2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein aq_1966
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
2O28A 2OH1A 1L0CA 1XEBA 4MY3A 1M1DA 1TIQA 3IWGA 4YFJA 4XNHB 3W6SA 3T90A 4KVME 2K5TA 3K9UA 3JUWA 1V0CA 3SXOA 3T9YA 2G0BA 3TE4A 1Y9WA 1YK3A 3TO9A 4R87A 1ON0A 1Z4RA 5FVJA 3PGPA 2D4OA 4J3GA 2OU2A 3N7ZA 3IGRA 5HH1A 2ZW4A 3I9SA 2R98A 1KUXA 3SXNA 3S6GA 3PP9A 4XPKA 2PR1A 1Z4EA 2JEVA 1VHSA 4ORFA 1QSNA 4KLWA 4NEXA 1MJ9A 5KTAA 3KKWA 3EC4A 4R57A 2KCWA 2J8NA 4UA3A 1S7FA 3R9GA 1Q2CA 4XPDC 4ONUA 3W6XA 4XNHC 1XIXA 5C88A 4ZBGA 3VWEA 2ZW7A 3D2PA 4DNCA 2JDCA 2P6FA 2FXFA 4U9YA 2Y0MA 2NMTA 2VEZA 3DSBA 3FRMA 3CXSA 2FCKA 4FD5A 3G3SA 4MBUA 4KOSA 4KOTA 3BJ7A 1FY7A 3EY5A 2WPWA 1OZPA 2JLMA 2ZXVA 2Q4YA 1LRZA 2J8RA 3S6KA 4E0AA 2BEIA 3UY5A 1IIDA 4LUAA 3GKRA 5E96A 4H89A 4PK3A 1QSMA 3B8GA 3CXQA 3FBUA 4CAWA 1YX0A 3QAHA 2Z10A 4GS4A 4NCZA 3H4QA 1XMTA 4CAXA 3TOBA 4QC6A 1J4JA 4UBRA 5JQ4A 4RS2A 4B5OA 2G3TA 4HNXB 4OAEA 3SHPA 2OZHA 2C27A 4XPDB 4LX9A 5H84A 2X7BA 3FXTA 1M44A 4FD7A 1Y9KA 3MGDA 3QB8A 1P4NA 1I12A 2QMLA 1P0HA 3ZZIA 1XE4A 4H6ZA 1I1DA 2ATRA 4Y49C 1NE9A 1S3ZA 4AG9A 2GIVA 2B5GA 4AVBA 1Z9UA 4IF5A 1YVOA 2FS5A 3GY9A 4R9MA 2Q7BA 4U5YA 3RYOA 2FIWA 4AVAA 4MHDA 4F6AA 1N71A 1MJAA 1PU9A 2BSWA 5IX3A 2CNSA 3F5BA 4KOWA 3LODA 2OZGA 1SQHA 1MK4A 1YR0A 3DR6A 2ZW5A 2ZPAA 1S60A 2PSWA 3BJ8A 3R9FA 5JPHA 1YGHA 1I21A 2VXKA 2EUIA 3I3GA 3TFYA 2PDOA 3WR7A 4JWPA 1K4JA 3OWCA 4OADA 2VQYA 3PZJA 4KZTA 3TCVA 1KUVA 4B5PA 5DWMA 4AG7A 3GYAA 3NE7A 3TOAA 3TO6A 3DNSA 3P2FA 2VZZA 4F0YA 5C82A 3DDDA 2BL1A 1CJWA 2EVNA 2AJ6A 4MY0A 1IICA 4KLVA 4Y49B 2J8MA 3R96A 5ISVA 2GE3A 1S7KA 2REEA 3LD2A 2Z0ZA 4KOUA 2Q44A 3R95A 3D3SA 4PV6A 1BOBA 4YGOA 4K30A 2B4BA 1Y7RA 1S5KA 2BUEA 3W91A 3F8KA 2B4DA 1PUAA 3D2MA 2HUZA 4NSQA 2I79A 2QECA 4E8OA 2FIAA 2B5GB 5EBVA 1M4GA 4JD6A 4BMHA 4QVTA 1Q2DA 2WPXA 3FNCA 2B58A 1B6BA 3C26A 2P6GA 4QBJA 4L89A 1NSLA 4II9A 3S6FA 3G8WA 3S6HA 3ZJ0A 1CM0A 1IYKA 1S7NA 1GHEA 3R1KA 3E0KA 4IUSA 2FE7A 5F46A 3F0AA 2ARHA 2A4NA 4M85A 2R1IA 1IB1E 3DR8A 2P6EA 1KZFA 2I00A 3FIXA 3BLNA 4KOXA 4CS0B 2OZUA 4JJXA 4KOVA 1YLEA 4CRYB 4B5PB 4HKFA 4YRHA 4QB9A 2F5IA 2FT0A 2AE6A 2Z11A 2G3AA 4AVCA 4MI4A 1XF8A 1IYLA 4XPLA 4QUSA 2PC1A 2IL4A 4X5KA 4RI1A 2Q0YA 4HNWB 3D8PA 1WK4A 1QSRA 2JDDA 2H5MA 2GANA 4I49A 5HMNA 1VKCA 3TO7A 2HQYA 1U6MA 2HV2A 4KORA 2P0WA 2PQ8A 3EO4A 4KUBA 5DWNA 4E2AA 4HNYB 5EC4A 5GCNA 3VWDA 4CRZB 4R3KA 3EXNA 1YVKA 1QSOA 1QSTA 4PSXA 4JXQA 2B4DB 2D4PA 2CY2A 2VBQA 4OLLA 2DXQA 4KVOE 4KVXA 2RC4A 1BO4A 4FD4A 4UWIA 2FL4A 3FB3A 5KTCA 4FD6A 3TTHA 2FSRA 4PSWA 4JLYA 5KTDA 3EFAA 1RO5A 2Q04A 3P2HA 5H86A 3R9EA 4MJ8A 1R57A 2REFA 3TT2A 4CAVA 1YREA 2B3VA 2Q4VA 1Q2YA 3JVNA 1RXTA 1M4IA 1WWZA 1NMTA 2ZW6A 5J8CA 5F48A 1M4DA 4R3LA 5F47A 2OB0A 2CNTA 4U9ZA 5I0CA 5CNPA 2PRBA 3V8IA 2PR8A 2CNMA 4L8AA 5F49A 5IB0A 2QIRA 1KUYA 2VI7A 4AB7A 2R8VA 4PK2A 4EVYA 1S7LA 5IV0A 4M3SA 3CXPA 2R7HA 2B3UA 4H6UA 4JXRA 1B87A 4UWJA 5J8FA 1UFHA 3FYNA 4NF1A 4NXYA 1MJBA 2VZYA 4KOYA 4KUAA
chains in the Genus database with same CATH superfamily
5LHGA 2VQFO 2O28A 1XBLA 1HNXB 3L70H 4W4KA 2CTWA 3QNVA 2ZOFA 4JAVA 2ZE6A 4KXRA 1HDUA 2LGQA 4ZIBA 4KVME 2E5LB 1DF5A 1DLBA 1BE3H 1Q3EA 1V0CA 1KYOF 3D7GA 3K9UA 3TE4A 4K8XA 4JV5B 3TO9A 4A31A 1JOYA 1OZ0A 3ZIAG 2E5LO 1ON0A 4MVQA 5LL6Y 1U96A 4ZOLB 3LNMB 2WA3A 4JAUA 3CCRV 3HKCB 4JV5O 2Q69A 1NJIW 3PGPA 3N2GB 1RP3B 2G9DA 2OU2A 3H1KH 1AJNA 4MW8A 2ATKC 2PIZA 4FIPC 2F8HA 2XEFA 1WNSA 3IGRA 3N7ZA 4L87A 3I9SA 1IU8A 3ABKB 4LBEC 3SXNA 1JFFB 2QE7G 4UCMA 1VQOV 3J81N 2Q73A 3CEIA 4JI3B 2QM7A 4JI7B 3GIUA 2PR1A 5LP6B 4FZ0A 3KZWA 1K9MW 4PD4F 1VHSA 1MZEA 3T4ZA 2IJJA 2QM4A 3KKWA 3EC4A 1MNGA 2Y69C 4Z1MG 4JI3O 4DK0A 5KA5A 2P6JA 4JI7O 2JDIG 1J95A 5B5EZ 4LC1A 3K03A 4PXEA 4X20A 4O4JB 1XIXA 2E76B 5C88A 3K04A 1F7YA 4UVAA 2Z3KA 3AG3B 1MSWD 3D2PA 2JBKA 1R3KC 1RPRA 1SQVH 2Q7HA 4I4TA 5FNVB 4JTDB 2CXAA 3TK1A 2IJIA 1M90W 5KHHA 2IU0A 4YWYA 3ZHSA 4RWUA 1QQCA 2KG7B 2Y0MA 4TUYA 2NMTA 2VEZA 5LYIA 2PJCA 3JRUA 4CGOA 1FFTB 2HC9A 2AFUA 5CA0B 4K0KB 4UF4A 2Q5ZA 1NKDA 4DUYO 2FCKA 4FD5A 3U11A 2ITDC 3G3SA 2AFSA 4MBUA 5FLXN 4WFFA 3ZJZA 1W2BU 4KOTA 2UXCO 1XI1A 5EBMC 1M5IA 2WPWA 2QWOB 4JYAB 3GWKC 2F4VB 2GHYA 4GUNA 4I5SA 3R66A 3ABKC 2Q4YA 1LRZA 2J8RA 5LRKA 2Z3LA 3ABLB 2EINB 3CCVV 3SJEA 2IBZH 4JYAO 2F4VO 1W59A 3CCJV 5LP6C 2BEIA 1IIDA 4LUAA 5E96A 3DGEA 2QKCA 1QSMA 2IU3A 3CXQA 5G21A 2ZR2A 1VF7A 4YXWG 1YX0A 2JRIA 3DGVA 3QAHA 2RFHA 3RYFA 4X8IA 5IYBO 2ODMA 3H4QA 3C90A 4C7UA 2Q43A 2VS0A 4BWAA 1XMTA 5BY1A 4G28B 4CAXA 4QC6A 3HPLC 1R6TA 2ETNA 5DS0A 4B10A 2R9IA 3Q4HA 2YICA 3T8WA 1K8AW 1R6KA 1TF9A 3VARA 4B5OA 1ZL8A 3W7UA 2UXXA 3APQA 1L1FA 4YY3B 3AG4C 3AG7A 3L73H 2WZNA 5LXTB 4GXHA 4JI5B 2DF5A 4NXMB 4X1KB 4XPDB 1XUQA 2CTQA 2CDYA 3LSUA 1M44A 4FD7A 3MGDA 4UB8Z 1CPXA 5CBMA 1YTFB 5LBQA 3B3SA 3PB9X 1KKDA 3JSLA 4I55B 4YY3O 3OFNG 4JI5O 4NXMO 3JAKB 3ETDA 4WBNB 1PNKA 4DV0B 2E75B 1NE9A 4LWSA 4N21A 5J2UB 2VWKA 2EZOA 3H01A 4B7KA 4LCUC 2YNCA 3S9NA 4EWTA 4O4LB 4NR1A 3B3WA 5D5PA 1JWQA 1YVOA 3PB4X 1FS0G 1B6QA 3OGIB 1GM8A 4U5YA 2EIMB 4MVSA 1K5QA 1MZFA 2FIWA 4Z2WA 1OHHG 2KB1A 4MFLA 3M99B 1KC8W 5IX3A 3BXMA 1BCCH 2CNSA 4UIAA 4UFXA 2BTQA 3SYCA 4ZX8A 1CPYA 1AR5A 5JCOC 3RO0A 3W7SA 1XL6A 1JVMA 2IMOA 2BSKB 2ZKOA 1NH2D 1ORQC 5GTHZ 1RM1C 3DR6A 2PIYA 2ZPAA 4MFKA 2PJ9A 3OGCC 5J2TA 1M1KW 2WSSG 4IIJA 3I3GA 4CH3A 1LR1A 5H5NA 4JWPA 3WR7A 1TXRA 2Y0PA 2Q51A 2YIDA 1TVKB 2VQYA 2HFEC 2BTOA 4OP4A 3RVYA 4Q20A 1UFIA 4O2AA 2LW7A 4MTXA 5D8NA 2DQ3A 4X65B 4RQFA 3GYAA 3D36A 1NBMG 3EHBB 4D7SA 1NTKH 2VZZA 1M57C 3JAMN 3LSSA 2YXYA 3KCXA 3KZIZ 2ZCEA 2EVNA 4UCNA 4X65O 1QNMA 3PBEA 3I5DA 4Y49B 3R96A 4WFHA 2ZEFA 2EIMC 1Q6UA 3HKEB 3D3SA 3D36C 3LNNA 3K5NA 4PV6A 2Q0OC 5HVGA 4B11A 1GTOA 4K30A 1O9GA 1QLEC 2B4BA 2RB7A 3ZRWB 3GB7C 2JGDA 4A5UB 4E8OA 3JTKA 5DM6V 4DO2A 3U0ZA 3MAQA 1E1QG 2XUMA 5EBVA 4PXCA 1M4GA 3KCYA 3LMSA 1SKVA 2YEVB 3WB0A 1K4CC 2VQEB 2AW9A 4FLWA 3C26A 4F6EA 4L89A 1WA8B 1N34B 3SYAA 2IH1C 3G8WA 2E3CA 3JASA 2VQEO 1P84F 1S7NA 2JIZG 5K8NA 1SS3A 1VIXA 2ARHA 1N34O 3SJXA 1GM9A 4B08A 5LRJA 4NGQA 3NFZA 3SPHA 1V55C 2EIJB 1IBMB 3DR8A 2P6EA 3TGUH 1NU1H 4LQGA 5B1AB 2R72A 3CC4V 3I55V 4DUZB 4MW3A 2PJ6A 4KOXA 1LUVA 3H1HH 4JJXA 4P9PA 3NXSA 3SI1A 4NYKA 1IBMO 4GX5A 3OR6C 3ZCCA 2RJZA 4FVMA 1R1BA 3G80A 3E8BA 4DUZO 1WLEA 5A27A 2JS3A 2FT0A 1Y0RA 4Z65A 4PI0A 1I08A 5LHHA 1HNWB 2PC1A 4UCPA 3CHXA 4WCEV 1URFA 1WK4A 1QSRA 4MVMA 2GANA 4I49A 3OT7A 3JSNA 4OX9B 2BOCC 1RTQA 3WFVA 1HNWO 1U6MA 3ASNC 5JQGA 2P0WA 5AG6A 4E2AA 4HNAA 4MFPA 2UUCO 5GCNA 3VWDA 2YNEA 2OYQA 5I4MA 2ANPA 2K1EA 4KHPO 1FXKB 5AGEA 4F8ZA 1Y4MA 3DXRB 5B1BC 4KS9A 4OX9O 4J9YB 2QA4V 4PSXA 4JZGA 3WG7B 3BVOA 1M56C 4OPHA 2VBQA 4IHJB 2RMKB 2WLLB 3KHZA 3W7XA 1SA0B 2QWQB 2EX3A 4HPSA 4KVOE 4GKKB 3FEEA 2XAHA 2CGNA 4DV3B 1ZAUA 2RC4A 1XNQB 4UWIA 1FT7A 1N0NA 5HFLA 3ZRSA 3K0GA 2Z0AA 2FL4A 4MTOA 5KTCA 4FFKA 2Y0IA 4GKKO 1YZBA 3BCCH 1BT8A 2CIJA 1TUBA 4M6GA 4DV3O 5KHIA 1FXHA 1BLLE 3WC5A 4GX1A 5HFMA 2XAGA 4DR6B 1P7BA 5H86A 3R9EA 1ENVA 2EBJA 1TUEB 1VQ7V 5DN6G 2F93B 1FFXB 3BFRA 4A2ZA 4DR6O 3A0RA 2LFRA 4YJ2A 5E1AC 2WLIB 2JEXA 4O4HB 3L2NA 2AHZA 2C6PA 4N23A 3CCEV 4PPZA 2RDCA 5F47A 4DUKA 2OB0A 3SPGA 2CNTA 1OJHA 3RBUA 5I0CA 1AYEA 2UU9B 2JBJA 2BCOA 4IK2A 2PR8A 4LFBB 4C2YA 1AVMA 2PYJA 2VI7A 4OIDA 4G2KA 5KX5A 4AB7A 1COWG 1XNRB 4EVYA 2VWJA 4LH7A 5IJ0A 1SQGA 2UU9O 3CXPA 1PKXA 4XDJA 3OW2U 3CCLV 4LFBO 1F2PA 5HVHA 4UFZA 3ZEDA 4EB6A 4MSWC 4CYPA 3RYIA 1NTMH 3IFEA 3UT5B 2FMLA 5J8FA 3FB6C 3IAYA 3FYNA 5A28A 4K35A 2JVDA 5BMVA 2MW2B 1KU9A 1IGBA 3CRAA 1SQPH 5IT9N 4G27B 5JM6A 1IX9A 3ETQA 2YI8A 3GB0A 5CA1B 1TIQA 1YCIA 4J9ZB 1NT2B 3FX6A 4PXDA 3W6SA 4YFJA 2ILMA 1M9NA 4CH4A 3OMNB 2NNUA 1Z8XA 1ZO0A 3SPCA 3T9YA 3SXOA 4BD9A 1H38A 4X1IB 3F5WC 3ZHTA 3E22B 2YUAA 1Y9WA 4JI1O 1Q81W 2CGOA 1AJQA 2PTMA 5LOVA 1P4RA 4NTWA 1QQ9A 3N2KA 2XT9A 5A2QN 4R87A 4ZI6A 1Q6IA 2NR5A 4FWUA 1OCZB 5CB4B 4B3SB 4YIPA 4R7CA 5CBGA 2D4OA 1KP2A 1K7DA 3VBBA 3WT4A 3KKYA 3STLC 1BZKA 4P4IA 1VMGA 5DECA 4CS4A 3ZHRA 2XHBA 1FD9A 4BW5A 4FBEA 2CAZC 2IH3C 4LNUB 1SRYA 2DW4A 5L3BA 4A95A 4UIBA 4I0XB 3G71V 1NI8A 5A9GA 4XPKA 2HVJC 2ZD9A 2ZEHA 4CAEA 2JEVA 1S76D 4ORFA 4DR4B 1QSNA 3MN8A 1ZG9A 5KHKA 2H8PC 4IHMA 3AG1B 2L35A 3ZMZA 1JJ2U 4JI6B 4CC6A 1IVSA 5BXZA 1TF8A 1N4CA 2H94A 2PJ2A 4X64B 4ONUA 2X6BA 2EWBA 2GREA 4ZBGA 1SETA 4JYBA 1YITV 1M4LA 2JDCA 2FXFA 4JI6O 2HP8A 3FAVB 3CP1A 4X64O 4J7JA 4L8JA 1S0VA 4OC0A 3DSBA 3FRMA 1L8DA 3CXSA 4XDLA 3CXHF 3F7VC 3G67A 4C7IA 2WPDG 3BJ7A 3FKSG 2P7TC 3RGBA 3RYCB 3VQWA 1OZPA 3A0HZ 2AXTZ 2Y4UA 4TV9A 4RO2A 4WFEA 3S3XA 1J5EO 3A9LA 4DXWA 1I7FA 4GX0A 4DR3B 1F23A 1HEEA 4WF9V 2IJKA 1SZXA 4AHCA 3ZHUA 4FLTA 4P6YA 4FLUA 3HR0A 2JJ2G 4PK3A 3B8GA 4MHNA 2CK3G 3HUVA 2Z10A 5KLVH 4DR3O 3RWRD 3TETA 3K08A 4X3RA 4OKOA 1TKJA 4P4JA 1SQQH 2GUZA 1CBXA 3PB6X 1YJNV 2Y69B 4JGSA 3E83A 3RVZA 5JQ4A 5FPOA 4FLVA 2G3TA 2Q7SA 4OMEA 1PP9H 3RYCA 2LFSA 3AK3A 3ZMTA 2B5UA 4YJ3A 3E8HA 1ZG7A 2X7BA 3FXTA 3PFOA 1R43A 4NGMA 3QB8A 1Q8IA 1DK1A 1VQMV 3ETEA 4H0LB 3ZZIA 4QNHB 2Q8VA 4RAIA 1TGOA 3JD0A 1Q6HA 4LFCB 3X2QC 1EN6A 1Z8WA 3IWEA 4J7ZA 4QJFB 1F57A 2OT5A 2GV9A 2WLHA 3OR7C 4JI8B 4AVBA 4X2TA 2WSAA 1Z9UA 1QCEA 3DC5A 4YU9A 3CC7V 2F7VA 4X20B 4NFRA 4IF5A 1Q90D 1EZVH 3H1IH 1VIBA 2FS5A 4R9MA 1B3QA 4LFCO 2Q7BA 4B3MB 3OE7G 1E79G 4NGPA 1CP9A 3RYOA 1ARLA 4NKGB 4AVAA 3FMCA 4JI8O 4I4TB 1VQ8V 4F6AA 3VATA 1N71A 5B3SB 4QE9A 3F5TA 4B3MO 3F5BA 1QVGU 2G38A 1GO3F 1WPXA 4TUYB 3PN1A 3LODA 4OC5A 2N05A 3ZBHA 4X62B 3CXCU 1AROP 3ZMUA 1SQHA 1PNLA 1MK4A 5EYPA 1YR0A 2ZOGA 3B3TA 4U7NA 4EKWA 2A3QA 3ZN1A 2W0FC 4IAVA 4LFAB 4DRXA 4B6ZA 2GBOA 3R9FA 4X62O 3ZN0A 5FL7G 4PQAA 1EE3P 1I21A 1WP8A 3APOA 4UCOA 2EJRA 3IFXA 3JARA 4DR2B 3IEHA 4OADA 4LFAO 3QO5A 3MD0A 1IBKB 1ELMP 3NR7A 3OMAB 3PZJA 3QF7A 3BABA 4A39A 4U7OA 4PA7A 4B5PA 3WB2A 4X1YA 2GLFA 3V7ZA 3AG4B 1S5HC 4DR2O 5K8MA 4DUYB 3FVLA 3NE7A 3DTUB 1LUWA 1H2NA 2EULA 1MABG 3RYFB 5IWAB 1IBKO 3CYOA 3P2FA 3TOAA 3EXAA 2UXCB 3D4UA 1OBRA 2WA4A 4P2ZA 4KSAA 3VH9A 1PM9A 2BL1A 1CJWA 4CH6A 3Q4HB 3SJFA 4DV5B 2J8MA 5IWAO 5ISVA 2GE3A 3BPZA 4H37A 4BR6A 3LD2A 1ZL8B 2Z0ZA 4KOUA 4DR1B 4OXSA 5B3SC 4ZY2A 4PI2A 4PDMA 1BOBA 4DV5O 4CGPA 5AG5A 2LGWA 4DR1O 4FJCC 1S77D 3B7IA 2XAQA 4MTGA 3D2MA 4LWSB 1FXVA 2B1IA 2ZXWB 4NVPA 1UJWB 5BR8O 2L6LA 3H8GA 4NSQA 1S5JA 4MHYA 1BSMA 1NR1A 1BHAA 5EC1C 4LF7B 4P44A 4DV7B 4BMHA 3LSQA 4QVTA 1Q2DA 2EIKC 2B58A 1H2MA 3L72H 1SQBH 2QWNB 2YIAA 1RM1B 3KR5A 3BAAA 1E1RG 1B6BA 2WUUA 4NXNB 4LF7O 4DV7O 2OIEA 5EZYA 3PEIA 2QWPB 5JVDA 4DV1B 3LUTB 2HB6A 1K33A 4UCVA 3EVKA 4U3FH 4NTXA 3THOA 4UFWA 2BTQB 4GYCB 1PNMA 1FAFA 4LF9B 1YW4A 1CM0A 1NTZH 1Z5WA 4NXNO 1GHEA 3E0KA 5F46A 3F0AA 1PV0A 4DV1O 1ZLZA 4LF9O 4OIWA 1M57B 5J2TB 1IB1E 4TT3G 4IIJB 5F2VO 4B3RO 4JTAB 2I00A 1HW7A 4TV8A 3FIXA 1EN5A 4JZ0A 4K3NA 3JALA 4R8FA 4QGPA 4IT5A 2Z3YA 3K3WA 1ROPA 2CTBA 2F95B 3F7YC 1YLEA 4O2AB 4F6RA 2D2CB 3IC1A 2C1CA 2FTKA 2F5IA 2AE6A 2ZXWC 1AI5A 2V1DA 5EMIA 4MI4A 2YNCC 1QLEB 4O2BA 5D29A 4RI1A 4A94A 4HNWB 3A8TA 1KBHA 2H5MA 4Q6GA 4RQEA 5HMNA 2AFXA 4MCSA 5IJ9A 2OCCC 1RFYA 1Y74A 6CPAA 4PA9A 3JCZA 4KORA 5LGUA 4UB6Z 4KP4A 2PQ8A 5AG4A 3AK1A 3CT9A 1HWYA 1N0JA 3P30A 1EBOA 3L71H 3A2FA 3O9OA 2JGDB 5LYDA 3NH8A 2WAMA 4OLLA 1AP5A 5L3DA 4ASUG 2PJ0A 4P4EA 4DV4B 2GLJA 1BO4A 4FD4A 2PJ1A 1JCHA 2AFWA 1O9HA 7CPAA 4HZ3A 1SQXH 3CSXA 3K0DA 4U3JA 3FB3A 1TKHA 3K2KA 1NH2B 3CRMA 3RYHA 5LGTA 1LNQA 3GWOA 4JLYA 3FB7C 1V55B 4DV4O 1GN6A 3EFAA 1ZSPA 1X12A 3N27A 4MRIA 3BHPA 4UCRA 2AFOA 5L3EA 2BOAA 3BI0A 4MJ8A 3JASB 5C8YA 4AILC 1YI2V 1R57A 2REFA 3SYOA 3JD4A 4FUUA 1YREA 4CS2A 1Q2YA 4DV6B 3T1HB 1WWZA 1NMTA 3DC6A 3P3PA 1D5NA 3SPJA 1U97A 4DV6O 3T1HO 2YS8A 3B4SA 3IU2A 2XTAA 4L8AA 2QIRA 1AUGA 3DSQA 3RNZA 3ASNB 2R8VA 5J9PC 4PK2A 2WLNA 1W0KG 3SR2C 2QM8A 1S7LA 3FEDA 5IV0A 4UCSA 1JQGA 3AG2C 5B1BB 1AP6A 1YVWA 3HKBA 4JXRA 1N8RW 3WC7A 4AI8A 4AQYO 4UWJA 1M56B 1XMQB 5JGFA 1AJPA 1IDSA 5JQGB 4HNAB 2AFMA 4KOYA 4A30A 4BINA 3ZS8C 1F2OA 2OH1A 5LA6A 3UO2A 5H9CA 1XMQO 3OUSA 5THWA 4DYOA 1XEBA 1LCPA 2JS5A 3B77A 4DYLA 4XNHB 4ZX9A 3KI9A 3T90A 1VHEA 1XMBA 2K5TA 3SJBC 4DR7B 3OTOB 1Q43A 2ZEEA 3D7HA 3JUWA 4R76A 3PB7X 1R3JC 2G0BA 4IYHA 3ISZA 5IDJA 3SJGA 3B35A 2XEJA 2XNDG 5JJEB 1AILA 1YK3A 4X66O 1KMIZ 3CCMV 1VEWA 3E89A 3OTOO 4DR7O 4JI0B 1RSOA 2UUCB 1LAPA 1VF6A 4LF4B 1Z4RA 1TUBB 2BOBC 2N04A 3BY6A 4KHPB 1YHQV 5TISZ 5FVJA 2P4KA 1YW6A 4IGGA 4MVUA 2Q4PA 3ZX6A 4JI0O 3ZRXA 2R98A 4LF4O 4JYYA 4LF8O 1KUXA 1MOFA 2OIGA 3RN4A 3SJAC 4OC2A 3CC2V 3RBZA 3WU2Z 1IURA 4UCUA 3ZHQA 3G4SV 2Z5UA 4YJ2B 1VF6C 3TXQA 2ZM6B 1VP7A 1L0NH 3TCUA 4NEXA 5KTAA 2HG5C 5IYZA 1Y66A 3JD2A 4UEEA 4CS3A 1VARA 2P22C 1XJOA 2ZM6O 2ADQB 2J8NA 1S7FA 4R7MA 3R9GA 2E74B 2XAJA 4E4EA 1Q2CA 5KX5B 4YHHB 3W6XA 4XNHC 4FFBA 2IM9A 1R3LC 4D7TA 5IJ0B 3CCSV 1XOVA 3D3QA 4XBFA 2ZW7A 4A32A 4DNCA 4GX2A 5JH7A 4EMEA 4EB6B 4UEZA 3LWUA 4U9YA 3RYIB 4FZ1A 1T5EA 5CN0A 4YHHO 1BMFG 2KSDA 5EBLC 1YJWV 2EILC 3IU1A 3JD3A 1G1XB 2ZNIA 1H8HG 3KASA 2OR4A 2D3OW 1K97A 5BMVB 1HNZB 4B7EA 2PE3A 2X6AA 4UVBA 3J7AU 2ZE8A 4F9VA 2GTAA 3AEIA 4KOSA 1H2LA 1CX8A 1FY7A 5B1OA 4NGNA 1ELLP 1GM7A 2JLMA 1HNZO 1PYTB 3K5MA 4J41A 3K5OA 4MCQA 2YNDA 3B3CA 2A7WA 2ADPA 5EIBD 3PFEA 5LOVB 3UY5A 4UFVA 1Q5OA 4F4LA 3GKRA 2X6CA 3IO1A 4H89A 3N2KB 1XDCA 3FBUA 2WLJA 4QPJA 2BO9A 1SZTA 3QO8A 5LYJA 2UUAB 4J42A 4GS4A 2PJ7A 3FB5C 3CDXA 3ABTA 2V4DA 3DLJA 4ZBMA 3OAAG 3P32A 1MSDA 3CPWU 2UUAO 4JASA 4UBRA 4BIZA 4RS2A 2OWOA 1KWMA 4WWVA 2P4VA 4X8AA 3SHPA 2OZHA 4A33A 4JI1B 2XAFA 1Y67A 1Y9KA 2B9ZA 1Z2GA 5D5QA 2DPTA 1P4NA 3CB2A 4LP8A 1I12A 2QMLA 1GMGA 4A38A 1XE4A 4B3TO 3T1YB 1V54C 4X88A 5LMNB 2ATRA 4BIOA 3K79A 1QMUA 2GIVA 1A32A 2EZPA 2ZIOA 3LDEA 2B5GA 3RT3C 2Q7EA 2CTRA 3T1YO 1I5XA 3GY9A 5LMNO 1XREA 4H44B 2DEAA 1R6NA 2ZQMA 4CH5A 3E86A 3EFFK 3JAWA 5CPAA 2HEPA 3K57A 2DQ0A 2A9HA 3OM3B 2NSMA 3HLPA 1B04A 1IXBA 2A0LA 2ZDIA 2V8DA 1AB3A 2W6JG 3I1UA 4LF6B 4CYNA 4NGSA 3H1JH 4CBCA 2ZEDA 3IJ4A 1EM1A 5LGNA 4MTFA 4JF3A 1HP8A 2IW5A 1WN7A 4LF6O 2ZW5A 2CF4A 1S60A 1VGYA 2PJ3A 1H2SB 4KL1A 1X4TA 2PSWA 1KECA 4QE7A 1I94B 2ABZA 4CYOA 5JPHA 2ZDIC 1LAMA 4I9WA 4TV9B 3QO7A 2RCVA 3JATA 1M93A 3ZRVA 3L74H 3TFYA 2EUIA 1WJZA 1EN4A 4G1PA 5GTIZ 1ZX3A 1V9PA 2LO1A 2QR4A 1BAVA 1I94O 2DWEC 4EFEA 4KZTA 5KUKA 1KUVA 3V38A 5EIBC 3BRCA 5DWMA 5LHIA 2CH7A 3ABMC 3E8FA 2Y48A 3D67A 1HDJA 3STZC 2WLKA 2DYRC 3BEHA 4F0YA 1US6A 1H2KA 1ZTEA 4X9QA 4EFBA 8CPAA 1KB9F 2GUZB 1KD1W 1OCOC 2AJ6A 3FYEB 1IICA 4KLVA 4ABMA 3X2QB 1J5EB 3CPAA 4KSIA 2PI4A 1AI6A 2A06H 1FPOA 3TC8A 4TQFA 4QIWF 4YJ3B 1PD3A 4ZGYB 3CCQV 4PA4A 2CUGA 1QVFU 2WWWA 3ICXA 2QDOA 1Z5VA 1S5KA 2BUEA 1WPBA 3F8KA 3HKDA 2B4DA 1PUAA 2PJ4A 1DTOA 1NR7A 3A0BZ 1YXBA 1BQZA 2LQTA 2HUZA 3JD1A 2FIAA 4MFZA 1G6UA 2HJFC 3QG5A 4J7KA 3CRCA 3LDCA 2PYLA 2RN9A 5KUMA 3VQXA 4O23A 1S72V 2DN9A 3CJHA 2WPXA 3B09A 3FNCA 3OMIB 3K9AA 1LANA 4MFJA 2P6GA 4R6TA 2POKA 4OGQB 1YDXA 1Z5RA 4II9A 4MVRA 2IQ6A 4I50A 4NGRA 5G22A 2HHHB 3S6FA 1NZ6A 3ZMVA 1YF2A 3H9VA 1IYKA 2V77A 3D3IA 3CWBH 3R1KA 4O4IA 1D5AA 2FE7A 1YIJV 1XEQA 5EYPB 5LYFA 3KQZA 2P5OA 2HHHO 4M85A 1G4YB 4DRXB 1YSCA 5ITZA 2Q9LA 2O57A 5GONA 3IC9A 4J10A 1ARMA 3JARB 3CZXA 4NGTA 4RUEA 3VQYA 4ZI7A 2NN4A 4DK1A 4CS0B 4CGLA 4KOVA 4C2XA 1XHXA 2HVKC 5FPRA 2ZIMA 1IOFA 4CRYB 4B5PB 4YRHA 3IC7A 4X1YB 2AGAA 5KMGA 3CCUV 1HNXO 4Q38A 3VQVA 2R9AA 4ZHQA 1OCCC 4AVCA 1AR4A 4PA3A 4JTCB 1VQLV 4A37A 4F9UA 1NS1A 1MMMA 1XF8A 4QUSA 2QVPA 4YIOA 4X5KA 1PPJH 2Q0YA 2ZE7A 3OTFA 1Q7YW 2YDEA 3SJQC 3TO7A 1UWYA 4H13B 2HV2A 4ZKIA 1AMPA 5DWNA 5B1NA 2DYSB 3IIBA 5EC4A 4CRZB 3ABUA 5B66Z 4R3KA 2EIKB 1YLOA 5IYCO 4CC5A 4PXBA 1TA8A 3EXNA 1YVKA 1Q7LA 1BPNA 2OTJV 1QSOA 2RNBA 3B2YA 2CY2A 3G6BA 5KHGA 1VQNV 2XEGA 3OEHG 4W9YA 2DXQA 5L3GA 1H8LA 5CBFA 4KVXA 3B2EE 2F43G 1Q82W 4DJLA 2EK8A 5LYLA 4H2KA 1P49A 5IY5B 1K34A 4P4BA 1MA1A 5L3FA 4ZOLA 4FD6A 2FSRA 3BA8A 3D68A 3ZHVA 4PSWA 5KTDA 2UUBB 3HKCA 1XHZA 2PY5A 1CP6A 1RO5A 4I9QA 4OC4A 4CPAA 2Y4TA 5EZYB 3N2GA 5JVDB 5ELYA 4GT1A 4ZYQA 4K3AA 2ODFA 3CRQA 3P2HA 1ZUQA 4GCZA 4OPAA 4PA6A 3LDDA 2QJ8A 4IL6Z 1CG2A 2UUBO 4CGNA 5BR8B 1N36B 3TT2A 3D66A 4C7HA 1NVPD 1GAXA 1JFFA 2DOSA 3JVNA 1RXTA 2PVVA 2ZW6A 1AI4A 1X59A 1M4UA 5LP6A 5F48A 1N36O 4R3LA 4MFQA 1QR9A 4P45A 4B13A 1XRYA 4TV8B 2NYQA 5CNPA 2DYSC 2MK3A 2PRBA 3JALB 1VQ5V 3V8IA 4K0KO 2OCCB 2X0LA 4Z1VA 4RN7A 2V7QG 4F6RB 1KUQA 4P9OA 1KUYA 3W7WA 4RUHA 4O4JA 1I5YA 1WP7A 1EFRG 2PJ5A 3E35A 1YTFD 2BE3A 1GRJA 4BBHA 2QKSA 2R7HA 1I0HA 2B3UA 1Y76B 5FNVA 4O2BB 1GN2A 2W6IG 1NVPB 1DGSA 3RAMA 4M6HA 2EJ7A 2PJ8A 4B3RB 3FJUA 2KG7A 1YJ9V 5IY5C 1UFHA 2QTOA 4MMOA 3MDSA 5IJ9B 2C6GA 3NH4A 1Y74B 3KHXA 2O4HA 5CA0A 2JEUA 1BGYH 4FM0A 1N32B 2VZYA 4KUAA 3AG3C 4FM1A 3T2MA 1L0CA 3LACA 4XDKA 4MY3A 1M1DA 5IB9A 2R9RB 3IWGA 4DR5B 5KA6A 1YSJA 1N32O 1K5SA 1THZA 1EZJA 1Y6XA 1BQ0A 2AZ0A 4DR5O 3VOUA 1D2DA 1Y76A 1Z8TA 4KFMA 3RFRA 2YIBD 2Q4ZA 4U3JB 4GM5A 2AHYA 2JGUA 3RYHB 3B8NA 3K5LA 1NQTA 5JCOA 4DV0O 3QAYA 4GKJB 5CBHA 4MVOA 1JR9A 4J3GA 2M6YA 4LF5B 1YMEA 3ABLC 3GVMA 2EINC 3ASOB 3FX7A 1XFOA 5HH1A 1PCAA 2ZW4A 5C8YB 3PJSK 4CYQA 4FK5C 4UXNA 3RZAA 1IOIA 1JA8A 1GN4A 5LXTA 4GKJO 2Q0AA 4X1KA 4LF5O 4HAMA 1PL0A 3S6GA 3FYIB 3H1LH 3PP9A 5K8OA 4HYOA 1PL4A 1WAZA 5H6RA 3W7TA 3D7DA 3AG2B 1Z4EA 4I55A 2YXHA 3OD4A 2QYVA 1ZWIC 1MJ9A 2ZEPA 3HB3B 3JAKA 3PBBA 4KLWA 4WBNA 5G1ZA 5J2UA 3SGIA 1H8EG 1BHBA 2ZINA 4R57A 2YXLA 5BZBA 3WABA 2KCWA 1XILA 4UA3A 3K9SA 4O4LA 4LQ6A 1XMOB 4XPDC 2FKXA 1IBLB 2GFQA 1VQ9V 4OC3A 3VWEA 4TNUA 4NB5A 2P6FA 4MXUA 3UKMA 1F4NA 3HKBB 5JJNB 2A79B 1XMOO 1IBLO 2PJBA 4R50A 1XL4A 2UXNA 2JEWA 2XEIA 2ITCC 4NJRA 3WC6A 4WFBV 3O65A 1Z2LA 1YQEA 4C68A 2ZEGA 4MHPA 3H8FA 3L75H 2Q68A 4DW0A 2BSKA 3RW0A 1XQ8A 1VQPV 4F0XA 5LA6B 2EO8A 1VQ4V 3ISXA 4DV2B 1Y7EA 3EY5A 3C3TA 1F51A 3ASOC 2YIBA 1SF9A 3CRRA 3CX5F 1X10A 4HBNA 2ZENA 3FH4A 2ZXVA 2P90A 5K8PA 3FD9A 2PUSA 5LMUB 4WFAV 4DV2O 1JX9A 1TVKA 4AQYB 5LRGA 2K9PA 2QTSA 2ZELA 3S6KA 2QEXV 4E0AA 4JYWA 3UQ8A 3K59A 3OUFA 2CTPA 4CAWA 1QR8A 3T1CA 4B14A 5LMUO 4M6IA 4FM2A 1RSOB 3SI0A 4NCZA 2V8GA 2PCUA 2HJDA 3P3NA 2Q7GA 5KHJA 1KP3A 2DMXA 1K3EA 3TOBA 4FMTA 1ZG8A 4PHZA 3QNEA 3D8CA 1J4JA 2N74A 3UO3A 4MCRA 2LJ2A 5K1XA 3KQXA 3HKEA 4HNXB 4OAEA 4FAIA 2C27A 4JI2B 2HLDG 2R70A 4LX9A 5H84A 2UXDB 3BHXA 2P06A 2ZT9B 4X66B 1JJOA 3ZMSA 4KUMA 1DE4C 1JPXA 4WJBA 1K92A 4TSFG 2CE4A 4JPRA 1P0HA 5DEDA 1R3IC 5IYDO 4FLXA 4H6ZA 3CS5A 3ZRWA 3CMAV 1I1DA 4JI2O 2CTCA 5IYZB 4Y49C 5JWPA 2UXDO 1S3ZA 1AI7A 4PDVA 2YI9A 4AG9A 1SQFA 1R73A 2EILB 1SERA 3SPIA 2ZEOA 3K06A 2Z3PA 5C93A 4LF8B 4FFBB 1L0LH 2YEVA 1LOKA 2PVWA 5JH7B 1K73W 1JQ0A 4MHDA 1MJAA 4MS2A 1PU9A 2BSWA 4EEQA 4JAAA 1XBUA 1WA8A 5HXDA 3S3WA 1F4MA 4MCPA 4KOWA 2DPSA 2C2AA 4P30A 2GSMB 2OZGA 4Q36A 4ONWA 1CXZB 3CPXA 4BAYA 1YEWA 2IJHA 3AK2A 3IWWA 4JI4B 4P4FA 3E8GA 1KQSU 5IE9A 3KR4A 4RUFA 3BJ8A 3TX8A 1YGHA 4MHZA 4DW1A 2VXKA 2NLJC 2PDOA 3B40A 4JI4O 2C6CA 1K4JA 3E2EA 1R3NA 4PELA 3OWCA 5EC2C 5L3CA 3T4DA 3H5ZA 5HVFA 1H2GA 2PF4E 3TCVA 2ZNJA 3D7FA 4NJQA 4AG7A 2Z3OA 3MHHC 3SYQA 1TAEA 5LYJB 3TO6A 3U10A 3DNSA 4KSFA 2EIJC 1HR0B 5C82A 3DDDA 3FB8C 3SJCC 3GLJA 5B1AC 3CMEV 3QVNA 3R65A 4H33A 2UXBB 3NE8A 1V54B 4MY0A 4IYIA 2IJZA 5EK0A 2J9AA 3IJ3A 3PRTA 5KAFZ 1XNQO 1BL8A 1HR0O 1GN3A 1S7KA 2REEA 2Q44A 3R95A 3BA9A 1FJGB 2DWDC 2QSAA 2UXBO 2FYUH 4YGOA 3QTCA 1FXKA 2HKOA 3C3SA 3DXRA 1Y7RA 3W91A 2F66C 3TJTA 4BIUA 1FJGO 2H3OA 5G20A 4B12A 4X89A 4IHJA 2WLLA 1A2ZA 1SA0A 2YGWA 2I79A 2QECA 3JYCA 1CP7A 2B5GB 1Q86W 5BWAB 1VHOA 3WB1A 5EBWC 3ML0A 4JD6A 1G8MA 1FXKC 1BPMA 3N5FA 4LH6A 4GLXA 2KKWA 3B8MA 3JAWB 5J1QA 3WG7C 3UM7A 1RPOA 2QWRB 4ICGA 4QBJA 2OCHA 2PI5A 4Q7AA 1NSLA 1WB8A 1WB7A 4ZY0A 4JZ2A 2KQXA 4B3TB 3KL9A 2JJ1G 2ZR3A 3S6HA 1FYJA 3ZJ0A 1N33B 1LFWA 2I3CA 3GUXA 1XNRO 3JCUZ 1B06A 3MRUA 1AR1B 3K9TA 4IUSA 2B1GA 1FFXA 2A4NA 2Q67A 1NSAA 3ABMB 1ZLHA 1IZ3A 2WLIA 2PZSA 1Y0YA 2AFZA 2R1IA 1MG1A 2F23A 1N33O 2DYRB 4O4HA 5CA3A 3JATB 4CAFA 1W0JG 3CD6V 2GU2A 2GTSA 1KZFA 3FECA 2WLMA 3NH5A 5H6QA 3B3VA 1OCOB 2DE0X 2O53A 1OCRB 1VQKV 3BLNA 4P10A 3SYPA 2OZUA 1OV9A 4AXVA 2Z3NA 1DF4A 3SDLA 4QPKA 4HKFA 3G6EV 2Q6AA 2V8VA 4QB9A 2ZEMA 3FFQA 2CH7B 1ZLIA 1HDQA 2YC0A 2Z11A 4WFGA 4C2ZA 2G3AA 3KG2A 2BCCH 2WYRA 1IYLA 4XPLA 2IL4A 3H8EA 4PDLA 1XOUA 3UT5A 3D8PA 2JDDA 4OC1A 3UCSC 2EBOA 2QJ1A 5CMUA 1GKFA 1VKCA 2DJVA 4UVCA 2M7WA 2W0XA 5JJJB 4BW9A 2HQYA 3EO4A 4KUBA 1KKCA 4GZRB 4HNYB 4CGMA 1BS3A 4B3SO 5F09A 1QU7A 4R6ZA 5KAIZ 2RQ6A 5JH9A 1IXMA 5CA1A 3TXSA 4R8CA 4TOIA 2JK5C 4FLYA 3L9DA 1QSTA 1IY7A 4J80A 1S3JA 4JXQA 3HKDB 2LP7A 2B4DB 2D4PA 2QGNA 1GYTA 4X1IA 4NTYA 1GH6A 3E22A 3ETGA 2V8HA 4PDRA 1JMKC 2PJAA 3K58A 3CJHB 2OOTA 4E2LA 4D6TH 2PGGA 1UPGA 4I7ZB 3TTHA 1OCRC 1CPSA 5E79Z 4UCTA 4DR4O 5CB4A 5K1PA 4LR3A 2Q04A 1VF5B 4MT8A 2PRQA 2GDSA 1QHTA 1QLNA 4K8ZA 1FNOA 2VL1A 4P4DA 4I50B 4TQDA 3J80N 3KGQA 2EK9A 1FKAO 1DTDA 3BI1A 4CAVA 4LNUA 2X7RB 1QBZA 4O4IB 2B3VA 2VRZA 4CZZA 2Q4VA 3I56V 1M4IA 2HR3A 4FPPA 1P7GA 4UV9A 5GW7A 4PJ0Z 5J8CA 4I0XA 5ITZB 1OCZC 1OCCB 2ZE5A 3SI2A 4TWEA 4UV8A 5GONB 3CE2A 1M4DA 4ZY1A 3M8AA 4EFDA 4MVZA 4U9ZA 5AG7A 4ZI7B 2FVGA 4PV1B 1VQ6V 1S5LZ 2LW1A 2YSUB 2P67A 4W4LA 2CNMA 5F49A 2OTLV 5IB0A 1TKFA 2Z3MA 2AZ2A 3MHSC 5KMGB 1CEZA 5AG2A 1Z8LA 1GK9A 3OEEG 4ZHQB 4M3SA 2QKAA 3FF3A 3PB8X 3IGAC 2F1MA 5H2FZ 3S9MA 4H6UA 3M7MX 4J11A 1SESA 3FAVA 3NA6A 4JYCA 4UEFA 2VQFB 1B87A 4UUJC 2FB5A 3S9LA 2XOKG 3AG1C 4TWKA 1K4DC 1SC5B 4NF1A 4FLZA 2XASA 4NXYA 1MJBA
chains in the Genus database with same CATH topology
2O28A 2OH1A 1L0CA 1XEBA 4MY3A 1M1DA 1TIQA 3IWGA 4YFJA 4XNHB 3W6SA 3T90A 4KVME 1ZO0A 2K5TA 3K9UA 3JUWA 1V0CA 3SXOA 3T9YA 2G0BA 3TE4A 1Y9WA 1YK3A 3TO9A 4A31A 4R87A 1ON0A 1Z4RA 5FVJA 3PGPA 2D4OA 4J3GA 2OU2A 3N7ZA 3IGRA 5HH1A 2ZW4A 3I9SA 4CYQA 2R98A 1KUXA 3SXNA 4UCMA 3S6GA 4A95A 3PP9A 4XPKA 2PR1A 4CAEA 1Z4EA 2JEVA 1VHSA 4ORFA 1QSNA 4KLWA 4NEXA 1MJ9A 5KTAA 5G1ZA 3KKWA 3EC4A 4R57A 2KCWA 2J8NA 4UA3A 1S7FA 3R9GA 1Q2CA 4XPDC 4ONUA 3W6XA 4XNHC 1XIXA 5C88A 4ZBGA 2Z3KA 3VWEA 2ZW7A 3D2PA 4A32A 4DNCA 2JDCA 2P6FA 2FXFA 4U9YA 2CXAA 3IU1A 2Y0MA 2NMTA 2VEZA 3DSBA 3FRMA 4CGOA 3CXSA 4C68A 2FCKA 4FD5A 3G3SA 4MBUA 4C7IA 4KOSA 4F0XA 4KOTA 3BJ7A 1FY7A 3EY5A 2WPWA 1OZPA 2JLMA 2ZXVA 2Q4YA 1LRZA 3A9LA 2J8RA 2Z3LA 2YNDA 3S6KA 4E0AA 2BEIA 4UFVA 3UY5A 1IIDA 4LUAA 3GKRA 5E96A 4H89A 4PK3A 1QSMA 3B8GA 3CXQA 5G21A 3FBUA 4CAWA 1YX0A 3QAHA 2Z10A 4B14A 4GS4A 4NCZA 3H4QA 1XMTA 4CAXA 3TOBA 4QC6A 4B10A 1J4JA 4UBRA 5JQ4A 4RS2A 4B5OA 2G3TA 4HNXB 4OAEA 3SHPA 2OZHA 2C27A 4A33A 4XPDB 4LX9A 5H84A 2X7BA 3FXTA 1M44A 4FD7A 1Y9KA 3MGDA 3QB8A 2DPTA 1P4NA 1I12A 2QMLA 1P0HA 3ZZIA 1XE4A 4H6ZA 1I1DA 2ATRA 4Y49C 1NE9A 1S3ZA 3IWEA 4AG9A 2GIVA 2YNCA 2B5GA 4AVBA 2WSAA 1Z9UA 2Z3PA 4IF5A 1YVOA 2FS5A 3GY9A 4R9MA 2Q7BA 4U5YA 3RYOA 2FIWA 4AVAA 4MFLA 4MHDA 4F6AA 1N71A 1MJAA 1PU9A 2BSWA 5IX3A 4CYNA 2CNSA 3F5BA 4UFXA 4KOWA 2DPSA 3LODA 2OZGA 4Q36A 1SQHA 1MK4A 1YR0A 3DR6A 2ZW5A 2ZPAA 1S60A 4MFKA 2PSWA 3BJ8A 3R9FA 4CYOA 5JPHA 1YGHA 1I21A 2VXKA 2EUIA 3I3GA 3TFYA 2PDOA 3WR7A 4JWPA 1K4JA 3OWCA 4OADA 2VQYA 3H5ZA 3PZJA 4KZTA 3TCVA 1KUVA 4B5PA 5DWMA 4AG7A 2Z3OA 3GYAA 3NE7A 3TOAA 3TO6A 3DNSA 3P2FA 4KSFA 2VZZA 4F0YA 5C82A 3DDDA 4KSAA 2BL1A 1CJWA 2EVNA 4UCNA 2AJ6A 4MY0A 1IICA 4KLVA 4Y49B 2J8MA 3R96A 5ISVA 2GE3A 1S7KA 2REEA 3LD2A 2Z0ZA 4KOUA 2Q44A 3R95A 3D3SA 4A30A 4ZGYB 4PV6A 1BOBA 4YGOA 4B11A 4K30A 4CGPA 2B4BA 5AG5A 1Y7RA 1S5KA 2BUEA 3W91A 5G20A 3F8KA 2B4DA 1PUAA 4B12A 3D2MA 2HUZA 2YGWA 2I79A 2QECA 3JTKA 4NSQA 4E8OA 2FIAA 2B5GB 4MFZA 5BWAB 5EBVA 1M4GA 4JD6A 4BMHA 4QVTA 1Q2DA 2WPXA 3FNCA 2B58A 1B6BA 3C26A 4MFJA 2P6GA 2WUUA 4QBJA 4L89A 1NSLA 4II9A 5G22A 3S6FA 4UFWA 3G8WA 3S6HA 3ZJ0A 1CM0A 1IYKA 1S7NA 1GHEA 3R1KA 3E0KA 4IUSA 2FE7A 5F46A 3F0AA 2ARHA 2A4NA 4M85A 2R1IA 1IB1E 4CAFA 3DR8A 2P6EA 1KZFA 2I00A 3FIXA 3BLNA 4KOXA 4CS0B 2OZUA 4JJXA 4CGLA 4KOVA 4C2XA 2Z3NA 1YLEA 4CRYB 4B5PB 4HKFA 4YRHA 4Q38A 4QB9A 5A27A 2F5IA 2FT0A 2AE6A 2Z11A 4C2ZA 2G3AA 4AVCA 4MI4A 1XF8A 2YNCC 1IYLA 4XPLA 4QUSA 2PC1A 2IL4A 4UCPA 4X5KA 4RI1A 2Q0YA 4HNWB 3D8PA 1WK4A 1QSRA 2JDDA 2H5MA 2GANA 4I49A 5HMNA 1VKCA 3TO7A 2HQYA 1U6MA 2HV2A 4KORA 2P0WA 2PQ8A 3EO4A 4KUBA 5AG6A 5DWNA 4E2AA 5AG4A 4MFPA 4HNYB 5EC4A 5GCNA 3VWDA 2YNEA 4CRZB 4R3KA 4CGMA 5AGEA 3EXNA 4KS9A 1YVKA 1QSOA 1QSTA 4PSXA 4JXQA 2B4DB 2D4PA 2CY2A 2VBQA 4OLLA 2DXQA 4KVOE 4KVXA 2RC4A 1BO4A 4FD4A 4UWIA 2FL4A 3FB3A 5KTCA 4FD6A 3TTHA 2FSRA 4PSWA 4JLYA 5KTDA 3EFAA 1RO5A 2Q04A 3P2HA 5H86A 3R9EA 4MJ8A 1R57A 4CGNA 2REFA 3TT2A 4CAVA 1YREA 4C7HA 2B3VA 2Q4VA 4A2ZA 1Q2YA 3JVNA 1RXTA 1M4IA 1WWZA 1NMTA 2ZW6A 5J8CA 5F48A 1M4DA 4R3LA 5F47A 4MFQA 2OB0A 2CNTA 4B13A 4U9ZA 5AG7A 5CNPA 5I0CA 2PRBA 3V8IA 2PR8A 4C2YA 2CNMA 3IU2A 4L8AA 5F49A 5IB0A 2Z3MA 2QIRA 1KUYA 2VI7A 4AB7A 2R8VA 4PK2A 4EVYA 1S7LA 5IV0A 4M3SA 3CXPA 4BBHA 2R7HA 2B3UA 4H6UA 4CYPA 4JXRA 1B87A 4UWJA 5J8FA 1UFHA 3FYNA 5A28A 4NF1A 4NXYA 1MJBA 2VZYA 4KOYA 4KUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O28 A;  2OH1 A;  1L0C A;  1XEB A;  4MY3 A;  1M1D A;  1TIQ A;  3IWG A;  4YFJ A;  4XNH B;  3W6S A;  3T90 A;  4KVM E;  2K5T A;  3K9U A;  3JUW A;  1V0C A;  3SXO A;  3T9Y A;  2G0B A;  3TE4 A;  1Y9W A;  1YK3 A;  3TO9 A;  4R87 A;  1ON0 A;  1Z4R A;  5FVJ A;  3PGP A;  2D4O A;  4J3G A;  2OU2 A;  3N7Z A;  3IGR A;  5HH1 A;  2ZW4 A;  3I9S A;  2R98 A;  1KUX A;  3SXN A;  3S6G A;  3PP9 A;  4XPK A;  2PR1 A;  1Z4E A;  2JEV A;  1VHS A;  4ORF A;  1QSN A;  4KLW A;  4NEX A;  1MJ9 A;  5KTA A;  3KKW A;  3EC4 A;  4R57 A;  2KCW A;  2J8N A;  4UA3 A;  1S7F A;  3R9G A;  1Q2C A;  4XPD C;  4ONU A;  3W6X A;  4XNH C;  1XIX A;  5C88 A;  4ZBG A;  3VWE A;  2ZW7 A;  3D2P A;  4DNC A;  2JDC A;  2P6F A;  2FXF A;  4U9Y A;  2Y0M A;  2NMT A;  2VEZ A;  3DSB A;  3FRM A;  3CXS A;  2FCK A;  4FD5 A;  3G3S A;  4MBU A;  4KOS A;  4KOT A;  3BJ7 A;  1FY7 A;  3EY5 A;  2WPW A;  1OZP A;  2JLM A;  2ZXV A;  2Q4Y A;  1LRZ A;  2J8R A;  3S6K A;  4E0A A;  2BEI A;  3UY5 A;  1IID A;  4LUA A;  3GKR A;  5E96 A;  4H89 A;  4PK3 A;  1QSM A;  3B8G A;  3CXQ A;  3FBU A;  4CAW A;  1YX0 A;  3QAH A;  2Z10 A;  4GS4 A;  4NCZ A;  3H4Q A;  1XMT A;  4CAX A;  3TOB A;  4QC6 A;  1J4J A;  4UBR A;  5JQ4 A;  4RS2 A;  4B5O A;  2G3T A;  4HNX B;  4OAE A;  3SHP A;  2OZH A;  2C27 A;  4XPD B;  4LX9 A;  5H84 A;  2X7B A;  3FXT A;  1M44 A;  4FD7 A;  1Y9K A;  3MGD A;  3QB8 A;  1P4N A;  1I12 A;  2QML A;  1P0H A;  3ZZI A;  1XE4 A;  4H6Z A;  1I1D A;  2ATR A;  4Y49 C;  1NE9 A;  1S3Z A;  4AG9 A;  2GIV A;  2B5G A;  4AVB A;  1Z9U A;  4IF5 A;  1YVO A;  2FS5 A;  3GY9 A;  4R9M A;  2Q7B A;  4U5Y A;  3RYO A;  2FIW A;  4AVA A;  4MHD A;  4F6A A;  1N71 A;  1MJA A;  1PU9 A;  2BSW A;  5IX3 A;  2CNS A;  3F5B A;  4KOW A;  3LOD A;  2OZG A;  1SQH A;  1MK4 A;  1YR0 A;  3DR6 A;  2ZW5 A;  2ZPA A;  1S60 A;  2PSW A;  3BJ8 A;  3R9F A;  5JPH A;  1YGH A;  1I21 A;  2VXK A;  2EUI A;  3I3G A;  3TFY A;  2PDO A;  3WR7 A;  4JWP A;  1K4J A;  3OWC A;  4OAD A;  2VQY A;  3PZJ A;  4KZT A;  3TCV A;  1KUV A;  4B5P A;  5DWM A;  4AG7 A;  3GYA A;  3NE7 A;  3TOA A;  3TO6 A;  3DNS A;  3P2F A;  2VZZ A;  4F0Y A;  5C82 A;  3DDD A;  2BL1 A;  1CJW A;  2EVN A;  2AJ6 A;  4MY0 A;  1IIC A;  4KLV A;  4Y49 B;  2J8M A;  3R96 A;  5ISV A;  2GE3 A;  1S7K A;  2REE A;  3LD2 A;  2Z0Z A;  4KOU A;  2Q44 A;  3R95 A;  3D3S A;  4PV6 A;  1BOB A;  4YGO A;  4K30 A;  2B4B A;  1Y7R A;  1S5K A;  2BUE A;  3W91 A;  3F8K A;  2B4D A;  1PUA A;  3D2M A;  2HUZ A;  4NSQ A;  2I79 A;  2QEC A;  4E8O A;  2FIA A;  2B5G B;  5EBV A;  1M4G A;  4JD6 A;  4BMH A;  4QVT A;  1Q2D A;  2WPX A;  3FNC A;  2B58 A;  1B6B A;  3C26 A;  2P6G A;  4QBJ A;  4L89 A;  1NSL A;  4II9 A;  3S6F A;  3G8W A;  3S6H A;  3ZJ0 A;  1CM0 A;  1IYK A;  1S7N A;  1GHE A;  3R1K A;  3E0K A;  4IUS A;  2FE7 A;  5F46 A;  3F0A A;  2ARH A;  2A4N A;  4M85 A;  2R1I A;  1IB1 E;  3DR8 A;  2P6E A;  1KZF A;  2I00 A;  3FIX A;  3BLN A;  4KOX A;  4CS0 B;  2OZU A;  4JJX A;  4KOV A;  1YLE A;  4CRY B;  4B5P B;  4HKF A;  4YRH A;  4QB9 A;  2F5I A;  2FT0 A;  2AE6 A;  2Z11 A;  2G3A A;  4AVC A;  4MI4 A;  1XF8 A;  1IYL A;  4XPL A;  4QUS A;  2PC1 A;  2IL4 A;  4X5K A;  4RI1 A;  2Q0Y A;  4HNW B;  3D8P A;  1WK4 A;  1QSR A;  2JDD A;  2H5M A;  2GAN A;  4I49 A;  5HMN A;  1VKC A;  3TO7 A;  2HQY A;  1U6M A;  2HV2 A;  4KOR A;  2P0W A;  2PQ8 A;  3EO4 A;  4KUB A;  5DWN A;  4E2A A;  4HNY B;  5EC4 A;  5GCN A;  3VWD A;  4CRZ B;  4R3K A;  3EXN A;  1YVK A;  1QSO A;  1QST A;  4PSX A;  4JXQ A;  2B4D B;  2D4P A;  2CY2 A;  2VBQ A;  4OLL A;  2DXQ A;  4KVO E;  4KVX A;  2RC4 A;  1BO4 A;  4FD4 A;  4UWI A;  2FL4 A;  3FB3 A;  5KTC A;  4FD6 A;  3TTH A;  2FSR A;  4PSW A;  4JLY A;  5KTD A;  3EFA A;  1RO5 A;  2Q04 A;  3P2H A;  5H86 A;  3R9E A;  4MJ8 A;  1R57 A;  2REF A;  3TT2 A;  4CAV A;  1YRE A;  2B3V A;  2Q4V A;  1Q2Y A;  3JVN A;  1RXT A;  1M4I A;  1WWZ A;  1NMT A;  2ZW6 A;  5J8C A;  5F48 A;  1M4D A;  4R3L A;  5F47 A;  2OB0 A;  2CNT A;  4U9Z A;  5I0C A;  5CNP A;  2PRB A;  3V8I A;  2PR8 A;  2CNM A;  4L8A A;  5F49 A;  5IB0 A;  2QIR A;  1KUY A;  2VI7 A;  4AB7 A;  2R8V A;  4PK2 A;  4EVY A;  1S7L A;  5IV0 A;  4M3S A;  3CXP A;  2R7H A;  2B3U A;  4H6U A;  4JXR A;  1B87 A;  4UWJ A;  5J8F A;  1UFH A;  3FYN A;  4NF1 A;  4NXY A;  1MJB A;  2VZY A;  4KOY A;  4KUA A; 
#chains in the Genus database with same CATH topology
 5LHG A;  2VQF O;  2O28 A;  1XBL A;  1HNX B;  3L70 H;  4W4K A;  2CTW A;  3QNV A;  2ZOF A;  4JAV A;  2ZE6 A;  4KXR A;  1HDU A;  2LGQ A;  4ZIB A;  4KVM E;  2E5L B;  1DF5 A;  1DLB A;  1BE3 H;  1Q3E A;  1V0C A;  1KYO F;  3D7G A;  3K9U A;  3TE4 A;  4K8X A;  4JV5 B;  3TO9 A;  4A31 A;  1JOY A;  1OZ0 A;  3ZIA G;  2E5L O;  1ON0 A;  4MVQ A;  5LL6 Y;  1U96 A;  4ZOL B;  3LNM B;  2WA3 A;  4JAU A;  3CCR V;  3HKC B;  4JV5 O;  2Q69 A;  1NJI W;  3PGP A;  3N2G B;  1RP3 B;  2G9D A;  2OU2 A;  3H1K H;  1AJN A;  4MW8 A;  2ATK C;  2PIZ A;  4FIP C;  2F8H A;  2XEF A;  1WNS A;  3IGR A;  3N7Z A;  4L87 A;  3I9S A;  1IU8 A;  3ABK B;  4LBE C;  3SXN A;  1JFF B;  2QE7 G;  4UCM A;  1VQO V;  3J81 N;  2Q73 A;  3CEI A;  4JI3 B;  2QM7 A;  4JI7 B;  3GIU A;  2PR1 A;  5LP6 B;  4FZ0 A;  3KZW A;  1K9M W;  4PD4 F;  1VHS A;  1MZE A;  3T4Z A;  2IJJ A;  2QM4 A;  3KKW A;  3EC4 A;  1MNG A;  2Y69 C;  4Z1M G;  4JI3 O;  4DK0 A;  5KA5 A;  2P6J A;  4JI7 O;  2JDI G;  1J95 A;  5B5E Z;  4LC1 A;  3K03 A;  4PXE A;  4X20 A;  4O4J B;  1XIX A;  2E76 B;  5C88 A;  3K04 A;  1F7Y A;  4UVA A;  2Z3K A;  3AG3 B;  1MSW D;  3D2P A;  2JBK A;  1R3K C;  1RPR A;  1SQV H;  2Q7H A;  4I4T A;  5FNV B;  4JTD B;  2CXA A;  3TK1 A;  2IJI A;  1M90 W;  5KHH A;  2IU0 A;  4YWY A;  3ZHS A;  4RWU A;  1QQC A;  2KG7 B;  2Y0M A;  4TUY A;  2NMT A;  2VEZ A;  5LYI A;  2PJC A;  3JRU A;  4CGO A;  1FFT B;  2HC9 A;  2AFU A;  5CA0 B;  4K0K B;  4UF4 A;  2Q5Z A;  1NKD A;  4DUY O;  2FCK A;  4FD5 A;  3U11 A;  2ITD C;  3G3S A;  2AFS A;  4MBU A;  5FLX N;  4WFF A;  3ZJZ A;  1W2B U;  4KOT A;  2UXC O;  1XI1 A;  5EBM C;  1M5I A;  2WPW A;  2QWO B;  4JYA B;  3GWK C;  2F4V B;  2GHY A;  4GUN A;  4I5S A;  3R66 A;  3ABK C;  2Q4Y A;  1LRZ A;  2J8R A;  5LRK A;  2Z3L A;  3ABL B;  2EIN B;  3CCV V;  3SJE A;  2IBZ H;  4JYA O;  2F4V O;  1W59 A;  3CCJ V;  5LP6 C;  2BEI A;  1IID A;  4LUA A;  5E96 A;  3DGE A;  2QKC A;  1QSM A;  2IU3 A;  3CXQ A;  5G21 A;  2ZR2 A;  1VF7 A;  4YXW G;  1YX0 A;  2JRI A;  3DGV A;  3QAH A;  2RFH A;  3RYF A;  4X8I A;  5IYB O;  2ODM A;  3H4Q A;  3C90 A;  4C7U A;  2Q43 A;  2VS0 A;  4BWA A;  1XMT A;  5BY1 A;  4G28 B;  4CAX A;  4QC6 A;  3HPL C;  1R6T A;  2ETN A;  5DS0 A;  4B10 A;  2R9I A;  3Q4H A;  2YIC A;  3T8W A;  1K8A W;  1R6K A;  1TF9 A;  3VAR A;  4B5O A;  1ZL8 A;  3W7U A;  2UXX A;  3APQ A;  1L1F A;  4YY3 B;  3AG4 C;  3AG7 A;  3L73 H;  2WZN A;  5LXT B;  4GXH A;  4JI5 B;  2DF5 A;  4NXM B;  4X1K B;  4XPD B;  1XUQ A;  2CTQ A;  2CDY A;  3LSU A;  1M44 A;  4FD7 A;  3MGD A;  4UB8 Z;  1CPX A;  5CBM A;  1YTF B;  5LBQ A;  3B3S A;  3PB9 X;  1KKD A;  3JSL A;  4I55 B;  4YY3 O;  3OFN G;  4JI5 O;  4NXM O;  3JAK B;  3ETD A;  4WBN B;  1PNK A;  4DV0 B;  2E75 B;  1NE9 A;  4LWS A;  4N21 A;  5J2U B;  2VWK A;  2EZO A;  3H01 A;  4B7K A;  4LCU C;  2YNC A;  3S9N A;  4EWT A;  4O4L B;  4NR1 A;  3B3W A;  5D5P A;  1JWQ A;  1YVO A;  3PB4 X;  1FS0 G;  1B6Q A;  3OGI B;  1GM8 A;  4U5Y A;  2EIM B;  4MVS A;  1K5Q A;  1MZF A;  2FIW A;  4Z2W A;  1OHH G;  2KB1 A;  4MFL A;  3M99 B;  1KC8 W;  5IX3 A;  3BXM A;  1BCC H;  2CNS A;  4UIA A;  4UFX A;  2BTQ A;  3SYC A;  4ZX8 A;  1CPY A;  1AR5 A;  5JCO C;  3RO0 A;  3W7S A;  1XL6 A;  1JVM A;  2IMO A;  2BSK B;  2ZKO A;  1NH2 D;  1ORQ C;  5GTH Z;  1RM1 C;  3DR6 A;  2PIY A;  2ZPA A;  4MFK A;  2PJ9 A;  3OGC C;  5J2T A;  1M1K W;  2WSS G;  4IIJ A;  3I3G A;  4CH3 A;  1LR1 A;  5H5N A;  4JWP A;  3WR7 A;  1TXR A;  2Y0P A;  2Q51 A;  2YID A;  1TVK B;  2VQY A;  2HFE C;  2BTO A;  4OP4 A;  3RVY A;  4Q20 A;  1UFI A;  4O2A A;  2LW7 A;  4MTX A;  5D8N A;  2DQ3 A;  4X65 B;  4RQF A;  3GYA A;  3D36 A;  1NBM G;  3EHB B;  4D7S A;  1NTK H;  2VZZ A;  1M57 C;  3JAM N;  3LSS A;  2YXY A;  3KCX A;  3KZI Z;  2ZCE A;  2EVN A;  4UCN A;  4X65 O;  1QNM A;  3PBE A;  3I5D A;  4Y49 B;  3R96 A;  4WFH A;  2ZEF A;  2EIM C;  1Q6U A;  3HKE B;  3D3S A;  3D36 C;  3LNN A;  3K5N A;  4PV6 A;  2Q0O C;  5HVG A;  4B11 A;  1GTO A;  4K30 A;  1O9G A;  1QLE C;  2B4B A;  2RB7 A;  3ZRW B;  3GB7 C;  2JGD A;  4A5U B;  4E8O A;  3JTK A;  5DM6 V;  4DO2 A;  3U0Z A;  3MAQ A;  1E1Q G;  2XUM A;  5EBV A;  4PXC A;  1M4G A;  3KCY A;  3LMS A;  1SKV A;  2YEV B;  3WB0 A;  1K4C C;  2VQE B;  2AW9 A;  4FLW A;  3C26 A;  4F6E A;  4L89 A;  1WA8 B;  1N34 B;  3SYA A;  2IH1 C;  3G8W A;  2E3C A;  3JAS A;  2VQE O;  1P84 F;  1S7N A;  2JIZ G;  5K8N A;  1SS3 A;  1VIX A;  2ARH A;  1N34 O;  3SJX A;  1GM9 A;  4B08 A;  5LRJ A;  4NGQ A;  3NFZ A;  3SPH A;  1V55 C;  2EIJ B;  1IBM B;  3DR8 A;  2P6E A;  3TGU H;  1NU1 H;  4LQG A;  5B1A B;  2R72 A;  3CC4 V;  3I55 V;  4DUZ B;  4MW3 A;  2PJ6 A;  4KOX A;  1LUV A;  3H1H H;  4JJX A;  4P9P A;  3NXS A;  3SI1 A;  4NYK A;  1IBM O;  4GX5 A;  3OR6 C;  3ZCC A;  2RJZ A;  4FVM A;  1R1B A;  3G80 A;  3E8B A;  4DUZ O;  1WLE A;  5A27 A;  2JS3 A;  2FT0 A;  1Y0R A;  4Z65 A;  4PI0 A;  1I08 A;  5LHH A;  1HNW B;  2PC1 A;  4UCP A;  3CHX A;  4WCE V;  1URF A;  1WK4 A;  1QSR A;  4MVM A;  2GAN A;  4I49 A;  3OT7 A;  3JSN A;  4OX9 B;  2BOC C;  1RTQ A;  3WFV A;  1HNW O;  1U6M A;  3ASN C;  5JQG A;  2P0W A;  5AG6 A;  4E2A A;  4HNA A;  4MFP A;  2UUC O;  5GCN A;  3VWD A;  2YNE A;  2OYQ A;  5I4M A;  2ANP A;  2K1E A;  4KHP O;  1FXK B;  5AGE A;  4F8Z A;  1Y4M A;  3DXR B;  5B1B C;  4KS9 A;  4OX9 O;  4J9Y B;  2QA4 V;  4PSX A;  4JZG A;  3WG7 B;  3BVO A;  1M56 C;  4OPH A;  2VBQ A;  4IHJ B;  2RMK B;  2WLL B;  3KHZ A;  3W7X A;  1SA0 B;  2QWQ B;  2EX3 A;  4HPS A;  4KVO E;  4GKK B;  3FEE A;  2XAH A;  2CGN A;  4DV3 B;  1ZAU A;  2RC4 A;  1XNQ B;  4UWI A;  1FT7 A;  1N0N A;  5HFL A;  3ZRS A;  3K0G A;  2Z0A A;  2FL4 A;  4MTO A;  5KTC A;  4FFK A;  2Y0I A;  4GKK O;  1YZB A;  3BCC H;  1BT8 A;  2CIJ A;  1TUB A;  4M6G A;  4DV3 O;  5KHI A;  1FXH A;  1BLL E;  3WC5 A;  4GX1 A;  5HFM A;  2XAG A;  4DR6 B;  1P7B A;  5H86 A;  3R9E A;  1ENV A;  2EBJ A;  1TUE B;  1VQ7 V;  5DN6 G;  2F93 B;  1FFX B;  3BFR A;  4A2Z A;  4DR6 O;  3A0R A;  2LFR A;  4YJ2 A;  5E1A C;  2WLI B;  2JEX A;  4O4H B;  3L2N A;  2AHZ A;  2C6P A;  4N23 A;  3CCE V;  4PPZ A;  2RDC A;  5F47 A;  4DUK A;  2OB0 A;  3SPG A;  2CNT A;  1OJH A;  3RBU A;  5I0C A;  1AYE A;  2UU9 B;  2JBJ A;  2BCO A;  4IK2 A;  2PR8 A;  4LFB B;  4C2Y A;  1AVM A;  2PYJ A;  2VI7 A;  4OID A;  4G2K A;  5KX5 A;  4AB7 A;  1COW G;  1XNR B;  4EVY A;  2VWJ A;  4LH7 A;  5IJ0 A;  1SQG A;  2UU9 O;  3CXP A;  1PKX A;  4XDJ A;  3OW2 U;  3CCL V;  4LFB O;  1F2P A;  5HVH A;  4UFZ A;  3ZED A;  4EB6 A;  4MSW C;  4CYP A;  3RYI A;  1NTM H;  3IFE A;  3UT5 B;  2FML A;  5J8F A;  3FB6 C;  3IAY A;  3FYN A;  5A28 A;  4K35 A;  2JVD A;  5BMV A;  2MW2 B;  1KU9 A;  1IGB A;  3CRA A;  1SQP H;  5IT9 N;  4G27 B;  5JM6 A;  1IX9 A;  3ETQ A;  2YI8 A;  3GB0 A;  5CA1 B;  1TIQ A;  1YCI A;  4J9Z B;  1NT2 B;  3FX6 A;  4PXD A;  3W6S A;  4YFJ A;  2ILM A;  1M9N A;  4CH4 A;  3OMN B;  2NNU A;  1Z8X A;  1ZO0 A;  3SPC A;  3T9Y A;  3SXO A;  4BD9 A;  1H38 A;  4X1I B;  3F5W C;  3ZHT A;  3E22 B;  2YUA A;  1Y9W A;  4JI1 O;  1Q81 W;  2CGO A;  1AJQ A;  2PTM A;  5LOV A;  1P4R A;  4NTW A;  1QQ9 A;  3N2K A;  2XT9 A;  5A2Q N;  4R87 A;  4ZI6 A;  1Q6I A;  2NR5 A;  4FWU A;  1OCZ B;  5CB4 B;  4B3S B;  4YIP A;  4R7C A;  5CBG A;  2D4O A;  1KP2 A;  1K7D A;  3VBB A;  3WT4 A;  3KKY A;  3STL C;  1BZK A;  4P4I A;  1VMG A;  5DEC A;  4CS4 A;  3ZHR A;  2XHB A;  1FD9 A;  4BW5 A;  4FBE A;  2CAZ C;  2IH3 C;  4LNU B;  1SRY A;  2DW4 A;  5L3B A;  4A95 A;  4UIB A;  4I0X B;  3G71 V;  1NI8 A;  5A9G A;  4XPK A;  2HVJ C;  2ZD9 A;  2ZEH A;  4CAE A;  2JEV A;  1S76 D;  4ORF A;  4DR4 B;  1QSN A;  3MN8 A;  1ZG9 A;  5KHK A;  2H8P C;  4IHM A;  3AG1 B;  2L35 A;  3ZMZ A;  1JJ2 U;  4JI6 B;  4CC6 A;  1IVS A;  5BXZ A;  1TF8 A;  1N4C A;  2H94 A;  2PJ2 A;  4X64 B;  4ONU A;  2X6B A;  2EWB A;  2GRE A;  4ZBG A;  1SET A;  4JYB A;  1YIT V;  1M4L A;  2JDC A;  2FXF A;  4JI6 O;  2HP8 A;  3FAV B;  3CP1 A;  4X64 O;  4J7J A;  4L8J A;  1S0V A;  4OC0 A;  3DSB A;  3FRM A;  1L8D A;  3CXS A;  4XDL A;  3CXH F;  3F7V C;  3G67 A;  4C7I A;  2WPD G;  3BJ7 A;  3FKS G;  2P7T C;  3RGB A;  3RYC B;  3VQW A;  1OZP A;  3A0H Z;  2AXT Z;  2Y4U A;  4TV9 A;  4RO2 A;  4WFE A;  3S3X A;  1J5E O;  3A9L A;  4DXW A;  1I7F A;  4GX0 A;  4DR3 B;  1F23 A;  1HEE A;  4WF9 V;  2IJK A;  1SZX A;  4AHC A;  3ZHU A;  4FLT A;  4P6Y A;  4FLU A;  3HR0 A;  2JJ2 G;  4PK3 A;  3B8G A;  4MHN A;  2CK3 G;  3HUV A;  2Z10 A;  5KLV H;  4DR3 O;  3RWR D;  3TET A;  3K08 A;  4X3R A;  4OKO A;  1TKJ A;  4P4J A;  1SQQ H;  2GUZ A;  1CBX A;  3PB6 X;  1YJN V;  2Y69 B;  4JGS A;  3E83 A;  3RVZ A;  5JQ4 A;  5FPO A;  4FLV A;  2G3T A;  2Q7S A;  4OME A;  1PP9 H;  3RYC A;  2LFS A;  3AK3 A;  3ZMT A;  2B5U A;  4YJ3 A;  3E8H A;  1ZG7 A;  2X7B A;  3FXT A;  3PFO A;  1R43 A;  4NGM A;  3QB8 A;  1Q8I A;  1DK1 A;  1VQM V;  3ETE A;  4H0L B;  3ZZI A;  4QNH B;  2Q8V A;  4RAI A;  1TGO A;  3JD0 A;  1Q6H A;  4LFC B;  3X2Q C;  1EN6 A;  1Z8W A;  3IWE A;  4J7Z A;  4QJF B;  1F57 A;  2OT5 A;  2GV9 A;  2WLH A;  3OR7 C;  4JI8 B;  4AVB A;  4X2T A;  2WSA A;  1Z9U A;  1QCE A;  3DC5 A;  4YU9 A;  3CC7 V;  2F7V A;  4X20 B;  4NFR A;  4IF5 A;  1Q90 D;  1EZV H;  3H1I H;  1VIB A;  2FS5 A;  4R9M A;  1B3Q A;  4LFC O;  2Q7B A;  4B3M B;  3OE7 G;  1E79 G;  4NGP A;  1CP9 A;  3RYO A;  1ARL A;  4NKG B;  4AVA A;  3FMC A;  4JI8 O;  4I4T B;  1VQ8 V;  4F6A A;  3VAT A;  1N71 A;  5B3S B;  4QE9 A;  3F5T A;  4B3M O;  3F5B A;  1QVG U;  2G38 A;  1GO3 F;  1WPX A;  4TUY B;  3PN1 A;  3LOD A;  4OC5 A;  2N05 A;  3ZBH A;  4X62 B;  3CXC U;  1ARO P;  3ZMU A;  1SQH A;  1PNL A;  1MK4 A;  5EYP A;  1YR0 A;  2ZOG A;  3B3T A;  4U7N A;  4EKW A;  2A3Q A;  3ZN1 A;  2W0F C;  4IAV A;  4LFA B;  4DRX A;  4B6Z A;  2GBO A;  3R9F A;  4X62 O;  3ZN0 A;  5FL7 G;  4PQA A;  1EE3 P;  1I21 A;  1WP8 A;  3APO A;  4UCO A;  2EJR A;  3IFX A;  3JAR A;  4DR2 B;  3IEH A;  4OAD A;  4LFA O;  3QO5 A;  3MD0 A;  1IBK B;  1ELM P;  3NR7 A;  3OMA B;  3PZJ A;  3QF7 A;  3BAB A;  4A39 A;  4U7O A;  4PA7 A;  4B5P A;  3WB2 A;  4X1Y A;  2GLF A;  3V7Z A;  3AG4 B;  1S5H C;  4DR2 O;  5K8M A;  4DUY B;  3FVL A;  3NE7 A;  3DTU B;  1LUW A;  1H2N A;  2EUL A;  1MAB G;  3RYF B;  5IWA B;  1IBK O;  3CYO A;  3P2F A;  3TOA A;  3EXA A;  2UXC B;  3D4U A;  1OBR A;  2WA4 A;  4P2Z A;  4KSA A;  3VH9 A;  1PM9 A;  2BL1 A;  1CJW A;  4CH6 A;  3Q4H B;  3SJF A;  4DV5 B;  2J8M A;  5IWA O;  5ISV A;  2GE3 A;  3BPZ A;  4H37 A;  4BR6 A;  3LD2 A;  1ZL8 B;  2Z0Z A;  4KOU A;  4DR1 B;  4OXS A;  5B3S C;  4ZY2 A;  4PI2 A;  4PDM A;  1BOB A;  4DV5 O;  4CGP A;  5AG5 A;  2LGW A;  4DR1 O;  4FJC C;  1S77 D;  3B7I A;  2XAQ A;  4MTG A;  3D2M A;  4LWS B;  1FXV A;  2B1I A;  2ZXW B;  4NVP A;  1UJW B;  5BR8 O;  2L6L A;  3H8G A;  4NSQ A;  1S5J A;  4MHY A;  1BSM A;  1NR1 A;  1BHA A;  5EC1 C;  4LF7 B;  4P44 A;  4DV7 B;  4BMH A;  3LSQ A;  4QVT A;  1Q2D A;  2EIK C;  2B58 A;  1H2M A;  3L72 H;  1SQB H;  2QWN B;  2YIA A;  1RM1 B;  3KR5 A;  3BAA A;  1E1R G;  1B6B A;  2WUU A;  4NXN B;  4LF7 O;  4DV7 O;  2OIE A;  5EZY A;  3PEI A;  2QWP B;  5JVD A;  4DV1 B;  3LUT B;  2HB6 A;  1K33 A;  4UCV A;  3EVK A;  4U3F H;  4NTX A;  3THO A;  4UFW A;  2BTQ B;  4GYC B;  1PNM A;  1FAF A;  4LF9 B;  1YW4 A;  1CM0 A;  1NTZ H;  1Z5W A;  4NXN O;  1GHE A;  3E0K A;  5F46 A;  3F0A A;  1PV0 A;  4DV1 O;  1ZLZ A;  4LF9 O;  4OIW A;  1M57 B;  5J2T B;  1IB1 E;  4TT3 G;  4IIJ B;  5F2V O;  4B3R O;  4JTA B;  2I00 A;  1HW7 A;  4TV8 A;  3FIX A;  1EN5 A;  4JZ0 A;  4K3N A;  3JAL A;  4R8F A;  4QGP A;  4IT5 A;  2Z3Y A;  3K3W A;  1ROP A;  2CTB A;  2F95 B;  3F7Y C;  1YLE A;  4O2A B;  4F6R A;  2D2C B;  3IC1 A;  2C1C A;  2FTK A;  2F5I A;  2AE6 A;  2ZXW C;  1AI5 A;  2V1D A;  5EMI A;  4MI4 A;  2YNC C;  1QLE B;  4O2B A;  5D29 A;  4RI1 A;  4A94 A;  4HNW B;  3A8T A;  1KBH A;  2H5M A;  4Q6G A;  4RQE A;  5HMN A;  2AFX A;  4MCS A;  5IJ9 A;  2OCC C;  1RFY A;  1Y74 A;  6CPA A;  4PA9 A;  3JCZ A;  4KOR A;  5LGU A;  4UB6 Z;  4KP4 A;  2PQ8 A;  5AG4 A;  3AK1 A;  3CT9 A;  1HWY A;  1N0J A;  3P30 A;  1EBO A;  3L71 H;  3A2F A;  3O9O A;  2JGD B;  5LYD A;  3NH8 A;  2WAM A;  4OLL A;  1AP5 A;  5L3D A;  4ASU G;  2PJ0 A;  4P4E A;  4DV4 B;  2GLJ A;  1BO4 A;  4FD4 A;  2PJ1 A;  1JCH A;  2AFW A;  1O9H A;  7CPA A;  4HZ3 A;  1SQX H;  3CSX A;  3K0D A;  4U3J A;  3FB3 A;  1TKH A;  3K2K A;  1NH2 B;  3CRM A;  3RYH A;  5LGT A;  1LNQ A;  3GWO A;  4JLY A;  3FB7 C;  1V55 B;  4DV4 O;  1GN6 A;  3EFA A;  1ZSP A;  1X12 A;  3N27 A;  4MRI A;  3BHP A;  4UCR A;  2AFO A;  5L3E A;  2BOA A;  3BI0 A;  4MJ8 A;  3JAS B;  5C8Y A;  4AIL C;  1YI2 V;  1R57 A;  2REF A;  3SYO A;  3JD4 A;  4FUU A;  1YRE A;  4CS2 A;  1Q2Y A;  4DV6 B;  3T1H B;  1WWZ A;  1NMT A;  3DC6 A;  3P3P A;  1D5N A;  3SPJ A;  1U97 A;  4DV6 O;  3T1H O;  2YS8 A;  3B4S A;  3IU2 A;  2XTA A;  4L8A A;  2QIR A;  1AUG A;  3DSQ A;  3RNZ A;  3ASN B;  2R8V A;  5J9P C;  4PK2 A;  2WLN A;  1W0K G;  3SR2 C;  2QM8 A;  1S7L A;  3FED A;  5IV0 A;  4UCS A;  1JQG A;  3AG2 C;  5B1B B;  1AP6 A;  1YVW A;  3HKB A;  4JXR A;  1N8R W;  3WC7 A;  4AI8 A;  4AQY O;  4UWJ A;  1M56 B;  1XMQ B;  5JGF A;  1AJP A;  1IDS A;  5JQG B;  4HNA B;  2AFM A;  4KOY A;  4A30 A;  4BIN A;  3ZS8 C;  1F2O A;  2OH1 A;  5LA6 A;  3UO2 A;  5H9C A;  1XMQ O;  3OUS A;  5THW A;  4DYO A;  1XEB A;  1LCP A;  2JS5 A;  3B77 A;  4DYL A;  4XNH B;  4ZX9 A;  3KI9 A;  3T90 A;  1VHE A;  1XMB A;  2K5T A;  3SJB C;  4DR7 B;  3OTO B;  1Q43 A;  2ZEE A;  3D7H A;  3JUW A;  4R76 A;  3PB7 X;  1R3J C;  2G0B A;  4IYH A;  3ISZ A;  5IDJ A;  3SJG A;  3B35 A;  2XEJ A;  2XND G;  5JJE B;  1AIL A;  1YK3 A;  4X66 O;  1KMI Z;  3CCM V;  1VEW A;  3E89 A;  3OTO O;  4DR7 O;  4JI0 B;  1RSO A;  2UUC B;  1LAP A;  1VF6 A;  4LF4 B;  1Z4R A;  1TUB B;  2BOB C;  2N04 A;  3BY6 A;  4KHP B;  1YHQ V;  5TIS Z;  5FVJ A;  2P4K A;  1YW6 A;  4IGG A;  4MVU A;  2Q4P A;  3ZX6 A;  4JI0 O;  3ZRX A;  2R98 A;  4LF4 O;  4JYY A;  4LF8 O;  1KUX A;  1MOF A;  2OIG A;  3RN4 A;  3SJA C;  4OC2 A;  3CC2 V;  3RBZ A;  3WU2 Z;  1IUR A;  4UCU A;  3ZHQ A;  3G4S V;  2Z5U A;  4YJ2 B;  1VF6 C;  3TXQ A;  2ZM6 B;  1VP7 A;  1L0N H;  3TCU A;  4NEX A;  5KTA A;  2HG5 C;  5IYZ A;  1Y66 A;  3JD2 A;  4UEE A;  4CS3 A;  1VAR A;  2P22 C;  1XJO A;  2ZM6 O;  2ADQ B;  2J8N A;  1S7F A;  4R7M A;  3R9G A;  2E74 B;  2XAJ A;  4E4E A;  1Q2C A;  5KX5 B;  4YHH B;  3W6X A;  4XNH C;  4FFB A;  2IM9 A;  1R3L C;  4D7T A;  5IJ0 B;  3CCS V;  1XOV A;  3D3Q A;  4XBF A;  2ZW7 A;  4A32 A;  4DNC A;  4GX2 A;  5JH7 A;  4EME A;  4EB6 B;  4UEZ A;  3LWU A;  4U9Y A;  3RYI B;  4FZ1 A;  1T5E A;  5CN0 A;  4YHH O;  1BMF G;  2KSD A;  5EBL C;  1YJW V;  2EIL C;  3IU1 A;  3JD3 A;  1G1X B;  2ZNI A;  1H8H G;  3KAS A;  2OR4 A;  2D3O W;  1K97 A;  5BMV B;  1HNZ B;  4B7E A;  2PE3 A;  2X6A A;  4UVB A;  3J7A U;  2ZE8 A;  4F9V A;  2GTA A;  3AEI A;  4KOS A;  1H2L A;  1CX8 A;  1FY7 A;  5B1O A;  4NGN A;  1ELL P;  1GM7 A;  2JLM A;  1HNZ O;  1PYT B;  3K5M A;  4J41 A;  3K5O A;  4MCQ A;  2YND A;  3B3C A;  2A7W A;  2ADP A;  5EIB D;  3PFE A;  5LOV B;  3UY5 A;  4UFV A;  1Q5O A;  4F4L A;  3GKR A;  2X6C A;  3IO1 A;  4H89 A;  3N2K B;  1XDC A;  3FBU A;  2WLJ A;  4QPJ A;  2BO9 A;  1SZT A;  3QO8 A;  5LYJ A;  2UUA B;  4J42 A;  4GS4 A;  2PJ7 A;  3FB5 C;  3CDX A;  3ABT A;  2V4D A;  3DLJ A;  4ZBM A;  3OAA G;  3P32 A;  1MSD A;  3CPW U;  2UUA O;  4JAS A;  4UBR A;  4BIZ A;  4RS2 A;  2OWO A;  1KWM A;  4WWV A;  2P4V A;  4X8A A;  3SHP A;  2OZH A;  4A33 A;  4JI1 B;  2XAF A;  1Y67 A;  1Y9K A;  2B9Z A;  1Z2G A;  5D5Q A;  2DPT A;  1P4N A;  3CB2 A;  4LP8 A;  1I12 A;  2QML A;  1GMG A;  4A38 A;  1XE4 A;  4B3T O;  3T1Y B;  1V54 C;  4X88 A;  5LMN B;  2ATR A;  4BIO A;  3K79 A;  1QMU A;  2GIV A;  1A32 A;  2EZP A;  2ZIO A;  3LDE A;  2B5G A;  3RT3 C;  2Q7E A;  2CTR A;  3T1Y O;  1I5X A;  3GY9 A;  5LMN O;  1XRE A;  4H44 B;  2DEA A;  1R6N A;  2ZQM A;  4CH5 A;  3E86 A;  3EFF K;  3JAW A;  5CPA A;  2HEP A;  3K57 A;  2DQ0 A;  2A9H A;  3OM3 B;  2NSM A;  3HLP A;  1B04 A;  1IXB A;  2A0L A;  2ZDI A;  2V8D A;  1AB3 A;  2W6J G;  3I1U A;  4LF6 B;  4CYN A;  4NGS A;  3H1J H;  4CBC A;  2ZED A;  3IJ4 A;  1EM1 A;  5LGN A;  4MTF A;  4JF3 A;  1HP8 A;  2IW5 A;  1WN7 A;  4LF6 O;  2ZW5 A;  2CF4 A;  1S60 A;  1VGY A;  2PJ3 A;  1H2S B;  4KL1 A;  1X4T A;  2PSW A;  1KEC A;  4QE7 A;  1I94 B;  2ABZ A;  4CYO A;  5JPH A;  2ZDI C;  1LAM A;  4I9W A;  4TV9 B;  3QO7 A;  2RCV A;  3JAT A;  1M93 A;  3ZRV A;  3L74 H;  3TFY A;  2EUI A;  1WJZ A;  1EN4 A;  4G1P A;  5GTI Z;  1ZX3 A;  1V9P A;  2LO1 A;  2QR4 A;  1BAV A;  1I94 O;  2DWE C;  4EFE A;  4KZT A;  5KUK A;  1KUV A;  3V38 A;  5EIB C;  3BRC A;  5DWM A;  5LHI A;  2CH7 A;  3ABM C;  3E8F A;  2Y48 A;  3D67 A;  1HDJ A;  3STZ C;  2WLK A;  2DYR C;  3BEH A;  4F0Y A;  1US6 A;  1H2K A;  1ZTE A;  4X9Q A;  4EFB A;  8CPA A;  1KB9 F;  2GUZ B;  1KD1 W;  1OCO C;  2AJ6 A;  3FYE B;  1IIC A;  4KLV A;  4ABM A;  3X2Q B;  1J5E B;  3CPA A;  4KSI A;  2PI4 A;  1AI6 A;  2A06 H;  1FPO A;  3TC8 A;  4TQF A;  4QIW F;  4YJ3 B;  1PD3 A;  4ZGY B;  3CCQ V;  4PA4 A;  2CUG A;  1QVF U;  2WWW A;  3ICX A;  2QDO A;  1Z5V A;  1S5K A;  2BUE A;  1WPB A;  3F8K A;  3HKD A;  2B4D A;  1PUA A;  2PJ4 A;  1DTO A;  1NR7 A;  3A0B Z;  1YXB A;  1BQZ A;  2LQT A;  2HUZ A;  3JD1 A;  2FIA A;  4MFZ A;  1G6U A;  2HJF C;  3QG5 A;  4J7K A;  3CRC A;  3LDC A;  2PYL A;  2RN9 A;  5KUM A;  3VQX A;  4O23 A;  1S72 V;  2DN9 A;  3CJH A;  2WPX A;  3B09 A;  3FNC A;  3OMI B;  3K9A A;  1LAN A;  4MFJ A;  2P6G A;  4R6T A;  2POK A;  4OGQ B;  1YDX A;  1Z5R A;  4II9 A;  4MVR A;  2IQ6 A;  4I50 A;  4NGR A;  5G22 A;  2HHH B;  3S6F A;  1NZ6 A;  3ZMV A;  1YF2 A;  3H9V A;  1IYK A;  2V77 A;  3D3I A;  3CWB H;  3R1K A;  4O4I A;  1D5A A;  2FE7 A;  1YIJ V;  1XEQ A;  5EYP B;  5LYF A;  3KQZ A;  2P5O A;  2HHH O;  4M85 A;  1G4Y B;  4DRX B;  1YSC A;  5ITZ A;  2Q9L A;  2O57 A;  5GON A;  3IC9 A;  4J10 A;  1ARM A;  3JAR B;  3CZX A;  4NGT A;  4RUE A;  3VQY A;  4ZI7 A;  2NN4 A;  4DK1 A;  4CS0 B;  4CGL A;  4KOV A;  4C2X A;  1XHX A;  2HVK C;  5FPR A;  2ZIM A;  1IOF A;  4CRY B;  4B5P B;  4YRH A;  3IC7 A;  4X1Y B;  2AGA A;  5KMG A;  3CCU V;  1HNX O;  4Q38 A;  3VQV A;  2R9A A;  4ZHQ A;  1OCC C;  4AVC A;  1AR4 A;  4PA3 A;  4JTC B;  1VQL V;  4A37 A;  4F9U A;  1NS1 A;  1MMM A;  1XF8 A;  4QUS A;  2QVP A;  4YIO A;  4X5K A;  1PPJ H;  2Q0Y A;  2ZE7 A;  3OTF A;  1Q7Y W;  2YDE A;  3SJQ C;  3TO7 A;  1UWY A;  4H13 B;  2HV2 A;  4ZKI A;  1AMP A;  5DWN A;  5B1N A;  2DYS B;  3IIB A;  5EC4 A;  4CRZ B;  3ABU A;  5B66 Z;  4R3K A;  2EIK B;  1YLO A;  5IYC O;  4CC5 A;  4PXB A;  1TA8 A;  3EXN A;  1YVK A;  1Q7L A;  1BPN A;  2OTJ V;  1QSO A;  2RNB A;  3B2Y A;  2CY2 A;  3G6B A;  5KHG A;  1VQN V;  2XEG A;  3OEH G;  4W9Y A;  2DXQ A;  5L3G A;  1H8L A;  5CBF A;  4KVX A;  3B2E E;  2F43 G;  1Q82 W;  4DJL A;  2EK8 A;  5LYL A;  4H2K A;  1P49 A;  5IY5 B;  1K34 A;  4P4B A;  1MA1 A;  5L3F A;  4ZOL A;  4FD6 A;  2FSR A;  3BA8 A;  3D68 A;  3ZHV A;  4PSW A;  5KTD A;  2UUB B;  3HKC A;  1XHZ A;  2PY5 A;  1CP6 A;  1RO5 A;  4I9Q A;  4OC4 A;  4CPA A;  2Y4T A;  5EZY B;  3N2G A;  5JVD B;  5ELY A;  4GT1 A;  4ZYQ A;  4K3A A;  2ODF A;  3CRQ A;  3P2H A;  1ZUQ A;  4GCZ A;  4OPA A;  4PA6 A;  3LDD A;  2QJ8 A;  4IL6 Z;  1CG2 A;  2UUB O;  4CGN A;  5BR8 B;  1N36 B;  3TT2 A;  3D66 A;  4C7H A;  1NVP D;  1GAX A;  1JFF A;  2DOS A;  3JVN A;  1RXT A;  2PVV A;  2ZW6 A;  1AI4 A;  1X59 A;  1M4U A;  5LP6 A;  5F48 A;  1N36 O;  4R3L A;  4MFQ A;  1QR9 A;  4P45 A;  4B13 A;  1XRY A;  4TV8 B;  2NYQ A;  5CNP A;  2DYS C;  2MK3 A;  2PRB A;  3JAL B;  1VQ5 V;  3V8I A;  4K0K O;  2OCC B;  2X0L A;  4Z1V A;  4RN7 A;  2V7Q G;  4F6R B;  1KUQ A;  4P9O A;  1KUY A;  3W7W A;  4RUH A;  4O4J A;  1I5Y A;  1WP7 A;  1EFR G;  2PJ5 A;  3E35 A;  1YTF D;  2BE3 A;  1GRJ A;  4BBH A;  2QKS A;  2R7H A;  1I0H A;  2B3U A;  1Y76 B;  5FNV A;  4O2B B;  1GN2 A;  2W6I G;  1NVP B;  1DGS A;  3RAM A;  4M6H A;  2EJ7 A;  2PJ8 A;  4B3R B;  3FJU A;  2KG7 A;  1YJ9 V;  5IY5 C;  1UFH A;  2QTO A;  4MMO A;  3MDS A;  5IJ9 B;  2C6G A;  3NH4 A;  1Y74 B;  3KHX A;  2O4H A;  5CA0 A;  2JEU A;  1BGY H;  4FM0 A;  1N32 B;  2VZY A;  4KUA A;  3AG3 C;  4FM1 A;  3T2M A;  1L0C A;  3LAC A;  4XDK A;  4MY3 A;  1M1D A;  5IB9 A;  2R9R B;  3IWG A;  4DR5 B;  5KA6 A;  1YSJ A;  1N32 O;  1K5S A;  1THZ A;  1EZJ A;  1Y6X A;  1BQ0 A;  2AZ0 A;  4DR5 O;  3VOU A;  1D2D A;  1Y76 A;  1Z8T A;  4KFM A;  3RFR A;  2YIB D;  2Q4Z A;  4U3J B;  4GM5 A;  2AHY A;  2JGU A;  3RYH B;  3B8N A;  3K5L A;  1NQT A;  5JCO A;  4DV0 O;  3QAY A;  4GKJ B;  5CBH A;  4MVO A;  1JR9 A;  4J3G A;  2M6Y A;  4LF5 B;  1YME A;  3ABL C;  3GVM A;  2EIN C;  3ASO B;  3FX7 A;  1XFO A;  5HH1 A;  1PCA A;  2ZW4 A;  5C8Y B;  3PJS K;  4CYQ A;  4FK5 C;  4UXN A;  3RZA A;  1IOI A;  1JA8 A;  1GN4 A;  5LXT A;  4GKJ O;  2Q0A A;  4X1K A;  4LF5 O;  4HAM A;  1PL0 A;  3S6G A;  3FYI B;  3H1L H;  3PP9 A;  5K8O A;  4HYO A;  1PL4 A;  1WAZ A;  5H6R A;  3W7T A;  3D7D A;  3AG2 B;  1Z4E A;  4I55 A;  2YXH A;  3OD4 A;  2QYV A;  1ZWI C;  1MJ9 A;  2ZEP A;  3HB3 B;  3JAK A;  3PBB A;  4KLW A;  4WBN A;  5G1Z A;  5J2U A;  3SGI A;  1H8E G;  1BHB A;  2ZIN A;  4R57 A;  2YXL A;  5BZB A;  3WAB A;  2KCW A;  1XIL A;  4UA3 A;  3K9S A;  4O4L A;  4LQ6 A;  1XMO B;  4XPD C;  2FKX A;  1IBL B;  2GFQ A;  1VQ9 V;  4OC3 A;  3VWE A;  4TNU A;  4NB5 A;  2P6F A;  4MXU A;  3UKM A;  1F4N A;  3HKB B;  5JJN B;  2A79 B;  1XMO O;  1IBL O;  2PJB A;  4R50 A;  1XL4 A;  2UXN A;  2JEW A;  2XEI A;  2ITC C;  4NJR A;  3WC6 A;  4WFB V;  3O65 A;  1Z2L A;  1YQE A;  4C68 A;  2ZEG A;  4MHP A;  3H8F A;  3L75 H;  2Q68 A;  4DW0 A;  2BSK A;  3RW0 A;  1XQ8 A;  1VQP V;  4F0X A;  5LA6 B;  2EO8 A;  1VQ4 V;  3ISX A;  4DV2 B;  1Y7E A;  3EY5 A;  3C3T A;  1F51 A;  3ASO C;  2YIB A;  1SF9 A;  3CRR A;  3CX5 F;  1X10 A;  4HBN A;  2ZEN A;  3FH4 A;  2ZXV A;  2P90 A;  5K8P A;  3FD9 A;  2PUS A;  5LMU B;  4WFA V;  4DV2 O;  1JX9 A;  1TVK A;  4AQY B;  5LRG A;  2K9P A;  2QTS A;  2ZEL A;  3S6K A;  2QEX V;  4E0A A;  4JYW A;  3UQ8 A;  3K59 A;  3OUF A;  2CTP A;  4CAW A;  1QR8 A;  3T1C A;  4B14 A;  5LMU O;  4M6I A;  4FM2 A;  1RSO B;  3SI0 A;  4NCZ A;  2V8G A;  2PCU A;  2HJD A;  3P3N A;  2Q7G A;  5KHJ A;  1KP3 A;  2DMX A;  1K3E A;  3TOB A;  4FMT A;  1ZG8 A;  4PHZ A;  3QNE A;  3D8C A;  1J4J A;  2N74 A;  3UO3 A;  4MCR A;  2LJ2 A;  5K1X A;  3KQX A;  3HKE A;  4HNX B;  4OAE A;  4FAI A;  2C27 A;  4JI2 B;  2HLD G;  2R70 A;  4LX9 A;  5H84 A;  2UXD B;  3BHX A;  2P06 A;  2ZT9 B;  4X66 B;  1JJO A;  3ZMS A;  4KUM A;  1DE4 C;  1JPX A;  4WJB A;  1K92 A;  4TSF G;  2CE4 A;  4JPR A;  1P0H A;  5DED A;  1R3I C;  5IYD O;  4FLX A;  4H6Z A;  3CS5 A;  3ZRW A;  3CMA V;  1I1D A;  4JI2 O;  2CTC A;  5IYZ B;  4Y49 C;  5JWP A;  2UXD O;  1S3Z A;  1AI7 A;  4PDV A;  2YI9 A;  4AG9 A;  1SQF A;  1R73 A;  2EIL B;  1SER A;  3SPI A;  2ZEO A;  3K06 A;  2Z3P A;  5C93 A;  4LF8 B;  4FFB B;  1L0L H;  2YEV A;  1LOK A;  2PVW A;  5JH7 B;  1K73 W;  1JQ0 A;  4MHD A;  1MJA A;  4MS2 A;  1PU9 A;  2BSW A;  4EEQ A;  4JAA A;  1XBU A;  1WA8 A;  5HXD A;  3S3W A;  1F4M A;  4MCP A;  4KOW A;  2DPS A;  2C2A A;  4P30 A;  2GSM B;  2OZG A;  4Q36 A;  4ONW A;  1CXZ B;  3CPX A;  4BAY A;  1YEW A;  2IJH A;  3AK2 A;  3IWW A;  4JI4 B;  4P4F A;  3E8G A;  1KQS U;  5IE9 A;  3KR4 A;  4RUF A;  3BJ8 A;  3TX8 A;  1YGH A;  4MHZ A;  4DW1 A;  2VXK A;  2NLJ C;  2PDO A;  3B40 A;  4JI4 O;  2C6C A;  1K4J A;  3E2E A;  1R3N A;  4PEL A;  3OWC A;  5EC2 C;  5L3C A;  3T4D A;  3H5Z A;  5HVF A;  1H2G A;  2PF4 E;  3TCV A;  2ZNJ A;  3D7F A;  4NJQ A;  4AG7 A;  2Z3O A;  3MHH C;  3SYQ A;  1TAE A;  5LYJ B;  3TO6 A;  3U10 A;  3DNS A;  4KSF A;  2EIJ C;  1HR0 B;  5C82 A;  3DDD A;  3FB8 C;  3SJC C;  3GLJ A;  5B1A C;  3CME V;  3QVN A;  3R65 A;  4H33 A;  2UXB B;  3NE8 A;  1V54 B;  4MY0 A;  4IYI A;  2IJZ A;  5EK0 A;  2J9A A;  3IJ3 A;  3PRT A;  5KAF Z;  1XNQ O;  1BL8 A;  1HR0 O;  1GN3 A;  1S7K A;  2REE A;  2Q44 A;  3R95 A;  3BA9 A;  1FJG B;  2DWD C;  2QSA A;  2UXB O;  2FYU H;  4YGO A;  3QTC A;  1FXK A;  2HKO A;  3C3S A;  3DXR A;  1Y7R A;  3W91 A;  2F66 C;  3TJT A;  4BIU A;  1FJG O;  2H3O A;  5G20 A;  4B12 A;  4X89 A;  4IHJ A;  2WLL A;  1A2Z A;  1SA0 A;  2YGW A;  2I79 A;  2QEC A;  3JYC A;  1CP7 A;  2B5G B;  1Q86 W;  5BWA B;  1VHO A;  3WB1 A;  5EBW C;  3ML0 A;  4JD6 A;  1G8M A;  1FXK C;  1BPM A;  3N5F A;  4LH6 A;  4GLX A;  2KKW A;  3B8M A;  3JAW B;  5J1Q A;  3WG7 C;  3UM7 A;  1RPO A;  2QWR B;  4ICG A;  4QBJ A;  2OCH A;  2PI5 A;  4Q7A A;  1NSL A;  1WB8 A;  1WB7 A;  4ZY0 A;  4JZ2 A;  2KQX A;  4B3T B;  3KL9 A;  2JJ1 G;  2ZR3 A;  3S6H A;  1FYJ A;  3ZJ0 A;  1N33 B;  1LFW A;  2I3C A;  3GUX A;  1XNR O;  3JCU Z;  1B06 A;  3MRU A;  1AR1 B;  3K9T A;  4IUS A;  2B1G A;  1FFX A;  2A4N A;  2Q67 A;  1NSA A;  3ABM B;  1ZLH A;  1IZ3 A;  2WLI A;  2PZS A;  1Y0Y A;  2AFZ A;  2R1I A;  1MG1 A;  2F23 A;  1N33 O;  2DYR B;  4O4H A;  5CA3 A;  3JAT B;  4CAF A;  1W0J G;  3CD6 V;  2GU2 A;  2GTS A;  1KZF A;  3FEC A;  2WLM A;  3NH5 A;  5H6Q A;  3B3V A;  1OCO B;  2DE0 X;  2O53 A;  1OCR B;  1VQK V;  3BLN A;  4P10 A;  3SYP A;  2OZU A;  1OV9 A;  4AXV A;  2Z3N A;  1DF4 A;  3SDL A;  4QPK A;  4HKF A;  3G6E V;  2Q6A A;  2V8V A;  4QB9 A;  2ZEM A;  3FFQ A;  2CH7 B;  1ZLI A;  1HDQ A;  2YC0 A;  2Z11 A;  4WFG A;  4C2Z A;  2G3A A;  3KG2 A;  2BCC H;  2WYR A;  1IYL A;  4XPL A;  2IL4 A;  3H8E A;  4PDL A;  1XOU A;  3UT5 A;  3D8P A;  2JDD A;  4OC1 A;  3UCS C;  2EBO A;  2QJ1 A;  5CMU A;  1GKF A;  1VKC A;  2DJV A;  4UVC A;  2M7W A;  2W0X A;  5JJJ B;  4BW9 A;  2HQY A;  3EO4 A;  4KUB A;  1KKC A;  4GZR B;  4HNY B;  4CGM A;  1BS3 A;  4B3S O;  5F09 A;  1QU7 A;  4R6Z A;  5KAI Z;  2RQ6 A;  5JH9 A;  1IXM A;  5CA1 A;  3TXS A;  4R8C A;  4TOI A;  2JK5 C;  4FLY A;  3L9D A;  1QST A;  1IY7 A;  4J80 A;  1S3J A;  4JXQ A;  3HKD B;  2LP7 A;  2B4D B;  2D4P A;  2QGN A;  1GYT A;  4X1I A;  4NTY A;  1GH6 A;  3E22 A;  3ETG A;  2V8H A;  4PDR A;  1JMK C;  2PJA A;  3K58 A;  3CJH B;  2OOT A;  4E2L A;  4D6T H;  2PGG A;  1UPG A;  4I7Z B;  3TTH A;  1OCR C;  1CPS A;  5E79 Z;  4UCT A;  4DR4 O;  5CB4 A;  5K1P A;  4LR3 A;  2Q04 A;  1VF5 B;  4MT8 A;  2PRQ A;  2GDS A;  1QHT A;  1QLN A;  4K8Z A;  1FNO A;  2VL1 A;  4P4D A;  4I50 B;  4TQD A;  3J80 N;  3KGQ A;  2EK9 A;  1FKA O;  1DTD A;  3BI1 A;  4CAV A;  4LNU A;  2X7R B;  1QBZ A;  4O4I B;  2B3V A;  2VRZ A;  4CZZ A;  2Q4V A;  3I56 V;  1M4I A;  2HR3 A;  4FPP A;  1P7G A;  4UV9 A;  5GW7 A;  4PJ0 Z;  5J8C A;  4I0X A;  5ITZ B;  1OCZ C;  1OCC B;  2ZE5 A;  3SI2 A;  4TWE A;  4UV8 A;  5GON B;  3CE2 A;  1M4D A;  4ZY1 A;  3M8A A;  4EFD A;  4MVZ A;  4U9Z A;  5AG7 A;  4ZI7 B;  2FVG A;  4PV1 B;  1VQ6 V;  1S5L Z;  2LW1 A;  2YSU B;  2P67 A;  4W4L A;  2CNM A;  5F49 A;  2OTL V;  5IB0 A;  1TKF A;  2Z3M A;  2AZ2 A;  3MHS C;  5KMG B;  1CEZ A;  5AG2 A;  1Z8L A;  1GK9 A;  3OEE G;  4ZHQ B;  4M3S A;  2QKA A;  3FF3 A;  3PB8 X;  3IGA C;  2F1M A;  5H2F Z;  3S9M A;  4H6U A;  3M7M X;  4J11 A;  1SES A;  3FAV A;  3NA6 A;  4JYC A;  4UEF A;  2VQF B;  1B87 A;  4UUJ C;  2FB5 A;  3S9L A;  2XOK G;  3AG1 C;  4TWK A;  1K4D C;  1SC5 B;  4NF1 A;  4FLZ A;  2XAS A;  4NXY A;  1MJB A; 
#chains in the Genus database with same CATH homology
 2O28 A;  2OH1 A;  1L0C A;  1XEB A;  4MY3 A;  1M1D A;  1TIQ A;  3IWG A;  4YFJ A;  4XNH B;  3W6S A;  3T90 A;  4KVM E;  1ZO0 A;  2K5T A;  3K9U A;  3JUW A;  1V0C A;  3SXO A;  3T9Y A;  2G0B A;  3TE4 A;  1Y9W A;  1YK3 A;  3TO9 A;  4A31 A;  4R87 A;  1ON0 A;  1Z4R A;  5FVJ A;  3PGP A;  2D4O A;  4J3G A;  2OU2 A;  3N7Z A;  3IGR A;  5HH1 A;  2ZW4 A;  3I9S A;  4CYQ A;  2R98 A;  1KUX A;  3SXN A;  4UCM A;  3S6G A;  4A95 A;  3PP9 A;  4XPK A;  2PR1 A;  4CAE A;  1Z4E A;  2JEV A;  1VHS A;  4ORF A;  1QSN A;  4KLW A;  4NEX A;  1MJ9 A;  5KTA A;  5G1Z A;  3KKW A;  3EC4 A;  4R57 A;  2KCW A;  2J8N A;  4UA3 A;  1S7F A;  3R9G A;  1Q2C A;  4XPD C;  4ONU A;  3W6X A;  4XNH C;  1XIX A;  5C88 A;  4ZBG A;  2Z3K A;  3VWE A;  2ZW7 A;  3D2P A;  4A32 A;  4DNC A;  2JDC A;  2P6F A;  2FXF A;  4U9Y A;  2CXA A;  3IU1 A;  2Y0M A;  2NMT A;  2VEZ A;  3DSB A;  3FRM A;  4CGO A;  3CXS A;  4C68 A;  2FCK A;  4FD5 A;  3G3S A;  4MBU A;  4C7I A;  4KOS A;  4F0X A;  4KOT A;  3BJ7 A;  1FY7 A;  3EY5 A;  2WPW A;  1OZP A;  2JLM A;  2ZXV A;  2Q4Y A;  1LRZ A;  3A9L A;  2J8R A;  2Z3L A;  2YND A;  3S6K A;  4E0A A;  2BEI A;  4UFV A;  3UY5 A;  1IID A;  4LUA A;  3GKR A;  5E96 A;  4H89 A;  4PK3 A;  1QSM A;  3B8G A;  3CXQ A;  5G21 A;  3FBU A;  4CAW A;  1YX0 A;  3QAH A;  2Z10 A;  4B14 A;  4GS4 A;  4NCZ A;  3H4Q A;  1XMT A;  4CAX A;  3TOB A;  4QC6 A;  4B10 A;  1J4J A;  4UBR A;  5JQ4 A;  4RS2 A;  4B5O A;  2G3T A;  4HNX B;  4OAE A;  3SHP A;  2OZH A;  2C27 A;  4A33 A;  4XPD B;  4LX9 A;  5H84 A;  2X7B A;  3FXT A;  1M44 A;  4FD7 A;  1Y9K A;  3MGD A;  3QB8 A;  2DPT A;  1P4N A;  1I12 A;  2QML A;  1P0H A;  3ZZI A;  1XE4 A;  4H6Z A;  1I1D A;  2ATR A;  4Y49 C;  1NE9 A;  1S3Z A;  3IWE A;  4AG9 A;  2GIV A;  2YNC A;  2B5G A;  4AVB A;  2WSA A;  1Z9U A;  2Z3P A;  4IF5 A;  1YVO A;  2FS5 A;  3GY9 A;  4R9M A;  2Q7B A;  4U5Y A;  3RYO A;  2FIW A;  4AVA A;  4MFL A;  4MHD A;  4F6A A;  1N71 A;  1MJA A;  1PU9 A;  2BSW A;  5IX3 A;  4CYN A;  2CNS A;  3F5B A;  4UFX A;  4KOW A;  2DPS A;  3LOD A;  2OZG A;  4Q36 A;  1SQH A;  1MK4 A;  1YR0 A;  3DR6 A;  2ZW5 A;  2ZPA A;  1S60 A;  4MFK A;  2PSW A;  3BJ8 A;  3R9F A;  4CYO A;  5JPH A;  1YGH A;  1I21 A;  2VXK A;  2EUI A;  3I3G A;  3TFY A;  2PDO A;  3WR7 A;  4JWP A;  1K4J A;  3OWC A;  4OAD A;  2VQY A;  3H5Z A;  3PZJ A;  4KZT A;  3TCV A;  1KUV A;  4B5P A;  5DWM A;  4AG7 A;  2Z3O A;  3GYA A;  3NE7 A;  3TOA A;  3TO6 A;  3DNS A;  3P2F A;  4KSF A;  2VZZ A;  4F0Y A;  5C82 A;  3DDD A;  4KSA A;  2BL1 A;  1CJW A;  2EVN A;  4UCN A;  2AJ6 A;  4MY0 A;  1IIC A;  4KLV A;  4Y49 B;  2J8M A;  3R96 A;  5ISV A;  2GE3 A;  1S7K A;  2REE A;  3LD2 A;  2Z0Z A;  4KOU A;  2Q44 A;  3R95 A;  3D3S A;  4A30 A;  4ZGY B;  4PV6 A;  1BOB A;  4YGO A;  4B11 A;  4K30 A;  4CGP A;  2B4B A;  5AG5 A;  1Y7R A;  1S5K A;  2BUE A;  3W91 A;  5G20 A;  3F8K A;  2B4D A;  1PUA A;  4B12 A;  3D2M A;  2HUZ A;  2YGW A;  2I79 A;  2QEC A;  3JTK A;  4NSQ A;  4E8O A;  2FIA A;  2B5G B;  4MFZ A;  5BWA B;  5EBV A;  1M4G A;  4JD6 A;  4BMH A;  4QVT A;  1Q2D A;  2WPX A;  3FNC A;  2B58 A;  1B6B A;  3C26 A;  4MFJ A;  2P6G A;  2WUU A;  4QBJ A;  4L89 A;  1NSL A;  4II9 A;  5G22 A;  3S6F A;  4UFW A;  3G8W A;  3S6H A;  3ZJ0 A;  1CM0 A;  1IYK A;  1S7N A;  1GHE A;  3R1K A;  3E0K A;  4IUS A;  2FE7 A;  5F46 A;  3F0A A;  2ARH A;  2A4N A;  4M85 A;  2R1I A;  1IB1 E;  4CAF A;  3DR8 A;  2P6E A;  1KZF A;  2I00 A;  3FIX A;  3BLN A;  4KOX A;  4CS0 B;  2OZU A;  4JJX A;  4CGL A;  4KOV A;  4C2X A;  2Z3N A;  1YLE A;  4CRY B;  4B5P B;  4HKF A;  4YRH A;  4Q38 A;  4QB9 A;  5A27 A;  2F5I A;  2FT0 A;  2AE6 A;  2Z11 A;  4C2Z A;  2G3A A;  4AVC A;  4MI4 A;  1XF8 A;  2YNC C;  1IYL A;  4XPL A;  4QUS A;  2PC1 A;  2IL4 A;  4UCP A;  4X5K A;  4RI1 A;  2Q0Y A;  4HNW B;  3D8P A;  1WK4 A;  1QSR A;  2JDD A;  2H5M A;  2GAN A;  4I49 A;  5HMN A;  1VKC A;  3TO7 A;  2HQY A;  1U6M A;  2HV2 A;  4KOR A;  2P0W A;  2PQ8 A;  3EO4 A;  4KUB A;  5AG6 A;  5DWN A;  4E2A A;  5AG4 A;  4MFP A;  4HNY B;  5EC4 A;  5GCN A;  3VWD A;  2YNE A;  4CRZ B;  4R3K A;  4CGM A;  5AGE A;  3EXN A;  4KS9 A;  1YVK A;  1QSO A;  1QST A;  4PSX A;  4JXQ A;  2B4D B;  2D4P A;  2CY2 A;  2VBQ A;  4OLL A;  2DXQ A;  4KVO E;  4KVX A;  2RC4 A;  1BO4 A;  4FD4 A;  4UWI A;  2FL4 A;  3FB3 A;  5KTC A;  4FD6 A;  3TTH A;  2FSR A;  4PSW A;  4JLY A;  5KTD A;  3EFA A;  1RO5 A;  2Q04 A;  3P2H A;  5H86 A;  3R9E A;  4MJ8 A;  1R57 A;  4CGN A;  2REF A;  3TT2 A;  4CAV A;  1YRE A;  4C7H A;  2B3V A;  2Q4V A;  4A2Z A;  1Q2Y A;  3JVN A;  1RXT A;  1M4I A;  1WWZ A;  1NMT A;  2ZW6 A;  5J8C A;  5F48 A;  1M4D A;  4R3L A;  5F47 A;  4MFQ A;  2OB0 A;  2CNT A;  4B13 A;  4U9Z A;  5AG7 A;  5CNP A;  5I0C A;  2PRB A;  3V8I A;  2PR8 A;  4C2Y A;  2CNM A;  3IU2 A;  4L8A A;  5F49 A;  5IB0 A;  2Z3M A;  2QIR A;  1KUY A;  2VI7 A;  4AB7 A;  2R8V A;  4PK2 A;  4EVY A;  1S7L A;  5IV0 A;  4M3S A;  3CXP A;  4BBH A;  2R7H A;  2B3U A;  4H6U A;  4CYP A;  4JXR A;  1B87 A;  4UWJ A;  5J8F A;  1UFH A;  3FYN A;  5A28 A;  4NF1 A;  4NXY A;  1MJB A;  2VZY A;  4KOY A;  4KUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...