2ARHA

Crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
198
structure length
198
Chain Sequence
DAMVKYEELLKTLENGINSEEGEIRLVRKSQGRFKEEFNFDLSLGSKPLLTLKVFLGRKPYWQPWVEVFGVNPNLRNVFFGSEAERKLYEFLSEHFGRIFVEYFEDKETTYELQKGVPPALSRLGFELLKLGYTYFRDWFIPEGLMEGGHKIQAEKPKTEEAKKRHLENLKKEFEEFIGKCEDEGLIKKVKERYNFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Hypothetical Protein Aq_1966 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein aq_1966
total genus 64
structure length 198
sequence length 198
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06557 DUF1122 Protein of unknown function (DUF1122)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.870 Mainly Alpha Orthogonal Bundle Helix Hairpins Acyl-CoA N-acyltransferases (Nat) 2arhA02
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2arhA01
3VWDA 4RS2A 1Z4EA 3D3SA 2B4DB 3H4QA 4QBJA 1B6BA 2WPWA 2REEA 1OZPA 3TT2A 3P2FA 4H6UA 3R1KA 4EVYA 2OB0A 3JUWA 2B5GB 5C82A 3CXSA 4RI1A 1S7LA 1QSOA 3TTHA 5JQ4A 5GCNA 4E2AA 4YRHA 3GKRA 3T9YA 1QSMA 4F0YA 2I79A 1BOBA 5CNPA 3P2HA 3R95A 2B5GA 1U6MA 2AE6A 2ZW6A 1XMTA 4PK2A 3FBUA 3WR7A 2QMLA 4UA3A 3FXTA 1BO4A 4JXQA 4M3SA 1YGHA 2JDCA 3C26A 2ZPAA 1P4NA 1VKCA 3FNCA 4KOUA 4XPLA 1QSTA 2J8MA 3F0AA 2CY2A 4UWIA 1I21A 2Y0MA 3S6FA 2C27A 2JDDA 1P0HA 2J8RA 3ZZIA 2D4OA 2O28A 2R7HA 2GANA 1L0CA 4R87A 1J4JA 2AJ6A 2ATRA 4MI4A 1IIDA 4QUSA 1XEBA 2ZW5A 3EFAA 2PR1A 1Q2DA 4XNHB 3UY5A 4R3KA 4HNYB 1Y9KA 4JLYA 4KUAA 1WK4A 4JD6A 1M1DA 2FT0A 1PU9A 4FD7A 1YK3A 2JLMA 2FSRA 1Q2YA 3LD2A 2PDOA 3BJ7A 4KLVA 4IF5A 3VWEA 4FD5A 4KOSA 4K30A 4QC6A 3G3SA 2BUEA 1TIQA 2PQ8A 5F48A 4HNWB 4DNCA 4F6AA 2VZYA 4KLWA 4FD6A 1KUVA 5KTDA 2EVNA 2Z11A 3W6XA 3I3GA 2PSWA 2QECA 3PP9A 4AVAA 1XIXA 3TE4A 1IB1E 5I0CA 1S5KA 3D2PA 4B5OA 2R98A 4NSQA 1I12A 1S3ZA 5EC4A 3SXNA 2CNMA 1YREA 4MJ8A 1XF8A 3FIXA 4MY3A 3G8WA 4KOYA 4KZTA 2VEZA 1MJAA 4MHDA 2BL1A 1M4GA 1ON0A 1MK4A 4KOTA 4HNXB 3W6SA 4YGOA 2NMTA 3MGDA 3DDDA 3TO6A 4XPDC 2H5MA 5ISVA 1S7NA 4R9MA 1M4IA 2ARHA 3N7ZA 4U5YA 2VZZA 4KVME 2VQYA 4B5PA 5HMNA 4CAXA 3S6KA 4E0AA 2Q4YA 1UFHA 3DSBA 1NSLA 2Q0YA 3QB8A 2BSWA 4AB7A 3SXOA 2I00A 5E96A 3GYAA 1YR0A 1RO5A 3CXPA 2P0WA 2X7BA 1YVOA 4UBRA 3GY9A 1RXTA 2Z10A 3NE7A 4KORA 4U9YA 5F47A 2EUIA 4XPKA 5F49A 3R9GA 2QIRA 3DR6A 4PV6A 3RYOA 3DR8A 3W91A 4H89A 4LUAA 4ORFA 2BEIA 4KUBA 4NCZA 3EXNA 4BMHA 2HV2A 1MJ9A 3TO9A 3LODA 4XNHC 3EY5A 2PC1A 1M4DA 2ZXVA 2DXQA 2HQYA 3KKWA 3S6GA 3IGRA 1NE9A 4QB9A 3PGPA 1R57A 4M85A 3F8KA 4PSWA 2PR8A 2IL4A 2FXFA 2P6GA 4QVTA 4LX9A 2P6EA 4MBUA 3E0KA 2OZHA 2Q44A 5IV0A 4H6ZA 1I1DA 1SQHA 4L8AA 4JXRA 4B5PB 2GIVA 4UWJA 2G3TA 1FY7A 1Y9WA 1V0CA 1CM0A 2F5IA 2B4DA 4Y49B 2K5TA 1IYLA 2CNTA 4ONUA 4L89A 5J8CA 4E8OA 3TO7A 2OZUA 1YVKA 1M44A 3R9FA 3FB3A 2G0BA 2D4PA 2FE7A 4GS4A 4OAEA 4PSXA 4NEXA 3JVNA 1VHSA 2FIAA 4CAWA 4U9ZA 4AVCA 4KOVA 1KZFA 4J3GA 4PK3A 3V8IA 1S7FA 1Z9UA 5FVJA 4ZBGA 3D8PA 5JPHA 1Y7RA 1IICA 4KOWA 4CRZB 4MY0A 1LRZA 4R57A 5F46A 2JEVA 1CJWA 2OZGA 3F5BA 3TCVA 2VXKA 5H86A 3EC4A 2PRBA 1IYKA 2B4BA 5IX3A 1YX0A 2A4NA 4JWPA 1WWZA 2R8VA 3OWCA 4JJXA 1KUYA 1QSNA 3TOAA 4OADA 5EBVA 4CRYB 5KTAA 3R9EA 1K4JA 1NMTA 4OLLA 3DNSA 4AVBA 2FIWA 3TFYA 2OH1A 1YLEA 3BLNA 1N71A 2VBQA 4CS0B 1GHEA 2RC4A 4AG9A 3BJ8A 2Z0ZA 2HUZA 2OU2A 3QAHA 4X5KA 2R1IA 5HH1A 3K9UA 2CNSA 3I9SA 3FYNA 4CAVA 2GE3A 4NXYA 4YFJA 2G3AA 2Q04A 4IUSA 3PZJA 3R96A 3T90A 1Z4RA 3TOBA 2WPXA 5IB0A 2Q7BA 1Q2CA 4KOXA 4I49A 3D2MA 4II9A 3ZJ0A 2ZW4A 1KUXA 3CXQA 5KTCA 4HKFA 3SHPA 4XPDB 1PUAA 2VI7A 5J8FA 2B58A 4Y49C 2ZW7A 2J8NA 1MJBA 2KCWA 3IWGA 1QSRA 2Q4VA 2FCKA 3S6HA 2FS5A 1S60A 2B3UA 2REFA 4KVOE 2P6FA 4KVXA 4NF1A 4AG7A 1XE4A 2B3VA 2FL4A 3FRMA 1B87A 1S7KA 5DWMA 4R3LA 4FD4A 3EO4A 5C88A 5H84A 5DWNA 3B8GA
chains in the Genus database with same CATH superfamily
4HNAA 4XBFA 4MFZA 3N2KB 4FBEA 4CGNA 4OC0A 4UXNA 5C8YB 3D3SA 3ABTA 2Q69A 4X1KA 3TT2A 1Q90D 3P2FA 1K4DC 2P06A 2OYQA 3L70H 2POKA 2EULA 4H6UA 3OM3B 1KUQA 2PZSA 1YW6A 1CBXA 2WA4A 4C7IA 2ZEMA 3JUWA 1H2MA 3CMEV 2ZNIA 4GZRB 3LSQA 3FFQA 4MFLA 4LNUA 4EFEA 3CXSA 1AJQA 4TT3G 1U96A 2ITDC 5GCNA 4E2AA 1Q6HA 4PA4A 4F4LA 3GKRA 3ABMC 5L3DA 5IYZA 2EIJB 1W59A 2X6CA 5L3FA 2I79A 3H8GA 2K9PA 3T1HO 1GYTA 4H0LB 4Q7AA 4PA7A 4K8XA 4NGSA 4UCOA 4PHZA 1MZEA 3OMAB 3SJFA 3SPCA 4MCSA 4RWUA 2A9HA 1U6MA 3LDDA 2AE6A 5H9CA 1LAMA 3FD9A 1XMTA 5BR8B 4PK2A 4WFHA 1N32O 3K08A 2R72A 4NXNB 2QMLA 2ZR3A 4Q6GA 1BL8A 1ZLZA 3FB5C 2QKCA 4M3SA 4PA9A 3ZMSA 4A2ZA 1SQXH 3L2NA 2JDCA 1YTFB 4KHPO 3F7YC 1VKCA 2MW2B 3SGIA 4HAMA 1TF8A 5JH7A 1WB7A 4JI2B 4YU9A 4X66O 3RO0A 2ZM6O 4B6ZA 2ZEHA 1SC5B 2EZOA 3LMSA 1P7BA 3WABA 3H1HH 4DV3O 5ELYA 1GRJA 1P0HA 1G1XB 2GV9A 2O28A 1KQSU 1XMBA 2GANA 4FLZA 4JI6O 3E8FA 3B2EE 1RM1C 1SERA 2ATRA 4C2YA 4KHPB 4ZX8A 4BIZA 1MNGA 4PXCA 2HFEC 2WLKA 2ZXWB 3BPZA 5LOVA 4JTDB 3IEHA 1OBRA 4MVMA 5E79Z 3W7UA 2K1EA 2Y4TA 5KA5A 1Z5VA 4YJ3A 3R66A 2OIEA 2P90A 1VQOV 3K03A 3D66A 3UY5A 4F9VA 4JLYA 5LMUO 4NVPA 3ZRSA 1H38A 2QJ1A 1BPNA 2QDOA 2GU2A 1B3QA 3P30A 4WCEV 2QKAA 4GKKB 4DV0B 1FXVA 5EZYA 5EBWC 4NJQA 1KP3A 5AG7A 1TUEB 4XDLA 5GONB 2JLMA 5LGNA 2FSRA 3LSUA 1Q2YA 4MCPA 1V54C 2PDOA 4Z1MG 4TV8A 4KLVA 2Y69B 4IF5A 2ZEOA 2GFQA 4K30A 2OCCC 2UUCB 2HB6A 1PD3A 1FJGB 1TIQA 2R9RB 5A28A 2DYRB 2WLLB 4OMEA 3FVLA 2PQ8A 5EMIA 4YHHB 4F6AA 5LBQA 2KG7B 4KLWA 4PI0A 4JYWA 5HVFA 3K58A 2Q4PA 4JAAA 1XBUA 2P5OA 4MFJA 4I0XB 3K5NA 3SJBC 3UM7A 2PJ4A 1BT8A 4UEZA 4OKOA 4Q36A 2FTKA 2Z11A 2GTSA 5L3GA 2ZEEA 4IYHA 3EVKA 3RNZA 3LNNA 2KG7A 2JIZG 1XIXA 5LHHA 5LXTA 3H1IH 2JGDB 4B3TO 3D2PA 3FKSG 2CAZC 2R98A 2GBOA 1BQZA 1KP2A 5D5PA 4LF7B 3CZXA 1MMMA 1WP8A 3ICXA 3B35A 1NVPB 4MJ8A 3FIXA 2KB1A 3GWOA 5HXDA 3NR7A 5JJNB 3F5TA 4KZTA 2VEZA 4AXVA 3D68A 5C93A 5I4MA 1AYEA 1M4GA 2ZELA 4UCMA 2BE3A 1VQNV 1M57B 3X2QC 3IWWA 3T1YB 8CPAA 4IYIA 2PGGA 3W6SA 1KYOF 3L75H 2E5LB 3EFFK 2NMTA 3VOUA 3ZHVA 4JV5O 2EK9A 1PPJH 3B3SA 2WSSG 4KUMA 3BVOA 5LRJA 3KI9A 1L1FA 5EZYB 3CD6V 3QF7A 4ZI7A 1M4IA 5DECA 3ETDA 2YXYA 1HNZO 3N7ZA 2GLJA 1MA1A 4B12A 2VZZA 3JARB 3SI1A 5IYBO 4DV5B 2ZE8A 3CWBH 3B40A 5HMNA 4TV8B 3KL9A 3ZMVA 4P4DA 3SJEA 2Q5ZA 4P4IA 2Q4YA 3PB4X 3ZHTA 3JAKA 4MCQA 3ZN1A 4RUEA 2PF4E 1TGOA 2EX3A 1BPMA 1IDSA 3RYIA 1V55B 3B3WA 5E96A 5THWA 1NH2B 3H1LH 4OX9O 3VH9A 3MRUA 3M7MX 3CC4V 1TVKB 3SJGA 1M4LA 3ZMUA 2EIMC 3AG3B 4K35A 1YVOA 4MHZA 1PL0A 2D2CB 3JAWA 1RXTA 4WFAV 4DUZB 2H8PC 3NE7A 3DLJA 5JCOA 1YSCA 4U9YA 3CRMA 1L0NH 4XPKA 2QIRA 5LA6A 1Y76B 3VQVA 4YJ3B 3RGBA 4JASA 3ETEA 4MRIA 2PRQA 3J80N 4MVQA 3F7VC 3W91A 2Z3KA 4H89A 4UCVA 3PJSK 1RM1B 4NCZA 3EXNA 5JVDA 5CN0A 5L3BA 4JI5O 4LR3A 3TO9A 1GTOA 2IJHA 5GTHZ 4XNHC 1SF9A 4L87A 1CEZA 2DXQA 2CTPA 4NYKA 2WWWA 3S6GA 4M6IA 4P4FA 1R57A 5KLVH 4M85A 4I55B 2LQTA 2Q7GA 2WSAA 1MSWD 2HR3A 4XDJA 1JR9A 2IL4A 1DF4A 1HW7A 4UFXA 4Z2WA 2P6GA 1OZ0A 2P22C 4CC5A 4FMTA 1XILA 4UF4A 4E4EA 4RO2A 1K3EA 2B5UA 5GW7A 2L35A 2OZHA 4L8AA 1VQ4V 2EJ7A 1QLNA 2GIVA 3ETQA 2ATKC 2ZINA 1A2ZA 3VQWA 1XDCA 5KMGA 2D3OW 1FY7A 1XNQO 1COWG 4CYPA 4UB8Z 1CM0A 2B4DA 2PYLA 2UXBO 2NLJC 2BTQA 2WLJA 1XNRO 2CNTA 1AI6A 4ONUA 5J8CA 2QVPA 3TO7A 1M1KW 4CGLA 3LDEA 3ASNB 4UIAA 3AG2C 5IY5B 1IXMA 1DTOA 1F2OA 4CPAA 3R9FA 4IHMA 5FNVB 3D8CA 4UCNA 1GN4A 2YEVB 1ZLHA 4X64B 4OAEA 2C6PA 5B1OA 4TUYB 3FJUA 1VHSA 3G4SV 3SR2C 1NR7A 2UUAO 4ZI7B 4DW0A 1VF7A 3STLC 4AVCA 4KOVA 3PFOA 1XOUA 1Z9UA 2AFWA 3CCMV 1VGYA 1AR4A 1H2LA 5FVJA 4ZBGA 2Y0IA 3GVMA 3D8PA 3BEHA 4O4LB 3RT3C 4ZHQB 4KSAA 4KP4A 3QO7A 1NT2B 3CP1A 3PEIA 3QO5A 3A0BZ 3GLJA 4FM1A 4P45A 5J2UB 5KAFZ 2BOAA 4EEQA 2ADQB 5B1NA 2VXKA 5H86A 3EC4A 2QM8A 2YDEA 1IYKA 2B4BA 1W2BU 3OW2U 4FLVA 1XHXA 1YX0A 3NFZA 3IC9A 2WLHA 2J9AA 4JWPA 4RN7A 4JJXA 1EN6A 3MDSA 4QE9A 1JMKC 3ABMB 4X8IA 4A95A 1JA8A 4FFKA 1I08A 5KTAA 4I55A 1K4JA 1NMTA 3JATB 2BSKA 3E2EA 2OH1A 4ZX9A 1N71A 2JEXA 4NTWA 3CPXA 3UQ8A 3ZCCA 2CTBA 2NNUA 5FLXN 2F23A 5CA1A 5JCOC 4U7OA 3QAHA 4X5KA 3K9UA 2CNSA 3HKBB 2GE3A 2G3AA 1S5JA 1N4CA 4JV5B 2V8DA 2VQEO 1IBLO 1OV9A 5FL7G 4X1IA 2DMXA 4N23A 1CPXA 3TOBA 2Q7BA 1Q2CA 4DJLA 3GIUA 1RSOB 4II9A 4DR1O 2WLMA 2F4VB 3ZHRA 3ZJ0A 1O9HA 3HKEA 1FFTB 2XAHA 3PBBA 4HKFA 3PB7X 1UFIA 1PUAA 4R7MA 2B58A 4F9UA 4R8CA 2KCWA 4YXWG 1AB3A 1TXRA 3K79A 3HR0A 2FCKA 1AI4A 4JYBA 1S60A 1XUQA 5TISZ 2PVWA 2PJCA 2EILB 3CCQV 3ZRWA 4KVXA 1Y6XA 4EB6A 2UU9O 4O4IA 5IJ9B 4O4JB 3RW0A 3HKDB 2IU0A 1ZL8A 4LF9O 1ZX3A 5DWMA 1TA8A 2QWQB 5JQGB 3EO4A 2KSDA 4LFAB 1SQVH 1WA8A 1M56B 4DV1O 2Z3NA 4UIBA 4F8ZA 2ZOFA 3HLPA 1IBMO 1R73A 4MTGA 4K3NA 1XMQO 3IC7A 2YSUB 2A06H 4JTCB 1Z4EA 4RS2A 2B4DB 3H4QA 4LFCB 4DR3O 2B1GA 3SPJA 1HNZB 1CP9A 3EXAA 2REEA 2C6CA 4JI5B 2AFZA 4EVYA 4QIWF 1S5LZ 1HR0B 1FYJA 5B3SB 2W0FC 3BA9A 4JI7O 3KR5A 2B5GB 3JASB 4CYNA 5LHIA 5FNVA 5C82A 1S7LA 4UVCA 2IM9A 1P49A 2B9ZA 3O65A 4PELA 3WG7C 1QSMA 3E89A 5CB4B 4HBNA 4PV1B 4KSFA 4JI0O 5CNPA 4DK0A 2YNDA 1MZFA 1G4YB 2B5GA 4AI8A 1SZXA 2ZW6A 1HR0O 4WBNB 3WR7A 4ONWA 1FXHA 2UXXA 3ASNC 3ZN0A 1DK1A 4WFEA 3FXTA 5EK0A 4JXQA 4MHPA 1YGHA 2E3CA 1Z8WA 5DS0A 1ZUQA 1WJZA 3C26A 4BBHA 3ZEDA 3VQXA 4MVOA 5EBLC 1K33A 3FNCA 5B3SC 4KOUA 4QJFB 1VF5B 4ZKIA 2E75B 2ZQMA 2RFHA 3F0AA 1I21A 3S6FA 2VL1A 4NTXA 4MXUA 1R1BA 1DLBA 4LNUB 1QVFU 2D4OA 1KB9F 1QHTA 4CAFA 1LFWA 2R7HA 4TWKA 5IJ9A 3V38A 3JYCA 3PFEA 4GYCB 4R87A 4QE7A 1J4JA 3B8NA 4MI4A 3N2KA 4MVRA 1IIDA 1LOKA 4QUSA 5A27A 4MW8A 5C8YA 4BIOA 2BOBC 1EE3P 4DV2O 3B09A 4CS3A 2VWKA 2QE7G 5L3EA 4OC2A 4P9PA 1IBKB 3EFAA 4A33A 4A38A 1Q2DA 1RFYA 4R3KA 1Y9KA 4I5SA 4KUAA 1FXKC 2IU3A 4X65O 3K5OA 2F43G 3CHXA 3ASOC 1K5SA 4ABMA 1NZ6A 2YC0A 2XT9A 1IVSA 1M1DA 2DW4A 1VQ7V 1M5IA 1PU9A 4FD7A 3APOA 4WFFA 3ABLB 1NH2D 3TX8A 5IE9A 4DV2B 2DJVA 4C7UA 2PJ7A 3T4ZA 2GLFA 4YIPA 4U3JB 1TUBA 4FD5A 3B77A 4MVZA 1I94O 3H8FA 1Y67A 1IU8A 3ZX6A 2PJ6A 4OPHA 3QO8A 3K04A 2ZE5A 4DNCA 1H2SB 4R8FA 2HKOA 1N8RW 1F2PA 3D36C 1VHEA 1AR1B 3VATA 3WU2Z 1TKJA 1MOFA 4DR4B 3MN8A 1P84F 2V8HA 3BHPA 2OTLV 2XUMA 2ZXWC 3CXCU 3CX5F 3I3GA 1H2GA 4KL1A 2PSWA 5IWAO 3SJAC 4I50B 4R6ZA 4QNHB 2QECA 4AVAA 4GT1A 1I94B 1VQ9V 4UCSA 2EZPA 4PA6A 2P67A 3T1CA 3CCSV 1N34B 1IB1E 1BCCH 3JARA 5LYLA 5LYFA 2PY5A 2ZDIA 3CRQA 1IXBA 4DR7O 1V54B 1OCZB 3CCVV 4LF4O 1BZKA 2YNCA 1YF2A 3S9NA 2DPTA 5EC4A 4FJCC 4MCRA 2CNMA 1YREA 2PVVA 1PCAA 1NBMG 4J80A 2FVGA 4KS9A 1XBLA 1K7DA 4KOYA 1SQQH 2F95B 3JCUZ 3RWRD 1MJAA 2BL1A 1AI5A 3KQXA 4K3AA 1BAVA 4MTOA 1OCRB 1MK4A 4MT8A 5FPRA 4HNXB 4Q38A 2AW9A 4GLXA 3UT5A 2Z3LA 1S77D 5LYIA 4AQYB 3HKBA 4DV6B 2EIJC 5GONA 2VWJA 3P3NA 2BCCH 4A31A 5DN6G 4DO2A 1S7NA 4MTXA 5ISVA 1AMPA 4OX9B 2XEFA 1KC8W 1JFFB 1B06A 4A32A 4H13B 2PIYA 2XEIA 2AFUA 2PJ5A 2YIAA 1JX9A 3H1JH 5LXTB 4U5YA 1Q6UA 3DTUB 1GK9A 1OHHG 3KKYA 3K57A 4JI7B 4Z65A 3JSNA 5B5EZ 4CAXA 5LYJA 3S6KA 1F7YA 4IIJA 1UFHA 1NS1A 1Y74A 2A3QA 1Z2LA 3APQA 3QB8A 3ZRVA 5GTIZ 2LO1A 3WC6A 1KBHA 1EN5A 4CYOA 3B2YA 3GYAA 1YLOA 3GUXA 5KX5A 4X66B 2CK3G 1U97A 1VF6A 3E22A 3CCJV 2P0WA 2X7BA 2DF5A 5B1AC 1ZG7A 1SRYA 1Y7EA 4UBRA 2UUBB 1WN7A 4MMOA 2OCCB 2UUCO 5CBFA 4A30A 5F47A 1P7GA 2A79B 3WG7B 2YNEA 2EUIA 6CPAA 1F4NA 1FKAO 3CPWU 4BR6A 1K8AW 5LP6A 4UV9A 1VARA 1CPYA 1IBMB 4X9QA 5LRGA 5JH7B 1QLEB 3AK2A 1YW4A 4LUAA 5K8PA 4DR3B 4LFCO 2AHYA 4DR2O 2LFRA 2QWRB 2WYRA 3AG7A 3V7ZA 1SETA 3U11A 4C2ZA 1XEQA 4BMHA 2Q0OC 2HV2A 2CTQA 4YIOA 1K34A 4DUYO 2BO9A 4CAEA 1N33B 2YIBD 4EFBA 1M4DA 3OEEG 4CGPA 3KKWA 2ZKOA 4JI3O 3SYOA 2PJ2A 3JRUA 3RYIB 2FXFA 5LOVB 5EBMC 4QVTA 1X59A 4DXWA 1YIJV 4UEFA 4JYAB 5H6QA 4MBUA 1MABG 2B1IA 1SQHA 1IBKO 3E8GA 1HNXO 3PB9X 4UWJA 5CA0A 2JJ1G 2WLIA 1Y9WA 2PE3A 2WUUA 2YICA 2ODMA 1IYLA 3AEIA 1BHAA 3RYFA 2YNCC 1SA0B 4P9OA 3B8MA 1VQ5V 4B3MB 4DRXB 1NTMH 3SJQC 4I4TB 2G0BA 2QR4A 3CC2V 2EBJA 1AILA 2FIAA 3RAMA 5LYDA 2F66C 1HWYA 2CE4A 3L72H 4X1KB 4FVMA 4DV7B 1CP6A 3BI1A 1OCCB 5LRKA 5HFMA 5JPHA 1Y7RA 1IICA 4MY0A 3RYCA 1LRZA 2JDIG 2PJ0A 2YIBA 2ZEDA 2DN9A 3DXRB 1SQGA 5F46A 2EIMB 3AG3C 1N36O 3M99B 1K9MW 3F5BA 2XAGA 1PP9H 3FYEB 1YMEA 5IX3A 2GTAA 2C2AA 5G1ZA 4LF4B 1WWZA 2ODFA 3K9TA 4MHYA 1QSNA 3SI0A 4OADA 2OT5A 3E86A 3H8EA 4X20B 3IU1A 2P6JA 1F51A 1LNQA 4AILC 4UFZA 5HFLA 4LF5B 3QNEA 4JPRA 2LP7A 4JZ0A 2LFSA 4X1YA 4AVBA 1D5NA 4L8JA 2CTCA 4MVSA 3TFYA 4FK5C 1FS0G 7CPAA 1I0HA 3KZWA 2Z3MA 2HP8A 1RSOA 1GHEA 1QQ9A 4O4JA 4CS0B 1G8MA 3BJ8A 3H9VA 4NGQA 2HUZA 1S5HC 2QA4V 2OU2A 4NFRA 4CAVA 3I5DA 3NA6A 4NXYA 1I5XA 1PYTB 4AQYO 1FAFA 3PZJA 1OCCC 1KU9A 4A5UB 2QYVA 1Z4RA 3T90A 2XAFA 4OC5A 4KOXA 4CH6A 4UVBA 4YY3O 4I49A 1MG1A 2RQ6A 3ZHQA 5D29A 3D2MA 5CA1B 2LGQA 4O4IB 3R65A 2ZW4A 4DRXA 4DUKA 1KUXA 4JI6B 1ZL8B 1XNQB 3FH4A 4J9ZB 5J8FA 1Q5OA 4Y49C 4F0XA 1AUGA 4BD9A 3PRTA 2J8NA 1BS3A 4J10A 3HUVA 1THZA 1QSRA 2PTMA 3D67A 1KWMA 4B3SB 2Q4VA 3BABA 3CB2A 1YSJA 3S6HA 1JJOA 2ZEPA 2RMKB 4J11A 4ZHQA 2REFA 3E35A 4LH7A 3LACA 1Q7YW 2P6FA 1VQ8V 3S3WA 1YXBA 4NF1A 4MW3A 2IH3C 2B3VA 5IDJA 3FRMA 3SJXA 3MHHC 1B87A 4UV8A 5KHJA 1ZO0A 1R3LC 2HG5C 2HHHB 4O2BB 3KCYA 3HKCB 5K8OA 3CC7V 5H84A 4UVAA 4X1IB 3RFRA 3CCEV 3IAYA 3B8GA 4TQDA 1OCOB 3JD0A 1R6NA 4ZI6A 3FX6A 2OCHA 2HEPA 3DGEA 3VWDA 4UCRA 2XOKG 4QBJA 1B6BA 2WLLA 4BW5A 2WPWA 1OZPA 4UCUA 2CIJA 3S9MA 4JI8O 4JZ2A 1EFRG 3HKCA 1XI1A 1YI2V 5JQGA 3UO3A 3NH4A 3X2QB 2YS8A 2N74A 4GXHA 4WBNA 4JI3B 1XREA 4H37A 4IT5A 4LF8B 3D7FA 5JQ4A 1XNRB 2E5LO 1VQPV 3NE8A 2N05A 4QGPA 3ZRWB 2IJJA 4LCUC 4DW1A 5CBHA 1AI7A 3S9LA 2V8GA 1BOBA 3E8BA 4JYAO 3R95A 1XMOB 4IAVA 3BHXA 4P6YA 4MFPA 3JASA 1IOFA 4PJ0Z 4DV5O 3FBUA 2HLDG 2UXCO 4PDVA 4B3TB 2KKWA 4UA3A 4X1YB 1BO4A 4NB5A 3ETGA 1XFOA 4LF7O 2DPSA 2Z3PA 5L3CA 1H8EG 1QNMA 4AHCA 2ZPAA 2GDSA 3JALB 1P4NA 3OUFA 3WT4A 3M8AA 2JEUA 5KHIA 2Q68A 1QSTA 4DR2B 5B1BC 5JH9A 2J8MA 2CY2A 3K06A 1VIBA 2ZE6A 4TOIA 2FB5A 4PXBA 1YZBA 3UCSC 4DUYB 1YITV 1Z8XA 2PCUA 1SQFA 4EFDA 1UPGA 3EHBB 3JD1A 3ZZIA 1JJ2U 1BQ0A 2HJDA 1M57C 4ZBMA 4DR6O 1I5YA 2KQXA 4FLYA 3FEEA 5KUKA 1L0CA 3TC8A 3CMAV 1B04A 5JJJB 2Q43A 2AJ6A 3AG2B 5CB4A 5IY5C 2ILMA 4KXRA 3RZAA 4ZOLA 2IH1C 4R6TA 4R76A 1VQKV 4HPSA 5A9GA 5BMVA 1CPSA 4LP8A 4UCPA 3ZHSA 4JGSA 4PDMA 1ZTEA 4JYYA 1TKFA 1XEBA 2CH7B 4DK1A 1FD9A 1R3NA 3CPAA 5HVHA 3TCUA 1X4TA 3A9LA 3JAKB 4FWUA 3D36A 2ZCEA 2RDCA 1MSDA 3K5MA 3JD4A 4HNYB 5KA6A 4ASUG 1IOIA 4HZ3A 3LUTB 2E76B 2ZD9A 2V8VA 5KHHA 4GKJO 2PJBA 2LGWA 1W0KG 1NSAA 3LDCA 4FM0A 4TNUA 3P3PA 1AR5A 4FLWA 2FT0A 2EK8A 3WFVA 4B11A 1KMIZ 1GO3F 1XL4A 5LMNO 3CRAA 3J81N 4N21A 3LD2A 5G20A 2XASA 4LF5O 4G28B 1XOVA 3ASOB 4W4KA 3BJ7A 5IB9A 5IWAB 1SQBH 2F7VA 2ABZA 3VWEA 1YEWA 3FB8C 4KOSA 3K0GA 2ZENA 4IGGA 4I4TA 4QC6A 3G3SA 3ABLC 3AG1C 2QWOB 2ZIOA 4HNWB 4P4BA 3K9AA 2IQ6A 5KHGA 5BWAB 5J1QA 4I7ZB 1HNWO 4IHJA 4OC3A 3D7HA 3AG1B 4FD6A 1KUVA 2QWPB 3UT5B 4WJBA 1VIXA 5CPAA 5G22A 3KQZA 5KTDA 4ZY1A 1JQ0A 3RVZA 4F6RA 2EVNA 3IIBA 2IW5A 4X3RA 1VQ6V 1T5EA 1GM9A 1DF5A 3VBBA 3FB7C 2DEAA 1XQ8A 1N36B 3ISZA 2AGAA 3IJ4A 3PP9A 4FUUA 5DEDA 1R3JC 4LH6A 5BR8O 2LW1A 3I1UA 3CSXA 5H5NA 3TE4A 1BGYH 2YI8A 1X12A 1RPOA 3L74H 4K0KB 4B5OA 4I9QA 2IJZA 4F6EA 1HNWB 1S3ZA 1BLLE 3DSQA 4ZOLB 2DYSC 3ZRXA 1WPXA 1XF8A 4A94A 1QR8A 3VARA 4J7KA 4FAIA 4MY3A 1BHBA 3K0DA 5A2QN 3G8WA 2Y48A 2R9IA 4NGPA 1LR1A 1Q86W 2W0XA 3H5ZA 4MHDA 2QSAA 1S0VA 1ON0A 2CF4A 1IX9A 3KG2A 4KSIA 1DTDA 1KKDA 1Q3EA 4MVUA 4J42A 1F23A 1JWQA 3DGVA 3FB6C 4J7ZA 1DE4C 3DDDA 4GUNA 1KECA 5LL6Y 5KHKA 5FPOA 4XPDC 2X0LA 2W6IG 4OC4A 2ARHA 3ZMTA 2UXDO 3J7AU 1ELMP 3PN1A 2BTOA 3PB8X 5KMGB 3CT9A 2JEWA 4JI8B 1Z2GA 3RYHB 4JZGA 2VQYA 5KUMA 2ADPA 3GB7C 1ZG8A 4B5PA 1NKDA 1TVKA 3I55V 2F93B 4CH3A 1H8LA 4E0AA 5JM6A 4JF3A 1BE3H 5JGFA 3DSBA 4LF8O 2Q0YA 2W6JG 2CDYA 2V4DA 1SQPH 3K59A 2CTWA 5EYPA 3SXOA 4NXMO 2I00A 1GN6A 4K8ZA 2YI9A 1E1QG 4NGNA 5H6RA 1VQLV 1RO5A 3OFNG 3KCXA 3KASA 4B7EA 1YTFD 2PIZA 4ZGYB 3GY9A 2Z10A 3CJHA 2PJAA 1K97A 2YUAA 2Y0PA 4KORA 2CH7A 2M7WA 2Q67A 1RTQA 5AG5A 3OR7C 5F49A 3R9GA 4X8AA 3W7XA 3GWKC 5CA0B 4B7KA 1D5AA 4PV6A 3RYOA 4BINA 3DR8A 3CYOA 4LWSB 4UUJC 3Q4HB 2V7QG 4B3RO 3T2MA 1EM1A 3SYPA 3QG5A 4NJRA 5G21A 2O53A 3FX7A 3K9SA 4FZ1A 1QQCA 4BIUA 3EY5A 4DR6B 5LMUB 5J9PC 1HDJA 3SPIA 1N34O 3UKMA 3ML0A 3PGPA 1GM8A 4PI2A 4QB9A 4DV1B 1R43A 4QPKA 3PB6X 2PR8A 4B08A 1S72V 4LFBO 4LX9A 4P30A 3N5FA 4H33A 3IO1A 2X7RB 2QEXV 1XMOO 1NQTA 5AGEA 2QJ8A 2H94A 1I1DA 4PD4F 4JXRA 1HP8A 4RQEA 5F09A 3N2GB 2G3TA 1BMFG 2ZDIC 2UXCB 4OPAA 2JGUA 1PL4A 4JAVA 2X6BA 3KHZA 5CBMA 2JK5C 1Z5WA 2WAMA 1GN2A 2RNBA 2V77A 4Y49B 4G2KA 3QVNA 3FECA 3BFRA 2K5TA 1ZWIC 1OJHA 4L89A 1QLEC 4E8OA 4M6GA 1YVKA 1Y0YA 4W4LA 4ICGA 1QU7A 5K1PA 1BSMA 1NR1A 3FB3A 4P10A 4C7HA 2Q6AA 2FE7A 3F5WC 4LF9B 3D4UA 3DXRA 3JVNA 4GX2A 1VF6C 3W7TA 3D7DA 5K8NA 5LP6C 1CG2A 5IT9N 3NXSA 5J2UA 1JVMA 2C6GA 3FAVA 1R3IC 2Q0AA 3RYFB 5LGUA 4FFBA 1UWYA 1IGBA 1TF9A 1WPBA 3KR4A 4FM2A 1WLEA 1Q82W 2IJKA 3QTCA 4LBEC 1E1RG 4R57A 4D7SA 4GCZA 2OZGA 2QGNA 1UJWB 1B6QA 1WP7A 3JSLA 2BSKB 1Q43A 4UFWA 3BXMA 2YIDA 3ABKC 2IJIA 1US6A 2GSMB 3O9OA 3RYHA 5JJEB 4M6HA 2CUGA 4O4LA 2A4NA 2O57A 1JCHA 2AFOA 3WB2A 3L9DA 2R8VA 1R3KC 3OWCA 1KUYA 3RYCB 4HNAB 5EBVA 4CRYB 5LMNB 4KFMA 3CRCA 3R9EA 1WNSA 5LA6B 3U0ZA 1AP5A 1D2DA 4ZY0A 2O4HA 1KD1W 2XTAA 2PI5A 2Q7EA 3ABUA 1X10A 4UB6Z 3MAQA 1M9NA 5J2TA 4P44A 4NR1A 2VBQA 4P2ZA 1GN3A 1HDQA 1N0NA 2FKXA 4OIDA 4ZYQA 3A0RA 4NTYA 1WAZA 4RQFA 1AVMA 1QMUA 3BAAA 3I9SA 3FYNA 4B3SO 2DQ0A 1J5EO 4IHJB 2NR5A 1ZLIA 4NGTA 5IYZB 3OMNB 5IB0A 5B1BB 2F8HA 2ZEFA 3STZC 1VHOA 5B1AB 3JTKA 2QTOA 4GX5A 3SPGA 1JOYA 2Y69C 2OR4A 4EMEA 2HVJC 5EC1C 5EIBD 4JTAB 3B3CA 1V9PA 5HVGA 4X62B 2XNDG 1FJGO 1LCPA 3JAMN 3SHPA 4XPDB 2YEVA 2VS0A 2MK3A 1CXZB 1EZJA 2ZW7A 4X20A 2UXBB 3IWGA 3GB0A 1QVGU 2EJRA 1J5EB 2FS5A 4TQFA 1E79G 1ELLP 4DR4O 3OEHG 4KVOE 3G6BA 4U7NA 3G71V 1YCIA 1NTZH 2LW7A 2JBKA 2FL4A 1DGSA 3CCLV 2C1CA 1PV0A 1S7KA 3CCUV 1WB8A 3U10A 4X65B 4FD4A 4B13A 5C88A 3W7SA 3WC5A 2AFSA 5DWNA 1G6UA 4DR7B 4DV0O 4CH4A 2N04A 2WZNA 5CMUA 5JWPA 2UXDB 1OCOC 2ANPA 1HNXB 3R1KA 2G38A 3T4DA 3AK3A 2RB7A 1W0JG 4O2BA 2OB0A 5K1XA 2JS3A 3LSSA 3D3IA 3CXHF 2NN4A 4RI1A 2JRIA 1QSOA 3TTHA 3S3XA 4ZIBA 4WF9V 4WFBV 4I9WA 2ITCC 4YRHA 3T9YA 5AG2A 2RN9A 1YJ9V 4F0YA 3FAVB 2NYQA 4B3MO 2YGWA 4FFBB 3P2HA 4DV4B 2GUZB 2XAJA 2OIGA 1LUVA 3JAWB 4C68A 4CYQA 1HEEA 2UUAB 2LJ2A 4WFGA 4DR5B 4UEEA 1SKVA 2AXTZ 4MFKA 4GM5A 2EIKC 1J95A 3TGUH 4D7TA 5IYDO 1ARMA 1Z8LA 2Q8VA 1S76D 1ORQC 3ZS8C 1Y66A 2A7WA 5LGTA 2DE0X 1VQMV 4PQAA 5IJ0A 4XPLA 3SYAA 3IC1A 4ZY2A 2DYSB 3TK1A 2YXLA 4IL6Z 5BMVB 3T1HB 4UWIA 1H2NA 2Y0MA 4MTFA 3SYQA 2FYUH 4IIJB 3OTOB 2HC9A 3W7WA 2C27A 2JDDA 1Q8IA 2J8RA 2RCVA 4DR1B 2VQFO 2ZIMA 1N32B 3E8HA 2H3OA 4NXNO 1TKHA 3BA8A 1PKXA 4PA3A 5KX5B 2AFXA 3LWUA 2PUSA 2WPDG 1SZTA 3QAYA 5EC2C 3MD0A 4LQGA 1TAEA 4TSFG 3FMCA 2Q7HA 5D8NA 1ZG9A 4FIPC 3TXQA 2ZW5A 2Q7SA 5ITZA 4RUHA 3ZIAG 2ZM6B 1Q81W 1CX8A 1SESA 2UU9B 4P4JA 2AFMA 2JBJA 2PR1A 3RBZA 3IJ3A 2OOTA 4CBCA 4XNHB 2R70A 3N27A 3MHSC 1VEWA 4WWVA 1WK4A 5IYCO 4JD6A 2HJFC 2QM4A 3UO2A 1JFFA 2WLNA 4G27B 5ITZB 4FLXA 4JI4B 2ZR2A 1ZSPA 3T8WA 1YK3A 1M93A 2IMOA 4YY3B 1WA8B 3QNVA 3B4SA 1YDXA 3ZHUA 4PXDA 4C2XA 1RP3B 3LNMB 3JCZA 4HYOA 4QPJA 5LYJB 2Y4UA 4DUZO 1QCEA 4NGMA 4X88A 1K73W 1QR9A 2BUEA 1LUWA 5KAIZ 2EINC 2GUZA 4E2LA 3K2KA 1NJIW 4FZ0A 5F48A 4MFQA 2VZYA 2RJZA 1ENVA 1H8HG 3JALA 1YVWA 3KZIZ 4JAUA 3E22B 5BXZA 2EWBA 3H01A 1R6TA 4YWYA 1Z5RA 3OGCC 1JPXA 3L71H 2Z5UA 3W6XA 4R7CA 2OWOA 1VMGA 4PDRA 3BY6A 2XHBA 2AZ0A 1R6KA 4CZZA 2ZEGA 2DOSA 4X64O 1CP7A 2Z0AA 1FPOA 5DM6V 4X62O 3G6EV 5I0CA 1S5KA 3E83A 4NGRA 3TETA 4BWAA 4NSQA 4DV7O 2I3CA 5AG4A 4UCTA 1I12A 3JD2A 4F6RB 1N0JA 3SXNA 3HB3B 4RUFA 3WB1A 2DWDC 3C3SA 1LANA 2XEGA 4FLTA 1M4UA 1ZAUA 4G1PA 2WA3A 3ZJZA 1H2KA 3NH5A 3DC5A 3OE7G 2ETNA 2JGDA 4P4EA 1FXKA 2P7TC 2Q73A 4O2AB 3A0HZ 1S3JA 4A39A 4KOTA 1AROP 4CGOA 3B3VA 1A32A 4JI1B 4I0XA 3IFXA 4YGOA 2XAQA 4IK2A 3MGDA 2BCOA 5D5QA 4CH5A 2DWEC 4MHNA 3ZMZA 4B14A 3L73H 4NXMB 3TO6A 3AK1A 5BY1A 4NKGB 2H5MA 2QTSA 4R9MA 1AP6A 1L0LH 4EKWA 4O2AA 2WLIB 3C90A 3KHXA 3SI2A 2VRZA 2PJ8A 2YXHA 3D7GA 2E74B 4KVME 2JVDA 4GX1A 5JVDB 1Q7LA 2EILC 3OTFA 4RAIA 3SJCC 2PJ1A 4LQ6A 4BW9A 2ZOGA 1URFA 1SS3A 1V55C 3CJHB 1Z8TA 1AJPA 1SA0A 1NSLA 4MS2A 4D6TH 1YQEA 2BSWA 4AB7A 5F2VO 2VQEB 1IBLB 2EIKB 3NH8A 1YR0A 4XDKA 4LWSA 3CXPA 4A37A 4FPPA 4DV4O 3PBEA 3WB0A 4LC1A 2BOCC 1NTKH 4OXSA 3OAAG 2FMLA 3BI0A 4O23A 2DQ3A 1XHZA 3DR6A 2R9AA 4J9YB 4H44B 4OP4A 1Y0RA 2L6LA 4Z1VA 4Q20A 5EIBC 2ZNJA 1GAXA 2PJ3A 2AZ2A 4ORFA 2P4KA 3AG4B 2BEIA 4KUBA 4X2TA 1ROPA 4BAYA 2Q4ZA 4PPZA 3BRCA 4JYCA 1MJ9A 4TV9B 3LODA 4DV3B 3JD3A 2PC1A 4DYOA 2ZXVA 3OT7A 1GM7A 2HQYA 3IGAC 2VQFB 1PNKA 2A0LA 1M90W 2HHHO 3CEIA 3IGRA 1GKFA 3G80A 1NE9A 4LF6B 2Q51A 1TUBB 4LFAO 4I50A 3Q4HA 3D3QA 5K8MA 3IFEA 3F8KA 1L8DA 4PSWA 4PXEA 3ZBHA 3I56V 2BTQB 4PDLA 2P6EA 3E0KA 2Q44A 5IV0A 4H6ZA 1IZ3A 3B7IA 2F4VO 3FYIB 1P4RA 4B5PB 3VQYA 1RPRA 1Y76A 3RVYA 4DR5O 3G67A 5J2TB 4UFVA 1V0CA 2M6YA 3ISXA 2F5IA 3K5LA 1YJWV 4LF6O 2GREA 2JJ2G 4GKKO 4OGQB 1Q6IA 2F1MA 1AJNA 4DV6O 1Y74B 2OZUA 2QM7A 3A8TA 4JI2O 1M44A 1NI8A 4MSWC 2XEJA 2HVKC 3OTOO 1O9GA 2PI4A 2D4PA 4GS4A 2PJ9A 4PSXA 3HPLC 4NEXA 2Z3OA 4CAWA 4CC6A 4U9ZA 3HKEB 1VP7A 1PNLA 4J41A 1KZFA 4J3GA 4PK3A 3V8IA 4YHHO 1S7FA 4O4HA 1PNMA 4OIWA 3OR6C 2IBZH 4GX0A 4TWEA 1EN4A 1XMQB 4J7JA 3TXSA 3CDXA 1K5QA 3RN4A 4KOWA 4FLUA 4CRZB 2GHYA 2EINB 1PM9A 1FFXB 3OD4A 2V1DA 1XJOA 4DYLA 4CGMA 4TUYA 4CS4A 1IY7A 1CJWA 5E1AC 2JEVA 5H2FZ 3SPHA 3HKDA 2UUBO 3KGQA 3RBUA 1FNOA 1IURA 3TCVA 4U3FH 1EZVH 2UXNA 2Z3YA 2PRBA 3CCRV 1XL6A 1K4CC 1YHQV 3P32A 1FFXA 4JI4O 2CGNA 2X6AA 3TOAA 3CRRA 2DYRC 2AHZA 4JI0B 1FT7A 4OLLA 3DNSA 4H2KA 5LP6B 1F4MA 5BZBA 2ZT9B 2QWNB 4W9YA 3K3WA 5CBGA 4EWTA 1I7FA 2JS5A 2FIWA 3SYCA 3CS5A 3N2GA 1NU1H 3A2FA 3SDLA 2OTJV 1YLEA 4U3JA 1GMGA 1K92A 3BLNA 2PYJA 4EB6B 1N33O 2RC4A 4AG9A 3OMIB 3TJTA 2Z0ZA 3IWEA 2R1IA 5HH1A 5AG6A 4TV9A 4JI1O 3C3TA 4YFJA 2Q04A 1YJNV 4IUSA 1KKCA 3R96A 2EBOA 5CA3A 3IU2A 4LFBB 3OUSA 1EBOA 2WPXA 3FEDA 1QBZA 3H1KH 1M56C 2EO8A 2CTRA 2G9DA 1Y4MA 2ZE7A 1GH6A 4X89A 4CS2A 2NSMA 3OGIB 3CXQA 5KTCA 1LAPA 2CGOA 2VI7A 3ABKB 3BCCH 3FF3A 3CE2A 1MJBA 5EYPB 2CXAA 3JATA 1HDUA 4O4HB 4B3RB 2B3UA 1OCRC 4YJ2A 5IJ0B 2QKSA 4AG7A 1XRYA 1XE4A 3B3TA 2Q9LA 4OC1A 3THOA 4B10A 3AG4C 5LHGA 1ARLA 3WC7A 1FXKB 1NVPD 3T1YO 4R3LA 5B66Z 4GKJB 3DC6A 4R50A 1JQGA 1F57A 4YJ2B 4K0KO 2P4VA 1OCZC
chains in the Genus database with same CATH topology
4MFZA 4CGNA 3VWDA 4RS2A 1Z4EA 3D3SA 2B4DB 3H4QA 4QBJA 1B6BA 2WPWA 2REEA 1OZPA 3TT2A 3P2FA 4H6UA 3R1KA 4EVYA 4C7IA 2OB0A 3JUWA 2B5GB 4CYNA 4MFLA 5C82A 3CXSA 4RI1A 1S7LA 1QSOA 3TTHA 5JQ4A 5GCNA 4E2AA 4YRHA 3GKRA 3T9YA 1QSMA 4F0YA 2I79A 4KSFA 1BOBA 5CNPA 2YGWA 3P2HA 2YNDA 3R95A 2B5GA 1U6MA 2AE6A 4MFPA 2ZW6A 1XMTA 4PK2A 3FBUA 3WR7A 4C68A 4CYQA 2QMLA 4MFKA 4UA3A 3FXTA 1BO4A 4JXQA 4M3SA 1YGHA 4A2ZA 2DPSA 2JDCA 2Z3PA 3C26A 4BBHA 2ZPAA 1P4NA 1VKCA 3FNCA 4KOUA 4XPLA 1QSTA 2J8MA 3F0AA 2CY2A 4UWIA 1I21A 2Y0MA 3S6FA 2C27A 2JDDA 1P0HA 2J8RA 3ZZIA 2D4OA 4CAFA 2O28A 2R7HA 2GANA 1L0CA 4R87A 1J4JA 2AJ6A 2ATRA 4MI4A 4C2YA 1IIDA 4QUSA 5A27A 4UCPA 1XEBA 2ZW5A 3EFAA 4A33A 3A9LA 2PR1A 1Q2DA 4XNHB 3UY5A 4R3KA 4HNYB 1Y9KA 4JLYA 4KUAA 1WK4A 4JD6A 1M1DA 2FT0A 4B11A 5AG7A 1PU9A 4FD7A 1YK3A 2JLMA 2FSRA 1Q2YA 3LD2A 5G20A 2PDOA 3BJ7A 4C2XA 4KLVA 4IF5A 3VWEA 4FD5A 4KOSA 4K30A 4QC6A 3G3SA 2BUEA 1TIQA 5A28A 2PQ8A 5F48A 4HNWB 4DNCA 4F6AA 4MFQA 2VZYA 4KLWA 5BWAB 4FD6A 1KUVA 4MFJA 5G22A 5KTDA 2EVNA 4Q36A 2Z11A 3W6XA 3I3GA 2PSWA 2QECA 3PP9A 4AVAA 1XIXA 3TE4A 1IB1E 5I0CA 1S5KA 3D2PA 4B5OA 2R98A 4NSQA 2YNCA 5AG4A 1I12A 1S3ZA 2DPTA 5EC4A 3SXNA 2CNMA 1YREA 4MJ8A 1XF8A 3FIXA 4MY3A 4KS9A 3G8WA 4KOYA 4KZTA 2VEZA 3H5ZA 1MJAA 4MHDA 2BL1A 1M4GA 1ON0A 4UCMA 1MK4A 4KOTA 4CGOA 4HNXB 4Q38A 3W6SA 4YGOA 2Z3LA 2NMTA 3MGDA 3DDDA 4B14A 3TO6A 4A31A 4XPDC 2H5MA 5ISVA 1S7NA 4R9MA 4A32A 1M4IA 2ARHA 3N7ZA 4U5YA 4B12A 2VZZA 4KVME 2VQYA 4B5PA 5HMNA 4CAXA 3S6KA 4E0AA 2Q4YA 1UFHA 3DSBA 1NSLA 2Q0YA 3QB8A 2BSWA 4AB7A 3SXOA 2I00A 5E96A 4CYOA 3GYAA 1YR0A 1RO5A 3CXPA 2P0WA 2X7BA 1YVOA 4UBRA 4ZGYB 3GY9A 1RXTA 2Z10A 3NE7A 4A30A 4KORA 4U9YA 2YNEA 5F47A 5AG5A 2EUIA 4XPKA 5F49A 3R9GA 2QIRA 3DR6A 4PV6A 3RYOA 3DR8A 3W91A 2Z3KA 4H89A 4LUAA 4ORFA 2BEIA 4KUBA 4NCZA 3EXNA 4C2ZA 4BMHA 2HV2A 1MJ9A 5G21A 3TO9A 3LODA 4XNHC 3EY5A 4CAEA 2PC1A 1M4DA 2ZXVA 2DXQA 2HQYA 4CGPA 3KKWA 3S6GA 3IGRA 1NE9A 4QB9A 3PGPA 1R57A 4M85A 2WSAA 3F8KA 4PSWA 2PR8A 2IL4A 2FXFA 4UFXA 2P6GA 4QVTA 4LX9A 2P6EA 4MBUA 3E0KA 5AGEA 2OZHA 2Q44A 5IV0A 4H6ZA 1I1DA 1SQHA 4L8AA 4JXRA 4B5PB 2GIVA 4UWJA 2G3TA 4UFVA 1FY7A 4CYPA 1Y9WA 1V0CA 1CM0A 2WUUA 2F5IA 2B4DA 4Y49B 2K5TA 1IYLA 2CNTA 4ONUA 4L89A 5J8CA 2YNCC 4E8OA 3TO7A 4CGLA 2OZUA 1YVKA 1M44A 3R9FA 3FB3A 2G0BA 4UCNA 4C7HA 2D4PA 2FE7A 4GS4A 4OAEA 4PSXA 4NEXA 2Z3OA 3JVNA 1VHSA 2FIAA 4CAWA 4U9ZA 4AVCA 4KOVA 1KZFA 4J3GA 4PK3A 3V8IA 1S7FA 1Z9UA 5FVJA 4ZBGA 3D8PA 5JPHA 1Y7RA 1IICA 4KSAA 4KOWA 4CRZB 4MY0A 1LRZA 4R57A 4CGMA 5F46A 2JEVA 1CJWA 2OZGA 3F5BA 3TCVA 2VXKA 5H86A 3EC4A 4UFWA 2PRBA 1IYKA 2B4BA 5IX3A 1YX0A 5G1ZA 2A4NA 4JWPA 1WWZA 2R8VA 3OWCA 4JJXA 1KUYA 1QSNA 3TOAA 4OADA 4A95A 3IU1A 5EBVA 4CRYB 5KTAA 3R9EA 1K4JA 1NMTA 4OLLA 3DNSA 4AVBA 2FIWA 3TFYA 2OH1A 1YLEA 3BLNA 1N71A 2Z3MA 2VBQA 4CS0B 1GHEA 2RC4A 4AG9A 3BJ8A 2Z0ZA 2HUZA 3IWEA 2OU2A 3QAHA 4X5KA 2R1IA 5HH1A 3K9UA 5AG6A 2CNSA 3I9SA 3FYNA 4CAVA 2GE3A 4NXYA 4YFJA 2G3AA 2Q04A 4IUSA 3PZJA 3R96A 3T90A 1Z4RA 3IU2A 3TOBA 2WPXA 5IB0A 2Q7BA 1Q2CA 4KOXA 4I49A 3JTKA 3D2MA 4II9A 3ZJ0A 2ZW4A 1KUXA 3CXQA 5KTCA 4HKFA 3SHPA 4XPDB 1PUAA 2VI7A 5J8FA 2B58A 4Y49C 4F0XA 2ZW7A 2J8NA 1MJBA 2KCWA 3IWGA 1QSRA 2CXAA 2Q4VA 2FCKA 3S6HA 2FS5A 1S60A 2B3UA 2REFA 4KVOE 2P6FA 4KVXA 4NF1A 4AG7A 1XE4A 2B3VA 2FL4A 3FRMA 1B87A 1ZO0A 4B10A 1S7KA 5DWMA 4R3LA 4FD4A 3EO4A 4B13A 5C88A 5H84A 5DWNA 2Z3NA 3B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWD A;  4RS2 A;  1Z4E A;  3D3S A;  2B4D B;  3H4Q A;  4QBJ A;  1B6B A;  2WPW A;  2REE A;  1OZP A;  3TT2 A;  3P2F A;  4H6U A;  3R1K A;  4EVY A;  2OB0 A;  3JUW A;  2B5G B;  5C82 A;  3CXS A;  4RI1 A;  1S7L A;  1QSO A;  3TTH A;  5JQ4 A;  5GCN A;  4E2A A;  4YRH A;  3GKR A;  3T9Y A;  1QSM A;  4F0Y A;  2I79 A;  1BOB A;  5CNP A;  3P2H A;  3R95 A;  2B5G A;  1U6M A;  2AE6 A;  2ZW6 A;  1XMT A;  4PK2 A;  3FBU A;  3WR7 A;  2QML A;  4UA3 A;  3FXT A;  1BO4 A;  4JXQ A;  4M3S A;  1YGH A;  2JDC A;  3C26 A;  2ZPA A;  1P4N A;  1VKC A;  3FNC A;  4KOU A;  4XPL A;  1QST A;  2J8M A;  3F0A A;  2CY2 A;  4UWI A;  1I21 A;  2Y0M A;  3S6F A;  2C27 A;  2JDD A;  1P0H A;  2J8R A;  3ZZI A;  2D4O A;  2O28 A;  2R7H A;  2GAN A;  1L0C A;  4R87 A;  1J4J A;  2AJ6 A;  2ATR A;  4MI4 A;  1IID A;  4QUS A;  1XEB A;  2ZW5 A;  3EFA A;  2PR1 A;  1Q2D A;  4XNH B;  3UY5 A;  4R3K A;  4HNY B;  1Y9K A;  4JLY A;  4KUA A;  1WK4 A;  4JD6 A;  1M1D A;  2FT0 A;  1PU9 A;  4FD7 A;  1YK3 A;  2JLM A;  2FSR A;  1Q2Y A;  3LD2 A;  2PDO A;  3BJ7 A;  4KLV A;  4IF5 A;  3VWE A;  4FD5 A;  4KOS A;  4K30 A;  4QC6 A;  3G3S A;  2BUE A;  1TIQ A;  2PQ8 A;  5F48 A;  4HNW B;  4DNC A;  4F6A A;  2VZY A;  4KLW A;  4FD6 A;  1KUV A;  5KTD A;  2EVN A;  2Z11 A;  3W6X A;  3I3G A;  2PSW A;  2QEC A;  3PP9 A;  4AVA A;  1XIX A;  3TE4 A;  1IB1 E;  5I0C A;  1S5K A;  3D2P A;  4B5O A;  2R98 A;  4NSQ A;  1I12 A;  1S3Z A;  5EC4 A;  3SXN A;  2CNM A;  1YRE A;  4MJ8 A;  1XF8 A;  3FIX A;  4MY3 A;  3G8W A;  4KOY A;  4KZT A;  2VEZ A;  1MJA A;  4MHD A;  2BL1 A;  1M4G A;  1ON0 A;  1MK4 A;  4KOT A;  4HNX B;  3W6S A;  4YGO A;  2NMT A;  3MGD A;  3DDD A;  3TO6 A;  4XPD C;  2H5M A;  5ISV A;  1S7N A;  4R9M A;  1M4I A;  2ARH A;  3N7Z A;  4U5Y A;  2VZZ A;  4KVM E;  2VQY A;  4B5P A;  5HMN A;  4CAX A;  3S6K A;  4E0A A;  2Q4Y A;  1UFH A;  3DSB A;  1NSL A;  2Q0Y A;  3QB8 A;  2BSW A;  4AB7 A;  3SXO A;  2I00 A;  5E96 A;  3GYA A;  1YR0 A;  1RO5 A;  3CXP A;  2P0W A;  2X7B A;  1YVO A;  4UBR A;  3GY9 A;  1RXT A;  2Z10 A;  3NE7 A;  4KOR A;  4U9Y A;  5F47 A;  2EUI A;  4XPK A;  5F49 A;  3R9G A;  2QIR A;  3DR6 A;  4PV6 A;  3RYO A;  3DR8 A;  3W91 A;  4H89 A;  4LUA A;  4ORF A;  2BEI A;  4KUB A;  4NCZ A;  3EXN A;  4BMH A;  2HV2 A;  1MJ9 A;  3TO9 A;  3LOD A;  4XNH C;  3EY5 A;  2PC1 A;  1M4D A;  2ZXV A;  2DXQ A;  2HQY A;  3KKW A;  3S6G A;  3IGR A;  1NE9 A;  4QB9 A;  3PGP A;  1R57 A;  4M85 A;  3F8K A;  4PSW A;  2PR8 A;  2IL4 A;  2FXF A;  2P6G A;  4QVT A;  4LX9 A;  2P6E A;  4MBU A;  3E0K A;  2OZH A;  2Q44 A;  5IV0 A;  4H6Z A;  1I1D A;  1SQH A;  4L8A A;  4JXR A;  4B5P B;  2GIV A;  4UWJ A;  2G3T A;  1FY7 A;  1Y9W A;  1V0C A;  1CM0 A;  2F5I A;  2B4D A;  4Y49 B;  2K5T A;  1IYL A;  2CNT A;  4ONU A;  4L89 A;  5J8C A;  4E8O A;  3TO7 A;  2OZU A;  1YVK A;  1M44 A;  3R9F A;  3FB3 A;  2G0B A;  2D4P A;  2FE7 A;  4GS4 A;  4OAE A;  4PSX A;  4NEX A;  3JVN A;  1VHS A;  2FIA A;  4CAW A;  4U9Z A;  4AVC A;  4KOV A;  1KZF A;  4J3G A;  4PK3 A;  3V8I A;  1S7F A;  1Z9U A;  5FVJ A;  4ZBG A;  3D8P A;  5JPH A;  1Y7R A;  1IIC A;  4KOW A;  4CRZ B;  4MY0 A;  1LRZ A;  4R57 A;  5F46 A;  2JEV A;  1CJW A;  2OZG A;  3F5B A;  3TCV A;  2VXK A;  5H86 A;  3EC4 A;  2PRB A;  1IYK A;  2B4B A;  5IX3 A;  1YX0 A;  2A4N A;  4JWP A;  1WWZ A;  2R8V A;  3OWC A;  4JJX A;  1KUY A;  1QSN A;  3TOA A;  4OAD A;  5EBV A;  4CRY B;  5KTA A;  3R9E A;  1K4J A;  1NMT A;  4OLL A;  3DNS A;  4AVB A;  2FIW A;  3TFY A;  2OH1 A;  1YLE A;  3BLN A;  1N71 A;  2VBQ A;  4CS0 B;  1GHE A;  2RC4 A;  4AG9 A;  3BJ8 A;  2Z0Z A;  2HUZ A;  2OU2 A;  3QAH A;  4X5K A;  2R1I A;  5HH1 A;  3K9U A;  2CNS A;  3I9S A;  3FYN A;  4CAV A;  2GE3 A;  4NXY A;  4YFJ A;  2G3A A;  2Q04 A;  4IUS A;  3PZJ A;  3R96 A;  3T90 A;  1Z4R A;  3TOB A;  2WPX A;  5IB0 A;  2Q7B A;  1Q2C A;  4KOX A;  4I49 A;  3D2M A;  4II9 A;  3ZJ0 A;  2ZW4 A;  1KUX A;  3CXQ A;  5KTC A;  4HKF A;  3SHP A;  4XPD B;  1PUA A;  2VI7 A;  5J8F A;  2B58 A;  4Y49 C;  2ZW7 A;  2J8N A;  1MJB A;  2KCW A;  3IWG A;  1QSR A;  2Q4V A;  2FCK A;  3S6H A;  2FS5 A;  1S60 A;  2B3U A;  2REF A;  4KVO E;  2P6F A;  4KVX A;  4NF1 A;  4AG7 A;  1XE4 A;  2B3V A;  2FL4 A;  3FRM A;  1B87 A;  1S7K A;  5DWM A;  4R3L A;  4FD4 A;  3EO4 A;  5C88 A;  5H84 A;  5DWN A;  3B8G A; 
#chains in the Genus database with same CATH topology
 4HNA A;  4XBF A;  4MFZ A;  3N2K B;  4FBE A;  4CGN A;  4OC0 A;  4UXN A;  5C8Y B;  3D3S A;  3ABT A;  2Q69 A;  4X1K A;  3TT2 A;  1Q90 D;  3P2F A;  1K4D C;  2P06 A;  2OYQ A;  3L70 H;  2POK A;  2EUL A;  4H6U A;  3OM3 B;  1KUQ A;  2PZS A;  1YW6 A;  1CBX A;  2WA4 A;  4C7I A;  2ZEM A;  3JUW A;  1H2M A;  3CME V;  2ZNI A;  4GZR B;  3LSQ A;  3FFQ A;  4MFL A;  4LNU A;  4EFE A;  3CXS A;  1AJQ A;  4TT3 G;  1U96 A;  2ITD C;  5GCN A;  4E2A A;  1Q6H A;  4PA4 A;  4F4L A;  3GKR A;  3ABM C;  5L3D A;  5IYZ A;  2EIJ B;  1W59 A;  2X6C A;  5L3F A;  2I79 A;  3H8G A;  2K9P A;  3T1H O;  1GYT A;  4H0L B;  4Q7A A;  4PA7 A;  4K8X A;  4NGS A;  4UCO A;  4PHZ A;  1MZE A;  3OMA B;  3SJF A;  3SPC A;  4MCS A;  4RWU A;  2A9H A;  1U6M A;  3LDD A;  2AE6 A;  5H9C A;  1LAM A;  3FD9 A;  1XMT A;  5BR8 B;  4PK2 A;  4WFH A;  1N32 O;  3K08 A;  2R72 A;  4NXN B;  2QML A;  2ZR3 A;  4Q6G A;  1BL8 A;  1ZLZ A;  3FB5 C;  2QKC A;  4M3S A;  4PA9 A;  3ZMS A;  4A2Z A;  1SQX H;  3L2N A;  2JDC A;  1YTF B;  4KHP O;  3F7Y C;  1VKC A;  2MW2 B;  3SGI A;  4HAM A;  1TF8 A;  5JH7 A;  1WB7 A;  4JI2 B;  4YU9 A;  4X66 O;  3RO0 A;  2ZM6 O;  4B6Z A;  2ZEH A;  1SC5 B;  2EZO A;  3LMS A;  1P7B A;  3WAB A;  3H1H H;  4DV3 O;  5ELY A;  1GRJ A;  1P0H A;  1G1X B;  2GV9 A;  2O28 A;  1KQS U;  1XMB A;  2GAN A;  4FLZ A;  4JI6 O;  3E8F A;  3B2E E;  1RM1 C;  1SER A;  2ATR A;  4C2Y A;  4KHP B;  4ZX8 A;  4BIZ A;  1MNG A;  4PXC A;  2HFE C;  2WLK A;  2ZXW B;  3BPZ A;  5LOV A;  4JTD B;  3IEH A;  1OBR A;  4MVM A;  5E79 Z;  3W7U A;  2K1E A;  2Y4T A;  5KA5 A;  1Z5V A;  4YJ3 A;  3R66 A;  2OIE A;  2P90 A;  1VQO V;  3K03 A;  3D66 A;  3UY5 A;  4F9V A;  4JLY A;  5LMU O;  4NVP A;  3ZRS A;  1H38 A;  2QJ1 A;  1BPN A;  2QDO A;  2GU2 A;  1B3Q A;  3P30 A;  4WCE V;  2QKA A;  4GKK B;  4DV0 B;  1FXV A;  5EZY A;  5EBW C;  4NJQ A;  1KP3 A;  5AG7 A;  1TUE B;  4XDL A;  5GON B;  2JLM A;  5LGN A;  2FSR A;  3LSU A;  1Q2Y A;  4MCP A;  1V54 C;  2PDO A;  4Z1M G;  4TV8 A;  4KLV A;  2Y69 B;  4IF5 A;  2ZEO A;  2GFQ A;  4K30 A;  2OCC C;  2UUC B;  2HB6 A;  1PD3 A;  1FJG B;  1TIQ A;  2R9R B;  5A28 A;  2DYR B;  2WLL B;  4OME A;  3FVL A;  2PQ8 A;  5EMI A;  4YHH B;  4F6A A;  5LBQ A;  2KG7 B;  4KLW A;  4PI0 A;  4JYW A;  5HVF A;  3K58 A;  2Q4P A;  4JAA A;  1XBU A;  2P5O A;  4MFJ A;  4I0X B;  3K5N A;  3SJB C;  3UM7 A;  2PJ4 A;  1BT8 A;  4UEZ A;  4OKO A;  4Q36 A;  2FTK A;  2Z11 A;  2GTS A;  5L3G A;  2ZEE A;  4IYH A;  3EVK A;  3RNZ A;  3LNN A;  2KG7 A;  2JIZ G;  1XIX A;  5LHH A;  5LXT A;  3H1I H;  2JGD B;  4B3T O;  3D2P A;  3FKS G;  2CAZ C;  2R98 A;  2GBO A;  1BQZ A;  1KP2 A;  5D5P A;  4LF7 B;  3CZX A;  1MMM A;  1WP8 A;  3ICX A;  3B35 A;  1NVP B;  4MJ8 A;  3FIX A;  2KB1 A;  3GWO A;  5HXD A;  3NR7 A;  5JJN B;  3F5T A;  4KZT A;  2VEZ A;  4AXV A;  3D68 A;  5C93 A;  5I4M A;  1AYE A;  1M4G A;  2ZEL A;  4UCM A;  2BE3 A;  1VQN V;  1M57 B;  3X2Q C;  3IWW A;  3T1Y B;  8CPA A;  4IYI A;  2PGG A;  3W6S A;  1KYO F;  3L75 H;  2E5L B;  3EFF K;  2NMT A;  3VOU A;  3ZHV A;  4JV5 O;  2EK9 A;  1PPJ H;  3B3S A;  2WSS G;  4KUM A;  3BVO A;  5LRJ A;  3KI9 A;  1L1F A;  5EZY B;  3CD6 V;  3QF7 A;  4ZI7 A;  1M4I A;  5DEC A;  3ETD A;  2YXY A;  1HNZ O;  3N7Z A;  2GLJ A;  1MA1 A;  4B12 A;  2VZZ A;  3JAR B;  3SI1 A;  5IYB O;  4DV5 B;  2ZE8 A;  3CWB H;  3B40 A;  5HMN A;  4TV8 B;  3KL9 A;  3ZMV A;  4P4D A;  3SJE A;  2Q5Z A;  4P4I A;  2Q4Y A;  3PB4 X;  3ZHT A;  3JAK A;  4MCQ A;  3ZN1 A;  4RUE A;  2PF4 E;  1TGO A;  2EX3 A;  1BPM A;  1IDS A;  3RYI A;  1V55 B;  3B3W A;  5E96 A;  5THW A;  1NH2 B;  3H1L H;  4OX9 O;  3VH9 A;  3MRU A;  3M7M X;  3CC4 V;  1TVK B;  3SJG A;  1M4L A;  3ZMU A;  2EIM C;  3AG3 B;  4K35 A;  1YVO A;  4MHZ A;  1PL0 A;  2D2C B;  3JAW A;  1RXT A;  4WFA V;  4DUZ B;  2H8P C;  3NE7 A;  3DLJ A;  5JCO A;  1YSC A;  4U9Y A;  3CRM A;  1L0N H;  4XPK A;  2QIR A;  5LA6 A;  1Y76 B;  3VQV A;  4YJ3 B;  3RGB A;  4JAS A;  3ETE A;  4MRI A;  2PRQ A;  3J80 N;  4MVQ A;  3F7V C;  3W91 A;  2Z3K A;  4H89 A;  4UCV A;  3PJS K;  1RM1 B;  4NCZ A;  3EXN A;  5JVD A;  5CN0 A;  5L3B A;  4JI5 O;  4LR3 A;  3TO9 A;  1GTO A;  2IJH A;  5GTH Z;  4XNH C;  1SF9 A;  4L87 A;  1CEZ A;  2DXQ A;  2CTP A;  4NYK A;  2WWW A;  3S6G A;  4M6I A;  4P4F A;  1R57 A;  5KLV H;  4M85 A;  4I55 B;  2LQT A;  2Q7G A;  2WSA A;  1MSW D;  2HR3 A;  4XDJ A;  1JR9 A;  2IL4 A;  1DF4 A;  1HW7 A;  4UFX A;  4Z2W A;  2P6G A;  1OZ0 A;  2P22 C;  4CC5 A;  4FMT A;  1XIL A;  4UF4 A;  4E4E A;  4RO2 A;  1K3E A;  2B5U A;  5GW7 A;  2L35 A;  2OZH A;  4L8A A;  1VQ4 V;  2EJ7 A;  1QLN A;  2GIV A;  3ETQ A;  2ATK C;  2ZIN A;  1A2Z A;  3VQW A;  1XDC A;  5KMG A;  2D3O W;  1FY7 A;  1XNQ O;  1COW G;  4CYP A;  4UB8 Z;  1CM0 A;  2B4D A;  2PYL A;  2UXB O;  2NLJ C;  2BTQ A;  2WLJ A;  1XNR O;  2CNT A;  1AI6 A;  4ONU A;  5J8C A;  2QVP A;  3TO7 A;  1M1K W;  4CGL A;  3LDE A;  3ASN B;  4UIA A;  3AG2 C;  5IY5 B;  1IXM A;  1DTO A;  1F2O A;  4CPA A;  3R9F A;  4IHM A;  5FNV B;  3D8C A;  4UCN A;  1GN4 A;  2YEV B;  1ZLH A;  4X64 B;  4OAE A;  2C6P A;  5B1O A;  4TUY B;  3FJU A;  1VHS A;  3G4S V;  3SR2 C;  1NR7 A;  2UUA O;  4ZI7 B;  4DW0 A;  1VF7 A;  3STL C;  4AVC A;  4KOV A;  3PFO A;  1XOU A;  1Z9U A;  2AFW A;  3CCM V;  1VGY A;  1AR4 A;  1H2L A;  5FVJ A;  4ZBG A;  2Y0I A;  3GVM A;  3D8P A;  3BEH A;  4O4L B;  3RT3 C;  4ZHQ B;  4KSA A;  4KP4 A;  3QO7 A;  1NT2 B;  3CP1 A;  3PEI A;  3QO5 A;  3A0B Z;  3GLJ A;  4FM1 A;  4P45 A;  5J2U B;  5KAF Z;  2BOA A;  4EEQ A;  2ADQ B;  5B1N A;  2VXK A;  5H86 A;  3EC4 A;  2QM8 A;  2YDE A;  1IYK A;  2B4B A;  1W2B U;  3OW2 U;  4FLV A;  1XHX A;  1YX0 A;  3NFZ A;  3IC9 A;  2WLH A;  2J9A A;  4JWP A;  4RN7 A;  4JJX A;  1EN6 A;  3MDS A;  4QE9 A;  1JMK C;  3ABM B;  4X8I A;  4A95 A;  1JA8 A;  4FFK A;  1I08 A;  5KTA A;  4I55 A;  1K4J A;  1NMT A;  3JAT B;  2BSK A;  3E2E A;  2OH1 A;  4ZX9 A;  1N71 A;  2JEX A;  4NTW A;  3CPX A;  3UQ8 A;  3ZCC A;  2CTB A;  2NNU A;  5FLX N;  2F23 A;  5CA1 A;  5JCO C;  4U7O A;  3QAH A;  4X5K A;  3K9U A;  2CNS A;  3HKB B;  2GE3 A;  2G3A A;  1S5J A;  1N4C A;  4JV5 B;  2V8D A;  2VQE O;  1IBL O;  1OV9 A;  5FL7 G;  4X1I A;  2DMX A;  4N23 A;  1CPX A;  3TOB A;  2Q7B A;  1Q2C A;  4DJL A;  3GIU A;  1RSO B;  4II9 A;  4DR1 O;  2WLM A;  2F4V B;  3ZHR A;  3ZJ0 A;  1O9H A;  3HKE A;  1FFT B;  2XAH A;  3PBB A;  4HKF A;  3PB7 X;  1UFI A;  1PUA A;  4R7M A;  2B58 A;  4F9U A;  4R8C A;  2KCW A;  4YXW G;  1AB3 A;  1TXR A;  3K79 A;  3HR0 A;  2FCK A;  1AI4 A;  4JYB A;  1S60 A;  1XUQ A;  5TIS Z;  2PVW A;  2PJC A;  2EIL B;  3CCQ V;  3ZRW A;  4KVX A;  1Y6X A;  4EB6 A;  2UU9 O;  4O4I A;  5IJ9 B;  4O4J B;  3RW0 A;  3HKD B;  2IU0 A;  1ZL8 A;  4LF9 O;  1ZX3 A;  5DWM A;  1TA8 A;  2QWQ B;  5JQG B;  3EO4 A;  2KSD A;  4LFA B;  1SQV H;  1WA8 A;  1M56 B;  4DV1 O;  2Z3N A;  4UIB A;  4F8Z A;  2ZOF A;  3HLP A;  1IBM O;  1R73 A;  4MTG A;  4K3N A;  1XMQ O;  3IC7 A;  2YSU B;  2A06 H;  4JTC B;  1Z4E A;  4RS2 A;  2B4D B;  3H4Q A;  4LFC B;  4DR3 O;  2B1G A;  3SPJ A;  1HNZ B;  1CP9 A;  3EXA A;  2REE A;  2C6C A;  4JI5 B;  2AFZ A;  4EVY A;  4QIW F;  1S5L Z;  1HR0 B;  1FYJ A;  5B3S B;  2W0F C;  3BA9 A;  4JI7 O;  3KR5 A;  2B5G B;  3JAS B;  4CYN A;  5LHI A;  5FNV A;  5C82 A;  1S7L A;  4UVC A;  2IM9 A;  1P49 A;  2B9Z A;  3O65 A;  4PEL A;  3WG7 C;  1QSM A;  3E89 A;  5CB4 B;  4HBN A;  4PV1 B;  4KSF A;  4JI0 O;  5CNP A;  4DK0 A;  2YND A;  1MZF A;  1G4Y B;  2B5G A;  4AI8 A;  1SZX A;  2ZW6 A;  1HR0 O;  4WBN B;  3WR7 A;  4ONW A;  1FXH A;  2UXX A;  3ASN C;  3ZN0 A;  1DK1 A;  4WFE A;  3FXT A;  5EK0 A;  4JXQ A;  4MHP A;  1YGH A;  2E3C A;  1Z8W A;  5DS0 A;  1ZUQ A;  1WJZ A;  3C26 A;  4BBH A;  3ZED A;  3VQX A;  4MVO A;  5EBL C;  1K33 A;  3FNC A;  5B3S C;  4KOU A;  4QJF B;  1VF5 B;  4ZKI A;  2E75 B;  2ZQM A;  2RFH A;  3F0A A;  1I21 A;  3S6F A;  2VL1 A;  4NTX A;  4MXU A;  1R1B A;  1DLB A;  4LNU B;  1QVF U;  2D4O A;  1KB9 F;  1QHT A;  4CAF A;  1LFW A;  2R7H A;  4TWK A;  5IJ9 A;  3V38 A;  3JYC A;  3PFE A;  4GYC B;  4R87 A;  4QE7 A;  1J4J A;  3B8N A;  4MI4 A;  3N2K A;  4MVR A;  1IID A;  1LOK A;  4QUS A;  5A27 A;  4MW8 A;  5C8Y A;  4BIO A;  2BOB C;  1EE3 P;  4DV2 O;  3B09 A;  4CS3 A;  2VWK A;  2QE7 G;  5L3E A;  4OC2 A;  4P9P A;  1IBK B;  3EFA A;  4A33 A;  4A38 A;  1Q2D A;  1RFY A;  4R3K A;  1Y9K A;  4I5S A;  4KUA A;  1FXK C;  2IU3 A;  4X65 O;  3K5O A;  2F43 G;  3CHX A;  3ASO C;  1K5S A;  4ABM A;  1NZ6 A;  2YC0 A;  2XT9 A;  1IVS A;  1M1D A;  2DW4 A;  1VQ7 V;  1M5I A;  1PU9 A;  4FD7 A;  3APO A;  4WFF A;  3ABL B;  1NH2 D;  3TX8 A;  5IE9 A;  4DV2 B;  2DJV A;  4C7U A;  2PJ7 A;  3T4Z A;  2GLF A;  4YIP A;  4U3J B;  1TUB A;  4FD5 A;  3B77 A;  4MVZ A;  1I94 O;  3H8F A;  1Y67 A;  1IU8 A;  3ZX6 A;  2PJ6 A;  4OPH A;  3QO8 A;  3K04 A;  2ZE5 A;  4DNC A;  1H2S B;  4R8F A;  2HKO A;  1N8R W;  1F2P A;  3D36 C;  1VHE A;  1AR1 B;  3VAT A;  3WU2 Z;  1TKJ A;  1MOF A;  4DR4 B;  3MN8 A;  1P84 F;  2V8H A;  3BHP A;  2OTL V;  2XUM A;  2ZXW C;  3CXC U;  3CX5 F;  3I3G A;  1H2G A;  4KL1 A;  2PSW A;  5IWA O;  3SJA C;  4I50 B;  4R6Z A;  4QNH B;  2QEC A;  4AVA A;  4GT1 A;  1I94 B;  1VQ9 V;  4UCS A;  2EZP A;  4PA6 A;  2P67 A;  3T1C A;  3CCS V;  1N34 B;  1IB1 E;  1BCC H;  3JAR A;  5LYL A;  5LYF A;  2PY5 A;  2ZDI A;  3CRQ A;  1IXB A;  4DR7 O;  1V54 B;  1OCZ B;  3CCV V;  4LF4 O;  1BZK A;  2YNC A;  1YF2 A;  3S9N A;  2DPT A;  5EC4 A;  4FJC C;  4MCR A;  2CNM A;  1YRE A;  2PVV A;  1PCA A;  1NBM G;  4J80 A;  2FVG A;  4KS9 A;  1XBL A;  1K7D A;  4KOY A;  1SQQ H;  2F95 B;  3JCU Z;  3RWR D;  1MJA A;  2BL1 A;  1AI5 A;  3KQX A;  4K3A A;  1BAV A;  4MTO A;  1OCR B;  1MK4 A;  4MT8 A;  5FPR A;  4HNX B;  4Q38 A;  2AW9 A;  4GLX A;  3UT5 A;  2Z3L A;  1S77 D;  5LYI A;  4AQY B;  3HKB A;  4DV6 B;  2EIJ C;  5GON A;  2VWJ A;  3P3N A;  2BCC H;  4A31 A;  5DN6 G;  4DO2 A;  1S7N A;  4MTX A;  5ISV A;  1AMP A;  4OX9 B;  2XEF A;  1KC8 W;  1JFF B;  1B06 A;  4A32 A;  4H13 B;  2PIY A;  2XEI A;  2AFU A;  2PJ5 A;  2YIA A;  1JX9 A;  3H1J H;  5LXT B;  4U5Y A;  1Q6U A;  3DTU B;  1GK9 A;  1OHH G;  3KKY A;  3K57 A;  4JI7 B;  4Z65 A;  3JSN A;  5B5E Z;  4CAX A;  5LYJ A;  3S6K A;  1F7Y A;  4IIJ A;  1UFH A;  1NS1 A;  1Y74 A;  2A3Q A;  1Z2L A;  3APQ A;  3QB8 A;  3ZRV A;  5GTI Z;  2LO1 A;  3WC6 A;  1KBH A;  1EN5 A;  4CYO A;  3B2Y A;  3GYA A;  1YLO A;  3GUX A;  5KX5 A;  4X66 B;  2CK3 G;  1U97 A;  1VF6 A;  3E22 A;  3CCJ V;  2P0W A;  2X7B A;  2DF5 A;  5B1A C;  1ZG7 A;  1SRY A;  1Y7E A;  4UBR A;  2UUB B;  1WN7 A;  4MMO A;  2OCC B;  2UUC O;  5CBF A;  4A30 A;  5F47 A;  1P7G A;  2A79 B;  3WG7 B;  2YNE A;  2EUI A;  6CPA A;  1F4N A;  1FKA O;  3CPW U;  4BR6 A;  1K8A W;  5LP6 A;  4UV9 A;  1VAR A;  1CPY A;  1IBM B;  4X9Q A;  5LRG A;  5JH7 B;  1QLE B;  3AK2 A;  1YW4 A;  4LUA A;  5K8P A;  4DR3 B;  4LFC O;  2AHY A;  4DR2 O;  2LFR A;  2QWR B;  2WYR A;  3AG7 A;  3V7Z A;  1SET A;  3U11 A;  4C2Z A;  1XEQ A;  4BMH A;  2Q0O C;  2HV2 A;  2CTQ A;  4YIO A;  1K34 A;  4DUY O;  2BO9 A;  4CAE A;  1N33 B;  2YIB D;  4EFB A;  1M4D A;  3OEE G;  4CGP A;  3KKW A;  2ZKO A;  4JI3 O;  3SYO A;  2PJ2 A;  3JRU A;  3RYI B;  2FXF A;  5LOV B;  5EBM C;  4QVT A;  1X59 A;  4DXW A;  1YIJ V;  4UEF A;  4JYA B;  5H6Q A;  4MBU A;  1MAB G;  2B1I A;  1SQH A;  1IBK O;  3E8G A;  1HNX O;  3PB9 X;  4UWJ A;  5CA0 A;  2JJ1 G;  2WLI A;  1Y9W A;  2PE3 A;  2WUU A;  2YIC A;  2ODM A;  1IYL A;  3AEI A;  1BHA A;  3RYF A;  2YNC C;  1SA0 B;  4P9O A;  3B8M A;  1VQ5 V;  4B3M B;  4DRX B;  1NTM H;  3SJQ C;  4I4T B;  2G0B A;  2QR4 A;  3CC2 V;  2EBJ A;  1AIL A;  2FIA A;  3RAM A;  5LYD A;  2F66 C;  1HWY A;  2CE4 A;  3L72 H;  4X1K B;  4FVM A;  4DV7 B;  1CP6 A;  3BI1 A;  1OCC B;  5LRK A;  5HFM A;  5JPH A;  1Y7R A;  1IIC A;  4MY0 A;  3RYC A;  1LRZ A;  2JDI G;  2PJ0 A;  2YIB A;  2ZED A;  2DN9 A;  3DXR B;  1SQG A;  5F46 A;  2EIM B;  3AG3 C;  1N36 O;  3M99 B;  1K9M W;  3F5B A;  2XAG A;  1PP9 H;  3FYE B;  1YME A;  5IX3 A;  2GTA A;  2C2A A;  5G1Z A;  4LF4 B;  1WWZ A;  2ODF A;  3K9T A;  4MHY A;  1QSN A;  3SI0 A;  4OAD A;  2OT5 A;  3E86 A;  3H8E A;  4X20 B;  3IU1 A;  2P6J A;  1F51 A;  1LNQ A;  4AIL C;  4UFZ A;  5HFL A;  4LF5 B;  3QNE A;  4JPR A;  2LP7 A;  4JZ0 A;  2LFS A;  4X1Y A;  4AVB A;  1D5N A;  4L8J A;  2CTC A;  4MVS A;  3TFY A;  4FK5 C;  1FS0 G;  7CPA A;  1I0H A;  3KZW A;  2Z3M A;  2HP8 A;  1RSO A;  1GHE A;  1QQ9 A;  4O4J A;  4CS0 B;  1G8M A;  3BJ8 A;  3H9V A;  4NGQ A;  2HUZ A;  1S5H C;  2QA4 V;  2OU2 A;  4NFR A;  4CAV A;  3I5D A;  3NA6 A;  4NXY A;  1I5X A;  1PYT B;  4AQY O;  1FAF A;  3PZJ A;  1OCC C;  1KU9 A;  4A5U B;  2QYV A;  1Z4R A;  3T90 A;  2XAF A;  4OC5 A;  4KOX A;  4CH6 A;  4UVB A;  4YY3 O;  4I49 A;  1MG1 A;  2RQ6 A;  3ZHQ A;  5D29 A;  3D2M A;  5CA1 B;  2LGQ A;  4O4I B;  3R65 A;  2ZW4 A;  4DRX A;  4DUK A;  1KUX A;  4JI6 B;  1ZL8 B;  1XNQ B;  3FH4 A;  4J9Z B;  5J8F A;  1Q5O A;  4Y49 C;  4F0X A;  1AUG A;  4BD9 A;  3PRT A;  2J8N A;  1BS3 A;  4J10 A;  3HUV A;  1THZ A;  1QSR A;  2PTM A;  3D67 A;  1KWM A;  4B3S B;  2Q4V A;  3BAB A;  3CB2 A;  1YSJ A;  3S6H A;  1JJO A;  2ZEP A;  2RMK B;  4J11 A;  4ZHQ A;  2REF A;  3E35 A;  4LH7 A;  3LAC A;  1Q7Y W;  2P6F A;  1VQ8 V;  3S3W A;  1YXB A;  4NF1 A;  4MW3 A;  2IH3 C;  2B3V A;  5IDJ A;  3FRM A;  3SJX A;  3MHH C;  1B87 A;  4UV8 A;  5KHJ A;  1ZO0 A;  1R3L C;  2HG5 C;  2HHH B;  4O2B B;  3KCY A;  3HKC B;  5K8O A;  3CC7 V;  5H84 A;  4UVA A;  4X1I B;  3RFR A;  3CCE V;  3IAY A;  3B8G A;  4TQD A;  1OCO B;  3JD0 A;  1R6N A;  4ZI6 A;  3FX6 A;  2OCH A;  2HEP A;  3DGE A;  3VWD A;  4UCR A;  2XOK G;  4QBJ A;  1B6B A;  2WLL A;  4BW5 A;  2WPW A;  1OZP A;  4UCU A;  2CIJ A;  3S9M A;  4JI8 O;  4JZ2 A;  1EFR G;  3HKC A;  1XI1 A;  1YI2 V;  5JQG A;  3UO3 A;  3NH4 A;  3X2Q B;  2YS8 A;  2N74 A;  4GXH A;  4WBN A;  4JI3 B;  1XRE A;  4H37 A;  4IT5 A;  4LF8 B;  3D7F A;  5JQ4 A;  1XNR B;  2E5L O;  1VQP V;  3NE8 A;  2N05 A;  4QGP A;  3ZRW B;  2IJJ A;  4LCU C;  4DW1 A;  5CBH A;  1AI7 A;  3S9L A;  2V8G A;  1BOB A;  3E8B A;  4JYA O;  3R95 A;  1XMO B;  4IAV A;  3BHX A;  4P6Y A;  4MFP A;  3JAS A;  1IOF A;  4PJ0 Z;  4DV5 O;  3FBU A;  2HLD G;  2UXC O;  4PDV A;  4B3T B;  2KKW A;  4UA3 A;  4X1Y B;  1BO4 A;  4NB5 A;  3ETG A;  1XFO A;  4LF7 O;  2DPS A;  2Z3P A;  5L3C A;  1H8E G;  1QNM A;  4AHC A;  2ZPA A;  2GDS A;  3JAL B;  1P4N A;  3OUF A;  3WT4 A;  3M8A A;  2JEU A;  5KHI A;  2Q68 A;  1QST A;  4DR2 B;  5B1B C;  5JH9 A;  2J8M A;  2CY2 A;  3K06 A;  1VIB A;  2ZE6 A;  4TOI A;  2FB5 A;  4PXB A;  1YZB A;  3UCS C;  4DUY B;  1YIT V;  1Z8X A;  2PCU A;  1SQF A;  4EFD A;  1UPG A;  3EHB B;  3JD1 A;  3ZZI A;  1JJ2 U;  1BQ0 A;  2HJD A;  1M57 C;  4ZBM A;  4DR6 O;  1I5Y A;  2KQX A;  4FLY A;  3FEE A;  5KUK A;  1L0C A;  3TC8 A;  3CMA V;  1B04 A;  5JJJ B;  2Q43 A;  2AJ6 A;  3AG2 B;  5CB4 A;  5IY5 C;  2ILM A;  4KXR A;  3RZA A;  4ZOL A;  2IH1 C;  4R6T A;  4R76 A;  1VQK V;  4HPS A;  5A9G A;  5BMV A;  1CPS A;  4LP8 A;  4UCP A;  3ZHS A;  4JGS A;  4PDM A;  1ZTE A;  4JYY A;  1TKF A;  1XEB A;  2CH7 B;  4DK1 A;  1FD9 A;  1R3N A;  3CPA A;  5HVH A;  3TCU A;  1X4T A;  3A9L A;  3JAK B;  4FWU A;  3D36 A;  2ZCE A;  2RDC A;  1MSD A;  3K5M A;  3JD4 A;  4HNY B;  5KA6 A;  4ASU G;  1IOI A;  4HZ3 A;  3LUT B;  2E76 B;  2ZD9 A;  2V8V A;  5KHH A;  4GKJ O;  2PJB A;  2LGW A;  1W0K G;  1NSA A;  3LDC A;  4FM0 A;  4TNU A;  3P3P A;  1AR5 A;  4FLW A;  2FT0 A;  2EK8 A;  3WFV A;  4B11 A;  1KMI Z;  1GO3 F;  1XL4 A;  5LMN O;  3CRA A;  3J81 N;  4N21 A;  3LD2 A;  5G20 A;  2XAS A;  4LF5 O;  4G28 B;  1XOV A;  3ASO B;  4W4K A;  3BJ7 A;  5IB9 A;  5IWA B;  1SQB H;  2F7V A;  2ABZ A;  3VWE A;  1YEW A;  3FB8 C;  4KOS A;  3K0G A;  2ZEN A;  4IGG A;  4I4T A;  4QC6 A;  3G3S A;  3ABL C;  3AG1 C;  2QWO B;  2ZIO A;  4HNW B;  4P4B A;  3K9A A;  2IQ6 A;  5KHG A;  5BWA B;  5J1Q A;  4I7Z B;  1HNW O;  4IHJ A;  4OC3 A;  3D7H A;  3AG1 B;  4FD6 A;  1KUV A;  2QWP B;  3UT5 B;  4WJB A;  1VIX A;  5CPA A;  5G22 A;  3KQZ A;  5KTD A;  4ZY1 A;  1JQ0 A;  3RVZ A;  4F6R A;  2EVN A;  3IIB A;  2IW5 A;  4X3R A;  1VQ6 V;  1T5E A;  1GM9 A;  1DF5 A;  3VBB A;  3FB7 C;  2DEA A;  1XQ8 A;  1N36 B;  3ISZ A;  2AGA A;  3IJ4 A;  3PP9 A;  4FUU A;  5DED A;  1R3J C;  4LH6 A;  5BR8 O;  2LW1 A;  3I1U A;  3CSX A;  5H5N A;  3TE4 A;  1BGY H;  2YI8 A;  1X12 A;  1RPO A;  3L74 H;  4K0K B;  4B5O A;  4I9Q A;  2IJZ A;  4F6E A;  1HNW B;  1S3Z A;  1BLL E;  3DSQ A;  4ZOL B;  2DYS C;  3ZRX A;  1WPX A;  1XF8 A;  4A94 A;  1QR8 A;  3VAR A;  4J7K A;  4FAI A;  4MY3 A;  1BHB A;  3K0D A;  5A2Q N;  3G8W A;  2Y48 A;  2R9I A;  4NGP A;  1LR1 A;  1Q86 W;  2W0X A;  3H5Z A;  4MHD A;  2QSA A;  1S0V A;  1ON0 A;  2CF4 A;  1IX9 A;  3KG2 A;  4KSI A;  1DTD A;  1KKD A;  1Q3E A;  4MVU A;  4J42 A;  1F23 A;  1JWQ A;  3DGV A;  3FB6 C;  4J7Z A;  1DE4 C;  3DDD A;  4GUN A;  1KEC A;  5LL6 Y;  5KHK A;  5FPO A;  4XPD C;  2X0L A;  2W6I G;  4OC4 A;  2ARH A;  3ZMT A;  2UXD O;  3J7A U;  1ELM P;  3PN1 A;  2BTO A;  3PB8 X;  5KMG B;  3CT9 A;  2JEW A;  4JI8 B;  1Z2G A;  3RYH B;  4JZG A;  2VQY A;  5KUM A;  2ADP A;  3GB7 C;  1ZG8 A;  4B5P A;  1NKD A;  1TVK A;  3I55 V;  2F93 B;  4CH3 A;  1H8L A;  4E0A A;  5JM6 A;  4JF3 A;  1BE3 H;  5JGF A;  3DSB A;  4LF8 O;  2Q0Y A;  2W6J G;  2CDY A;  2V4D A;  1SQP H;  3K59 A;  2CTW A;  5EYP A;  3SXO A;  4NXM O;  2I00 A;  1GN6 A;  4K8Z A;  2YI9 A;  1E1Q G;  4NGN A;  5H6R A;  1VQL V;  1RO5 A;  3OFN G;  3KCX A;  3KAS A;  4B7E A;  1YTF D;  2PIZ A;  4ZGY B;  3GY9 A;  2Z10 A;  3CJH A;  2PJA A;  1K97 A;  2YUA A;  2Y0P A;  4KOR A;  2CH7 A;  2M7W A;  2Q67 A;  1RTQ A;  5AG5 A;  3OR7 C;  5F49 A;  3R9G A;  4X8A A;  3W7X A;  3GWK C;  5CA0 B;  4B7K A;  1D5A A;  4PV6 A;  3RYO A;  4BIN A;  3DR8 A;  3CYO A;  4LWS B;  4UUJ C;  3Q4H B;  2V7Q G;  4B3R O;  3T2M A;  1EM1 A;  3SYP A;  3QG5 A;  4NJR A;  5G21 A;  2O53 A;  3FX7 A;  3K9S A;  4FZ1 A;  1QQC A;  4BIU A;  3EY5 A;  4DR6 B;  5LMU B;  5J9P C;  1HDJ A;  3SPI A;  1N34 O;  3UKM A;  3ML0 A;  3PGP A;  1GM8 A;  4PI2 A;  4QB9 A;  4DV1 B;  1R43 A;  4QPK A;  3PB6 X;  2PR8 A;  4B08 A;  1S72 V;  4LFB O;  4LX9 A;  4P30 A;  3N5F A;  4H33 A;  3IO1 A;  2X7R B;  2QEX V;  1XMO O;  1NQT A;  5AGE A;  2QJ8 A;  2H94 A;  1I1D A;  4PD4 F;  4JXR A;  1HP8 A;  4RQE A;  5F09 A;  3N2G B;  2G3T A;  1BMF G;  2ZDI C;  2UXC B;  4OPA A;  2JGU A;  1PL4 A;  4JAV A;  2X6B A;  3KHZ A;  5CBM A;  2JK5 C;  1Z5W A;  2WAM A;  1GN2 A;  2RNB A;  2V77 A;  4Y49 B;  4G2K A;  3QVN A;  3FEC A;  3BFR A;  2K5T A;  1ZWI C;  1OJH A;  4L89 A;  1QLE C;  4E8O A;  4M6G A;  1YVK A;  1Y0Y A;  4W4L A;  4ICG A;  1QU7 A;  5K1P A;  1BSM A;  1NR1 A;  3FB3 A;  4P10 A;  4C7H A;  2Q6A A;  2FE7 A;  3F5W C;  4LF9 B;  3D4U A;  3DXR A;  3JVN A;  4GX2 A;  1VF6 C;  3W7T A;  3D7D A;  5K8N A;  5LP6 C;  1CG2 A;  5IT9 N;  3NXS A;  5J2U A;  1JVM A;  2C6G A;  3FAV A;  1R3I C;  2Q0A A;  3RYF B;  5LGU A;  4FFB A;  1UWY A;  1IGB A;  1TF9 A;  1WPB A;  3KR4 A;  4FM2 A;  1WLE A;  1Q82 W;  2IJK A;  3QTC A;  4LBE C;  1E1R G;  4R57 A;  4D7S A;  4GCZ A;  2OZG A;  2QGN A;  1UJW B;  1B6Q A;  1WP7 A;  3JSL A;  2BSK B;  1Q43 A;  4UFW A;  3BXM A;  2YID A;  3ABK C;  2IJI A;  1US6 A;  2GSM B;  3O9O A;  3RYH A;  5JJE B;  4M6H A;  2CUG A;  4O4L A;  2A4N A;  2O57 A;  1JCH A;  2AFO A;  3WB2 A;  3L9D A;  2R8V A;  1R3K C;  3OWC A;  1KUY A;  3RYC B;  4HNA B;  5EBV A;  4CRY B;  5LMN B;  4KFM A;  3CRC A;  3R9E A;  1WNS A;  5LA6 B;  3U0Z A;  1AP5 A;  1D2D A;  4ZY0 A;  2O4H A;  1KD1 W;  2XTA A;  2PI5 A;  2Q7E A;  3ABU A;  1X10 A;  4UB6 Z;  3MAQ A;  1M9N A;  5J2T A;  4P44 A;  4NR1 A;  2VBQ A;  4P2Z A;  1GN3 A;  1HDQ A;  1N0N A;  2FKX A;  4OID A;  4ZYQ A;  3A0R A;  4NTY A;  1WAZ A;  4RQF A;  1AVM A;  1QMU A;  3BAA A;  3I9S A;  3FYN A;  4B3S O;  2DQ0 A;  1J5E O;  4IHJ B;  2NR5 A;  1ZLI A;  4NGT A;  5IYZ B;  3OMN B;  5IB0 A;  5B1B B;  2F8H A;  2ZEF A;  3STZ C;  1VHO A;  5B1A B;  3JTK A;  2QTO A;  4GX5 A;  3SPG A;  1JOY A;  2Y69 C;  2OR4 A;  4EME A;  2HVJ C;  5EC1 C;  5EIB D;  4JTA B;  3B3C A;  1V9P A;  5HVG A;  4X62 B;  2XND G;  1FJG O;  1LCP A;  3JAM N;  3SHP A;  4XPD B;  2YEV A;  2VS0 A;  2MK3 A;  1CXZ B;  1EZJ A;  2ZW7 A;  4X20 A;  2UXB B;  3IWG A;  3GB0 A;  1QVG U;  2EJR A;  1J5E B;  2FS5 A;  4TQF A;  1E79 G;  1ELL P;  4DR4 O;  3OEH G;  4KVO E;  3G6B A;  4U7N A;  3G71 V;  1YCI A;  1NTZ H;  2LW7 A;  2JBK A;  2FL4 A;  1DGS A;  3CCL V;  2C1C A;  1PV0 A;  1S7K A;  3CCU V;  1WB8 A;  3U10 A;  4X65 B;  4FD4 A;  4B13 A;  5C88 A;  3W7S A;  3WC5 A;  2AFS A;  5DWN A;  1G6U A;  4DR7 B;  4DV0 O;  4CH4 A;  2N04 A;  2WZN A;  5CMU A;  5JWP A;  2UXD B;  1OCO C;  2ANP A;  1HNX B;  3R1K A;  2G38 A;  3T4D A;  3AK3 A;  2RB7 A;  1W0J G;  4O2B A;  2OB0 A;  5K1X A;  2JS3 A;  3LSS A;  3D3I A;  3CXH F;  2NN4 A;  4RI1 A;  2JRI A;  1QSO A;  3TTH A;  3S3X A;  4ZIB A;  4WF9 V;  4WFB V;  4I9W A;  2ITC C;  4YRH A;  3T9Y A;  5AG2 A;  2RN9 A;  1YJ9 V;  4F0Y A;  3FAV B;  2NYQ A;  4B3M O;  2YGW A;  4FFB B;  3P2H A;  4DV4 B;  2GUZ B;  2XAJ A;  2OIG A;  1LUV A;  3JAW B;  4C68 A;  4CYQ A;  1HEE A;  2UUA B;  2LJ2 A;  4WFG A;  4DR5 B;  4UEE A;  1SKV A;  2AXT Z;  4MFK A;  4GM5 A;  2EIK C;  1J95 A;  3TGU H;  4D7T A;  5IYD O;  1ARM A;  1Z8L A;  2Q8V A;  1S76 D;  1ORQ C;  3ZS8 C;  1Y66 A;  2A7W A;  5LGT A;  2DE0 X;  1VQM V;  4PQA A;  5IJ0 A;  4XPL A;  3SYA A;  3IC1 A;  4ZY2 A;  2DYS B;  3TK1 A;  2YXL A;  4IL6 Z;  5BMV B;  3T1H B;  4UWI A;  1H2N A;  2Y0M A;  4MTF A;  3SYQ A;  2FYU H;  4IIJ B;  3OTO B;  2HC9 A;  3W7W A;  2C27 A;  2JDD A;  1Q8I A;  2J8R A;  2RCV A;  4DR1 B;  2VQF O;  2ZIM A;  1N32 B;  3E8H A;  2H3O A;  4NXN O;  1TKH A;  3BA8 A;  1PKX A;  4PA3 A;  5KX5 B;  2AFX A;  3LWU A;  2PUS A;  2WPD G;  1SZT A;  3QAY A;  5EC2 C;  3MD0 A;  4LQG A;  1TAE A;  4TSF G;  3FMC A;  2Q7H A;  5D8N A;  1ZG9 A;  4FIP C;  3TXQ A;  2ZW5 A;  2Q7S A;  5ITZ A;  4RUH A;  3ZIA G;  2ZM6 B;  1Q81 W;  1CX8 A;  1SES A;  2UU9 B;  4P4J A;  2AFM A;  2JBJ A;  2PR1 A;  3RBZ A;  3IJ3 A;  2OOT A;  4CBC A;  4XNH B;  2R70 A;  3N27 A;  3MHS C;  1VEW A;  4WWV A;  1WK4 A;  5IYC O;  4JD6 A;  2HJF C;  2QM4 A;  3UO2 A;  1JFF A;  2WLN A;  4G27 B;  5ITZ B;  4FLX A;  4JI4 B;  2ZR2 A;  1ZSP A;  3T8W A;  1YK3 A;  1M93 A;  2IMO A;  4YY3 B;  1WA8 B;  3QNV A;  3B4S A;  1YDX A;  3ZHU A;  4PXD A;  4C2X A;  1RP3 B;  3LNM B;  3JCZ A;  4HYO A;  4QPJ A;  5LYJ B;  2Y4U A;  4DUZ O;  1QCE A;  4NGM A;  4X88 A;  1K73 W;  1QR9 A;  2BUE A;  1LUW A;  5KAI Z;  2EIN C;  2GUZ A;  4E2L A;  3K2K A;  1NJI W;  4FZ0 A;  5F48 A;  4MFQ A;  2VZY A;  2RJZ A;  1ENV A;  1H8H G;  3JAL A;  1YVW A;  3KZI Z;  4JAU A;  3E22 B;  5BXZ A;  2EWB A;  3H01 A;  1R6T A;  4YWY A;  1Z5R A;  3OGC C;  1JPX A;  3L71 H;  2Z5U A;  3W6X A;  4R7C A;  2OWO A;  1VMG A;  4PDR A;  3BY6 A;  2XHB A;  2AZ0 A;  1R6K A;  4CZZ A;  2ZEG A;  2DOS A;  4X64 O;  1CP7 A;  2Z0A A;  1FPO A;  5DM6 V;  4X62 O;  3G6E V;  5I0C A;  1S5K A;  3E83 A;  4NGR A;  3TET A;  4BWA A;  4NSQ A;  4DV7 O;  2I3C A;  5AG4 A;  4UCT A;  1I12 A;  3JD2 A;  4F6R B;  1N0J A;  3SXN A;  3HB3 B;  4RUF A;  3WB1 A;  2DWD C;  3C3S A;  1LAN A;  2XEG A;  4FLT A;  1M4U A;  1ZAU A;  4G1P A;  2WA3 A;  3ZJZ A;  1H2K A;  3NH5 A;  3DC5 A;  3OE7 G;  2ETN A;  2JGD A;  4P4E A;  1FXK A;  2P7T C;  2Q73 A;  4O2A B;  3A0H Z;  1S3J A;  4A39 A;  4KOT A;  1ARO P;  4CGO A;  3B3V A;  1A32 A;  4JI1 B;  4I0X A;  3IFX A;  4YGO A;  2XAQ A;  4IK2 A;  3MGD A;  2BCO A;  5D5Q A;  4CH5 A;  2DWE C;  4MHN A;  3ZMZ A;  4B14 A;  3L73 H;  4NXM B;  3TO6 A;  3AK1 A;  5BY1 A;  4NKG B;  2H5M A;  2QTS A;  4R9M A;  1AP6 A;  1L0L H;  4EKW A;  4O2A A;  2WLI B;  3C90 A;  3KHX A;  3SI2 A;  2VRZ A;  2PJ8 A;  2YXH A;  3D7G A;  2E74 B;  4KVM E;  2JVD A;  4GX1 A;  5JVD B;  1Q7L A;  2EIL C;  3OTF A;  4RAI A;  3SJC C;  2PJ1 A;  4LQ6 A;  4BW9 A;  2ZOG A;  1URF A;  1SS3 A;  1V55 C;  3CJH B;  1Z8T A;  1AJP A;  1SA0 A;  1NSL A;  4MS2 A;  4D6T H;  1YQE A;  2BSW A;  4AB7 A;  5F2V O;  2VQE B;  1IBL B;  2EIK B;  3NH8 A;  1YR0 A;  4XDK A;  4LWS A;  3CXP A;  4A37 A;  4FPP A;  4DV4 O;  3PBE A;  3WB0 A;  4LC1 A;  2BOC C;  1NTK H;  4OXS A;  3OAA G;  2FML A;  3BI0 A;  4O23 A;  2DQ3 A;  1XHZ A;  3DR6 A;  2R9A A;  4J9Y B;  4H44 B;  4OP4 A;  1Y0R A;  2L6L A;  4Z1V A;  4Q20 A;  5EIB C;  2ZNJ A;  1GAX A;  2PJ3 A;  2AZ2 A;  4ORF A;  2P4K A;  3AG4 B;  2BEI A;  4KUB A;  4X2T A;  1ROP A;  4BAY A;  2Q4Z A;  4PPZ A;  3BRC A;  4JYC A;  1MJ9 A;  4TV9 B;  3LOD A;  4DV3 B;  3JD3 A;  2PC1 A;  4DYO A;  2ZXV A;  3OT7 A;  1GM7 A;  2HQY A;  3IGA C;  2VQF B;  1PNK A;  2A0L A;  1M90 W;  2HHH O;  3CEI A;  3IGR A;  1GKF A;  3G80 A;  1NE9 A;  4LF6 B;  2Q51 A;  1TUB B;  4LFA O;  4I50 A;  3Q4H A;  3D3Q A;  5K8M A;  3IFE A;  3F8K A;  1L8D A;  4PSW A;  4PXE A;  3ZBH A;  3I56 V;  2BTQ B;  4PDL A;  2P6E A;  3E0K A;  2Q44 A;  5IV0 A;  4H6Z A;  1IZ3 A;  3B7I A;  2F4V O;  3FYI B;  1P4R A;  4B5P B;  3VQY A;  1RPR A;  1Y76 A;  3RVY A;  4DR5 O;  3G67 A;  5J2T B;  4UFV A;  1V0C A;  2M6Y A;  3ISX A;  2F5I A;  3K5L A;  1YJW V;  4LF6 O;  2GRE A;  2JJ2 G;  4GKK O;  4OGQ B;  1Q6I A;  2F1M A;  1AJN A;  4DV6 O;  1Y74 B;  2OZU A;  2QM7 A;  3A8T A;  4JI2 O;  1M44 A;  1NI8 A;  4MSW C;  2XEJ A;  2HVK C;  3OTO O;  1O9G A;  2PI4 A;  2D4P A;  4GS4 A;  2PJ9 A;  4PSX A;  3HPL C;  4NEX A;  2Z3O A;  4CAW A;  4CC6 A;  4U9Z A;  3HKE B;  1VP7 A;  1PNL A;  4J41 A;  1KZF A;  4J3G A;  4PK3 A;  3V8I A;  4YHH O;  1S7F A;  4O4H A;  1PNM A;  4OIW A;  3OR6 C;  2IBZ H;  4GX0 A;  4TWE A;  1EN4 A;  1XMQ B;  4J7J A;  3TXS A;  3CDX A;  1K5Q A;  3RN4 A;  4KOW A;  4FLU A;  4CRZ B;  2GHY A;  2EIN B;  1PM9 A;  1FFX B;  3OD4 A;  2V1D A;  1XJO A;  4DYL A;  4CGM A;  4TUY A;  4CS4 A;  1IY7 A;  1CJW A;  5E1A C;  2JEV A;  5H2F Z;  3SPH A;  3HKD A;  2UUB O;  3KGQ A;  3RBU A;  1FNO A;  1IUR A;  3TCV A;  4U3F H;  1EZV H;  2UXN A;  2Z3Y A;  2PRB A;  3CCR V;  1XL6 A;  1K4C C;  1YHQ V;  3P32 A;  1FFX A;  4JI4 O;  2CGN A;  2X6A A;  3TOA A;  3CRR A;  2DYR C;  2AHZ A;  4JI0 B;  1FT7 A;  4OLL A;  3DNS A;  4H2K A;  5LP6 B;  1F4M A;  5BZB A;  2ZT9 B;  2QWN B;  4W9Y A;  3K3W A;  5CBG A;  4EWT A;  1I7F A;  2JS5 A;  2FIW A;  3SYC A;  3CS5 A;  3N2G A;  1NU1 H;  3A2F A;  3SDL A;  2OTJ V;  1YLE A;  4U3J A;  1GMG A;  1K92 A;  3BLN A;  2PYJ A;  4EB6 B;  1N33 O;  2RC4 A;  4AG9 A;  3OMI B;  3TJT A;  2Z0Z A;  3IWE A;  2R1I A;  5HH1 A;  5AG6 A;  4TV9 A;  4JI1 O;  3C3T A;  4YFJ A;  2Q04 A;  1YJN V;  4IUS A;  1KKC A;  3R96 A;  2EBO A;  5CA3 A;  3IU2 A;  4LFB B;  3OUS A;  1EBO A;  2WPX A;  3FED A;  1QBZ A;  3H1K H;  1M56 C;  2EO8 A;  2CTR A;  2G9D A;  1Y4M A;  2ZE7 A;  1GH6 A;  4X89 A;  4CS2 A;  2NSM A;  3OGI B;  3CXQ A;  5KTC A;  1LAP A;  2CGO A;  2VI7 A;  3ABK B;  3BCC H;  3FF3 A;  3CE2 A;  1MJB A;  5EYP B;  2CXA A;  3JAT A;  1HDU A;  4O4H B;  4B3R B;  2B3U A;  1OCR C;  4YJ2 A;  5IJ0 B;  2QKS A;  4AG7 A;  1XRY A;  1XE4 A;  3B3T A;  2Q9L A;  4OC1 A;  3THO A;  4B10 A;  3AG4 C;  5LHG A;  1ARL A;  3WC7 A;  1FXK B;  1NVP D;  3T1Y O;  4R3L A;  5B66 Z;  4GKJ B;  3DC6 A;  4R50 A;  1JQG A;  1F57 A;  4YJ2 B;  4K0K O;  2P4V A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 4MFZ A;  4CGN A;  3VWD A;  4RS2 A;  1Z4E A;  3D3S A;  2B4D B;  3H4Q A;  4QBJ A;  1B6B A;  2WPW A;  2REE A;  1OZP A;  3TT2 A;  3P2F A;  4H6U A;  3R1K A;  4EVY A;  4C7I A;  2OB0 A;  3JUW A;  2B5G B;  4CYN A;  4MFL A;  5C82 A;  3CXS A;  4RI1 A;  1S7L A;  1QSO A;  3TTH A;  5JQ4 A;  5GCN A;  4E2A A;  4YRH A;  3GKR A;  3T9Y A;  1QSM A;  4F0Y A;  2I79 A;  4KSF A;  1BOB A;  5CNP A;  2YGW A;  3P2H A;  2YND A;  3R95 A;  2B5G A;  1U6M A;  2AE6 A;  4MFP A;  2ZW6 A;  1XMT A;  4PK2 A;  3FBU A;  3WR7 A;  4C68 A;  4CYQ A;  2QML A;  4MFK A;  4UA3 A;  3FXT A;  1BO4 A;  4JXQ A;  4M3S A;  1YGH A;  4A2Z A;  2DPS A;  2JDC A;  2Z3P A;  3C26 A;  4BBH A;  2ZPA A;  1P4N A;  1VKC A;  3FNC A;  4KOU A;  4XPL A;  1QST A;  2J8M A;  3F0A A;  2CY2 A;  4UWI A;  1I21 A;  2Y0M A;  3S6F A;  2C27 A;  2JDD A;  1P0H A;  2J8R A;  3ZZI A;  2D4O A;  4CAF A;  2O28 A;  2R7H A;  2GAN A;  1L0C A;  4R87 A;  1J4J A;  2AJ6 A;  2ATR A;  4MI4 A;  4C2Y A;  1IID A;  4QUS A;  5A27 A;  4UCP A;  1XEB A;  2ZW5 A;  3EFA A;  4A33 A;  3A9L A;  2PR1 A;  1Q2D A;  4XNH B;  3UY5 A;  4R3K A;  4HNY B;  1Y9K A;  4JLY A;  4KUA A;  1WK4 A;  4JD6 A;  1M1D A;  2FT0 A;  4B11 A;  5AG7 A;  1PU9 A;  4FD7 A;  1YK3 A;  2JLM A;  2FSR A;  1Q2Y A;  3LD2 A;  5G20 A;  2PDO A;  3BJ7 A;  4C2X A;  4KLV A;  4IF5 A;  3VWE A;  4FD5 A;  4KOS A;  4K30 A;  4QC6 A;  3G3S A;  2BUE A;  1TIQ A;  5A28 A;  2PQ8 A;  5F48 A;  4HNW B;  4DNC A;  4F6A A;  4MFQ A;  2VZY A;  4KLW A;  5BWA B;  4FD6 A;  1KUV A;  4MFJ A;  5G22 A;  5KTD A;  2EVN A;  4Q36 A;  2Z11 A;  3W6X A;  3I3G A;  2PSW A;  2QEC A;  3PP9 A;  4AVA A;  1XIX A;  3TE4 A;  1IB1 E;  5I0C A;  1S5K A;  3D2P A;  4B5O A;  2R98 A;  4NSQ A;  2YNC A;  5AG4 A;  1I12 A;  1S3Z A;  2DPT A;  5EC4 A;  3SXN A;  2CNM A;  1YRE A;  4MJ8 A;  1XF8 A;  3FIX A;  4MY3 A;  4KS9 A;  3G8W A;  4KOY A;  4KZT A;  2VEZ A;  3H5Z A;  1MJA A;  4MHD A;  2BL1 A;  1M4G A;  1ON0 A;  4UCM A;  1MK4 A;  4KOT A;  4CGO A;  4HNX B;  4Q38 A;  3W6S A;  4YGO A;  2Z3L A;  2NMT A;  3MGD A;  3DDD A;  4B14 A;  3TO6 A;  4A31 A;  4XPD C;  2H5M A;  5ISV A;  1S7N A;  4R9M A;  4A32 A;  1M4I A;  2ARH A;  3N7Z A;  4U5Y A;  4B12 A;  2VZZ A;  4KVM E;  2VQY A;  4B5P A;  5HMN A;  4CAX A;  3S6K A;  4E0A A;  2Q4Y A;  1UFH A;  3DSB A;  1NSL A;  2Q0Y A;  3QB8 A;  2BSW A;  4AB7 A;  3SXO A;  2I00 A;  5E96 A;  4CYO A;  3GYA A;  1YR0 A;  1RO5 A;  3CXP A;  2P0W A;  2X7B A;  1YVO A;  4UBR A;  4ZGY B;  3GY9 A;  1RXT A;  2Z10 A;  3NE7 A;  4A30 A;  4KOR A;  4U9Y A;  2YNE A;  5F47 A;  5AG5 A;  2EUI A;  4XPK A;  5F49 A;  3R9G A;  2QIR A;  3DR6 A;  4PV6 A;  3RYO A;  3DR8 A;  3W91 A;  2Z3K A;  4H89 A;  4LUA A;  4ORF A;  2BEI A;  4KUB A;  4NCZ A;  3EXN A;  4C2Z A;  4BMH A;  2HV2 A;  1MJ9 A;  5G21 A;  3TO9 A;  3LOD A;  4XNH C;  3EY5 A;  4CAE A;  2PC1 A;  1M4D A;  2ZXV A;  2DXQ A;  2HQY A;  4CGP A;  3KKW A;  3S6G A;  3IGR A;  1NE9 A;  4QB9 A;  3PGP A;  1R57 A;  4M85 A;  2WSA A;  3F8K A;  4PSW A;  2PR8 A;  2IL4 A;  2FXF A;  4UFX A;  2P6G A;  4QVT A;  4LX9 A;  2P6E A;  4MBU A;  3E0K A;  5AGE A;  2OZH A;  2Q44 A;  5IV0 A;  4H6Z A;  1I1D A;  1SQH A;  4L8A A;  4JXR A;  4B5P B;  2GIV A;  4UWJ A;  2G3T A;  4UFV A;  1FY7 A;  4CYP A;  1Y9W A;  1V0C A;  1CM0 A;  2WUU A;  2F5I A;  2B4D A;  4Y49 B;  2K5T A;  1IYL A;  2CNT A;  4ONU A;  4L89 A;  5J8C A;  2YNC C;  4E8O A;  3TO7 A;  4CGL A;  2OZU A;  1YVK A;  1M44 A;  3R9F A;  3FB3 A;  2G0B A;  4UCN A;  4C7H A;  2D4P A;  2FE7 A;  4GS4 A;  4OAE A;  4PSX A;  4NEX A;  2Z3O A;  3JVN A;  1VHS A;  2FIA A;  4CAW A;  4U9Z A;  4AVC A;  4KOV A;  1KZF A;  4J3G A;  4PK3 A;  3V8I A;  1S7F A;  1Z9U A;  5FVJ A;  4ZBG A;  3D8P A;  5JPH A;  1Y7R A;  1IIC A;  4KSA A;  4KOW A;  4CRZ B;  4MY0 A;  1LRZ A;  4R57 A;  4CGM A;  5F46 A;  2JEV A;  1CJW A;  2OZG A;  3F5B A;  3TCV A;  2VXK A;  5H86 A;  3EC4 A;  4UFW A;  2PRB A;  1IYK A;  2B4B A;  5IX3 A;  1YX0 A;  5G1Z A;  2A4N A;  4JWP A;  1WWZ A;  2R8V A;  3OWC A;  4JJX A;  1KUY A;  1QSN A;  3TOA A;  4OAD A;  4A95 A;  3IU1 A;  5EBV A;  4CRY B;  5KTA A;  3R9E A;  1K4J A;  1NMT A;  4OLL A;  3DNS A;  4AVB A;  2FIW A;  3TFY A;  2OH1 A;  1YLE A;  3BLN A;  1N71 A;  2Z3M A;  2VBQ A;  4CS0 B;  1GHE A;  2RC4 A;  4AG9 A;  3BJ8 A;  2Z0Z A;  2HUZ A;  3IWE A;  2OU2 A;  3QAH A;  4X5K A;  2R1I A;  5HH1 A;  3K9U A;  5AG6 A;  2CNS A;  3I9S A;  3FYN A;  4CAV A;  2GE3 A;  4NXY A;  4YFJ A;  2G3A A;  2Q04 A;  4IUS A;  3PZJ A;  3R96 A;  3T90 A;  1Z4R A;  3IU2 A;  3TOB A;  2WPX A;  5IB0 A;  2Q7B A;  1Q2C A;  4KOX A;  4I49 A;  3JTK A;  3D2M A;  4II9 A;  3ZJ0 A;  2ZW4 A;  1KUX A;  3CXQ A;  5KTC A;  4HKF A;  3SHP A;  4XPD B;  1PUA A;  2VI7 A;  5J8F A;  2B58 A;  4Y49 C;  4F0X A;  2ZW7 A;  2J8N A;  1MJB A;  2KCW A;  3IWG A;  1QSR A;  2CXA A;  2Q4V A;  2FCK A;  3S6H A;  2FS5 A;  1S60 A;  2B3U A;  2REF A;  4KVO E;  2P6F A;  4KVX A;  4NF1 A;  4AG7 A;  1XE4 A;  2B3V A;  2FL4 A;  3FRM A;  1B87 A;  1ZO0 A;  4B10 A;  1S7K A;  5DWM A;  4R3L A;  4FD4 A;  3EO4 A;  4B13 A;  5C88 A;  5H84 A;  5DWN A;  2Z3N A;  3B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...