4H89A

The structure of a gcn5-related n-acetyltransferase from kribbella flavida
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
168
Chain Sequence
b'SPEALQVRDAEDADWPAILPFFREIVSAGETYAYDPELTDEQARSLWMTPSGPQSRTTVAVDADGTVLGSANMYPNRPGPGAHVASASFMVAAAARGRGVGRALCQDMIDWAGREGFRAIQFNAVVETNTVAVKLWQSLGFRVIGTVPEAFHHPTHGYVGLHVMHRPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title The Structure of a GCN5-Related N-Acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
total genus 44
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h89A00
1M1DA 5J8FA 2Y0MA 2BEIA 2VI7A 2FSRA 2PSWA 4AVAA 5KTCA 2B58A 2OH1A 2FS5A 1V0CA 4KORA 2Z11A 2KCWA 4AB7A 4XPLA 2D4OA 3ZJ0A 2REFA 3TOBA 2R7HA 3PGPA 4CRYB 3TOAA 1FY7A 4II9A 1MJAA 1QSNA 2AJ6A 3FNCA 2VBQA 1YREA 3CXSA 3FXTA 2Z0ZA 2ZW4A 3TE4A 1M4IA 4H6ZA 2FIWA 4KOTA 3UY5A 4E2AA 4M85A 1R57A 4KZTA 2QECA 3EC4A 3TO6A 2PRBA 3QB8A 4F0YA 4YRHA 2ZW6A 4PK2A 4LX9A 3N7ZA 2PR1A 4L8AA 4QUSA 4CRZB 4NF1A 3I9SA 2VZYA 4QB9A 3CXPA 3D2MA 1L0CA 3W6SA 1M44A 2ZPAA 3RYOA 5F46A 1IYLA 3R9GA 4AG9A 3QAHA 4B5PB 2B4BA 1WK4A 3TT2A 5C82A 4UA3A 4B5PA 2AE6A 5EC4A 2A4NA 3PP9A 3T9YA 4NEXA 5F47A 1MK4A 4NSQA 4CS0B 4KVXA 3LODA 4FD5A 4CAXA 2I00A 5IV0A 2B4DB 2P6GA 3BLNA 3D3SA 4X5KA 1Z4EA 1XEBA 4Y49C 1S60A 2G0BA 3TO7A 4F6AA 2JDDA 1S3ZA 5FVJA 3P2HA 5DWNA 1GHEA 4KVME 2O28A 3ZZIA 2OU2A 3R1KA 2J8MA 2OB0A 1J4JA 2PC1A 4KOVA 2NMTA 4IUSA 2EUIA 1Z4RA 2B3UA 1B87A 2OZUA 3DDDA 1XF8A 5HH1A 3S6HA 1UFHA 2PDOA 2G3AA 3PZJA 3SXNA 1CM0A 2WPWA 2Z10A 4PV6A 3I3GA 1KUYA 4ONUA 1K4JA 2R98A 4MBUA 3T90A 3S6KA 2FCKA 4KUBA 2I79A 2CNMA 1Q2DA 2QIRA 4UWIA 3SXOA 2PQ8A 1Z9UA 2Q4YA 5JQ4A 2OZGA 4E8OA 2Q7BA 2J8NA 1U6MA 4HNYB 3DNSA 4KUAA 2ARHA 4AVCA 4XNHB 4I49A 2QMLA 4U9YA 1Y7RA 1ON0A 3VWEA 3FBUA 4KLVA 4AVBA 1S7LA 3MGDA 3S6GA 2GE3A 2IL4A 1MJBA 1Y9KA 4JD6A 3EXNA 1SQHA 2Q04A 1B6BA 3D8PA 1YX0A 3DR6A 4U9ZA 2P6FA 4K30A 1S5KA 1YK3A 1NSLA 3F0AA 3JUWA 2CY2A 3E0KA 3BJ7A 4KOSA 4JJXA 2CNTA 3F5BA 3G8WA 3LD2A 4B5OA 5ISVA 2EVNA 2P6EA 4NCZA 3FYNA 1QSTA 2PR8A 4HKFA 2D4PA 5EBVA 1CJWA 3WR7A 2RC4A 5JPHA 3DSBA 4MJ8A 2J8RA 4UWJA 3R96A 1VHSA 5H84A 2BSWA 2B4DA 1QSMA 2B5GB 2BL1A 5KTAA 4R57A 5F48A 5CNPA 4GS4A 2VXKA 2BUEA 2WPXA 4KOWA 4IF5A 4MY0A 1M4DA 3GY9A 4JWPA 3TO9A 1KUVA 1RO5A 2FL4A 2ZW5A 2HUZA 1S7FA 3C26A 4ZBGA 1M4GA 1I12A 5GCNA 4E0AA 5H86A 3IWGA 2VEZA 4JXQA 4QBJA 4LUAA 1YLEA 3FIXA 2HQYA 1S7KA 3R95A 3FRMA 4CAWA 3B8GA 4YFJA 1BO4A 1MJ9A 3H4QA 4UBRA 4U5YA 3TFYA 1BOBA 5E96A 4OADA 2G3TA 4KOUA 1IICA 2B3VA 2P0WA 1IYKA 2FIAA 4H6UA 2DXQA 4PSXA 4KOXA 4H89A 3S6FA 2F5IA 1I21A 3EO4A 2H5MA 4NXYA 5F49A 1Q2YA 4PSWA 2JLMA 3IGRA 4R3KA 2Q4VA 1I1DA 4FD7A 3W6XA 1OZPA 2JEVA 4XNHC 4MHDA 1YVKA 5I0CA 2X7BA 3TTHA 4M3SA 4KOYA 4R87A 3K9UA 1Q2CA 1TIQA 2ZXVA 2K5TA 4KLWA 5C88A 3TCVA 4FD6A 4RS2A 4OLLA 5J8CA 2GIVA 4R9MA 3CXQA 1LRZA 5IB0A 4JXRA 3GYAA 2C27A 2GANA 1PU9A 2JDCA 2CNSA 3W91A 5HMNA 5KTDA 3FB3A 1XE4A 4QVTA 1PUAA 3D2PA 4R3LA 3JVNA 1NE9A 4CAVA 2ATRA 3BJ8A 3KKWA 3EFAA 3R9FA 2OZHA 4QC6A 4BMHA 5DWMA 3V8IA 1KZFA 1WWZA 1XIXA 5IX3A 3R9EA 2VZZA 4XPKA 3OWCA 4KVOE 4PK3A 3SHPA 4MY3A 2R1IA 1RXTA 4ORFA 1P0HA 2VQYA 4HNWB 2B5GA 4XPDC 3NE7A 4MI4A 1Y9WA 2HV2A 1QSRA 4XPDB 3GKRA 2Q44A 1YVOA 1VKCA 4HNXB 2FE7A 3EY5A 2FXFA 4FD4A 1YR0A 4Y49B 3DR8A 1XMTA 1KUXA 2R8VA 2ZW7A 1NMTA 4DNCA 1YGHA 4L89A 4YGOA 4JLYA 4OAEA 3G3SA 3VWDA 3F8KA 4J3GA 4RI1A 4EVYA 1QSOA 1S7NA 2FT0A 2Q0YA 4AG7A 1IB1E 3P2FA 1N71A 2REEA 1P4NA 1IIDA
chains in the Genus database with same CATH superfamily
1M1DA 5J8FA 4TNUA 4Q36A 2Y0MA 2BEIA 2IQ6A 2VI7A 3ISZA 4UEZA 2FSRA 2PSWA 4AVAA 5KTCA 2Z3OA 1FNOA 2B58A 2OH1A 2FS5A 2YNEA 1V0CA 2JEWA 4KORA 4EMEA 3H8GA 3FF3A 1Q7LA 2Z11A 2KCWA 4AB7A 2C6PA 4PPZA 2C6GA 4XPLA 4A33A 5K8OA 1LANA 5D29A 2D4OA 3PB6X 3FH4A 1Y0RA 4B11A 4Q7AA 1Y7EA 4C2XA 3ZJ0A 2REFA 3TOBA 2EK9A 5A28A 4OIDA 2R7HA 3KGQA 4OMEA 2CTBA 1QQ9A 3PGPA 4CRYB 1XJOA 4UIAA 2PJAA 3TOAA 2QVPA 1FY7A 4CGMA 2Z3PA 1ELLP 2YNDA 4II9A 1ZG8A 3NE8A 4P4EA 1MJAA 1QSNA 1CX8A 2AJ6A 3FMCA 4W9YA 3FNCA 2VBQA 3CZXA 1YREA 2PJ3A 3LWUA 3CXSA 3FXTA 3PBBA 2Q7SA 1IY7A 2Z0ZA 2ZW4A 1AYEA 3TE4A 1M4IA 4H6ZA 1TKJA 2PJ1A 2FIWA 4KOTA 2CTCA 4BINA 3MN8A 3UY5A 4E2AA 1R3NA 4M85A 2ZEMA 2AFMA 4RUHA 1R57A 4KZTA 4NFRA 3DGVA 2QECA 4MHPA 3EC4A 3TO6A 4UEFA 4NJRA 2PRBA 3QB8A 4F0YA 4YRHA 2ZEOA 2ZW6A 4PK2A 4LX9A 3CT9A 3S9NA 1PYTB 2XEFA 3N7ZA 2PR1A 4L8AA 2GU2A 4QUSA 4CRZB 4NF1A 3I1UA 3I9SA 5AG5A 2VZYA 4QB9A 3KHXA 4NJQA 2ZELA 3D7GA 4LQ6A 3CXPA 2CF4A 3D2MA 4M6IA 4CGPA 1L0CA 3W6SA 3BXMA 3T8WA 1M44A 2ZPAA 3RYOA 5F46A 1IYLA 3R9GA 4MCRA 2ABZA 3PRTA 4AG9A 3QAHA 4B5PB 4MFPA 4MCPA 2B4BA 1JQGA 4CYOA 1WK4A 3TT2A 5C82A 2EBJA 4K3NA 1Z8LA 4UA3A 3RZAA 4B5PA 2EK8A 4PQAA 4MXUA 2AE6A 4FBEA 2V8VA 1IU8A 3KQZA 1Z8WA 5EC4A 2A4NA 3PP9A 3T9YA 4NEXA 4EWTA 3QAYA 1HEEA 5F47A 1MK4A 4NSQA 4CS0B 2PJBA 4KVXA 3CPXA 4F9VA 3LODA 4FD5A 4P6YA 3VARA 3FX6A 3K9TA 4CAXA 1QMUA 2I00A 5IV0A 1YSJA 2B4DB 2ZEGA 4MCQA 2P6GA 3BLNA 3D3SA 4X5KA 4X3RA 1Z4EA 5AGEA 1XEBA 4UFXA 3IU2A 4Y49C 1S60A 4A30A 4C2YA 4ZGYB 3IU1A 2G0BA 5K8PA 5CBMA 5CPAA 3TO7A 3DLJA 3D66A 4UF4A 4F6AA 4B14A 1YW6A 4ZYQA 2JDDA 2GFQA 1S3ZA 3D67A 3JTKA 3FECA 5FVJA 3P2HA 1BLLE 4C68A 4MFJA 5DWNA 3WC5A 1GHEA 1LOKA 2HB6A 4KVME 4OP4A 5JGFA 2O28A 3H8FA 3ZZIA 4C2ZA 2OU2A 3R1KA 4LQGA 2J8MA 1R43A 3SJXA 1TF9A 2Q51A 3WC6A 2OB0A 1J4JA 2PC1A 4KOVA 4H2KA 4UFWA 2NMTA 1P4NA 4IUSA 2EUIA 4X2TA 1Z4RA 4DYOA 2B3UA 1B87A 5LRJA 3IEHA 2OZUA 4UEEA 3DDDA 3NA6A 3ISXA 4B13A 1XF8A 5HH1A 2NSMA 2PJ8A 3IO1A 5AG7A 3S6HA 1LCPA 5AG6A 3WT4A 1DE4C 4MHZA 1CP6A 1Y0YA 3KR4A 1UFHA 2PIYA 2I3CA 2PDOA 2G3AA 4MFKA 5LRGA 2NYQA 3PZJA 3SJEA 3SXNA 1CM0A 2WPWA 3NH8A 2Z10A 4PV6A 5A27A 3I3GA 4C7IA 3MRUA 3KZWA 1KUYA 2G9DA 2Z3NA 4ONUA 1K4JA 4B10A 5HXDA 2R98A 4MBUA 1VHOA 5K8MA 3GUXA 3H5ZA 3S6KA 3T90A 2IJZA 2FCKA 4P4IA 2PJ6A 4KUBA 3TC8A 5I4MA 2I79A 2CNMA 4PXCA 5IB9A 4YU9A 2PVVA 1HDUA 1Q2DA 2QIRA 2C1CA 2WUUA 3IFEA 4UWIA 3V38A 3SXOA 3B7IA 2PQ8A 5G22A 4MFLA 1Z9UA 3D7FA 2Q4YA 1F2PA 1BAVA 2OZGA 3KI9A 2PJ7A 3KQXA 2JBJA 5JQ4A 2XEJA 2AFUA 1F2OA 4E8OA 2WSAA 4CYQA 1IGBA 2WZNA 2Q7BA 2J8NA 4P4DA 1U6MA 1VIXA 1PCAA 3B3SA 4P4JA 1BPNA 4M6HA 4HNYB 2ZEEA 3DNSA 2JBKA 4KUAA 1TF8A 3B35A 8CPAA 2EO8A 1YLOA 2ARHA 4AVCA 4CGOA 1TKHA 2PVWA 4XNHB 1XFOA 4I49A 4A38A 3RBUA 3IC1A 4KSIA 4YWYA 2QMLA 3PEIA 4U9YA 2ZEDA 4NGNA 3RNZA 4A32A 1Y7RA 4B12A 3S9LA 1ON0A 3SI2A 5HVGA 3VWEA 1Z5RA 2AFOA 3FBUA 3PFOA 4KLVA 4NGTA 4R7MA 1ARLA 4AVBA 1S7LA 3MGDA 3S6GA 2GE3A 2IL4A 3GB0A 1MJBA 1Y9KA 4JD6A 2CIJA 4MFQA 1UWYA 3EXNA 5G21A 1SQHA 2Q04A 2RFHA 1B6BA 3D8PA 5LYLA 1YX0A 3DR6A 2F7VA 4U9ZA 4DJLA 4A2ZA 2P6FA 2AFWA 3KHZA 1ZLHA 4K30A 3NFZA 2PRQA 2RB7A 1S5KA 1YK3A 1NSLA 5LRKA 2GLFA 4NGPA 4PXEA 3D68A 4UCMA 3F0AA 3JUWA 1F57A 2CY2A 3E0KA 4A37A 3BJ7A 1XBUA 4KOSA 4JJXA 2CNTA 3F5BA 4KS9A 3G8WA 3B3CA 3LD2A 4B5OA 5G1ZA 4AXVA 2VL1A 4CPAA 5ISVA 2EVNA 2DF5A 2P6EA 4NCZA 3FYNA 1QSTA 2PE3A 2PR8A 4HKFA 4MHNA 2D4PA 3CPAA 1TKFA 3A9LA 1HDQA 1XRYA 3PBEA 2OR4A 5EBVA 1CJWA 3WR7A 3D4UA 1VHEA 2POKA 4OC4A 2RC4A 4Q38A 4ONWA 3DSBA 4A39A 5JPHA 4MJ8A 2J8RA 5HVFA 4UWJA 3R96A 4ZI6A 1VHSA 1XOVA 2ZEFA 1AUGA 2BSWA 5H84A 2B4DA 4CAEA 1QSMA 3LMSA 5G20A 4CAFA 4FAIA 2HC9A 2B5GB 4P45A 7CPAA 2BL1A 2Z3LA 3H8EA 3PB7X 4JYWA 5KTAA 4R57A 5F48A 5F09A 2V8GA 2OOTA 5CNPA 4GS4A 1ZG7A 2VXKA 4ZX8A 3B3VA 4OIWA 2BUEA 2WPXA 5THWA 3D7HA 1JWQA 4KOWA 4OC1A 4NGMA 4IF5A 3QNVA 4MY0A 1M4DA 3GY9A 4JWPA 3TO9A 1KUVA 1RO5A 2FL4A 3B3TA 2ZW5A 2HUZA 1S7FA 3C26A 4ZBGA 1H8LA 1M4GA 1I12A 3PB9X 4WJBA 5GCNA 4E0AA 5H86A 2DEAA 3IWGA 3IJ3A 2VEZA 4JXQA 2BOAA 4P10A 3RAMA 4QBJA 4ZY1A 4LUAA 2YNCC 1YLEA 3FIXA 4GXHA 3JRUA 2HQYA 4TWEA 4OC2A 4WWVA 1S7KA 1ELMP 3R95A 2PCUA 3FRMA 3KR5A 3SJFA 4CAWA 3B8GA 5LYIA 4YFJA 1EE3P 1BO4A 2QJ8A 1CG2A 1MJ9A 3SJGA 3H4QA 1BPMA 4UBRA 2DPTA 4U5YA 4X8IA 1BOBA 3TFYA 3WABA 5BWAB 2FVGA 5E96A 4OADA 3IWEA 4PXBA 2ODFA 3HLPA 2G3TA 5J1QA 4BBHA 2EWBA 1ZLIA 4KOUA 1IICA 4ZY0A 2B3VA 1CPSA 2P0WA 1IYKA 2FIAA 1LFWA 2DXQA 4H6UA 4KOXA 3K2KA 2ZOGA 4H89A 4M6GA 4PSXA 3S6FA 2F5IA 4GM5A 3TX8A 1I21A 1Z8XA 3EO4A 2QYVA 1AMPA 2V8DA 2H5MA 4UCNA 4NXYA 3RO0A 5F49A 2AFSA 1Q2YA 4PSWA 2J9AA 2JLMA 3IGRA 4R3KA 2Q4VA 1I1DA 4FD7A 3FJUA 2GLJA 3BHXA 3SI1A 4MRIA 3W6XA 1LAMA 3FEDA 1OZPA 2JEVA 2PIZA 4XNHC 4MHDA 3BI0A 2V77A 4F9UA 3B2YA 1YVKA 2PJ5A 5I0CA 4CGLA 1DTDA 2X7BA 3TTHA 4G1PA 4KOYA 4M3SA 4R87A 1Z2LA 4MFZA 2CXAA 3K9UA 3KASA 1Q2CA 4KSAA 4MMOA 1TIQA 2ZXVA 4OC3A 2O53A 2K5TA 4KLWA 3VATA 2AFZA 3PB4X 1M4LA 4FD6A 3TCVA 4RS2A 2ANPA 4B6ZA 5C88A 1LAPA 4CYPA 2PJ9A 4CGNA 4OLLA 5J8CA 3LACA 2GIVA 2ZENA 2ZEPA 5DS0A 2C6CA 4R9MA 3CXQA 3HUVA 1LRZA 6CPAA 5EMIA 4O23A 4JXRA 4ZY2A 3GYAA 5IB0A 2C27A 2GANA 2XEIA 1PU9A 4NGRA 2JDCA 1X10A 1FT7A 4A95A 4UIBA 5JM6A 2CNSA 3D7DA 3W91A 5HMNA 5KTDA 2GREA 1YW4A 3FB3A 2DPSA 1XE4A 4QVTA 4ZX9A 3VH9A 4A31A 1X12A 1PUAA 5JH9A 3D2PA 4R3LA 2XEGA 3JVNA 4IAVA 1NE9A 3PB8X 4CAVA 2ATRA 3BJ8A 3KKWA 3EFAA 4FWUA 4JZ0A 2OZHA 4QC6A 3GLJA 3R9FA 4BMHA 5AG4A 5DWMA 3V8IA 3FEEA 1KZFA 4A94A 4CYNA 1WWZA 1XIXA 5IX3A 2PJCA 3R9EA 2VZZA 1OBRA 1IOFA 3L2NA 3OWCA 2BCOA 3NH5A 4IHMA 4XPKA 4KVOE 4PK3A 3KL9A 5K8NA 2F8HA 2ZEHA 4OC0A 4NGSA 3SI0A 3V7ZA 3SHPA 1VGYA 2R1IA 4MY3A 2WYRA 4PXDA 3IIBA 3FVLA 4C7HA 1RXTA 2PJ4A 4MHYA 4OC5A 4ORFA 1P0HA 2VQYA 3NH4A 2B5GA 4HNWB 4XPDC 4P4FA 5D8NA 3NE7A 4R76A 2IMOA 4IK2A 2Z3KA 2PJ0A 4MI4A 4F0XA 1Y9WA 4OKOA 2HV2A 1QSRA 1CP7A 2O4HA 2Q44A 3GKRA 4XPDB 1YVOA 1KWMA 2BO9A 4BD9A 4UCPA 1IOIA 1VKCA 4HNXB 4F8ZA 4P4BA 1GYTA 4UFVA 4P44A 2FE7A 1A2ZA 1YQEA 4RN7A 4NGQA 3BI1A 3EY5A 2FXFA 4FD4A 1YR0A 2Q43A 5ELYA 2YGWA 4Y49B 3DR8A 1XMTA 1KUXA 2R8VA 1NSAA 2ZW7A 5LYFA 5LYDA 1NMTA 4DNCA 3S9MA 1YGHA 4L89A 3GIUA 2ZOFA 3PFEA 4YGOA 2AFXA 4JLYA 1RTQA 4EFDA 4R6TA 4OAEA 4HPSA 3G3SA 4DUKA 2PJ2A 4FUUA 3VWDA 1YMEA 3CDXA 3N5FA 3F8KA 2Q4ZA 1CPXA 4J3GA 4RI1A 5HVHA 2YNCA 4EVYA 2V8HA 4R8FA 1QSOA 1XMBA 1S7NA 1CBXA 1ZG9A 1TXRA 3B3WA 4Z65A 2FT0A 3WC7A 2Q0YA 4AG7A 1IB1E 2Z3MA 3P2FA 4MCSA 1N71A 2REEA 3IWWA 1Z8TA 1ARMA 4KSFA 1ZO0A 1IIDA
chains in the Genus database with same CATH topology
1M1DA 5J8FA 4Q36A 2Y0MA 2BEIA 2VI7A 2FSRA 2PSWA 4AVAA 5KTCA 2Z3OA 2B58A 2OH1A 2FS5A 2YNEA 1V0CA 4KORA 2Z11A 2KCWA 4AB7A 4XPLA 4A33A 2D4OA 4B11A 4C2XA 3ZJ0A 2REFA 3TOBA 5A28A 2R7HA 3PGPA 4CRYB 3TOAA 1FY7A 4CGMA 2Z3PA 4II9A 2YNDA 1MJAA 1QSNA 2AJ6A 3FNCA 2VBQA 1YREA 3CXSA 3FXTA 2Z0ZA 2ZW4A 3TE4A 1M4IA 4H6ZA 2FIWA 4KOTA 3UY5A 4E2AA 4M85A 1R57A 4KZTA 2QECA 3EC4A 3TO6A 2PRBA 3QB8A 4F0YA 4YRHA 2ZW6A 4PK2A 4LX9A 3N7ZA 2PR1A 4L8AA 4QUSA 4CRZB 4NF1A 3I9SA 5AG5A 2VZYA 4QB9A 3CXPA 3D2MA 4CGPA 1L0CA 3W6SA 1M44A 2ZPAA 3RYOA 5F46A 1IYLA 3R9GA 4AG9A 3QAHA 4B5PB 4MFPA 2B4BA 4CYOA 1WK4A 3TT2A 5C82A 4UA3A 4B5PA 2AE6A 5EC4A 2A4NA 3PP9A 3T9YA 4NEXA 5F47A 1MK4A 4NSQA 4CS0B 4KVXA 3LODA 4FD5A 4CAXA 2I00A 5IV0A 2B4DB 2P6GA 3BLNA 3D3SA 4X5KA 1Z4EA 5AGEA 1XEBA 4UFXA 3IU2A 4Y49C 1S60A 4A30A 4C2YA 4ZGYB 3IU1A 2G0BA 3TO7A 4F6AA 4B14A 2JDDA 3JTKA 1S3ZA 5FVJA 3P2HA 4C68A 4MFJA 5DWNA 1GHEA 4KVME 2O28A 3ZZIA 4C2ZA 2OU2A 3R1KA 2J8MA 2OB0A 1J4JA 2PC1A 4KOVA 4UFWA 2NMTA 4IUSA 1P4NA 2EUIA 1Z4RA 2B3UA 1B87A 2OZUA 3DDDA 4B13A 1XF8A 5HH1A 5AG7A 3S6HA 5AG6A 1UFHA 4MFKA 2PDOA 2G3AA 3PZJA 5A27A 3SXNA 1CM0A 2WPWA 2Z10A 4PV6A 3I3GA 4C7IA 1KUYA 4ONUA 2Z3NA 1K4JA 4B10A 2R98A 4MBUA 3H5ZA 3T90A 3S6KA 2FCKA 4KUBA 2I79A 2CNMA 1Q2DA 2QIRA 2WUUA 4UWIA 3SXOA 2PQ8A 5G22A 4MFLA 1Z9UA 2Q4YA 5JQ4A 2OZGA 4E8OA 2WSAA 4CYQA 2Q7BA 2J8NA 1U6MA 4HNYB 3DNSA 4KUAA 2ARHA 4AVCA 4CGOA 4XNHB 4I49A 2QMLA 4U9YA 4A32A 1Y7RA 4B12A 1ON0A 3VWEA 3FBUA 4KLVA 4AVBA 1S7LA 3MGDA 3S6GA 2GE3A 2IL4A 1MJBA 1Y9KA 4JD6A 4MFQA 3EXNA 5G21A 1SQHA 2Q04A 1B6BA 3D8PA 1YX0A 3DR6A 4U9ZA 4A2ZA 2P6FA 4K30A 1S5KA 1YK3A 1NSLA 4UCMA 3F0AA 3JUWA 2CY2A 3E0KA 3BJ7A 4KOSA 4JJXA 2CNTA 3F5BA 4KS9A 3G8WA 3LD2A 4B5OA 5G1ZA 5ISVA 2EVNA 2P6EA 4NCZA 3FYNA 1QSTA 2PR8A 4HKFA 2D4PA 3A9LA 5EBVA 1CJWA 3WR7A 2RC4A 4Q38A 5JPHA 3DSBA 4MJ8A 2J8RA 4UWJA 3R96A 1VHSA 5H84A 4CAEA 2BSWA 2B4DA 1QSMA 5G20A 4CAFA 2B5GB 2BL1A 2Z3LA 5KTAA 4R57A 5F48A 5CNPA 4GS4A 2VXKA 2BUEA 2WPXA 4KOWA 4IF5A 4MY0A 1M4DA 3GY9A 4JWPA 3TO9A 1KUVA 1RO5A 2FL4A 2ZW5A 2HUZA 1S7FA 3C26A 4ZBGA 1M4GA 1I12A 5GCNA 4E0AA 5H86A 3IWGA 2VEZA 4JXQA 4QBJA 4LUAA 2YNCC 1YLEA 3FIXA 2HQYA 1S7KA 3R95A 3FRMA 4CAWA 3B8GA 4YFJA 1BO4A 1MJ9A 3H4QA 4UBRA 2DPTA 4U5YA 3TFYA 1BOBA 5BWAB 5E96A 4OADA 3IWEA 2G3TA 4BBHA 4KOUA 1IICA 2B3VA 2P0WA 1IYKA 2FIAA 4H6UA 2DXQA 4PSXA 4KOXA 4H89A 3S6FA 2F5IA 1I21A 4UCNA 3EO4A 2H5MA 4NXYA 5F49A 1Q2YA 4PSWA 2JLMA 3IGRA 4R3KA 2Q4VA 1I1DA 4FD7A 3W6XA 1OZPA 2JEVA 4XNHC 4MHDA 1YVKA 5I0CA 4CGLA 2X7BA 3TTHA 4M3SA 4KOYA 4R87A 4MFZA 3K9UA 2CXAA 1Q2CA 4KSAA 1TIQA 2ZXVA 2K5TA 4KLWA 5C88A 3TCVA 4FD6A 4RS2A 4CYPA 4CGNA 4OLLA 5J8CA 2GIVA 4R9MA 3CXQA 1LRZA 5IB0A 4JXRA 3GYAA 2C27A 2GANA 1PU9A 2JDCA 4A95A 2CNSA 3W91A 5HMNA 5KTDA 3FB3A 2DPSA 1XE4A 4QVTA 4A31A 1PUAA 3D2PA 4R3LA 3JVNA 1NE9A 4CAVA 2ATRA 3BJ8A 3KKWA 3EFAA 3R9FA 2OZHA 4QC6A 4BMHA 5AG4A 5DWMA 3V8IA 1KZFA 4CYNA 1WWZA 1XIXA 5IX3A 3R9EA 2VZZA 4XPKA 3OWCA 4KVOE 4PK3A 3SHPA 4MY3A 2R1IA 4C7HA 1RXTA 4ORFA 1P0HA 2VQYA 4HNWB 2B5GA 4XPDC 3NE7A 4MI4A 2Z3KA 4F0XA 1Y9WA 2HV2A 1QSRA 4XPDB 3GKRA 2Q44A 1YVOA 4UCPA 1VKCA 4HNXB 4UFVA 2FE7A 3EY5A 2FXFA 4FD4A 1YR0A 2YGWA 4Y49B 3DR8A 1XMTA 1KUXA 2R8VA 2ZW7A 1NMTA 4DNCA 1YGHA 4L89A 4YGOA 4JLYA 4OAEA 3G3SA 3VWDA 3F8KA 4J3GA 4RI1A 2YNCA 4EVYA 1QSOA 1S7NA 2FT0A 2Q0YA 4AG7A 1IB1E 2Z3MA 3P2FA 1N71A 2REEA 4KSFA 1ZO0A 1IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1D A;  5J8F A;  2Y0M A;  2BEI A;  2VI7 A;  2FSR A;  2PSW A;  4AVA A;  5KTC A;  2B58 A;  2OH1 A;  2FS5 A;  1V0C A;  4KOR A;  2Z11 A;  2KCW A;  4AB7 A;  4XPL A;  2D4O A;  3ZJ0 A;  2REF A;  3TOB A;  2R7H A;  3PGP A;  4CRY B;  3TOA A;  1FY7 A;  4II9 A;  1MJA A;  1QSN A;  2AJ6 A;  3FNC A;  2VBQ A;  1YRE A;  3CXS A;  3FXT A;  2Z0Z A;  2ZW4 A;  3TE4 A;  1M4I A;  4H6Z A;  2FIW A;  4KOT A;  3UY5 A;  4E2A A;  4M85 A;  1R57 A;  4KZT A;  2QEC A;  3EC4 A;  3TO6 A;  2PRB A;  3QB8 A;  4F0Y A;  4YRH A;  2ZW6 A;  4PK2 A;  4LX9 A;  3N7Z A;  2PR1 A;  4L8A A;  4QUS A;  4CRZ B;  4NF1 A;  3I9S A;  2VZY A;  4QB9 A;  3CXP A;  3D2M A;  1L0C A;  3W6S A;  1M44 A;  2ZPA A;  3RYO A;  5F46 A;  1IYL A;  3R9G A;  4AG9 A;  3QAH A;  4B5P B;  2B4B A;  1WK4 A;  3TT2 A;  5C82 A;  4UA3 A;  4B5P A;  2AE6 A;  5EC4 A;  2A4N A;  3PP9 A;  3T9Y A;  4NEX A;  5F47 A;  1MK4 A;  4NSQ A;  4CS0 B;  4KVX A;  3LOD A;  4FD5 A;  4CAX A;  2I00 A;  5IV0 A;  2B4D B;  2P6G A;  3BLN A;  3D3S A;  4X5K A;  1Z4E A;  1XEB A;  4Y49 C;  1S60 A;  2G0B A;  3TO7 A;  4F6A A;  2JDD A;  1S3Z A;  5FVJ A;  3P2H A;  5DWN A;  1GHE A;  4KVM E;  2O28 A;  3ZZI A;  2OU2 A;  3R1K A;  2J8M A;  2OB0 A;  1J4J A;  2PC1 A;  4KOV A;  2NMT A;  4IUS A;  2EUI A;  1Z4R A;  2B3U A;  1B87 A;  2OZU A;  3DDD A;  1XF8 A;  5HH1 A;  3S6H A;  1UFH A;  2PDO A;  2G3A A;  3PZJ A;  3SXN A;  1CM0 A;  2WPW A;  2Z10 A;  4PV6 A;  3I3G A;  1KUY A;  4ONU A;  1K4J A;  2R98 A;  4MBU A;  3T90 A;  3S6K A;  2FCK A;  4KUB A;  2I79 A;  2CNM A;  1Q2D A;  2QIR A;  4UWI A;  3SXO A;  2PQ8 A;  1Z9U A;  2Q4Y A;  5JQ4 A;  2OZG A;  4E8O A;  2Q7B A;  2J8N A;  1U6M A;  4HNY B;  3DNS A;  4KUA A;  2ARH A;  4AVC A;  4XNH B;  4I49 A;  2QML A;  4U9Y A;  1Y7R A;  1ON0 A;  3VWE A;  3FBU A;  4KLV A;  4AVB A;  1S7L A;  3MGD A;  3S6G A;  2GE3 A;  2IL4 A;  1MJB A;  1Y9K A;  4JD6 A;  3EXN A;  1SQH A;  2Q04 A;  1B6B A;  3D8P A;  1YX0 A;  3DR6 A;  4U9Z A;  2P6F A;  4K30 A;  1S5K A;  1YK3 A;  1NSL A;  3F0A A;  3JUW A;  2CY2 A;  3E0K A;  3BJ7 A;  4KOS A;  4JJX A;  2CNT A;  3F5B A;  3G8W A;  3LD2 A;  4B5O A;  5ISV A;  2EVN A;  2P6E A;  4NCZ A;  3FYN A;  1QST A;  2PR8 A;  4HKF A;  2D4P A;  5EBV A;  1CJW A;  3WR7 A;  2RC4 A;  5JPH A;  3DSB A;  4MJ8 A;  2J8R A;  4UWJ A;  3R96 A;  1VHS A;  5H84 A;  2BSW A;  2B4D A;  1QSM A;  2B5G B;  2BL1 A;  5KTA A;  4R57 A;  5F48 A;  5CNP A;  4GS4 A;  2VXK A;  2BUE A;  2WPX A;  4KOW A;  4IF5 A;  4MY0 A;  1M4D A;  3GY9 A;  4JWP A;  3TO9 A;  1KUV A;  1RO5 A;  2FL4 A;  2ZW5 A;  2HUZ A;  1S7F A;  3C26 A;  4ZBG A;  1M4G A;  1I12 A;  5GCN A;  4E0A A;  5H86 A;  3IWG A;  2VEZ A;  4JXQ A;  4QBJ A;  4LUA A;  1YLE A;  3FIX A;  2HQY A;  1S7K A;  3R95 A;  3FRM A;  4CAW A;  3B8G A;  4YFJ A;  1BO4 A;  1MJ9 A;  3H4Q A;  4UBR A;  4U5Y A;  3TFY A;  1BOB A;  5E96 A;  4OAD A;  2G3T A;  4KOU A;  1IIC A;  2B3V A;  2P0W A;  1IYK A;  2FIA A;  4H6U A;  2DXQ A;  4PSX A;  4KOX A;  4H89 A;  3S6F A;  2F5I A;  1I21 A;  3EO4 A;  2H5M A;  4NXY A;  5F49 A;  1Q2Y A;  4PSW A;  2JLM A;  3IGR A;  4R3K A;  2Q4V A;  1I1D A;  4FD7 A;  3W6X A;  1OZP A;  2JEV A;  4XNH C;  4MHD A;  1YVK A;  5I0C A;  2X7B A;  3TTH A;  4M3S A;  4KOY A;  4R87 A;  3K9U A;  1Q2C A;  1TIQ A;  2ZXV A;  2K5T A;  4KLW A;  5C88 A;  3TCV A;  4FD6 A;  4RS2 A;  4OLL A;  5J8C A;  2GIV A;  4R9M A;  3CXQ A;  1LRZ A;  5IB0 A;  4JXR A;  3GYA A;  2C27 A;  2GAN A;  1PU9 A;  2JDC A;  2CNS A;  3W91 A;  5HMN A;  5KTD A;  3FB3 A;  1XE4 A;  4QVT A;  1PUA A;  3D2P A;  4R3L A;  3JVN A;  1NE9 A;  4CAV A;  2ATR A;  3BJ8 A;  3KKW A;  3EFA A;  3R9F A;  2OZH A;  4QC6 A;  4BMH A;  5DWM A;  3V8I A;  1KZF A;  1WWZ A;  1XIX A;  5IX3 A;  3R9E A;  2VZZ A;  4XPK A;  3OWC A;  4KVO E;  4PK3 A;  3SHP A;  4MY3 A;  2R1I A;  1RXT A;  4ORF A;  1P0H A;  2VQY A;  4HNW B;  2B5G A;  4XPD C;  3NE7 A;  4MI4 A;  1Y9W A;  2HV2 A;  1QSR A;  4XPD B;  3GKR A;  2Q44 A;  1YVO A;  1VKC A;  4HNX B;  2FE7 A;  3EY5 A;  2FXF A;  4FD4 A;  1YR0 A;  4Y49 B;  3DR8 A;  1XMT A;  1KUX A;  2R8V A;  2ZW7 A;  1NMT A;  4DNC A;  1YGH A;  4L89 A;  4YGO A;  4JLY A;  4OAE A;  3G3S A;  3VWD A;  3F8K A;  4J3G A;  4RI1 A;  4EVY A;  1QSO A;  1S7N A;  2FT0 A;  2Q0Y A;  4AG7 A;  1IB1 E;  3P2F A;  1N71 A;  2REE A;  1P4N A;  1IID A; 
#chains in the Genus database with same CATH topology
 1M1D A;  5J8F A;  4TNU A;  4Q36 A;  2Y0M A;  2BEI A;  2IQ6 A;  2VI7 A;  3ISZ A;  4UEZ A;  2FSR A;  2PSW A;  4AVA A;  5KTC A;  2Z3O A;  1FNO A;  2B58 A;  2OH1 A;  2FS5 A;  2YNE A;  1V0C A;  2JEW A;  4KOR A;  4EME A;  3H8G A;  3FF3 A;  1Q7L A;  2Z11 A;  2KCW A;  4AB7 A;  2C6P A;  4PPZ A;  2C6G A;  4XPL A;  4A33 A;  5K8O A;  1LAN A;  5D29 A;  2D4O A;  3PB6 X;  3FH4 A;  1Y0R A;  4B11 A;  4Q7A A;  1Y7E A;  4C2X A;  3ZJ0 A;  2REF A;  3TOB A;  2EK9 A;  5A28 A;  4OID A;  2R7H A;  3KGQ A;  4OME A;  2CTB A;  1QQ9 A;  3PGP A;  4CRY B;  1XJO A;  4UIA A;  2PJA A;  3TOA A;  2QVP A;  1FY7 A;  4CGM A;  2Z3P A;  1ELL P;  2YND A;  4II9 A;  1ZG8 A;  3NE8 A;  4P4E A;  1MJA A;  1QSN A;  1CX8 A;  2AJ6 A;  3FMC A;  4W9Y A;  3FNC A;  2VBQ A;  3CZX A;  1YRE A;  2PJ3 A;  3LWU A;  3CXS A;  3FXT A;  3PBB A;  2Q7S A;  1IY7 A;  2Z0Z A;  2ZW4 A;  1AYE A;  3TE4 A;  1M4I A;  4H6Z A;  1TKJ A;  2PJ1 A;  2FIW A;  4KOT A;  2CTC A;  4BIN A;  3MN8 A;  3UY5 A;  4E2A A;  1R3N A;  4M85 A;  2ZEM A;  2AFM A;  4RUH A;  1R57 A;  4KZT A;  4NFR A;  3DGV A;  2QEC A;  4MHP A;  3EC4 A;  3TO6 A;  4UEF A;  4NJR A;  2PRB A;  3QB8 A;  4F0Y A;  4YRH A;  2ZEO A;  2ZW6 A;  4PK2 A;  4LX9 A;  3CT9 A;  3S9N A;  1PYT B;  2XEF A;  3N7Z A;  2PR1 A;  4L8A A;  2GU2 A;  4QUS A;  4CRZ B;  4NF1 A;  3I1U A;  3I9S A;  5AG5 A;  2VZY A;  4QB9 A;  3KHX A;  4NJQ A;  2ZEL A;  3D7G A;  4LQ6 A;  3CXP A;  2CF4 A;  3D2M A;  4M6I A;  4CGP A;  1L0C A;  3W6S A;  3BXM A;  3T8W A;  1M44 A;  2ZPA A;  3RYO A;  5F46 A;  1IYL A;  3R9G A;  4MCR A;  2ABZ A;  3PRT A;  4AG9 A;  3QAH A;  4B5P B;  4MFP A;  4MCP A;  2B4B A;  1JQG A;  4CYO A;  1WK4 A;  3TT2 A;  5C82 A;  2EBJ A;  4K3N A;  1Z8L A;  4UA3 A;  3RZA A;  4B5P A;  2EK8 A;  4PQA A;  4MXU A;  2AE6 A;  4FBE A;  2V8V A;  1IU8 A;  3KQZ A;  1Z8W A;  5EC4 A;  2A4N A;  3PP9 A;  3T9Y A;  4NEX A;  4EWT A;  3QAY A;  1HEE A;  5F47 A;  1MK4 A;  4NSQ A;  4CS0 B;  2PJB A;  4KVX A;  3CPX A;  4F9V A;  3LOD A;  4FD5 A;  4P6Y A;  3VAR A;  3FX6 A;  3K9T A;  4CAX A;  1QMU A;  2I00 A;  5IV0 A;  1YSJ A;  2B4D B;  2ZEG A;  4MCQ A;  2P6G A;  3BLN A;  3D3S A;  4X5K A;  4X3R A;  1Z4E A;  5AGE A;  1XEB A;  4UFX A;  3IU2 A;  4Y49 C;  1S60 A;  4A30 A;  4C2Y A;  4ZGY B;  3IU1 A;  2G0B A;  5K8P A;  5CBM A;  5CPA A;  3TO7 A;  3DLJ A;  3D66 A;  4UF4 A;  4F6A A;  4B14 A;  1YW6 A;  4ZYQ A;  2JDD A;  2GFQ A;  1S3Z A;  3D67 A;  3JTK A;  3FEC A;  5FVJ A;  3P2H A;  1BLL E;  4C68 A;  4MFJ A;  5DWN A;  3WC5 A;  1GHE A;  1LOK A;  2HB6 A;  4KVM E;  4OP4 A;  5JGF A;  2O28 A;  3H8F A;  3ZZI A;  4C2Z A;  2OU2 A;  3R1K A;  4LQG A;  2J8M A;  1R43 A;  3SJX A;  1TF9 A;  2Q51 A;  3WC6 A;  2OB0 A;  1J4J A;  2PC1 A;  4KOV A;  4H2K A;  4UFW A;  2NMT A;  1P4N A;  4IUS A;  2EUI A;  4X2T A;  1Z4R A;  4DYO A;  2B3U A;  1B87 A;  5LRJ A;  3IEH A;  2OZU A;  4UEE A;  3DDD A;  3NA6 A;  3ISX A;  4B13 A;  1XF8 A;  5HH1 A;  2NSM A;  2PJ8 A;  3IO1 A;  5AG7 A;  3S6H A;  1LCP A;  5AG6 A;  3WT4 A;  1DE4 C;  4MHZ A;  1CP6 A;  1Y0Y A;  3KR4 A;  1UFH A;  2PIY A;  2I3C A;  2PDO A;  2G3A A;  4MFK A;  5LRG A;  2NYQ A;  3PZJ A;  3SJE A;  3SXN A;  1CM0 A;  2WPW A;  3NH8 A;  2Z10 A;  4PV6 A;  5A27 A;  3I3G A;  4C7I A;  3MRU A;  3KZW A;  1KUY A;  2G9D A;  2Z3N A;  4ONU A;  1K4J A;  4B10 A;  5HXD A;  2R98 A;  4MBU A;  1VHO A;  5K8M A;  3GUX A;  3H5Z A;  3S6K A;  3T90 A;  2IJZ A;  2FCK A;  4P4I A;  2PJ6 A;  4KUB A;  3TC8 A;  5I4M A;  2I79 A;  2CNM A;  4PXC A;  5IB9 A;  4YU9 A;  2PVV A;  1HDU A;  1Q2D A;  2QIR A;  2C1C A;  2WUU A;  3IFE A;  4UWI A;  3V38 A;  3SXO A;  3B7I A;  2PQ8 A;  5G22 A;  4MFL A;  1Z9U A;  3D7F A;  2Q4Y A;  1F2P A;  1BAV A;  2OZG A;  3KI9 A;  2PJ7 A;  3KQX A;  2JBJ A;  5JQ4 A;  2XEJ A;  2AFU A;  1F2O A;  4E8O A;  2WSA A;  4CYQ A;  1IGB A;  2WZN A;  2Q7B A;  2J8N A;  4P4D A;  1U6M A;  1VIX A;  1PCA A;  3B3S A;  4P4J A;  1BPN A;  4M6H A;  4HNY B;  2ZEE A;  3DNS A;  2JBK A;  4KUA A;  1TF8 A;  3B35 A;  8CPA A;  2EO8 A;  1YLO A;  2ARH A;  4AVC A;  4CGO A;  1TKH A;  2PVW A;  4XNH B;  1XFO A;  4I49 A;  4A38 A;  3RBU A;  3IC1 A;  4KSI A;  4YWY A;  2QML A;  3PEI A;  4U9Y A;  2ZED A;  4NGN A;  3RNZ A;  4A32 A;  1Y7R A;  4B12 A;  3S9L A;  1ON0 A;  3SI2 A;  5HVG A;  3VWE A;  1Z5R A;  2AFO A;  3FBU A;  3PFO A;  4KLV A;  4NGT A;  4R7M A;  1ARL A;  4AVB A;  1S7L A;  3MGD A;  3S6G A;  2GE3 A;  2IL4 A;  3GB0 A;  1MJB A;  1Y9K A;  4JD6 A;  2CIJ A;  4MFQ A;  1UWY A;  3EXN A;  5G21 A;  1SQH A;  2Q04 A;  2RFH A;  1B6B A;  3D8P A;  5LYL A;  1YX0 A;  3DR6 A;  2F7V A;  4U9Z A;  4DJL A;  4A2Z A;  2P6F A;  2AFW A;  3KHZ A;  1ZLH A;  4K30 A;  3NFZ A;  2PRQ A;  2RB7 A;  1S5K A;  1YK3 A;  1NSL A;  5LRK A;  2GLF A;  4NGP A;  4PXE A;  3D68 A;  4UCM A;  3F0A A;  3JUW A;  1F57 A;  2CY2 A;  3E0K A;  4A37 A;  3BJ7 A;  1XBU A;  4KOS A;  4JJX A;  2CNT A;  3F5B A;  4KS9 A;  3G8W A;  3B3C A;  3LD2 A;  4B5O A;  5G1Z A;  4AXV A;  2VL1 A;  4CPA A;  5ISV A;  2EVN A;  2DF5 A;  2P6E A;  4NCZ A;  3FYN A;  1QST A;  2PE3 A;  2PR8 A;  4HKF A;  4MHN A;  2D4P A;  3CPA A;  1TKF A;  3A9L A;  1HDQ A;  1XRY A;  3PBE A;  2OR4 A;  5EBV A;  1CJW A;  3WR7 A;  3D4U A;  1VHE A;  2POK A;  4OC4 A;  2RC4 A;  4Q38 A;  4ONW A;  3DSB A;  4A39 A;  5JPH A;  4MJ8 A;  2J8R A;  5HVF A;  4UWJ A;  3R96 A;  4ZI6 A;  1VHS A;  1XOV A;  2ZEF A;  1AUG A;  2BSW A;  5H84 A;  2B4D A;  4CAE A;  1QSM A;  3LMS A;  5G20 A;  4CAF A;  4FAI A;  2HC9 A;  2B5G B;  4P45 A;  7CPA A;  2BL1 A;  2Z3L A;  3H8E A;  3PB7 X;  4JYW A;  5KTA A;  4R57 A;  5F48 A;  5F09 A;  2V8G A;  2OOT A;  5CNP A;  4GS4 A;  1ZG7 A;  2VXK A;  4ZX8 A;  3B3V A;  4OIW A;  2BUE A;  2WPX A;  5THW A;  3D7H A;  1JWQ A;  4KOW A;  4OC1 A;  4NGM A;  4IF5 A;  3QNV A;  4MY0 A;  1M4D A;  3GY9 A;  4JWP A;  3TO9 A;  1KUV A;  1RO5 A;  2FL4 A;  3B3T A;  2ZW5 A;  2HUZ A;  1S7F A;  3C26 A;  4ZBG A;  1H8L A;  1M4G A;  1I12 A;  3PB9 X;  4WJB A;  5GCN A;  4E0A A;  5H86 A;  2DEA A;  3IWG A;  3IJ3 A;  2VEZ A;  4JXQ A;  2BOA A;  4P10 A;  3RAM A;  4QBJ A;  4ZY1 A;  4LUA A;  2YNC C;  1YLE A;  3FIX A;  4GXH A;  3JRU A;  2HQY A;  4TWE A;  4OC2 A;  4WWV A;  1S7K A;  1ELM P;  3R95 A;  2PCU A;  3FRM A;  3KR5 A;  3SJF A;  4CAW A;  3B8G A;  5LYI A;  4YFJ A;  1EE3 P;  1BO4 A;  2QJ8 A;  1CG2 A;  1MJ9 A;  3SJG A;  3H4Q A;  1BPM A;  4UBR A;  2DPT A;  4U5Y A;  4X8I A;  1BOB A;  3TFY A;  3WAB A;  5BWA B;  2FVG A;  5E96 A;  4OAD A;  3IWE A;  4PXB A;  2ODF A;  3HLP A;  2G3T A;  5J1Q A;  4BBH A;  2EWB A;  1ZLI A;  4KOU A;  1IIC A;  4ZY0 A;  2B3V A;  1CPS A;  2P0W A;  1IYK A;  2FIA A;  1LFW A;  2DXQ A;  4H6U A;  4KOX A;  3K2K A;  2ZOG A;  4H89 A;  4M6G A;  4PSX A;  3S6F A;  2F5I A;  4GM5 A;  3TX8 A;  1I21 A;  1Z8X A;  3EO4 A;  2QYV A;  1AMP A;  2V8D A;  2H5M A;  4UCN A;  4NXY A;  3RO0 A;  5F49 A;  2AFS A;  1Q2Y A;  4PSW A;  2J9A A;  2JLM A;  3IGR A;  4R3K A;  2Q4V A;  1I1D A;  4FD7 A;  3FJU A;  2GLJ A;  3BHX A;  3SI1 A;  4MRI A;  3W6X A;  1LAM A;  3FED A;  1OZP A;  2JEV A;  2PIZ A;  4XNH C;  4MHD A;  3BI0 A;  2V77 A;  4F9U A;  3B2Y A;  1YVK A;  2PJ5 A;  5I0C A;  4CGL A;  1DTD A;  2X7B A;  3TTH A;  4G1P A;  4KOY A;  4M3S A;  4R87 A;  1Z2L A;  4MFZ A;  2CXA A;  3K9U A;  3KAS A;  1Q2C A;  4KSA A;  4MMO A;  1TIQ A;  2ZXV A;  4OC3 A;  2O53 A;  2K5T A;  4KLW A;  3VAT A;  2AFZ A;  3PB4 X;  1M4L A;  4FD6 A;  3TCV A;  4RS2 A;  2ANP A;  4B6Z A;  5C88 A;  1LAP A;  4CYP A;  2PJ9 A;  4CGN A;  4OLL A;  5J8C A;  3LAC A;  2GIV A;  2ZEN A;  2ZEP A;  5DS0 A;  2C6C A;  4R9M A;  3CXQ A;  3HUV A;  1LRZ A;  6CPA A;  5EMI A;  4O23 A;  4JXR A;  4ZY2 A;  3GYA A;  5IB0 A;  2C27 A;  2GAN A;  2XEI A;  1PU9 A;  4NGR A;  2JDC A;  1X10 A;  1FT7 A;  4A95 A;  4UIB A;  5JM6 A;  2CNS A;  3D7D A;  3W91 A;  5HMN A;  5KTD A;  2GRE A;  1YW4 A;  3FB3 A;  2DPS A;  1XE4 A;  4QVT A;  4ZX9 A;  3VH9 A;  4A31 A;  1X12 A;  1PUA A;  5JH9 A;  3D2P A;  4R3L A;  2XEG A;  3JVN A;  4IAV A;  1NE9 A;  3PB8 X;  4CAV A;  2ATR A;  3BJ8 A;  3KKW A;  3EFA A;  4FWU A;  4JZ0 A;  2OZH A;  4QC6 A;  3GLJ A;  3R9F A;  4BMH A;  5AG4 A;  5DWM A;  3V8I A;  3FEE A;  1KZF A;  4A94 A;  4CYN A;  1WWZ A;  1XIX A;  5IX3 A;  2PJC A;  3R9E A;  2VZZ A;  1OBR A;  1IOF A;  3L2N A;  3OWC A;  2BCO A;  3NH5 A;  4IHM A;  4XPK A;  4KVO E;  4PK3 A;  3KL9 A;  5K8N A;  2F8H A;  2ZEH A;  4OC0 A;  4NGS A;  3SI0 A;  3V7Z A;  3SHP A;  1VGY A;  2R1I A;  4MY3 A;  2WYR A;  4PXD A;  3IIB A;  3FVL A;  4C7H A;  1RXT A;  2PJ4 A;  4MHY A;  4OC5 A;  4ORF A;  1P0H A;  2VQY A;  3NH4 A;  2B5G A;  4HNW B;  4XPD C;  4P4F A;  5D8N A;  3NE7 A;  4R76 A;  2IMO A;  4IK2 A;  2Z3K A;  2PJ0 A;  4MI4 A;  4F0X A;  1Y9W A;  4OKO A;  2HV2 A;  1QSR A;  1CP7 A;  2O4H A;  2Q44 A;  3GKR A;  4XPD B;  1YVO A;  1KWM A;  2BO9 A;  4BD9 A;  4UCP A;  1IOI A;  1VKC A;  4HNX B;  4F8Z A;  4P4B A;  1GYT A;  4UFV A;  4P44 A;  2FE7 A;  1A2Z A;  1YQE A;  4RN7 A;  4NGQ A;  3BI1 A;  3EY5 A;  2FXF A;  4FD4 A;  1YR0 A;  2Q43 A;  5ELY A;  2YGW A;  4Y49 B;  3DR8 A;  1XMT A;  1KUX A;  2R8V A;  1NSA A;  2ZW7 A;  5LYF A;  5LYD A;  1NMT A;  4DNC A;  3S9M A;  1YGH A;  4L89 A;  3GIU A;  2ZOF A;  3PFE A;  4YGO A;  2AFX A;  4JLY A;  1RTQ A;  4EFD A;  4R6T A;  4OAE A;  4HPS A;  3G3S A;  4DUK A;  2PJ2 A;  4FUU A;  3VWD A;  1YME A;  3CDX A;  3N5F A;  3F8K A;  2Q4Z A;  1CPX A;  4J3G A;  4RI1 A;  5HVH A;  2YNC A;  4EVY A;  2V8H A;  4R8F A;  1QSO A;  1XMB A;  1S7N A;  1CBX A;  1ZG9 A;  1TXR A;  3B3W A;  4Z65 A;  2FT0 A;  3WC7 A;  2Q0Y A;  4AG7 A;  1IB1 E;  2Z3M A;  3P2F A;  4MCS A;  1N71 A;  2REE A;  3IWW A;  1Z8T A;  1ARM A;  4KSF A;  1ZO0 A;  1IID A; 
#chains in the Genus database with same CATH homology
 1M1D A;  5J8F A;  4Q36 A;  2Y0M A;  2BEI A;  2VI7 A;  2FSR A;  2PSW A;  4AVA A;  5KTC A;  2Z3O A;  2B58 A;  2OH1 A;  2FS5 A;  2YNE A;  1V0C A;  4KOR A;  2Z11 A;  2KCW A;  4AB7 A;  4XPL A;  4A33 A;  2D4O A;  4B11 A;  4C2X A;  3ZJ0 A;  2REF A;  3TOB A;  5A28 A;  2R7H A;  3PGP A;  4CRY B;  3TOA A;  1FY7 A;  4CGM A;  2Z3P A;  4II9 A;  2YND A;  1MJA A;  1QSN A;  2AJ6 A;  3FNC A;  2VBQ A;  1YRE A;  3CXS A;  3FXT A;  2Z0Z A;  2ZW4 A;  3TE4 A;  1M4I A;  4H6Z A;  2FIW A;  4KOT A;  3UY5 A;  4E2A A;  4M85 A;  1R57 A;  4KZT A;  2QEC A;  3EC4 A;  3TO6 A;  2PRB A;  3QB8 A;  4F0Y A;  4YRH A;  2ZW6 A;  4PK2 A;  4LX9 A;  3N7Z A;  2PR1 A;  4L8A A;  4QUS A;  4CRZ B;  4NF1 A;  3I9S A;  5AG5 A;  2VZY A;  4QB9 A;  3CXP A;  3D2M A;  4CGP A;  1L0C A;  3W6S A;  1M44 A;  2ZPA A;  3RYO A;  5F46 A;  1IYL A;  3R9G A;  4AG9 A;  3QAH A;  4B5P B;  4MFP A;  2B4B A;  4CYO A;  1WK4 A;  3TT2 A;  5C82 A;  4UA3 A;  4B5P A;  2AE6 A;  5EC4 A;  2A4N A;  3PP9 A;  3T9Y A;  4NEX A;  5F47 A;  1MK4 A;  4NSQ A;  4CS0 B;  4KVX A;  3LOD A;  4FD5 A;  4CAX A;  2I00 A;  5IV0 A;  2B4D B;  2P6G A;  3BLN A;  3D3S A;  4X5K A;  1Z4E A;  5AGE A;  1XEB A;  4UFX A;  3IU2 A;  4Y49 C;  1S60 A;  4A30 A;  4C2Y A;  4ZGY B;  3IU1 A;  2G0B A;  3TO7 A;  4F6A A;  4B14 A;  2JDD A;  3JTK A;  1S3Z A;  5FVJ A;  3P2H A;  4C68 A;  4MFJ A;  5DWN A;  1GHE A;  4KVM E;  2O28 A;  3ZZI A;  4C2Z A;  2OU2 A;  3R1K A;  2J8M A;  2OB0 A;  1J4J A;  2PC1 A;  4KOV A;  4UFW A;  2NMT A;  4IUS A;  1P4N A;  2EUI A;  1Z4R A;  2B3U A;  1B87 A;  2OZU A;  3DDD A;  4B13 A;  1XF8 A;  5HH1 A;  5AG7 A;  3S6H A;  5AG6 A;  1UFH A;  4MFK A;  2PDO A;  2G3A A;  3PZJ A;  5A27 A;  3SXN A;  1CM0 A;  2WPW A;  2Z10 A;  4PV6 A;  3I3G A;  4C7I A;  1KUY A;  4ONU A;  2Z3N A;  1K4J A;  4B10 A;  2R98 A;  4MBU A;  3H5Z A;  3T90 A;  3S6K A;  2FCK A;  4KUB A;  2I79 A;  2CNM A;  1Q2D A;  2QIR A;  2WUU A;  4UWI A;  3SXO A;  2PQ8 A;  5G22 A;  4MFL A;  1Z9U A;  2Q4Y A;  5JQ4 A;  2OZG A;  4E8O A;  2WSA A;  4CYQ A;  2Q7B A;  2J8N A;  1U6M A;  4HNY B;  3DNS A;  4KUA A;  2ARH A;  4AVC A;  4CGO A;  4XNH B;  4I49 A;  2QML A;  4U9Y A;  4A32 A;  1Y7R A;  4B12 A;  1ON0 A;  3VWE A;  3FBU A;  4KLV A;  4AVB A;  1S7L A;  3MGD A;  3S6G A;  2GE3 A;  2IL4 A;  1MJB A;  1Y9K A;  4JD6 A;  4MFQ A;  3EXN A;  5G21 A;  1SQH A;  2Q04 A;  1B6B A;  3D8P A;  1YX0 A;  3DR6 A;  4U9Z A;  4A2Z A;  2P6F A;  4K30 A;  1S5K A;  1YK3 A;  1NSL A;  4UCM A;  3F0A A;  3JUW A;  2CY2 A;  3E0K A;  3BJ7 A;  4KOS A;  4JJX A;  2CNT A;  3F5B A;  4KS9 A;  3G8W A;  3LD2 A;  4B5O A;  5G1Z A;  5ISV A;  2EVN A;  2P6E A;  4NCZ A;  3FYN A;  1QST A;  2PR8 A;  4HKF A;  2D4P A;  3A9L A;  5EBV A;  1CJW A;  3WR7 A;  2RC4 A;  4Q38 A;  5JPH A;  3DSB A;  4MJ8 A;  2J8R A;  4UWJ A;  3R96 A;  1VHS A;  5H84 A;  4CAE A;  2BSW A;  2B4D A;  1QSM A;  5G20 A;  4CAF A;  2B5G B;  2BL1 A;  2Z3L A;  5KTA A;  4R57 A;  5F48 A;  5CNP A;  4GS4 A;  2VXK A;  2BUE A;  2WPX A;  4KOW A;  4IF5 A;  4MY0 A;  1M4D A;  3GY9 A;  4JWP A;  3TO9 A;  1KUV A;  1RO5 A;  2FL4 A;  2ZW5 A;  2HUZ A;  1S7F A;  3C26 A;  4ZBG A;  1M4G A;  1I12 A;  5GCN A;  4E0A A;  5H86 A;  3IWG A;  2VEZ A;  4JXQ A;  4QBJ A;  4LUA A;  2YNC C;  1YLE A;  3FIX A;  2HQY A;  1S7K A;  3R95 A;  3FRM A;  4CAW A;  3B8G A;  4YFJ A;  1BO4 A;  1MJ9 A;  3H4Q A;  4UBR A;  2DPT A;  4U5Y A;  3TFY A;  1BOB A;  5BWA B;  5E96 A;  4OAD A;  3IWE A;  2G3T A;  4BBH A;  4KOU A;  1IIC A;  2B3V A;  2P0W A;  1IYK A;  2FIA A;  4H6U A;  2DXQ A;  4PSX A;  4KOX A;  4H89 A;  3S6F A;  2F5I A;  1I21 A;  4UCN A;  3EO4 A;  2H5M A;  4NXY A;  5F49 A;  1Q2Y A;  4PSW A;  2JLM A;  3IGR A;  4R3K A;  2Q4V A;  1I1D A;  4FD7 A;  3W6X A;  1OZP A;  2JEV A;  4XNH C;  4MHD A;  1YVK A;  5I0C A;  4CGL A;  2X7B A;  3TTH A;  4M3S A;  4KOY A;  4R87 A;  4MFZ A;  3K9U A;  2CXA A;  1Q2C A;  4KSA A;  1TIQ A;  2ZXV A;  2K5T A;  4KLW A;  5C88 A;  3TCV A;  4FD6 A;  4RS2 A;  4CYP A;  4CGN A;  4OLL A;  5J8C A;  2GIV A;  4R9M A;  3CXQ A;  1LRZ A;  5IB0 A;  4JXR A;  3GYA A;  2C27 A;  2GAN A;  1PU9 A;  2JDC A;  4A95 A;  2CNS A;  3W91 A;  5HMN A;  5KTD A;  3FB3 A;  2DPS A;  1XE4 A;  4QVT A;  4A31 A;  1PUA A;  3D2P A;  4R3L A;  3JVN A;  1NE9 A;  4CAV A;  2ATR A;  3BJ8 A;  3KKW A;  3EFA A;  3R9F A;  2OZH A;  4QC6 A;  4BMH A;  5AG4 A;  5DWM A;  3V8I A;  1KZF A;  4CYN A;  1WWZ A;  1XIX A;  5IX3 A;  3R9E A;  2VZZ A;  4XPK A;  3OWC A;  4KVO E;  4PK3 A;  3SHP A;  4MY3 A;  2R1I A;  4C7H A;  1RXT A;  4ORF A;  1P0H A;  2VQY A;  4HNW B;  2B5G A;  4XPD C;  3NE7 A;  4MI4 A;  2Z3K A;  4F0X A;  1Y9W A;  2HV2 A;  1QSR A;  4XPD B;  3GKR A;  2Q44 A;  1YVO A;  4UCP A;  1VKC A;  4HNX B;  4UFV A;  2FE7 A;  3EY5 A;  2FXF A;  4FD4 A;  1YR0 A;  2YGW A;  4Y49 B;  3DR8 A;  1XMT A;  1KUX A;  2R8V A;  2ZW7 A;  1NMT A;  4DNC A;  1YGH A;  4L89 A;  4YGO A;  4JLY A;  4OAE A;  3G3S A;  3VWD A;  3F8K A;  4J3G A;  4RI1 A;  2YNC A;  4EVY A;  1QSO A;  1S7N A;  2FT0 A;  2Q0Y A;  4AG7 A;  1IB1 E;  2Z3M A;  3P2F A;  1N71 A;  2REE A;  4KSF A;  1ZO0 A;  1IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...