4H89A

The structure of a gcn5-related n-acetyltransferase from kribbella flavida
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
168
Chain Sequence
SPEALQVRDAEDADWPAILPFFREIVSAGETYAYDPELTDEQARSLWMTPSGPQSRTTVAVDADGTVLGSANMYPNRPGPGAHVASASFMVAAAARGRGVGRALCQDMIDWAGREGFRAIQFNAVVETNTVAVKLWQSLGFRVIGTVPEAFHHPTHGYVGLHVMHRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GCN5-related N-acetyltransferase
publication title The Structure of a GCN5-Related N-Acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
total genus 44
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h89A00
4MJ8A 1I21A 2EVNA 3TT2A 3VWEA 3OWCA 4KOVA 4QVTA 4MY0A 5C82A 1QSNA 3TTHA 4AG7A 2X7BA 3TO7A 2Q04A 2FL4A 3FNCA 5H86A 1YX0A 3CXQA 5J8CA 1M4IA 2FT0A 3D3SA 4H6ZA 3EO4A 1M44A 1NSLA 1Y9WA 3D2PA 4PV6A 2OB0A 3H4QA 4KVXA 5ISVA 2CNSA 3QB8A 2REEA 5J8FA 3FYNA 3JVNA 1BO4A 2ATRA 4HKFA 5IV0A 1GHEA 2HV2A 5HMNA 4KOWA 4OADA 1YR0A 1Y9KA 1S3ZA 2BUEA 2FIWA 1MK4A 2B58A 2PR8A 3P2HA 1Q2DA 5HH1A 4KLVA 4AB7A 4M3SA 3DNSA 2GE3A 2ZW4A 5F47A 3DDDA 4RI1A 1M4DA 4U9ZA 5F46A 4KLWA 2P0WA 3KKWA 2OZGA 4U5YA 4KOUA 2F5IA 3TE4A 2VEZA 3G8WA 1RO5A 4U9YA 5IX3A 2IL4A 4M85A 4XPLA 4MBUA 1VKCA 1YK3A 5E96A 1R57A 2PR1A 2PQ8A 4DNCA 3FXTA 2G0BA 3W6XA 2PDOA 4MHDA 2VQYA 1Z9UA 1QSRA 4MY3A 2Q7BA 4HNYB 5F49A 1L0CA 2JLMA 3CXPA 1Q2YA 1YREA 1S7FA 2B4BA 2Q4VA 2J8NA 2Z10A 3D2MA 2HQYA 3N7ZA 3TOAA 2FSRA 3F0AA 1KUXA 2O28A 1U6MA 4JWPA 2VI7A 3JUWA 5KTAA 4MI4A 2CY2A 5F48A 4YGOA 3F8KA 5KTCA 1QSOA 4FD4A 1CJWA 2WPXA 2Q4YA 1XMTA 1LRZA 1KZFA 2QECA 3ZZIA 2R7HA 4OAEA 4H89A 4CRZB 4II9A 2GIVA 3R9EA 4AVBA 3C26A 4JD6A 3EC4A 4KOTA 4YRHA 4NSQA 5GCNA 3MGDA 3V8IA 3TO6A 2PC1A 1XE4A 1IYLA 4CRYB 3S6GA 1S7KA 2VXKA 2VZZA 4KUAA 2AE6A 1S60A 2FXFA 1QSTA 3S6HA 4ORFA 4KOXA 2G3AA 1P4NA 4LUAA 1WK4A 2Z0ZA 4AG9A 2QMLA 4PK2A 2HUZA 4X5KA 2R1IA 1Z4EA 1I1DA 2REFA 3S6FA 1FY7A 2D4PA 2P6EA 3FB3A 3EXNA 2EUIA 3TCVA 1XF8A 3NE7A 2OZUA 4H6UA 2R8VA 4J3GA 4FD6A 5JPHA 1N71A 4CAXA 2B4DB 2RC4A 3R96A 2B3UA 3FRMA 2OZHA 4KORA 2OU2A 3DR6A 1KUVA 1Q2CA 1M1DA 1YLEA 4GS4A 3FBUA 4B5PB 4FD5A 4B5PA 2JDCA 4IUSA 4F6AA 2GANA 2H5MA 3GY9A 4QC6A 3DSBA 3R9GA 3W6SA 3PGPA 1K4JA 2FE7A 1WWZA 2J8RA 4L89A 4E8OA 2ARHA 4CAVA 1TIQA 4XNHB 2K5TA 2FCKA 4CS0B 2WPWA 1VHSA 3P2FA 2OH1A 1S5KA 2ZPAA 3R95A 5IB0A 2DXQA 4I49A 3TO9A 1IB1E 3G3SA 4XNHC 1QSMA 4KVOE 3TOBA 5CNPA 5FVJA 1SQHA 3WR7A 2ZXVA 4EVYA 4KOSA 2I79A 4XPDB 4R57A 1UFHA 4UWJA 1I12A 5DWNA 1V0CA 2QIRA 3BLNA 4Y49B 1PU9A 2ZW5A 3RYOA 2G3TA 1Y7RA 2FIAA 4XPDC 2ZW6A 2J8MA 3W91A 3VWDA 4Y49C 5H84A 1IIDA 1XIXA 3GYAA 4CAWA 1RXTA 3E0KA 3LD2A 3K9UA 2CNTA 2I00A 5I0CA 3D8PA 4XPKA 4R3LA 4RS2A 2JEVA 4E2AA 2KCWA 3IWGA 4QBJA 1MJ9A 2PRBA 1J4JA 2R98A 1BOBA 3R1KA 1P0HA 4LX9A 4FD7A 2A4NA 4JXRA 3SXNA 3GKRA 3SHPA 1PUAA 2VBQA 1XEBA 4UWIA 1S7NA 4JLYA 2BSWA 4NEXA 1B87A 2BL1A 4UA3A 4HNWB 1ON0A 2CNMA 3FIXA 4QB9A 5C88A 4ONUA 4NXYA 4KVME 1YVKA 4PSWA 2Z11A 3R9FA 3IGRA 2D4OA 4K30A 5EBVA 2Q0YA 4JJXA 5KTDA 1CM0A 3I3GA 3CXSA 2NMTA 3F5BA 2B4DA 2PSWA 1B6BA 4PSXA 3SXOA 4NF1A 2FS5A 3BJ7A 4OLLA 4YFJA 2AJ6A 3TFYA 1YVOA 2ZW7A 3T9YA 5DWMA 3EY5A 2JDDA 2P6GA 4KOYA 4IF5A 1OZPA 4BMHA 2Q44A 2Y0MA 3T90A 2BEIA 4R87A 1M4GA 4QUSA 2C27A 3PZJA 3UY5A 3PP9A 4PK3A 4UBRA 4AVAA 4KZTA 2B3VA 3I9SA 4NCZA 1KUYA 4R9MA 4R3KA 1IYKA 2VZYA 4L8AA 5EC4A 1IICA 3S6KA 1YGHA 4AVCA 3QAHA 4E0AA 3LODA 1NMTA 4ZBGA 1NE9A 2B5GB 4HNXB 3ZJ0A 4F0YA 3B8GA 1MJAA 1S7LA 1Z4RA 2B5GA 5JQ4A 1MJBA 4B5OA 3BJ8A 3EFAA 3DR8A 4KUBA 4JXQA 2P6FA
chains in the Genus database with same CATH superfamily
4MJ8A 4P4FA 1I21A 3QAYA 2EVNA 4B11A 4IHMA 2CF4A 5HVFA 4CYPA 3TT2A 4OMEA 3VWEA 3OWCA 4KOVA 4OC4A 4Q7AA 1ZLIA 2Z3LA 4MY0A 2YNEA 4QVTA 5C82A 1QSNA 4F9UA 3TTHA 5A28A 4AG7A 1TKFA 2X7BA 3TO7A 2Q04A 5EMIA 2AFXA 2FL4A 3FNCA 5H86A 2GREA 3RNZA 1CPSA 1YX0A 3WABA 3KL9A 2PJ7A 1FNOA 3CXQA 5J8CA 4BD9A 5JM6A 1M4IA 1JWQA 3B35A 4X2TA 2FT0A 3D3SA 1CX8A 4H6ZA 1IOFA 2BOAA 3EO4A 4A94A 1M44A 2F8HA 3CDXA 4OC5A 4RN7A 4Z65A 3H8EA 1NSLA 1Y9WA 3D2PA 5I4MA 3IU2A 2AFZA 3BI1A 5JH9A 4PV6A 2OB0A 3WT4A 3H4QA 2WSAA 4KVXA 5ISVA 3H5ZA 2CNSA 4P4BA 3QB8A 2REEA 3IWWA 4OC0A 5J8FA 3PB9X 3FYNA 3JVNA 2XEIA 4CAEA 3LWUA 5IX3A 1Z8LA 2ZENA 2GLFA 1BO4A 2ATRA 2YNCA 5G20A 4NGPA 4HKFA 5THWA 5IV0A 1GHEA 1Q7LA 1ZO0A 4MHZA 2HV2A 2PJ8A 5HMNA 4KOWA 3FEDA 4OADA 4KSIA 1YR0A 1Y9KA 1S3ZA 2BUEA 1QQ9A 1MK4A 2FIWA 2B58A 2YNCC 5LYIA 2PR8A 3P2HA 2PIZA 3T8WA 1Q2DA 5HH1A 3FVLA 2ZEDA 2O4HA 1Y0YA 4KLVA 4AB7A 4M3SA 3DNSA 3B3TA 2GE3A 2ZW4A 2RFHA 2HB6A 5F47A 4C2XA 2PVWA 3DDDA 4RI1A 4MCQA 1M4DA 4U9ZA 5F46A 4KLWA 3KQXA 3K9TA 1BPMA 2P0WA 3IU1A 4P4DA 1DE4C 3KKWA 1Z5RA 1ELMP 4PXDA 1OBRA 2EWBA 4MFQA 1YLOA 2OZGA 2ZEHA 4U5YA 4KOUA 2F5IA 1ARMA 3TE4A 2VEZA 1XRYA 1RO5A 1TXRA 2Z3NA 2IL4A 3FJUA 3G8WA 3PFOA 4U9YA 4YU9A 4CYOA 4M85A 4XPLA 2DEAA 4MBUA 3K2KA 2IMOA 1XBUA 1VKCA 1YK3A 2XEFA 4A30A 4R8FA 3SI2A 3PRTA 5E96A 3DLJA 1R57A 2PR1A 2VL1A 2PQ8A 4DNCA 1VHEA 2AFUA 2C6GA 3FXTA 2G0BA 3SJGA 3MRUA 4MXUA 3W6XA 2PDOA 4MHDA 2VQYA 3GLJA 4M6IA 1CBXA 4CYNA 1Z9UA 3GB0A 3V38A 1IOIA 2WZNA 4PXBA 1NSAA 1QSRA 1TKJA 2Q7SA 2PJ6A 4MY3A 2Q7BA 2F7VA 4HNYB 5F49A 4PXCA 3KI9A 3GUXA 1L0CA 2JLMA 1Y7EA 3CXPA 4W9YA 1Q2YA 1YREA 1S7FA 1ZG8A 4NGMA 4CYQA 2B4BA 2Q4VA 4B14A 2J8NA 2Z10A 3D2MA 3NFZA 3I1UA 2HQYA 3N7ZA 3TOAA 2FSRA 4IK2A 3F0AA 4IAVA 3B3WA 5AG4A 3ISXA 1KUXA 3SJXA 2O28A 3NH4A 4B13A 3N5FA 4FUUA 1U6MA 4UF4A 4JWPA 5JGFA 2VI7A 3JUWA 1XJOA 5KTAA 2V8VA 4X3RA 2EK9A 2OOTA 1LAMA 2PJ0A 4MI4A 2CY2A 5F48A 4YGOA 3F8KA 2NSMA 3D7DA 2ANPA 2PCUA 5KTCA 3S9LA 3S9NA 5CPAA 1QSOA 1IY7A 5DS0A 4FD4A 1CJWA 2WPXA 4KSAA 4JYWA 4B12A 2Q4YA 5D8NA 4M6HA 1XMTA 3VATA 2PJ2A 1LRZA 1KZFA 2CXAA 2QECA 2R7HA 2ZEGA 3ZZIA 4NGRA 4OAEA 4H89A 4ZY0A 1DTDA 4CRZB 4II9A 2GIVA 3R9EA 2O53A 5LRJA 3D68A 1YW4A 8CPAA 4AVBA 3C26A 4JD6A 1YQEA 4MCSA 2EBJA 3EC4A 3IO1A 4KOTA 5K8NA 4YRHA 1QMUA 5LRKA 2ZEEA 2G9DA 4NSQA 4NGSA 2AFSA 5G1ZA 4C68A 3S9MA 5GCNA 3MGDA 3V8IA 3FMCA 2CTCA 2PRQA 4OC1A 3TO6A 2Q51A 2PC1A 1XE4A 2V8HA 1IYLA 3B3CA 3PEIA 3SJFA 4WJBA 4TNUA 4CRYB 4MCPA 4C2YA 2YNDA 3S6GA 3IC1A 1S7KA 2VXKA 1HDQA 2VZZA 4KUAA 1KWMA 2AE6A 4A33A 1S60A 3CZXA 2PJ4A 3HUVA 2FXFA 2JBJA 1QSTA 4C7IA 3H8FA 2PJ3A 3S6HA 4BINA 4ORFA 2V8GA 2EO8A 1CP7A 4KOXA 1RTQA 3VH9A 2G3AA 2ZEMA 1P4NA 4LUAA 1WK4A 2Z0ZA 4AG9A 4A39A 4CAFA 4K3NA 1LFWA 3KHZA 5G21A 1AMPA 2QMLA 4PK2A 1CG2A 2HUZA 5LYFA 4X5KA 2R1IA 1Z8TA 4YWYA 4ZGYB 5A27A 1Z4EA 2PE3A 2QYVA 5AGEA 1I1DA 2PJBA 1X12A 2WYRA 4GM5A 2REFA 3RAMA 4MMOA 4NFRA 3S6FA 7CPAA 1FY7A 2D4PA 2P6EA 3H8GA 3FB3A 3EXNA 2AFOA 4P10A 2EK8A 2EUIA 4NJQA 3TCVA 4MHPA 1XF8A 3NE7A 2OZUA 3NH5A 4H6UA 2R8VA 5LYLA 4H2KA 1PYTB 1TKHA 3JTKA 4J3GA 1R3NA 4FD6A 4R7MA 5JPHA 1N71A 3WC5A 4CAXA 2B4DB 3KR5A 5CBMA 2RC4A 3IIBA 2ZEPA 3D4UA 2B3UA 3FRMA 3R96A 4OC2A 3D7GA 2YGWA 2IQ6A 2OZHA 4KORA 5D29A 2OU2A 3DR6A 5BWAB 1KUVA 1Q2CA 1M1DA 4NGNA 1YLEA 1YW6A 2PJAA 3B2YA 4GS4A 2DF5A 3ISZA 3CT9A 3NA6A 4MRIA 5ELYA 4F9VA 3FBUA 3RZAA 4B5PB 4FD5A 2ZELA 4X8IA 5AG6A 4F8ZA 4MFLA 4B5PA 1F57A 2JDCA 4IUSA 4OIDA 4ZY2A 4TWEA 4Q36A 2GU2A 2GANA 2H5MA 4F6AA 3GY9A 4OC3A 4QC6A 3DSBA 3R9GA 3W6SA 4AXVA 4LQ6A 3PGPA 2PIYA 1K4JA 2FE7A 1ELLP 1WWZA 2J8RA 3LMSA 4L89A 4ZX8A 3V7ZA 4E8OA 2ARHA 4CAVA 3CPXA 3TC8A 1TIQA 4PXEA 1VGYA 2HC9A 4XNHB 1YMEA 2K5TA 2FCKA 2ZOFA 3D66A 5AG7A 4CGOA 1HEEA 4CS0B 2WPWA 1F2PA 1VHSA 2ZEFA 3P2FA 4C2ZA 1ZG7A 2OH1A 1S5KA 2OR4A 2ZPAA 3JRUA 2DXQA 3R95A 1Y0RA 5IB0A 2C1CA 4I49A 3TO9A 1M4LA 4O23A 3SJEA 1IB1E 4PQAA 4OIWA 3BXMA 4P6YA 3G3SA 1TF9A 1QSMA 4XNHC 4KVOE 3CPAA 4A38A 2PJ1A 2WUUA 5F09A 3A9LA 3IEHA 3KHXA 3TOBA 5CNPA 5FVJA 2AFWA 5LYDA 2J9AA 1SQHA 3SI0A 3WR7A 4BBHA 4DYOA 4FAIA 2ZXVA 4EVYA 4DJLA 4KOSA 2I79A 4CGLA 4PPZA 4XPDB 4R57A 4FBEA 1UFHA 3NH8A 4NJRA 4UWJA 2CTBA 3FEEA 4UEZA 4EMEA 1BAVA 4RUHA 1I12A 1Z2LA 1V0CA 2QIRA 2V8DA 3BLNA 4Y49B 5DWNA 4CGMA 1ZG9A 4NGTA 4EFDA 4UFXA 3GIUA 3RBUA 1PU9A 2ZW5A 2PJ9A 3RYOA 2G3TA 1Y7RA 2FIAA 1F2OA 4XPDC 2JEWA 3PB4X 2ABZA 3BHXA 2GFQA 2ZW6A 1IGBA 2J8MA 3W91A 1XOVA 3VWDA 4Y49C 3HLPA 5H84A 1IIDA 4M6GA 2ODFA 2AFMA 1XIXA 2PJCA 3GYAA 4CAWA 1RXTA 3E0KA 3LD2A 3K9UA 2CNTA 2I00A 2V77A 5I0CA 1YSJA 1H8LA 3D8PA 4XPKA 4GXHA 4P44A 4R3LA 2ZEOA 4P45A 4R6TA 4RS2A 5J1QA 3FH4A 1LAPA 2JEVA 3IFEA 4CGPA 1R43A 4E2AA 2KCWA 3IWGA 4C7HA 4QBJA 1MJ9A 4MHYA 3PB6X 3RO0A 2PRBA 1J4JA 2QJ8A 2R98A 3PB8X 4G1PA 4F0XA 1BOBA 1JQGA 3R1KA 1P0HA 4LX9A 4FD7A 2A4NA 4P4EA 4JXRA 3SXNA 3GKRA 3SHPA 1PUAA 2VBQA 2C6CA 2XEJA 5AG5A 1XEBA 3L2NA 1S7NA 1TF8A 4UWIA 4JLYA 2BSWA 4NEXA 2C6PA 3D7FA 1B87A 2BL1A 3FX6A 4HNWB 4UA3A 5IB9A 1ON0A 2CNMA 3WC6A 3FIXA 4HPSA 2ZOGA 3B7IA 3D7HA 4QB9A 4P4JA 5C88A 3KASA 4ONUA 2IJZA 4KVME 1YVKA 4NXYA 4PSWA 2Z11A 3R9FA 3IGRA 2PJ5A 3IJ3A 2D4OA 2Q4ZA 4WWVA 3BI0A 3WC7A 4K30A 5EBVA 2Q0YA 4JJXA 5KTDA 2DPTA 1A2ZA 1CM0A 3KR4A 4ZY1A 1CPXA 4UIAA 4UIBA 3I3GA 2BO9A 3CXSA 3PBBA 2CIJA 2NMTA 3F5BA 2POKA 2B4DA 2JBKA 1B6BA 2PSWA 2Z3MA 4PSXA 3SXOA 4B10A 4UCMA 4UCNA 4CPAA 3B3VA 2DPSA 4LQGA 4NF1A 2FS5A 3BJ7A 1FT7A 4OLLA 3NE8A 2BCOA 4MCRA 4YFJA 2AJ6A 3TFYA 1YVOA 5G22A 2ZW7A 3T9YA 2XEGA 5DWMA 3EY5A 1XMBA 2JDDA 3DGVA 4KS9A 4MFKA 3QNVA 1AYEA 2P6GA 4KOYA 3FECA 4IF5A 1OZPA 1ARLA 3B3SA 2Q44A 4BMHA 4DUKA 2RB7A 3D67A 4ZI6A 5HVHA 1HDUA 2Y0MA 4R76A 3PBEA 4A37A 2Z3OA 3FF3A 3T90A 2BEIA 3MN8A 4UFWA 4R87A 4UCPA 1M4GA 4QUSA 4B6ZA 6CPAA 1X10A 2C27A 3PZJA 3SI1A 3UY5A 3PP9A 1BPNA 4PK3A 5K8OA 4UBRA 1PCAA 2Z3KA 4ZYQA 4P4IA 3KZWA 4AVAA 4KZTA 3PB7X 3LACA 2B3VA 3I9SA 2FVGA 4NCZA 4MFJA 4JZ0A 3KQZA 3TX8A 1IU8A 1ZLHA 4A31A 2Z3PA 4Q38A 1AUGA 5HXDA 2NYQA 4OP4A 1KUYA 5K8MA 1Z8WA 4R9MA 4R3KA 1IYKA 5K8PA 2GLJA 2PVVA 2VZYA 4L8AA 5EC4A 1IICA 4EWTA 3S6KA 1YGHA 4MHNA 4AVCA 1VHOA 5HVGA 3QAHA 4E0AA 1GYTA 3LODA 1LANA 4UEEA 4NGQA 1LOKA 1NMTA 4UFVA 4ZBGA 1LCPA 1NE9A 4ZX9A 3VARA 1VIXA 1EE3P 2B5GB 4HNXB 4KSFA 3ZJ0A 4F0YA 1XFOA 1UWYA 3B8GA 1MJAA 1S7LA 1Z4RA 3PFEA 2B5GA 2Q43A 5LRGA 5JQ4A 3KGQA 4OKOA 2QVPA 4MFZA 1MJBA 4MFPA 3BJ8A 3EFAA 3IWEA 4A2ZA 1BLLE 3DR8A 4KUBA 4B5OA 4A32A 4CGNA 1Z8XA 4ONWA 1CP6A 4UEFA 4FWUA 4A95A 4JXQA 2P6FA 2I3CA
chains in the Genus database with same CATH topology
4MJ8A 1I21A 2EVNA 4B11A 4CYPA 3TT2A 3VWEA 3OWCA 4KOVA 4QVTA 2Z3LA 4MY0A 2YNEA 5C82A 1QSNA 3TTHA 5A28A 4AG7A 2X7BA 3TO7A 2Q04A 2FL4A 3FNCA 5H86A 1YX0A 3CXQA 5J8CA 1M4IA 2FT0A 3D3SA 4H6ZA 3EO4A 1M44A 1NSLA 1Y9WA 3D2PA 3IU2A 4PV6A 2OB0A 3H4QA 2WSAA 4KVXA 5ISVA 3H5ZA 2CNSA 3QB8A 2REEA 5J8FA 3FYNA 3JVNA 4CAEA 1BO4A 2ATRA 2YNCA 5G20A 4HKFA 5IV0A 1GHEA 1ZO0A 2HV2A 5HMNA 4KOWA 4OADA 1YR0A 1Y9KA 1S3ZA 2BUEA 2FIWA 1MK4A 2YNCC 2B58A 2PR8A 3P2HA 1Q2DA 5HH1A 4KLVA 4AB7A 4M3SA 3DNSA 2GE3A 2ZW4A 5F47A 4C2XA 3DDDA 4RI1A 1M4DA 4U9ZA 5F46A 4KLWA 3IU1A 2P0WA 3KKWA 4MFQA 2OZGA 4U5YA 4KOUA 2F5IA 3TE4A 2VEZA 2Z3NA 1RO5A 3G8WA 4U9YA 2IL4A 5IX3A 4CYOA 4M85A 4XPLA 4MBUA 1VKCA 1YK3A 4A30A 5E96A 1R57A 2PR1A 2PQ8A 4DNCA 3FXTA 2G0BA 3W6XA 2PDOA 4MHDA 2VQYA 4CYNA 1Z9UA 1QSRA 4MY3A 2Q7BA 4HNYB 5F49A 1L0CA 2JLMA 3CXPA 1Q2YA 1YREA 1S7FA 4CYQA 2B4BA 2Q4VA 4B14A 2J8NA 2Z10A 3D2MA 2HQYA 3N7ZA 3TOAA 2FSRA 3F0AA 5AG4A 1KUXA 2O28A 4B13A 1U6MA 4JWPA 2VI7A 3JUWA 5KTAA 4MI4A 2CY2A 5F48A 4YGOA 3F8KA 5KTCA 1QSOA 4FD4A 1CJWA 2WPXA 4KSAA 4B12A 2Q4YA 1XMTA 1LRZA 1KZFA 2CXAA 2QECA 2R7HA 3ZZIA 4OAEA 4H89A 4CRZB 4II9A 2GIVA 3R9EA 4AVBA 3C26A 4JD6A 3EC4A 4KOTA 4YRHA 4NSQA 5G1ZA 4C68A 5GCNA 3MGDA 3V8IA 3TO6A 2PC1A 1XE4A 1IYLA 4CRYB 4C2YA 2YNDA 3S6GA 1S7KA 2VXKA 2VZZA 4KUAA 2AE6A 4A33A 1S60A 2FXFA 1QSTA 4C7IA 3S6HA 4ORFA 4KOXA 2G3AA 1P4NA 4LUAA 1WK4A 2Z0ZA 4AG9A 4CAFA 5G21A 2QMLA 4PK2A 2HUZA 4X5KA 2R1IA 4ZGYB 5A27A 1Z4EA 5AGEA 1I1DA 2REFA 3S6FA 1FY7A 2D4PA 2P6EA 3FB3A 3EXNA 2EUIA 3TCVA 1XF8A 3NE7A 2OZUA 4H6UA 2R8VA 3JTKA 4J3GA 4FD6A 5JPHA 1N71A 4CAXA 2B4DB 2RC4A 3R96A 2B3UA 3FRMA 2YGWA 2OZHA 4KORA 2OU2A 3DR6A 5BWAB 1KUVA 1Q2CA 1M1DA 1YLEA 4GS4A 3FBUA 4B5PB 4FD5A 5AG6A 4MFLA 4B5PA 2JDCA 4IUSA 4Q36A 4F6AA 2GANA 2H5MA 3GY9A 4QC6A 3DSBA 3R9GA 3W6SA 3PGPA 1K4JA 2FE7A 1WWZA 2J8RA 4L89A 4E8OA 2ARHA 4CAVA 1TIQA 4XNHB 2K5TA 5AG7A 2FCKA 4CGOA 4CS0B 2WPWA 1VHSA 4C2ZA 3P2FA 2OH1A 1S5KA 2ZPAA 3R95A 5IB0A 2DXQA 4I49A 3TO9A 1IB1E 3G3SA 4XNHC 1QSMA 4KVOE 2WUUA 3A9LA 3TOBA 5CNPA 5FVJA 4BBHA 1SQHA 3WR7A 2ZXVA 4EVYA 4KOSA 2I79A 4CGLA 4XPDB 4R57A 1UFHA 4UWJA 1I12A 5DWNA 1V0CA 2QIRA 3BLNA 4Y49B 4CGMA 4UFXA 1PU9A 2ZW5A 3RYOA 2G3TA 1Y7RA 2FIAA 4XPDC 2ZW6A 2J8MA 3W91A 3VWDA 4Y49C 5H84A 1IIDA 1XIXA 3GYAA 4CAWA 1RXTA 3E0KA 3LD2A 3K9UA 2CNTA 2I00A 5I0CA 3D8PA 4XPKA 4R3LA 4RS2A 4CGPA 2JEVA 4E2AA 2KCWA 3IWGA 4C7HA 4QBJA 1MJ9A 2PRBA 1J4JA 2R98A 4F0XA 1BOBA 3R1KA 1P0HA 4LX9A 4FD7A 2A4NA 4JXRA 3SXNA 3GKRA 3SHPA 1PUAA 2VBQA 5AG5A 1XEBA 4UWIA 1S7NA 4JLYA 2BSWA 4NEXA 1B87A 2BL1A 4UA3A 4HNWB 1ON0A 2CNMA 3FIXA 4QB9A 5C88A 4ONUA 4NXYA 4KVME 1YVKA 4PSWA 2Z11A 3R9FA 3IGRA 2D4OA 4K30A 5EBVA 2Q0YA 4JJXA 5KTDA 2DPTA 1CM0A 3I3GA 3CXSA 2NMTA 3F5BA 2B4DA 2PSWA 1B6BA 2Z3MA 4PSXA 3SXOA 4B10A 4UCMA 4UCNA 2DPSA 4NF1A 2FS5A 3BJ7A 4OLLA 4YFJA 2AJ6A 3TFYA 1YVOA 5G22A 2ZW7A 3T9YA 5DWMA 3EY5A 2JDDA 4KS9A 4MFKA 2P6GA 4KOYA 4IF5A 1OZPA 4BMHA 2Q44A 2Y0MA 2Z3OA 3T90A 2BEIA 4UFWA 4UCPA 4R87A 1M4GA 4QUSA 2C27A 3PZJA 3UY5A 3PP9A 4PK3A 4UBRA 2Z3KA 4AVAA 4KZTA 2B3VA 3I9SA 4NCZA 4MFJA 4A31A 2Z3PA 4Q38A 1KUYA 4R9MA 4R3KA 1IYKA 2VZYA 4L8AA 5EC4A 1IICA 3S6KA 1YGHA 4AVCA 3QAHA 4E0AA 3LODA 1NMTA 4UFVA 4ZBGA 1NE9A 4KSFA 2B5GB 4HNXB 3ZJ0A 4F0YA 3B8GA 1MJAA 1S7LA 1Z4RA 2B5GA 5JQ4A 4MFZA 4A2ZA 1MJBA 4MFPA 3BJ8A 3EFAA 3IWEA 4B5OA 3DR8A 4KUBA 4A32A 4CGNA 4A95A 4JXQA 2P6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJ8 A;  1I21 A;  2EVN A;  3TT2 A;  3VWE A;  3OWC A;  4KOV A;  4QVT A;  4MY0 A;  5C82 A;  1QSN A;  3TTH A;  4AG7 A;  2X7B A;  3TO7 A;  2Q04 A;  2FL4 A;  3FNC A;  5H86 A;  1YX0 A;  3CXQ A;  5J8C A;  1M4I A;  2FT0 A;  3D3S A;  4H6Z A;  3EO4 A;  1M44 A;  1NSL A;  1Y9W A;  3D2P A;  4PV6 A;  2OB0 A;  3H4Q A;  4KVX A;  5ISV A;  2CNS A;  3QB8 A;  2REE A;  5J8F A;  3FYN A;  3JVN A;  1BO4 A;  2ATR A;  4HKF A;  5IV0 A;  1GHE A;  2HV2 A;  5HMN A;  4KOW A;  4OAD A;  1YR0 A;  1Y9K A;  1S3Z A;  2BUE A;  2FIW A;  1MK4 A;  2B58 A;  2PR8 A;  3P2H A;  1Q2D A;  5HH1 A;  4KLV A;  4AB7 A;  4M3S A;  3DNS A;  2GE3 A;  2ZW4 A;  5F47 A;  3DDD A;  4RI1 A;  1M4D A;  4U9Z A;  5F46 A;  4KLW A;  2P0W A;  3KKW A;  2OZG A;  4U5Y A;  4KOU A;  2F5I A;  3TE4 A;  2VEZ A;  3G8W A;  1RO5 A;  4U9Y A;  5IX3 A;  2IL4 A;  4M85 A;  4XPL A;  4MBU A;  1VKC A;  1YK3 A;  5E96 A;  1R57 A;  2PR1 A;  2PQ8 A;  4DNC A;  3FXT A;  2G0B A;  3W6X A;  2PDO A;  4MHD A;  2VQY A;  1Z9U A;  1QSR A;  4MY3 A;  2Q7B A;  4HNY B;  5F49 A;  1L0C A;  2JLM A;  3CXP A;  1Q2Y A;  1YRE A;  1S7F A;  2B4B A;  2Q4V A;  2J8N A;  2Z10 A;  3D2M A;  2HQY A;  3N7Z A;  3TOA A;  2FSR A;  3F0A A;  1KUX A;  2O28 A;  1U6M A;  4JWP A;  2VI7 A;  3JUW A;  5KTA A;  4MI4 A;  2CY2 A;  5F48 A;  4YGO A;  3F8K A;  5KTC A;  1QSO A;  4FD4 A;  1CJW A;  2WPX A;  2Q4Y A;  1XMT A;  1LRZ A;  1KZF A;  2QEC A;  3ZZI A;  2R7H A;  4OAE A;  4H89 A;  4CRZ B;  4II9 A;  2GIV A;  3R9E A;  4AVB A;  3C26 A;  4JD6 A;  3EC4 A;  4KOT A;  4YRH A;  4NSQ A;  5GCN A;  3MGD A;  3V8I A;  3TO6 A;  2PC1 A;  1XE4 A;  1IYL A;  4CRY B;  3S6G A;  1S7K A;  2VXK A;  2VZZ A;  4KUA A;  2AE6 A;  1S60 A;  2FXF A;  1QST A;  3S6H A;  4ORF A;  4KOX A;  2G3A A;  1P4N A;  4LUA A;  1WK4 A;  2Z0Z A;  4AG9 A;  2QML A;  4PK2 A;  2HUZ A;  4X5K A;  2R1I A;  1Z4E A;  1I1D A;  2REF A;  3S6F A;  1FY7 A;  2D4P A;  2P6E A;  3FB3 A;  3EXN A;  2EUI A;  3TCV A;  1XF8 A;  3NE7 A;  2OZU A;  4H6U A;  2R8V A;  4J3G A;  4FD6 A;  5JPH A;  1N71 A;  4CAX A;  2B4D B;  2RC4 A;  3R96 A;  2B3U A;  3FRM A;  2OZH A;  4KOR A;  2OU2 A;  3DR6 A;  1KUV A;  1Q2C A;  1M1D A;  1YLE A;  4GS4 A;  3FBU A;  4B5P B;  4FD5 A;  4B5P A;  2JDC A;  4IUS A;  4F6A A;  2GAN A;  2H5M A;  3GY9 A;  4QC6 A;  3DSB A;  3R9G A;  3W6S A;  3PGP A;  1K4J A;  2FE7 A;  1WWZ A;  2J8R A;  4L89 A;  4E8O A;  2ARH A;  4CAV A;  1TIQ A;  4XNH B;  2K5T A;  2FCK A;  4CS0 B;  2WPW A;  1VHS A;  3P2F A;  2OH1 A;  1S5K A;  2ZPA A;  3R95 A;  5IB0 A;  2DXQ A;  4I49 A;  3TO9 A;  1IB1 E;  3G3S A;  4XNH C;  1QSM A;  4KVO E;  3TOB A;  5CNP A;  5FVJ A;  1SQH A;  3WR7 A;  2ZXV A;  4EVY A;  4KOS A;  2I79 A;  4XPD B;  4R57 A;  1UFH A;  4UWJ A;  1I12 A;  5DWN A;  1V0C A;  2QIR A;  3BLN A;  4Y49 B;  1PU9 A;  2ZW5 A;  3RYO A;  2G3T A;  1Y7R A;  2FIA A;  4XPD C;  2ZW6 A;  2J8M A;  3W91 A;  3VWD A;  4Y49 C;  5H84 A;  1IID A;  1XIX A;  3GYA A;  4CAW A;  1RXT A;  3E0K A;  3LD2 A;  3K9U A;  2CNT A;  2I00 A;  5I0C A;  3D8P A;  4XPK A;  4R3L A;  4RS2 A;  2JEV A;  4E2A A;  2KCW A;  3IWG A;  4QBJ A;  1MJ9 A;  2PRB A;  1J4J A;  2R98 A;  1BOB A;  3R1K A;  1P0H A;  4LX9 A;  4FD7 A;  2A4N A;  4JXR A;  3SXN A;  3GKR A;  3SHP A;  1PUA A;  2VBQ A;  1XEB A;  4UWI A;  1S7N A;  4JLY A;  2BSW A;  4NEX A;  1B87 A;  2BL1 A;  4UA3 A;  4HNW B;  1ON0 A;  2CNM A;  3FIX A;  4QB9 A;  5C88 A;  4ONU A;  4NXY A;  4KVM E;  1YVK A;  4PSW A;  2Z11 A;  3R9F A;  3IGR A;  2D4O A;  4K30 A;  5EBV A;  2Q0Y A;  4JJX A;  5KTD A;  1CM0 A;  3I3G A;  3CXS A;  2NMT A;  3F5B A;  2B4D A;  2PSW A;  1B6B A;  4PSX A;  3SXO A;  4NF1 A;  2FS5 A;  3BJ7 A;  4OLL A;  4YFJ A;  2AJ6 A;  3TFY A;  1YVO A;  2ZW7 A;  3T9Y A;  5DWM A;  3EY5 A;  2JDD A;  2P6G A;  4KOY A;  4IF5 A;  1OZP A;  4BMH A;  2Q44 A;  2Y0M A;  3T90 A;  2BEI A;  4R87 A;  1M4G A;  4QUS A;  2C27 A;  3PZJ A;  3UY5 A;  3PP9 A;  4PK3 A;  4UBR A;  4AVA A;  4KZT A;  2B3V A;  3I9S A;  4NCZ A;  1KUY A;  4R9M A;  4R3K A;  1IYK A;  2VZY A;  4L8A A;  5EC4 A;  1IIC A;  3S6K A;  1YGH A;  4AVC A;  3QAH A;  4E0A A;  3LOD A;  1NMT A;  4ZBG A;  1NE9 A;  2B5G B;  4HNX B;  3ZJ0 A;  4F0Y A;  3B8G A;  1MJA A;  1S7L A;  1Z4R A;  2B5G A;  5JQ4 A;  1MJB A;  4B5O A;  3BJ8 A;  3EFA A;  3DR8 A;  4KUB A;  4JXQ A;  2P6F A; 
#chains in the Genus database with same CATH topology
 4MJ8 A;  4P4F A;  1I21 A;  3QAY A;  2EVN A;  4B11 A;  4IHM A;  2CF4 A;  5HVF A;  4CYP A;  3TT2 A;  4OME A;  3VWE A;  3OWC A;  4KOV A;  4OC4 A;  4Q7A A;  1ZLI A;  2Z3L A;  4MY0 A;  2YNE A;  4QVT A;  5C82 A;  1QSN A;  4F9U A;  3TTH A;  5A28 A;  4AG7 A;  1TKF A;  2X7B A;  3TO7 A;  2Q04 A;  5EMI A;  2AFX A;  2FL4 A;  3FNC A;  5H86 A;  2GRE A;  3RNZ A;  1CPS A;  1YX0 A;  3WAB A;  3KL9 A;  2PJ7 A;  1FNO A;  3CXQ A;  5J8C A;  4BD9 A;  5JM6 A;  1M4I A;  1JWQ A;  3B35 A;  4X2T A;  2FT0 A;  3D3S A;  1CX8 A;  4H6Z A;  1IOF A;  2BOA A;  3EO4 A;  4A94 A;  1M44 A;  2F8H A;  3CDX A;  4OC5 A;  4RN7 A;  4Z65 A;  3H8E A;  1NSL A;  1Y9W A;  3D2P A;  5I4M A;  3IU2 A;  2AFZ A;  3BI1 A;  5JH9 A;  4PV6 A;  2OB0 A;  3WT4 A;  3H4Q A;  2WSA A;  4KVX A;  5ISV A;  3H5Z A;  2CNS A;  4P4B A;  3QB8 A;  2REE A;  3IWW A;  4OC0 A;  5J8F A;  3PB9 X;  3FYN A;  3JVN A;  2XEI A;  4CAE A;  3LWU A;  5IX3 A;  1Z8L A;  2ZEN A;  2GLF A;  1BO4 A;  2ATR A;  2YNC A;  5G20 A;  4NGP A;  4HKF A;  5THW A;  5IV0 A;  1GHE A;  1Q7L A;  1ZO0 A;  4MHZ A;  2HV2 A;  2PJ8 A;  5HMN A;  4KOW A;  3FED A;  4OAD A;  4KSI A;  1YR0 A;  1Y9K A;  1S3Z A;  2BUE A;  1QQ9 A;  1MK4 A;  2FIW A;  2B58 A;  2YNC C;  5LYI A;  2PR8 A;  3P2H A;  2PIZ A;  3T8W A;  1Q2D A;  5HH1 A;  3FVL A;  2ZED A;  2O4H A;  1Y0Y A;  4KLV A;  4AB7 A;  4M3S A;  3DNS A;  3B3T A;  2GE3 A;  2ZW4 A;  2RFH A;  2HB6 A;  5F47 A;  4C2X A;  2PVW A;  3DDD A;  4RI1 A;  4MCQ A;  1M4D A;  4U9Z A;  5F46 A;  4KLW A;  3KQX A;  3K9T A;  1BPM A;  2P0W A;  3IU1 A;  4P4D A;  1DE4 C;  3KKW A;  1Z5R A;  1ELM P;  4PXD A;  1OBR A;  2EWB A;  4MFQ A;  1YLO A;  2OZG A;  2ZEH A;  4U5Y A;  4KOU A;  2F5I A;  1ARM A;  3TE4 A;  2VEZ A;  1XRY A;  1RO5 A;  1TXR A;  2Z3N A;  2IL4 A;  3FJU A;  3G8W A;  3PFO A;  4U9Y A;  4YU9 A;  4CYO A;  4M85 A;  4XPL A;  2DEA A;  4MBU A;  3K2K A;  2IMO A;  1XBU A;  1VKC A;  1YK3 A;  2XEF A;  4A30 A;  4R8F A;  3SI2 A;  3PRT A;  5E96 A;  3DLJ A;  1R57 A;  2PR1 A;  2VL1 A;  2PQ8 A;  4DNC A;  1VHE A;  2AFU A;  2C6G A;  3FXT A;  2G0B A;  3SJG A;  3MRU A;  4MXU A;  3W6X A;  2PDO A;  4MHD A;  2VQY A;  3GLJ A;  4M6I A;  1CBX A;  4CYN A;  1Z9U A;  3GB0 A;  3V38 A;  1IOI A;  2WZN A;  4PXB A;  1NSA A;  1QSR A;  1TKJ A;  2Q7S A;  2PJ6 A;  4MY3 A;  2Q7B A;  2F7V A;  4HNY B;  5F49 A;  4PXC A;  3KI9 A;  3GUX A;  1L0C A;  2JLM A;  1Y7E A;  3CXP A;  4W9Y A;  1Q2Y A;  1YRE A;  1S7F A;  1ZG8 A;  4NGM A;  4CYQ A;  2B4B A;  2Q4V A;  4B14 A;  2J8N A;  2Z10 A;  3D2M A;  3NFZ A;  3I1U A;  2HQY A;  3N7Z A;  3TOA A;  2FSR A;  4IK2 A;  3F0A A;  4IAV A;  3B3W A;  5AG4 A;  3ISX A;  1KUX A;  3SJX A;  2O28 A;  3NH4 A;  4B13 A;  3N5F A;  4FUU A;  1U6M A;  4UF4 A;  4JWP A;  5JGF A;  2VI7 A;  3JUW A;  1XJO A;  5KTA A;  2V8V A;  4X3R A;  2EK9 A;  2OOT A;  1LAM A;  2PJ0 A;  4MI4 A;  2CY2 A;  5F48 A;  4YGO A;  3F8K A;  2NSM A;  3D7D A;  2ANP A;  2PCU A;  5KTC A;  3S9L A;  3S9N A;  5CPA A;  1QSO A;  1IY7 A;  5DS0 A;  4FD4 A;  1CJW A;  2WPX A;  4KSA A;  4JYW A;  4B12 A;  2Q4Y A;  5D8N A;  4M6H A;  1XMT A;  3VAT A;  2PJ2 A;  1LRZ A;  1KZF A;  2CXA A;  2QEC A;  2R7H A;  2ZEG A;  3ZZI A;  4NGR A;  4OAE A;  4H89 A;  4ZY0 A;  1DTD A;  4CRZ B;  4II9 A;  2GIV A;  3R9E A;  2O53 A;  5LRJ A;  3D68 A;  1YW4 A;  8CPA A;  4AVB A;  3C26 A;  4JD6 A;  1YQE A;  4MCS A;  2EBJ A;  3EC4 A;  3IO1 A;  4KOT A;  5K8N A;  4YRH A;  1QMU A;  5LRK A;  2ZEE A;  2G9D A;  4NSQ A;  4NGS A;  2AFS A;  5G1Z A;  4C68 A;  3S9M A;  5GCN A;  3MGD A;  3V8I A;  3FMC A;  2CTC A;  2PRQ A;  4OC1 A;  3TO6 A;  2Q51 A;  2PC1 A;  1XE4 A;  2V8H A;  1IYL A;  3B3C A;  3PEI A;  3SJF A;  4WJB A;  4TNU A;  4CRY B;  4MCP A;  4C2Y A;  2YND A;  3S6G A;  3IC1 A;  1S7K A;  2VXK A;  1HDQ A;  2VZZ A;  4KUA A;  1KWM A;  2AE6 A;  4A33 A;  1S60 A;  3CZX A;  2PJ4 A;  3HUV A;  2FXF A;  2JBJ A;  1QST A;  4C7I A;  3H8F A;  2PJ3 A;  3S6H A;  4BIN A;  4ORF A;  2V8G A;  2EO8 A;  1CP7 A;  4KOX A;  1RTQ A;  3VH9 A;  2G3A A;  2ZEM A;  1P4N A;  4LUA A;  1WK4 A;  2Z0Z A;  4AG9 A;  4A39 A;  4CAF A;  4K3N A;  1LFW A;  3KHZ A;  5G21 A;  1AMP A;  2QML A;  4PK2 A;  1CG2 A;  2HUZ A;  5LYF A;  4X5K A;  2R1I A;  1Z8T A;  4YWY A;  4ZGY B;  5A27 A;  1Z4E A;  2PE3 A;  2QYV A;  5AGE A;  1I1D A;  2PJB A;  1X12 A;  2WYR A;  4GM5 A;  2REF A;  3RAM A;  4MMO A;  4NFR A;  3S6F A;  7CPA A;  1FY7 A;  2D4P A;  2P6E A;  3H8G A;  3FB3 A;  3EXN A;  2AFO A;  4P10 A;  2EK8 A;  2EUI A;  4NJQ A;  3TCV A;  4MHP A;  1XF8 A;  3NE7 A;  2OZU A;  3NH5 A;  4H6U A;  2R8V A;  5LYL A;  4H2K A;  1PYT B;  1TKH A;  3JTK A;  4J3G A;  1R3N A;  4FD6 A;  4R7M A;  5JPH A;  1N71 A;  3WC5 A;  4CAX A;  2B4D B;  3KR5 A;  5CBM A;  2RC4 A;  3IIB A;  2ZEP A;  3D4U A;  2B3U A;  3FRM A;  3R96 A;  4OC2 A;  3D7G A;  2YGW A;  2IQ6 A;  2OZH A;  4KOR A;  5D29 A;  2OU2 A;  3DR6 A;  5BWA B;  1KUV A;  1Q2C A;  1M1D A;  4NGN A;  1YLE A;  1YW6 A;  2PJA A;  3B2Y A;  4GS4 A;  2DF5 A;  3ISZ A;  3CT9 A;  3NA6 A;  4MRI A;  5ELY A;  4F9V A;  3FBU A;  3RZA A;  4B5P B;  4FD5 A;  2ZEL A;  4X8I A;  5AG6 A;  4F8Z A;  4MFL A;  4B5P A;  1F57 A;  2JDC A;  4IUS A;  4OID A;  4ZY2 A;  4TWE A;  4Q36 A;  2GU2 A;  2GAN A;  2H5M A;  4F6A A;  3GY9 A;  4OC3 A;  4QC6 A;  3DSB A;  3R9G A;  3W6S A;  4AXV A;  4LQ6 A;  3PGP A;  2PIY A;  1K4J A;  2FE7 A;  1ELL P;  1WWZ A;  2J8R A;  3LMS A;  4L89 A;  4ZX8 A;  3V7Z A;  4E8O A;  2ARH A;  4CAV A;  3CPX A;  3TC8 A;  1TIQ A;  4PXE A;  1VGY A;  2HC9 A;  4XNH B;  1YME A;  2K5T A;  2FCK A;  2ZOF A;  3D66 A;  5AG7 A;  4CGO A;  1HEE A;  4CS0 B;  2WPW A;  1F2P A;  1VHS A;  2ZEF A;  3P2F A;  4C2Z A;  1ZG7 A;  2OH1 A;  1S5K A;  2OR4 A;  2ZPA A;  3JRU A;  2DXQ A;  3R95 A;  1Y0R A;  5IB0 A;  2C1C A;  4I49 A;  3TO9 A;  1M4L A;  4O23 A;  3SJE A;  1IB1 E;  4PQA A;  4OIW A;  3BXM A;  4P6Y A;  3G3S A;  1TF9 A;  1QSM A;  4XNH C;  4KVO E;  3CPA A;  4A38 A;  2PJ1 A;  2WUU A;  5F09 A;  3A9L A;  3IEH A;  3KHX A;  3TOB A;  5CNP A;  5FVJ A;  2AFW A;  5LYD A;  2J9A A;  1SQH A;  3SI0 A;  3WR7 A;  4BBH A;  4DYO A;  4FAI A;  2ZXV A;  4EVY A;  4DJL A;  4KOS A;  2I79 A;  4CGL A;  4PPZ A;  4XPD B;  4R57 A;  4FBE A;  1UFH A;  3NH8 A;  4NJR A;  4UWJ A;  2CTB A;  3FEE A;  4UEZ A;  4EME A;  1BAV A;  4RUH A;  1I12 A;  1Z2L A;  1V0C A;  2QIR A;  2V8D A;  3BLN A;  4Y49 B;  5DWN A;  4CGM A;  1ZG9 A;  4NGT A;  4EFD A;  4UFX A;  3GIU A;  3RBU A;  1PU9 A;  2ZW5 A;  2PJ9 A;  3RYO A;  2G3T A;  1Y7R A;  2FIA A;  1F2O A;  4XPD C;  2JEW A;  3PB4 X;  2ABZ A;  3BHX A;  2GFQ A;  2ZW6 A;  1IGB A;  2J8M A;  3W91 A;  1XOV A;  3VWD A;  4Y49 C;  3HLP A;  5H84 A;  1IID A;  4M6G A;  2ODF A;  2AFM A;  1XIX A;  2PJC A;  3GYA A;  4CAW A;  1RXT A;  3E0K A;  3LD2 A;  3K9U A;  2CNT A;  2I00 A;  2V77 A;  5I0C A;  1YSJ A;  1H8L A;  3D8P A;  4XPK A;  4GXH A;  4P44 A;  4R3L A;  2ZEO A;  4P45 A;  4R6T A;  4RS2 A;  5J1Q A;  3FH4 A;  1LAP A;  2JEV A;  3IFE A;  4CGP A;  1R43 A;  4E2A A;  2KCW A;  3IWG A;  4C7H A;  4QBJ A;  1MJ9 A;  4MHY A;  3PB6 X;  3RO0 A;  2PRB A;  1J4J A;  2QJ8 A;  2R98 A;  3PB8 X;  4G1P A;  4F0X A;  1BOB A;  1JQG A;  3R1K A;  1P0H A;  4LX9 A;  4FD7 A;  2A4N A;  4P4E A;  4JXR A;  3SXN A;  3GKR A;  3SHP A;  1PUA A;  2VBQ A;  2C6C A;  2XEJ A;  5AG5 A;  1XEB A;  3L2N A;  1S7N A;  1TF8 A;  4UWI A;  4JLY A;  2BSW A;  4NEX A;  2C6P A;  3D7F A;  1B87 A;  2BL1 A;  3FX6 A;  4HNW B;  4UA3 A;  5IB9 A;  1ON0 A;  2CNM A;  3WC6 A;  3FIX A;  4HPS A;  2ZOG A;  3B7I A;  3D7H A;  4QB9 A;  4P4J A;  5C88 A;  3KAS A;  4ONU A;  2IJZ A;  4KVM E;  1YVK A;  4NXY A;  4PSW A;  2Z11 A;  3R9F A;  3IGR A;  2PJ5 A;  3IJ3 A;  2D4O A;  2Q4Z A;  4WWV A;  3BI0 A;  3WC7 A;  4K30 A;  5EBV A;  2Q0Y A;  4JJX A;  5KTD A;  2DPT A;  1A2Z A;  1CM0 A;  3KR4 A;  4ZY1 A;  1CPX A;  4UIA A;  4UIB A;  3I3G A;  2BO9 A;  3CXS A;  3PBB A;  2CIJ A;  2NMT A;  3F5B A;  2POK A;  2B4D A;  2JBK A;  1B6B A;  2PSW A;  2Z3M A;  4PSX A;  3SXO A;  4B10 A;  4UCM A;  4UCN A;  4CPA A;  3B3V A;  2DPS A;  4LQG A;  4NF1 A;  2FS5 A;  3BJ7 A;  1FT7 A;  4OLL A;  3NE8 A;  2BCO A;  4MCR A;  4YFJ A;  2AJ6 A;  3TFY A;  1YVO A;  5G22 A;  2ZW7 A;  3T9Y A;  2XEG A;  5DWM A;  3EY5 A;  1XMB A;  2JDD A;  3DGV A;  4KS9 A;  4MFK A;  3QNV A;  1AYE A;  2P6G A;  4KOY A;  3FEC A;  4IF5 A;  1OZP A;  1ARL A;  3B3S A;  2Q44 A;  4BMH A;  4DUK A;  2RB7 A;  3D67 A;  4ZI6 A;  5HVH A;  1HDU A;  2Y0M A;  4R76 A;  3PBE A;  4A37 A;  2Z3O A;  3FF3 A;  3T90 A;  2BEI A;  3MN8 A;  4UFW A;  4R87 A;  4UCP A;  1M4G A;  4QUS A;  4B6Z A;  6CPA A;  1X10 A;  2C27 A;  3PZJ A;  3SI1 A;  3UY5 A;  3PP9 A;  1BPN A;  4PK3 A;  5K8O A;  4UBR A;  1PCA A;  2Z3K A;  4ZYQ A;  4P4I A;  3KZW A;  4AVA A;  4KZT A;  3PB7 X;  3LAC A;  2B3V A;  3I9S A;  2FVG A;  4NCZ A;  4MFJ A;  4JZ0 A;  3KQZ A;  3TX8 A;  1IU8 A;  1ZLH A;  4A31 A;  2Z3P A;  4Q38 A;  1AUG A;  5HXD A;  2NYQ A;  4OP4 A;  1KUY A;  5K8M A;  1Z8W A;  4R9M A;  4R3K A;  1IYK A;  5K8P A;  2GLJ A;  2PVV A;  2VZY A;  4L8A A;  5EC4 A;  1IIC A;  4EWT A;  3S6K A;  1YGH A;  4MHN A;  4AVC A;  1VHO A;  5HVG A;  3QAH A;  4E0A A;  1GYT A;  3LOD A;  1LAN A;  4UEE A;  4NGQ A;  1LOK A;  1NMT A;  4UFV A;  4ZBG A;  1LCP A;  1NE9 A;  4ZX9 A;  3VAR A;  1VIX A;  1EE3 P;  2B5G B;  4HNX B;  4KSF A;  3ZJ0 A;  4F0Y A;  1XFO A;  1UWY A;  3B8G A;  1MJA A;  1S7L A;  1Z4R A;  3PFE A;  2B5G A;  2Q43 A;  5LRG A;  5JQ4 A;  3KGQ A;  4OKO A;  2QVP A;  4MFZ A;  1MJB A;  4MFP A;  3BJ8 A;  3EFA A;  3IWE A;  4A2Z A;  1BLL E;  3DR8 A;  4KUB A;  4B5O A;  4A32 A;  4CGN A;  1Z8X A;  4ONW A;  1CP6 A;  4UEF A;  4FWU A;  4A95 A;  4JXQ A;  2P6F A;  2I3C A; 
#chains in the Genus database with same CATH homology
 4MJ8 A;  1I21 A;  2EVN A;  4B11 A;  4CYP A;  3TT2 A;  3VWE A;  3OWC A;  4KOV A;  4QVT A;  2Z3L A;  4MY0 A;  2YNE A;  5C82 A;  1QSN A;  3TTH A;  5A28 A;  4AG7 A;  2X7B A;  3TO7 A;  2Q04 A;  2FL4 A;  3FNC A;  5H86 A;  1YX0 A;  3CXQ A;  5J8C A;  1M4I A;  2FT0 A;  3D3S A;  4H6Z A;  3EO4 A;  1M44 A;  1NSL A;  1Y9W A;  3D2P A;  3IU2 A;  4PV6 A;  2OB0 A;  3H4Q A;  2WSA A;  4KVX A;  5ISV A;  3H5Z A;  2CNS A;  3QB8 A;  2REE A;  5J8F A;  3FYN A;  3JVN A;  4CAE A;  1BO4 A;  2ATR A;  2YNC A;  5G20 A;  4HKF A;  5IV0 A;  1GHE A;  1ZO0 A;  2HV2 A;  5HMN A;  4KOW A;  4OAD A;  1YR0 A;  1Y9K A;  1S3Z A;  2BUE A;  2FIW A;  1MK4 A;  2YNC C;  2B58 A;  2PR8 A;  3P2H A;  1Q2D A;  5HH1 A;  4KLV A;  4AB7 A;  4M3S A;  3DNS A;  2GE3 A;  2ZW4 A;  5F47 A;  4C2X A;  3DDD A;  4RI1 A;  1M4D A;  4U9Z A;  5F46 A;  4KLW A;  3IU1 A;  2P0W A;  3KKW A;  4MFQ A;  2OZG A;  4U5Y A;  4KOU A;  2F5I A;  3TE4 A;  2VEZ A;  2Z3N A;  1RO5 A;  3G8W A;  4U9Y A;  2IL4 A;  5IX3 A;  4CYO A;  4M85 A;  4XPL A;  4MBU A;  1VKC A;  1YK3 A;  4A30 A;  5E96 A;  1R57 A;  2PR1 A;  2PQ8 A;  4DNC A;  3FXT A;  2G0B A;  3W6X A;  2PDO A;  4MHD A;  2VQY A;  4CYN A;  1Z9U A;  1QSR A;  4MY3 A;  2Q7B A;  4HNY B;  5F49 A;  1L0C A;  2JLM A;  3CXP A;  1Q2Y A;  1YRE A;  1S7F A;  4CYQ A;  2B4B A;  2Q4V A;  4B14 A;  2J8N A;  2Z10 A;  3D2M A;  2HQY A;  3N7Z A;  3TOA A;  2FSR A;  3F0A A;  5AG4 A;  1KUX A;  2O28 A;  4B13 A;  1U6M A;  4JWP A;  2VI7 A;  3JUW A;  5KTA A;  4MI4 A;  2CY2 A;  5F48 A;  4YGO A;  3F8K A;  5KTC A;  1QSO A;  4FD4 A;  1CJW A;  2WPX A;  4KSA A;  4B12 A;  2Q4Y A;  1XMT A;  1LRZ A;  1KZF A;  2CXA A;  2QEC A;  2R7H A;  3ZZI A;  4OAE A;  4H89 A;  4CRZ B;  4II9 A;  2GIV A;  3R9E A;  4AVB A;  3C26 A;  4JD6 A;  3EC4 A;  4KOT A;  4YRH A;  4NSQ A;  5G1Z A;  4C68 A;  5GCN A;  3MGD A;  3V8I A;  3TO6 A;  2PC1 A;  1XE4 A;  1IYL A;  4CRY B;  4C2Y A;  2YND A;  3S6G A;  1S7K A;  2VXK A;  2VZZ A;  4KUA A;  2AE6 A;  4A33 A;  1S60 A;  2FXF A;  1QST A;  4C7I A;  3S6H A;  4ORF A;  4KOX A;  2G3A A;  1P4N A;  4LUA A;  1WK4 A;  2Z0Z A;  4AG9 A;  4CAF A;  5G21 A;  2QML A;  4PK2 A;  2HUZ A;  4X5K A;  2R1I A;  4ZGY B;  5A27 A;  1Z4E A;  5AGE A;  1I1D A;  2REF A;  3S6F A;  1FY7 A;  2D4P A;  2P6E A;  3FB3 A;  3EXN A;  2EUI A;  3TCV A;  1XF8 A;  3NE7 A;  2OZU A;  4H6U A;  2R8V A;  3JTK A;  4J3G A;  4FD6 A;  5JPH A;  1N71 A;  4CAX A;  2B4D B;  2RC4 A;  3R96 A;  2B3U A;  3FRM A;  2YGW A;  2OZH A;  4KOR A;  2OU2 A;  3DR6 A;  5BWA B;  1KUV A;  1Q2C A;  1M1D A;  1YLE A;  4GS4 A;  3FBU A;  4B5P B;  4FD5 A;  5AG6 A;  4MFL A;  4B5P A;  2JDC A;  4IUS A;  4Q36 A;  4F6A A;  2GAN A;  2H5M A;  3GY9 A;  4QC6 A;  3DSB A;  3R9G A;  3W6S A;  3PGP A;  1K4J A;  2FE7 A;  1WWZ A;  2J8R A;  4L89 A;  4E8O A;  2ARH A;  4CAV A;  1TIQ A;  4XNH B;  2K5T A;  5AG7 A;  2FCK A;  4CGO A;  4CS0 B;  2WPW A;  1VHS A;  4C2Z A;  3P2F A;  2OH1 A;  1S5K A;  2ZPA A;  3R95 A;  5IB0 A;  2DXQ A;  4I49 A;  3TO9 A;  1IB1 E;  3G3S A;  4XNH C;  1QSM A;  4KVO E;  2WUU A;  3A9L A;  3TOB A;  5CNP A;  5FVJ A;  4BBH A;  1SQH A;  3WR7 A;  2ZXV A;  4EVY A;  4KOS A;  2I79 A;  4CGL A;  4XPD B;  4R57 A;  1UFH A;  4UWJ A;  1I12 A;  5DWN A;  1V0C A;  2QIR A;  3BLN A;  4Y49 B;  4CGM A;  4UFX A;  1PU9 A;  2ZW5 A;  3RYO A;  2G3T A;  1Y7R A;  2FIA A;  4XPD C;  2ZW6 A;  2J8M A;  3W91 A;  3VWD A;  4Y49 C;  5H84 A;  1IID A;  1XIX A;  3GYA A;  4CAW A;  1RXT A;  3E0K A;  3LD2 A;  3K9U A;  2CNT A;  2I00 A;  5I0C A;  3D8P A;  4XPK A;  4R3L A;  4RS2 A;  4CGP A;  2JEV A;  4E2A A;  2KCW A;  3IWG A;  4C7H A;  4QBJ A;  1MJ9 A;  2PRB A;  1J4J A;  2R98 A;  4F0X A;  1BOB A;  3R1K A;  1P0H A;  4LX9 A;  4FD7 A;  2A4N A;  4JXR A;  3SXN A;  3GKR A;  3SHP A;  1PUA A;  2VBQ A;  5AG5 A;  1XEB A;  4UWI A;  1S7N A;  4JLY A;  2BSW A;  4NEX A;  1B87 A;  2BL1 A;  4UA3 A;  4HNW B;  1ON0 A;  2CNM A;  3FIX A;  4QB9 A;  5C88 A;  4ONU A;  4NXY A;  4KVM E;  1YVK A;  4PSW A;  2Z11 A;  3R9F A;  3IGR A;  2D4O A;  4K30 A;  5EBV A;  2Q0Y A;  4JJX A;  5KTD A;  2DPT A;  1CM0 A;  3I3G A;  3CXS A;  2NMT A;  3F5B A;  2B4D A;  2PSW A;  1B6B A;  2Z3M A;  4PSX A;  3SXO A;  4B10 A;  4UCM A;  4UCN A;  2DPS A;  4NF1 A;  2FS5 A;  3BJ7 A;  4OLL A;  4YFJ A;  2AJ6 A;  3TFY A;  1YVO A;  5G22 A;  2ZW7 A;  3T9Y A;  5DWM A;  3EY5 A;  2JDD A;  4KS9 A;  4MFK A;  2P6G A;  4KOY A;  4IF5 A;  1OZP A;  4BMH A;  2Q44 A;  2Y0M A;  2Z3O A;  3T90 A;  2BEI A;  4UFW A;  4UCP A;  4R87 A;  1M4G A;  4QUS A;  2C27 A;  3PZJ A;  3UY5 A;  3PP9 A;  4PK3 A;  4UBR A;  2Z3K A;  4AVA A;  4KZT A;  2B3V A;  3I9S A;  4NCZ A;  4MFJ A;  4A31 A;  2Z3P A;  4Q38 A;  1KUY A;  4R9M A;  4R3K A;  1IYK A;  2VZY A;  4L8A A;  5EC4 A;  1IIC A;  3S6K A;  1YGH A;  4AVC A;  3QAH A;  4E0A A;  3LOD A;  1NMT A;  4UFV A;  4ZBG A;  1NE9 A;  4KSF A;  2B5G B;  4HNX B;  3ZJ0 A;  4F0Y A;  3B8G A;  1MJA A;  1S7L A;  1Z4R A;  2B5G A;  5JQ4 A;  4MFZ A;  4A2Z A;  1MJB A;  4MFP A;  3BJ8 A;  3EFA A;  3IWE A;  4B5O A;  3DR8 A;  4KUB A;  4A32 A;  4CGN A;  4A95 A;  4JXQ A;  2P6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...