4H89A

The structure of a gcn5-related n-acetyltransferase from kribbella flavida
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
168
Chain Sequence
SPEALQVRDAEDADWPAILPFFREIVSAGETYAYDPELTDEQARSLWMTPSGPQSRTTVAVDADGTVLGSANMYPNRPGPGAHVASASFMVAAAARGRGVGRALCQDMIDWAGREGFRAIQFNAVVETNTVAVKLWQSLGFRVIGTVPEAFHHPTHGYVGLHVMHRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a GCN5-Related N-Acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
total genus 44
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h89A00
1Z4RA 4UA3A 2Q04A 2R98A 2VXKA 3WR7A 2B5GB 2DXQA 1S3ZA 2JEVA 5FVJA 2D4PA 3BLNA 2ARHA 3GY9A 4MY0A 2O28A 2FXFA 4QVTA 2QECA 4NCZA 3TTHA 3W91A 2HV2A 4E8OA 3W6SA 2Q7BA 3QB8A 4QUSA 1XMTA 1QSOA 3CXQA 2IL4A 3F0AA 4FD4A 2HUZA 3DR6A 3QAHA 2C27A 1NSLA 2CNTA 1WWZA 1WK4A 2QIRA 2FE7A 5IX3A 4MI4A 4AVCA 3R9GA 3TOAA 2OB0A 3RYOA 5GCNA 3VWEA 3SXNA 2CNSA 3TOBA 3UY5A 2I79A 2VBQA 3S6KA 1S60A 2J8MA 2H5MA 2ZW7A 4KOVA 2B58A 2K5TA 1IICA 4EVYA 4QB9A 2JDDA 1S5KA 1BOBA 1BO4A 4ORFA 3D8PA 2GANA 4NXYA 4XPDB 5J8FA 1B6BA 2NMTA 5F47A 2BEIA 2FL4A 3EY5A 4KLWA 3TE4A 1VKCA 3D2PA 3C26A 3F8KA 1XF8A 2VZYA 4JWPA 1I12A 2PR1A 1R57A 4B5OA 4R3LA 5DWNA 3H4QA 3BJ8A 4UWJA 2ZXVA 5E96A 4ONUA 4PK3A 5J8CA 4JXRA 2FS5A 3TO6A 3ZZIA 3FBUA 4OAEA 4HNWB 4NF1A 1KUVA 3I3GA 5IV0A 3TFYA 1Q2DA 4B5PA 1YLEA 1P0HA 2Q0YA 2QMLA 3B8GA 4CAVA 4XNHC 4KVXA 2Y0MA 3FRMA 2WPXA 3S6GA 4HNXB 1KUXA 1YVOA 4RI1A 2R1IA 3DNSA 2AJ6A 2PRBA 3JVNA 3PGPA 1MJ9A 2VEZA 3FYNA 2GE3A 2Q44A 4PSXA 4UWIA 3V8IA 1OZPA 2HQYA 3DSBA 1Z9UA 1YK3A 3FNCA 2J8NA 1CM0A 2Z10A 5F48A 4L8AA 5EC4A 2GIVA 3F5BA 1MJAA 1RXTA 3LODA 1Q2YA 1B87A 1ON0A 3EC4A 3TO7A 1XE4A 4FD6A 2B5GA 1Q2CA 3PZJA 1IIDA 3EFAA 5I0CA 2P0WA 4KUAA 3IGRA 2ZW5A 2FIWA 1XEBA 5KTCA 1IB1E 4LX9A 1FY7A 1TIQA 4FD7A 4NEXA 3S6FA 2BSWA 4CS0B 2CY2A 3D2MA 4JJXA 4XPDC 1CJWA 4H89A 3BJ7A 3KKWA 4AG9A 1QSNA 4ZBGA 2P6FA 2FCKA 3JUWA 2P6GA 2X7BA 1YX0A 3MGDA 2FT0A 1GHEA 2PSWA 3ZJ0A 1QSMA 4YFJA 4KLVA 4HNYB 4R57A 5C88A 3R95A 1IYKA 1S7LA 1P4NA 4J3GA 4Y49B 4OADA 3VWDA 4BMHA 1S7NA 1S7FA 3E0KA 2PQ8A 2P6EA 4M3SA 2OU2A 2BL1A 1YGHA 2B4DB 2PDOA 2EUIA 1KUYA 4RS2A 1XIXA 2A4NA 4CRYB 5HH1A 4HKFA 4PSWA 1MJBA 2AE6A 2R7HA 1MK4A 5JQ4A 1VHSA 3LD2A 1YREA 4QBJA 5F49A 2B3VA 5EBVA 4E2AA 3EO4A 4KUBA 2ATRA 5H84A 4R3KA 4Y49C 4CRZB 4PV6A 3TT2A 2EVNA 2KCWA 1UFHA 4M85A 4CAXA 1IYLA 3PP9A 5KTDA 1QSRA 3FIXA 4QC6A 3TO9A 4YGOA 1M1DA 1K4JA 4U9ZA 4UBRA 4MY3A 4KORA 1J4JA 1S7KA 1M44A 4KZTA 2OZGA 2ZW6A 4B5PB 2VZZA 4KOYA 4AVAA 1M4DA 1M4GA 4MJ8A 1L0CA 2D4OA 4NSQA 4U5YA 4F6AA 2Q4VA 5H86A 4AG7A 4KVOE 3R96A 2JLMA 4YRHA 4CAWA 3DR8A 1Z4EA 4L89A 2G3TA 4MHDA 1I1DA 3OWCA 2ZW4A 5JPHA 2OZUA 1RO5A 5F46A 4AB7A 4AVBA 2OZHA 5IB0A 3T9YA 4JXQA 4E0AA 1LRZA 3G8WA 1M4IA 2PR8A 2VI7A 5KTAA 1PUAA 1NMTA 3GYAA 4KOTA 2B3UA 2VQYA 2JDCA 5C82A 2B4DA 1I21A 3GKRA 3FXTA 3NE7A 1PU9A 1YVKA 2Z11A 4X5KA 3P2HA 3D3SA 3R9EA 3FB3A 5HMNA 4R9MA 4MBUA 3R9FA 3TCVA 4H6ZA 2REFA 4DNCA 2FSRA 4F0YA 3SHPA 2I00A 2B4BA 3EXNA 4KOUA 3CXSA 3R1KA 3G3SA 5ISVA 4IF5A 4LUAA 2OH1A 1V0CA 4XNHB 1N71A 4KOXA 3S6HA 3DDDA 4IUSA 2Z0ZA 2R8VA 4K30A 4KOWA 2CNMA 3I9SA 3W6XA 3K9UA 4FD5A 3SXOA 5CNPA 5DWMA 2J8RA 2FIAA 4JD6A 4KOSA 1NE9A 1Y7RA 2Q4YA 1KZFA 2BUEA 4KVME 1QSTA 3P2FA 4I49A 4R87A 1Y9WA 4OLLA 1YR0A 1SQHA 4XPKA 2G3AA 4JLYA 3CXPA 4PK2A 2REEA 2PC1A 1Y9KA 2F5IA 2WPWA 4H6UA 3T90A 3IWGA 2G0BA 4XPLA 4U9YA 2RC4A 4GS4A 4II9A 2ZPAA 3N7ZA 1U6MA
chains in the Genus database with same CATH superfamily
2Q43A 3CT9A 1Z4RA 4PQAA 4UA3A 1DE4C 1HEEA 2Q04A 4UEFA 2R98A 2XEJA 1DTDA 4UCPA 2VXKA 3WR7A 4B14A 4YU9A 2B5GB 2DXQA 4UIBA 1S3ZA 4PPZA 2JEVA 3CZXA 5BWAB 5FVJA 1FNOA 2PJ4A 2D4PA 2GU2A 3BLNA 2ARHA 2ZELA 3GY9A 4MY0A 2O28A 2FXFA 3GB0A 4QVTA 2V8HA 2QECA 3NH4A 4MCSA 4M6HA 4NCZA 3TTHA 5G22A 3W91A 4ZI6A 2AFSA 3B35A 4DJLA 3TX8A 2HV2A 2PIZA 4X2TA 4E8OA 3PBEA 3SJEA 3TC8A 5CPAA 3W6SA 2GREA 4MHYA 2Q7BA 1BPMA 3QB8A 3H8GA 4MHNA 4OC5A 4QUSA 4PXCA 5JM6A 1XMTA 1HDQA 1QSOA 1VGYA 3RAMA 1CBXA 1OBRA 3CXQA 2IL4A 3F0AA 3FX6A 4FD4A 4MCQA 4C68A 2HUZA 3DR6A 2AFZA 3QAHA 2C27A 1NSLA 4OC3A 4P4FA 4LQGA 2CNTA 1WWZA 1WK4A 2QIRA 2FE7A 4A94A 4F0XA 5IX3A 5LRKA 4MI4A 4AVCA 3R9GA 3TOAA 2OB0A 4OIDA 3ISXA 3RYOA 5GCNA 3VWEA 3SXNA 2ZEMA 2CNSA 2C6GA 3TOBA 3UY5A 4A95A 4CYOA 4MRIA 2I79A 2VBQA 3PB8X 1S60A 2J8MA 4NJRA 2H5MA 3KR5A 3S6KA 2ZW7A 2Z3KA 4UIAA 4KOVA 2B58A 2K5TA 1IICA 2QVPA 3T8WA 4EVYA 4QB9A 2JDDA 4A33A 1S5KA 1BOBA 3NA6A 4IAVA 1BO4A 4ORFA 3D8PA 2GANA 3FJUA 3IIBA 3NE8A 4NXYA 4XPDB 4B10A 5J8FA 1B6BA 3IU2A 2NMTA 3QAYA 4IK2A 5F47A 2BEIA 2FL4A 2AFMA 2NSMA 4C2XA 3EY5A 4KLWA 3TE4A 3QNVA 4MFQA 1VKCA 3VATA 3D67A 3D2PA 1X12A 3C26A 4UFVA 3WABA 3F8KA 2WZNA 4CPAA 3FEEA 4CGMA 4F9VA 3B3WA 3D68A 1Y0YA 5F09A 1H8LA 1XF8A 4UCMA 5I4MA 1VHOA 1EE3P 2CTBA 1CX8A 1F2PA 2VZYA 5AG7A 4JWPA 2PIYA 1I12A 4GM5A 2PR1A 4P10A 1R57A 4A38A 4R3LA 4B5OA 5IB9A 5DWNA 3H4QA 1ELMP 3BJ8A 4UWJA 2ZXVA 2YNCA 5E96A 4ONUA 5THWA 4LQ6A 4PK3A 1QMUA 5J8CA 4JXRA 1GYTA 4UEEA 2FS5A 2PVVA 3TO6A 4NJQA 3ZZIA 4B6ZA 3FBUA 1CPSA 5A27A 4OAEA 1ARLA 2ZEDA 4HNWB 4NF1A 2EBJA 1KUVA 3I3GA 4ZY0A 5IV0A 5DS0A 4CGLA 3TFYA 4MXUA 1Q2DA 3BXMA 3DGVA 1A2ZA 1YLEA 1P0HA 2EK9A 2Q0YA 1YSJA 2ODFA 2Q7SA 2QMLA 2JBJA 2ZENA 3B8GA 2YNDA 4ZY2A 4GXHA 4CAVA 1TKHA 1VHEA 3HUVA 5J1QA 4XNHC 4KVXA 4B11A 5LYDA 2Y0MA 1PYTB 2NYQA 3FRMA 4OP4A 2WPXA 3RO0A 2YNCC 3S6GA 4HNXB 1KUXA 5CBMA 1YVOA 4RI1A 4TNUA 2GFQA 2R1IA 2QJ8A 2AJ6A 2PRBA 3D7FA 3DNSA 3IU1A 4MCRA 3JVNA 1Z8WA 4W9YA 3PGPA 1MJ9A 2VEZA 2ZEPA 2GE3A 3CDXA 3FYNA 2Q44A 2ABZA 4PSXA 3SI1A 4H2KA 4UWIA 3V8IA 1ELLP 1OZPA 4UF4A 1IY7A 5HVFA 1R3NA 2HC9A 2HQYA 3DSBA 1Z9UA 4KSAA 5D8NA 1YK3A 3FNCA 2J8NA 1CM0A 3IFEA 2Z10A 5F48A 4CYQA 1XMBA 3FF3A 3GUXA 4L8AA 5EC4A 2GIVA 3F5BA 3PEIA 1MJAA 1RXTA 1ZLIA 4Q36A 3RBUA 3LODA 1Q2YA 3VARA 1B87A 3B3VA 4KSIA 2IJZA 1LOKA 2PE3A 1XJOA 3H8EA 3MN8A 4C2ZA 1ON0A 2PJCA 3IC1A 4NGMA 1KWMA 4F8ZA 2PJBA 3EC4A 4Q38A 2V8VA 3IWEA 2BCOA 4OC2A 4P4JA 3TO7A 4CYPA 1XE4A 4FD6A 3PRTA 3WT4A 2B5GA 4B13A 1Q2CA 3PZJA 1IIDA 3EFAA 5I0CA 1FT7A 4F9UA 1QQ9A 2Q4ZA 2P0WA 3B7IA 4UFWA 1R43A 4KUAA 2XEIA 2EK8A 3IGRA 4NGSA 5LYLA 3VH9A 1RTQA 2ZW5A 2FIWA 1XEBA 1IGBA 5KTCA 1BPNA 1IB1E 1X10A 4LX9A 3BHXA 4MFKA 1ZLHA 3D4UA 4FUUA 1Z8TA 1FY7A 4WWVA 2BOAA 1TIQA 1CP7A 1IOFA 4FD7A 4CGOA 2GLFA 3KHXA 2O53A 4A30A 4EMEA 4IHMA 4NEXA 3S6FA 3MRUA 1NSAA 2BSWA 4CS0B 3PB6X 1BAVA 3KQXA 2CY2A 2I3CA 3D2MA 1XRYA 4JJXA 1LAMA 1CJWA 1TXRA 4H89A 4XPDC 1CPXA 5JGFA 3BJ7A 3KKWA 4AG9A 1QSNA 2YNEA 3GLJA 3B3SA 2DF5A 2P6FA 3PFOA 4ZBGA 3SJXA 2PJ2A 5HVGA 5JH9A 2F8HA 2V77A 3DLJA 2FCKA 1Y0RA 2PJ6A 4ZX8A 3JUWA 4G1PA 3B3TA 3V7ZA 2P6GA 4MFLA 2X7BA 1YX0A 2ANPA 3MGDA 2JEWA 2FT0A 4A2ZA 4C2YA 1GHEA 2PSWA 3ZJ0A 4EFDA 4JYWA 1QSMA 4YFJA 4KLVA 4HNYB 4R57A 2PJ8A 5C88A 2PJ9A 3R95A 2O4HA 1IYKA 1S7LA 3LACA 4B5PA 2CTCA 1P4NA 2V8DA 3A9LA 2WYRA 4J3GA 4Y49B 3N5FA 3FMCA 4OADA 3VWDA 1LCPA 1S7NA 3D7GA 4BMHA 1S7FA 1F57A 2F7VA 3E0KA 2PQ8A 3FVLA 2P6EA 3CPXA 3I1UA 2OU2A 4M3SA 5AG5A 2BL1A 1YGHA 1PCAA 3S9MA 2B4DB 5K8OA 5ELYA 4C7IA 4BINA 4OMEA 2ZEGA 2WUUA 2CF4A 2PDOA 1CG2A 1YQEA 2EUIA 4YWYA 1KUYA 5HXDA 2HB6A 4RS2A 4X8IA 1Q7LA 1XIXA 2A4NA 4TWEA 4CRYB 5HH1A 2DPTA 4HKFA 2FVGA 4PSWA 1MJBA 2AE6A 2IMOA 2R7HA 4KSFA 1MK4A 2PJ0A 4NGQA 3FH4A 4B12A 2DPSA 5JQ4A 1VHSA 4BD9A 2ZEFA 3LD2A 3FEDA 2AFWA 1YREA 2AFOA 2C6CA 2EO8A 4CGNA 4FBEA 3SI0A 4QBJA 4K3NA 4UEZA 5F49A 4ONWA 2ZOFA 4UFXA 2B3VA 2VL1A 4M6GA 5EBVA 4E2AA 3EO4A 4KUBA 2ATRA 5H84A 2C1CA 2DEAA 4R3KA 2ZOGA 4Y49C 4CRZB 4PV6A 3TT2A 3S9NA 1YW4A 2EVNA 2G9DA 2KCWA 1UFHA 4JZ0A 4M85A 2AFXA 4CAXA 5AG4A 4ZGYB 1IYLA 3PP9A 2IQ6A 3RZAA 5KTDA 2EWBA 1QSRA 4WJBA 3FIXA 4QC6A 3SI2A 3TO9A 4P6YA 4YGOA 1M1DA 1K4JA 4U9ZA 2J9AA 4NFRA 4UBRA 4A39A 4MY3A 7CPAA 4KORA 5G1ZA 1J4JA 1S7KA 4PXBA 1M44A 4KZTA 3LMSA 2OZGA 5LYIA 1AMPA 2ZW6A 4B5PB 2VZZA 4KOYA 4M6IA 4OC0A 4RUHA 4AVAA 1M4DA 5LYFA 1M4GA 3FECA 4MJ8A 1L0CA 2D4OA 4P4EA 4NSQA 5LRGA 2ZEHA 4U5YA 1LAPA 3JRUA 3PBBA 4F6AA 4Q7AA 3V38A 2Q4VA 5H86A 4AG7A 3KI9A 3IJ3A 2Z3NA 4KVOE 3KASA 3R96A 2JLMA 4Z65A 1YW6A 4O23A 3B3CA 4YRHA 2BO9A 3BI0A 4MFPA 4CAWA 3DR8A 3D66A 1XFOA 2Q51A 1Z4EA 4L89A 3PB7X 2G3TA 1UWYA 1ZO0A 3K2KA 3IWWA 4MHDA 1I1DA 4X3RA 3OWCA 2JBKA 4MCPA 1ARMA 2ZW4A 4R6TA 5JPHA 4MHPA 2OZUA 1RO5A 5F46A 4AB7A 3LWUA 3KGQA 1JWQA 4AVBA 2PJ3A 3NFZA 2OZHA 1F2OA 4CYNA 2XEGA 3JTKA 4RN7A 3T9YA 4NGTA 5IB0A 3K9TA 2PJAA 4P4DA 1ZG8A 4JXQA 4E0AA 2POKA 8CPAA 4R8FA 1IU8A 3S9LA 1LRZA 3G8WA 3B2YA 1M4IA 2PR8A 2VI7A 3H8FA 3HLPA 4FAIA 1LFWA 5KTAA 1PUAA 1NMTA 3GYAA 2OOTA 1BLLE 4FWUA 4KOTA 2B3UA 3PB9X 4OKOA 2PCUA 4ZY1A 2VQYA 1ZG9A 3SJFA 1JQGA 4UCNA 2JDCA 2PJ7A 1CP6A 3KR4A 4R7MA 4NGRA 4C7HA 5C82A 2B4DA 1I21A 3GKRA 3FXTA 1AYEA 4OC4A 3KQZA 1PU9A 1YVKA 2Z11A 3NE7A 4P4IA 4X5KA 4MFZA 3WC5A 3P2HA 1YLOA 3D3SA 5EMIA 2ZEEA 3PB4X 2RB7A 3R9EA 3RNZA 3FB3A 5K8MA 3KL9A 5HMNA 4MFJA 4OIWA 4R9MA 3H5ZA 4MBUA 3R9FA 4A31A 2Z3LA 3TCVA 3GIUA 4H6ZA 1TF9A 5AG6A 2REFA 3D7HA 1Z8LA 4R76A 2CIJA 4DNCA 4CGPA 2FSRA 3KZWA 2Z3OA 4F0YA 1YMEA 3SHPA 2PJ1A 2I00A 3L2NA 4P4BA 4DYOA 2B4BA 3CPAA 3EXNA 4P44A 4KOUA 3CXSA 5AGEA 4P45A 3R1KA 3G3SA 5ISVA 4IF5A 4LUAA 3BI1A 1Y7EA 5G20A 2OH1A 4ZX9A 3IEHA 1HDUA 1AUGA 3KHZA 2PVWA 4A32A 1XBUA 1V0CA 4OC1A 2YGWA 3SJGA 6CPAA 3NH8A 4XNHB 2Z3PA 3WC6A 1N71A 2XEFA 2OR4A 1XOVA 1VIXA 4PXEA 4KOXA 3ISZA 2ZEOA 3S6HA 4BBHA 4AXVA 2AFUA 3DDDA 4IUSA 2PJ5A 2Z0ZA 2R8VA 1Z2LA 4K30A 4KOWA 2CNMA 3WC7A 3I9SA 5HVHA 4PXDA 3W6XA 2RFHA 3K9UA 4FD5A 3SXOA 4CAEA 5CNPA 5DWMA 2J8RA 2FIAA 4JD6A 4MMOA 4HPSA 4KOSA 1NE9A 1Y7RA 2Q4YA 1KZFA 1TKJA 2BUEA 5LRJA 4KVME 1QSTA 5K8PA 3P2FA 4I49A 2CXAA 4R87A 1Y9WA 3D7DA 4OLLA 1YR0A 1SQHA 4XPKA 2G3AA 2C6PA 4MHZA 1TF8A 4JLYA 3CXPA 1TKFA 2REEA 4PK2A 2PC1A 5D29A 1Y9KA 2F5IA 2WPWA 4H6UA 3T90A 3IWGA 4DUKA 5K8NA 2G0BA 1M4LA 3IO1A 4XPLA 4U9YA 2RC4A 4CAFA 1IOIA 2PRQA 2V8GA 1LANA 2GLJA 4KS9A 3PFEA 4GS4A 4NGNA 4EWTA 3NH5A 2QYVA 5A28A 1ZG7A 5G21A 4ZYQA 2WSAA 1Z8XA 4II9A 2ZPAA 3N7ZA 1U6MA 4A37A 1Z5RA 2Z3MA 4NGPA
chains in the Genus database with same CATH topology
1Z4RA 4UA3A 2Q04A 4UCPA 2R98A 2VXKA 3WR7A 4B14A 2B5GB 2DXQA 1S3ZA 2JEVA 5BWAB 5FVJA 2D4PA 3BLNA 2ARHA 3GY9A 4MY0A 2O28A 2FXFA 4QVTA 2QECA 4NCZA 3TTHA 5G22A 3W91A 2HV2A 4E8OA 3W6SA 2Q7BA 3QB8A 4QUSA 1XMTA 1QSOA 3CXQA 2IL4A 3F0AA 4FD4A 4C68A 2HUZA 3DR6A 3QAHA 2C27A 1NSLA 2CNTA 1WWZA 1WK4A 2QIRA 2FE7A 5IX3A 4MI4A 4AVCA 3R9GA 3TOAA 2OB0A 3RYOA 5GCNA 3VWEA 3SXNA 2CNSA 3TOBA 3UY5A 4A95A 4CYOA 2I79A 2VBQA 3S6KA 1S60A 2J8MA 2H5MA 2ZW7A 2Z3KA 4KOVA 2B58A 2K5TA 1IICA 4EVYA 4QB9A 2JDDA 4A33A 1S5KA 1BOBA 1BO4A 4ORFA 3D8PA 2GANA 4NXYA 4XPDB 4B10A 5J8FA 1B6BA 3IU2A 2NMTA 5F47A 2BEIA 2FL4A 4C2XA 3EY5A 4KLWA 3TE4A 4MFQA 1VKCA 3D2PA 3C26A 4UFVA 3F8KA 4CGMA 1XF8A 4UCMA 5AG7A 2VZYA 4JWPA 1I12A 2PR1A 1R57A 4B5OA 4R3LA 5DWNA 3H4QA 3BJ8A 4UWJA 2ZXVA 2YNCA 5E96A 4ONUA 4PK3A 5J8CA 4JXRA 2FS5A 3TO6A 3ZZIA 3FBUA 5A27A 4OAEA 4HNWB 4NF1A 1KUVA 3I3GA 5IV0A 4CGLA 3TFYA 1Q2DA 4B5PA 1YLEA 1P0HA 2Q0YA 2QMLA 3B8GA 2YNDA 4CAVA 4XNHC 4KVXA 4B11A 2Y0MA 3FRMA 2WPXA 2YNCC 3S6GA 4HNXB 1KUXA 1YVOA 4RI1A 2R1IA 3DNSA 2AJ6A 2PRBA 3IU1A 3JVNA 3PGPA 1MJ9A 2VEZA 3FYNA 2GE3A 2Q44A 4PSXA 4UWIA 3V8IA 1OZPA 2HQYA 3DSBA 1Z9UA 4KSAA 1YK3A 3FNCA 2J8NA 1CM0A 2Z10A 5F48A 4CYQA 4L8AA 5EC4A 2GIVA 3F5BA 1MJAA 1RXTA 4Q36A 3LODA 1Q2YA 1B87A 4C2ZA 1ON0A 4Q38A 3EC4A 3IWEA 3TO7A 4CYPA 1XE4A 4FD6A 4B13A 2B5GA 1Q2CA 3PZJA 1IIDA 3EFAA 5I0CA 2P0WA 4UFWA 4KUAA 3IGRA 2ZW5A 2FIWA 1XEBA 5KTCA 1IB1E 4LX9A 4MFKA 1FY7A 1TIQA 4FD7A 4CGOA 4A30A 4NEXA 3S6FA 2BSWA 4CS0B 2CY2A 3D2MA 4JJXA 4XPDC 1CJWA 4H89A 3BJ7A 3KKWA 4AG9A 1QSNA 2YNEA 4ZBGA 2P6FA 2FCKA 3JUWA 2P6GA 4MFLA 2X7BA 1YX0A 3MGDA 4C2YA 2FT0A 4A2ZA 1GHEA 2PSWA 3ZJ0A 1QSMA 4YFJA 4KLVA 4HNYB 4R57A 5C88A 3R95A 1IYKA 1S7LA 1P4NA 3A9LA 4J3GA 4Y49B 4F0XA 4OADA 3VWDA 4BMHA 1S7NA 1S7FA 3E0KA 2PQ8A 2P6EA 4M3SA 2OU2A 5AG5A 2BL1A 1YGHA 2B4DB 4C7IA 2WUUA 2PDOA 2EUIA 1KUYA 4RS2A 1XIXA 2A4NA 4CRYB 5HH1A 2DPTA 4HKFA 4PSWA 1MJBA 2AE6A 2R7HA 4KSFA 4B12A 1MK4A 2DPSA 5JQ4A 1VHSA 3LD2A 1YREA 4CGNA 4QBJA 5F49A 4UFXA 2B3VA 5EBVA 4E2AA 3EO4A 4KUBA 2ATRA 5H84A 4R3KA 4Y49C 4CRZB 4PV6A 3TT2A 2EVNA 2KCWA 1UFHA 4M85A 4CAXA 5AG4A 4ZGYB 1IYLA 3PP9A 5KTDA 1QSRA 3FIXA 4QC6A 3TO9A 4YGOA 1M1DA 1K4JA 4U9ZA 4UBRA 4MY3A 4KORA 5G1ZA 1J4JA 1S7KA 1M44A 4KZTA 2OZGA 2ZW6A 4B5PB 2VZZA 4KOYA 4AVAA 1M4DA 1M4GA 4MJ8A 1L0CA 2D4OA 4NSQA 4U5YA 4F6AA 2Q4VA 5H86A 4AG7A 2Z3NA 4KVOE 3R96A 2JLMA 4YRHA 4MFPA 4CAWA 3DR8A 1Z4EA 4L89A 2G3TA 1ZO0A 4MHDA 1I1DA 3OWCA 2ZW4A 5JPHA 2OZUA 1RO5A 5F46A 4AB7A 4AVBA 2OZHA 4CYNA 3JTKA 3T9YA 5IB0A 4JXQA 4E0AA 1LRZA 3G8WA 1M4IA 2PR8A 2VI7A 5KTAA 1PUAA 1NMTA 3GYAA 4KOTA 2B3UA 2VQYA 4UCNA 2JDCA 4C7HA 5C82A 2B4DA 1I21A 3GKRA 3FXTA 3NE7A 1PU9A 1YVKA 2Z11A 4X5KA 4MFZA 3P2HA 3D3SA 3R9EA 3FB3A 5HMNA 4MFJA 4R9MA 3H5ZA 4MBUA 3R9FA 4A31A 2Z3LA 3TCVA 4H6ZA 5AG6A 2REFA 4DNCA 4CGPA 2FSRA 2Z3OA 4F0YA 3SHPA 2I00A 2B4BA 3EXNA 4KOUA 3CXSA 5AGEA 3R1KA 3G3SA 5ISVA 4IF5A 4LUAA 5G20A 2OH1A 4A32A 1V0CA 2YGWA 4XNHB 2Z3PA 1N71A 4KOXA 3S6HA 4BBHA 3DDDA 4IUSA 2Z0ZA 2R8VA 4K30A 4KOWA 2CNMA 3I9SA 3W6XA 3K9UA 4FD5A 3SXOA 4CAEA 5CNPA 5DWMA 2J8RA 2FIAA 4JD6A 4KOSA 1NE9A 1Y7RA 2Q4YA 1KZFA 2BUEA 4KVME 1QSTA 3P2FA 4I49A 2CXAA 4R87A 1Y9WA 4OLLA 1YR0A 1SQHA 4XPKA 2G3AA 4JLYA 3CXPA 4PK2A 2REEA 2PC1A 1Y9KA 2F5IA 2WPWA 4H6UA 3T90A 3IWGA 2G0BA 4XPLA 4U9YA 2RC4A 4CAFA 4KS9A 4GS4A 5A28A 5G21A 2WSAA 4II9A 2ZPAA 3N7ZA 1U6MA 2Z3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4R A;  4UA3 A;  2Q04 A;  2R98 A;  2VXK A;  3WR7 A;  2B5G B;  2DXQ A;  1S3Z A;  2JEV A;  5FVJ A;  2D4P A;  3BLN A;  2ARH A;  3GY9 A;  4MY0 A;  2O28 A;  2FXF A;  4QVT A;  2QEC A;  4NCZ A;  3TTH A;  3W91 A;  2HV2 A;  4E8O A;  3W6S A;  2Q7B A;  3QB8 A;  4QUS A;  1XMT A;  1QSO A;  3CXQ A;  2IL4 A;  3F0A A;  4FD4 A;  2HUZ A;  3DR6 A;  3QAH A;  2C27 A;  1NSL A;  2CNT A;  1WWZ A;  1WK4 A;  2QIR A;  2FE7 A;  5IX3 A;  4MI4 A;  4AVC A;  3R9G A;  3TOA A;  2OB0 A;  3RYO A;  5GCN A;  3VWE A;  3SXN A;  2CNS A;  3TOB A;  3UY5 A;  2I79 A;  2VBQ A;  3S6K A;  1S60 A;  2J8M A;  2H5M A;  2ZW7 A;  4KOV A;  2B58 A;  2K5T A;  1IIC A;  4EVY A;  4QB9 A;  2JDD A;  1S5K A;  1BOB A;  1BO4 A;  4ORF A;  3D8P A;  2GAN A;  4NXY A;  4XPD B;  5J8F A;  1B6B A;  2NMT A;  5F47 A;  2BEI A;  2FL4 A;  3EY5 A;  4KLW A;  3TE4 A;  1VKC A;  3D2P A;  3C26 A;  3F8K A;  1XF8 A;  2VZY A;  4JWP A;  1I12 A;  2PR1 A;  1R57 A;  4B5O A;  4R3L A;  5DWN A;  3H4Q A;  3BJ8 A;  4UWJ A;  2ZXV A;  5E96 A;  4ONU A;  4PK3 A;  5J8C A;  4JXR A;  2FS5 A;  3TO6 A;  3ZZI A;  3FBU A;  4OAE A;  4HNW B;  4NF1 A;  1KUV A;  3I3G A;  5IV0 A;  3TFY A;  1Q2D A;  4B5P A;  1YLE A;  1P0H A;  2Q0Y A;  2QML A;  3B8G A;  4CAV A;  4XNH C;  4KVX A;  2Y0M A;  3FRM A;  2WPX A;  3S6G A;  4HNX B;  1KUX A;  1YVO A;  4RI1 A;  2R1I A;  3DNS A;  2AJ6 A;  2PRB A;  3JVN A;  3PGP A;  1MJ9 A;  2VEZ A;  3FYN A;  2GE3 A;  2Q44 A;  4PSX A;  4UWI A;  3V8I A;  1OZP A;  2HQY A;  3DSB A;  1Z9U A;  1YK3 A;  3FNC A;  2J8N A;  1CM0 A;  2Z10 A;  5F48 A;  4L8A A;  5EC4 A;  2GIV A;  3F5B A;  1MJA A;  1RXT A;  3LOD A;  1Q2Y A;  1B87 A;  1ON0 A;  3EC4 A;  3TO7 A;  1XE4 A;  4FD6 A;  2B5G A;  1Q2C A;  3PZJ A;  1IID A;  3EFA A;  5I0C A;  2P0W A;  4KUA A;  3IGR A;  2ZW5 A;  2FIW A;  1XEB A;  5KTC A;  1IB1 E;  4LX9 A;  1FY7 A;  1TIQ A;  4FD7 A;  4NEX A;  3S6F A;  2BSW A;  4CS0 B;  2CY2 A;  3D2M A;  4JJX A;  4XPD C;  1CJW A;  4H89 A;  3BJ7 A;  3KKW A;  4AG9 A;  1QSN A;  4ZBG A;  2P6F A;  2FCK A;  3JUW A;  2P6G A;  2X7B A;  1YX0 A;  3MGD A;  2FT0 A;  1GHE A;  2PSW A;  3ZJ0 A;  1QSM A;  4YFJ A;  4KLV A;  4HNY B;  4R57 A;  5C88 A;  3R95 A;  1IYK A;  1S7L A;  1P4N A;  4J3G A;  4Y49 B;  4OAD A;  3VWD A;  4BMH A;  1S7N A;  1S7F A;  3E0K A;  2PQ8 A;  2P6E A;  4M3S A;  2OU2 A;  2BL1 A;  1YGH A;  2B4D B;  2PDO A;  2EUI A;  1KUY A;  4RS2 A;  1XIX A;  2A4N A;  4CRY B;  5HH1 A;  4HKF A;  4PSW A;  1MJB A;  2AE6 A;  2R7H A;  1MK4 A;  5JQ4 A;  1VHS A;  3LD2 A;  1YRE A;  4QBJ A;  5F49 A;  2B3V A;  5EBV A;  4E2A A;  3EO4 A;  4KUB A;  2ATR A;  5H84 A;  4R3K A;  4Y49 C;  4CRZ B;  4PV6 A;  3TT2 A;  2EVN A;  2KCW A;  1UFH A;  4M85 A;  4CAX A;  1IYL A;  3PP9 A;  5KTD A;  1QSR A;  3FIX A;  4QC6 A;  3TO9 A;  4YGO A;  1M1D A;  1K4J A;  4U9Z A;  4UBR A;  4MY3 A;  4KOR A;  1J4J A;  1S7K A;  1M44 A;  4KZT A;  2OZG A;  2ZW6 A;  4B5P B;  2VZZ A;  4KOY A;  4AVA A;  1M4D A;  1M4G A;  4MJ8 A;  1L0C A;  2D4O A;  4NSQ A;  4U5Y A;  4F6A A;  2Q4V A;  5H86 A;  4AG7 A;  4KVO E;  3R96 A;  2JLM A;  4YRH A;  4CAW A;  3DR8 A;  1Z4E A;  4L89 A;  2G3T A;  4MHD A;  1I1D A;  3OWC A;  2ZW4 A;  5JPH A;  2OZU A;  1RO5 A;  5F46 A;  4AB7 A;  4AVB A;  2OZH A;  5IB0 A;  3T9Y A;  4JXQ A;  4E0A A;  1LRZ A;  3G8W A;  1M4I A;  2PR8 A;  2VI7 A;  5KTA A;  1PUA A;  1NMT A;  3GYA A;  4KOT A;  2B3U A;  2VQY A;  2JDC A;  5C82 A;  2B4D A;  1I21 A;  3GKR A;  3FXT A;  3NE7 A;  1PU9 A;  1YVK A;  2Z11 A;  4X5K A;  3P2H A;  3D3S A;  3R9E A;  3FB3 A;  5HMN A;  4R9M A;  4MBU A;  3R9F A;  3TCV A;  4H6Z A;  2REF A;  4DNC A;  2FSR A;  4F0Y A;  3SHP A;  2I00 A;  2B4B A;  3EXN A;  4KOU A;  3CXS A;  3R1K A;  3G3S A;  5ISV A;  4IF5 A;  4LUA A;  2OH1 A;  1V0C A;  4XNH B;  1N71 A;  4KOX A;  3S6H A;  3DDD A;  4IUS A;  2Z0Z A;  2R8V A;  4K30 A;  4KOW A;  2CNM A;  3I9S A;  3W6X A;  3K9U A;  4FD5 A;  3SXO A;  5CNP A;  5DWM A;  2J8R A;  2FIA A;  4JD6 A;  4KOS A;  1NE9 A;  1Y7R A;  2Q4Y A;  1KZF A;  2BUE A;  4KVM E;  1QST A;  3P2F A;  4I49 A;  4R87 A;  1Y9W A;  4OLL A;  1YR0 A;  1SQH A;  4XPK A;  2G3A A;  4JLY A;  3CXP A;  4PK2 A;  2REE A;  2PC1 A;  1Y9K A;  2F5I A;  2WPW A;  4H6U A;  3T90 A;  3IWG A;  2G0B A;  4XPL A;  4U9Y A;  2RC4 A;  4GS4 A;  4II9 A;  2ZPA A;  3N7Z A;  1U6M A; 
#chains in the Genus database with same CATH topology
 2Q43 A;  3CT9 A;  1Z4R A;  4PQA A;  4UA3 A;  1DE4 C;  1HEE A;  2Q04 A;  4UEF A;  2R98 A;  2XEJ A;  1DTD A;  4UCP A;  2VXK A;  3WR7 A;  4B14 A;  4YU9 A;  2B5G B;  2DXQ A;  4UIB A;  1S3Z A;  4PPZ A;  2JEV A;  3CZX A;  5BWA B;  5FVJ A;  1FNO A;  2PJ4 A;  2D4P A;  2GU2 A;  3BLN A;  2ARH A;  2ZEL A;  3GY9 A;  4MY0 A;  2O28 A;  2FXF A;  3GB0 A;  4QVT A;  2V8H A;  2QEC A;  3NH4 A;  4MCS A;  4M6H A;  4NCZ A;  3TTH A;  5G22 A;  3W91 A;  4ZI6 A;  2AFS A;  3B35 A;  4DJL A;  3TX8 A;  2HV2 A;  2PIZ A;  4X2T A;  4E8O A;  3PBE A;  3SJE A;  3TC8 A;  5CPA A;  3W6S A;  2GRE A;  4MHY A;  2Q7B A;  1BPM A;  3QB8 A;  3H8G A;  4MHN A;  4OC5 A;  4QUS A;  4PXC A;  5JM6 A;  1XMT A;  1HDQ A;  1QSO A;  1VGY A;  3RAM A;  1CBX A;  1OBR A;  3CXQ A;  2IL4 A;  3F0A A;  3FX6 A;  4FD4 A;  4MCQ A;  4C68 A;  2HUZ A;  3DR6 A;  2AFZ A;  3QAH A;  2C27 A;  1NSL A;  4OC3 A;  4P4F A;  4LQG A;  2CNT A;  1WWZ A;  1WK4 A;  2QIR A;  2FE7 A;  4A94 A;  4F0X A;  5IX3 A;  5LRK A;  4MI4 A;  4AVC A;  3R9G A;  3TOA A;  2OB0 A;  4OID A;  3ISX A;  3RYO A;  5GCN A;  3VWE A;  3SXN A;  2ZEM A;  2CNS A;  2C6G A;  3TOB A;  3UY5 A;  4A95 A;  4CYO A;  4MRI A;  2I79 A;  2VBQ A;  3PB8 X;  1S60 A;  2J8M A;  4NJR A;  2H5M A;  3KR5 A;  3S6K A;  2ZW7 A;  2Z3K A;  4UIA A;  4KOV A;  2B58 A;  2K5T A;  1IIC A;  2QVP A;  3T8W A;  4EVY A;  4QB9 A;  2JDD A;  4A33 A;  1S5K A;  1BOB A;  3NA6 A;  4IAV A;  1BO4 A;  4ORF A;  3D8P A;  2GAN A;  3FJU A;  3IIB A;  3NE8 A;  4NXY A;  4XPD B;  4B10 A;  5J8F A;  1B6B A;  3IU2 A;  2NMT A;  3QAY A;  4IK2 A;  5F47 A;  2BEI A;  2FL4 A;  2AFM A;  2NSM A;  4C2X A;  3EY5 A;  4KLW A;  3TE4 A;  3QNV A;  4MFQ A;  1VKC A;  3VAT A;  3D67 A;  3D2P A;  1X12 A;  3C26 A;  4UFV A;  3WAB A;  3F8K A;  2WZN A;  4CPA A;  3FEE A;  4CGM A;  4F9V A;  3B3W A;  3D68 A;  1Y0Y A;  5F09 A;  1H8L A;  1XF8 A;  4UCM A;  5I4M A;  1VHO A;  1EE3 P;  2CTB A;  1CX8 A;  1F2P A;  2VZY A;  5AG7 A;  4JWP A;  2PIY A;  1I12 A;  4GM5 A;  2PR1 A;  4P10 A;  1R57 A;  4A38 A;  4R3L A;  4B5O A;  5IB9 A;  5DWN A;  3H4Q A;  1ELM P;  3BJ8 A;  4UWJ A;  2ZXV A;  2YNC A;  5E96 A;  4ONU A;  5THW A;  4LQ6 A;  4PK3 A;  1QMU A;  5J8C A;  4JXR A;  1GYT A;  4UEE A;  2FS5 A;  2PVV A;  3TO6 A;  4NJQ A;  3ZZI A;  4B6Z A;  3FBU A;  1CPS A;  5A27 A;  4OAE A;  1ARL A;  2ZED A;  4HNW B;  4NF1 A;  2EBJ A;  1KUV A;  3I3G A;  4ZY0 A;  5IV0 A;  5DS0 A;  4CGL A;  3TFY A;  4MXU A;  1Q2D A;  3BXM A;  3DGV A;  1A2Z A;  1YLE A;  1P0H A;  2EK9 A;  2Q0Y A;  1YSJ A;  2ODF A;  2Q7S A;  2QML A;  2JBJ A;  2ZEN A;  3B8G A;  2YND A;  4ZY2 A;  4GXH A;  4CAV A;  1TKH A;  1VHE A;  3HUV A;  5J1Q A;  4XNH C;  4KVX A;  4B11 A;  5LYD A;  2Y0M A;  1PYT B;  2NYQ A;  3FRM A;  4OP4 A;  2WPX A;  3RO0 A;  2YNC C;  3S6G A;  4HNX B;  1KUX A;  5CBM A;  1YVO A;  4RI1 A;  4TNU A;  2GFQ A;  2R1I A;  2QJ8 A;  2AJ6 A;  2PRB A;  3D7F A;  3DNS A;  3IU1 A;  4MCR A;  3JVN A;  1Z8W A;  4W9Y A;  3PGP A;  1MJ9 A;  2VEZ A;  2ZEP A;  2GE3 A;  3CDX A;  3FYN A;  2Q44 A;  2ABZ A;  4PSX A;  3SI1 A;  4H2K A;  4UWI A;  3V8I A;  1ELL P;  1OZP A;  4UF4 A;  1IY7 A;  5HVF A;  1R3N A;  2HC9 A;  2HQY A;  3DSB A;  1Z9U A;  4KSA A;  5D8N A;  1YK3 A;  3FNC A;  2J8N A;  1CM0 A;  3IFE A;  2Z10 A;  5F48 A;  4CYQ A;  1XMB A;  3FF3 A;  3GUX A;  4L8A A;  5EC4 A;  2GIV A;  3F5B A;  3PEI A;  1MJA A;  1RXT A;  1ZLI A;  4Q36 A;  3RBU A;  3LOD A;  1Q2Y A;  3VAR A;  1B87 A;  3B3V A;  4KSI A;  2IJZ A;  1LOK A;  2PE3 A;  1XJO A;  3H8E A;  3MN8 A;  4C2Z A;  1ON0 A;  2PJC A;  3IC1 A;  4NGM A;  1KWM A;  4F8Z A;  2PJB A;  3EC4 A;  4Q38 A;  2V8V A;  3IWE A;  2BCO A;  4OC2 A;  4P4J A;  3TO7 A;  4CYP A;  1XE4 A;  4FD6 A;  3PRT A;  3WT4 A;  2B5G A;  4B13 A;  1Q2C A;  3PZJ A;  1IID A;  3EFA A;  5I0C A;  1FT7 A;  4F9U A;  1QQ9 A;  2Q4Z A;  2P0W A;  3B7I A;  4UFW A;  1R43 A;  4KUA A;  2XEI A;  2EK8 A;  3IGR A;  4NGS A;  5LYL A;  3VH9 A;  1RTQ A;  2ZW5 A;  2FIW A;  1XEB A;  1IGB A;  5KTC A;  1BPN A;  1IB1 E;  1X10 A;  4LX9 A;  3BHX A;  4MFK A;  1ZLH A;  3D4U A;  4FUU A;  1Z8T A;  1FY7 A;  4WWV A;  2BOA A;  1TIQ A;  1CP7 A;  1IOF A;  4FD7 A;  4CGO A;  2GLF A;  3KHX A;  2O53 A;  4A30 A;  4EME A;  4IHM A;  4NEX A;  3S6F A;  3MRU A;  1NSA A;  2BSW A;  4CS0 B;  3PB6 X;  1BAV A;  3KQX A;  2CY2 A;  2I3C A;  3D2M A;  1XRY A;  4JJX A;  1LAM A;  1CJW A;  1TXR A;  4H89 A;  4XPD C;  1CPX A;  5JGF A;  3BJ7 A;  3KKW A;  4AG9 A;  1QSN A;  2YNE A;  3GLJ A;  3B3S A;  2DF5 A;  2P6F A;  3PFO A;  4ZBG A;  3SJX A;  2PJ2 A;  5HVG A;  5JH9 A;  2F8H A;  2V77 A;  3DLJ A;  2FCK A;  1Y0R A;  2PJ6 A;  4ZX8 A;  3JUW A;  4G1P A;  3B3T A;  3V7Z A;  2P6G A;  4MFL A;  2X7B A;  1YX0 A;  2ANP A;  3MGD A;  2JEW A;  2FT0 A;  4A2Z A;  4C2Y A;  1GHE A;  2PSW A;  3ZJ0 A;  4EFD A;  4JYW A;  1QSM A;  4YFJ A;  4KLV A;  4HNY B;  4R57 A;  2PJ8 A;  5C88 A;  2PJ9 A;  3R95 A;  2O4H A;  1IYK A;  1S7L A;  3LAC A;  4B5P A;  2CTC A;  1P4N A;  2V8D A;  3A9L A;  2WYR A;  4J3G A;  4Y49 B;  3N5F A;  3FMC A;  4OAD A;  3VWD A;  1LCP A;  1S7N A;  3D7G A;  4BMH A;  1S7F A;  1F57 A;  2F7V A;  3E0K A;  2PQ8 A;  3FVL A;  2P6E A;  3CPX A;  3I1U A;  2OU2 A;  4M3S A;  5AG5 A;  2BL1 A;  1YGH A;  1PCA A;  3S9M A;  2B4D B;  5K8O A;  5ELY A;  4C7I A;  4BIN A;  4OME A;  2ZEG A;  2WUU A;  2CF4 A;  2PDO A;  1CG2 A;  1YQE A;  2EUI A;  4YWY A;  1KUY A;  5HXD A;  2HB6 A;  4RS2 A;  4X8I A;  1Q7L A;  1XIX A;  2A4N A;  4TWE A;  4CRY B;  5HH1 A;  2DPT A;  4HKF A;  2FVG A;  4PSW A;  1MJB A;  2AE6 A;  2IMO A;  2R7H A;  4KSF A;  1MK4 A;  2PJ0 A;  4NGQ A;  3FH4 A;  4B12 A;  2DPS A;  5JQ4 A;  1VHS A;  4BD9 A;  2ZEF A;  3LD2 A;  3FED A;  2AFW A;  1YRE A;  2AFO A;  2C6C A;  2EO8 A;  4CGN A;  4FBE A;  3SI0 A;  4QBJ A;  4K3N A;  4UEZ A;  5F49 A;  4ONW A;  2ZOF A;  4UFX A;  2B3V A;  2VL1 A;  4M6G A;  5EBV A;  4E2A A;  3EO4 A;  4KUB A;  2ATR A;  5H84 A;  2C1C A;  2DEA A;  4R3K A;  2ZOG A;  4Y49 C;  4CRZ B;  4PV6 A;  3TT2 A;  3S9N A;  1YW4 A;  2EVN A;  2G9D A;  2KCW A;  1UFH A;  4JZ0 A;  4M85 A;  2AFX A;  4CAX A;  5AG4 A;  4ZGY B;  1IYL A;  3PP9 A;  2IQ6 A;  3RZA A;  5KTD A;  2EWB A;  1QSR A;  4WJB A;  3FIX A;  4QC6 A;  3SI2 A;  3TO9 A;  4P6Y A;  4YGO A;  1M1D A;  1K4J A;  4U9Z A;  2J9A A;  4NFR A;  4UBR A;  4A39 A;  4MY3 A;  7CPA A;  4KOR A;  5G1Z A;  1J4J A;  1S7K A;  4PXB A;  1M44 A;  4KZT A;  3LMS A;  2OZG A;  5LYI A;  1AMP A;  2ZW6 A;  4B5P B;  2VZZ A;  4KOY A;  4M6I A;  4OC0 A;  4RUH A;  4AVA A;  1M4D A;  5LYF A;  1M4G A;  3FEC A;  4MJ8 A;  1L0C A;  2D4O A;  4P4E A;  4NSQ A;  5LRG A;  2ZEH A;  4U5Y A;  1LAP A;  3JRU A;  3PBB A;  4F6A A;  4Q7A A;  3V38 A;  2Q4V A;  5H86 A;  4AG7 A;  3KI9 A;  3IJ3 A;  2Z3N A;  4KVO E;  3KAS A;  3R96 A;  2JLM A;  4Z65 A;  1YW6 A;  4O23 A;  3B3C A;  4YRH A;  2BO9 A;  3BI0 A;  4MFP A;  4CAW A;  3DR8 A;  3D66 A;  1XFO A;  2Q51 A;  1Z4E A;  4L89 A;  3PB7 X;  2G3T A;  1UWY A;  1ZO0 A;  3K2K A;  3IWW A;  4MHD A;  1I1D A;  4X3R A;  3OWC A;  2JBK A;  4MCP A;  1ARM A;  2ZW4 A;  4R6T A;  5JPH A;  4MHP A;  2OZU A;  1RO5 A;  5F46 A;  4AB7 A;  3LWU A;  3KGQ A;  1JWQ A;  4AVB A;  2PJ3 A;  3NFZ A;  2OZH A;  1F2O A;  4CYN A;  2XEG A;  3JTK A;  4RN7 A;  3T9Y A;  4NGT A;  5IB0 A;  3K9T A;  2PJA A;  4P4D A;  1ZG8 A;  4JXQ A;  4E0A A;  2POK A;  8CPA A;  4R8F A;  1IU8 A;  3S9L A;  1LRZ A;  3G8W A;  3B2Y A;  1M4I A;  2PR8 A;  2VI7 A;  3H8F A;  3HLP A;  4FAI A;  1LFW A;  5KTA A;  1PUA A;  1NMT A;  3GYA A;  2OOT A;  1BLL E;  4FWU A;  4KOT A;  2B3U A;  3PB9 X;  4OKO A;  2PCU A;  4ZY1 A;  2VQY A;  1ZG9 A;  3SJF A;  1JQG A;  4UCN A;  2JDC A;  2PJ7 A;  1CP6 A;  3KR4 A;  4R7M A;  4NGR A;  4C7H A;  5C82 A;  2B4D A;  1I21 A;  3GKR A;  3FXT A;  1AYE A;  4OC4 A;  3KQZ A;  1PU9 A;  1YVK A;  2Z11 A;  3NE7 A;  4P4I A;  4X5K A;  4MFZ A;  3WC5 A;  3P2H A;  1YLO A;  3D3S A;  5EMI A;  2ZEE A;  3PB4 X;  2RB7 A;  3R9E A;  3RNZ A;  3FB3 A;  5K8M A;  3KL9 A;  5HMN A;  4MFJ A;  4OIW A;  4R9M A;  3H5Z A;  4MBU A;  3R9F A;  4A31 A;  2Z3L A;  3TCV A;  3GIU A;  4H6Z A;  1TF9 A;  5AG6 A;  2REF A;  3D7H A;  1Z8L A;  4R76 A;  2CIJ A;  4DNC A;  4CGP A;  2FSR A;  3KZW A;  2Z3O A;  4F0Y A;  1YME A;  3SHP A;  2PJ1 A;  2I00 A;  3L2N A;  4P4B A;  4DYO A;  2B4B A;  3CPA A;  3EXN A;  4P44 A;  4KOU A;  3CXS A;  5AGE A;  4P45 A;  3R1K A;  3G3S A;  5ISV A;  4IF5 A;  4LUA A;  3BI1 A;  1Y7E A;  5G20 A;  2OH1 A;  4ZX9 A;  3IEH A;  1HDU A;  1AUG A;  3KHZ A;  2PVW A;  4A32 A;  1XBU A;  1V0C A;  4OC1 A;  2YGW A;  3SJG A;  6CPA A;  3NH8 A;  4XNH B;  2Z3P A;  3WC6 A;  1N71 A;  2XEF A;  2OR4 A;  1XOV A;  1VIX A;  4PXE A;  4KOX A;  3ISZ A;  2ZEO A;  3S6H A;  4BBH A;  4AXV A;  2AFU A;  3DDD A;  4IUS A;  2PJ5 A;  2Z0Z A;  2R8V A;  1Z2L A;  4K30 A;  4KOW A;  2CNM A;  3WC7 A;  3I9S A;  5HVH A;  4PXD A;  3W6X A;  2RFH A;  3K9U A;  4FD5 A;  3SXO A;  4CAE A;  5CNP A;  5DWM A;  2J8R A;  2FIA A;  4JD6 A;  4MMO A;  4HPS A;  4KOS A;  1NE9 A;  1Y7R A;  2Q4Y A;  1KZF A;  1TKJ A;  2BUE A;  5LRJ A;  4KVM E;  1QST A;  5K8P A;  3P2F A;  4I49 A;  2CXA A;  4R87 A;  1Y9W A;  3D7D A;  4OLL A;  1YR0 A;  1SQH A;  4XPK A;  2G3A A;  2C6P A;  4MHZ A;  1TF8 A;  4JLY A;  3CXP A;  1TKF A;  2REE A;  4PK2 A;  2PC1 A;  5D29 A;  1Y9K A;  2F5I A;  2WPW A;  4H6U A;  3T90 A;  3IWG A;  4DUK A;  5K8N A;  2G0B A;  1M4L A;  3IO1 A;  4XPL A;  4U9Y A;  2RC4 A;  4CAF A;  1IOI A;  2PRQ A;  2V8G A;  1LAN A;  2GLJ A;  4KS9 A;  3PFE A;  4GS4 A;  4NGN A;  4EWT A;  3NH5 A;  2QYV A;  5A28 A;  1ZG7 A;  5G21 A;  4ZYQ A;  2WSA A;  1Z8X A;  4II9 A;  2ZPA A;  3N7Z A;  1U6M A;  4A37 A;  1Z5R A;  2Z3M A;  4NGP A; 
#chains in the Genus database with same CATH homology
 1Z4R A;  4UA3 A;  2Q04 A;  4UCP A;  2R98 A;  2VXK A;  3WR7 A;  4B14 A;  2B5G B;  2DXQ A;  1S3Z A;  2JEV A;  5BWA B;  5FVJ A;  2D4P A;  3BLN A;  2ARH A;  3GY9 A;  4MY0 A;  2O28 A;  2FXF A;  4QVT A;  2QEC A;  4NCZ A;  3TTH A;  5G22 A;  3W91 A;  2HV2 A;  4E8O A;  3W6S A;  2Q7B A;  3QB8 A;  4QUS A;  1XMT A;  1QSO A;  3CXQ A;  2IL4 A;  3F0A A;  4FD4 A;  4C68 A;  2HUZ A;  3DR6 A;  3QAH A;  2C27 A;  1NSL A;  2CNT A;  1WWZ A;  1WK4 A;  2QIR A;  2FE7 A;  5IX3 A;  4MI4 A;  4AVC A;  3R9G A;  3TOA A;  2OB0 A;  3RYO A;  5GCN A;  3VWE A;  3SXN A;  2CNS A;  3TOB A;  3UY5 A;  4A95 A;  4CYO A;  2I79 A;  2VBQ A;  3S6K A;  1S60 A;  2J8M A;  2H5M A;  2ZW7 A;  2Z3K A;  4KOV A;  2B58 A;  2K5T A;  1IIC A;  4EVY A;  4QB9 A;  2JDD A;  4A33 A;  1S5K A;  1BOB A;  1BO4 A;  4ORF A;  3D8P A;  2GAN A;  4NXY A;  4XPD B;  4B10 A;  5J8F A;  1B6B A;  3IU2 A;  2NMT A;  5F47 A;  2BEI A;  2FL4 A;  4C2X A;  3EY5 A;  4KLW A;  3TE4 A;  4MFQ A;  1VKC A;  3D2P A;  3C26 A;  4UFV A;  3F8K A;  4CGM A;  1XF8 A;  4UCM A;  5AG7 A;  2VZY A;  4JWP A;  1I12 A;  2PR1 A;  1R57 A;  4B5O A;  4R3L A;  5DWN A;  3H4Q A;  3BJ8 A;  4UWJ A;  2ZXV A;  2YNC A;  5E96 A;  4ONU A;  4PK3 A;  5J8C A;  4JXR A;  2FS5 A;  3TO6 A;  3ZZI A;  3FBU A;  5A27 A;  4OAE A;  4HNW B;  4NF1 A;  1KUV A;  3I3G A;  5IV0 A;  4CGL A;  3TFY A;  1Q2D A;  4B5P A;  1YLE A;  1P0H A;  2Q0Y A;  2QML A;  3B8G A;  2YND A;  4CAV A;  4XNH C;  4KVX A;  4B11 A;  2Y0M A;  3FRM A;  2WPX A;  2YNC C;  3S6G A;  4HNX B;  1KUX A;  1YVO A;  4RI1 A;  2R1I A;  3DNS A;  2AJ6 A;  2PRB A;  3IU1 A;  3JVN A;  3PGP A;  1MJ9 A;  2VEZ A;  3FYN A;  2GE3 A;  2Q44 A;  4PSX A;  4UWI A;  3V8I A;  1OZP A;  2HQY A;  3DSB A;  1Z9U A;  4KSA A;  1YK3 A;  3FNC A;  2J8N A;  1CM0 A;  2Z10 A;  5F48 A;  4CYQ A;  4L8A A;  5EC4 A;  2GIV A;  3F5B A;  1MJA A;  1RXT A;  4Q36 A;  3LOD A;  1Q2Y A;  1B87 A;  4C2Z A;  1ON0 A;  4Q38 A;  3EC4 A;  3IWE A;  3TO7 A;  4CYP A;  1XE4 A;  4FD6 A;  4B13 A;  2B5G A;  1Q2C A;  3PZJ A;  1IID A;  3EFA A;  5I0C A;  2P0W A;  4UFW A;  4KUA A;  3IGR A;  2ZW5 A;  2FIW A;  1XEB A;  5KTC A;  1IB1 E;  4LX9 A;  4MFK A;  1FY7 A;  1TIQ A;  4FD7 A;  4CGO A;  4A30 A;  4NEX A;  3S6F A;  2BSW A;  4CS0 B;  2CY2 A;  3D2M A;  4JJX A;  4XPD C;  1CJW A;  4H89 A;  3BJ7 A;  3KKW A;  4AG9 A;  1QSN A;  2YNE A;  4ZBG A;  2P6F A;  2FCK A;  3JUW A;  2P6G A;  4MFL A;  2X7B A;  1YX0 A;  3MGD A;  4C2Y A;  2FT0 A;  4A2Z A;  1GHE A;  2PSW A;  3ZJ0 A;  1QSM A;  4YFJ A;  4KLV A;  4HNY B;  4R57 A;  5C88 A;  3R95 A;  1IYK A;  1S7L A;  1P4N A;  3A9L A;  4J3G A;  4Y49 B;  4F0X A;  4OAD A;  3VWD A;  4BMH A;  1S7N A;  1S7F A;  3E0K A;  2PQ8 A;  2P6E A;  4M3S A;  2OU2 A;  5AG5 A;  2BL1 A;  1YGH A;  2B4D B;  4C7I A;  2WUU A;  2PDO A;  2EUI A;  1KUY A;  4RS2 A;  1XIX A;  2A4N A;  4CRY B;  5HH1 A;  2DPT A;  4HKF A;  4PSW A;  1MJB A;  2AE6 A;  2R7H A;  4KSF A;  4B12 A;  1MK4 A;  2DPS A;  5JQ4 A;  1VHS A;  3LD2 A;  1YRE A;  4CGN A;  4QBJ A;  5F49 A;  4UFX A;  2B3V A;  5EBV A;  4E2A A;  3EO4 A;  4KUB A;  2ATR A;  5H84 A;  4R3K A;  4Y49 C;  4CRZ B;  4PV6 A;  3TT2 A;  2EVN A;  2KCW A;  1UFH A;  4M85 A;  4CAX A;  5AG4 A;  4ZGY B;  1IYL A;  3PP9 A;  5KTD A;  1QSR A;  3FIX A;  4QC6 A;  3TO9 A;  4YGO A;  1M1D A;  1K4J A;  4U9Z A;  4UBR A;  4MY3 A;  4KOR A;  5G1Z A;  1J4J A;  1S7K A;  1M44 A;  4KZT A;  2OZG A;  2ZW6 A;  4B5P B;  2VZZ A;  4KOY A;  4AVA A;  1M4D A;  1M4G A;  4MJ8 A;  1L0C A;  2D4O A;  4NSQ A;  4U5Y A;  4F6A A;  2Q4V A;  5H86 A;  4AG7 A;  2Z3N A;  4KVO E;  3R96 A;  2JLM A;  4YRH A;  4MFP A;  4CAW A;  3DR8 A;  1Z4E A;  4L89 A;  2G3T A;  1ZO0 A;  4MHD A;  1I1D A;  3OWC A;  2ZW4 A;  5JPH A;  2OZU A;  1RO5 A;  5F46 A;  4AB7 A;  4AVB A;  2OZH A;  4CYN A;  3JTK A;  3T9Y A;  5IB0 A;  4JXQ A;  4E0A A;  1LRZ A;  3G8W A;  1M4I A;  2PR8 A;  2VI7 A;  5KTA A;  1PUA A;  1NMT A;  3GYA A;  4KOT A;  2B3U A;  2VQY A;  4UCN A;  2JDC A;  4C7H A;  5C82 A;  2B4D A;  1I21 A;  3GKR A;  3FXT A;  3NE7 A;  1PU9 A;  1YVK A;  2Z11 A;  4X5K A;  4MFZ A;  3P2H A;  3D3S A;  3R9E A;  3FB3 A;  5HMN A;  4MFJ A;  4R9M A;  3H5Z A;  4MBU A;  3R9F A;  4A31 A;  2Z3L A;  3TCV A;  4H6Z A;  5AG6 A;  2REF A;  4DNC A;  4CGP A;  2FSR A;  2Z3O A;  4F0Y A;  3SHP A;  2I00 A;  2B4B A;  3EXN A;  4KOU A;  3CXS A;  5AGE A;  3R1K A;  3G3S A;  5ISV A;  4IF5 A;  4LUA A;  5G20 A;  2OH1 A;  4A32 A;  1V0C A;  2YGW A;  4XNH B;  2Z3P A;  1N71 A;  4KOX A;  3S6H A;  4BBH A;  3DDD A;  4IUS A;  2Z0Z A;  2R8V A;  4K30 A;  4KOW A;  2CNM A;  3I9S A;  3W6X A;  3K9U A;  4FD5 A;  3SXO A;  4CAE A;  5CNP A;  5DWM A;  2J8R A;  2FIA A;  4JD6 A;  4KOS A;  1NE9 A;  1Y7R A;  2Q4Y A;  1KZF A;  2BUE A;  4KVM E;  1QST A;  3P2F A;  4I49 A;  2CXA A;  4R87 A;  1Y9W A;  4OLL A;  1YR0 A;  1SQH A;  4XPK A;  2G3A A;  4JLY A;  3CXP A;  4PK2 A;  2REE A;  2PC1 A;  1Y9K A;  2F5I A;  2WPW A;  4H6U A;  3T90 A;  3IWG A;  2G0B A;  4XPL A;  4U9Y A;  2RC4 A;  4CAF A;  4KS9 A;  4GS4 A;  5A28 A;  5G21 A;  2WSA A;  4II9 A;  2ZPA A;  3N7Z A;  1U6M A;  2Z3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...