR3A 3JATA 2CGNA 5D8NA 4MHZA 3ZHUA 2QEXV 2I3CA 2PJ6A 1T5EA 2E3CA 4GT1A 3D7HA 4MCRA 1KZFA 4GX5A 4KSAA 3UO2A 2Q68A 2VWJA 2PUSA 3FEDA 4BW5A 1ELLP 1QLNA 1U6MA 3I9SA 2ZCEA 1Q7YW 2IJKA 1TUBA 4LP8A 4JI1B 1NH2D 2BOAA 4R87A 3IC1A 4HBNA 1Q7LA 4DW0A 4ZBMA 3ABKB 3P32A 5C8YB 1QCEA 5HFMA 3I3GA 1JPXA 1M5IA 1R3JC 3ZRXA 1H8HG 1N36O 4I50B 1WLEA 3UQ8A 3AG3C 1BE3H 2HFEC 3IWGA 2PYLA 2AXTZ 2VWKA 1IX9A 2EIMB 4CGPA 1Y76B 1EN5A 2QTOA 5DWNA 3HKCB 2D4OA 3NXSA 2XHBA 4YWYA 5CBMA 3JSLA 3PFOA 3TETA 4BAYA 4X89A 4PV1B 1GM8A 4JI5B 1BAVA 3R65A 5BY1A 5GTIZ 2WLNA 2C6GA 4PK2A 3QO5A 2EINB 3GY9A 1JOYA 4A31A 3ICXA 4UXNA 3ISXA 3OAAG 3RAMA 4C7UA 2GLFA 2YIBA 4I55B 4KOSA 4LFBO 3S9LA 1YXBA 2CTPA 1ON0A 2CTBA 2RDCA 2DF5A 3CT9A 1AB3A 4OKOA 3UCSC 4KL1A 2ANPA 2EUIA 3D36A 4WFEA 1CP7A 5KHGA 3FD9A 5CA0A 1QVGU 5KLVH 1HEEA 1OCRC 1ZG7A 1CP9A 5KX5A 2CTQA 2HJDA 3TJTA 2ZEMA 3BXMA 2WSSG 3IIBA 2P6JA 2PJCA 2GV9A 4HYOA 4MMOA 4NSQA 2ZQMA 3DC5A 2P0WA 2YNCC 4C2XA 4XPLA 4H37A 4ZYQA 4DR3B 3IFEA 1TVKA 4Q7AA 2JJ1G 3P2HA 1P84F 4EEQA 1SQBH 4LFAB 2EZOA 4YIOA 2RJZA 4F9VA 2X7BA 4NTXA 4X64B 2Y4UA 1HDJA 3ZMZA 2YEVB 3SI1A 3WC5A 1X10A 4OAEA 1AROP 2ZW5A 1MNGA 4J42A 3Q4HB 5CA3A 1N33B 1HNZO 4WJBA 1S5JA 1THZA 4MHDA 4UB6Z 1N0NA 1XBLA 3C3TA 3FYNA 2XAFA 1XMQB 2AW9A 1PP9H 4MXUA 2G38A 2R8VA 4MI4A 4DV4B 2YDEA 2UXBB 2AFWA 1EM1A 3CRCA 1G6UA 2EJ7A 2FKXA 4O4HA 4UIBA 5KA5A 1XREA 3EO4A 4I9WA 1V9PA 3E8FA 4KORA 4IHMA 4FK5C 1XNQO 2V8VA 4FFBB 3PRTA 2DN9A 4JAAA 5CB4A 3IGAC 4X9QA 4EFEA 2DXQA 5F09A 4E4EA 1H8LA 4H2KA 1M4UA 4DV5B 2BO9A 4C7IA 5EMIA 2LW7A 3QVNA 2RC4A 5GW7A 3OTOO 3P3PA 2PJ2A 2WA4A 5HH1A 3K9UA 5FNVA 2F95B 1URFA 2VQFB 4U9YA 1ZL8B 2ZM6O 3CX5F 1V0CA
chains in the Genus database with same CATH topology
3TT2A 1S7LA 1IYKA 3EFAA 1B6BA 1Q2DA 2DPSA 1YREA 4AVAA 4R3LA 2REEA 4M85A 5F48A 1YGHA 2Z10A 4DNCA 2JDDA 4XPKA 2Z3OA 3FXTA 4H89A 1WWZA 2Z0ZA 5IV0A 4B12A 2B4DB 4KOVA 4AG9A 3G3SA 4M3SA 5C82A 1YVKA 1B87A 2WPXA 3DR8A 2AJ6A 4H6ZA 4CAWA 1Y9WA 1XEBA 2PSWA 3DR6A 1FY7A 4OADA 2VQYA 4E2AA 3TO9A 1PUAA 3SHPA 4B11A 2A4NA 2BUEA 4CGMA 4K30A 2B5GB 3D2PA 1MJBA 2B5GA 3VWDA 2ZW4A 5FVJA 1TIQA 2GIVA 4JXRA 4CAEA 5AG4A 2O28A 2FE7A 1YK3A 2JEVA 5AG7A 4UA3A 4KSFA 3GKRA 4KOXA 4CRYB 4KZTA 1MJAA 4BBHA 2HV2A 2OZHA 2PRBA 2CXAA 4KOWA 4JXQA 3H4QA 4LUAA 2WPWA 2Z3PA 3G8WA 2PQ8A 5F47A 4QC6A 3VWEA 4F0XA 3D8PA 2FIWA 4NCZA 4CGLA 4ZGYB 4FD5A 2OU2A 5A27A 5G21A 3PZJA 5AGEA 4MY3A 4XPDB 1Z4EA 2DPTA 3LD2A 2FCKA 2WUUA 3BJ8A 1Q2CA 1MJ9A 1Y9KA 2IL4A 1GHEA 2R98A 1CM0A 4R57A 3A9LA 4KLWA 1K4JA 4HNWB 4YFJA 2PR1A 2REFA 2Z3KA 3TFYA 4PSXA 4KVXA 3P2FA 2YGWA 2ZPAA 3GYAA 4XPDC 4UFXA 4B13A 4F0YA 4CYOA 1ZO0A 1IB1E 2AE6A 1S60A 3T9YA 4A95A 4C2YA 4CYNA 1S7KA 3N7ZA 5DWMA 2ZXVA 3TOBA 4ZBGA 2Q0YA 3EY5A 3FBUA 4A33A 4MFQA 5H86A 4CAXA 3R9FA 2R7HA 2G3AA 4GS4A 2R1IA 4NF1A 2PDOA 1IIDA 2HQYA 5C88A 3EXNA 3H5ZA 2I00A 3W6XA 4RS2A 4JD6A 3W6SA 4C7HA 3FRMA 4MBUA 5I0CA 2Z3NA 2QMLA 4UFWA 3MGDA 2CNTA 1VHSA 2GANA 2Q4YA 3UY5A 3IU2A 2P6FA 1QSNA 2P6GA 4PV6A 4Q36A 3V8IA 5G22A 4BMHA 5H84A 2Y0MA 4CAVA 2FXFA 2JLMA 1CJWA 4CGNA 1KUVA 3PGPA 3W91A 4IF5A 1I12A 4L8AA 2B4BA 4UBRA 4R9MA 3IWEA 2Q44A 4MFPA 4I49A 3R9GA 1Z4RA 2VI7A 5EBVA 3IGRA 2B58A 3QB8A 2CNSA 3FB3A 3DDDA 1BOBA 4UFVA 2JDCA 4MFJA 4B5OA 5CNPA 3F0AA 5G20A 3CXPA 3B8GA 1LRZA 1M44A 1I21A 1M4GA 2VBQA 4II9A 1YLEA 4KOTA 2BEIA 4FD6A 4CRZB 2B3VA 4E8OA 4KVOE 4CGOA 1XMTA 4UWIA 5F49A 4CS0B 5AG5A 1NSLA 3BLNA 3RYOA 4KOYA 3TOAA 3PP9A 1RXTA 2F5IA 5IB0A 2OZGA 4MY0A 3NE7A 4UWJA 3TCVA 2J8RA 1S7FA 5E96A 2GE3A 4KUBA 3R95A 2FL4A 4CYPA 2PR8A 1NE9A 1VKCA 2YNCA 3ZJ0A 2VEZA 2G0BA 2H5MA 2D4PA 4NEXA 4HNYB 1MK4A 2WSAA 2EVNA 2CY2A 3DSBA 5F46A 4X5KA 1QSOA 1IYLA 4L89A 3CXQA 4EVYA 1M4DA 2Q4VA 4KVME 1XF8A 1SQHA 4YGOA 3KKWA 1L0CA 1WK4A 2YNEA 4KUAA 2PC1A 3TO7A 1NMTA 2Z3MA 4FD7A 2YNDA 2Z3LA 1QSRA 4RI1A 1UFHA 3R96A 4HNXB 5JPHA 3ZZIA 1S7NA 4E0AA 4NXYA 5GCNA 4MJ8A 5AG6A 3QAHA 4J3GA 5JQ4A 4PK3A 4XNHB 5BWAB 4U5YA 4HKFA 1QSTA 3S6KA 5ISVA 1P0HA 1BO4A 1OZPA 4QBJA 4JJXA 1KZFA 4KSAA 3E0KA 1KUYA 4XNHC 3R9EA 1N71A 2FS5A 1U6MA 2VXKA 3I9SA 3EC4A 3S6HA 1QSMA 3SXOA 5KTCA 4R87A 3FIXA 2FSRA 1P4NA 1R57A 1S5KA 3TTHA 1YR0A 2QECA 2J8NA 4H6UA 3I3GA 4B14A 3SXNA 4JLYA 5KTDA 3IWGA 5KTAA 5J8FA 4B5PB 1YX0A 4CGPA 4AVCA 4B5PA 2B4DA 4UCPA 1IICA 2QIRA 4LX9A 2OB0A 3CXSA 1J4JA 5DWNA 4OLLA 2D4OA 2K5TA 2J8MA 4ORFA 1Y7RA 4UCNA 1M4IA 2ATRA 4MFKA 4AG7A 3JUWA 4PK2A 4MFLA 3GY9A 4A31A 4B10A 4AVBA 2G3TA 4Y49B 4QUSA 4KOSA 2I79A 4A32A 1ON0A 2FIAA 3OWCA 4KS9A 4A30A 4YRHA 3TO6A 2EUIA 2BSWA 3DNSA 4QB9A 1M1DA 4MFZA 4CYQA 4UCMA 4Y49C 3S6FA 3JTKA 3WR7A 2CNMA 1Q2YA 4A2ZA 4C2ZA 2VZYA 2ZW7A 1PU9A 2OH1A 4CAFA 3T90A 3D2MA 2ARHA 5EC4A 4NSQA 3D3SA 2P0WA 2YNCC 5G1ZA 4C2XA 4IUSA 1I1DA 4XPLA 2B3UA 4PSWA 2OZUA 1XE4A 3P2HA 5J8CA 2Q04A 3S6GA 3IU1A 1Z9UA 1S3ZA 2C27A 2X7BA 4AB7A 3LODA 4OAEA 2ZW5A 4QVTA 4MHDA 3C26A 3F5BA 2KCWA 3FNCA 3FYNA 4ONUA 2R8VA 4MI4A 1XIXA 2NMTA 2FT0A 4KLVA 3JVNA 5IX3A 4F6AA 3EO4A 1YVOA 4R3KA 4KORA 5HMNA 4U9ZA 1KUXA 3F8KA 2DXQA 3BJ7A 4JWPA 2HUZA 4KOUA 1RO5A 2VZZA 2Z11A 2P6EA 4C7IA 3R1KA 2RC4A 4Q38A 2ZW6A 4C68A 5HH1A 2BL1A 3K9UA 3TE4A 4FD4A 4U9YA 5A28A 1V0CA 2Q7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TT2 A;  1S7L A;  1IYK A;  3EFA A;  1B6B A;  1Q2D A;  1YRE A;  4AVA A;  4R3L A;  2REE A;  4M85 A;  5F48 A;  1YGH A;  2Z10 A;  4DNC A;  2JDD A;  4XPK A;  3FXT A;  4H89 A;  1WWZ A;  2Z0Z A;  5IV0 A;  2B4D B;  4KOV A;  4AG9 A;  3G3S A;  4M3S A;  5C82 A;  1YVK A;  1B87 A;  2WPX A;  3DR8 A;  2AJ6 A;  4H6Z A;  4CAW A;  1Y9W A;  1XEB A;  2PSW A;  3DR6 A;  1FY7 A;  4OAD A;  2VQY A;  4E2A A;  3TO9 A;  1PUA A;  3SHP A;  2A4N A;  2BUE A;  4K30 A;  2B5G B;  3D2P A;  1MJB A;  2B5G A;  3VWD A;  2ZW4 A;  5FVJ A;  1TIQ A;  2GIV A;  4JXR A;  2O28 A;  2FE7 A;  1YK3 A;  2JEV A;  4UA3 A;  3GKR A;  4KOX A;  4CRY B;  4KZT A;  1MJA A;  2HV2 A;  2OZH A;  2PRB A;  4KOW A;  4JXQ A;  3H4Q A;  4LUA A;  2WPW A;  3G8W A;  5F47 A;  2PQ8 A;  3VWE A;  4QC6 A;  3D8P A;  2FIW A;  4NCZ A;  4FD5 A;  2OU2 A;  3PZJ A;  4MY3 A;  4XPD B;  1Z4E A;  3LD2 A;  2FCK A;  3BJ8 A;  1Q2C A;  1MJ9 A;  1Y9K A;  2IL4 A;  1GHE A;  2R98 A;  1CM0 A;  4R57 A;  4KLW A;  1K4J A;  4HNW B;  4YFJ A;  2PR1 A;  2REF A;  3TFY A;  4PSX A;  4KVX A;  3P2F A;  2ZPA A;  4XPD C;  3GYA A;  4F0Y A;  1IB1 E;  2AE6 A;  1S60 A;  3T9Y A;  1S7K A;  3N7Z A;  5DWM A;  2ZXV A;  3TOB A;  4ZBG A;  2Q0Y A;  3EY5 A;  3FBU A;  4CAX A;  5H86 A;  3R9F A;  2R7H A;  2G3A A;  4GS4 A;  2R1I A;  4NF1 A;  2PDO A;  1IID A;  2HQY A;  5C88 A;  3EXN A;  2I00 A;  3W6X A;  4RS2 A;  4JD6 A;  3W6S A;  3FRM A;  4MBU A;  5I0C A;  2QML A;  3MGD A;  2CNT A;  1VHS A;  2GAN A;  2Q4Y A;  3UY5 A;  2P6F A;  1QSN A;  2P6G A;  4PV6 A;  3V8I A;  4BMH A;  5H84 A;  2Y0M A;  4CAV A;  2FXF A;  2JLM A;  1CJW A;  1KUV A;  3PGP A;  3W91 A;  4IF5 A;  1I12 A;  4L8A A;  2B4B A;  4UBR A;  4R9M A;  2Q44 A;  4I49 A;  3R9G A;  1Z4R A;  2VI7 A;  5EBV A;  3IGR A;  2B58 A;  3QB8 A;  2CNS A;  3FB3 A;  3DDD A;  1BOB A;  2JDC A;  4B5O A;  5CNP A;  3F0A A;  3CXP A;  3B8G A;  1LRZ A;  1M44 A;  1I21 A;  1M4G A;  2VBQ A;  4II9 A;  1YLE A;  4KOT A;  2BEI A;  4FD6 A;  4CRZ B;  2B3V A;  4E8O A;  4KVO E;  1XMT A;  4UWI A;  5F49 A;  4CS0 B;  1NSL A;  3BLN A;  3RYO A;  4KOY A;  3TOA A;  3PP9 A;  1RXT A;  2F5I A;  5IB0 A;  2OZG A;  4MY0 A;  3NE7 A;  4UWJ A;  3TCV A;  2J8R A;  1S7F A;  5E96 A;  2GE3 A;  4KUB A;  3R95 A;  2FL4 A;  2PR8 A;  1NE9 A;  1VKC A;  3ZJ0 A;  2VEZ A;  2G0B A;  2H5M A;  2D4P A;  4NEX A;  4HNY B;  1MK4 A;  2EVN A;  2CY2 A;  3DSB A;  5F46 A;  4X5K A;  1QSO A;  1IYL A;  4L89 A;  3CXQ A;  4EVY A;  1M4D A;  2Q4V A;  4KVM E;  1XF8 A;  1SQH A;  4YGO A;  3KKW A;  1L0C A;  1WK4 A;  4KUA A;  2PC1 A;  3TO7 A;  1NMT A;  4FD7 A;  1QSR A;  4RI1 A;  1UFH A;  3R96 A;  4HNX B;  5JPH A;  3ZZI A;  1S7N A;  4E0A A;  4NXY A;  5GCN A;  4MJ8 A;  3QAH A;  4J3G A;  5JQ4 A;  4PK3 A;  4XNH B;  4U5Y A;  4HKF A;  1QST A;  3S6K A;  5ISV A;  1P0H A;  1BO4 A;  1OZP A;  4QBJ A;  4JJX A;  1KZF A;  3E0K A;  1KUY A;  4XNH C;  3R9E A;  1N71 A;  2FS5 A;  1U6M A;  2VXK A;  3I9S A;  3EC4 A;  3S6H A;  1QSM A;  3SXO A;  5KTC A;  4R87 A;  3FIX A;  2FSR A;  1P4N A;  1R57 A;  1S5K A;  3TTH A;  1YR0 A;  2QEC A;  2J8N A;  4H6U A;  3I3G A;  3SXN A;  4JLY A;  5KTD A;  3IWG A;  5KTA A;  5J8F A;  4B5P B;  1YX0 A;  4AVC A;  4B5P A;  2B4D A;  1IIC A;  2QIR A;  4LX9 A;  2OB0 A;  3CXS A;  1J4J A;  5DWN A;  4OLL A;  2D4O A;  2K5T A;  2J8M A;  4ORF A;  1Y7R A;  1M4I A;  2ATR A;  4AG7 A;  3JUW A;  4PK2 A;  3GY9 A;  4AVB A;  2G3T A;  4Y49 B;  4QUS A;  4KOS A;  2I79 A;  1ON0 A;  2FIA A;  3OWC A;  4YRH A;  3TO6 A;  2EUI A;  2BSW A;  3DNS A;  4QB9 A;  1M1D A;  4Y49 C;  3S6F A;  3WR7 A;  2CNM A;  1Q2Y A;  2VZY A;  2ZW7 A;  1PU9 A;  2OH1 A;  3T90 A;  3D2M A;  2ARH A;  5EC4 A;  4NSQ A;  3D3S A;  2P0W A;  4IUS A;  1I1D A;  4XPL A;  2B3U A;  4PSW A;  2OZU A;  1XE4 A;  3P2H A;  5J8C A;  2Q04 A;  3S6G A;  1Z9U A;  1S3Z A;  2C27 A;  2X7B A;  4AB7 A;  3LOD A;  4OAE A;  2ZW5 A;  4QVT A;  4MHD A;  3C26 A;  3F5B A;  2KCW A;  3FNC A;  3FYN A;  4ONU A;  2R8V A;  4MI4 A;  1XIX A;  2NMT A;  2FT0 A;  4KLV A;  3JVN A;  5IX3 A;  4F6A A;  3EO4 A;  1YVO A;  4R3K A;  4KOR A;  5HMN A;  4U9Z A;  1KUX A;  3F8K A;  2DXQ A;  3BJ7 A;  4JWP A;  2HUZ A;  4KOU A;  1RO5 A;  2VZZ A;  2Z11 A;  2P6E A;  3R1K A;  2RC4 A;  2ZW6 A;  5HH1 A;  2BL1 A;  3K9U A;  3TE4 A;  4FD4 A;  4U9Y A;  1V0C A;  2Q7B A; 
#chains in the Genus database with same CATH topology
 1S7L A;  5IE9 A;  3E22 B;  1NBM G;  2DPS A;  4LF4 O;  3ZJZ A;  1QHT A;  1TA8 A;  4OC5 A;  4R3L A;  2REE A;  2VQE O;  2Z10 A;  5CBG A;  4DNC A;  1FXK A;  3A8T A;  3K58 A;  1X12 A;  4H89 A;  1WWZ A;  5LMU B;  3HKB A;  4UUJ C;  3AK1 A;  3AG1 C;  2XEI A;  4R76 A;  4KOV A;  1N34 O;  3OW2 U;  4M3S A;  4XDJ A;  2ZEP A;  1L0L H;  1Z8X A;  3VOU A;  1B87 A;  4D7T A;  4GCZ A;  4RO2 A;  2CH7 A;  4H6Z A;  2X6A A;  4HNA A;  2AHY A;  4UFZ A;  4GLX A;  2JK5 C;  2P5O A;  2CK3 G;  1IXB A;  1Z2G A;  1FY7 A;  2C2A A;  4OAD A;  3BI1 A;  5IYC O;  2VQY A;  4E2A A;  3I55 V;  1TF8 A;  2PY5 A;  3SHP A;  4CGM A;  1W0K G;  4PDM A;  1SQF A;  4UEZ A;  1S76 D;  1N32 B;  4MCS A;  4QPK A;  4UCU A;  1IBK B;  4FFK A;  4DR1 O;  2AZ2 A;  3DSQ A;  3DLJ A;  4JXR A;  5CN0 A;  4CAE A;  4DRX A;  3ZRW B;  4DR2 O;  4K3A A;  5LOV B;  2JEV A;  4OPH A;  4WWV A;  4AIL C;  2ZIM A;  4KSF A;  1Z5R A;  3GKR A;  4CRY B;  4KZT A;  1MJA A;  2EK8 A;  3KQZ A;  1OCO B;  1K7D A;  4X8I A;  5CA0 B;  3VAT A;  1D5A A;  4P9P A;  1CP6 A;  3K5N A;  3KGQ A;  5JVD A;  4JXQ A;  4LUA A;  2WPW A;  4F0X A;  3ASO B;  2PQ8 A;  4IL6 Z;  2HC9 A;  1MZE A;  1JJO A;  1XL4 A;  1UPG A;  1YEW A;  1BPM A;  2V8G A;  4NVP A;  3B3C A;  4OME A;  4LF5 O;  3TXQ A;  3ZN0 A;  4AQY B;  1MSW D;  4JYA B;  1K4C C;  2WUU A;  3BJ8 A;  1TVK B;  3K0G A;  2JS5 A;  1F7Y A;  1MA1 A;  1CM0 A;  3F5T A;  1DF5 A;  4LWS B;  4YFJ A;  4J11 A;  2PR1 A;  2QM8 A;  2X6B A;  3TFY A;  1KB9 F;  1Y7E A;  3D67 A;  2EO8 A;  3GB7 C;  3CCQ V;  2Z5U A;  4F0Y A;  1TF9 A;  5EIB D;  4K0K O;  1LUW A;  1JVM A;  1HDQ A;  3K59 A;  1ZO0 A;  2C6C A;  2AE6 A;  2WPD G;  2JDI G;  2Y4T A;  4HAM A;  1Q82 W;  1S7K A;  5JGF A;  3N7Z A;  3UO3 A;  3GIU A;  2Q0Y A;  2ZEN A;  4JI3 B;  1YI2 V;  4JI8 B;  5KMG B;  4P4J A;  5H86 A;  2G3A A;  3RYI A;  2IM9 A;  4F6E A;  1N0J A;  2PDO A;  1YJ9 V;  1WPX A;  3CPA A;  3L71 H;  4QIW F;  4DV0 B;  2V8H A;  3CMA V;  2IBZ H;  4RS2 A;  1LNQ A;  4XDL A;  4JD6 A;  3FB5 C;  3B09 A;  2PIY A;  2KKW A;  4DV6 O;  3CC4 V;  5I0C A;  4XDK A;  2Z3N A;  2XUM A;  4UFW A;  2ZEL A;  4LF7 B;  3KI9 A;  3F7Y C;  4MCP A;  1VHS A;  4DXW A;  5TIS Z;  5KUK A;  4R6Z A;  3E2E A;  5EK0 A;  3BA9 A;  4DV2 O;  1FJG O;  1V54 B;  4G28 B;  2LO1 A;  1E1R G;  1K8A W;  1UWY A;  1V55 C;  3JAL A;  3PB6 X;  3CCU V;  3H8E A;  3K03 A;  4JTD B;  4IGG A;  3HKB B;  1E1Q G;  1CJW A;  2POK A;  4CGN A;  1KUV A;  1Z8T A;  1AJN A;  3DC6 A;  2UUB B;  4G27 B;  4PA3 A;  1QU7 A;  4J10 A;  2Q44 A;  4J41 A;  3BA8 A;  3RFR A;  2CH7 B;  1HWY A;  2F23 A;  3ABU A;  2VI7 A;  5LP6 C;  4BIN A;  3RO0 A;  5EBW C;  3IGR A;  1GRJ A;  2RQ6 A;  2CNS A;  1XI1 A;  5LXT B;  1FPO A;  2WLH A;  1BOB A;  2ZEG A;  4UFV A;  4UF4 A;  4MFJ A;  4B5O A;  3JRU A;  5CNP A;  3ML0 A;  4FVM A;  2FML A;  4U3J A;  2WAM A;  3QTC A;  3CXP A;  3B8G A;  4GX0 A;  2JBK A;  4IYI A;  1YTF B;  2ZE7 A;  1WN7 A;  3CWB H;  4DRX B;  1VF6 A;  1XFO A;  2VBQ A;  2UXX A;  1RM1 C;  5LYF A;  3FX7 A;  1K92 A;  4II9 A;  4EFB A;  4MHY A;  1TUE B;  2JS3 A;  4CRZ B;  1Z8L A;  2WLL B;  2CAZ C;  2CDY A;  4GZR B;  4F4L A;  1XMT A;  4CS0 B;  2RMK B;  4CS3 A;  5IJ0 A;  3TOA A;  2RNB A;  4FUU A;  1U96 A;  2F5I A;  5CPA A;  4ZOL A;  4J80 A;  3BHX A;  1ORQ C;  3NE7 A;  5D5Q A;  1K97 A;  3AK2 A;  4DR6 B;  3B3S A;  5B3S C;  3CEI A;  3B2E E;  2QA4 V;  5GON B;  3L2N A;  1VKC A;  3T8W A;  1GM9 A;  3OD4 A;  4PQA A;  4ZI7 A;  3ZJ0 A;  2JEX A;  2OCC C;  3BAB A;  4NKG B;  4TUY A;  2VEZ A;  4P4F A;  4BD9 A;  2IJI A;  2H5M A;  4JI5 O;  4ZHQ B;  2ZEO A;  4PA6 A;  3VQW A;  4DV7 O;  4LF8 B;  4TNU A;  4IIJ A;  1GAX A;  1JQ0 A;  1WAZ A;  1YIJ V;  2YID A;  1QSO A;  3K5L A;  2Y0P A;  2EIK B;  1PCA A;  5IDJ A;  1L8D A;  2AGA A;  2BE3 A;  4PHZ A;  4TV9 A;  5L3B A;  2AFO A;  1YDX A;  3KKW A;  1ZSP A;  4L8J A;  5BXZ A;  5J2U B;  3B77 A;  3ZED A;  3BEH A;  4G2K A;  4KUA A;  1AR4 A;  1EN6 A;  2IMO A;  4DR5 O;  4DW1 A;  2PC1 A;  4UV9 A;  2QM7 A;  5KAF Z;  2RB7 A;  2Z3M A;  2DWD C;  4RUH A;  2OWO A;  1UFH A;  4YJ2 B;  5CA1 B;  4LNU A;  4MJ8 A;  3ABM C;  4JI4 B;  3QAH A;  4FM2 A;  1F51 A;  4FM1 A;  3G80 A;  2JBJ A;  4R8F A;  4XNH B;  1RPR A;  3M99 B;  4U5Y A;  5C93 A;  3N2K A;  4CS4 A;  1EZV H;  4OC3 A;  4UV8 A;  2V77 A;  2WZN A;  4MTX A;  2LW1 A;  2QWP B;  1BO4 A;  1P0H A;  3ABL C;  2ITD C;  2G9D A;  4DO2 A;  2GDS A;  3W7T A;  4LR3 A;  4JJX A;  3E0K A;  5L3C A;  1KUY A;  5ITZ B;  1N33 O;  2WWW A;  3BFR A;  1XRY A;  4FZ0 A;  2FS5 A;  2CIJ A;  1XMQ O;  1W2B U;  4KFM A;  2O53 A;  2VXK A;  2YXY A;  2Q0A A;  3X2Q B;  4LF9 O;  4FLX A;  2DYS C;  3LDE A;  3WB0 A;  4PA7 A;  1P4N A;  1S5K A;  1JA8 A;  3BAA A;  2B9Z A;  3SPI A;  4DV3 B;  1PNL A;  4B7E A;  2J8N A;  4H6U A;  1K73 W;  3SXN A;  4JLY A;  2Q43 A;  1IVS A;  1YTF D;  2GSM B;  4B5P B;  1YX0 A;  4GX2 A;  4D7S A;  2P7T C;  3ABT A;  2QIR A;  4LX9 A;  2HJF C;  1S0V A;  3CXS A;  5FPO A;  2QWO B;  1Y7R A;  4I4T A;  4MTO A;  3PB8 X;  2PJ4 A;  3QNV A;  1S77 D;  2BOC C;  1VQ6 V;  5IJ0 B;  2F4V B;  1E79 G;  4MFL A;  3JCU Z;  2IJH A;  4B3M B;  1U97 A;  2YI8 A;  1VQ8 V;  4QE9 A;  2YXH A;  5JQG A;  2D3O W;  3LWU A;  3ZRS A;  4AVB A;  5THW A;  1IBL O;  2IH3 C;  3FB8 C;  3ASN B;  2WLJ A;  3JD2 A;  3MHH C;  4X8A A;  2I79 A;  4I55 A;  4OIW A;  4M6G A;  3VH9 A;  1CPX A;  2ZOF A;  4KHP O;  2QR4 A;  3CDX A;  4IYH A;  2OOT A;  2BSW A;  4QB9 A;  1NU1 H;  4CYQ A;  1I94 O;  2PJ1 A;  4X62 B;  4Y49 C;  3KHZ A;  1IOF A;  2BSK A;  4PI0 A;  3SYO A;  3IC9 A;  3RBZ A;  4A2Z A;  1PPJ H;  2ZW7 A;  1FKA O;  1YSC A;  3MRU A;  1GK9 A;  4B3S B;  3D36 C;  2OH1 A;  3LAC A;  4CAF A;  4P4E A;  2LGQ A;  2ARH A;  1A32 A;  2XAQ A;  3UKM A;  1IBK O;  4U7O A;  3CCV V;  2OYQ A;  3B3T A;  3SJC C;  1KQS U;  2QTS A;  5J8C A;  1O9H A;  3S6G A;  3PN1 A;  3ZMT A;  3L72 H;  1SC5 B;  2C27 A;  4X1Y B;  1KP2 A;  2ZEE A;  5K8N A;  2XOK G;  4EWT A;  1FFT B;  2YEV A;  1A2Z A;  1Z8W A;  1QMU A;  1AP6 A;  1Z5W A;  2A79 B;  1XJO A;  2PJ9 A;  3MN8 A;  3WAB A;  3Q4H A;  3C26 A;  3PB9 X;  3D68 A;  2KCW A;  1BS3 A;  2YXL A;  3TC8 A;  3PB7 X;  1SZT A;  2JIZ G;  4X65 B;  4ONU A;  2WLI A;  1XIX A;  2NMT A;  2K9P A;  3H1J H;  3SYQ A;  4GYC B;  3KCY A;  4JYA O;  1YQE A;  3PFE A;  4GUN A;  1BL8 A;  1QLE C;  2C1C A;  3D3Q A;  4U9Z A;  5HMN A;  4I7Z B;  1LAP A;  4FFB A;  4B6Z A;  2HUZ A;  4GKK B;  1RO5 A;  2VZZ A;  1KUQ A;  4PD4 F;  4IK2 A;  1TKF A;  2P6E A;  2QWN B;  1EZJ A;  3U10 A;  3RYF B;  2DMX A;  3CC2 V;  4ICG A;  3KHX A;  2UUA B;  2CE4 A;  3B40 A;  4P6Y A;  2DYR B;  1Y0Y A;  4ZKI A;  4FD4 A;  1R6T A;  4YY3 B;  4FWU A;  3TT2 A;  1ZL8 A;  3I1U A;  1AYE A;  1IYK A;  4X1I B;  3E22 A;  4NGQ A;  3RVZ A;  3BRC A;  3TCU A;  3UT5 A;  2QWR B;  1VEW A;  4JPR A;  4B3T B;  4M85 A;  5F48 A;  1YGH A;  4BIO A;  3HKD B;  4JZ2 A;  2Z3O A;  3S9M A;  3C3S A;  3FEC A;  3WT4 A;  4RUE A;  3CZX A;  4G1P A;  1Q6H A;  3KL9 A;  2A9H A;  5B1A B;  3B2Y A;  4CH3 A;  3V7Z A;  3P30 A;  5C82 A;  3ZRV A;  4P4B A;  4ZX8 A;  1SS3 A;  2AJ6 A;  1FXK C;  4QE7 A;  1B06 A;  4I4T B;  1Y9W A;  2PSW A;  2QJ8 A;  3JAS B;  4LF6 B;  3CPX A;  1TKH A;  3EXA A;  3VAR A;  1XDC A;  1WPB A;  1Q3E A;  3H1I H;  3MAQ A;  1PUA A;  1NSA A;  4K30 A;  2B5G B;  3D2P A;  1JR9 A;  3FH4 A;  4FLW A;  5JQG B;  1VQL V;  1TIQ A;  2QKA A;  2DWE C;  3EHB B;  5AG4 A;  2O28 A;  3S3X A;  2F43 G;  2X7R B;  3ZRW A;  5LOV A;  4M6H A;  3L9D A;  1YIT V;  5EZY B;  3FKS G;  1AUG A;  5JCO A;  5L3E A;  3PBE A;  2Z3Y A;  4I5S A;  2ZXW C;  3OEH G;  4RQF A;  2V8D A;  2KG7 B;  2BSK B;  1ZAU A;  2CXA A;  3FJU A;  3VWE A;  2XAH A;  5HVF A;  5F47 A;  3LDC A;  1M57 C;  2FIW A;  2ODM A;  4NCZ A;  3OFN G;  2OU2 A;  1XMO O;  3L75 H;  2IU0 A;  3FAV B;  2ZD9 A;  1IOI A;  3BHP A;  2HHH O;  1Q6U A;  1H8E G;  2FCK A;  3W7X A;  2GLJ A;  1Q2C A;  3T1H B;  5DEC A;  1IBM B;  1S72 V;  3BY6 A;  1OCZ B;  4NTW A;  2ZEH A;  4R57 A;  1XMB A;  4KLW A;  4MCQ A;  1QBZ A;  1YVW A;  4HNW B;  2HVK C;  4LWS A;  4UVC A;  4FMT A;  4Z2W A;  2GRE A;  1XIL A;  3J7A U;  4XPD C;  1HNX O;  4B13 A;  3SJF A;  2NN4 A;  3IFX A;  4UVB A;  1TKJ A;  1CBX A;  2P4K A;  4JF3 A;  2WLI B;  4J7K A;  5CBH A;  1SA0 A;  4J9Z B;  1J5E O;  2ZXV A;  1H38 A;  4DR6 O;  4WF9 V;  4BR6 A;  3FBU A;  4CAX A;  2XEJ A;  1XL6 A;  3R9F A;  1PNM A;  2EIL B;  1QQC A;  2W6J G;  1NQT A;  4FJC C;  5KMG A;  5LYI A;  2Y69 B;  4NF1 A;  5EC2 C;  4D6T H;  1AI6 A;  3BI0 A;  1KP3 A;  3H5Z A;  2JJ2 G;  3O65 A;  4MHP A;  5LMN B;  1CG2 A;  1X4T A;  3FRM A;  4DV1 B;  3RZA A;  4NR1 A;  2QML A;  4JI2 B;  4OX9 B;  1WB8 A;  2LGW A;  4Q6G A;  2ZDI A;  1H2S B;  4OID A;  3SYP A;  3UT5 B;  3T1Y O;  3CB2 A;  4HPS A;  4NJR A;  1SF9 A;  5J2T B;  3FMC A;  2JRI A;  4PDR A;  2WYR A;  1K9M W;  5K8P A;  1QSN A;  4PV6 A;  4GM5 A;  4Q36 A;  3NFZ A;  2PI4 A;  1FXV A;  4BIU A;  4MVO A;  4WFG A;  4NJQ A;  3OTF A;  2EZP A;  4OC2 A;  4GKJ B;  2FXF A;  2UXD O;  1M56 C;  1OCC B;  4DR4 B;  2V7Q G;  5EYP B;  1I12 A;  5J1Q A;  2B4B A;  4NGP A;  3G6B A;  4R9M A;  2F7V A;  5H2F Z;  1S3J A;  1I5Y A;  4JI4 O;  3ZCC A;  2BTQ B;  3R9G A;  5H9C A;  2XAS A;  1K5S A;  4K3N A;  1CPY A;  3CP1 A;  4TOI A;  4JV5 O;  1QR9 A;  4A5U B;  2QKS A;  3DDD A;  1SQG A;  4K8Z A;  2JDC A;  5LXT A;  4TWK A;  1YSJ A;  5G20 A;  4MVQ A;  1LRZ A;  4OXS A;  2DW4 A;  3FB7 C;  3K3W A;  2Q4Z A;  3JAM N;  1BGY H;  1M4G A;  4CZZ A;  1PYT B;  3PB4 X;  1VGY A;  3OT7 A;  2B3V A;  2RCV A;  4X88 A;  2WLL A;  4ZY2 A;  2GU2 A;  1FFX A;  2ZED A;  1YLO A;  1R3K C;  5AG5 A;  3BLN A;  2OCH A;  3RYO A;  5DED A;  3PP9 A;  4TV8 A;  3IC7 A;  4E2L A;  3ZMS A;  5E79 Z;  1VQ5 V;  2PF4 E;  2EX3 A;  3RYH B;  3TCV A;  3H1H H;  3RGB A;  1ZLH A;  4NXN B;  4KUB A;  2OT5 A;  3ETG A;  4UIA A;  4CYP A;  3N27 A;  2YNC A;  1Q90 D;  3RNZ A;  5GON A;  2G0B A;  3KAS A;  2D4P A;  3IO1 A;  4ZHQ A;  5JH9 A;  1MK4 A;  1VF7 A;  2VL1 A;  4I0X A;  1BCC H;  3CCJ V;  5F46 A;  3AG4 B;  1IYL A;  3CXQ A;  1SA0 B;  1XF8 A;  4OGQ B;  3CYO A;  5D5P A;  1SQH A;  5IY5 B;  4U7N A;  1DTD A;  4JI0 O;  4MTF A;  1L0C A;  4LCU C;  2HP8 A;  4UCS A;  1GN6 A;  5B1B B;  1M9N A;  5J2U A;  1SZX A;  4JYW A;  4X3R A;  1MG1 A;  5KAI Z;  5FL7 G;  3QO7 A;  2JVD A;  5FPR A;  1HNW B;  1DE4 C;  4LFC O;  2DEA A;  1AIL A;  4LQG A;  3B4S A;  4JAS A;  1RFY A;  1G1X B;  1SRY A;  1Y67 A;  1QSR A;  3KR5 A;  3AG2 C;  4JI6 O;  5JPH A;  4B3S O;  3ZZI A;  1WA8 B;  4YJ2 A;  1S7N A;  4DR7 B;  2DJV A;  1QVF U;  4B3R B;  4PEL A;  4W4K A;  5CA1 A;  1F2O A;  3MDS A;  4UCV A;  4X66 O;  3D4U A;  4NGM A;  2XAJ A;  3RN4 A;  1G4Y B;  5ISV A;  1I08 A;  1JCH A;  4JZG A;  4RQE A;  4Z65 A;  2LQT A;  5J9P C;  1SQX H;  2Q9L A;  3GUX A;  1AP5 A;  1YF2 A;  3STZ C;  3K2K A;  5ELY A;  5ITZ A;  2IJZ A;  4JI7 O;  1SET A;  1Y4M A;  3SPC A;  3IJ3 A;  3D7G A;  3EC4 A;  3K9S A;  3S6H A;  4DYO A;  3ETD A;  2ODF A;  5KTC A;  3JD0 A;  3AG3 B;  2IQ6 A;  5LL6 Y;  2FSR A;  3E8G A;  3D7D A;  1BZK A;  3SR2 C;  3TTH A;  2EBO A;  1BT8 A;  1MAB G;  2QEC A;  1H2M A;  4NYK A;  1Z5V A;  2QYV A;  4B14 A;  4GKK O;  1HP8 A;  2H94 A;  4OPA A;  1WB7 A;  1NR1 A;  3THO A;  4LFB B;  1WP7 A;  3JSN A;  4AI8 A;  3OGC C;  3CRQ A;  2OTL V;  5J8F A;  3R66 A;  5KTA A;  4OC4 A;  4NXM B;  4AVC A;  4B5P A;  3NR7 A;  3ABK C;  3H8F A;  4UCP A;  3CXH F;  4LH6 A;  4RUF A;  4R50 A;  2OB0 A;  2JGD A;  3QO8 A;  5EBL C;  1J4J A;  2R9A A;  4OLL A;  4RN7 A;  3A0B Z;  1ARL A;  4JI1 O;  2K5T A;  4ORF A;  4UCN A;  1HW7 A;  1FFX B;  2QE7 G;  4PXE A;  2Q4P A;  3N2G B;  4UEE A;  2EIM C;  1LAM A;  3KZI Z;  4ZI6 A;  3WC7 A;  3RWR D;  4MT8 A;  2XAG A;  4B3T O;  1PL0 A;  3LUT B;  4JAU A;  4TV8 B;  3ZN1 A;  3P3N A;  4B10 A;  3F5W C;  1GTO A;  2G3T A;  1XHX A;  3IWW A;  3ETE A;  4QUS A;  4H0L B;  3GWO A;  3OMA B;  3FVL A;  4XBF A;  1OCR B;  2FIA A;  4KS9 A;  4A30 A;  4YRH A;  5KUM A;  3TO6 A;  7CPA A;  1SQV H;  2EIN C;  2CTW A;  3JD1 A;  3DNS A;  1N4C A;  4MW3 A;  3CD6 V;  1M1D A;  1EN4 A;  3B3V A;  4EB6 B;  4MFZ A;  3G67 A;  1O9G A;  5GTH Z;  3S6F A;  2PJ8 A;  2E74 B;  4BW9 A;  2CNM A;  1Q2Y A;  4C2Z A;  3FF3 A;  4DYL A;  4Z1V A;  4P4I A;  3H8G A;  4I0X B;  5F2V O;  2PI5 A;  1Q5O A;  1F23 A;  4FM0 A;  3SJB C;  1Q43 A;  3WC6 A;  4FPP A;  2A7W A;  3HKE B;  5G1Z A;  1ZLZ A;  3FB6 C;  4IUS A;  1I1D A;  3VQX A;  2OZU A;  3ZMU A;  1HR0 B;  1VIX A;  1XNQ B;  1XE4 A;  3G71 V;  3CC7 V;  2NYQ A;  1F2P A;  5LHG A;  2H8P C;  1NS1 A;  1Z9U A;  2RFH A;  1FT7 A;  1ELM P;  4AB7 A;  3LOD A;  4X1Y A;  4WBN B;  1AVM A;  1PV0 A;  4QVT A;  4X2T A;  1IXM A;  3OTO B;  4CBC A;  3RVY A;  3F5B A;  2NLJ C;  5JH7 A;  3FNC A;  1OCZ C;  4B7K A;  4FLU A;  3SPG A;  3SJE A;  4BIZ A;  2ZM6 B;  4KLV A;  5LYD A;  3JVN A;  3N5F A;  2QM4 A;  4GX1 A;  4F6A A;  4YJ3 B;  4J7Z A;  4LF4 B;  3B7I A;  3T1H O;  4R3K A;  4DR3 O;  1IBM O;  4ASU G;  1KUX A;  1K4D C;  4A37 A;  3F8K A;  3BJ7 A;  4LFA O;  4JWP A;  5EIB C;  2OIG A;  2Z11 A;  4X64 O;  3F7V C;  2ETN A;  4PXC A;  3RYF A;  2E5L B;  5K1P A;  1NTM H;  3OUS A;  4KP4 A;  3GWK C;  1XEQ A;  2ZW6 A;  1OHH G;  2ZIN A;  2BL1 A;  1FD9 A;  4DV4 O;  2UXB O;  5A28 A;  1KU9 A;  1WP8 A;  3TX8 A;  3MHS C;  3EFA A;  1B6B A;  1GN2 A;  4N21 A;  3AG1 B;  1Q2D A;  4X1I A;  2YC0 A;  2CUG A;  5L3F A;  4TT3 G;  2YSU B;  4AVA A;  5KHI A;  1YZB A;  3WG7 B;  1F57 A;  1VQO V;  5JM6 A;  4DV5 O;  2VRZ A;  2JDD A;  1ZG9 A;  4XPK A;  3OMI B;  4DR1 B;  3FXT A;  3HKD A;  4PA4 A;  5IT9 N;  2ZR2 A;  1RPO A;  2Z0Z A;  4DR2 B;  1Y66 A;  1KD1 W;  3K9T A;  3ZIA G;  4B12 A;  1M4L A;  1KYO F;  4AG9 A;  3G3S A;  4MTG A;  3RBU A;  1LR1 A;  2PTM A;  2B1G A;  2JGD B;  2Z0A A;  4JI2 O;  4OX9 O;  1K34 A;  2VQF O;  2WPX A;  4QNH B;  2X0L A;  2CGO A;  1SKV A;  4AHC A;  5IJ9 B;  4O23 A;  4WFH A;  5B1O A;  1BPN A;  3JAS A;  4FLT A;  3TO9 A;  3KZW A;  1NT2 B;  4B11 A;  5LYJ A;  2BUE A;  2HLD G;  1Y0R A;  4LF5 B;  2P06 A;  4F9U A;  2B5G A;  1NI8 A;  2KB1 A;  4K8X A;  2ZW4 A;  5FVJ A;  4I9Q A;  2LP7 A;  2GIV A;  4O4I A;  3CRA A;  4H33 A;  5LMU O;  4DR4 O;  1NVP D;  2RN9 A;  4TQF A;  2FE7 A;  4WCE V;  1YK3 A;  3D7F A;  3JAW A;  2EBJ A;  2Q0O C;  3FX6 A;  4P4D A;  5B66 Z;  4N23 A;  1CX8 A;  3K9A A;  2IW5 A;  5JJE B;  5EZY A;  3B35 A;  3SJX A;  4TSF G;  4DK1 A;  5I4M A;  2XND G;  2HV2 A;  3MD0 A;  3A2F A;  4K0K B;  3CCL V;  2KG7 A;  3H4Q A;  4KOW A;  3TK1 A;  2D2C B;  4KXR A;  2Z3P A;  3PEI A;  1JMK C;  3D8P A;  4CGL A;  4ZGY B;  2BCC H;  4FD5 A;  5LGN A;  3NH4 A;  4MY3 A;  1OCO C;  1OV9 A;  3FAV A;  1N32 O;  1TXR A;  4O2A A;  1M93 A;  1Z4E A;  4CH5 A;  1CPS A;  1MJ9 A;  3CRR A;  1Y9K A;  3M7M X;  4Z1M G;  3ASO C;  4JAV A;  3K57 A;  2Z3K A;  5B5E Z;  3NH8 A;  1AI5 A;  1M1K W;  1NKD A;  1IZ3 A;  3P2F A;  3PJS K;  1VQ4 V;  2R9R B;  2YGW A;  2ZPA A;  2UXN A;  1F4M A;  3OGI B;  3GYA A;  2A0L A;  1IDS A;  3LNM B;  3GB0 A;  1YW6 A;  5JH7 B;  4DV6 B;  2J9A A;  3DGE A;  4C2Y A;  2UU9 B;  3AG7 A;  5H5N A;  5H6R A;  5DWM A;  1VP7 A;  3TOB A;  4ZBG A;  4AQY O;  1VQ7 V;  3EY5 A;  1UFI A;  3K5M A;  1NJI W;  1PL4 A;  4A33 A;  5BR8 B;  4GS4 A;  5A9G A;  4DV2 B;  1FJG B;  1FS0 G;  3O9O A;  1YJN V;  2NNU A;  4UCT A;  1F4N A;  2R1I A;  1WNS A;  4H44 B;  2GFQ A;  3SDL A;  1IID A;  2HQY A;  5C88 A;  2N04 A;  2JGU A;  5FLX N;  4UVA A;  1JJ2 U;  3W6X A;  3W6S A;  1LAN A;  5K8M A;  1GH6 A;  1B3Q A;  1IGB A;  2WA3 A;  4Q20 A;  2ILM A;  4MHN A;  1QQ9 A;  4NGT A;  4ZIB A;  1V55 B;  1K33 A;  3DXR A;  4DK0 A;  2CNT A;  1MOF A;  1PM9 A;  3ZS8 C;  2DE0 X;  2AHZ A;  2GAN A;  1MMM A;  1P7B A;  4JI3 O;  4JI8 O;  2Q4Y A;  3UY5 A;  4JYY A;  1K5Q A;  5AG2 A;  5KHH A;  2AFZ A;  3IU2 A;  5J2T A;  2P6G A;  4ABM A;  2M6Y A;  1HNW O;  4BMH A;  5LP6 B;  5H84 A;  2AZ0 A;  1IUR A;  3RT3 C;  2ZDI C;  2ZOG A;  2Y0M A;  1P7G A;  3D8C A;  3K79 A;  3QG5 A;  4LH7 A;  3D3I A;  3VQV A;  4DV0 O;  2JLM A;  3PGP A;  1UJW B;  4WFF A;  1VHO A;  1I0H A;  4A39 A;  1W0J G;  2QDO A;  4KUM A;  4DR7 O;  5EYP A;  4B3R O;  5K8O A;  1DK1 A;  1AR1 B;  4MFP A;  1V54 C;  5JJN B;  4I49 A;  4LF7 O;  1Z4R A;  2BTQ A;  5EBV A;  1KKC A;  4RWU A;  4JGS A;  4X20 A;  3ETQ A;  3QB8 A;  2P4V A;  4JYB A;  1RM1 B;  2YUA A;  3FB3 A;  4YU9 A;  4UCR A;  5LYJ B;  5JJJ B;  3OR6 C;  1Q8I A;  4QJF B;  3W7S A;  1TGO A;  2EIJ B;  3TGU H;  3CE2 A;  1FAF A;  5HXD A;  1BQ0 A;  4O4I B;  4W9Y A;  3OUF A;  4PXB A;  2F1M A;  1H2K A;  3JAW B;  2HVJ C;  2UUB O;  2BEI A;  5E1A C;  1DTO A;  2QGN A;  3PBB A;  1Q6I A;  1VIB A;  4O4J A;  1FYJ A;  1HDU A;  4E8O A;  4KVO E;  4FLZ A;  2ZIO A;  1JFF B;  2V4D A;  3WB1 A;  4CGO A;  4DV7 B;  5B3S B;  5F49 A;  3IEH A;  3CSX A;  2DOS A;  4FLY A;  4P45 A;  4KOY A;  1RXT A;  5IB0 A;  2OCC B;  3APQ A;  3W7W A;  2OZG A;  4MY0 A;  4W4L A;  2BTO A;  4O2A B;  4UWJ A;  5LHI A;  3RYH A;  2J8R A;  2PVV A;  4H13 B;  4NXM O;  1S7F A;  5E96 A;  1VQP V;  2GE3 A;  3JCZ A;  4AXV A;  3R95 A;  4F6R A;  4PA9 A;  2FL4 A;  3RYC B;  2PR8 A;  3HB3 B;  4DR5 B;  1AI7 A;  5LA6 B;  3VQY A;  3FYI B;  4IT5 A;  4NEX A;  1B04 A;  4DUY B;  2ZE8 A;  2LFS A;  4CH4 A;  2WSA A;  1CEZ A;  2EVN A;  3DSB A;  2FYU H;  4X5K A;  2W0F C;  5IWA B;  4L89 A;  1ZX3 A;  4YGO A;  2ZKO A;  1Z2L A;  2UXC B;  1WK4 A;  5K1X A;  4IHJ B;  3IJ4 A;  2ADQ B;  1H2N A;  3WFV A;  3ABM B;  3LMS A;  3JAR B;  2EWB A;  2EIK C;  5LRK A;  2F66 C;  2ATK C;  1KEC A;  3JAK B;  4L87 A;  3BCC H;  1DGS A;  4FD7 A;  3E86 A;  4LF8 O;  3R96 A;  4QPJ A;  4HNX B;  2WLK A;  3ABL B;  3ZHT A;  1L1F A;  4E0A A;  4LF9 B;  4F8Z A;  4NXY A;  3SYA A;  2ZE6 A;  1WA8 A;  3A0R A;  1B6Q A;  4YHH B;  3CCM V;  1AI4 A;  4P30 A;  1Y74 B;  3DXR B;  1KWM A;  1HR0 O;  1ROP A;  3JAT B;  1YJW V;  1QST A;  3S6K A;  4CS2 A;  4DJL A;  3E8B A;  1OZP A;  2DYS B;  2ABZ A;  4UEF A;  3CCR V;  1GYT A;  4QBJ A;  4JTA B;  2L35 A;  1JQG A;  4R6T A;  4XNH C;  3FYE B;  3R9E A;  2YI9 A;  1N71 A;  1TUB B;  3QAY A;  3GVM A;  1L0N H;  1QSM A;  1GO3 F;  3SXO A;  3SJQ C;  3CHX A;  2UUC B;  4FZ1 A;  4EKW A;  3SYC A;  3HR0 A;  3U11 A;  2PZS A;  3FIX A;  1LFW A;  2R70 A;  1R57 A;  1GM7 A;  3J80 N;  1KC8 W;  3W7U A;  4X20 B;  3LDD A;  2HKO A;  4R8C A;  1IU8 A;  1YR0 A;  4DUZ B;  1SQQ H;  4YIP A;  1KBH A;  3HUV A;  3FFQ A;  3X2Q C;  1IBL B;  1CXZ B;  2OTJ V;  3BPZ A;  3GLJ A;  2E5L O;  5KTD A;  2A06 H;  3DTU B;  2LJ2 A;  4WFB V;  4MVR A;  1ARM A;  3CJH A;  5DS0 A;  2B4D A;  1IIC A;  4K35 A;  1JX9 A;  4IAV A;  1I5X A;  4KHP B;  1W59 A;  4MVZ A;  1BLL E;  3WG7 C;  4O4J B;  5L3G A;  1P49 A;  2ZNI A;  2J8M A;  1I94 B;  1LCP A;  2DQ3 A;  1M4I A;  2NSM A;  2ATR A;  4MVS A;  1VQN V;  2F8H A;  4MFK A;  2Q5Z A;  4AG7 A;  4DV3 O;  1VF6 C;  3JUW A;  3H1L H;  3N2G A;  1Q81 W;  3K04 A;  1ZG8 A;  3WB2 A;  1VF5 B;  3E8H A;  4JTC B;  4U3F H;  4LQ6 A;  1QNM A;  1GMG A;  2Q51 A;  3LSU A;  4Y49 B;  1XBU A;  1XHZ A;  4A32 A;  3OWC A;  5EBM C;  4MW8 A;  4UCO A;  1M90 W;  1H2L A;  1NZ6 A;  1R73 A;  3OR7 C;  3OE7 G;  3JYC A;  4F6R B;  1GKF A;  3S9N A;  2YIC A;  5BZB A;  3AK3 A;  2ZNJ A;  2HB6 A;  1KKD A;  4NFR A;  2PJ5 A;  4UCM A;  3D66 A;  4EB6 A;  3ASN C;  4QGP A;  5KX5 B;  4YXW G;  3JTK A;  1XNR B;  3WR7 A;  2VZY A;  1RSO A;  2F4V O;  3B8M A;  4UB8 Z;  5JWP A;  1PU9 A;  4B3M O;  4LC1 A;  3D2M A;  3T90 A;  5EC4 A;  3D3S A;  3HKE A;  1AR5 A;  2B3U A;  4PSW A;  5HVH A;  2GTS A;  2IH1 C;  5KHJ A;  3K06 A;  2Q04 A;  2CTR A;  1XOV A;  3IU1 A;  1S3Z A;  3BVO A;  2Q7H A;  2VS0 A;  5LGT A;  1SES A;  2KSD A;  4J7J A;  2R72 A;  3ISZ A;  3H9V A;  3CS5 A;  4X62 O;  5LRG A;  4WBN A;  1QLE B;  4NGR A;  4OC0 A;  3ZBH A;  4NTY A;  1N8R W;  2C6P A;  4MSW C;  2IJJ A;  2FT0 A;  4O4H B;  1EBO A;  2WLM A;  5IX3 A;  1XUQ A;  4DUK A;  4P44 A;  2ADP A;  2ZE5 A;  3L73 H;  1AJP A;  1YVO A;  4YJ3 A;  1X59 A;  3V38 A;  2IU3 A;  2PCU A;  3LSQ A;  2OR4 A;  5CB4 B;  1NTZ H;  2PRQ A;  4PXD A;  4ZY1 A;  1G8M A;  4FIP C;  4MVU A;  4CC5 A;  5BMV A;  1RTQ A;  2Q7S A;  3NA6 A;  2XEF A;  4KOU A;  1R3N A;  2Q7E A;  1N36 B;  4R7M A;  1ZWI C;  4MRI A;  1NTK H;  4NGN A;  3STL C;  3R1K A;  4Q38 A;  2P90 A;  5FNV B;  4C68 A;  4CH6 A;  2HEP A;  3TE4 A;  3SGI A;  4X65 O;  3G4S V;  2CF4 A;  1ZTE A;  2UU9 O;  2LFR A;  1VQK V;  1K3E A;  2Q7B A;  2B1I A;  2MW2 B;  1YCI A;  2Q7G A;  4X1K A;  5DM6 V;  2YIA A;  5LHH A;  1SER A;  5BR8 O;  5H6Q A;  1YRE A;  2E75 B;  3VBB A;  2KQX A;  4CPA A;  2ITC C;  2DYR C;  3CRM A;  2MK3 A;  1FXK B;  2B5U A;  3HPL C;  1YHQ V;  3I56 V;  3C90 A;  4R7C A;  2UUA O;  1RP3 B;  3CJH B;  4ZY0 A;  5IV0 A;  2Q73 A;  3J81 N;  4O4L A;  2B4D B;  2BCO A;  4A38 A;  1MSD A;  5IB9 A;  3OMN B;  3S3W A;  1YVK A;  3TXS A;  2Q67 A;  3DR8 A;  2PIZ A;  4HNA B;  4YY3 O;  4CAW A;  1XEB A;  3KR4 A;  3DR6 A;  1R3I C;  3T4Z A;  5IJ9 A;  1VHE A;  5LYL A;  3K0D A;  5B1A C;  1R43 A;  2A4N A;  2YIB D;  1XMO B;  3QF7 A;  1MJB A;  2HHH B;  4P9O A;  1R6N A;  3VWD A;  2ZXW B;  3KCX A;  4NB5 A;  1NR7 A;  3ZHQ A;  3CCS V;  4M6I A;  4B08 A;  3H1K H;  2JEW A;  1M57 B;  4ZX9 A;  5AG7 A;  3NH5 A;  4OP4 A;  4UA3 A;  4KOX A;  1NVP B;  2EIJ C;  1OJH A;  4BBH A;  3G6E V;  1BHA A;  1HNX B;  5KHK A;  2O57 A;  4JYC A;  5JVD B;  2OZH A;  3B3W A;  1FNO A;  2PRB A;  4LF6 O;  2Q6A A;  1HNZ B;  2HG5 C;  1J95 A;  1Q86 W;  3G8W A;  4KSI A;  4QC6 A;  1RSO B;  4CC6 A;  1GN4 A;  5A27 A;  5G21 A;  2A3Q A;  3PZJ A;  1J5E B;  5AGE A;  1S5L Z;  4XPD B;  3RW0 A;  1AJQ A;  2DPT A;  3LD2 A;  3LSS A;  1FXH A;  2IL4 A;  1GHE A;  2R98 A;  2GTA A;  2EUL A;  3T2M A;  4FBE A;  2QSA A;  3A9L A;  3EFF K;  1K4J A;  1DLB A;  3ZX6 A;  2W6I G;  5LGU A;  5IYB O;  1ZLI A;  2FVG A;  2REF A;  4PSX A;  4PPZ A;  2PJ0 A;  4KVX A;  2Q8V A;  1H2G A;  2PGG A;  5IYD O;  4UFX A;  1VQM V;  5CMU A;  4CYO A;  1XQ8 A;  1IB1 E;  4FAI A;  4WFA V;  3T9Y A;  1S60 A;  4A95 A;  5IYZ A;  4CYN A;  1Y6X A;  5EC1 C;  2OIE A;  3T1Y B;  1BMF G;  2GUZ A;  2PYJ A;  4MFQ A;  2R7H A;  3RYI B;  5BMV B;  3APO A;  1D2D A;  3CME V;  1EFR G;  3KQX A;  3H01 A;  2VQE B;  1KMI Z;  3EXN A;  2P67 A;  2UXD B;  1ENV A;  2I00 A;  4NGS A;  1QR8 A;  2L6L A;  4DUY O;  1I7F A;  2AFS A;  1US6 A;  4C7H A;  1EE3 P;  5LRJ A;  4MBU A;  1R3L C;  2Y48 A;  3E83 A;  3I5D A;  1N34 B;  2EIL C;  4J9Y B;  1SQP H;  5IWA O;  2EJR A;  2Y69 C;  3MGD A;  1IY7 A;  4GXH A;  3OEE G;  4X1K B;  4JV5 B;  1M56 B;  4O2B A;  4RAI A;  2UXC O;  1VQ9 V;  1WJZ A;  2P22 C;  4PDV A;  3ZHR A;  3SI0 A;  3LNN A;  2P6F A;  1TAE A;  4EME A;  3JAL B;  3V8I A;  4JZ0 A;  5G22 A;  1DF4 A;  3ZMV A;  1GN3 A;  5LP6 A;  4LBE C;  2CTC A;  4CAV A;  2JEU A;  3CCE V;  3W91 A;  4IF5 A;  5LMN O;  4O4L B;  2AFM A;  2QVP A;  3JD3 A;  4L8A A;  4UBR A;  4DV1 O;  2V1D A;  3IWE A;  2O4H A;  3UM7 A;  4YHH O;  1NH2 B;  1MZF A;  3NE8 A;  4MVM A;  2XEG A;  2B58 A;  2Q69 A;  1OCC C;  5C8Y A;  2AFU A;  3CXC U;  2PJ7 A;  3K08 A;  4ONW A;  4U3J B;  6CPA A;  3M8A A;  4TQD A;  3F0A A;  2FTK A;  4I50 A;  3SJA C;  3QNE A;  5HVG A;  1M44 A;  1COW G;  1R1B A;  4PJ0 Z;  3SJG A;  4GKJ O;  4BWA A;  4PDL A;  1I21 A;  1Y76 A;  2GHY A;  1YLE A;  4KOT A;  4FD6 A;  1PNK A;  3HKC A;  3JD4 A;  2DQ0 A;  2UUC O;  3ZHV A;  1JWQ A;  5DN6 G;  3E89 A;  3U0Z A;  3K5O A;  1JFF A;  2ZEF A;  4UWI A;  3E35 A;  3ZHS A;  4DUZ O;  1NSL A;  2QWQ B;  2PJ3 A;  2E76 B;  1S5H C;  4ZOL B;  5L3D A;  4P2Z A;  5KA6 A;  2PVW A;  1P4R A;  1OBR A;  4P10 A;  1PKX A;  1BSM A;  5D29 A;  5JCO C;  4JI0 B;  2XT9 A;  2N05 A;  2H3O A;  2N74 A;  2AFX A;  2Y0I A;  3A0H Z;  2QKC A;  3SPJ A;  4ZI7 B;  3HLP A;  3T1C A;  4TUY B;  3RYC A;  1NE9 A;  2GBO A;  2PJA A;  3B8N A;  2ZT9 B;  3WU2 Z;  1LOK A;  4LFC B;  2ZR3 A;  3EVK A;  5LA6 A;  2M7W A;  2R9I A;  1BQZ A;  2PE3 A;  4HNY B;  4IIJ B;  4FLV A;  1AMP A;  4MS2 A;  2F93 B;  4JI6 B;  4OC1 A;  2K1E A;  2CY2 A;  1XOU A;  2YS8 A;  5IYZ B;  1VAR A;  1YME A;  4EVY A;  3DGV A;  4TV9 B;  1M4D A;  3L74 H;  2PJB A;  2Q4V A;  4KVM E;  3KKY A;  4X66 B;  2W0X A;  5CBF A;  1PD3 A;  3T4D A;  2EK9 A;  8CPA A;  1LUV A;  2BOB C;  2GUZ B;  5LBQ A;  3AG2 B;  2YNE A;  4NXN O;  3SI2 A;  2FB5 A;  1VMG A;  3OM3 B;  4IHJ A;  3AG4 C;  1D5N A;  2XTA A;  3JAR A;  1R6K A;  1OZ0 A;  4PI2 A;  5A2Q N;  3TO7 A;  3CPW U;  5IY5 C;  4JI7 B;  1XNR O;  1NMT A;  5HFL A;  2YND A;  3JAK A;  2Z3L A;  3FEE A;  4RI1 A;  3KG2 A;  2NR5 A;  4LNU B;  4TWE A;  5B1B C;  3IAY A;  3AEI A;  5GCN A;  1ZUQ A;  4A94 A;  1YW4 A;  3L70 H;  5AG6 A;  4HZ3 A;  3SPH A;  4J3G A;  4EFD A;  1BHB A;  2X6C A;  4PK3 A;  5JQ4 A;  5B1N A;  5BWA B;  3N2K B;  1Y74 A;  2QJ1 A;  4O2B B;  4HKF A;  2HR3 A;  3JAT A;  2CGN A;  5D8N A;  4MHZ A;  3ZHU A;  2QEX V;  2I3C A;  2PJ6 A;  1T5E A;  2E3C A;  4GT1 A;  3D7H A;  4MCR A;  1KZF A;  4GX5 A;  4KSA A;  3UO2 A;  2Q68 A;  2VWJ A;  2PUS A;  3FED A;  4BW5 A;  1ELL P;  1QLN A;  1U6M A;  3I9S A;  2ZCE A;  1Q7Y W;  2IJK A;  1TUB A;  4LP8 A;  4JI1 B;  1NH2 D;  2BOA A;  4R87 A;  3IC1 A;  4HBN A;  1Q7L A;  4DW0 A;  4ZBM A;  3ABK B;  3P32 A;  5C8Y B;  1QCE A;  5HFM A;  3I3G A;  1JPX A;  1M5I A;  1R3J C;  3ZRX A;  1H8H G;  1N36 O;  4I50 B;  1WLE A;  3UQ8 A;  3AG3 C;  1BE3 H;  2HFE C;  3IWG A;  2PYL A;  2AXT Z;  2VWK A;  1IX9 A;  2EIM B;  4CGP A;  1Y76 B;  1EN5 A;  2QTO A;  5DWN A;  3HKC B;  2D4O A;  3NXS A;  2XHB A;  4YWY A;  5CBM A;  3JSL A;  3PFO A;  3TET A;  4BAY A;  4X89 A;  4PV1 B;  1GM8 A;  4JI5 B;  1BAV A;  3R65 A;  5BY1 A;  5GTI Z;  2WLN A;  2C6G A;  4PK2 A;  3QO5 A;  2EIN B;  3GY9 A;  1JOY A;  4A31 A;  3ICX A;  4UXN A;  3ISX A;  3OAA G;  3RAM A;  4C7U A;  2GLF A;  2YIB A;  4I55 B;  4KOS A;  4LFB O;  3S9L A;  1YXB A;  2CTP A;  1ON0 A;  2CTB A;  2RDC A;  2DF5 A;  3CT9 A;  1AB3 A;  4OKO A;  3UCS C;  4KL1 A;  2ANP A;  2EUI A;  3D36 A;  4WFE A;  1CP7 A;  5KHG A;  3FD9 A;  5CA0 A;  1QVG U;  5KLV H;  1HEE A;  1OCR C;  1ZG7 A;  1CP9 A;  5KX5 A;  2CTQ A;  2HJD A;  3TJT A;  2ZEM A;  3BXM A;  2WSS G;  3IIB A;  2P6J A;  2PJC A;  2GV9 A;  4HYO A;  4MMO A;  4NSQ A;  2ZQM A;  3DC5 A;  2P0W A;  2YNC C;  4C2X A;  4XPL A;  4H37 A;  4ZYQ A;  4DR3 B;  3IFE A;  1TVK A;  4Q7A A;  2JJ1 G;  3P2H A;  1P84 F;  4EEQ A;  1SQB H;  4LFA B;  2EZO A;  4YIO A;  2RJZ A;  4F9V A;  2X7B A;  4NTX A;  4X64 B;  2Y4U A;  1HDJ A;  3ZMZ A;  2YEV B;  3SI1 A;  3WC5 A;  1X10 A;  4OAE A;  1ARO P;  2ZW5 A;  1MNG A;  4J42 A;  3Q4H B;  5CA3 A;  1N33 B;  1HNZ O;  4WJB A;  1S5J A;  1THZ A;  4MHD A;  4UB6 Z;  1N0N A;  1XBL A;  3C3T A;  3FYN A;  2XAF A;  1XMQ B;  2AW9 A;  1PP9 H;  4MXU A;  2G38 A;  2R8V A;  4MI4 A;  4DV4 B;  2YDE A;  2UXB B;  2AFW A;  1EM1 A;  3CRC A;  1G6U A;  2EJ7 A;  2FKX A;  4O4H A;  4UIB A;  5KA5 A;  1XRE A;  3EO4 A;  4I9W A;  1V9P A;  3E8F A;  4KOR A;  4IHM A;  4FK5 C;  1XNQ O;  2V8V A;  4FFB B;  3PRT A;  2DN9 A;  4JAA A;  5CB4 A;  3IGA C;  4X9Q A;  4EFE A;  2DXQ A;  5F09 A;  4E4E A;  1H8L A;  4H2K A;  1M4U A;  4DV5 B;  2BO9 A;  4C7I A;  5EMI A;  2LW7 A;  3QVN A;  2RC4 A;  5GW7 A;  3OTO O;  3P3P A;  2PJ2 A;  2WA4 A;  5HH1 A;  3K9U A;  5FNV A;  2F95 B;  1URF A;  2VQF B;  4U9Y A;  1ZL8 B;  2ZM6 O;  3CX5 F;  1V0C A; 
#chains in the Genus database with same CATH homology
 3TT2 A;  1S7L A;  1IYK A;  3EFA A;  1B6B A;  1Q2D A;  2DPS A;  1YRE A;  4AVA A;  4R3L A;  2REE A;  4M85 A;  5F48 A;  1YGH A;  2Z10 A;  4DNC A;  2JDD A;  4XPK A;  2Z3O A;  3FXT A;  4H89 A;  1WWZ A;  2Z0Z A;  5IV0 A;  4B12 A;  2B4D B;  4KOV A;  4AG9 A;  3G3S A;  4M3S A;  5C82 A;  1YVK A;  1B87 A;  2WPX A;  3DR8 A;  2AJ6 A;  4H6Z A;  4CAW A;  1Y9W A;  1XEB A;  2PSW A;  3DR6 A;  1FY7 A;  4OAD A;  2VQY A;  4E2A A;  3TO9 A;  1PUA A;  3SHP A;  4B11 A;  2A4N A;  2BUE A;  4CGM A;  4K30 A;  2B5G B;  3D2P A;  1MJB A;  2B5G A;  3VWD A;  2ZW4 A;  5FVJ A;  1TIQ A;  2GIV A;  4JXR A;  4CAE A;  5AG4 A;  2O28 A;  2FE7 A;  1YK3 A;  2JEV A;  5AG7 A;  4UA3 A;  4KSF A;  3GKR A;  4KOX A;  4CRY B;  4KZT A;  1MJA A;  4BBH A;  2HV2 A;  2OZH A;  2PRB A;  2CXA A;  4KOW A;  4JXQ A;  3H4Q A;  4LUA A;  2WPW A;  2Z3P A;  3G8W A;  2PQ8 A;  5F47 A;  4QC6 A;  3VWE A;  4F0X A;  3D8P A;  2FIW A;  4NCZ A;  4CGL A;  4ZGY B;  4FD5 A;  2OU2 A;  5A27 A;  5G21 A;  3PZJ A;  5AGE A;  4MY3 A;  4XPD B;  1Z4E A;  2DPT A;  3LD2 A;  2FCK A;  2WUU A;  3BJ8 A;  1Q2C A;  1MJ9 A;  1Y9K A;  2IL4 A;  1GHE A;  2R98 A;  1CM0 A;  4R57 A;  3A9L A;  4KLW A;  1K4J A;  4HNW B;  4YFJ A;  2PR1 A;  2REF A;  2Z3K A;  3TFY A;  4PSX A;  4KVX A;  3P2F A;  2YGW A;  2ZPA A;  3GYA A;  4XPD C;  4UFX A;  4B13 A;  4F0Y A;  4CYO A;  1ZO0 A;  1IB1 E;  2AE6 A;  1S60 A;  3T9Y A;  4A95 A;  4C2Y A;  4CYN A;  1S7K A;  3N7Z A;  5DWM A;  2ZXV A;  3TOB A;  4ZBG A;  2Q0Y A;  3EY5 A;  3FBU A;  4A33 A;  4MFQ A;  5H86 A;  4CAX A;  3R9F A;  2R7H A;  2G3A A;  4GS4 A;  2R1I A;  4NF1 A;  2PDO A;  1IID A;  2HQY A;  5C88 A;  3EXN A;  3H5Z A;  2I00 A;  3W6X A;  4RS2 A;  4JD6 A;  3W6S A;  4C7H A;  3FRM A;  4MBU A;  5I0C A;  2Z3N A;  2QML A;  4UFW A;  3MGD A;  2CNT A;  1VHS A;  2GAN A;  2Q4Y A;  3UY5 A;  3IU2 A;  2P6F A;  1QSN A;  2P6G A;  4PV6 A;  4Q36 A;  3V8I A;  5G22 A;  4BMH A;  5H84 A;  2Y0M A;  4CAV A;  2FXF A;  2JLM A;  1CJW A;  4CGN A;  1KUV A;  3PGP A;  3W91 A;  4IF5 A;  1I12 A;  4L8A A;  2B4B A;  4UBR A;  4R9M A;  3IWE A;  2Q44 A;  4MFP A;  4I49 A;  3R9G A;  1Z4R A;  2VI7 A;  5EBV A;  3IGR A;  2B58 A;  3QB8 A;  2CNS A;  3FB3 A;  3DDD A;  1BOB A;  4UFV A;  2JDC A;  4MFJ A;  4B5O A;  5CNP A;  3F0A A;  5G20 A;  3CXP A;  3B8G A;  1LRZ A;  1M44 A;  1I21 A;  1M4G A;  2VBQ A;  4II9 A;  1YLE A;  4KOT A;  2BEI A;  4FD6 A;  4CRZ B;  2B3V A;  4E8O A;  4KVO E;  4CGO A;  1XMT A;  4UWI A;  5F49 A;  4CS0 B;  5AG5 A;  1NSL A;  3BLN A;  3RYO A;  4KOY A;  3TOA A;  3PP9 A;  1RXT A;  2F5I A;  5IB0 A;  2OZG A;  4MY0 A;  3NE7 A;  4UWJ A;  3TCV A;  2J8R A;  1S7F A;  5E96 A;  2GE3 A;  4KUB A;  3R95 A;  2FL4 A;  4CYP A;  2PR8 A;  1NE9 A;  1VKC A;  2YNC A;  3ZJ0 A;  2VEZ A;  2G0B A;  2H5M A;  2D4P A;  4NEX A;  4HNY B;  1MK4 A;  2WSA A;  2EVN A;  2CY2 A;  3DSB A;  5F46 A;  4X5K A;  1QSO A;  1IYL A;  4L89 A;  3CXQ A;  4EVY A;  1M4D A;  2Q4V A;  4KVM E;  1XF8 A;  1SQH A;  4YGO A;  3KKW A;  1L0C A;  1WK4 A;  2YNE A;  4KUA A;  2PC1 A;  3TO7 A;  1NMT A;  2Z3M A;  4FD7 A;  2YND A;  2Z3L A;  1QSR A;  4RI1 A;  1UFH A;  3R96 A;  4HNX B;  5JPH A;  3ZZI A;  1S7N A;  4E0A A;  4NXY A;  5GCN A;  4MJ8 A;  5AG6 A;  3QAH A;  4J3G A;  5JQ4 A;  4PK3 A;  4XNH B;  5BWA B;  4U5Y A;  4HKF A;  1QST A;  3S6K A;  5ISV A;  1P0H A;  1BO4 A;  1OZP A;  4QBJ A;  4JJX A;  1KZF A;  4KSA A;  3E0K A;  1KUY A;  4XNH C;  3R9E A;  1N71 A;  2FS5 A;  1U6M A;  2VXK A;  3I9S A;  3EC4 A;  3S6H A;  1QSM A;  3SXO A;  5KTC A;  4R87 A;  3FIX A;  2FSR A;  1P4N A;  1R57 A;  1S5K A;  3TTH A;  1YR0 A;  2QEC A;  2J8N A;  4H6U A;  3I3G A;  4B14 A;  3SXN A;  4JLY A;  5KTD A;  3IWG A;  5KTA A;  5J8F A;  4B5P B;  1YX0 A;  4CGP A;  4AVC A;  4B5P A;  2B4D A;  4UCP A;  1IIC A;  2QIR A;  4LX9 A;  2OB0 A;  3CXS A;  1J4J A;  5DWN A;  4OLL A;  2D4O A;  2K5T A;  2J8M A;  4ORF A;  1Y7R A;  4UCN A;  1M4I A;  2ATR A;  4MFK A;  4AG7 A;  3JUW A;  4PK2 A;  4MFL A;  3GY9 A;  4A31 A;  4B10 A;  4AVB A;  2G3T A;  4Y49 B;  4QUS A;  4KOS A;  2I79 A;  4A32 A;  1ON0 A;  2FIA A;  3OWC A;  4KS9 A;  4A30 A;  4YRH A;  3TO6 A;  2EUI A;  2BSW A;  3DNS A;  4QB9 A;  1M1D A;  4MFZ A;  4CYQ A;  4UCM A;  4Y49 C;  3S6F A;  3JTK A;  3WR7 A;  2CNM A;  1Q2Y A;  4A2Z A;  4C2Z A;  2VZY A;  2ZW7 A;  1PU9 A;  2OH1 A;  4CAF A;  3T90 A;  3D2M A;  2ARH A;  5EC4 A;  4NSQ A;  3D3S A;  2P0W A;  2YNC C;  5G1Z A;  4C2X A;  4IUS A;  1I1D A;  4XPL A;  2B3U A;  4PSW A;  2OZU A;  1XE4 A;  3P2H A;  5J8C A;  2Q04 A;  3S6G A;  3IU1 A;  1Z9U A;  1S3Z A;  2C27 A;  2X7B A;  4AB7 A;  3LOD A;  4OAE A;  2ZW5 A;  4QVT A;  4MHD A;  3C26 A;  3F5B A;  2KCW A;  3FNC A;  3FYN A;  4ONU A;  2R8V A;  4MI4 A;  1XIX A;  2NMT A;  2FT0 A;  4KLV A;  3JVN A;  5IX3 A;  4F6A A;  3EO4 A;  1YVO A;  4R3K A;  4KOR A;  5HMN A;  4U9Z A;  1KUX A;  3F8K A;  2DXQ A;  3BJ7 A;  4JWP A;  2HUZ A;  4KOU A;  1RO5 A;  2VZZ A;  2Z11 A;  2P6E A;  4C7I A;  3R1K A;  2RC4 A;  4Q38 A;  2ZW6 A;  4C68 A;  5HH1 A;  2BL1 A;  3K9U A;  3TE4 A;  4FD4 A;  4U9Y A;  5A28 A;  1V0C A;  2Q7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...