2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein aq_1966
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
2CY2A 5HH1A 2VZYA 4AVBA 3EFAA 2VBQA 4XPKA 2AJ6A 4X5KA 2CNSA 4UBRA 2I00A 2EUIA 2BEIA 4FD5A 3TTHA 5C88A 4NXYA 5F49A 1QSRA 2JEVA 4OLLA 1YK3A 2RC4A 4QUSA 3JVNA 2B4DB 3RYOA 2ZW4A 1Z9UA 4L89A 3S6FA 1I21A 3S6GA 3SXOA 4DNCA 3IWGA 1S7KA 2B3VA 2B5GB 2Z10A 1VHSA 2GIVA 3DSBA 1V0CA 3T90A 2FL4A 4KORA 5H84A 2OB0A 1LRZA 2Y0MA 4M3SA 4NF1A 1YVOA 4HNYB 1KUVA 2ZW7A 4GS4A 3VWDA 1Y7RA 1MJ9A 1YVKA 1SQHA 2WPWA 1CM0A 3R1KA 2FT0A 2R7HA 1XE4A 1PUAA 1Q2DA 2VI7A 4XNHB 2J8RA 3TO7A 4CAVA 1IICA 1Y9KA 3JUWA 2REEA 3S6KA 2FIWA 2PR8A 5KTCA 2GANA 4Y49C 3R9EA 1VKCA 2ATRA 3DNSA 2ZW6A 1IIDA 2PSWA 4KVXA 2PDOA 3BJ8A 2PR1A 3CXPA 2REFA 2G3AA 2J8MA 4KOUA 3FXTA 2B3UA 1P4NA 4KOXA 3C26A 3T9YA 2OZUA 1QSNA 1S3ZA 4B5PA 2Q7BA 2D4OA 4KVOE 1J4JA 4EVYA 2R1IA 1TIQA 4NCZA 3P2FA 2G3TA 2ZXVA 4QVTA 2FIAA 4J3GA 4QB9A 4KUAA 1QSMA 1KZFA 5F47A 3LD2A 2ARHA 4U5YA 3TO9A 4LX9A 1UFHA 3FB3A 4JJXA 3N7ZA 1NSLA 2HUZA 1YLEA 2PRBA 2JLMA 5JQ4A 1YGHA 2BUEA 2Q4VA 1BO4A 3TCVA 3D8PA 2VEZA 2ZPAA 4U9ZA 4XPDB 5J8CA 4YFJA 3S6HA 4E2AA 1XF8A 4MY0A 1I1DA 1PU9A 4CAXA 2HV2A 3I3GA 4KZTA 1S60A 4AG7A 5DWMA 5IV0A 1N71A 4HNWB 3TOAA 1S7NA 5J8FA 3CXSA 4U9YA 2FSRA 2Z11A 1Z4EA 2O28A 4R3KA 3OWCA 1MK4A 1KUYA 2Q44A 4OAEA 2QMLA 4B5OA 4F6AA 3B8GA 2WPXA 4RS2A 1GHEA 4QBJA 4NEXA 3GKRA 4JD6A 4KLVA 4K30A 2IL4A 4E0AA 1IYLA 2K5TA 4OADA 4JLYA 4XPDC 4PK3A 3TFYA 5E96A 2VXKA 4YGOA 4JXQA 3V8IA 2PQ8A 3G3SA 1S5KA 3F5BA 3PZJA 5ISVA 2B4DA 4LUAA 2GE3A 1QSTA 4UWJA 5FVJA 2X7BA 2FCKA 2P0WA 3ZZIA 2B5GA 3R95A 4MJ8A 3R96A 2KCWA 3FNCA 3W91A 4L8AA 4H6ZA 2JDCA 4CAWA 1QSOA 1XEBA 3PGPA 1M1DA 4F0YA 4QC6A 2BL1A 4XPLA 2R8VA 2CNMA 2QECA 3F0AA 4H89A 4R3LA 3FIXA 4KOWA 4ZBGA 4II9A 5DWNA 4MI4A 4HNXB 2EVNA 3W6XA 3D2MA 4I49A 4BMHA 4R57A 1KUXA 4MBUA 1Q2CA 3D3SA 4XNHC 2F5IA 2OZHA 4B5PB 2OH1A 4PV6A 1L0CA 4CRYB 1MJBA 3MGDA 4MY3A 5KTAA 3VWEA 5F48A 4KVME 1YR0A 5H86A 3EY5A 3DR8A 1M4GA 3K9UA 3FBUA 1S7FA 4PSXA 1FY7A 1Q2YA 3FRMA 2OU2A 2PC1A 3DDDA 4IUSA 2B58A 3G8WA 2C27A 4H6UA 3TE4A 2HQYA 2VZZA 4HKFA 3QAHA 5EC4A 1I12A 3PP9A 4Y49B 2P6FA 2ZW5A 1OZPA 1RXTA 2JDDA 3CXQA 4E8OA 5HMNA 2D4PA 5IB0A 1P0HA 1ON0A 2NMTA 5C82A 4KOVA 3GY9A 4FD7A 3EXNA 4CRZB 4JXRA 5KTDA 3TO6A 4JWPA 1Y9WA 4KOYA 4ORFA 4FD4A 4AVCA 2A4NA 3GYAA 3SXNA 3TT2A 2VQYA 4UA3A 3UY5A 3EO4A 2G0BA 1IYKA 1U6MA 2CNTA 1RO5A 1B87A 1YX0A 5GCNA 3QB8A 5CNPA 3W6SA 3F8KA 3H4QA 2DXQA 4CS0B 4KLWA 4YRHA 2J8NA 2OZGA 4AVAA 1XMTA 1B6BA 2AE6A 4NSQA 4ONUA 3R9GA 1WWZA 2P6GA 5EBVA 3D2PA 1Z4RA 3LODA 3BLNA 3DR6A 2I79A 2FE7A 1M44A 4MHDA 5IX3A 3KKWA 4KOTA 3WR7A 1BOBA 3I9SA 5I0CA 4M85A 1K4JA 1MJAA 3TOBA 2Q0YA 4PSWA 1NE9A 4RI1A 5JPHA 3EC4A 3BJ7A 2R98A 2H5MA 3R9FA 4KUBA 3IGRA 4KOSA 4IF5A 5F46A 1S7LA 1R57A 2Q4YA 3ZJ0A 1NMTA 2FS5A 1XIXA 4UWIA 2Q04A 1M4DA 1M4IA 4PK2A 4R87A 2FXFA 3P2HA 4AG9A 3E0KA 3SHPA 1YREA 2B4BA 3NE7A 2BSWA 4R9MA 3FYNA 1IB1E 2P6EA 1CJWA 4AB7A 2QIRA 1WK4A 2Z0ZA 4FD6A
chains in the Genus database with same CATH superfamily
4OIDA 1R6TA 1E1QG 2F23A 5CMUA 3H1HH 4DV1B 2CY2A 2WLLB 3AG7A 4NTXA 1JR9A 4PA3A 4I4TB 2RDCA 3LDDA 4UBRA 4PI2A 3IEHA 2I00A 4GKJB 3RVYA 4JI2O 5AG2A 1Y76A 1IY7A 1KMIZ 2EIJC 1YK3A 2ZEFA 2AXTZ 4A31A 3NE8A 2DPTA 3JVNA 2P22C 3BEHA 3M8AA 1DGSA 4GT1A 3HB3B 3FF3A 5LHIA 4I4TA 5IYBO 3N5FA 1S7KA 3D36C 1AR5A 1EZJA 2B1IA 1R3JC 3DSBA 4BIOA 1GN3A 3OT7A 2QSAA 1V0CA 3T90A 5GTHZ 1M4UA 2FL4A 5LL6Y 4KORA 1J95A 3IU2A 4DV2O 1NT2B 4PA7A 1XNRO 4M3SA 4NF1A 3JD0A 3STZC 2AZ2A 4NJQA 1KUVA 4Z1MG 1H8LA 1G6UA 3B7IA 3B8NA 3VWDA 4P9OA 4IYIA 4KUMA 4MHNA 3WFVA 2D2CB 4JF3A 4EB6A 2ZELA 4I9WA 3ZX6A 3R1KA 3G6EV 4FFBB 3F5WC 4DR7B 2R7HA 4Q7AA 3TO7A 2VI7A 1DE4C 1W59A 4MCQA 3KASA 4FAIA 2REEA 1H8HG 4A32A 3OEHG 1M9NA 4FM2A 5KTCA 5EBMC 1OCZC 2Y4UA 3JRUA 1VQPV 1HDJA 2GV9A 2X0LA 1WAZA 2WPDG 4OC1A 2E75B 2PTMA 1MSWD 3NR7A 2ZNIA 4LNUA 1XRYA 2ATRA 2PSWA 4TV8B 4N23A 3CXPA 3RYHA 3CE2A 2HJDA 4JV5O 3G71V 3GUXA 4J41A 1Q7YW 1AJPA 3EXAA 4JI6B 1KP2A 4RQFA 1P7GA 5KAIZ 1W2BU 5AG7A 1YLOA 1X10A 1S3ZA 3ZCCA 4B08A 1I7FA 1XEQA 2D4OA 1Q8IA 4DV0O 1QMUA 4KVOE 4PXDA 5JJEB 2Y4TA 5D5QA 3SJFA 1OCRC 2CH7B 4WJBA 1QLEC 3K58A 3P2FA 2G3TA 3SPHA 4NXMB 4O4JB 2YSUB 4CH3A 3K0GA 5KA5A 4PXBA 1VF6C 2FKXA 2FIAA 2HEPA 5CN0A 3QG5A 4KUAA 4LF8B 1KZFA 3GWOA 1R3KC 2H8PC 2ZE7A 1S72V 4ASUG 4X1KA 3UO3A 3N7ZA 1NSLA 1UWYA 2AFOA 4ICGA 3R66A 5JM6A 5BMVA 4CH4A 2MW2B 4N21A 2JLMA 2YI9A 2WLIB 1RPRA 5LRJA 4A39A 2IH1C 3CT9A 4KHPO 2Z3PA 4CAFA 4MCSA 3ZJZA 1YCIA 3JCUZ 2LW7A 3L73H 1CX8A 1YZBA 3UQ8A 1O9GA 3VBBA 3D8PA 3AK3A 3QNVA 2ZPAA 3ZRWB 5IE9A 1BCCH 2BOCC 2VQFO 4MFLA 4U9ZA 5J8CA 3CC2V 3VQXA 2A9HA 2V8HA 2N74A 1PU9A 1F51A 2HV2A 1M93A 5KHIA 5B1AC 1IBKB 4AG7A 4GYCB 5IY5C 1SS3A 4HNWB 1S7NA 2GFQA 2Q0AA 4JI1O 3DC5A 2YIBD 3CB2A 1DTDA 2WA4A 4U9YA 3HUVA 1ORQC 1K5QA 2A79B 4X66O 1EN4A 1Z8LA 4MXUA 2CAZC 4OC5A 2PVWA 5CPAA 4B7EA 3JASA 1K3EA 2YXYA 3RVZA 4C7UA 3QTCA 2Q44A 2QMLA 1CPSA 4DO2A 4B5OA 3HKDB 4DK1A 2EINB 4FUUA 3WC6A 2PJ7A 1Y0RA 4CGLA 2X6BA 4ZIBA 1GH6A 4RS2A 4QBJA 3CCUV 4JD6A 1EFRG 4K30A 2IL4A 3K06A 3D36A 1KKDA 4X62O 4OC3A 4XPDC 4FLUA 5EC2C 2ETNA 1YJ9V 5L3FA 3BVOA 3PFOA 4RUEA 4U7OA 2VXKA 1B6QA 4YGOA 5IB9A 2LFSA 1Y76B 4IYHA 1VEWA 2WA3A 4JPRA 3G6BA 1I5YA 3F7YC 3IU1A 4NVPA 4UFWA 4AXVA 3G3SA 4X1IB 1KWMA 4IHMA 1GM8A 2PJAA 3SJBC 2WLHA 3QVNA 1TUBA 4LF5B 1VGYA 1Q6UA 2B1GA 4JTCB 1BQZA 2YICA 4K35A 1NVPB 3OTOO 1GM7A 4U3JB 2CUGA 4PD4F 1FPOA 2P0WA 2CGOA 4Z65A 2EZOA 5H6QA 4MCRA 3P30A 4MJ8A 4FJCC 4CGNA 2WSAA 1X59A 3W7TA 2KCWA 2XAHA 3C3TA 2Q67A 1HNZO 2OR4A 4LWSA 1XEBA 1M4LA 4QE7A 4P4DA 2E74B 3WU2Z 5DS0A 4MSWC 5HFLA 4F0YA 1YSCA 3PB4X 4ZOLB 1FAFA 2OCCB 1HW7A 4XPLA 4EB6B 4W9YA 2JGDB 2WLNA 4OPAA 2QECA 4FFBA 2BO9A 2QDOA 2Z3KA 2OCHA 4JI4B 3ASNC 4B10A 1K34A 3LNNA 3KZWA 3OTFA 2RB7A 3L2NA 4JI6O 2Q51A 2YS8A 1XNRB 3SI0A 1TF9A 4HPSA 2EVNA 1RM1B 3WC7A 5IYZA 4DR2O 3CRCA 4TV8A 1PYTB 1XI1A 4CC5A 1PNKA 2GHYA 3ABTA 4TV9A 3T4DA 2VQEO 4I49A 4YXWG 1Q43A 4BMHA 2V8VA 2NR5A 4XDLA 4M6IA 1SKVA 5EYPB 3CCJV 2AGAA 4G1PA 4O23A 4UCMA 4NGQA 4NGSA 1V54B 1M57B 1UFIA 4AILC 1MJBA 4P4IA 2PZSA 1M57C 2JK5C 2IJJA 1YHQV 1AMPA 4KVME 1HNXB 4EFBA 3HKBA 1IURA 3IWWA 3TCUA 3JATA 1NJIW 3D8CA 2AFWA 4H37A 4BBHA 1K5SA 5KHJA 5J2TB 2C27A 4I7ZB 2EIMC 2ZM6B 4LP8A 5EC4A 1A32A 3PP9A 2EBJA 4Y49B 5KHGA 7CPAA 5LHHA 2QWRB 2Q7GA 1Y4MA 4K3AA 3ISXA 3K5OA 1OZPA 4LNUB 1RXTA 4DYOA 3RYFA 2JDDA 4IGGA 3T1CA 3CXQA 4NTYA 4JI2B 1NI8A 3UKMA 1ON0A 3KHZA 1RFYA 1IBLO 4DV6O 4KOVA 3SR2C 2LJ2A 3QF7A 3BXMA 3JATB 4CRZB 4B3SO 1RSOA 2ZEOA 2V4DA 3TO6A 4PELA 4JWPA 3CSXA 4JZGA 4CH6A 3CMEV 1EN6A 1WPBA 3WB0A 4DV6B 4G28B 4R8FA 4HYOA 3RFRA 1AB3A 3GYAA 3MHSC 3PRTA 2XAFA 1U6MA 3JAKB 1XNQO 3WABA 1WP7A 2WLKA 3RW0A 1E79G 2RNBA 3W6SA 4DXWA 2O57A 3H4QA 1L8DA 2LW1A 1NH2D 4CS0B 3ETGA 2ZDIC 4NJRA 5FPOA 4I5SA 2OZGA 1XMTA 5DEDA 3T1HO 4TUYB 3CRRA 1B6BA 2AE6A 3MRUA 5D29A 1GTOA 4KL1A 2P6GA 5EBVA 3D2PA 1Z4RA 2BE3A 1YXBA 3ZN0A 2E3CA 3ABMB 4X1KB 1JX9A 5CA0B 2Z3YA 4IHJB 5B5EZ 2I79A 2FE7A 1M44A 3CC7V 1SQQH 3KKWA 1IBKO 1ZLZA 4IIJB 1P4RA 2GREA 4WFEA 3JD3A 5I0CA 5G1ZA 4E2LA 1YEWA 1MJAA 4MCPA 3FD9A 3RGBA 5LHGA 2Q0YA 5I4MA 1YW4A 5A9GA 5AG4A 4UCNA 3R9FA 2ZD9A 1FT7A 2IW5A 3KQXA 5G22A 5F46A 4X65B 4MFZA 1S7LA 1XBLA 1ZG7A 1Q82W 4P4BA 1ARMA 4JV5B 3AG3C 1YITV 4C68A 4O4LB 1UJWB 4IIJA 2WUUA 3NA6A 1AJNA 2PYLA 1ELMP 4JI1B 1P84F 1NSAA 5LGUA 2Q9LA 1M4IA 1FKAO 2G38A 3RYCB 5KUKA 4C2YA 4ZX9A 2FXFA 1XL4A 3BAAA 2XEGA 2IM9A 4G27B 2GDSA 3D3QA 3S3WA 3SHPA 1MZFA 5LYJA 2DOSA 1JQGA 2D3OW 3OEEG 3DXRA 2BSWA 1QQCA 1YDXA 5KHHA 4X2TA 3IJ3A 1CJWA 2QIRA 4FLXA 2F66C 4HZ3A 3SJXA 1GN2A 2BSKA 5J1QA 4FD6A 2YDEA 2FVGA 5HH1A 2EK9A 1W0KG 3CYOA 1Q90D 2AJ6A 3IFXA 2V8DA 2ZT9B 1H38A 2CK3G 1B06A 2EUIA 2NYQA 3OMIB 4I50B 2BEIA 5LYDA 4A37A 2P67A 2QKAA 4UV9A 3TTHA 1IOFA 2JEVA 4OLLA 2P5OA 3K9AA 2ZE8A 2RC4A 4A30A 1BPNA 1Y74B 4P45A 4B12A 4ZI6A 2R70A 5JCOC 5CA3A 4YJ3A 5KUMA 4C2XA 2P4VA 4HNAB 4L89A 4U3JA 4J7JA 3MDSA 2VWKA 2VQFB 3S6FA 3K08A 1VHOA 5LGTA 3SXOA 3K3WA 4DNCA 3AG1C 2B3VA 2B5GB 2Z10A 5LMUO 1OCOB 2AHZA 2JVDA 2F4VB 2EIMB 2NNUA 4XDJA 1LR1A 2UUCB 1VQNV 2LGWA 1IBMB 1VF6A 2H3OA 3W7SA 4DV5O 1I94B 3ZRVA 1XDCA 5IJ0A 2PF4E 1K8AW 1H8EG 1VIXA 2ZW7A 3FJUA 1XILA 2DQ0A 5D5PA 4JI5B 1Y7RA 3O9OA 4NXMO 1YVKA 1SQHA 3DTUB 1VQ8V 1ZSPA 5HVFA 4J7ZA 1CM0A 4TSFG 5K1XA 2FT0A 1XE4A 1Q2DA 4MHYA 1N8RW 1I5XA 1N0NA 3A0RA 3FVLA 4B3SB 2UU9O 1FJGB 4BWAA 2QJ8A 1Z5WA 2ODMA 3SI1A 4DW0A 3R9EA 1VKCA 5IYDO 2DYSB 1DK1A 1IIDA 3QO7A 2PDOA 4NGPA 4K0KB 2PR1A 1K4DC 2HHHB 1TUEB 2J8MA 2UXXA 2ZR3A 1RSOB 5KX5B 2ZNJA 1R3IC 3GLJA 4BD9A 2X6CA 3APOA 3CPXA 3SPJA 4FK5C 1BZKA 4GM5A 1QU7A 3J7AU 4TT3G 3B09A 1DTOA 3ETEA 1R3LC 2PI4A 2R1IA 3H8EA 1TIQA 4A95A 4Q20A 2AZ0A 4NGNA 5BMVB 4QVTA 4H33A 1Z8TA 3U11A 2QEXV 5TISZ 3CPAA 2A0LA 3RNZA 5KHKA 2W0XA 3PBBA 3PB6X 1MOFA 2ARHA 1MA1A 2BTQB 5JH7A 4U5YA 4GZRB 2V1DA 2DQ3A 4LX9A 1UFHA 2QKCA 3P3PA 4QPJA 5CA0A 2G9DA 1P7BA 4NXNB 4MTOA 2HUZA 3OW2U 2X6AA 2XAJA 4O4HB 4F6EA 1YLEA 4YJ2A 4X8AA 2Q43A 4PJ0Z 4Z1VA 2V7QG 5JQ4A 4X65O 4B3MO 4RUHA 1XMOO 3K57A 3T1HB 5LGNA 3B77A 4RQEA 1M1KW 4Q38A 3TCVA 4DRXB 1BHBA 2Z3OA 1WB7A 3J80N 1YQEA 4DR4O 1XNQB 5LRKA 1U97A 1S60A 4LFBO 5DWMA 1N71A 3CS5A 1N34B 1SQXH 2PVVA 4KSAA 3RAMA 1FFXA 3MHHC 3J81N 1MNGA 1T5EA 1ROPA 4MTGA 3B3WA 5IWAO 3SJCC 4DRXA 3ZMVA 4X20B 4X89A 4K8ZA 2EK8A 2Q73A 4FLYA 1HWYA 3H01A 4UB8Z 1KUYA 3B4SA 2XEJA 1VQOV 4NGRA 3TXSA 5IWAB 4JI7O 1AUGA 1JMKC 1BQ0A 1GO3F 3ISZA 1THZA 1G8MA 2WPXA 5IY5B 4LF4O 3SYQA 1FFXB 1FD9A 2BSKB 2Z0AA 1G1XB 2WAMA 2QKSA 3I5DA 5KLVH 5G20A 1SETA 3FEDA 4JLYA 2ANPA 3JASB 4GLXA 2W6JG 1EM1A 4PDVA 2YEVB 1VQKV 5J9PC 5GONA 3KG2A 1IBLB 3HKDA 3QO8A 2JRIA 3UT5A 3E35A 2NN4A 5B1NA 2HP8A 3N2GA 3HKCB 5CA1B 3F5BA 1YVWA 1LAPA 4EKWA 4NB5A 4FLVA 5AG6A 3RYCA 4B3TB 3N27A 2V77A 1KD1W 3B3TA 4UWJA 1I94O 4GX1A 2X7BA 2V8GA 2CE4A 2FCKA 4DV2B 2LP7A 1KBHA 3BHXA 4LQ6A 1MG1A 2ZEDA 4YY3O 4JI4O 2Z3MA 1LAMA 4IL6Z 4K0KO 4ZI7B 3IO1A 4H6ZA 5HXDA 3N2GB 4PA9A 2GBOA 3FH4A 4ZGYB 2AFUA 2GUZB 2P6JA 3CHXA 1S5HC 2BL1A 1SESA 1SA0B 2QM4A 2ZDIA 3VQWA 1BS3A 3JYCA 1ZTEA 1S77D 1TKFA 2CNMA 1JPXA 2PJCA 4H89A 4R3LA 1ARLA 3FIXA 3OMAB 3K0DA 3ZRXA 3RO0A 4ZBGA 5EYPA 2JEUA 3AK1A 1EZVH 4II9A 1YW6A 5IT9N 3F7VC 5DWNA 1LFWA 2WYRA 2Q4ZA 1JFFB 1SQVH 1NH2B 1TKJA 3EVKA 5EIBD 2A3QA 1SA0A 3D7GA 5L3BA 2Q68A 5B66Z 2PGGA 4A38A 1NZ6A 3LDCA 4F9VA 1X4TA 4DV4O 4OX9O 2O53A 5LMUB 2F4VO 4R57A 1NTZH 2M6YA 1KUXA 2IH3C 3D3SA 5KX5A 4R50A 2F5IA 2F95B 2YNCA 4B5PB 2OH1A 3SYOA 4DV5B 1F2PA 1IU8A 1L0CA 3QNEA 1QBZA 3H1JH 2Z3LA 1G4YB 3MGDA 4X8IA 5CBHA 1YTFD 1Q3EA 3ABKB 3K59A 2HR3A 3CJHB 4H2KA 4MT8A 4DR3O 5F48A 4PDRA 1JCHA 4TV9B 3EY5A 3K9UA 3FBUA 1SC5B 1MZEA 4CYOA 2RJZA 4X62B 2PC1A 4YY3B 4FLZA 3RYIB 3TE4A 4H6UA 2JBJA 4HKFA 3V7ZA 1FXVA 5EBWC 3QAHA 4M6GA 4LF9B 3CD6V 3S3XA 5B3SC 4MFJA 1AILA 3FECA 2JEWA 1Y67A 1WNSA 4DUZB 2Q0OC 4X1YB 3B3CA 1VQLV 2YC0A 3CJHA 4AQYB 3FMCA 2XTAA 4O4HA 3FEEA 3O65A 2UXBO 5BWAB 5K8OA 8CPAA 3K04A 4R7CA 3EXNA 3SPCA 4PDLA 3OTOB 4DR4B 3VOUA 3ABLB 1AP5A 3PN1A 4NTWA 3EFFK 1SERA 4ORFA 1TKHA 2ZXWB 2QM7A 4J42A 1I08A 1WP8A 4NKGB 1BL8A 2IJIA 2A4NA 1QCEA 4UEFA 3TT2A 2VQYA 5H5NA 4UIAA 3C90A 4OGQB 4ZYQA 1IYKA 1FXKB 1FXHA 4MVMA 1H2GA 5DN6G 5FNVB 2PRQA 5A28A 4UFXA 1IX9A 1B87A 3PEIA 1AVMA 4O4JA 4FM0A 3CCEV 5JH9A 5HFMA 4LBEC 4KLWA 1Q86W 4UCVA 4OPHA 2OWOA 4CGPA 4ONUA 4P4EA 5HVGA 3NXSA 2Q6AA 4ONWA 4WBNA 5JH7B 1GN4A 1PM9A 1TXRA 1KC8W 5JGFA 3D7DA 1FXKA 3BLNA 3OMNB 4MHDA 4GKKB 3T1YO 3T2MA 3WR7A 4LF6O 2IU0A 2PJ2A 1W0JG 4JAUA 4WFGA 4UEZA 3FKSG 3TOBA 3K2KA 4PSWA 2GU2A 4EFEA 2YXLA 2JBKA 3EC4A 3CPWU 1PL0A 1VF7A 2X7RB 4AHCA 4KUBA 3LSQA 5GW7A 1XBUA 1QLNA 2YEVA 4IF5A 4PI0A 1ENVA 1NTMH 1HDUA 2IJHA 5H9CA 2EIKB 1BE3H 3E8BA 4FIPC 5EK0A 1N33O 1XIXA 2L6LA 2QWOB 2PJ0A 2Q69A 1D5NA 5CBFA 2XUMA 1H2LA 2Q04A 1BPMA 1M4DA 1Q81W 3R65A 4R87A 4IT5A 5C93A 3V38A 1K92A 4DR6O 4QIWF 4I9QA 4R9MA 3JD2A 4ABMA 4O4IB 4F6RA 1XL6A 1IB1E 2EX3A 2JDIG 5CB4B 1A2ZA 1Y74A 4YIPA 4JI0O 2HC9A 5LXTA 2KG7A 3OD4A 4J7KA 3RT3C 3BJ8A 2ZE6A 3B3VA 3ASOC 4AVBA 4IK2A 5ELYA 2VBQA 1Q7LA 4X5KA 2CNSA 4O2AB 3H1IH 3ZIAG 5BZBA 5C88A 4WCEV 2XEFA 5F49A 1QSRA 3IC1A 4R8CA 4RN7A 4QUSA 1H2NA 3OGCC 4MFKA 2GTSA 4OC0A 3OE7G 4WF9V 5JQGB 2ZW4A 1R6KA 1Z9UA 1LNQA 3FAVA 2YI8A 1I21A 4O2AA 3IWGA 2Z5UA 3KHXA 2BCCH 4DJLA 4I55B 1Z2GA 1VQ9V 4CH5A 1VHSA 4OMEA 1MMMA 4JI3O 2GTAA 4EFDA 3ABUA 2EO8A 2UU9B 1XOUA 4UCTA 5H84A 4K8XA 1LRZA 2OOTA 2Y0MA 1XJOA 1FS0G 3SJQC 2CTPA 1BSMA 4MVOA 5EBLC 3KQZA 3LMSA 4GS4A 1VIBA 4B13A 2F8HA 1MJ9A 2RMKB 2Q5ZA 2EILB 3NH5A 1LCPA 4NGTA 2WPWA 4MHPA 4P4FA 4UEEA 3WB2A 3DSQA 1LANA 4G2KA 3ZMSA 1HR0O 4XNHB 4LQGA 3K5LA 2QTOA 1IICA 1Y9KA 3LWUA 3JUWA 2BTOA 1D2DA 1IGBA 2EJ7A 3B40A 5DM6V 3S6KA 2FIWA 3K9TA 4W4KA 2P7TC 2GANA 5IJ0B 2IQ6A 4Y49C 2EBOA 3JARA 1Y6XA 1ZLHA 2RN9A 2PCUA 2IMOA 3SYCA 3KGQA 3DNSA 2CXAA 2ZEGA 2ZW6A 4KVXA 3ZN1A 2G3AA 1D5AA 3HPLC 3STLC 1DF4A 1URFA 4KOUA 4KOXA 3SI2A 3C26A 3T9YA 3OR6C 4GKKO 4CBCA 5C8YB 1TF8A 2ZXWC 1F57A 3ABLC 4QGPA 3BI1A 5K1PA 3QAYA 4EVYA 2F43G 1BT8A 5EC1C 5K8NA 1SQPH 4NCZA 1AI4A 2ZXVA 3SJAC 1DF5A 2ZKOA 1H2MA 3UCSC 2PY5A 5EZYA 4D7TA 3CC4V 4J3GA 3LNMB 4IAVA 5B3SB 4QB9A 4LH6A 4RO2A 1Y0YA 1SQFA 2C6PA 4FVMA 4DUYB 2HB6A 5F47A 1OCZB 4LF5O 1IVSA 3SYPA 4WBNB 3JALB 3LD2A 3X2QC 3ZRWA 2KB1A 1OHHG 1WJZA 3FB3A 4JAAA 5LYLA 4ZKIA 4JTAB 4JJXA 3B8MA 3TC8A 1UPGA 4MS2A 4QE9A 1AR4A 2JJ2G 3DLJA 2PRBA 1ZG9A 4JYCA 1U96A 3AK2A 1YGHA 1BLLE 2BUEA 2Q4VA 3JCZA 1XUQA 3A0BZ 4FWUA 1QNMA 2WZNA 3SGIA 3M99B 4MVZA 1BO4A 5AGEA 1K7DA 3PJSK 4TQFA 2VEZA 4X64O 5GTIZ 1IZ3A 3FB8C 3K79A 4RAIA 1V9PA 4YFJA 2UXCB 4E2AA 1XF8A 4MY0A 5K8PA 3HR0A 3AEIA 3CX5F 4OKOA 3I3GA 4KZTA 1AI6A 1OCCC 3OR7C 4UVAA 3TOAA 1ZWIC 5J8FA 1HDQA 4DV1O 2WLIA 4E4EA 1OJHA 3OUFA 4ZHQB 1GM9A 3TGUH 4CGOA 2FSRA 6CPAA 2E76B 2HVJC 4HAMA 1FNOA 4UCSA 2ZEEA 1VP7A 4R3KA 1BMFG 4O2BB 3Q4HA 1Z2LA 1F7YA 5AG5A 3OWCA 1MK4A 1EE3P 4KFMA 2LFRA 2ZINA 3DXRB 4U7NA 3ZMUA 1PCAA 1XHXA 4F6RB 3ML0A 4RWUA 3UT5B 5THWA 3B2YA 1KB9F 4DYLA 4TQDA 3HKCA 3L9DA 3T4ZA 1GHEA 1YMEA 2VL1A 5JVDA 3GKRA 4NEXA 2K9PA 4KLVA 3WB1A 4E0AA 1IYLA 1KECA 2Y69C 1E1RG 4PK3A 4FPPA 2DE0X 1ELLP 2RFHA 4KP4A 4LFCO 3TFYA 1R1BA 1L1FA 1RM1C 2QWNB 5E96A 2DYRB 3FB7C 1VQMV 3ZMZA 2E5LO 4O4LA 2PQ8A 3E8FA 4KHPB 3I56V 1S5KA 2WWWA 4LF8O 1P49A 3BI0A 5ISVA 2B4DA 4FZ1A 3A0HZ 3DGEA 1HP8A 4P30A 4X3RA 2GUZA 5FVJA 4F4LA 3QO5A 3D7HA 4AI8A 4DV4B 3ZZIA 1KKCA 2L35A 4J11A 2OT5A 2B5GA 4LH7A 5GONB 4DR1B 2DWEC 3R96A 1F2OA 4MW8A 1OCCB 4JI5O 1K73W 4O4IA 2N05A 4P9PA 4DK0A 5H2FZ 3PFEA 3W91A 2OTJV 4L8AA 3ICXA 1HR0B 1GKFA 1BAVA 5J2UB 5G21A 4DR1O 2PE3A 2QR4A 4NR1A 3IAYA 4BAYA 3T8WA 4C7HA 5E79Z 3LSUA 4P44A 2JIZG 3ZHQA 2PYJA 3W7UA 4LCUC 4HBNA 1L0LH 1YJWV 2ZIOA 2R8VA 4UVCA 5ITZA 1XHZA 3F0AA 2IJKA 4JI3B 5KMGA 2UUAO 1CXZB 2YIAA 4PPZA 4MI4A 5JQGA 5D8NA 4ZY0A 1SQGA 3AG3B 2DYRC 4PDMA 3W6XA 1PP9H 1MABG 4ZOLA 4TWEA 3KZIZ 5HVHA 3RYHB 3LACA 4QNHB 1VQ5V 1YTFB 3ZRSA 1F23A 4H44B 2DPSA 3FYEB 4MBUA 1Q2CA 3L75H 1OCRB 1PNLA 4GUNA 2EINC 4LR3A 2ZENA 3D7FA 2BOBC 2Y0PA 3D68A 1COWG 4CRYB 3JD1A 3FX6A 4MY3A 5KTAA 1CG2A 1WN7A 1QHTA 3KL9A 1OV9A 4DR6B 2YXHA 3ABMC 1CEZA 2IJZA 2PIZA 3A2FA 4UCPA 2AW9A 3CRMA 4X9QA 3I1UA 1S7FA 4PSXA 3APQA 1B3QA 4B11A 1VF5B 3FRMA 5LBQA 4H0LB 4P2ZA 5IDJA 2OU2A 2EZPA 3IWEA 4ZY1A 3S9NA 3RBUA 3D3IA 4GKJO 3ZHRA 1YSJA 3CDXA 2Q7SA 3D66A 1Q5OA 2VZZA 4MVRA 2GLFA 3JALA 4M6HA 3AG1B 2BTQA 5EIBC 1KUQA 1ZAUA 3B35A 2ZW5A 3NH8A 3PB9X 4WWVA 2ATKC 4D6TH 4MRIA 4E8OA 3CP1A 3JTKA 2A7WA 2Y48A 2NMTA 4Q36A 4X88A 4D7SA 3T1YB 2HKOA 4BIZA 5C82A 5LYFA 3HKBB 4DV3B 3LSSA 3JD4A 3GY9A 3E2EA 3LUTB 1QVFU 4NFRA 5LMNB 5CBMA 1YJNV 1Y9WA 4KOYA 4LF7O 3H8GA 5C8YA 4FD4A 2QWQB 4AVCA 4CGMA 4DV3O 3KCXA 3RBZA 2UUAB 2PIYA 3SXNA 1RTQA 5LA6B 3CCLV 2KQXA 3EO4A 2C6CA 2G0BA 2ILMA 3G4SV 3ZHUA 1Z5VA 2P06A 1SZTA 4LFCB 3QB8A 5CNPA 2Q8VA 2DXQA 4DV7O 1JA8A 4A2ZA 3IFEA 1S0VA 4YRHA 3U10A 3SPIA 2AFMA 4A5UB 4NSQA 3OUSA 2F1MA 3CMAV 4DUYO 3E8HA 3OAAG 1LUVA 4CS3A 3LODA 2YUAA 4FM1A 4CS2A 4ZX8A 4EMEA 5F2VO 4YJ2B 4JGSA 3H5ZA 1N32B 4MMOA 2F93B 2JJ1G 1V54C 4M85A 3BPZA 4JAVA 2YNCC 1XOVA 1NE9A 4RI1A 5JPHA 4U3FH 1H2SB 4TOIA 4J10A 2R98A 2H5MA 3BJ7A 1EN5A 5EMIA 4BW9A 1IXMA 4WFAV 4F0XA 1LUWA 5LYJB 1CBXA 3E22B 1VMGA 4IHJA 1YIJV 4B3TO 2ZE5A 1SQBH 1CP9A 1HNZB 5A2QN 1N36O 4PHZA 2UUBB 4JI0B 5BR8O 2FS5A 3N2KA 5B1BB 4ZHQA 2UUCO 1F4MA 2KG7B 5BY1A 4TWKA 4C7IA 2PJ1A 1IXBA 3ETQA 2ODFA 3VARA 3TETA 3IGAC 1XMOB 4AG9A 3P2HA 1ZUQA 4LF7B 4UVBA 2Q7HA 2YIDA 3E0KA 2DMXA 2QYVA 1HNWB 3Q4HB 1B04A 1KP3A 2HJFC 3OGIB 3NE7A 4A94A 3MN8A 3HKEA 4MFQA 3BA9A 4WFHA 2P6EA 1KU9A 5B1AB 4MVUA 1PD3A 2QM8A 2CTBA 2Z0ZA 5J2UA 3WG7B 2JGUA 2ZOGA 3G80A 2CTWA 4DR3B 5LOVB 4CPAA 2AFZA 4YJ3B 2VZYA 4UF4A 3EFAA 1NBMG 4XPKA 1JVMA 3UM7A 2HVKC 3DC6A 3SDLA 1VQ6V 2JGDA 4I55A 1NVPD 4DR5B 3P3NA 2UXDO 4FD5A 5IJ9A 5ITZB 3WC5A 4NXYA 2K1EA 3D4UA 2FYUH 5KMGB 5K8MA 2B4DB 4UXNA 3RYOA 5LXTB 3IIBA 4EWTA 1N32O 5LOVA 2DN9A 4B3RB 2UXBB 2WLLA 2YNDA 3X2QB 2ZEMA 4NGMA 3L74H 3S6GA 3WT4A 2QWPB 1VARA 5LRGA 4CC6A 4CYNA 3CRQA 1R6NA 1S5JA 2WLJA 2GIVA 4KSFA 4KS9A 3VQVA 3TK1A 3CWBH 3SYAA 4ZI7A 4UCRA 3NFZA 1GK9A 1TAEA 2OB0A 2LQTA 2EWBA 1K4CC 4LWSB 3GB0A 2C1CA 1YVOA 2QTSA 4HNYB 2PI5A 5E1AC 3E86A 2ZR2A 4HNAA 3W7WA 2IBZH 4KXRA 2CIJA 1GYTA 1GRJA 2XAGA 2HG5C 3OFNG 4X66B 3C3SA 2OIEA 3MAQA 4DUZO 1PUAA 4CAVA 2J8RA 3BRCA 1VQ7V 1M90W 1N34O 2YGWA 1KYOF 1FFTB 1RP3B 3CCVV 2PR8A 1SRYA 4MVSA 1NTKH 1I0HA 5L3EA 1N4CA 1JFFA 4BW5A 1CP7A 2VQEB 4GX0A 5FPRA 2W6IG 4F8ZA 2EULA 2FB5A 2KSDA 1N33B 3LDEA 2CTCA 1V55C 1NKDA 1S5LZ 1ZG8A 3ZBHA 5LP6C 2REFA 4OIWA 5LP6A 2R9RB 5JJJB 1QVGU 4MVQA 4CZZA 4R76A 3FXTA 2B3UA 4LFBB 2ZIMA 1P4NA 2OIGA 1LOKA 4JZ2A 1GMGA 3AG2C 1QSNA 2OZUA 3I55V 4DV7B 3A8TA 4B5PA 2VS0A 4LF4B 4Q6GA 2Q7BA 3SJGA 3F5TA 4YIOA 2OTLV 1JQ0A 1J4JA 3JAWA 3H9VA 2JS3A 3OM3B 4A33A 4FLWA 5FNVA 4W4LA 2VRZA 3FB5C 5LP6B 4FLTA 2POKA 3TX8A 4MTXA 1V55B 2PJ5A 2XASA 1Y7EA 1N36B 1SF9A 2R72A 2RQ6A 5J2TA 2ADPA 1QSMA 3RWRD 3E83A 3CCRV 3RZAA 2DWDC 1ZLIA 2DF5A 4JYBA 3TO9A 2CGNA 3VQYA 4JYYA 4I0XA 1JOYA 1NR7A 3PBEA 3HLPA 3SJEA 2J9AA 2ZM6O 1N0JA 4B6ZA 2B9ZA 2EIJB 1IBMO 5EZYB 1VQ4V 2C6GA 2QE7G 4DUKA 1SZXA 1TGOA 3L70H 5L3CA 3UO2A 3SPGA 2CTQA 3IJ4A 2JEXA 2P4KA 4JYAB 2NLJC 1RPOA 4UCOA 4X20A 2A06H 3CXCU 3ZMTA 4XPDB 1ZO0A 4O2BA 5FL7G 3S6HA 4LF9O 1ZL8A 1NR1A 4YHHB 4MHZA 4OC2A 1I1DA 4CAXA 4PXEA 1OCOC 4UFVA 4JI8B 2W0FC 1GAXA 4QPKA 2XAQA 4K3NA 2PJBA 2QVPA 5IV0A 4AQYO 1J5EB 1WLEA 3B2EE 4P6YA 4OC4A 3N2KB 1XMBA 4XDKA 3L72H 3MD0A 2PJ4A 2Z3NA 3CXSA 5JVDB 4RUFA 3B3SA 4GX2A 1R73A 2Z11A 3CCSV 2PJ9A 4KSIA 1Z4EA 2O28A 3ASNB 3P32A 3KI9A 4B3RO 1ZL8B 5L3GA 3ABKC 3K5NA 4OAEA 2CDYA 1WA8B 5KA6A 2OCCC 4F6AA 1XQ8A 5CB4A 3ETDA 5JCOA 3B8GA 1Y66A 2KKWA 4CAEA 3TJTA 1TUBB 1YF2A 2ZQMA 1JWQA 3THOA 1Z8XA 3CRAA 4F9UA 4UV8A 1WPXA 2ADQB 2BOAA 4CYQA 1CPYA 2K5TA 4OADA 4PA4A 3IC9A 2P90A 4R6ZA 4JYWA 1K33A 4WFBV 4UIBA 1HNWO 5JJNB 1NS1A 3L71H 1Z8WA 1PL4A 3CCQV 3S9MA 4JXQA 5IYCO 3A9LA 3V8IA 2XOKG 1WA8A 2DJVA 1K9MW 4OX9B 5L3DA 1IOIA 3PZJA 2H94A 1H2KA 2UXNA 2YIBA 3FB6C 1NQTA 4LUAA 2GE3A 1M56C 1QSTA 4LF6B 5CBGA 2LGQA 2AFSA 3E8GA 3K5MA 4ZY2A 1XMQB 4NXNO 2VWJA 1QR9A 2AFXA 2R9AA 1MSDA 3GVMA 2DEAA 3G67A 1XFOA 3R95A 4PQAA 4Z2WA 4OXSA 1QQ9A 3ASOB 2HFEC 4B14A 1L0NH 4PA6A 3FNCA 1JJOA 4P4JA 3ZHVA 4X1IA 2JDCA 4CAWA 3JAMN 5A27A 1QSOA 1FXKC 3KR5A 3PGPA 1J5EO 4MW3A 4UFZA 1M1DA 3VATA 4QC6A 5LYIA 4FMTA 1US6A 3E89A 4GX5A 3FX7A 2HHHO 1Q6HA 1WB8A 3ZHSA 4UB6Z 4DW1A 2PJ6A 4DR7O 5IJ9B 5JWPA 4TNUA 1M56B 3KKYA 2ZOFA 2YNEA 4KOWA 2B5UA 3CCMV 2HLDG 5H6RA 3W7XA 2QJ1A 4EEQA 4HNXB 3S9LA 1TA8A 3GB7C 1KQSU 3D2MA 3FAVB 1S3JA 5B1OA 5F09A 2PUSA 3H8FA 4BINA 4JASA 2UUBO 2XHBA 2MK3A 1AJQA 4WFFA 4QJFB 2OYQA 1VHEA 3BY6A 4XNHC 2OZHA 2ZCEA 4J9ZB 1EBOA 2ITCC 4PV6A 1M5IA 2NSMA 4PV1B 2CTRA 2CF4A 2ABZA 3GWKC 2EILC 3K9SA 3VWEA 1HEEA 1K97A 5IYZB 4P10A 4X1YA 3BHPA 1AROP 3RYFB 4B7KA 2CH7A 1YR0A 5H86A 1R43A 3DR8A 1M4GA 1YI2V 4LFAB 5LMNO 3CEIA 1FY7A 3VH9A 1Q2YA 3DGVA 1BHAA 3DDDA 4IUSA 2B58A 3G8WA 2DYSC 2HQYA 1AI7A 2EJRA 1F4NA 3JSLA 3U0ZA 1I12A 3BFRA 4LFAO 4YWYA 3JARB 2P6FA 5LA6A 2O4HA 3CZXA 4R6TA 1GN6A 1X12A 2ITDC 3KCYA 4I0XB 2RCVA 3AG4C 4JYAO 5HMNA 2D4PA 5IB0A 1P0HA 1QLEB 4DR5O 2UXDB 4DR2B 4FD7A 1PPJH 5DECA 2ZEHA 4JXRA 2UXCO 1BGYH 4UCUA 5KTDA 2FMLA 2IU3A 3RYIA 2PJ8A 2JS5A 4TUYA 2ZEPA 5KAFZ 4BIUA 4YU9A 1R3NA 4UA3A 3BCCH 2E5LB 3UY5A 2XEIA 4NYKA 3JAWB 2CNTA 3AG4B 2AHYA 1RO5A 4JZ0A 5BR8B 1YX0A 4LC1A 5GCNA 3H1KH 1AYEA 3F8KA 4J9YB 4BR6A 1CP6A 3IC7A 2N04A 4L8JA 1Q6IA 2J8NA 1AP6A 4AVAA 1TVKA 4FZ0A 3R9GA 1Z5RA 1WWZA 4JTDB 3RN4A 2Q7EA 4CYPA 1PV0A 1NU1H 3E22A 3JAKA 2PJ3A 3BABA 4J80A 3ZHTA 4PXCA 3DR6A 1O9HA 5IX3A 3CXHF 4L87A 4JI8O 4KOTA 3BA8A 3H1LH 4XBFA 3AG2B 3GIUA 3D67A 1BOBA 1S76D 1FYJA 3I9SA 1OZ0A 1K4JA 2QA4V 4DV0B 1TVKB 2EIKC 4OP4A 1DLBA 1OBRA 2XNDG 1QR8A 4C2ZA 2Q4PA 1IDSA 3WG7C 4B3MB 3IGRA 4KOSA 3JSNA 1AI5A 2M7WA 1XREA 2WLMA 4YHHO 1XMQO 1FJGO 4GCZA 4GXHA 5FLXN 3HKEB 1R57A 2I3CA 2Q4YA 3ZJ0A 1NMTA 3M7MX 3PB8X 5BXZA 5CA1A 2XT9A 1AR1B 4UWIA 2C2AA 2FTKA 2WSSG 3NH4A 2GLJA 4PK2A 3KR4A 4MFPA 1ZX3A 3ZS8C 4CS4A 3EHBB 1CPXA 4UUJC 2R9IA 4JI7B 2DW4A 4FBEA 4H13B 1YREA 2B4BA 5B1BC 4I50A 1HNXO 4FFKA 4X64B 2BCOA 3FFQA 2LO1A 4MTFA 3FYNA 2Y0IA 4R7MA 4AB7A 2F7VA 3PB7X 1WK4A 1PKXA 1JJ2U 2QGNA 2GSMB 2Y69B 4ZBMA 3TXQA 3ZEDA 1PNMA 3K03A 3FYIB
chains in the Genus database with same CATH topology
2CY2A 5HH1A 2VZYA 4AVBA 3EFAA 2VBQA 4XPKA 2AJ6A 4X5KA 2CNSA 4UBRA 2I00A 2EUIA 2BEIA 4FD5A 3TTHA 5C88A 4NXYA 5F49A 1QSRA 2JEVA 4OLLA 1YK3A 2RC4A 4QUSA 4A31A 4A30A 4B12A 2DPTA 4MFKA 3JVNA 2B4DB 3RYOA 2ZW4A 4C2XA 1Z9UA 2YNDA 4L89A 3S6FA 1I21A 3S6GA 3SXOA 4DNCA 3IWGA 1S7KA 2B3VA 4CYNA 2B5GB 2Z10A 4KSFA 1VHSA 2GIVA 4KS9A 3DSBA 1V0CA 3T90A 2FL4A 4KORA 5H84A 2OB0A 3IU2A 1LRZA 2Y0MA 4M3SA 4NF1A 1YVOA 4HNYB 1KUVA 2ZW7A 4GS4A 3VWDA 1Y7RA 4B13A 1MJ9A 1YVKA 1SQHA 2WPWA 1CM0A 3R1KA 2FT0A 2R7HA 1XE4A 1PUAA 1Q2DA 2VI7A 4XNHB 2J8RA 3TO7A 4CAVA 1IICA 1Y9KA 3JUWA 2REEA 2YGWA 3S6KA 4A32A 2FIWA 2PR8A 5KTCA 2GANA 4Y49C 3R9EA 1VKCA 2ATRA 3DNSA 2CXAA 2ZW6A 1IIDA 2PSWA 4KVXA 2PDOA 3BJ8A 2PR1A 3CXPA 2REFA 2G3AA 2J8MA 4KOUA 3FXTA 2B3UA 1P4NA 4KOXA 3C26A 3T9YA 2OZUA 1QSNA 5AG7A 1S3ZA 4B5PA 2Q7BA 2D4OA 4KVOE 1J4JA 4EVYA 2R1IA 1TIQA 4A95A 4A33A 4NCZA 3P2FA 2G3TA 2ZXVA 4QVTA 2FIAA 4J3GA 4QB9A 4KUAA 1QSMA 1KZFA 5F47A 3LD2A 2ARHA 4U5YA 3TO9A 4LX9A 1UFHA 3FB3A 4JJXA 3N7ZA 1NSLA 2HUZA 1YLEA 2PRBA 2JLMA 5JQ4A 1YGHA 2BUEA 2Q4VA 2Z3PA 4CAFA 1BO4A 5AGEA 4Q38A 3TCVA 3D8PA 2VEZA 2ZPAA 2Z3OA 1ZO0A 4U9ZA 4MFLA 4XPDB 4YFJA 3S6HA 5J8CA 4E2AA 1XF8A 4MY0A 1I1DA 1PU9A 4CAXA 4UFVA 2HV2A 3I3GA 4KZTA 1S60A 4AG7A 5DWMA 5IV0A 1N71A 4HNWB 3TOAA 1S7NA 5J8FA 4KSAA 3CXSA 2Z3NA 4U9YA 4CGOA 2FSRA 2Z11A 1Z4EA 2O28A 4R3KA 5AG5A 3OWCA 1MK4A 1KUYA 2Q44A 4OAEA 2QMLA 4B5OA 4F6AA 4CGLA 3B8GA 2WPXA 4CAEA 4RS2A 1GHEA 4QBJA 4NEXA 3GKRA 4JD6A 4KLVA 4K30A 2IL4A 4E0AA 5G20A 1IYLA 4CYQA 2K5TA 4JLYA 4OADA 4XPDC 4PK3A 3TFYA 5E96A 2VXKA 4YGOA 4JXQA 3A9LA 3V8IA 3IU1A 2PQ8A 4UFWA 3G3SA 1S5KA 3F5BA 3PZJA 5ISVA 2B4DA 4LUAA 2GE3A 5AG6A 1QSTA 4UWJA 5FVJA 2X7BA 2FCKA 2P0WA 3ZZIA 2B5GA 3R95A 4MJ8A 3R96A 4CGNA 2Z3MA 2WSAA 4B14A 2KCWA 3FNCA 3W91A 4L8AA 4H6ZA 2JDCA 4CAWA 5A27A 1QSOA 1XEBA 5G21A 4ZGYB 3PGPA 4C7HA 1M1DA 4F0YA 4QC6A 2BL1A 4XPLA 2R8VA 2CNMA 2QECA 2Z3KA 3F0AA 4H89A 4R3LA 3FIXA 2YNEA 4KOWA 4ZBGA 4B10A 4II9A 5DWNA 4MI4A 4HNXB 2EVNA 3W6XA 3D2MA 4I49A 4BMHA 4R57A 1KUXA 2DPSA 4MBUA 1Q2CA 3D3SA 4UCMA 4XNHC 2F5IA 2OZHA 2YNCA 4B5PB 2OH1A 4PV6A 1L0CA 4CRYB 2Z3LA 1MJBA 3MGDA 4MY3A 5KTAA 3VWEA 5F48A 4KVME 1YR0A 5H86A 3EY5A 3DR8A 1M4GA 3K9UA 3FBUA 4UCPA 1S7FA 4PSXA 4B11A 1FY7A 1Q2YA 4CYOA 3FRMA 2OU2A 2PC1A 3DDDA 3IWEA 4IUSA 2B58A 4BBHA 3G8WA 2C27A 4H6UA 3TE4A 2HQYA 2VZZA 4HKFA 3QAHA 5EC4A 1I12A 3PP9A 4MFJA 4Y49B 2P6FA 2ZW5A 1OZPA 1RXTA 2JDDA 3CXQA 4E8OA 5HMNA 2D4PA 3JTKA 5IB0A 1P0HA 1ON0A 2NMTA 4Q36A 5C82A 5BWAB 4KOVA 3GY9A 4FD7A 3EXNA 4CRZB 4JXRA 5KTDA 3TO6A 4JWPA 1Y9WA 4KOYA 4ORFA 4FD4A 4AVCA 4CGMA 2A4NA 3GYAA 3SXNA 3TT2A 2VQYA 4UA3A 3UY5A 3EO4A 2G0BA 1IYKA 1U6MA 2CNTA 1RO5A 5A28A 4UFXA 1B87A 1YX0A 5GCNA 3QB8A 5CNPA 3W6SA 3F8KA 3H4QA 2DXQA 4CS0B 4A2ZA 4KLWA 4YRHA 2J8NA 2OZGA 4AVAA 1XMTA 1B6BA 2AE6A 4CGPA 4NSQA 4ONUA 3R9GA 1WWZA 2P6GA 5EBVA 3D2PA 1Z4RA 4CYPA 3LODA 3BLNA 3DR6A 2I79A 2FE7A 1M44A 4MHDA 5IX3A 3KKWA 4KOTA 3H5ZA 3WR7A 1BOBA 3I9SA 5I0CA 5G1ZA 4M85A 1K4JA 1MJAA 3TOBA 2Q0YA 2YNCC 4PSWA 1NE9A 4RI1A 5JPHA 3EC4A 5AG4A 3BJ7A 2R98A 2H5MA 4UCNA 3R9FA 4KUBA 4C2ZA 4F0XA 3IGRA 4KOSA 5G22A 4IF5A 5F46A 4MFZA 1S7LA 1R57A 2Q4YA 3ZJ0A 1NMTA 4C68A 2WUUA 2FS5A 1XIXA 4UWIA 2Q04A 1M4DA 1M4IA 4C7IA 4PK2A 4C2YA 4MFPA 4R87A 2FXFA 3P2HA 4AG9A 3E0KA 3SHPA 1YREA 2B4BA 3NE7A 2BSWA 4R9MA 4MFQA 3FYNA 1IB1E 2P6EA 1CJWA 4AB7A 2QIRA 1WK4A 2Z0ZA 4FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY2 A;  5HH1 A;  2VZY A;  4AVB A;  3EFA A;  2VBQ A;  4XPK A;  2AJ6 A;  4X5K A;  2CNS A;  4UBR A;  2I00 A;  2EUI A;  2BEI A;  4FD5 A;  3TTH A;  5C88 A;  4NXY A;  5F49 A;  1QSR A;  2JEV A;  4OLL A;  1YK3 A;  2RC4 A;  4QUS A;  3JVN A;  2B4D B;  3RYO A;  2ZW4 A;  1Z9U A;  4L89 A;  3S6F A;  1I21 A;  3S6G A;  3SXO A;  4DNC A;  3IWG A;  1S7K A;  2B3V A;  2B5G B;  2Z10 A;  1VHS A;  2GIV A;  3DSB A;  1V0C A;  3T90 A;  2FL4 A;  4KOR A;  5H84 A;  2OB0 A;  1LRZ A;  2Y0M A;  4M3S A;  4NF1 A;  1YVO A;  4HNY B;  1KUV A;  2ZW7 A;  4GS4 A;  3VWD A;  1Y7R A;  1MJ9 A;  1YVK A;  1SQH A;  2WPW A;  1CM0 A;  3R1K A;  2FT0 A;  2R7H A;  1XE4 A;  1PUA A;  1Q2D A;  2VI7 A;  4XNH B;  2J8R A;  3TO7 A;  4CAV A;  1IIC A;  1Y9K A;  3JUW A;  2REE A;  3S6K A;  2FIW A;  2PR8 A;  5KTC A;  2GAN A;  4Y49 C;  3R9E A;  1VKC A;  2ATR A;  3DNS A;  2ZW6 A;  1IID A;  2PSW A;  4KVX A;  2PDO A;  3BJ8 A;  2PR1 A;  3CXP A;  2REF A;  2G3A A;  2J8M A;  4KOU A;  3FXT A;  2B3U A;  1P4N A;  4KOX A;  3C26 A;  3T9Y A;  2OZU A;  1QSN A;  1S3Z A;  4B5P A;  2Q7B A;  2D4O A;  4KVO E;  1J4J A;  4EVY A;  2R1I A;  1TIQ A;  4NCZ A;  3P2F A;  2G3T A;  2ZXV A;  4QVT A;  2FIA A;  4J3G A;  4QB9 A;  4KUA A;  1QSM A;  1KZF A;  5F47 A;  3LD2 A;  2ARH A;  4U5Y A;  3TO9 A;  4LX9 A;  1UFH A;  3FB3 A;  4JJX A;  3N7Z A;  1NSL A;  2HUZ A;  1YLE A;  2PRB A;  2JLM A;  5JQ4 A;  1YGH A;  2BUE A;  2Q4V A;  1BO4 A;  3TCV A;  3D8P A;  2VEZ A;  2ZPA A;  4U9Z A;  4XPD B;  5J8C A;  4YFJ A;  3S6H A;  4E2A A;  1XF8 A;  4MY0 A;  1I1D A;  1PU9 A;  4CAX A;  2HV2 A;  3I3G A;  4KZT A;  1S60 A;  4AG7 A;  5DWM A;  5IV0 A;  1N71 A;  4HNW B;  3TOA A;  1S7N A;  5J8F A;  3CXS A;  4U9Y A;  2FSR A;  2Z11 A;  1Z4E A;  2O28 A;  4R3K A;  3OWC A;  1MK4 A;  1KUY A;  2Q44 A;  4OAE A;  2QML A;  4B5O A;  4F6A A;  3B8G A;  2WPX A;  4RS2 A;  1GHE A;  4QBJ A;  4NEX A;  3GKR A;  4JD6 A;  4KLV A;  4K30 A;  2IL4 A;  4E0A A;  1IYL A;  2K5T A;  4OAD A;  4JLY A;  4XPD C;  4PK3 A;  3TFY A;  5E96 A;  2VXK A;  4YGO A;  4JXQ A;  3V8I A;  2PQ8 A;  3G3S A;  1S5K A;  3F5B A;  3PZJ A;  5ISV A;  2B4D A;  4LUA A;  2GE3 A;  1QST A;  4UWJ A;  5FVJ A;  2X7B A;  2FCK A;  2P0W A;  3ZZI A;  2B5G A;  3R95 A;  4MJ8 A;  3R96 A;  2KCW A;  3FNC A;  3W91 A;  4L8A A;  4H6Z A;  2JDC A;  4CAW A;  1QSO A;  1XEB A;  3PGP A;  1M1D A;  4F0Y A;  4QC6 A;  2BL1 A;  4XPL A;  2R8V A;  2CNM A;  2QEC A;  3F0A A;  4H89 A;  4R3L A;  3FIX A;  4KOW A;  4ZBG A;  4II9 A;  5DWN A;  4MI4 A;  4HNX B;  2EVN A;  3W6X A;  3D2M A;  4I49 A;  4BMH A;  4R57 A;  1KUX A;  4MBU A;  1Q2C A;  3D3S A;  4XNH C;  2F5I A;  2OZH A;  4B5P B;  2OH1 A;  4PV6 A;  1L0C A;  4CRY B;  1MJB A;  3MGD A;  4MY3 A;  5KTA A;  3VWE A;  5F48 A;  4KVM E;  1YR0 A;  5H86 A;  3EY5 A;  3DR8 A;  1M4G A;  3K9U A;  3FBU A;  1S7F A;  4PSX A;  1FY7 A;  1Q2Y A;  3FRM A;  2OU2 A;  2PC1 A;  3DDD A;  4IUS A;  2B58 A;  3G8W A;  2C27 A;  4H6U A;  3TE4 A;  2HQY A;  2VZZ A;  4HKF A;  3QAH A;  5EC4 A;  1I12 A;  3PP9 A;  4Y49 B;  2P6F A;  2ZW5 A;  1OZP A;  1RXT A;  2JDD A;  3CXQ A;  4E8O A;  5HMN A;  2D4P A;  5IB0 A;  1P0H A;  1ON0 A;  2NMT A;  5C82 A;  4KOV A;  3GY9 A;  4FD7 A;  3EXN A;  4CRZ B;  4JXR A;  5KTD A;  3TO6 A;  4JWP A;  1Y9W A;  4KOY A;  4ORF A;  4FD4 A;  4AVC A;  2A4N A;  3GYA A;  3SXN A;  3TT2 A;  2VQY A;  4UA3 A;  3UY5 A;  3EO4 A;  2G0B A;  1IYK A;  1U6M A;  2CNT A;  1RO5 A;  1B87 A;  1YX0 A;  5GCN A;  3QB8 A;  5CNP A;  3W6S A;  3F8K A;  3H4Q A;  2DXQ A;  4CS0 B;  4KLW A;  4YRH A;  2J8N A;  2OZG A;  4AVA A;  1XMT A;  1B6B A;  2AE6 A;  4NSQ A;  4ONU A;  3R9G A;  1WWZ A;  2P6G A;  5EBV A;  3D2P A;  1Z4R A;  3LOD A;  3BLN A;  3DR6 A;  2I79 A;  2FE7 A;  1M44 A;  4MHD A;  5IX3 A;  3KKW A;  4KOT A;  3WR7 A;  1BOB A;  3I9S A;  5I0C A;  4M85 A;  1K4J A;  1MJA A;  3TOB A;  2Q0Y A;  4PSW A;  1NE9 A;  4RI1 A;  5JPH A;  3EC4 A;  3BJ7 A;  2R98 A;  2H5M A;  3R9F A;  4KUB A;  3IGR A;  4KOS A;  4IF5 A;  5F46 A;  1S7L A;  1R57 A;  2Q4Y A;  3ZJ0 A;  1NMT A;  2FS5 A;  1XIX A;  4UWI A;  2Q04 A;  1M4D A;  1M4I A;  4PK2 A;  4R87 A;  2FXF A;  3P2H A;  4AG9 A;  3E0K A;  3SHP A;  1YRE A;  2B4B A;  3NE7 A;  2BSW A;  4R9M A;  3FYN A;  1IB1 E;  2P6E A;  1CJW A;  4AB7 A;  2QIR A;  1WK4 A;  2Z0Z A;  4FD6 A; 
#chains in the Genus database with same CATH topology
 4OID A;  1R6T A;  1E1Q G;  2F23 A;  5CMU A;  3H1H H;  4DV1 B;  2CY2 A;  2WLL B;  3AG7 A;  4NTX A;  1JR9 A;  4PA3 A;  4I4T B;  2RDC A;  3LDD A;  4UBR A;  4PI2 A;  3IEH A;  2I00 A;  4GKJ B;  3RVY A;  4JI2 O;  5AG2 A;  1Y76 A;  1IY7 A;  1KMI Z;  2EIJ C;  1YK3 A;  2ZEF A;  2AXT Z;  4A31 A;  3NE8 A;  2DPT A;  3JVN A;  2P22 C;  3BEH A;  3M8A A;  1DGS A;  4GT1 A;  3HB3 B;  3FF3 A;  5LHI A;  4I4T A;  5IYB O;  3N5F A;  1S7K A;  3D36 C;  1AR5 A;  1EZJ A;  2B1I A;  1R3J C;  3DSB A;  4BIO A;  1GN3 A;  3OT7 A;  2QSA A;  1V0C A;  3T90 A;  5GTH Z;  1M4U A;  2FL4 A;  5LL6 Y;  4KOR A;  1J95 A;  3IU2 A;  4DV2 O;  1NT2 B;  4PA7 A;  1XNR O;  4M3S A;  4NF1 A;  3JD0 A;  3STZ C;  2AZ2 A;  4NJQ A;  1KUV A;  4Z1M G;  1H8L A;  1G6U A;  3B7I A;  3B8N A;  3VWD A;  4P9O A;  4IYI A;  4KUM A;  4MHN A;  3WFV A;  2D2C B;  4JF3 A;  4EB6 A;  2ZEL A;  4I9W A;  3ZX6 A;  3R1K A;  3G6E V;  4FFB B;  3F5W C;  4DR7 B;  2R7H A;  4Q7A A;  3TO7 A;  2VI7 A;  1DE4 C;  1W59 A;  4MCQ A;  3KAS A;  4FAI A;  2REE A;  1H8H G;  4A32 A;  3OEH G;  1M9N A;  4FM2 A;  5KTC A;  5EBM C;  1OCZ C;  2Y4U A;  3JRU A;  1VQP V;  1HDJ A;  2GV9 A;  2X0L A;  1WAZ A;  2WPD G;  4OC1 A;  2E75 B;  2PTM A;  1MSW D;  3NR7 A;  2ZNI A;  4LNU A;  1XRY A;  2ATR A;  2PSW A;  4TV8 B;  4N23 A;  3CXP A;  3RYH A;  3CE2 A;  2HJD A;  4JV5 O;  3G71 V;  3GUX A;  4J41 A;  1Q7Y W;  1AJP A;  3EXA A;  4JI6 B;  1KP2 A;  4RQF A;  1P7G A;  5KAI Z;  1W2B U;  5AG7 A;  1YLO A;  1X10 A;  1S3Z A;  3ZCC A;  4B08 A;  1I7F A;  1XEQ A;  2D4O A;  1Q8I A;  4DV0 O;  1QMU A;  4KVO E;  4PXD A;  5JJE B;  2Y4T A;  5D5Q A;  3SJF A;  1OCR C;  2CH7 B;  4WJB A;  1QLE C;  3K58 A;  3P2F A;  2G3T A;  3SPH A;  4NXM B;  4O4J B;  2YSU B;  4CH3 A;  3K0G A;  5KA5 A;  4PXB A;  1VF6 C;  2FKX A;  2FIA A;  2HEP A;  5CN0 A;  3QG5 A;  4KUA A;  4LF8 B;  1KZF A;  3GWO A;  1R3K C;  2H8P C;  2ZE7 A;  1S72 V;  4ASU G;  4X1K A;  3UO3 A;  3N7Z A;  1NSL A;  1UWY A;  2AFO A;  4ICG A;  3R66 A;  5JM6 A;  5BMV A;  4CH4 A;  2MW2 B;  4N21 A;  2JLM A;  2YI9 A;  2WLI B;  1RPR A;  5LRJ A;  4A39 A;  2IH1 C;  3CT9 A;  4KHP O;  2Z3P A;  4CAF A;  4MCS A;  3ZJZ A;  1YCI A;  3JCU Z;  2LW7 A;  3L73 H;  1CX8 A;  1YZB A;  3UQ8 A;  1O9G A;  3VBB A;  3D8P A;  3AK3 A;  3QNV A;  2ZPA A;  3ZRW B;  5IE9 A;  1BCC H;  2BOC C;  2VQF O;  4MFL A;  4U9Z A;  5J8C A;  3CC2 V;  3VQX A;  2A9H A;  2V8H A;  2N74 A;  1PU9 A;  1F51 A;  2HV2 A;  1M93 A;  5KHI A;  5B1A C;  1IBK B;  4AG7 A;  4GYC B;  5IY5 C;  1SS3 A;  4HNW B;  1S7N A;  2GFQ A;  2Q0A A;  4JI1 O;  3DC5 A;  2YIB D;  3CB2 A;  1DTD A;  2WA4 A;  4U9Y A;  3HUV A;  1ORQ C;  1K5Q A;  2A79 B;  4X66 O;  1EN4 A;  1Z8L A;  4MXU A;  2CAZ C;  4OC5 A;  2PVW A;  5CPA A;  4B7E A;  3JAS A;  1K3E A;  2YXY A;  3RVZ A;  4C7U A;  3QTC A;  2Q44 A;  2QML A;  1CPS A;  4DO2 A;  4B5O A;  3HKD B;  4DK1 A;  2EIN B;  4FUU A;  3WC6 A;  2PJ7 A;  1Y0R A;  4CGL A;  2X6B A;  4ZIB A;  1GH6 A;  4RS2 A;  4QBJ A;  3CCU V;  4JD6 A;  1EFR G;  4K30 A;  2IL4 A;  3K06 A;  3D36 A;  1KKD A;  4X62 O;  4OC3 A;  4XPD C;  4FLU A;  5EC2 C;  2ETN A;  1YJ9 V;  5L3F A;  3BVO A;  3PFO A;  4RUE A;  4U7O A;  2VXK A;  1B6Q A;  4YGO A;  5IB9 A;  2LFS A;  1Y76 B;  4IYH A;  1VEW A;  2WA3 A;  4JPR A;  3G6B A;  1I5Y A;  3F7Y C;  3IU1 A;  4NVP A;  4UFW A;  4AXV A;  3G3S A;  4X1I B;  1KWM A;  4IHM A;  1GM8 A;  2PJA A;  3SJB C;  2WLH A;  3QVN A;  1TUB A;  4LF5 B;  1VGY A;  1Q6U A;  2B1G A;  4JTC B;  1BQZ A;  2YIC A;  4K35 A;  1NVP B;  3OTO O;  1GM7 A;  4U3J B;  2CUG A;  4PD4 F;  1FPO A;  2P0W A;  2CGO A;  4Z65 A;  2EZO A;  5H6Q A;  4MCR A;  3P30 A;  4MJ8 A;  4FJC C;  4CGN A;  2WSA A;  1X59 A;  3W7T A;  2KCW A;  2XAH A;  3C3T A;  2Q67 A;  1HNZ O;  2OR4 A;  4LWS A;  1XEB A;  1M4L A;  4QE7 A;  4P4D A;  2E74 B;  3WU2 Z;  5DS0 A;  4MSW C;  5HFL A;  4F0Y A;  1YSC A;  3PB4 X;  4ZOL B;  1FAF A;  2OCC B;  1HW7 A;  4XPL A;  4EB6 B;  4W9Y A;  2JGD B;  2WLN A;  4OPA A;  2QEC A;  4FFB A;  2BO9 A;  2QDO A;  2Z3K A;  2OCH A;  4JI4 B;  3ASN C;  4B10 A;  1K34 A;  3LNN A;  3KZW A;  3OTF A;  2RB7 A;  3L2N A;  4JI6 O;  2Q51 A;  2YS8 A;  1XNR B;  3SI0 A;  1TF9 A;  4HPS A;  2EVN A;  1RM1 B;  3WC7 A;  5IYZ A;  4DR2 O;  3CRC A;  4TV8 A;  1PYT B;  1XI1 A;  4CC5 A;  1PNK A;  2GHY A;  3ABT A;  4TV9 A;  3T4D A;  2VQE O;  4I49 A;  4YXW G;  1Q43 A;  4BMH A;  2V8V A;  2NR5 A;  4XDL A;  4M6I A;  1SKV A;  5EYP B;  3CCJ V;  2AGA A;  4G1P A;  4O23 A;  4UCM A;  4NGQ A;  4NGS A;  1V54 B;  1M57 B;  1UFI A;  4AIL C;  1MJB A;  4P4I A;  2PZS A;  1M57 C;  2JK5 C;  2IJJ A;  1YHQ V;  1AMP A;  4KVM E;  1HNX B;  4EFB A;  3HKB A;  1IUR A;  3IWW A;  3TCU A;  3JAT A;  1NJI W;  3D8C A;  2AFW A;  4H37 A;  4BBH A;  1K5S A;  5KHJ A;  5J2T B;  2C27 A;  4I7Z B;  2EIM C;  2ZM6 B;  4LP8 A;  5EC4 A;  1A32 A;  3PP9 A;  2EBJ A;  4Y49 B;  5KHG A;  7CPA A;  5LHH A;  2QWR B;  2Q7G A;  1Y4M A;  4K3A A;  3ISX A;  3K5O A;  1OZP A;  4LNU B;  1RXT A;  4DYO A;  3RYF A;  2JDD A;  4IGG A;  3T1C A;  3CXQ A;  4NTY A;  4JI2 B;  1NI8 A;  3UKM A;  1ON0 A;  3KHZ A;  1RFY A;  1IBL O;  4DV6 O;  4KOV A;  3SR2 C;  2LJ2 A;  3QF7 A;  3BXM A;  3JAT B;  4CRZ B;  4B3S O;  1RSO A;  2ZEO A;  2V4D A;  3TO6 A;  4PEL A;  4JWP A;  3CSX A;  4JZG A;  4CH6 A;  3CME V;  1EN6 A;  1WPB A;  3WB0 A;  4DV6 B;  4G28 B;  4R8F A;  4HYO A;  3RFR A;  1AB3 A;  3GYA A;  3MHS C;  3PRT A;  2XAF A;  1U6M A;  3JAK B;  1XNQ O;  3WAB A;  1WP7 A;  2WLK A;  3RW0 A;  1E79 G;  2RNB A;  3W6S A;  4DXW A;  2O57 A;  3H4Q A;  1L8D A;  2LW1 A;  1NH2 D;  4CS0 B;  3ETG A;  2ZDI C;  4NJR A;  5FPO A;  4I5S A;  2OZG A;  1XMT A;  5DED A;  3T1H O;  4TUY B;  3CRR A;  1B6B A;  2AE6 A;  3MRU A;  5D29 A;  1GTO A;  4KL1 A;  2P6G A;  5EBV A;  3D2P A;  1Z4R A;  2BE3 A;  1YXB A;  3ZN0 A;  2E3C A;  3ABM B;  4X1K B;  1JX9 A;  5CA0 B;  2Z3Y A;  4IHJ B;  5B5E Z;  2I79 A;  2FE7 A;  1M44 A;  3CC7 V;  1SQQ H;  3KKW A;  1IBK O;  1ZLZ A;  4IIJ B;  1P4R A;  2GRE A;  4WFE A;  3JD3 A;  5I0C A;  5G1Z A;  4E2L A;  1YEW A;  1MJA A;  4MCP A;  3FD9 A;  3RGB A;  5LHG A;  2Q0Y A;  5I4M A;  1YW4 A;  5A9G A;  5AG4 A;  4UCN A;  3R9F A;  2ZD9 A;  1FT7 A;  2IW5 A;  3KQX A;  5G22 A;  5F46 A;  4X65 B;  4MFZ A;  1S7L A;  1XBL A;  1ZG7 A;  1Q82 W;  4P4B A;  1ARM A;  4JV5 B;  3AG3 C;  1YIT V;  4C68 A;  4O4L B;  1UJW B;  4IIJ A;  2WUU A;  3NA6 A;  1AJN A;  2PYL A;  1ELM P;  4JI1 B;  1P84 F;  1NSA A;  5LGU A;  2Q9L A;  1M4I A;  1FKA O;  2G38 A;  3RYC B;  5KUK A;  4C2Y A;  4ZX9 A;  2FXF A;  1XL4 A;  3BAA A;  2XEG A;  2IM9 A;  4G27 B;  2GDS A;  3D3Q A;  3S3W A;  3SHP A;  1MZF A;  5LYJ A;  2DOS A;  1JQG A;  2D3O W;  3OEE G;  3DXR A;  2BSW A;  1QQC A;  1YDX A;  5KHH A;  4X2T A;  3IJ3 A;  1CJW A;  2QIR A;  4FLX A;  2F66 C;  4HZ3 A;  3SJX A;  1GN2 A;  2BSK A;  5J1Q A;  4FD6 A;  2YDE A;  2FVG A;  5HH1 A;  2EK9 A;  1W0K G;  3CYO A;  1Q90 D;  2AJ6 A;  3IFX A;  2V8D A;  2ZT9 B;  1H38 A;  2CK3 G;  1B06 A;  2EUI A;  2NYQ A;  3OMI B;  4I50 B;  2BEI A;  5LYD A;  4A37 A;  2P67 A;  2QKA A;  4UV9 A;  3TTH A;  1IOF A;  2JEV A;  4OLL A;  2P5O A;  3K9A A;  2ZE8 A;  2RC4 A;  4A30 A;  1BPN A;  1Y74 B;  4P45 A;  4B12 A;  4ZI6 A;  2R70 A;  5JCO C;  5CA3 A;  4YJ3 A;  5KUM A;  4C2X A;  2P4V A;  4HNA B;  4L89 A;  4U3J A;  4J7J A;  3MDS A;  2VWK A;  2VQF B;  3S6F A;  3K08 A;  1VHO A;  5LGT A;  3SXO A;  3K3W A;  4DNC A;  3AG1 C;  2B3V A;  2B5G B;  2Z10 A;  5LMU O;  1OCO B;  2AHZ A;  2JVD A;  2F4V B;  2EIM B;  2NNU A;  4XDJ A;  1LR1 A;  2UUC B;  1VQN V;  2LGW A;  1IBM B;  1VF6 A;  2H3O A;  3W7S A;  4DV5 O;  1I94 B;  3ZRV A;  1XDC A;  5IJ0 A;  2PF4 E;  1K8A W;  1H8E G;  1VIX A;  2ZW7 A;  3FJU A;  1XIL A;  2DQ0 A;  5D5P A;  4JI5 B;  1Y7R A;  3O9O A;  4NXM O;  1YVK A;  1SQH A;  3DTU B;  1VQ8 V;  1ZSP A;  5HVF A;  4J7Z A;  1CM0 A;  4TSF G;  5K1X A;  2FT0 A;  1XE4 A;  1Q2D A;  4MHY A;  1N8R W;  1I5X A;  1N0N A;  3A0R A;  3FVL A;  4B3S B;  2UU9 O;  1FJG B;  4BWA A;  2QJ8 A;  1Z5W A;  2ODM A;  3SI1 A;  4DW0 A;  3R9E A;  1VKC A;  5IYD O;  2DYS B;  1DK1 A;  1IID A;  3QO7 A;  2PDO A;  4NGP A;  4K0K B;  2PR1 A;  1K4D C;  2HHH B;  1TUE B;  2J8M A;  2UXX A;  2ZR3 A;  1RSO B;  5KX5 B;  2ZNJ A;  1R3I C;  3GLJ A;  4BD9 A;  2X6C A;  3APO A;  3CPX A;  3SPJ A;  4FK5 C;  1BZK A;  4GM5 A;  1QU7 A;  3J7A U;  4TT3 G;  3B09 A;  1DTO A;  3ETE A;  1R3L C;  2PI4 A;  2R1I A;  3H8E A;  1TIQ A;  4A95 A;  4Q20 A;  2AZ0 A;  4NGN A;  5BMV B;  4QVT A;  4H33 A;  1Z8T A;  3U11 A;  2QEX V;  5TIS Z;  3CPA A;  2A0L A;  3RNZ A;  5KHK A;  2W0X A;  3PBB A;  3PB6 X;  1MOF A;  2ARH A;  1MA1 A;  2BTQ B;  5JH7 A;  4U5Y A;  4GZR B;  2V1D A;  2DQ3 A;  4LX9 A;  1UFH A;  2QKC A;  3P3P A;  4QPJ A;  5CA0 A;  2G9D A;  1P7B A;  4NXN B;  4MTO A;  2HUZ A;  3OW2 U;  2X6A A;  2XAJ A;  4O4H B;  4F6E A;  1YLE A;  4YJ2 A;  4X8A A;  2Q43 A;  4PJ0 Z;  4Z1V A;  2V7Q G;  5JQ4 A;  4X65 O;  4B3M O;  4RUH A;  1XMO O;  3K57 A;  3T1H B;  5LGN A;  3B77 A;  4RQE A;  1M1K W;  4Q38 A;  3TCV A;  4DRX B;  1BHB A;  2Z3O A;  1WB7 A;  3J80 N;  1YQE A;  4DR4 O;  1XNQ B;  5LRK A;  1U97 A;  1S60 A;  4LFB O;  5DWM A;  1N71 A;  3CS5 A;  1N34 B;  1SQX H;  2PVV A;  4KSA A;  3RAM A;  1FFX A;  3MHH C;  3J81 N;  1MNG A;  1T5E A;  1ROP A;  4MTG A;  3B3W A;  5IWA O;  3SJC C;  4DRX A;  3ZMV A;  4X20 B;  4X89 A;  4K8Z A;  2EK8 A;  2Q73 A;  4FLY A;  1HWY A;  3H01 A;  4UB8 Z;  1KUY A;  3B4S A;  2XEJ A;  1VQO V;  4NGR A;  3TXS A;  5IWA B;  4JI7 O;  1AUG A;  1JMK C;  1BQ0 A;  1GO3 F;  3ISZ A;  1THZ A;  1G8M A;  2WPX A;  5IY5 B;  4LF4 O;  3SYQ A;  1FFX B;  1FD9 A;  2BSK B;  2Z0A A;  1G1X B;  2WAM A;  2QKS A;  3I5D A;  5KLV H;  5G20 A;  1SET A;  3FED A;  4JLY A;  2ANP A;  3JAS B;  4GLX A;  2W6J G;  1EM1 A;  4PDV A;  2YEV B;  1VQK V;  5J9P C;  5GON A;  3KG2 A;  1IBL B;  3HKD A;  3QO8 A;  2JRI A;  3UT5 A;  3E35 A;  2NN4 A;  5B1N A;  2HP8 A;  3N2G A;  3HKC B;  5CA1 B;  3F5B A;  1YVW A;  1LAP A;  4EKW A;  4NB5 A;  4FLV A;  5AG6 A;  3RYC A;  4B3T B;  3N27 A;  2V77 A;  1KD1 W;  3B3T A;  4UWJ A;  1I94 O;  4GX1 A;  2X7B A;  2V8G A;  2CE4 A;  2FCK A;  4DV2 B;  2LP7 A;  1KBH A;  3BHX A;  4LQ6 A;  1MG1 A;  2ZED A;  4YY3 O;  4JI4 O;  2Z3M A;  1LAM A;  4IL6 Z;  4K0K O;  4ZI7 B;  3IO1 A;  4H6Z A;  5HXD A;  3N2G B;  4PA9 A;  2GBO A;  3FH4 A;  4ZGY B;  2AFU A;  2GUZ B;  2P6J A;  3CHX A;  1S5H C;  2BL1 A;  1SES A;  1SA0 B;  2QM4 A;  2ZDI A;  3VQW A;  1BS3 A;  3JYC A;  1ZTE A;  1S77 D;  1TKF A;  2CNM A;  1JPX A;  2PJC A;  4H89 A;  4R3L A;  1ARL A;  3FIX A;  3OMA B;  3K0D A;  3ZRX A;  3RO0 A;  4ZBG A;  5EYP A;  2JEU A;  3AK1 A;  1EZV H;  4II9 A;  1YW6 A;  5IT9 N;  3F7V C;  5DWN A;  1LFW A;  2WYR A;  2Q4Z A;  1JFF B;  1SQV H;  1NH2 B;  1TKJ A;  3EVK A;  5EIB D;  2A3Q A;  1SA0 A;  3D7G A;  5L3B A;  2Q68 A;  5B66 Z;  2PGG A;  4A38 A;  1NZ6 A;  3LDC A;  4F9V A;  1X4T A;  4DV4 O;  4OX9 O;  2O53 A;  5LMU B;  2F4V O;  4R57 A;  1NTZ H;  2M6Y A;  1KUX A;  2IH3 C;  3D3S A;  5KX5 A;  4R50 A;  2F5I A;  2F95 B;  2YNC A;  4B5P B;  2OH1 A;  3SYO A;  4DV5 B;  1F2P A;  1IU8 A;  1L0C A;  3QNE A;  1QBZ A;  3H1J H;  2Z3L A;  1G4Y B;  3MGD A;  4X8I A;  5CBH A;  1YTF D;  1Q3E A;  3ABK B;  3K59 A;  2HR3 A;  3CJH B;  4H2K A;  4MT8 A;  4DR3 O;  5F48 A;  4PDR A;  1JCH A;  4TV9 B;  3EY5 A;  3K9U A;  3FBU A;  1SC5 B;  1MZE A;  4CYO A;  2RJZ A;  4X62 B;  2PC1 A;  4YY3 B;  4FLZ A;  3RYI B;  3TE4 A;  4H6U A;  2JBJ A;  4HKF A;  3V7Z A;  1FXV A;  5EBW C;  3QAH A;  4M6G A;  4LF9 B;  3CD6 V;  3S3X A;  5B3S C;  4MFJ A;  1AIL A;  3FEC A;  2JEW A;  1Y67 A;  1WNS A;  4DUZ B;  2Q0O C;  4X1Y B;  3B3C A;  1VQL V;  2YC0 A;  3CJH A;  4AQY B;  3FMC A;  2XTA A;  4O4H A;  3FEE A;  3O65 A;  2UXB O;  5BWA B;  5K8O A;  8CPA A;  3K04 A;  4R7C A;  3EXN A;  3SPC A;  4PDL A;  3OTO B;  4DR4 B;  3VOU A;  3ABL B;  1AP5 A;  3PN1 A;  4NTW A;  3EFF K;  1SER A;  4ORF A;  1TKH A;  2ZXW B;  2QM7 A;  4J42 A;  1I08 A;  1WP8 A;  4NKG B;  1BL8 A;  2IJI A;  2A4N A;  1QCE A;  4UEF A;  3TT2 A;  2VQY A;  5H5N A;  4UIA A;  3C90 A;  4OGQ B;  4ZYQ A;  1IYK A;  1FXK B;  1FXH A;  4MVM A;  1H2G A;  5DN6 G;  5FNV B;  2PRQ A;  5A28 A;  4UFX A;  1IX9 A;  1B87 A;  3PEI A;  1AVM A;  4O4J A;  4FM0 A;  3CCE V;  5JH9 A;  5HFM A;  4LBE C;  4KLW A;  1Q86 W;  4UCV A;  4OPH A;  2OWO A;  4CGP A;  4ONU A;  4P4E A;  5HVG A;  3NXS A;  2Q6A A;  4ONW A;  4WBN A;  5JH7 B;  1GN4 A;  1PM9 A;  1TXR A;  1KC8 W;  5JGF A;  3D7D A;  1FXK A;  3BLN A;  3OMN B;  4MHD A;  4GKK B;  3T1Y O;  3T2M A;  3WR7 A;  4LF6 O;  2IU0 A;  2PJ2 A;  1W0J G;  4JAU A;  4WFG A;  4UEZ A;  3FKS G;  3TOB A;  3K2K A;  4PSW A;  2GU2 A;  4EFE A;  2YXL A;  2JBK A;  3EC4 A;  3CPW U;  1PL0 A;  1VF7 A;  2X7R B;  4AHC A;  4KUB A;  3LSQ A;  5GW7 A;  1XBU A;  1QLN A;  2YEV A;  4IF5 A;  4PI0 A;  1ENV A;  1NTM H;  1HDU A;  2IJH A;  5H9C A;  2EIK B;  1BE3 H;  3E8B A;  4FIP C;  5EK0 A;  1N33 O;  1XIX A;  2L6L A;  2QWO B;  2PJ0 A;  2Q69 A;  1D5N A;  5CBF A;  2XUM A;  1H2L A;  2Q04 A;  1BPM A;  1M4D A;  1Q81 W;  3R65 A;  4R87 A;  4IT5 A;  5C93 A;  3V38 A;  1K92 A;  4DR6 O;  4QIW F;  4I9Q A;  4R9M A;  3JD2 A;  4ABM A;  4O4I B;  4F6R A;  1XL6 A;  1IB1 E;  2EX3 A;  2JDI G;  5CB4 B;  1A2Z A;  1Y74 A;  4YIP A;  4JI0 O;  2HC9 A;  5LXT A;  2KG7 A;  3OD4 A;  4J7K A;  3RT3 C;  3BJ8 A;  2ZE6 A;  3B3V A;  3ASO C;  4AVB A;  4IK2 A;  5ELY A;  2VBQ A;  1Q7L A;  4X5K A;  2CNS A;  4O2A B;  3H1I H;  3ZIA G;  5BZB A;  5C88 A;  4WCE V;  2XEF A;  5F49 A;  1QSR A;  3IC1 A;  4R8C A;  4RN7 A;  4QUS A;  1H2N A;  3OGC C;  4MFK A;  2GTS A;  4OC0 A;  3OE7 G;  4WF9 V;  5JQG B;  2ZW4 A;  1R6K A;  1Z9U A;  1LNQ A;  3FAV A;  2YI8 A;  1I21 A;  4O2A A;  3IWG A;  2Z5U A;  3KHX A;  2BCC H;  4DJL A;  4I55 B;  1Z2G A;  1VQ9 V;  4CH5 A;  1VHS A;  4OME A;  1MMM A;  4JI3 O;  2GTA A;  4EFD A;  3ABU A;  2EO8 A;  2UU9 B;  1XOU A;  4UCT A;  5H84 A;  4K8X A;  1LRZ A;  2OOT A;  2Y0M A;  1XJO A;  1FS0 G;  3SJQ C;  2CTP A;  1BSM A;  4MVO A;  5EBL C;  3KQZ A;  3LMS A;  4GS4 A;  1VIB A;  4B13 A;  2F8H A;  1MJ9 A;  2RMK B;  2Q5Z A;  2EIL B;  3NH5 A;  1LCP A;  4NGT A;  2WPW A;  4MHP A;  4P4F A;  4UEE A;  3WB2 A;  3DSQ A;  1LAN A;  4G2K A;  3ZMS A;  1HR0 O;  4XNH B;  4LQG A;  3K5L A;  2QTO A;  1IIC A;  1Y9K A;  3LWU A;  3JUW A;  2BTO A;  1D2D A;  1IGB A;  2EJ7 A;  3B40 A;  5DM6 V;  3S6K A;  2FIW A;  3K9T A;  4W4K A;  2P7T C;  2GAN A;  5IJ0 B;  2IQ6 A;  4Y49 C;  2EBO A;  3JAR A;  1Y6X A;  1ZLH A;  2RN9 A;  2PCU A;  2IMO A;  3SYC A;  3KGQ A;  3DNS A;  2CXA A;  2ZEG A;  2ZW6 A;  4KVX A;  3ZN1 A;  2G3A A;  1D5A A;  3HPL C;  3STL C;  1DF4 A;  1URF A;  4KOU A;  4KOX A;  3SI2 A;  3C26 A;  3T9Y A;  3OR6 C;  4GKK O;  4CBC A;  5C8Y B;  1TF8 A;  2ZXW C;  1F57 A;  3ABL C;  4QGP A;  3BI1 A;  5K1P A;  3QAY A;  4EVY A;  2F43 G;  1BT8 A;  5EC1 C;  5K8N A;  1SQP H;  4NCZ A;  1AI4 A;  2ZXV A;  3SJA C;  1DF5 A;  2ZKO A;  1H2M A;  3UCS C;  2PY5 A;  5EZY A;  4D7T A;  3CC4 V;  4J3G A;  3LNM B;  4IAV A;  5B3S B;  4QB9 A;  4LH6 A;  4RO2 A;  1Y0Y A;  1SQF A;  2C6P A;  4FVM A;  4DUY B;  2HB6 A;  5F47 A;  1OCZ B;  4LF5 O;  1IVS A;  3SYP A;  4WBN B;  3JAL B;  3LD2 A;  3X2Q C;  3ZRW A;  2KB1 A;  1OHH G;  1WJZ A;  3FB3 A;  4JAA A;  5LYL A;  4ZKI A;  4JTA B;  4JJX A;  3B8M A;  3TC8 A;  1UPG A;  4MS2 A;  4QE9 A;  1AR4 A;  2JJ2 G;  3DLJ A;  2PRB A;  1ZG9 A;  4JYC A;  1U96 A;  3AK2 A;  1YGH A;  1BLL E;  2BUE A;  2Q4V A;  3JCZ A;  1XUQ A;  3A0B Z;  4FWU A;  1QNM A;  2WZN A;  3SGI A;  3M99 B;  4MVZ A;  1BO4 A;  5AGE A;  1K7D A;  3PJS K;  4TQF A;  2VEZ A;  4X64 O;  5GTI Z;  1IZ3 A;  3FB8 C;  3K79 A;  4RAI A;  1V9P A;  4YFJ A;  2UXC B;  4E2A A;  1XF8 A;  4MY0 A;  5K8P A;  3HR0 A;  3AEI A;  3CX5 F;  4OKO A;  3I3G A;  4KZT A;  1AI6 A;  1OCC C;  3OR7 C;  4UVA A;  3TOA A;  1ZWI C;  5J8F A;  1HDQ A;  4DV1 O;  2WLI A;  4E4E A;  1OJH A;  3OUF A;  4ZHQ B;  1GM9 A;  3TGU H;  4CGO A;  2FSR A;  6CPA A;  2E76 B;  2HVJ C;  4HAM A;  1FNO A;  4UCS A;  2ZEE A;  1VP7 A;  4R3K A;  1BMF G;  4O2B B;  3Q4H A;  1Z2L A;  1F7Y A;  5AG5 A;  3OWC A;  1MK4 A;  1EE3 P;  4KFM A;  2LFR A;  2ZIN A;  3DXR B;  4U7N A;  3ZMU A;  1PCA A;  1XHX A;  4F6R B;  3ML0 A;  4RWU A;  3UT5 B;  5THW A;  3B2Y A;  1KB9 F;  4DYL A;  4TQD A;  3HKC A;  3L9D A;  3T4Z A;  1GHE A;  1YME A;  2VL1 A;  5JVD A;  3GKR A;  4NEX A;  2K9P A;  4KLV A;  3WB1 A;  4E0A A;  1IYL A;  1KEC A;  2Y69 C;  1E1R G;  4PK3 A;  4FPP A;  2DE0 X;  1ELL P;  2RFH A;  4KP4 A;  4LFC O;  3TFY A;  1R1B A;  1L1F A;  1RM1 C;  2QWN B;  5E96 A;  2DYR B;  3FB7 C;  1VQM V;  3ZMZ A;  2E5L O;  4O4L A;  2PQ8 A;  3E8F A;  4KHP B;  3I56 V;  1S5K A;  2WWW A;  4LF8 O;  1P49 A;  3BI0 A;  5ISV A;  2B4D A;  4FZ1 A;  3A0H Z;  3DGE A;  1HP8 A;  4P30 A;  4X3R A;  2GUZ A;  5FVJ A;  4F4L A;  3QO5 A;  3D7H A;  4AI8 A;  4DV4 B;  3ZZI A;  1KKC A;  2L35 A;  4J11 A;  2OT5 A;  2B5G A;  4LH7 A;  5GON B;  4DR1 B;  2DWE C;  3R96 A;  1F2O A;  4MW8 A;  1OCC B;  4JI5 O;  1K73 W;  4O4I A;  2N05 A;  4P9P A;  4DK0 A;  5H2F Z;  3PFE A;  3W91 A;  2OTJ V;  4L8A A;  3ICX A;  1HR0 B;  1GKF A;  1BAV A;  5J2U B;  5G21 A;  4DR1 O;  2PE3 A;  2QR4 A;  4NR1 A;  3IAY A;  4BAY A;  3T8W A;  4C7H A;  5E79 Z;  3LSU A;  4P44 A;  2JIZ G;  3ZHQ A;  2PYJ A;  3W7U A;  4LCU C;  4HBN A;  1L0L H;  1YJW V;  2ZIO A;  2R8V A;  4UVC A;  5ITZ A;  1XHZ A;  3F0A A;  2IJK A;  4JI3 B;  5KMG A;  2UUA O;  1CXZ B;  2YIA A;  4PPZ A;  4MI4 A;  5JQG A;  5D8N A;  4ZY0 A;  1SQG A;  3AG3 B;  2DYR C;  4PDM A;  3W6X A;  1PP9 H;  1MAB G;  4ZOL A;  4TWE A;  3KZI Z;  5HVH A;  3RYH B;  3LAC A;  4QNH B;  1VQ5 V;  1YTF B;  3ZRS A;  1F23 A;  4H44 B;  2DPS A;  3FYE B;  4MBU A;  1Q2C A;  3L75 H;  1OCR B;  1PNL A;  4GUN A;  2EIN C;  4LR3 A;  2ZEN A;  3D7F A;  2BOB C;  2Y0P A;  3D68 A;  1COW G;  4CRY B;  3JD1 A;  3FX6 A;  4MY3 A;  5KTA A;  1CG2 A;  1WN7 A;  1QHT A;  3KL9 A;  1OV9 A;  4DR6 B;  2YXH A;  3ABM C;  1CEZ A;  2IJZ A;  2PIZ A;  3A2F A;  4UCP A;  2AW9 A;  3CRM A;  4X9Q A;  3I1U A;  1S7F A;  4PSX A;  3APQ A;  1B3Q A;  4B11 A;  1VF5 B;  3FRM A;  5LBQ A;  4H0L B;  4P2Z A;  5IDJ A;  2OU2 A;  2EZP A;  3IWE A;  4ZY1 A;  3S9N A;  3RBU A;  3D3I A;  4GKJ O;  3ZHR A;  1YSJ A;  3CDX A;  2Q7S A;  3D66 A;  1Q5O A;  2VZZ A;  4MVR A;  2GLF A;  3JAL A;  4M6H A;  3AG1 B;  2BTQ A;  5EIB C;  1KUQ A;  1ZAU A;  3B35 A;  2ZW5 A;  3NH8 A;  3PB9 X;  4WWV A;  2ATK C;  4D6T H;  4MRI A;  4E8O A;  3CP1 A;  3JTK A;  2A7W A;  2Y48 A;  2NMT A;  4Q36 A;  4X88 A;  4D7S A;  3T1Y B;  2HKO A;  4BIZ A;  5C82 A;  5LYF A;  3HKB B;  4DV3 B;  3LSS A;  3JD4 A;  3GY9 A;  3E2E A;  3LUT B;  1QVF U;  4NFR A;  5LMN B;  5CBM A;  1YJN V;  1Y9W A;  4KOY A;  4LF7 O;  3H8G A;  5C8Y A;  4FD4 A;  2QWQ B;  4AVC A;  4CGM A;  4DV3 O;  3KCX A;  3RBZ A;  2UUA B;  2PIY A;  3SXN A;  1RTQ A;  5LA6 B;  3CCL V;  2KQX A;  3EO4 A;  2C6C A;  2G0B A;  2ILM A;  3G4S V;  3ZHU A;  1Z5V A;  2P06 A;  1SZT A;  4LFC B;  3QB8 A;  5CNP A;  2Q8V A;  2DXQ A;  4DV7 O;  1JA8 A;  4A2Z A;  3IFE A;  1S0V A;  4YRH A;  3U10 A;  3SPI A;  2AFM A;  4A5U B;  4NSQ A;  3OUS A;  2F1M A;  3CMA V;  4DUY O;  3E8H A;  3OAA G;  1LUV A;  4CS3 A;  3LOD A;  2YUA A;  4FM1 A;  4CS2 A;  4ZX8 A;  4EME A;  5F2V O;  4YJ2 B;  4JGS A;  3H5Z A;  1N32 B;  4MMO A;  2F93 B;  2JJ1 G;  1V54 C;  4M85 A;  3BPZ A;  4JAV A;  2YNC C;  1XOV A;  1NE9 A;  4RI1 A;  5JPH A;  4U3F H;  1H2S B;  4TOI A;  4J10 A;  2R98 A;  2H5M A;  3BJ7 A;  1EN5 A;  5EMI A;  4BW9 A;  1IXM A;  4WFA V;  4F0X A;  1LUW A;  5LYJ B;  1CBX A;  3E22 B;  1VMG A;  4IHJ A;  1YIJ V;  4B3T O;  2ZE5 A;  1SQB H;  1CP9 A;  1HNZ B;  5A2Q N;  1N36 O;  4PHZ A;  2UUB B;  4JI0 B;  5BR8 O;  2FS5 A;  3N2K A;  5B1B B;  4ZHQ A;  2UUC O;  1F4M A;  2KG7 B;  5BY1 A;  4TWK A;  4C7I A;  2PJ1 A;  1IXB A;  3ETQ A;  2ODF A;  3VAR A;  3TET A;  3IGA C;  1XMO B;  4AG9 A;  3P2H A;  1ZUQ A;  4LF7 B;  4UVB A;  2Q7H A;  2YID A;  3E0K A;  2DMX A;  2QYV A;  1HNW B;  3Q4H B;  1B04 A;  1KP3 A;  2HJF C;  3OGI B;  3NE7 A;  4A94 A;  3MN8 A;  3HKE A;  4MFQ A;  3BA9 A;  4WFH A;  2P6E A;  1KU9 A;  5B1A B;  4MVU A;  1PD3 A;  2QM8 A;  2CTB A;  2Z0Z A;  5J2U A;  3WG7 B;  2JGU A;  2ZOG A;  3G80 A;  2CTW A;  4DR3 B;  5LOV B;  4CPA A;  2AFZ A;  4YJ3 B;  2VZY A;  4UF4 A;  3EFA A;  1NBM G;  4XPK A;  1JVM A;  3UM7 A;  2HVK C;  3DC6 A;  3SDL A;  1VQ6 V;  2JGD A;  4I55 A;  1NVP D;  4DR5 B;  3P3N A;  2UXD O;  4FD5 A;  5IJ9 A;  5ITZ B;  3WC5 A;  4NXY A;  2K1E A;  3D4U A;  2FYU H;  5KMG B;  5K8M A;  2B4D B;  4UXN A;  3RYO A;  5LXT B;  3IIB A;  4EWT A;  1N32 O;  5LOV A;  2DN9 A;  4B3R B;  2UXB B;  2WLL A;  2YND A;  3X2Q B;  2ZEM A;  4NGM A;  3L74 H;  3S6G A;  3WT4 A;  2QWP B;  1VAR A;  5LRG A;  4CC6 A;  4CYN A;  3CRQ A;  1R6N A;  1S5J A;  2WLJ A;  2GIV A;  4KSF A;  4KS9 A;  3VQV A;  3TK1 A;  3CWB H;  3SYA A;  4ZI7 A;  4UCR A;  3NFZ A;  1GK9 A;  1TAE A;  2OB0 A;  2LQT A;  2EWB A;  1K4C C;  4LWS B;  3GB0 A;  2C1C A;  1YVO A;  2QTS A;  4HNY B;  2PI5 A;  5E1A C;  3E86 A;  2ZR2 A;  4HNA A;  3W7W A;  2IBZ H;  4KXR A;  2CIJ A;  1GYT A;  1GRJ A;  2XAG A;  2HG5 C;  3OFN G;  4X66 B;  3C3S A;  2OIE A;  3MAQ A;  4DUZ O;  1PUA A;  4CAV A;  2J8R A;  3BRC A;  1VQ7 V;  1M90 W;  1N34 O;  2YGW A;  1KYO F;  1FFT B;  1RP3 B;  3CCV V;  2PR8 A;  1SRY A;  4MVS A;  1NTK H;  1I0H A;  5L3E A;  1N4C A;  1JFF A;  4BW5 A;  1CP7 A;  2VQE B;  4GX0 A;  5FPR A;  2W6I G;  4F8Z A;  2EUL A;  2FB5 A;  2KSD A;  1N33 B;  3LDE A;  2CTC A;  1V55 C;  1NKD A;  1S5L Z;  1ZG8 A;  3ZBH A;  5LP6 C;  2REF A;  4OIW A;  5LP6 A;  2R9R B;  5JJJ B;  1QVG U;  4MVQ A;  4CZZ A;  4R76 A;  3FXT A;  2B3U A;  4LFB B;  2ZIM A;  1P4N A;  2OIG A;  1LOK A;  4JZ2 A;  1GMG A;  3AG2 C;  1QSN A;  2OZU A;  3I55 V;  4DV7 B;  3A8T A;  4B5P A;  2VS0 A;  4LF4 B;  4Q6G A;  2Q7B A;  3SJG A;  3F5T A;  4YIO A;  2OTL V;  1JQ0 A;  1J4J A;  3JAW A;  3H9V A;  2JS3 A;  3OM3 B;  4A33 A;  4FLW A;  5FNV A;  4W4L A;  2VRZ A;  3FB5 C;  5LP6 B;  4FLT A;  2POK A;  3TX8 A;  4MTX A;  1V55 B;  2PJ5 A;  2XAS A;  1Y7E A;  1N36 B;  1SF9 A;  2R72 A;  2RQ6 A;  5J2T A;  2ADP A;  1QSM A;  3RWR D;  3E83 A;  3CCR V;  3RZA A;  2DWD C;  1ZLI A;  2DF5 A;  4JYB A;  3TO9 A;  2CGN A;  3VQY A;  4JYY A;  4I0X A;  1JOY A;  1NR7 A;  3PBE A;  3HLP A;  3SJE A;  2J9A A;  2ZM6 O;  1N0J A;  4B6Z A;  2B9Z A;  2EIJ B;  1IBM O;  5EZY B;  1VQ4 V;  2C6G A;  2QE7 G;  4DUK A;  1SZX A;  1TGO A;  3L70 H;  5L3C A;  3UO2 A;  3SPG A;  2CTQ A;  3IJ4 A;  2JEX A;  2P4K A;  4JYA B;  2NLJ C;  1RPO A;  4UCO A;  4X20 A;  2A06 H;  3CXC U;  3ZMT A;  4XPD B;  1ZO0 A;  4O2B A;  5FL7 G;  3S6H A;  4LF9 O;  1ZL8 A;  1NR1 A;  4YHH B;  4MHZ A;  4OC2 A;  1I1D A;  4CAX A;  4PXE A;  1OCO C;  4UFV A;  4JI8 B;  2W0F C;  1GAX A;  4QPK A;  2XAQ A;  4K3N A;  2PJB A;  2QVP A;  5IV0 A;  4AQY O;  1J5E B;  1WLE A;  3B2E E;  4P6Y A;  4OC4 A;  3N2K B;  1XMB A;  4XDK A;  3L72 H;  3MD0 A;  2PJ4 A;  2Z3N A;  3CXS A;  5JVD B;  4RUF A;  3B3S A;  4GX2 A;  1R73 A;  2Z11 A;  3CCS V;  2PJ9 A;  4KSI A;  1Z4E A;  2O28 A;  3ASN B;  3P32 A;  3KI9 A;  4B3R O;  1ZL8 B;  5L3G A;  3ABK C;  3K5N A;  4OAE A;  2CDY A;  1WA8 B;  5KA6 A;  2OCC C;  4F6A A;  1XQ8 A;  5CB4 A;  3ETD A;  5JCO A;  3B8G A;  1Y66 A;  2KKW A;  4CAE A;  3TJT A;  1TUB B;  1YF2 A;  2ZQM A;  1JWQ A;  3THO A;  1Z8X A;  3CRA A;  4F9U A;  4UV8 A;  1WPX A;  2ADQ B;  2BOA A;  4CYQ A;  1CPY A;  2K5T A;  4OAD A;  4PA4 A;  3IC9 A;  2P90 A;  4R6Z A;  4JYW A;  1K33 A;  4WFB V;  4UIB A;  1HNW O;  5JJN B;  1NS1 A;  3L71 H;  1Z8W A;  1PL4 A;  3CCQ V;  3S9M A;  4JXQ A;  5IYC O;  3A9L A;  3V8I A;  2XOK G;  1WA8 A;  2DJV A;  1K9M W;  4OX9 B;  5L3D A;  1IOI A;  3PZJ A;  2H94 A;  1H2K A;  2UXN A;  2YIB A;  3FB6 C;  1NQT A;  4LUA A;  2GE3 A;  1M56 C;  1QST A;  4LF6 B;  5CBG A;  2LGQ A;  2AFS A;  3E8G A;  3K5M A;  4ZY2 A;  1XMQ B;  4NXN O;  2VWJ A;  1QR9 A;  2AFX A;  2R9A A;  1MSD A;  3GVM A;  2DEA A;  3G67 A;  1XFO A;  3R95 A;  4PQA A;  4Z2W A;  4OXS A;  1QQ9 A;  3ASO B;  2HFE C;  4B14 A;  1L0N H;  4PA6 A;  3FNC A;  1JJO A;  4P4J A;  3ZHV A;  4X1I A;  2JDC A;  4CAW A;  3JAM N;  5A27 A;  1QSO A;  1FXK C;  3KR5 A;  3PGP A;  1J5E O;  4MW3 A;  4UFZ A;  1M1D A;  3VAT A;  4QC6 A;  5LYI A;  4FMT A;  1US6 A;  3E89 A;  4GX5 A;  3FX7 A;  2HHH O;  1Q6H A;  1WB8 A;  3ZHS A;  4UB6 Z;  4DW1 A;  2PJ6 A;  4DR7 O;  5IJ9 B;  5JWP A;  4TNU A;  1M56 B;  3KKY A;  2ZOF A;  2YNE A;  4KOW A;  2B5U A;  3CCM V;  2HLD G;  5H6R A;  3W7X A;  2QJ1 A;  4EEQ A;  4HNX B;  3S9L A;  1TA8 A;  3GB7 C;  1KQS U;  3D2M A;  3FAV B;  1S3J A;  5B1O A;  5F09 A;  2PUS A;  3H8F A;  4BIN A;  4JAS A;  2UUB O;  2XHB A;  2MK3 A;  1AJQ A;  4WFF A;  4QJF B;  2OYQ A;  1VHE A;  3BY6 A;  4XNH C;  2OZH A;  2ZCE A;  4J9Z B;  1EBO A;  2ITC C;  4PV6 A;  1M5I A;  2NSM A;  4PV1 B;  2CTR A;  2CF4 A;  2ABZ A;  3GWK C;  2EIL C;  3K9S A;  3VWE A;  1HEE A;  1K97 A;  5IYZ B;  4P10 A;  4X1Y A;  3BHP A;  1ARO P;  3RYF B;  4B7K A;  2CH7 A;  1YR0 A;  5H86 A;  1R43 A;  3DR8 A;  1M4G A;  1YI2 V;  4LFA B;  5LMN O;  3CEI A;  1FY7 A;  3VH9 A;  1Q2Y A;  3DGV A;  1BHA A;  3DDD A;  4IUS A;  2B58 A;  3G8W A;  2DYS C;  2HQY A;  1AI7 A;  2EJR A;  1F4N A;  3JSL A;  3U0Z A;  1I12 A;  3BFR A;  4LFA O;  4YWY A;  3JAR B;  2P6F A;  5LA6 A;  2O4H A;  3CZX A;  4R6T A;  1GN6 A;  1X12 A;  2ITD C;  3KCY A;  4I0X B;  2RCV A;  3AG4 C;  4JYA O;  5HMN A;  2D4P A;  5IB0 A;  1P0H A;  1QLE B;  4DR5 O;  2UXD B;  4DR2 B;  4FD7 A;  1PPJ H;  5DEC A;  2ZEH A;  4JXR A;  2UXC O;  1BGY H;  4UCU A;  5KTD A;  2FML A;  2IU3 A;  3RYI A;  2PJ8 A;  2JS5 A;  4TUY A;  2ZEP A;  5KAF Z;  4BIU A;  4YU9 A;  1R3N A;  4UA3 A;  3BCC H;  2E5L B;  3UY5 A;  2XEI A;  4NYK A;  3JAW B;  2CNT A;  3AG4 B;  2AHY A;  1RO5 A;  4JZ0 A;  5BR8 B;  1YX0 A;  4LC1 A;  5GCN A;  3H1K H;  1AYE A;  3F8K A;  4J9Y B;  4BR6 A;  1CP6 A;  3IC7 A;  2N04 A;  4L8J A;  1Q6I A;  2J8N A;  1AP6 A;  4AVA A;  1TVK A;  4FZ0 A;  3R9G A;  1Z5R A;  1WWZ A;  4JTD B;  3RN4 A;  2Q7E A;  4CYP A;  1PV0 A;  1NU1 H;  3E22 A;  3JAK A;  2PJ3 A;  3BAB A;  4J80 A;  3ZHT A;  4PXC A;  3DR6 A;  1O9H A;  5IX3 A;  3CXH F;  4L87 A;  4JI8 O;  4KOT A;  3BA8 A;  3H1L H;  4XBF A;  3AG2 B;  3GIU A;  3D67 A;  1BOB A;  1S76 D;  1FYJ A;  3I9S A;  1OZ0 A;  1K4J A;  2QA4 V;  4DV0 B;  1TVK B;  2EIK C;  4OP4 A;  1DLB A;  1OBR A;  2XND G;  1QR8 A;  4C2Z A;  2Q4P A;  1IDS A;  3WG7 C;  4B3M B;  3IGR A;  4KOS A;  3JSN A;  1AI5 A;  2M7W A;  1XRE A;  2WLM A;  4YHH O;  1XMQ O;  1FJG O;  4GCZ A;  4GXH A;  5FLX N;  3HKE B;  1R57 A;  2I3C A;  2Q4Y A;  3ZJ0 A;  1NMT A;  3M7M X;  3PB8 X;  5BXZ A;  5CA1 A;  2XT9 A;  1AR1 B;  4UWI A;  2C2A A;  2FTK A;  2WSS G;  3NH4 A;  2GLJ A;  4PK2 A;  3KR4 A;  4MFP A;  1ZX3 A;  3ZS8 C;  4CS4 A;  3EHB B;  1CPX A;  4UUJ C;  2R9I A;  4JI7 B;  2DW4 A;  4FBE A;  4H13 B;  1YRE A;  2B4B A;  5B1B C;  4I50 A;  1HNX O;  4FFK A;  4X64 B;  2BCO A;  3FFQ A;  2LO1 A;  4MTF A;  3FYN A;  2Y0I A;  4R7M A;  4AB7 A;  2F7V A;  3PB7 X;  1WK4 A;  1PKX A;  1JJ2 U;  2QGN A;  2GSM B;  2Y69 B;  4ZBM A;  3TXQ A;  3ZED A;  1PNM A;  3K03 A;  3FYI B; 
#chains in the Genus database with same CATH homology
 2CY2 A;  5HH1 A;  2VZY A;  4AVB A;  3EFA A;  2VBQ A;  4XPK A;  2AJ6 A;  4X5K A;  2CNS A;  4UBR A;  2I00 A;  2EUI A;  2BEI A;  4FD5 A;  3TTH A;  5C88 A;  4NXY A;  5F49 A;  1QSR A;  2JEV A;  4OLL A;  1YK3 A;  2RC4 A;  4QUS A;  4A31 A;  4A30 A;  4B12 A;  2DPT A;  4MFK A;  3JVN A;  2B4D B;  3RYO A;  2ZW4 A;  4C2X A;  1Z9U A;  2YND A;  4L89 A;  3S6F A;  1I21 A;  3S6G A;  3SXO A;  4DNC A;  3IWG A;  1S7K A;  2B3V A;  4CYN A;  2B5G B;  2Z10 A;  4KSF A;  1VHS A;  2GIV A;  4KS9 A;  3DSB A;  1V0C A;  3T90 A;  2FL4 A;  4KOR A;  5H84 A;  2OB0 A;  3IU2 A;  1LRZ A;  2Y0M A;  4M3S A;  4NF1 A;  1YVO A;  4HNY B;  1KUV A;  2ZW7 A;  4GS4 A;  3VWD A;  1Y7R A;  4B13 A;  1MJ9 A;  1YVK A;  1SQH A;  2WPW A;  1CM0 A;  3R1K A;  2FT0 A;  2R7H A;  1XE4 A;  1PUA A;  1Q2D A;  2VI7 A;  4XNH B;  2J8R A;  3TO7 A;  4CAV A;  1IIC A;  1Y9K A;  3JUW A;  2REE A;  2YGW A;  3S6K A;  4A32 A;  2FIW A;  2PR8 A;  5KTC A;  2GAN A;  4Y49 C;  3R9E A;  1VKC A;  2ATR A;  3DNS A;  2CXA A;  2ZW6 A;  1IID A;  2PSW A;  4KVX A;  2PDO A;  3BJ8 A;  2PR1 A;  3CXP A;  2REF A;  2G3A A;  2J8M A;  4KOU A;  3FXT A;  2B3U A;  1P4N A;  4KOX A;  3C26 A;  3T9Y A;  2OZU A;  1QSN A;  5AG7 A;  1S3Z A;  4B5P A;  2Q7B A;  2D4O A;  4KVO E;  1J4J A;  4EVY A;  2R1I A;  1TIQ A;  4A95 A;  4A33 A;  4NCZ A;  3P2F A;  2G3T A;  2ZXV A;  4QVT A;  2FIA A;  4J3G A;  4QB9 A;  4KUA A;  1QSM A;  1KZF A;  5F47 A;  3LD2 A;  2ARH A;  4U5Y A;  3TO9 A;  4LX9 A;  1UFH A;  3FB3 A;  4JJX A;  3N7Z A;  1NSL A;  2HUZ A;  1YLE A;  2PRB A;  2JLM A;  5JQ4 A;  1YGH A;  2BUE A;  2Q4V A;  2Z3P A;  4CAF A;  1BO4 A;  5AGE A;  4Q38 A;  3TCV A;  3D8P A;  2VEZ A;  2ZPA A;  2Z3O A;  1ZO0 A;  4U9Z A;  4MFL A;  4XPD B;  4YFJ A;  3S6H A;  5J8C A;  4E2A A;  1XF8 A;  4MY0 A;  1I1D A;  1PU9 A;  4CAX A;  4UFV A;  2HV2 A;  3I3G A;  4KZT A;  1S60 A;  4AG7 A;  5DWM A;  5IV0 A;  1N71 A;  4HNW B;  3TOA A;  1S7N A;  5J8F A;  4KSA A;  3CXS A;  2Z3N A;  4U9Y A;  4CGO A;  2FSR A;  2Z11 A;  1Z4E A;  2O28 A;  4R3K A;  5AG5 A;  3OWC A;  1MK4 A;  1KUY A;  2Q44 A;  4OAE A;  2QML A;  4B5O A;  4F6A A;  4CGL A;  3B8G A;  2WPX A;  4CAE A;  4RS2 A;  1GHE A;  4QBJ A;  4NEX A;  3GKR A;  4JD6 A;  4KLV A;  4K30 A;  2IL4 A;  4E0A A;  5G20 A;  1IYL A;  4CYQ A;  2K5T A;  4JLY A;  4OAD A;  4XPD C;  4PK3 A;  3TFY A;  5E96 A;  2VXK A;  4YGO A;  4JXQ A;  3A9L A;  3V8I A;  3IU1 A;  2PQ8 A;  4UFW A;  3G3S A;  1S5K A;  3F5B A;  3PZJ A;  5ISV A;  2B4D A;  4LUA A;  2GE3 A;  5AG6 A;  1QST A;  4UWJ A;  5FVJ A;  2X7B A;  2FCK A;  2P0W A;  3ZZI A;  2B5G A;  3R95 A;  4MJ8 A;  3R96 A;  4CGN A;  2Z3M A;  2WSA A;  4B14 A;  2KCW A;  3FNC A;  3W91 A;  4L8A A;  4H6Z A;  2JDC A;  4CAW A;  5A27 A;  1QSO A;  1XEB A;  5G21 A;  4ZGY B;  3PGP A;  4C7H A;  1M1D A;  4F0Y A;  4QC6 A;  2BL1 A;  4XPL A;  2R8V A;  2CNM A;  2QEC A;  2Z3K A;  3F0A A;  4H89 A;  4R3L A;  3FIX A;  2YNE A;  4KOW A;  4ZBG A;  4B10 A;  4II9 A;  5DWN A;  4MI4 A;  4HNX B;  2EVN A;  3W6X A;  3D2M A;  4I49 A;  4BMH A;  4R57 A;  1KUX A;  2DPS A;  4MBU A;  1Q2C A;  3D3S A;  4UCM A;  4XNH C;  2F5I A;  2OZH A;  2YNC A;  4B5P B;  2OH1 A;  4PV6 A;  1L0C A;  4CRY B;  2Z3L A;  1MJB A;  3MGD A;  4MY3 A;  5KTA A;  3VWE A;  5F48 A;  4KVM E;  1YR0 A;  5H86 A;  3EY5 A;  3DR8 A;  1M4G A;  3K9U A;  3FBU A;  4UCP A;  1S7F A;  4PSX A;  4B11 A;  1FY7 A;  1Q2Y A;  4CYO A;  3FRM A;  2OU2 A;  2PC1 A;  3DDD A;  3IWE A;  4IUS A;  2B58 A;  4BBH A;  3G8W A;  2C27 A;  4H6U A;  3TE4 A;  2HQY A;  2VZZ A;  4HKF A;  3QAH A;  5EC4 A;  1I12 A;  3PP9 A;  4MFJ A;  4Y49 B;  2P6F A;  2ZW5 A;  1OZP A;  1RXT A;  2JDD A;  3CXQ A;  4E8O A;  5HMN A;  2D4P A;  3JTK A;  5IB0 A;  1P0H A;  1ON0 A;  2NMT A;  4Q36 A;  5C82 A;  5BWA B;  4KOV A;  3GY9 A;  4FD7 A;  3EXN A;  4CRZ B;  4JXR A;  5KTD A;  3TO6 A;  4JWP A;  1Y9W A;  4KOY A;  4ORF A;  4FD4 A;  4AVC A;  4CGM A;  2A4N A;  3GYA A;  3SXN A;  3TT2 A;  2VQY A;  4UA3 A;  3UY5 A;  3EO4 A;  2G0B A;  1IYK A;  1U6M A;  2CNT A;  1RO5 A;  5A28 A;  4UFX A;  1B87 A;  1YX0 A;  5GCN A;  3QB8 A;  5CNP A;  3W6S A;  3F8K A;  3H4Q A;  2DXQ A;  4CS0 B;  4A2Z A;  4KLW A;  4YRH A;  2J8N A;  2OZG A;  4AVA A;  1XMT A;  1B6B A;  2AE6 A;  4CGP A;  4NSQ A;  4ONU A;  3R9G A;  1WWZ A;  2P6G A;  5EBV A;  3D2P A;  1Z4R A;  4CYP A;  3LOD A;  3BLN A;  3DR6 A;  2I79 A;  2FE7 A;  1M44 A;  4MHD A;  5IX3 A;  3KKW A;  4KOT A;  3H5Z A;  3WR7 A;  1BOB A;  3I9S A;  5I0C A;  5G1Z A;  4M85 A;  1K4J A;  1MJA A;  3TOB A;  2Q0Y A;  2YNC C;  4PSW A;  1NE9 A;  4RI1 A;  5JPH A;  3EC4 A;  5AG4 A;  3BJ7 A;  2R98 A;  2H5M A;  4UCN A;  3R9F A;  4KUB A;  4C2Z A;  4F0X A;  3IGR A;  4KOS A;  5G22 A;  4IF5 A;  5F46 A;  4MFZ A;  1S7L A;  1R57 A;  2Q4Y A;  3ZJ0 A;  1NMT A;  4C68 A;  2WUU A;  2FS5 A;  1XIX A;  4UWI A;  2Q04 A;  1M4D A;  1M4I A;  4C7I A;  4PK2 A;  4C2Y A;  4MFP A;  4R87 A;  2FXF A;  3P2H A;  4AG9 A;  3E0K A;  3SHP A;  1YRE A;  2B4B A;  3NE7 A;  2BSW A;  4R9M A;  4MFQ A;  3FYN A;  1IB1 E;  2P6E A;  1CJW A;  4AB7 A;  2QIR A;  1WK4 A;  2Z0Z A;  4FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...