4H89A

The structure of a gcn5-related n-acetyltransferase from kribbella flavida
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
168
Chain Sequence
SPEALQVRDAEDADWPAILPFFREIVSAGETYAYDPELTDEQARSLWMTPSGPQSRTTVAVDADGTVLGSANMYPNRPGPGAHVASASFMVAAAARGRGVGRALCQDMIDWAGREGFRAIQFNAVVETNTVAVKLWQSLGFRVIGTVPEAFHHPTHGYVGLHVMHRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title The Structure of a GCN5-Related N-Acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
total genus 44
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h89A00
4AG9A 4NXYA 1Y9WA 5F49A 1K4JA 4QB9A 4FD7A 4L89A 3I3GA 4II9A 2P6EA 3FB3A 1WK4A 3EO4A 2P6FA 3TO6A 2FS5A 2VZYA 2C27A 4KORA 4JLYA 1S3ZA 1SQHA 2FT0A 1TIQA 1P0HA 4PSWA 4M85A 3SHPA 4R57A 1KZFA 4JWPA 2CNSA 2I00A 2FL4A 1YVKA 3EC4A 1QSTA 1BOBA 4JXRA 2Q44A 2B4DA 4MJ8A 4PK3A 5H86A 1YX0A 2OU2A 5CNPA 3R95A 1I1DA 3EY5A 3QAHA 4B5OA 4M3SA 2NMTA 3LODA 3CXQA 2P0WA 2PQ8A 4E8OA 2O28A 4J3GA 3P2HA 5E96A 1S60A 2ZW6A 1QSMA 4AG7A 3TO9A 2KCWA 3P2FA 3I9SA 4MHDA 2BUEA 1PU9A 1P4NA 4FD6A 4ONUA 2B3UA 4H89A 5EBVA 3W6XA 1MJAA 1NSLA 3W91A 1QSOA 3EFAA 1UFHA 3JVNA 2Q7BA 3DDDA 3R96A 4ZBGA 3TOBA 2FE7A 4KUBA 2R1IA 1Y7RA 5C82A 4NF1A 1N71A 4JJXA 1B6BA 4RS2A 4KOSA 3F0AA 3G3SA 4KUAA 2R98A 4QUSA 3TCVA 2B5GA 3TE4A 4GS4A 4CAWA 5DWMA 1S7FA 2ATRA 4U9ZA 3PZJA 5H84A 2OZGA 1VHSA 4JXQA 4LX9A 4KOTA 3F5BA 4H6ZA 4DNCA 2PC1A 3PP9A 5IX3A 1YLEA 4YFJA 1OZPA 1V0CA 4FD4A 2Z11A 1YVOA 5J8FA 2EUIA 4XPLA 1LRZA 3GY9A 1XMTA 4UA3A 1XIXA 2FXFA 1RXTA 4XNHC 1S7KA 2HQYA 1NMTA 1GHEA 4I49A 5IB0A 3TOAA 4MY0A 2HV2A 3V8IA 3GKRA 4XPDC 4KVME 4LUAA 3IWGA 2B5GB 1Q2CA 2REEA 3SXNA 3S6GA 2FIAA 4MI4A 1I12A 2ARHA 2PR1A 2J8RA 3F8KA 4B5PA 4QC6A 2B3VA 5JPHA 3D8PA 1S7NA 3MGDA 4KOUA 1KUVA 2ZPAA 2VZZA 2FCKA 2J8MA 3FXTA 4CAVA 1QSRA 3ZZIA 2J8NA 3CXPA 1IYLA 3D3SA 4R87A 1Z9UA 4E0AA 3W6SA 2FSRA 4H6UA 3D2MA 4Y49B 1IYKA 2GIVA 3T90A 2P6GA 2JDDA 3K9UA 3RYOA 2OB0A 3GYAA 1R57A 3TTHA 2Q4VA 3FIXA 1M4IA 4U9YA 2Z10A 3S6FA 1J4JA 1M4GA 1CJWA 2ZW4A 4OAEA 5F46A 3R1KA 1YK3A 2QECA 1XE4A 2PDOA 4PSXA 3R9GA 2ZW7A 4PK2A 2B4BA 2VI7A 3BJ8A 5EC4A 2B4DB 3TO7A 2OZHA 5J8CA 3NE7A 3FRMA 2VEZA 2R8VA 4AVBA 5HH1A 1Q2DA 3DR6A 1S5KA 2PSWA 1RO5A 2OH1A 3ZJ0A 4KVOE 4F6AA 5KTCA 2K5TA 2DXQA 4KOVA 1YREA 2BEIA 2QIRA 1Q2YA 4YRHA 2D4PA 3UY5A 2VXKA 2AE6A 5DWNA 2A4NA 2R7HA 3TT2A 4X5KA 1U6MA 3VWEA 5KTDA 1PUAA 4HNYB 4HKFA 4QBJA 1IB1E 4FD5A 2WPWA 4ORFA 3B8GA 3CXSA 1ON0A 5HMNA 2ZW5A 4K30A 2BSWA 4F0YA 3T9YA 3S6HA 4NSQA 4KOXA 4KOWA 4E2AA 1FY7A 2IL4A 4R3LA 4AVCA 4R3KA 2ZXVA 2GE3A 2PR8A 1QSNA 4U5YA 4CS0B 4QVTA 2QMLA 2FIWA 1M1DA 2AJ6A 4UWJA 2CNTA 4HNWB 5F48A 3BJ7A 4KVXA 3KKWA 1KUXA 2G3AA 4PV6A 1YGHA 4MBUA 4CRZB 4OADA 3R9EA 2Y0MA 1XF8A 1M4DA 2Q04A 4AVAA 2G3TA 1L0CA 3H4QA 3D2PA 2JEVA 3PGPA 4JD6A 4B5PB 1I21A 2OZUA 4EVYA 3WR7A 1BO4A 3FBUA 5FVJA 2JLMA 5IV0A 3FYNA 2CNMA 2VQYA 3TFYA 2HUZA 4IF5A 4CAXA 3DR8A 5JQ4A 3JUWA 1B87A 1Z4EA 5C88A 1MJBA 1KUYA 4XPKA 2REFA 2Z0ZA 3IGRA 4KOYA 2WPXA 2RC4A 2VBQA 3E0KA 3QB8A 4CRYB 3VWDA 2X7BA 2H5MA 1VKCA 4UWIA 4Y49C 3G8WA 4YGOA 4KLVA 1YR0A 2EVNA 3R9FA 4IUSA 3BLNA 5ISVA 1MJ9A 2BL1A 1IICA 2JDCA 1WWZA 4NEXA 2G0BA 4XNHB 4UBRA 2PRBA 5F47A 2D4OA 4HNXB 5GCNA 3LD2A 4OLLA 3FNCA 4XPDB 2Q4YA 5I0CA 4L8AA 4NCZA 4RI1A 2B58A 1CM0A 3DSBA 2F5IA 1NE9A 3EXNA 2GANA 1Y9KA 1M44A 5KTAA 1Z4RA 3SXOA 2CY2A 4AB7A 3OWCA 1MK4A 3C26A 4R9MA 1S7LA 4MY3A 3DNSA 1XEBA 2Q0YA 4KZTA 1IIDA 3N7ZA 4BMHA 2I79A 3S6KA 4KLWA
chains in the Genus database with same CATH superfamily
2I3CA 4K3NA 1CX8A 4AG9A 4UIAA 4PQAA 4NXYA 5AGEA 1Y9WA 1DTDA 5F49A 1K4JA 1AMPA 2Z3PA 3SI2A 5LRGA 4QB9A 3FEEA 4FD7A 2IQ6A 3KHXA 6CPAA 4L89A 5JH9A 2F7VA 2ZENA 3I3GA 4II9A 2P6EA 4CAEA 3FB3A 1HEEA 2V8GA 4NGPA 1WK4A 4NGTA 3EO4A 2AFOA 2P6FA 2IMOA 3TO6A 1A2ZA 2FS5A 2VZYA 2C27A 4JLYA 4KORA 1S3ZA 1SQHA 2FT0A 4MFPA 4ZY0A 1TIQA 4CGOA 3V38A 1P0HA 3FX6A 4PSWA 5K8PA 2EBJA 4M85A 4MCSA 2BO9A 5HVFA 4R57A 1KZFA 4NGSA 4JWPA 3SHPA 4A94A 3S9LA 3FH4A 2CNSA 2I00A 2PJ8A 2FL4A 1YVKA 3EC4A 1QSTA 1BOBA 4JXRA 2Q44A 2B4DA 4MJ8A 4NGQA 4PK3A 4UEFA 1Z5RA 1YX0A 5H86A 2OU2A 4CAWA 2QVPA 3CZXA 5CNPA 3R95A 1I1DA 1HDQA 3EY5A 3QAHA 3WC5A 5LYLA 4B5OA 4M3SA 1ZG7A 2NMTA 1ZLHA 4UCNA 1BPMA 2GREA 2YGWA 3H5ZA 4C7HA 3NFZA 4PXDA 4NJQA 3IU1A 4ZY2A 4FBEA 3LODA 3B35A 2XEJA 2QJ8A 3CXQA 2WSAA 4UF4A 2P0WA 1XFOA 2PQ8A 1DE4C 4E8OA 4NJRA 2O28A 4J3GA 3K2KA 3P2HA 3IWEA 4PXBA 1S60A 5E96A 2ZW6A 3B3SA 1QSMA 3RBUA 2Q51A 3FVLA 4X2TA 4AG7A 2CF4A 2KCWA 3P2FA 3TO9A 3I9SA 4MHDA 4ZX8A 2BUEA 4G1PA 1VIXA 4MFKA 4C7IA 3H8EA 1PU9A 1XOVA 4A39A 4Z65A 3PFOA 5ELYA 1P4NA 4FD6A 4CAFA 2PE3A 2CIJA 4ONUA 2B3UA 4H89A 5EBVA 1JQGA 3W6XA 2PIYA 4KSFA 1MJAA 3IIBA 3PEIA 3ISZA 1NSLA 3W91A 1QSOA 3EFAA 3QNVA 5LYIA 1UFHA 3JVNA 2Q7BA 3HLPA 3DDDA 3R96A 4ZBGA 3TOBA 2FE7A 4KUBA 4B13A 4UCMA 2Z3KA 2R1IA 3PB8X 4KS9A 1CG2A 1Y7RA 1RTQA 5D8NA 5C82A 1Y7EA 4NF1A 2V77A 3FEDA 3PBBA 1N71A 3CPXA 4JJXA 1B6BA 1TKFA 4RS2A 3F0AA 4KOSA 2NSMA 3G3SA 4P45A 3RAMA 4DJLA 4R6TA 4MFJA 4KUAA 2R98A 2V8VA 4QUSA 1IOIA 3TCVA 3JTKA 5AG4A 2B5GA 3FMCA 2EK9A 4MMOA 4NGMA 1IGBA 4MCQA 4CYQA 3NH5A 3TE4A 3SJEA 2POKA 4ZY1A 3GLJA 4GS4A 4FUUA 4IK2A 5AG6A 1S7FA 5DWMA 2ATRA 3NA6A 4U9ZA 1IOFA 2O4HA 2YNCC 3PZJA 2OZGA 4PXCA 5H84A 1VHSA 4R76A 5THWA 4A33A 4JXQA 4LX9A 4OC5A 4KOTA 2PJ3A 1EE3P 3CT9A 3F5BA 4H6ZA 4UFWA 1YQEA 2EO8A 3S9MA 4UEEA 2PC1A 3PP9A 3KGQA 4NFRA 4DNCA 5IX3A 1YLEA 1TKJA 4YWYA 4UFXA 2EK8A 1F57A 4YFJA 1OZPA 1V0CA 4KSIA 2ZELA 4FD4A 4OKOA 2Z11A 1YVOA 3LACA 5J8FA 2EUIA 3T8WA 4XPLA 4NGRA 1LRZA 3GY9A 1XMTA 4MHNA 1AUGA 4UA3A 1XIXA 2FXFA 4P4DA 1RXTA 4XNHC 1S7KA 4GXHA 1LANA 2ZEHA 1LFWA 4CGLA 2AFMA 2AFSA 2HQYA 4O23A 1NMTA 2RFHA 4A31A 3PB7X 3PFEA 1GHEA 4I49A 5IB0A 3TOAA 4MY0A 4OC4A 5EMIA 1YW6A 2HV2A 3V8IA 3GKRA 4XPDC 3B7IA 4KVME 3N5FA 4LUAA 3IWGA 2B5GB 1Q2CA 2REEA 3SXNA 3S6GA 2PJCA 2FIAA 1Z8LA 2XEGA 3KI9A 1I12A 4MI4A 4MHYA 2ARHA 2PR1A 2J8RA 3F8KA 3LWUA 4F9UA 4B5PA 2CTCA 4A38A 5A28A 3FJUA 3WC7A 4QC6A 2B3VA 2PJ9A 4OMEA 2EWBA 2V8DA 5JPHA 2DPSA 3D8PA 3B2YA 5LRJA 1S7NA 4X3RA 4A95A 3MGDA 4KOUA 1KUVA 3SJXA 2ZPAA 4UFVA 2ZEEA 2VZZA 3DGVA 4NGNA 4FAIA 2FCKA 3CDXA 2J8MA 4P44A 4A2ZA 4A30A 3FXTA 4RUHA 1H8LA 4CAVA 2ZEDA 1QSRA 5HVHA 4DYOA 3ZZIA 4MXUA 1TF9A 2J8NA 3CXPA 1IYLA 4C2YA 4TNUA 1ARMA 3D3SA 4R87A 1Z9UA 4E0AA 3L2NA 3W6SA 2ABZA 4MHPA 1TXRA 2FSRA 4H6UA 5F09A 3D2MA 4MHZA 4Y49B 1KWMA 1IYKA 2GIVA 2YNCA 3T90A 2P6GA 5G21A 2ZEOA 4OC1A 2JDDA 4Q36A 3K9UA 4ZX9A 3RYOA 1HDUA 2Q7SA 2G9DA 2OB0A 3GYAA 1R57A 1XRYA 2ZEMA 3IC1A 3D4UA 3TTHA 1LAPA 2CTBA 3HUVA 5IB9A 2C6GA 3H8FA 2Q4VA 4B14A 1YMEA 3FIXA 1M4IA 3B3CA 2PJBA 3KR5A 4U9YA 4H2KA 3IJ3A 2Z10A 1CPSA 3S6FA 1J4JA 1Q7LA 1M4GA 4LQ6A 1CJWA 2ZW4A 1LAMA 4OAEA 5F46A 3R1KA 1YK3A 2QECA 1XE4A 2ZOFA 2PDOA 4PSXA 4F9VA 3GUXA 4OC3A 3R9GA 2ZW7A 3RNZA 2WZNA 2B4BA 2VI7A 4PK2A 3BJ8A 1LOKA 2B4DB 5EC4A 3TO7A 2OZHA 5J8CA 1PCAA 3NE7A 2ZEGA 3D7DA 3FRMA 2JEWA 4A32A 1ZO0A 2R8VA 2VEZA 2PJ6A 4CPAA 1JWQA 1XBUA 2ZOGA 1Z2LA 5HH1A 2HC9A 1Q2DA 2Z3MA 2OOTA 4AVBA 3DR6A 4F0XA 1ELLP 1S5KA 2PSWA 3VATA 4KSAA 1RO5A 2OH1A 5G1ZA 3ZJ0A 4KVOE 4OIDA 4F6AA 5KTCA 2K5TA 2J9AA 4MFZA 3NH4A 2XEIA 5K8NA 3H8GA 4A37A 2PJ5A 3SI0A 2OR4A 2DXQA 3PBEA 4R8FA 1NSAA 2AFWA 4KOVA 1YREA 1IY7A 2BEIA 3IO1A 2QIRA 1Q2YA 3D67A 3LMSA 4YRHA 1ZG9A 2D4PA 3UY5A 3WABA 4MFQA 4CGNA 5CBMA 2VXKA 4R7MA 1YSJA 2AE6A 5DWNA 4LQGA 4AXVA 4B10A 2A4NA 1Z8TA 1ZG8A 4UIBA 4P4FA 8CPAA 2R7HA 5G22A 3TT2A 2O53A 4X5KA 1U6MA 2DPTA 3VH9A 3VWEA 5J1QA 2PJ2A 5KTDA 1PUAA 5AG7A 3PB9X 5CPAA 2CXAA 4HNYB 4P4BA 4ZI6A 4HKFA 1XJOA 3KQZA 4QBJA 1IB1E 4FD5A 2WPWA 1VHOA 4ORFA 1UWYA 4CGPA 3KZWA 4OC2A 3B8GA 3WC6A 1CBXA 1QMUA 2C6CA 5D29A 1X12A 3CXSA 1ON0A 3BI0A 5HMNA 2ZW5A 3GIUA 5JM6A 4K30A 2BSWA 4F0YA 3T9YA 2FVGA 3S6HA 1Z8WA 2PJ7A 2PVWA 2Z3LA 4NSQA 2ZEPA 3KL9A 2GFQA 1BAVA 1R3NA 4M6IA 4DUKA 2ODFA 4KOXA 3SI1A 1IU8A 4M6GA 4B12A 1ELMP 1M4LA 4KOWA 4E2AA 1FY7A 2IJZA 3FECA 3WT4A 4C2ZA 1YLOA 2IL4A 4R3LA 5DS0A 4AVCA 3D7HA 4R3KA 5HVGA 2NYQA 3SJGA 2PVVA 2ZXVA 4UEZA 4Q7AA 3KQXA 1VGYA 2GE3A 1X10A 2PR8A 1CP7A 1QSNA 3BHXA 4P10A 4U5YA 1XMBA 4RN7A 2PCUA 4CS0B 4QVTA 2QMLA 4OIWA 2FIWA 1M1DA 2AJ6A 4OC0A 1F2OA 1OBRA 4WWVA 3RO0A 1PYTB 1Y0RA 3BXMA 4UWJA 2GLJA 3KASA 2YNEA 4OP4A 2CNTA 1TF8A 3I1UA 4JYWA 4HNWB 5F48A 3K9TA 3BJ7A 4P4IA 4KVXA 2VL1A 3KKWA 2AFUA 2QYVA 1KUXA 4W9YA 5LYDA 2G3AA 3CPAA 4PV6A 2DEAA 1YGHA 3IWWA 4MBUA 2PJ0A 4ONWA 4JZ0A 3B3VA 3NH8A 4CRZB 4MCRA 4OADA 3R9EA 2Y0MA 4TWEA 7CPAA 1XF8A 4BBHA 1AYEA 1M4DA 2Q04A 1F2PA 4UCPA 4AVAA 2G3TA 5G20A 1L0CA 4CYOA 3H4QA 2Z3NA 2PIZA 2BCOA 3D2PA 2JEVA 1YW4A 3PGPA 4JD6A 4B5PB 1I21A 4X8IA 3PRTA 2OZUA 4EVYA 4C68A 5HXDA 3WR7A 1BO4A 4CYPA 3FBUA 3PB6X 1LCPA 5FVJA 5I4MA 2JLMA 5IV0A 2Q43A 3FYNA 2CNMA 4IHMA 3MN8A 2VQYA 4WJBA 4P4EA 4CYNA 3TFYA 2HUZA 4IF5A 1CP6A 2F8HA 3DR8A 4CAXA 4M6HA 4F8ZA 5K8MA 5JQ4A 3JUWA 2XEFA 3QAYA 1B87A 1CPXA 1Z4EA 2V8HA 3V7ZA 1MJBA 5C88A 5K8OA 2AFXA 1KUYA 4XPKA 4YU9A 2REFA 2Z0ZA 1Y0YA 4P6YA 3IGRA 4KOYA 2WPXA 4BINA 4IAVA 3SJFA 2RC4A 2VBQA 3DLJA 3E0KA 4ZYQA 3TX8A 3QB8A 4CRYB 3VWDA 2X7BA 5AG5A 2H5MA 3RZAA 3TC8A 1VKCA 4UWIA 4P4JA 4Y49C 2HB6A 2PRQA 2GU2A 3G8WA 2GLFA 4YGOA 2ANPA 4KLVA 1YR0A 2YNDA 2WYRA 2EVNA 1BLLE 3NE8A 4B6ZA 3R9FA 1R43A 2PJAA 2ZEFA 2RB7A 3MRUA 3VARA 4IUSA 3BLNA 2C1CA 4Q38A 5ISVA 3B3TA 4FWUA 5LRKA 1MJ9A 2DF5A 5JGFA 2BL1A 3PB4X 1IICA 2JDCA 1WWZA 4B11A 1QQ9A 3IFEA 4NEXA 4PPZA 2G0BA 4XNHB 4UBRA 2PRBA 4ZGYB 5F47A 1ARLA 2D4OA 3B3WA 4HNXB 5GCNA 3S9NA 3LD2A 2JBKA 4PXEA 3GB0A 4OLLA 2PJ4A 3FNCA 3ISXA 3BI1A 4XPDB 2Q4YA 5I0CA 4L8AA 3IU2A 4NCZA 3D66A 4BD9A 1BPNA 2Z3OA 4MRIA 1FNOA 4RI1A 2B58A 4EFDA 5BWAB 1CM0A 3DSBA 2F5IA 5LYFA 1FT7A 1GYTA 1NE9A 3A9LA 4MFLA 3EXNA 2AFZA 4EMEA 2GANA 4CGMA 1ZLIA 1Y9KA 3IEHA 2C6PA 1M44A 5KTAA 2Q4ZA 3D7GA 3JRUA 1Z4RA 4GM5A 2CY2A 3SXOA 3KHZA 2JBJA 1Z8XA 4AB7A 3D7FA 3KR4A 3OWCA 1MK4A 1TKHA 3FF3A 3C26A 4R9MA 4HPSA 2WUUA 1S7LA 4MY3A 3DNSA 1VHEA 1XEBA 2Q0YA 4KZTA 3D68A 5A27A 1IIDA 3N7ZA 4MCPA 4C2XA 2PJ1A 2BOAA 4BMHA 2I79A 3S6KA 4KLWA 4EWTA
chains in the Genus database with same CATH topology
4AG9A 4NXYA 5AGEA 1Y9WA 5F49A 1K4JA 2Z3PA 4QB9A 4FD7A 4L89A 3I3GA 4II9A 2P6EA 4CAEA 3FB3A 1WK4A 3EO4A 2P6FA 3TO6A 2FS5A 2VZYA 2C27A 4JLYA 4KORA 1S3ZA 1SQHA 2FT0A 4MFPA 1TIQA 4CGOA 1P0HA 4PSWA 4M85A 3SHPA 4R57A 1KZFA 4JWPA 2CNSA 2I00A 2FL4A 1YVKA 3EC4A 1QSTA 1BOBA 4JXRA 2Q44A 2B4DA 4MJ8A 4PK3A 5H86A 1YX0A 2OU2A 5CNPA 3R95A 1I1DA 3EY5A 3QAHA 4B5OA 4M3SA 2NMTA 4UCNA 2YGWA 3H5ZA 4C7HA 3IU1A 3LODA 3CXQA 2WSAA 2P0WA 2PQ8A 4E8OA 2O28A 4J3GA 3P2HA 3IWEA 5E96A 1S60A 2ZW6A 1QSMA 4AG7A 3TO9A 2KCWA 3P2FA 3I9SA 4MHDA 2BUEA 4C7IA 4MFKA 1PU9A 1P4NA 4FD6A 4CAFA 4ONUA 2B3UA 4H89A 5EBVA 3W6XA 4KSFA 1MJAA 1NSLA 3W91A 1QSOA 3EFAA 1UFHA 3JVNA 2Q7BA 3DDDA 3R96A 4ZBGA 3TOBA 2FE7A 4KUBA 4B13A 4UCMA 2Z3KA 2R1IA 4KS9A 1Y7RA 5C82A 4NF1A 1N71A 4JJXA 1B6BA 4RS2A 3F0AA 4KOSA 3G3SA 4MFJA 4KUAA 2R98A 4QUSA 3TCVA 3JTKA 5AG4A 2B5GA 4CYQA 3TE4A 4GS4A 4CAWA 5AG6A 5DWMA 1S7FA 2ATRA 4U9ZA 2YNCC 3PZJA 5H84A 2OZGA 4A33A 1VHSA 4JXQA 4LX9A 4UFWA 4KOTA 3F5BA 4H6ZA 4DNCA 2PC1A 3PP9A 5IX3A 1YLEA 4UFXA 4YFJA 1OZPA 1V0CA 4FD4A 2Z11A 1YVOA 5J8FA 2EUIA 4XPLA 1LRZA 3GY9A 1XMTA 4UA3A 1XIXA 2FXFA 1RXTA 4XNHC 1S7KA 4CGLA 2HQYA 1NMTA 4A31A 1GHEA 4I49A 5IB0A 3TOAA 4MY0A 2HV2A 3V8IA 3GKRA 4XPDC 4KVME 4LUAA 3IWGA 2B5GB 1Q2CA 2REEA 3SXNA 3S6GA 2FIAA 4MI4A 1I12A 2ARHA 2PR1A 2J8RA 3F8KA 5A28A 4B5PA 4QC6A 2B3VA 5JPHA 2DPSA 3D8PA 1S7NA 4A95A 3MGDA 4KOUA 1KUVA 2ZPAA 4UFVA 2VZZA 2FCKA 2J8MA 4A2ZA 4A30A 3FXTA 4CAVA 1QSRA 3ZZIA 4C2YA 2J8NA 3CXPA 1IYLA 3D3SA 4R87A 1Z9UA 4E0AA 3W6SA 2FSRA 4H6UA 3D2MA 4Y49B 1IYKA 2GIVA 2YNCA 3T90A 2P6GA 5G21A 2JDDA 4Q36A 3K9UA 3RYOA 2OB0A 3GYAA 1R57A 3TTHA 2Q4VA 4B14A 3FIXA 1M4IA 4U9YA 2Z10A 3S6FA 1J4JA 1M4GA 1CJWA 2ZW4A 4OAEA 5F46A 3R1KA 1YK3A 2QECA 1XE4A 2PDOA 4PSXA 3R9GA 2ZW7A 4PK2A 2B4BA 2VI7A 3BJ8A 5EC4A 2B4DB 3TO7A 2OZHA 5J8CA 3NE7A 3FRMA 4A32A 1ZO0A 2R8VA 2VEZA 4AVBA 5HH1A 4F0XA 1Q2DA 2Z3MA 3DR6A 1S5KA 2PSWA 4KSAA 1RO5A 2OH1A 5G1ZA 3ZJ0A 4KVOE 4F6AA 5KTCA 2K5TA 4MFZA 2DXQA 4KOVA 1YREA 2BEIA 2QIRA 1Q2YA 4YRHA 2D4PA 3UY5A 4MFQA 4CGNA 2VXKA 2AE6A 5DWNA 4B10A 2A4NA 2R7HA 5G22A 3TT2A 4X5KA 1U6MA 2DPTA 3VWEA 5KTDA 1PUAA 5AG7A 2CXAA 4HNYB 4HKFA 4QBJA 1IB1E 4FD5A 2WPWA 4ORFA 4CGPA 3B8GA 3CXSA 1ON0A 5HMNA 2ZW5A 4K30A 2BSWA 4F0YA 3T9YA 3S6HA 2Z3LA 4NSQA 4KOXA 4B12A 4KOWA 4E2AA 1FY7A 4C2ZA 2IL4A 4R3LA 4AVCA 4R3KA 2ZXVA 2GE3A 2PR8A 1QSNA 4U5YA 4CS0B 4QVTA 2QMLA 2FIWA 1M1DA 2AJ6A 4UWJA 2YNEA 2CNTA 4HNWB 5F48A 3BJ7A 4KVXA 3KKWA 1KUXA 2G3AA 4PV6A 1YGHA 4MBUA 4CRZB 4OADA 3R9EA 2Y0MA 1XF8A 4BBHA 1M4DA 2Q04A 4AVAA 4UCPA 2G3TA 5G20A 1L0CA 4CYOA 3H4QA 2Z3NA 3D2PA 2JEVA 3PGPA 4JD6A 4B5PB 1I21A 2OZUA 4EVYA 4C68A 3WR7A 1BO4A 4CYPA 3FBUA 5FVJA 2JLMA 5IV0A 3FYNA 2CNMA 2VQYA 3TFYA 4CYNA 2HUZA 4IF5A 4CAXA 3DR8A 5JQ4A 3JUWA 1B87A 1Z4EA 5C88A 1MJBA 1KUYA 4XPKA 2REFA 2Z0ZA 3IGRA 4KOYA 2WPXA 2RC4A 2VBQA 3E0KA 3QB8A 4CRYB 3VWDA 2X7BA 5AG5A 2H5MA 1VKCA 4UWIA 4Y49C 3G8WA 4YGOA 4KLVA 1YR0A 2YNDA 2EVNA 3R9FA 4IUSA 3BLNA 4Q38A 5ISVA 1MJ9A 2BL1A 1IICA 2JDCA 1WWZA 4B11A 4NEXA 2G0BA 4XNHB 4UBRA 2PRBA 4ZGYB 5F47A 2D4OA 4HNXB 5GCNA 3LD2A 4OLLA 3FNCA 4XPDB 2Q4YA 5I0CA 4L8AA 3IU2A 4NCZA 2Z3OA 4RI1A 2B58A 5BWAB 1CM0A 3DSBA 2F5IA 1NE9A 3A9LA 4MFLA 3EXNA 2GANA 4CGMA 1Y9KA 1M44A 5KTAA 1Z4RA 3SXOA 2CY2A 4AB7A 3OWCA 1MK4A 3C26A 4R9MA 2WUUA 1S7LA 4MY3A 3DNSA 1XEBA 2Q0YA 4KZTA 5A27A 1IIDA 3N7ZA 4C2XA 4BMHA 2I79A 3S6KA 4KLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG9 A;  4NXY A;  1Y9W A;  5F49 A;  1K4J A;  4QB9 A;  4FD7 A;  4L89 A;  3I3G A;  4II9 A;  2P6E A;  3FB3 A;  1WK4 A;  3EO4 A;  2P6F A;  3TO6 A;  2FS5 A;  2VZY A;  2C27 A;  4KOR A;  4JLY A;  1S3Z A;  1SQH A;  2FT0 A;  1TIQ A;  1P0H A;  4PSW A;  4M85 A;  3SHP A;  4R57 A;  1KZF A;  4JWP A;  2CNS A;  2I00 A;  2FL4 A;  1YVK A;  3EC4 A;  1QST A;  1BOB A;  4JXR A;  2Q44 A;  2B4D A;  4MJ8 A;  4PK3 A;  5H86 A;  1YX0 A;  2OU2 A;  5CNP A;  3R95 A;  1I1D A;  3EY5 A;  3QAH A;  4B5O A;  4M3S A;  2NMT A;  3LOD A;  3CXQ A;  2P0W A;  2PQ8 A;  4E8O A;  2O28 A;  4J3G A;  3P2H A;  5E96 A;  1S60 A;  2ZW6 A;  1QSM A;  4AG7 A;  3TO9 A;  2KCW A;  3P2F A;  3I9S A;  4MHD A;  2BUE A;  1PU9 A;  1P4N A;  4FD6 A;  4ONU A;  2B3U A;  4H89 A;  5EBV A;  3W6X A;  1MJA A;  1NSL A;  3W91 A;  1QSO A;  3EFA A;  1UFH A;  3JVN A;  2Q7B A;  3DDD A;  3R96 A;  4ZBG A;  3TOB A;  2FE7 A;  4KUB A;  2R1I A;  1Y7R A;  5C82 A;  4NF1 A;  1N71 A;  4JJX A;  1B6B A;  4RS2 A;  4KOS A;  3F0A A;  3G3S A;  4KUA A;  2R98 A;  4QUS A;  3TCV A;  2B5G A;  3TE4 A;  4GS4 A;  4CAW A;  5DWM A;  1S7F A;  2ATR A;  4U9Z A;  3PZJ A;  5H84 A;  2OZG A;  1VHS A;  4JXQ A;  4LX9 A;  4KOT A;  3F5B A;  4H6Z A;  4DNC A;  2PC1 A;  3PP9 A;  5IX3 A;  1YLE A;  4YFJ A;  1OZP A;  1V0C A;  4FD4 A;  2Z11 A;  1YVO A;  5J8F A;  2EUI A;  4XPL A;  1LRZ A;  3GY9 A;  1XMT A;  4UA3 A;  1XIX A;  2FXF A;  1RXT A;  4XNH C;  1S7K A;  2HQY A;  1NMT A;  1GHE A;  4I49 A;  5IB0 A;  3TOA A;  4MY0 A;  2HV2 A;  3V8I A;  3GKR A;  4XPD C;  4KVM E;  4LUA A;  3IWG A;  2B5G B;  1Q2C A;  2REE A;  3SXN A;  3S6G A;  2FIA A;  4MI4 A;  1I12 A;  2ARH A;  2PR1 A;  2J8R A;  3F8K A;  4B5P A;  4QC6 A;  2B3V A;  5JPH A;  3D8P A;  1S7N A;  3MGD A;  4KOU A;  1KUV A;  2ZPA A;  2VZZ A;  2FCK A;  2J8M A;  3FXT A;  4CAV A;  1QSR A;  3ZZI A;  2J8N A;  3CXP A;  1IYL A;  3D3S A;  4R87 A;  1Z9U A;  4E0A A;  3W6S A;  2FSR A;  4H6U A;  3D2M A;  4Y49 B;  1IYK A;  2GIV A;  3T90 A;  2P6G A;  2JDD A;  3K9U A;  3RYO A;  2OB0 A;  3GYA A;  1R57 A;  3TTH A;  2Q4V A;  3FIX A;  1M4I A;  4U9Y A;  2Z10 A;  3S6F A;  1J4J A;  1M4G A;  1CJW A;  2ZW4 A;  4OAE A;  5F46 A;  3R1K A;  1YK3 A;  2QEC A;  1XE4 A;  2PDO A;  4PSX A;  3R9G A;  2ZW7 A;  4PK2 A;  2B4B A;  2VI7 A;  3BJ8 A;  5EC4 A;  2B4D B;  3TO7 A;  2OZH A;  5J8C A;  3NE7 A;  3FRM A;  2VEZ A;  2R8V A;  4AVB A;  5HH1 A;  1Q2D A;  3DR6 A;  1S5K A;  2PSW A;  1RO5 A;  2OH1 A;  3ZJ0 A;  4KVO E;  4F6A A;  5KTC A;  2K5T A;  2DXQ A;  4KOV A;  1YRE A;  2BEI A;  2QIR A;  1Q2Y A;  4YRH A;  2D4P A;  3UY5 A;  2VXK A;  2AE6 A;  5DWN A;  2A4N A;  2R7H A;  3TT2 A;  4X5K A;  1U6M A;  3VWE A;  5KTD A;  1PUA A;  4HNY B;  4HKF A;  4QBJ A;  1IB1 E;  4FD5 A;  2WPW A;  4ORF A;  3B8G A;  3CXS A;  1ON0 A;  5HMN A;  2ZW5 A;  4K30 A;  2BSW A;  4F0Y A;  3T9Y A;  3S6H A;  4NSQ A;  4KOX A;  4KOW A;  4E2A A;  1FY7 A;  2IL4 A;  4R3L A;  4AVC A;  4R3K A;  2ZXV A;  2GE3 A;  2PR8 A;  1QSN A;  4U5Y A;  4CS0 B;  4QVT A;  2QML A;  2FIW A;  1M1D A;  2AJ6 A;  4UWJ A;  2CNT A;  4HNW B;  5F48 A;  3BJ7 A;  4KVX A;  3KKW A;  1KUX A;  2G3A A;  4PV6 A;  1YGH A;  4MBU A;  4CRZ B;  4OAD A;  3R9E A;  2Y0M A;  1XF8 A;  1M4D A;  2Q04 A;  4AVA A;  2G3T A;  1L0C A;  3H4Q A;  3D2P A;  2JEV A;  3PGP A;  4JD6 A;  4B5P B;  1I21 A;  2OZU A;  4EVY A;  3WR7 A;  1BO4 A;  3FBU A;  5FVJ A;  2JLM A;  5IV0 A;  3FYN A;  2CNM A;  2VQY A;  3TFY A;  2HUZ A;  4IF5 A;  4CAX A;  3DR8 A;  5JQ4 A;  3JUW A;  1B87 A;  1Z4E A;  5C88 A;  1MJB A;  1KUY A;  4XPK A;  2REF A;  2Z0Z A;  3IGR A;  4KOY A;  2WPX A;  2RC4 A;  2VBQ A;  3E0K A;  3QB8 A;  4CRY B;  3VWD A;  2X7B A;  2H5M A;  1VKC A;  4UWI A;  4Y49 C;  3G8W A;  4YGO A;  4KLV A;  1YR0 A;  2EVN A;  3R9F A;  4IUS A;  3BLN A;  5ISV A;  1MJ9 A;  2BL1 A;  1IIC A;  2JDC A;  1WWZ A;  4NEX A;  2G0B A;  4XNH B;  4UBR A;  2PRB A;  5F47 A;  2D4O A;  4HNX B;  5GCN A;  3LD2 A;  4OLL A;  3FNC A;  4XPD B;  2Q4Y A;  5I0C A;  4L8A A;  4NCZ A;  4RI1 A;  2B58 A;  1CM0 A;  3DSB A;  2F5I A;  1NE9 A;  3EXN A;  2GAN A;  1Y9K A;  1M44 A;  5KTA A;  1Z4R A;  3SXO A;  2CY2 A;  4AB7 A;  3OWC A;  1MK4 A;  3C26 A;  4R9M A;  1S7L A;  4MY3 A;  3DNS A;  1XEB A;  2Q0Y A;  4KZT A;  1IID A;  3N7Z A;  4BMH A;  2I79 A;  3S6K A;  4KLW A; 
#chains in the Genus database with same CATH topology
 2I3C A;  4K3N A;  1CX8 A;  4AG9 A;  4UIA A;  4PQA A;  4NXY A;  5AGE A;  1Y9W A;  1DTD A;  5F49 A;  1K4J A;  1AMP A;  2Z3P A;  3SI2 A;  5LRG A;  4QB9 A;  3FEE A;  4FD7 A;  2IQ6 A;  3KHX A;  6CPA A;  4L89 A;  5JH9 A;  2F7V A;  2ZEN A;  3I3G A;  4II9 A;  2P6E A;  4CAE A;  3FB3 A;  1HEE A;  2V8G A;  4NGP A;  1WK4 A;  4NGT A;  3EO4 A;  2AFO A;  2P6F A;  2IMO A;  3TO6 A;  1A2Z A;  2FS5 A;  2VZY A;  2C27 A;  4JLY A;  4KOR A;  1S3Z A;  1SQH A;  2FT0 A;  4MFP A;  4ZY0 A;  1TIQ A;  4CGO A;  3V38 A;  1P0H A;  3FX6 A;  4PSW A;  5K8P A;  2EBJ A;  4M85 A;  4MCS A;  2BO9 A;  5HVF A;  4R57 A;  1KZF A;  4NGS A;  4JWP A;  3SHP A;  4A94 A;  3S9L A;  3FH4 A;  2CNS A;  2I00 A;  2PJ8 A;  2FL4 A;  1YVK A;  3EC4 A;  1QST A;  1BOB A;  4JXR A;  2Q44 A;  2B4D A;  4MJ8 A;  4NGQ A;  4PK3 A;  4UEF A;  1Z5R A;  1YX0 A;  5H86 A;  2OU2 A;  4CAW A;  2QVP A;  3CZX A;  5CNP A;  3R95 A;  1I1D A;  1HDQ A;  3EY5 A;  3QAH A;  3WC5 A;  5LYL A;  4B5O A;  4M3S A;  1ZG7 A;  2NMT A;  1ZLH A;  4UCN A;  1BPM A;  2GRE A;  2YGW A;  3H5Z A;  4C7H A;  3NFZ A;  4PXD A;  4NJQ A;  3IU1 A;  4ZY2 A;  4FBE A;  3LOD A;  3B35 A;  2XEJ A;  2QJ8 A;  3CXQ A;  2WSA A;  4UF4 A;  2P0W A;  1XFO A;  2PQ8 A;  1DE4 C;  4E8O A;  4NJR A;  2O28 A;  4J3G A;  3K2K A;  3P2H A;  3IWE A;  4PXB A;  1S60 A;  5E96 A;  2ZW6 A;  3B3S A;  1QSM A;  3RBU A;  2Q51 A;  3FVL A;  4X2T A;  4AG7 A;  2CF4 A;  2KCW A;  3P2F A;  3TO9 A;  3I9S A;  4MHD A;  4ZX8 A;  2BUE A;  4G1P A;  1VIX A;  4MFK A;  4C7I A;  3H8E A;  1PU9 A;  1XOV A;  4A39 A;  4Z65 A;  3PFO A;  5ELY A;  1P4N A;  4FD6 A;  4CAF A;  2PE3 A;  2CIJ A;  4ONU A;  2B3U A;  4H89 A;  5EBV A;  1JQG A;  3W6X A;  2PIY A;  4KSF A;  1MJA A;  3IIB A;  3PEI A;  3ISZ A;  1NSL A;  3W91 A;  1QSO A;  3EFA A;  3QNV A;  5LYI A;  1UFH A;  3JVN A;  2Q7B A;  3HLP A;  3DDD A;  3R96 A;  4ZBG A;  3TOB A;  2FE7 A;  4KUB A;  4B13 A;  4UCM A;  2Z3K A;  2R1I A;  3PB8 X;  4KS9 A;  1CG2 A;  1Y7R A;  1RTQ A;  5D8N A;  5C82 A;  1Y7E A;  4NF1 A;  2V77 A;  3FED A;  3PBB A;  1N71 A;  3CPX A;  4JJX A;  1B6B A;  1TKF A;  4RS2 A;  3F0A A;  4KOS A;  2NSM A;  3G3S A;  4P45 A;  3RAM A;  4DJL A;  4R6T A;  4MFJ A;  4KUA A;  2R98 A;  2V8V A;  4QUS A;  1IOI A;  3TCV A;  3JTK A;  5AG4 A;  2B5G A;  3FMC A;  2EK9 A;  4MMO A;  4NGM A;  1IGB A;  4MCQ A;  4CYQ A;  3NH5 A;  3TE4 A;  3SJE A;  2POK A;  4ZY1 A;  3GLJ A;  4GS4 A;  4FUU A;  4IK2 A;  5AG6 A;  1S7F A;  5DWM A;  2ATR A;  3NA6 A;  4U9Z A;  1IOF A;  2O4H A;  2YNC C;  3PZJ A;  2OZG A;  4PXC A;  5H84 A;  1VHS A;  4R76 A;  5THW A;  4A33 A;  4JXQ A;  4LX9 A;  4OC5 A;  4KOT A;  2PJ3 A;  1EE3 P;  3CT9 A;  3F5B A;  4H6Z A;  4UFW A;  1YQE A;  2EO8 A;  3S9M A;  4UEE A;  2PC1 A;  3PP9 A;  3KGQ A;  4NFR A;  4DNC A;  5IX3 A;  1YLE A;  1TKJ A;  4YWY A;  4UFX A;  2EK8 A;  1F57 A;  4YFJ A;  1OZP A;  1V0C A;  4KSI A;  2ZEL A;  4FD4 A;  4OKO A;  2Z11 A;  1YVO A;  3LAC A;  5J8F A;  2EUI A;  3T8W A;  4XPL A;  4NGR A;  1LRZ A;  3GY9 A;  1XMT A;  4MHN A;  1AUG A;  4UA3 A;  1XIX A;  2FXF A;  4P4D A;  1RXT A;  4XNH C;  1S7K A;  4GXH A;  1LAN A;  2ZEH A;  1LFW A;  4CGL A;  2AFM A;  2AFS A;  2HQY A;  4O23 A;  1NMT A;  2RFH A;  4A31 A;  3PB7 X;  3PFE A;  1GHE A;  4I49 A;  5IB0 A;  3TOA A;  4MY0 A;  4OC4 A;  5EMI A;  1YW6 A;  2HV2 A;  3V8I A;  3GKR A;  4XPD C;  3B7I A;  4KVM E;  3N5F A;  4LUA A;  3IWG A;  2B5G B;  1Q2C A;  2REE A;  3SXN A;  3S6G A;  2PJC A;  2FIA A;  1Z8L A;  2XEG A;  3KI9 A;  1I12 A;  4MI4 A;  4MHY A;  2ARH A;  2PR1 A;  2J8R A;  3F8K A;  3LWU A;  4F9U A;  4B5P A;  2CTC A;  4A38 A;  5A28 A;  3FJU A;  3WC7 A;  4QC6 A;  2B3V A;  2PJ9 A;  4OME A;  2EWB A;  2V8D A;  5JPH A;  2DPS A;  3D8P A;  3B2Y A;  5LRJ A;  1S7N A;  4X3R A;  4A95 A;  3MGD A;  4KOU A;  1KUV A;  3SJX A;  2ZPA A;  4UFV A;  2ZEE A;  2VZZ A;  3DGV A;  4NGN A;  4FAI A;  2FCK A;  3CDX A;  2J8M A;  4P44 A;  4A2Z A;  4A30 A;  3FXT A;  4RUH A;  1H8L A;  4CAV A;  2ZED A;  1QSR A;  5HVH A;  4DYO A;  3ZZI A;  4MXU A;  1TF9 A;  2J8N A;  3CXP A;  1IYL A;  4C2Y A;  4TNU A;  1ARM A;  3D3S A;  4R87 A;  1Z9U A;  4E0A A;  3L2N A;  3W6S A;  2ABZ A;  4MHP A;  1TXR A;  2FSR A;  4H6U A;  5F09 A;  3D2M A;  4MHZ A;  4Y49 B;  1KWM A;  1IYK A;  2GIV A;  2YNC A;  3T90 A;  2P6G A;  5G21 A;  2ZEO A;  4OC1 A;  2JDD A;  4Q36 A;  3K9U A;  4ZX9 A;  3RYO A;  1HDU A;  2Q7S A;  2G9D A;  2OB0 A;  3GYA A;  1R57 A;  1XRY A;  2ZEM A;  3IC1 A;  3D4U A;  3TTH A;  1LAP A;  2CTB A;  3HUV A;  5IB9 A;  2C6G A;  3H8F A;  2Q4V A;  4B14 A;  1YME A;  3FIX A;  1M4I A;  3B3C A;  2PJB A;  3KR5 A;  4U9Y A;  4H2K A;  3IJ3 A;  2Z10 A;  1CPS A;  3S6F A;  1J4J A;  1Q7L A;  1M4G A;  4LQ6 A;  1CJW A;  2ZW4 A;  1LAM A;  4OAE A;  5F46 A;  3R1K A;  1YK3 A;  2QEC A;  1XE4 A;  2ZOF A;  2PDO A;  4PSX A;  4F9V A;  3GUX A;  4OC3 A;  3R9G A;  2ZW7 A;  3RNZ A;  2WZN A;  2B4B A;  2VI7 A;  4PK2 A;  3BJ8 A;  1LOK A;  2B4D B;  5EC4 A;  3TO7 A;  2OZH A;  5J8C A;  1PCA A;  3NE7 A;  2ZEG A;  3D7D A;  3FRM A;  2JEW A;  4A32 A;  1ZO0 A;  2R8V A;  2VEZ A;  2PJ6 A;  4CPA A;  1JWQ A;  1XBU A;  2ZOG A;  1Z2L A;  5HH1 A;  2HC9 A;  1Q2D A;  2Z3M A;  2OOT A;  4AVB A;  3DR6 A;  4F0X A;  1ELL P;  1S5K A;  2PSW A;  3VAT A;  4KSA A;  1RO5 A;  2OH1 A;  5G1Z A;  3ZJ0 A;  4KVO E;  4OID A;  4F6A A;  5KTC A;  2K5T A;  2J9A A;  4MFZ A;  3NH4 A;  2XEI A;  5K8N A;  3H8G A;  4A37 A;  2PJ5 A;  3SI0 A;  2OR4 A;  2DXQ A;  3PBE A;  4R8F A;  1NSA A;  2AFW A;  4KOV A;  1YRE A;  1IY7 A;  2BEI A;  3IO1 A;  2QIR A;  1Q2Y A;  3D67 A;  3LMS A;  4YRH A;  1ZG9 A;  2D4P A;  3UY5 A;  3WAB A;  4MFQ A;  4CGN A;  5CBM A;  2VXK A;  4R7M A;  1YSJ A;  2AE6 A;  5DWN A;  4LQG A;  4AXV A;  4B10 A;  2A4N A;  1Z8T A;  1ZG8 A;  4UIB A;  4P4F A;  8CPA A;  2R7H A;  5G22 A;  3TT2 A;  2O53 A;  4X5K A;  1U6M A;  2DPT A;  3VH9 A;  3VWE A;  5J1Q A;  2PJ2 A;  5KTD A;  1PUA A;  5AG7 A;  3PB9 X;  5CPA A;  2CXA A;  4HNY B;  4P4B A;  4ZI6 A;  4HKF A;  1XJO A;  3KQZ A;  4QBJ A;  1IB1 E;  4FD5 A;  2WPW A;  1VHO A;  4ORF A;  1UWY A;  4CGP A;  3KZW A;  4OC2 A;  3B8G A;  3WC6 A;  1CBX A;  1QMU A;  2C6C A;  5D29 A;  1X12 A;  3CXS A;  1ON0 A;  3BI0 A;  5HMN A;  2ZW5 A;  3GIU A;  5JM6 A;  4K30 A;  2BSW A;  4F0Y A;  3T9Y A;  2FVG A;  3S6H A;  1Z8W A;  2PJ7 A;  2PVW A;  2Z3L A;  4NSQ A;  2ZEP A;  3KL9 A;  2GFQ A;  1BAV A;  1R3N A;  4M6I A;  4DUK A;  2ODF A;  4KOX A;  3SI1 A;  1IU8 A;  4M6G A;  4B12 A;  1ELM P;  1M4L A;  4KOW A;  4E2A A;  1FY7 A;  2IJZ A;  3FEC A;  3WT4 A;  4C2Z A;  1YLO A;  2IL4 A;  4R3L A;  5DS0 A;  4AVC A;  3D7H A;  4R3K A;  5HVG A;  2NYQ A;  3SJG A;  2PVV A;  2ZXV A;  4UEZ A;  4Q7A A;  3KQX A;  1VGY A;  2GE3 A;  1X10 A;  2PR8 A;  1CP7 A;  1QSN A;  3BHX A;  4P10 A;  4U5Y A;  1XMB A;  4RN7 A;  2PCU A;  4CS0 B;  4QVT A;  2QML A;  4OIW A;  2FIW A;  1M1D A;  2AJ6 A;  4OC0 A;  1F2O A;  1OBR A;  4WWV A;  3RO0 A;  1PYT B;  1Y0R A;  3BXM A;  4UWJ A;  2GLJ A;  3KAS A;  2YNE A;  4OP4 A;  2CNT A;  1TF8 A;  3I1U A;  4JYW A;  4HNW B;  5F48 A;  3K9T A;  3BJ7 A;  4P4I A;  4KVX A;  2VL1 A;  3KKW A;  2AFU A;  2QYV A;  1KUX A;  4W9Y A;  5LYD A;  2G3A A;  3CPA A;  4PV6 A;  2DEA A;  1YGH A;  3IWW A;  4MBU A;  2PJ0 A;  4ONW A;  4JZ0 A;  3B3V A;  3NH8 A;  4CRZ B;  4MCR A;  4OAD A;  3R9E A;  2Y0M A;  4TWE A;  7CPA A;  1XF8 A;  4BBH A;  1AYE A;  1M4D A;  2Q04 A;  1F2P A;  4UCP A;  4AVA A;  2G3T A;  5G20 A;  1L0C A;  4CYO A;  3H4Q A;  2Z3N A;  2PIZ A;  2BCO A;  3D2P A;  2JEV A;  1YW4 A;  3PGP A;  4JD6 A;  4B5P B;  1I21 A;  4X8I A;  3PRT A;  2OZU A;  4EVY A;  4C68 A;  5HXD A;  3WR7 A;  1BO4 A;  4CYP A;  3FBU A;  3PB6 X;  1LCP A;  5FVJ A;  5I4M A;  2JLM A;  5IV0 A;  2Q43 A;  3FYN A;  2CNM A;  4IHM A;  3MN8 A;  2VQY A;  4WJB A;  4P4E A;  4CYN A;  3TFY A;  2HUZ A;  4IF5 A;  1CP6 A;  2F8H A;  3DR8 A;  4CAX A;  4M6H A;  4F8Z A;  5K8M A;  5JQ4 A;  3JUW A;  2XEF A;  3QAY A;  1B87 A;  1CPX A;  1Z4E A;  2V8H A;  3V7Z A;  1MJB A;  5C88 A;  5K8O A;  2AFX A;  1KUY A;  4XPK A;  4YU9 A;  2REF A;  2Z0Z A;  1Y0Y A;  4P6Y A;  3IGR A;  4KOY A;  2WPX A;  4BIN A;  4IAV A;  3SJF A;  2RC4 A;  2VBQ A;  3DLJ A;  3E0K A;  4ZYQ A;  3TX8 A;  3QB8 A;  4CRY B;  3VWD A;  2X7B A;  5AG5 A;  2H5M A;  3RZA A;  3TC8 A;  1VKC A;  4UWI A;  4P4J A;  4Y49 C;  2HB6 A;  2PRQ A;  2GU2 A;  3G8W A;  2GLF A;  4YGO A;  2ANP A;  4KLV A;  1YR0 A;  2YND A;  2WYR A;  2EVN A;  1BLL E;  3NE8 A;  4B6Z A;  3R9F A;  1R43 A;  2PJA A;  2ZEF A;  2RB7 A;  3MRU A;  3VAR A;  4IUS A;  3BLN A;  2C1C A;  4Q38 A;  5ISV A;  3B3T A;  4FWU A;  5LRK A;  1MJ9 A;  2DF5 A;  5JGF A;  2BL1 A;  3PB4 X;  1IIC A;  2JDC A;  1WWZ A;  4B11 A;  1QQ9 A;  3IFE A;  4NEX A;  4PPZ A;  2G0B A;  4XNH B;  4UBR A;  2PRB A;  4ZGY B;  5F47 A;  1ARL A;  2D4O A;  3B3W A;  4HNX B;  5GCN A;  3S9N A;  3LD2 A;  2JBK A;  4PXE A;  3GB0 A;  4OLL A;  2PJ4 A;  3FNC A;  3ISX A;  3BI1 A;  4XPD B;  2Q4Y A;  5I0C A;  4L8A A;  3IU2 A;  4NCZ A;  3D66 A;  4BD9 A;  1BPN A;  2Z3O A;  4MRI A;  1FNO A;  4RI1 A;  2B58 A;  4EFD A;  5BWA B;  1CM0 A;  3DSB A;  2F5I A;  5LYF A;  1FT7 A;  1GYT A;  1NE9 A;  3A9L A;  4MFL A;  3EXN A;  2AFZ A;  4EME A;  2GAN A;  4CGM A;  1ZLI A;  1Y9K A;  3IEH A;  2C6P A;  1M44 A;  5KTA A;  2Q4Z A;  3D7G A;  3JRU A;  1Z4R A;  4GM5 A;  2CY2 A;  3SXO A;  3KHZ A;  2JBJ A;  1Z8X A;  4AB7 A;  3D7F A;  3KR4 A;  3OWC A;  1MK4 A;  1TKH A;  3FF3 A;  3C26 A;  4R9M A;  4HPS A;  2WUU A;  1S7L A;  4MY3 A;  3DNS A;  1VHE A;  1XEB A;  2Q0Y A;  4KZT A;  3D68 A;  5A27 A;  1IID A;  3N7Z A;  4MCP A;  4C2X A;  2PJ1 A;  2BOA A;  4BMH A;  2I79 A;  3S6K A;  4KLW A;  4EWT A; 
#chains in the Genus database with same CATH homology
 4AG9 A;  4NXY A;  5AGE A;  1Y9W A;  5F49 A;  1K4J A;  2Z3P A;  4QB9 A;  4FD7 A;  4L89 A;  3I3G A;  4II9 A;  2P6E A;  4CAE A;  3FB3 A;  1WK4 A;  3EO4 A;  2P6F A;  3TO6 A;  2FS5 A;  2VZY A;  2C27 A;  4JLY A;  4KOR A;  1S3Z A;  1SQH A;  2FT0 A;  4MFP A;  1TIQ A;  4CGO A;  1P0H A;  4PSW A;  4M85 A;  3SHP A;  4R57 A;  1KZF A;  4JWP A;  2CNS A;  2I00 A;  2FL4 A;  1YVK A;  3EC4 A;  1QST A;  1BOB A;  4JXR A;  2Q44 A;  2B4D A;  4MJ8 A;  4PK3 A;  5H86 A;  1YX0 A;  2OU2 A;  5CNP A;  3R95 A;  1I1D A;  3EY5 A;  3QAH A;  4B5O A;  4M3S A;  2NMT A;  4UCN A;  2YGW A;  3H5Z A;  4C7H A;  3IU1 A;  3LOD A;  3CXQ A;  2WSA A;  2P0W A;  2PQ8 A;  4E8O A;  2O28 A;  4J3G A;  3P2H A;  3IWE A;  5E96 A;  1S60 A;  2ZW6 A;  1QSM A;  4AG7 A;  3TO9 A;  2KCW A;  3P2F A;  3I9S A;  4MHD A;  2BUE A;  4C7I A;  4MFK A;  1PU9 A;  1P4N A;  4FD6 A;  4CAF A;  4ONU A;  2B3U A;  4H89 A;  5EBV A;  3W6X A;  4KSF A;  1MJA A;  1NSL A;  3W91 A;  1QSO A;  3EFA A;  1UFH A;  3JVN A;  2Q7B A;  3DDD A;  3R96 A;  4ZBG A;  3TOB A;  2FE7 A;  4KUB A;  4B13 A;  4UCM A;  2Z3K A;  2R1I A;  4KS9 A;  1Y7R A;  5C82 A;  4NF1 A;  1N71 A;  4JJX A;  1B6B A;  4RS2 A;  3F0A A;  4KOS A;  3G3S A;  4MFJ A;  4KUA A;  2R98 A;  4QUS A;  3TCV A;  3JTK A;  5AG4 A;  2B5G A;  4CYQ A;  3TE4 A;  4GS4 A;  4CAW A;  5AG6 A;  5DWM A;  1S7F A;  2ATR A;  4U9Z A;  2YNC C;  3PZJ A;  5H84 A;  2OZG A;  4A33 A;  1VHS A;  4JXQ A;  4LX9 A;  4UFW A;  4KOT A;  3F5B A;  4H6Z A;  4DNC A;  2PC1 A;  3PP9 A;  5IX3 A;  1YLE A;  4UFX A;  4YFJ A;  1OZP A;  1V0C A;  4FD4 A;  2Z11 A;  1YVO A;  5J8F A;  2EUI A;  4XPL A;  1LRZ A;  3GY9 A;  1XMT A;  4UA3 A;  1XIX A;  2FXF A;  1RXT A;  4XNH C;  1S7K A;  4CGL A;  2HQY A;  1NMT A;  4A31 A;  1GHE A;  4I49 A;  5IB0 A;  3TOA A;  4MY0 A;  2HV2 A;  3V8I A;  3GKR A;  4XPD C;  4KVM E;  4LUA A;  3IWG A;  2B5G B;  1Q2C A;  2REE A;  3SXN A;  3S6G A;  2FIA A;  4MI4 A;  1I12 A;  2ARH A;  2PR1 A;  2J8R A;  3F8K A;  5A28 A;  4B5P A;  4QC6 A;  2B3V A;  5JPH A;  2DPS A;  3D8P A;  1S7N A;  4A95 A;  3MGD A;  4KOU A;  1KUV A;  2ZPA A;  4UFV A;  2VZZ A;  2FCK A;  2J8M A;  4A2Z A;  4A30 A;  3FXT A;  4CAV A;  1QSR A;  3ZZI A;  4C2Y A;  2J8N A;  3CXP A;  1IYL A;  3D3S A;  4R87 A;  1Z9U A;  4E0A A;  3W6S A;  2FSR A;  4H6U A;  3D2M A;  4Y49 B;  1IYK A;  2GIV A;  2YNC A;  3T90 A;  2P6G A;  5G21 A;  2JDD A;  4Q36 A;  3K9U A;  3RYO A;  2OB0 A;  3GYA A;  1R57 A;  3TTH A;  2Q4V A;  4B14 A;  3FIX A;  1M4I A;  4U9Y A;  2Z10 A;  3S6F A;  1J4J A;  1M4G A;  1CJW A;  2ZW4 A;  4OAE A;  5F46 A;  3R1K A;  1YK3 A;  2QEC A;  1XE4 A;  2PDO A;  4PSX A;  3R9G A;  2ZW7 A;  4PK2 A;  2B4B A;  2VI7 A;  3BJ8 A;  5EC4 A;  2B4D B;  3TO7 A;  2OZH A;  5J8C A;  3NE7 A;  3FRM A;  4A32 A;  1ZO0 A;  2R8V A;  2VEZ A;  4AVB A;  5HH1 A;  4F0X A;  1Q2D A;  2Z3M A;  3DR6 A;  1S5K A;  2PSW A;  4KSA A;  1RO5 A;  2OH1 A;  5G1Z A;  3ZJ0 A;  4KVO E;  4F6A A;  5KTC A;  2K5T A;  4MFZ A;  2DXQ A;  4KOV A;  1YRE A;  2BEI A;  2QIR A;  1Q2Y A;  4YRH A;  2D4P A;  3UY5 A;  4MFQ A;  4CGN A;  2VXK A;  2AE6 A;  5DWN A;  4B10 A;  2A4N A;  2R7H A;  5G22 A;  3TT2 A;  4X5K A;  1U6M A;  2DPT A;  3VWE A;  5KTD A;  1PUA A;  5AG7 A;  2CXA A;  4HNY B;  4HKF A;  4QBJ A;  1IB1 E;  4FD5 A;  2WPW A;  4ORF A;  4CGP A;  3B8G A;  3CXS A;  1ON0 A;  5HMN A;  2ZW5 A;  4K30 A;  2BSW A;  4F0Y A;  3T9Y A;  3S6H A;  2Z3L A;  4NSQ A;  4KOX A;  4B12 A;  4KOW A;  4E2A A;  1FY7 A;  4C2Z A;  2IL4 A;  4R3L A;  4AVC A;  4R3K A;  2ZXV A;  2GE3 A;  2PR8 A;  1QSN A;  4U5Y A;  4CS0 B;  4QVT A;  2QML A;  2FIW A;  1M1D A;  2AJ6 A;  4UWJ A;  2YNE A;  2CNT A;  4HNW B;  5F48 A;  3BJ7 A;  4KVX A;  3KKW A;  1KUX A;  2G3A A;  4PV6 A;  1YGH A;  4MBU A;  4CRZ B;  4OAD A;  3R9E A;  2Y0M A;  1XF8 A;  4BBH A;  1M4D A;  2Q04 A;  4AVA A;  4UCP A;  2G3T A;  5G20 A;  1L0C A;  4CYO A;  3H4Q A;  2Z3N A;  3D2P A;  2JEV A;  3PGP A;  4JD6 A;  4B5P B;  1I21 A;  2OZU A;  4EVY A;  4C68 A;  3WR7 A;  1BO4 A;  4CYP A;  3FBU A;  5FVJ A;  2JLM A;  5IV0 A;  3FYN A;  2CNM A;  2VQY A;  3TFY A;  4CYN A;  2HUZ A;  4IF5 A;  4CAX A;  3DR8 A;  5JQ4 A;  3JUW A;  1B87 A;  1Z4E A;  5C88 A;  1MJB A;  1KUY A;  4XPK A;  2REF A;  2Z0Z A;  3IGR A;  4KOY A;  2WPX A;  2RC4 A;  2VBQ A;  3E0K A;  3QB8 A;  4CRY B;  3VWD A;  2X7B A;  5AG5 A;  2H5M A;  1VKC A;  4UWI A;  4Y49 C;  3G8W A;  4YGO A;  4KLV A;  1YR0 A;  2YND A;  2EVN A;  3R9F A;  4IUS A;  3BLN A;  4Q38 A;  5ISV A;  1MJ9 A;  2BL1 A;  1IIC A;  2JDC A;  1WWZ A;  4B11 A;  4NEX A;  2G0B A;  4XNH B;  4UBR A;  2PRB A;  4ZGY B;  5F47 A;  2D4O A;  4HNX B;  5GCN A;  3LD2 A;  4OLL A;  3FNC A;  4XPD B;  2Q4Y A;  5I0C A;  4L8A A;  3IU2 A;  4NCZ A;  2Z3O A;  4RI1 A;  2B58 A;  5BWA B;  1CM0 A;  3DSB A;  2F5I A;  1NE9 A;  3A9L A;  4MFL A;  3EXN A;  2GAN A;  4CGM A;  1Y9K A;  1M44 A;  5KTA A;  1Z4R A;  3SXO A;  2CY2 A;  4AB7 A;  3OWC A;  1MK4 A;  3C26 A;  4R9M A;  2WUU A;  1S7L A;  4MY3 A;  3DNS A;  1XEB A;  2Q0Y A;  4KZT A;  5A27 A;  1IID A;  3N7Z A;  4C2X A;  4BMH A;  2I79 A;  3S6K A;  4KLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...