4H89A

The structure of a gcn5-related n-acetyltransferase from kribbella flavida
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
168
Chain Sequence
SPEALQVRDAEDADWPAILPFFREIVSAGETYAYDPELTDEQARSLWMTPSGPQSRTTVAVDADGTVLGSANMYPNRPGPGAHVASASFMVAAAARGRGVGRALCQDMIDWAGREGFRAIQFNAVVETNTVAVKLWQSLGFRVIGTVPEAFHHPTHGYVGLHVMHRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GCN5-related N-acetyltransferase
publication title The Structure of a GCN5-Related N-Acetyltransferase from Kribbella flavida.
rcsb
source organism Kribbella flavida
molecule tags Transferase
total genus 44
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2012-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4h89A00
2RC4A 4NSQA 3TO7A 2VZZA 2FCKA 4QUSA 2J8MA 2I79A 1XF8A 2B4DB 4Y49C 4AVBA 1FY7A 3FRMA 1S60A 4KOVA 2FSRA 4IF5A 3R9EA 4II9A 1XE4A 4E8OA 4OADA 5ISVA 1PU9A 1YK3A 2JDCA 4CAXA 2PDOA 5C88A 1YX0A 5CNPA 1WWZA 4YFJA 1L0CA 1UFHA 2ZW6A 3TOAA 2GANA 3TTHA 2DXQA 4JD6A 2VI7A 3VWEA 4YGOA 3KKWA 4KORA 4AVCA 2VXKA 4UWIA 3D2MA 1M4DA 5IV0A 3F8KA 2Q7BA 4F0YA 4KOTA 3W6XA 4AVAA 3SXNA 2Q4VA 4KVOE 4R3LA 3TFYA 5C82A 4H6ZA 3FYNA 4KUAA 5JPHA 4X5KA 4PK2A 3K9UA 1Z9UA 4NXYA 2HUZA 3TO6A 3DSBA 4R87A 2Z11A 3P2HA 2FXFA 4HNXB 1XIXA 4CAWA 1OZPA 3CXQA 1KUXA 1TIQA 4KVME 4JLYA 2VEZA 3D2PA 1N71A 1YREA 2CY2A 1I21A 2EVNA 4OLLA 1Z4RA 1CJWA 3BJ8A 1NSLA 3DR6A 1P0HA 5F49A 1B87A 4CAVA 1Y9WA 5I0CA 5J8CA 4M3SA 4MY0A 3UY5A 1K4JA 2ZW4A 3S6KA 1QSMA 2Q0YA 3S6FA 3F0AA 4KVXA 3R9FA 5KTAA 2OZUA 4B5PA 4MJ8A 3OWCA 4R9MA 4NF1A 5IX3A 4KLVA 2D4OA 1MJBA 2B3VA 2KCWA 1Y7RA 4GS4A 2G3TA 3CXPA 1NE9A 4H89A 5JQ4A 2PR8A 3B8GA 4PV6A 4NEXA 2ARHA 1P4NA 4BMHA 4JXRA 1IIDA 2OZGA 4E2AA 4JXQA 4KOYA 1RO5A 4PSWA 2B5GB 5DWMA 1NMTA 4RS2A 3TT2A 1U6MA 1Q2DA 4HNYB 4CS0B 1KUYA 1GHEA 2GIVA 4L8AA 1KUVA 2X7BA 4MY3A 1M44A 3EXNA 1IICA 2JDDA 1S3ZA 4UBRA 1XMTA 5J8FA 2J8RA 1I1DA 2OU2A 2B58A 2P6GA 4U5YA 2VQYA 3P2FA 4F6AA 2A4NA 2P6FA 3R95A 5DWNA 2OB0A 2PC1A 1J4JA 4EVYA 2BUEA 3IWGA 2Q44A 4PK3A 4U9ZA 2I00A 4CRZB 2CNSA 2Q04A 1M4GA 4OAEA 3SHPA 3TE4A 3EY5A 3RYOA 3TCVA 4FD4A 5KTCA 2B3UA 3PGPA 2Q4YA 4L89A 2J8NA 4JWPA 4UWJA 2R1IA 4J3GA 3N7ZA 2B4BA 3FIXA 2ZXVA 3LD2A 1QSTA 2EUIA 1Z4EA 4R57A 1Y9KA 4KZTA 2HV2A 4I49A 2QIRA 2PR1A 2P0WA 2D4PA 4QBJA 2C27A 4KOSA 4R3KA 3GKRA 1RXTA 4YRHA 5HH1A 1ON0A 4AG7A 1B6BA 3IGRA 1QSNA 1CM0A 4QVTA 4MHDA 2Z10A 1BO4A 3FB3A 3C26A 4ORFA 3EFAA 2H5MA 4KOWA 4KLWA 4IUSA 2FT0A 5HMNA 3D3SA 3FXTA 4MBUA 5E96A 3FNCA 2CNTA 1Q2YA 4LX9A 4RI1A 1MJ9A 1YLEA 4QB9A 3T90A 2FE7A 4ONUA 3CXSA 3W91A 4B5PB 2FIWA 4H6UA 4B5OA 3R96A 1Q2CA 3EO4A 2R98A 3SXOA 2PSWA 4NCZA 2B4DA 4XPLA 4XPDB 2O28A 4QC6A 1QSOA 3QB8A 2ZW7A 3E0KA 2G0BA 3R9GA 3TOBA 1S7KA 5KTDA 2ZW5A 3GYAA 1SQHA 2QMLA 2F5IA 2REEA 1BOBA 3I9SA 1YR0A 5F48A 4PSXA 1KZFA 1IYLA 2OH1A 2R7HA 3DDDA 4DNCA 3DNSA 3NE7A 2PRBA 3LODA 2FS5A 4XNHB 4FD6A 3ZJ0A 4KUBA 2ZPAA 3V8IA 3G3SA 1YVOA 5EC4A 2VBQA 3PZJA 2JEVA 1QSRA 3BLNA 4LUAA 2WPXA 3F5BA 2JLMA 2BL1A 4XPDC 4HNWB 2WPWA 4KOUA 3FBUA 5H84A 1S7FA 4E0AA 2GE3A 1MK4A 3I3GA 4M85A 2HQYA 4K30A 3GY9A 1R57A 4MI4A 3TO9A 4FD7A 3S6GA 1S7LA 3S6HA 4FD5A 2BEIA 1M4IA 4KOXA 1S7NA 2OZHA 3DR8A 2R8VA 4AG9A 2NMTA 5H86A 3MGDA 2BSWA 3D8PA 1I12A 4U9YA 3BJ7A 3EC4A 3G8WA 4XNHC 4JJXA 5EBVA 1V0CA 2G3AA 1MJAA 3T9YA 3JVNA 4Y49B 2FL4A 1YVKA 3ZZIA 1VKCA 1LRZA 1IB1E 2AJ6A 1M1DA 5F46A 4UA3A 2Y0MA 3WR7A 4ZBGA 2VZYA 5IB0A 1XEBA 2K5TA 2IL4A 2QECA 1PUAA 3PP9A 2B5GA 4XPKA 4HKFA 2FIAA 1YGHA 2CNMA 1IYKA 4CRYB 2AE6A 2PQ8A 3H4QA 3R1KA 2ATRA 2P6EA 2Z0ZA 3JUWA 2REFA 5F47A 1WK4A 3VWDA 3QAHA 1S5KA 5FVJA 3W6SA 5GCNA 4AB7A 1VHSA
chains in the Genus database with same CATH superfamily
2RC4A 4NSQA 4NGRA 3TO7A 2VZZA 4NGNA 2FCKA 4QUSA 2J8MA 3H5ZA 2I79A 1XF8A 2B4DB 4Y49C 3IJ3A 4AVBA 1VGYA 2PRQA 3PFEA 1FY7A 3SJEA 3FRMA 1S60A 4KOVA 4ZGYB 2FSRA 4IF5A 3R9EA 1Z8WA 3PRTA 1XE4A 4E8OA 4II9A 1X10A 1UWYA 4OADA 5LRKA 1PU9A 3NH4A 5ISVA 1YK3A 2JDCA 4CAXA 3PBBA 2PDOA 5C88A 1ZLHA 2JEWA 4MFKA 1YX0A 5CNPA 3JTKA 1EE3P 1WWZA 4OC0A 4YFJA 3FVLA 1L0CA 1UFHA 2ZW6A 4A37A 4PPZA 2Z3MA 3IWWA 3TOAA 5HVHA 2GANA 5K8NA 2ZEPA 5A27A 4A39A 1Y0YA 3GUXA 3TTHA 2DEAA 2PJ1A 2DXQA 4JD6A 2VI7A 3VWEA 3K9TA 5G22A 4YGOA 2BCOA 3KKWA 4KORA 4AVCA 2XEGA 5LYDA 4Z65A 2VXKA 3IO1A 3B3SA 3KI9A 4UWIA 3SI2A 5D8NA 4A95A 3D2MA 1M4DA 5IV0A 3B3TA 2DPTA 4MHZA 3F8KA 2Q7BA 2PE3A 1ELLP 1H8LA 3KHXA 4F0YA 4KOTA 2EBJA 4O23A 4P4DA 4M6HA 3SXNA 3W6XA 4AVAA 5I4MA 1YW6A 1X12A 2Q4VA 4KVOE 1ZLIA 4R3LA 3TFYA 5C82A 3GIUA 5JM6A 4UIBA 4GM5A 3FYNA 3B35A 2JBKA 4H6ZA 4KUAA 6CPAA 4DJLA 4X5KA 2Z3PA 4FAIA 5JPHA 3S9NA 4PK2A 2V8VA 3K9UA 3ISXA 1Z9UA 4NXYA 2HUZA 3TO6A 3DSBA 4R87A 2C6PA 2Z11A 3P2HA 2FXFA 4HNXB 3SJFA 3PB4X 1XIXA 4LQ6A 1FNOA 4CAWA 1R3NA 1OZPA 3CXQA 1KUXA 1TIQA 2POKA 3SI0A 4KVME 4JLYA 2VEZA 3D2PA 1N71A 1YREA 2CY2A 4MFPA 2WYRA 1I21A 2EVNA 2ZEMA 4CYPA 4OLLA 1Z4RA 4MHYA 5K8PA 5AGEA 1CJWA 4MRIA 4R7MA 3HUVA 3BJ8A 1NSLA 3DR6A 4EWTA 1P0HA 5F49A 4UCNA 2ZEHA 2I3CA 4X3RA 4CYNA 1B87A 2DPSA 4CAVA 1TF9A 1Y9WA 5I0CA 4M3SA 1FT7A 4MY0A 3UY5A 5J8CA 1K4JA 2ZW4A 3D68A 3S6KA 5K8OA 1QSMA 1Z8TA 2Q0YA 3S6FA 3F0AA 4KVXA 4C2YA 1Y7EA 4RUHA 3SJXA 4UFXA 1ARMA 3PB6X 3R9FA 5KTAA 4B10A 2OZUA 4B5PA 2PJ8A 4MJ8A 3OWCA 4R9MA 4NF1A 2ZELA 2IQ6A 4KLVA 5IX3A 5HVFA 4FBEA 2D4OA 1MJBA 2B3VA 4P4FA 3RAMA 1IU8A 2AFXA 4A33A 4PXCA 2KCWA 1Y7RA 4GS4A 3DGVA 2CXAA 2G3TA 3CXPA 3PBEA 1NE9A 4H89A 5JQ4A 2PVWA 2Z3OA 2RB7A 1CPSA 2PJ7A 3WC5A 4IHMA 2PR8A 5CPAA 5F09A 1LAPA 4F0XA 3B8GA 1ELMP 4PV6A 1KWMA 4TWEA 4NEXA 2ARHA 2QVPA 2PJBA 4NFRA 3D7HA 1P4NA 4M6GA 4BMHA 3PFOA 4JXRA 1Z8XA 4ZYQA 1AUGA 3NA6A 3IU2A 2QYVA 4NGTA 1IIDA 2OZGA 3FEEA 4E2AA 4JXQA 4KOYA 3RO0A 4CPAA 3RBUA 4DYOA 1RO5A 3GLJA 2Q7SA 4PSWA 2B5GB 4CAEA 4UEFA 1HEEA 2GU2A 5DWMA 1NMTA 2YNEA 2ZEGA 3BHXA 3D66A 3IIBA 4RS2A 3TT2A 3WT4A 2PJ9A 4OP4A 2CTCA 1U6MA 3CPXA 1LANA 2C6CA 1Q2DA 3FECA 2YNCA 4HNYB 4B6ZA 1KUYA 2Z3KA 3PB8X 1GHEA 4CS0B 2GIVA 5LYLA 1YW4A 4L8AA 3PB9X 1KUVA 5JGFA 5K8MA 1ZG8A 2X7BA 4MY3A 2WUUA 1M44A 3EXNA 1IICA 2JDDA 2ZEDA 4H2KA 1S3ZA 4P45A 2F8HA 5EMIA 3WC7A 1GYTA 4AB7A 4UBRA 1XMTA 4MFJA 3IEHA 4IK2A 4UFWA 5J8FA 1VIXA 2J8RA 1I1DA 2NSMA 2B58A 2OU2A 2P6GA 4CAFA 5AG7A 4U5YA 2VQYA 1Z8LA 4P6YA 3P2FA 4C2ZA 4F6AA 1BLLE 1CP6A 2A4NA 2P6FA 3H8GA 1TF8A 3R95A 5DWNA 2OB0A 2PC1A 1J4JA 2BO9A 4NJQA 4Q7AA 4EVYA 4X2TA 1XOVA 4B12A 1IY7A 2Q4ZA 1TKHA 2BUEA 3QAYA 4K3NA 2EK8A 3IWGA 2PJ3A 4MHPA 4MFLA 2Q44A 4PK3A 4U9ZA 2I00A 3LACA 4CRZB 2CNSA 2Q04A 1M4GA 4OAEA 5HXDA 3SHPA 3TE4A 2CTBA 3EY5A 3RYOA 4MFQA 3TCVA 4FD4A 1DTDA 1VHOA 4R76A 2WSAA 5KTCA 3V38A 2GREA 5ELYA 3GB0A 4CGOA 2B3UA 3PGPA 2AFSA 1JWQA 2Q4YA 2GFQA 7CPAA 4L89A 2AFMA 3S9MA 2J8NA 4JWPA 2ZEOA 4UIAA 1XMBA 4GXHA 3KZWA 2AFOA 3D7DA 3CT9A 4UWJA 3KGQA 2R1IA 4CGMA 4A30A 4J3GA 2BOAA 3N7ZA 4KS9A 3IFEA 3KL9A 2B4BA 3FIXA 1Z2LA 4RN7A 2ZXVA 3LD2A 5AG4A 1QSTA 2EUIA 1Z4EA 2EO8A 4R57A 2AFUA 4TNUA 4CGLA 1CG2A 1Y9KA 1BAVA 4F9UA 4KZTA 2HV2A 4UCMA 1AYEA 4I49A 2EK9A 3KR5A 4C2XA 2QIRA 2PR1A 2Z3NA 2P0WA 4CGPA 2ZEFA 4F9VA 2D4PA 4C7HA 4QBJA 4OC5A 2V8HA 1F2PA 4ZY2A 3MN8A 4C68A 2C27A 2GLJA 4KOSA 4OC2A 3GKRA 4R3KA 3TX8A 2PVVA 4UCPA 2AFWA 1RXTA 4YRHA 5HH1A 1ON0A 5DS0A 4AG7A 1B6BA 3IGRA 1QSNA 5THWA 2Q51A 1CM0A 1BPMA 4QVTA 3H8FA 4MHDA 1F2OA 2Z10A 1BO4A 2ZENA 3FB3A 4R8FA 4X8IA 3C26A 4ORFA 4IAVA 3EFAA 2H5MA 4KOWA 4OIWA 4KLWA 4IUSA 5LRGA 2FT0A 5LRJA 3B3VA 5HMNA 3D3SA 2XEJA 3FXTA 5G1ZA 1CBXA 5HVGA 2WZNA 1XRYA 4MCQA 4MBUA 1BPNA 5E96A 3FNCA 2HC9A 4WJBA 2CNTA 1Q2YA 2V8DA 4UEEA 4B13A 3VARA 4LX9A 4RI1A 1HDUA 1MJ9A 1YLEA 2ABZA 2PJCA 5AG6A 4QB9A 2ZEEA 3B3CA 3T90A 2FE7A 4ONUA 1XFOA 3KR4A 3HLPA 4ONWA 3CXSA 4A32A 3W91A 3MRUA 4B5PB 3FX6A 5G21A 2FIWA 1Z5RA 4AXVA 4H6UA 4NGPA 4B5OA 5J1QA 2CIJA 3NFZA 3D7FA 1IOIA 2PCUA 4UFVA 3R96A 2C1CA 4KSIA 1Q2CA 2PIZA 1Q7LA 3EO4A 4ZX9A 2R98A 3SXOA 2PSWA 4MCRA 2ODFA 4NCZA 2B4DA 2XEFA 4OC1A 1YLOA 4PXEA 4YU9A 4XPLA 4BINA 1ZO0A 1A2ZA 1CPXA 2HB6A 4XPDB 4B11A 2O28A 1LOKA 4EFDA 4QC6A 1QMUA 1OBRA 1QSOA 1TKJA 4YWYA 3QB8A 1XBUA 2ZW7A 3E0KA 4OC3A 1LAMA 2NYQA 4A31A 2G0BA 3R9GA 3TOBA 1S7KA 2V77A 5KTDA 1Y0RA 4KSAA 1NSAA 2ZW5A 3GYAA 4A94A 4MMOA 4ZY1A 4P10A 3KASA 1SQHA 3D7GA 2QMLA 4MXUA 4ZX8A 3A9LA 2F5IA 2REEA 4ZI6A 4PQAA 4ZY0A 1BOBA 3I9SA 4Q36A 4BD9A 1YR0A 2PJAA 1IOFA 2CF4A 3JRUA 5F48A 1ARLA 4P4EA 2YGWA 1TXRA 2IJZA 4PSXA 3IWEA 1KZFA 5G20A 1IYLA 1HDQA 2OH1A 4W9YA 8CPAA 2R7HA 2FVGA 3DDDA 2F7VA 4DNCA 2YNDA 3CDXA 3DNSA 3NE7A 2PRBA 3FF3A 3LODA 2FS5A 4XNHB 4PXDA 4FD6A 3ZJ0A 4KUBA 2EWBA 1M4LA 2IMOA 1YQEA 2ZPAA 3V8IA 3G3SA 1YVOA 3LMSA 2VBQA 3FJUA 3FEDA 4MCSA 3PZJA 5EC4A 5JH9A 2OR4A 2ZOGA 2AFZA 2JEVA 3SI1A 1QSRA 2RFHA 3BLNA 4MHNA 2VL1A 2PJ0A 4LUAA 4Q38A 4R6TA 3KQXA 3WC6A 4NGSA 2WPXA 3VH9A 3F5BA 4P4JA 2JLMA 2BL1A 4XPDC 4HNWB 3TC8A 4PXBA 2WPWA 4KOUA 2G9DA 3FBUA 5H84A 5BWAB 1S7FA 4CYQA 4E0AA 3KQZA 4KSFA 2GE3A 3RZAA 1MK4A 2DF5A 3I3GA 4M6IA 3S9LA 4M85A 2HQYA 3D67A 2OOTA 5A28A 3NH8A 4K30A 3GY9A 4JYWA 4CYOA 4DUKA 1R57A 4MI4A 4P4IA 2ANPA 3TO9A 4FD7A 3S6GA 1S7LA 2J9AA 2JBJA 4FD5A 3S6HA 2BEIA 5IB9A 2PJ5A 2PIYA 5LYFA 3LWUA 1VHEA 4UEZA 1M4IA 3B3WA 4JZ0A 2Z3LA 4KOXA 1R43A 1LFWA 1S7NA 4P4BA 1F57A 2OZHA 3DR8A 1IGBA 1ZG7A 3K2KA 2R8VA 2YNCC 2GLFA 2QJ8A 4AG9A 1AMPA 2PJ2A 2NMTA 3PB7X 4NJRA 3FMCA 3V7ZA 3VATA 1YMEA 5H86A 3MGDA 4F8ZA 2BSWA 4WWVA 1CP7A 1YSJA 2Q43A 3D8PA 4OIDA 1I12A 4U9YA 3CPAA 3B7IA 3BJ7A 3EC4A 3G8WA 4NGQA 3T8WA 1JQGA 4XNHC 4P44A 3BI0A 4JJXA 3SJGA 5EBVA 4NGMA 3DLJA 4FUUA 4OC4A 1V0CA 2G3AA 1MJAA 4OMEA 3T9YA 4BBHA 1CX8A 3JVNA 4Y49B 3KHZA 2O53A 2FL4A 3CZXA 3IC1A 3WABA 1YVKA 5LYIA 3ZZIA 1VKCA 3H8EA 1XJOA 4CGNA 1LRZA 1IB1E 2AJ6A 3RNZA 1M1DA 1DE4C 4C7IA 5F46A 4UA3A 2Y0MA 3B2YA 4LQGA 3WR7A 4ZBGA 1QQ9A 1LCPA 2VZYA 4A38A 5IB0A 1XEBA 3IU1A 1PCAA 2K5TA 2IL4A 2QECA 4A2ZA 1PUAA 3ISZA 3PP9A 2B5GA 5CBMA 4HPSA 1PYTB 2PJ6A 3BI1A 2PJ4A 2C6GA 2FIAA 4HKFA 4MFZA 4OKOA 4XPKA 5D29A 5AG5A 4FWUA 1YGHA 2CNMA 2O4HA 1IYKA 4G1PA 4MCPA 4CRYB 2AE6A 3BXMA 4UF4A 2PQ8A 3H4QA 3R1KA 2ATRA 3N5FA 3L2NA 4B14A 2P6EA 2Z0ZA 3JUWA 2REFA 3NH5A 5F47A 3I1UA 3FH4A 1WK4A 3PEIA 3VWDA 3QAHA 1S5KA 1ZG9A 3NE8A 3QNVA 4EMEA 5FVJA 2V8GA 3W6SA 2ZOFA 1TKFA 3D4UA 1RTQA 5GCNA 1VHSA 2XEIA
chains in the Genus database with same CATH topology
2RC4A 4NSQA 3TO7A 2VZZA 2FCKA 4QUSA 2J8MA 3H5ZA 2I79A 1XF8A 2B4DB 4Y49C 4AVBA 1FY7A 3FRMA 1S60A 4KOVA 4ZGYB 2FSRA 4IF5A 3R9EA 4II9A 1XE4A 4E8OA 4OADA 5ISVA 1PU9A 1YK3A 2JDCA 4CAXA 2PDOA 5C88A 4MFKA 1YX0A 5CNPA 3JTKA 1WWZA 4YFJA 1L0CA 1UFHA 2ZW6A 2Z3MA 3TOAA 2GANA 5A27A 3TTHA 2DXQA 4JD6A 2VI7A 3VWEA 5G22A 4YGOA 3KKWA 4KORA 4AVCA 2VXKA 4UWIA 4A95A 3D2MA 1M4DA 5IV0A 2DPTA 3F8KA 2Q7BA 4F0YA 4KOTA 3W6XA 4AVAA 3SXNA 2Q4VA 4KVOE 4R3LA 3TFYA 5C82A 4H6ZA 3FYNA 4KUAA 5JPHA 4X5KA 2Z3PA 4PK2A 3K9UA 1Z9UA 4NXYA 2HUZA 3TO6A 3DSBA 4R87A 2Z11A 3P2HA 2FXFA 4HNXB 1XIXA 4CAWA 1OZPA 3CXQA 1KUXA 1TIQA 4KVME 4JLYA 2VEZA 3D2PA 1N71A 1YREA 2CY2A 4MFPA 1I21A 2EVNA 4CYPA 4OLLA 1Z4RA 5AGEA 1CJWA 3BJ8A 1NSLA 3DR6A 1P0HA 5F49A 4UCNA 4CYNA 1B87A 2DPSA 4CAVA 1Y9WA 5I0CA 5J8CA 4M3SA 4MY0A 3UY5A 1K4JA 2ZW4A 3S6KA 1QSMA 2Q0YA 3S6FA 3F0AA 4KVXA 4C2YA 4UFXA 3R9FA 5KTAA 4B10A 2OZUA 4B5PA 4MJ8A 3OWCA 4R9MA 4NF1A 5IX3A 4KLVA 2D4OA 1MJBA 2B3VA 4A33A 2KCWA 1Y7RA 4GS4A 2CXAA 2G3TA 3CXPA 1NE9A 4H89A 5JQ4A 2Z3OA 2PR8A 4F0XA 3B8GA 4PV6A 4NEXA 2ARHA 1P4NA 4BMHA 4JXRA 3IU2A 1IIDA 2OZGA 4E2AA 4JXQA 4KOYA 1RO5A 4PSWA 2B5GB 4CAEA 5DWMA 1NMTA 2YNEA 4RS2A 3TT2A 1U6MA 1Q2DA 2YNCA 4HNYB 4CS0B 1KUYA 2Z3KA 1GHEA 2GIVA 4L8AA 1KUVA 2X7BA 4MY3A 2WUUA 1M44A 3EXNA 1IICA 2JDDA 1S3ZA 4UBRA 1XMTA 4MFJA 4UFWA 5J8FA 2J8RA 1I1DA 2OU2A 2B58A 2P6GA 4CAFA 5AG7A 4U5YA 2VQYA 4C2ZA 3P2FA 4F6AA 2A4NA 2P6FA 3R95A 5DWNA 2OB0A 2PC1A 1J4JA 4EVYA 4B12A 2BUEA 3IWGA 4MFLA 2Q44A 4PK3A 4U9ZA 2I00A 4CRZB 2CNSA 2Q04A 1M4GA 4OAEA 3SHPA 3TE4A 3EY5A 3RYOA 4MFQA 3TCVA 4FD4A 2WSAA 5KTCA 4CGOA 2B3UA 3PGPA 2Q4YA 4L89A 2J8NA 4JWPA 4UWJA 2R1IA 4CGMA 4A30A 4J3GA 3N7ZA 4KS9A 2B4BA 3FIXA 2ZXVA 3LD2A 5AG4A 1QSTA 2EUIA 1Z4EA 4R57A 4CGLA 1Y9KA 4KZTA 2HV2A 4UCMA 4I49A 4C2XA 2QIRA 2PR1A 2Z3NA 2P0WA 4CGPA 2D4PA 4C7HA 4QBJA 4C68A 2C27A 4KOSA 4R3KA 3GKRA 4UCPA 1RXTA 4YRHA 5HH1A 1ON0A 4AG7A 1B6BA 3IGRA 1QSNA 1CM0A 4QVTA 4MHDA 2Z10A 1BO4A 3FB3A 3C26A 4ORFA 3EFAA 2H5MA 4KOWA 4KLWA 4IUSA 2FT0A 5HMNA 3D3SA 3FXTA 5G1ZA 4MBUA 5E96A 3FNCA 2CNTA 1Q2YA 4B13A 4LX9A 4RI1A 1MJ9A 1YLEA 5AG6A 4QB9A 3T90A 2FE7A 4ONUA 3CXSA 4A32A 3W91A 4B5PB 5G21A 2FIWA 4H6UA 4B5OA 4UFVA 3R96A 1Q2CA 3EO4A 2R98A 3SXOA 2PSWA 4NCZA 2B4DA 4XPLA 1ZO0A 4XPDB 4B11A 2O28A 4QC6A 1QSOA 3QB8A 2ZW7A 3E0KA 4A31A 2G0BA 3R9GA 3TOBA 1S7KA 5KTDA 4KSAA 2ZW5A 3GYAA 1SQHA 2QMLA 3A9LA 2F5IA 2REEA 1BOBA 3I9SA 4Q36A 1YR0A 5F48A 2YGWA 4PSXA 3IWEA 1KZFA 5G20A 1IYLA 2OH1A 2R7HA 3DDDA 4DNCA 2YNDA 3DNSA 3NE7A 2PRBA 3LODA 2FS5A 4XNHB 4FD6A 3ZJ0A 4KUBA 2ZPAA 3V8IA 3G3SA 1YVOA 5EC4A 2VBQA 3PZJA 2JEVA 1QSRA 3BLNA 4LUAA 4Q38A 2WPXA 3F5BA 2JLMA 2BL1A 4XPDC 4HNWB 2WPWA 4KOUA 3FBUA 5H84A 5BWAB 1S7FA 4CYQA 4E0AA 4KSFA 2GE3A 1MK4A 3I3GA 4M85A 2HQYA 5A28A 4K30A 3GY9A 4CYOA 1R57A 4MI4A 3TO9A 4FD7A 3S6GA 1S7LA 3S6HA 4FD5A 2BEIA 1M4IA 2Z3LA 4KOXA 1S7NA 2OZHA 3DR8A 2R8VA 2YNCC 4AG9A 2NMTA 5H86A 3MGDA 2BSWA 3D8PA 1I12A 4U9YA 3BJ7A 3EC4A 3G8WA 4XNHC 4JJXA 5EBVA 1V0CA 2G3AA 1MJAA 3T9YA 4BBHA 3JVNA 4Y49B 2FL4A 1YVKA 3ZZIA 1VKCA 4CGNA 1LRZA 1IB1E 2AJ6A 1M1DA 4C7IA 5F46A 4UA3A 2Y0MA 3WR7A 4ZBGA 2VZYA 5IB0A 1XEBA 3IU1A 2K5TA 2IL4A 2QECA 4A2ZA 1PUAA 3PP9A 2B5GA 4XPKA 4HKFA 2FIAA 4MFZA 5AG5A 1YGHA 2CNMA 1IYKA 4CRYB 2AE6A 2PQ8A 3H4QA 3R1KA 2ATRA 4B14A 2P6EA 2Z0ZA 3JUWA 2REFA 5F47A 1WK4A 3VWDA 3QAHA 1S5KA 5FVJA 3W6SA 5GCNA 4AB7A 1VHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC4 A;  4NSQ A;  3TO7 A;  2VZZ A;  2FCK A;  4QUS A;  2J8M A;  2I79 A;  1XF8 A;  2B4D B;  4Y49 C;  4AVB A;  1FY7 A;  3FRM A;  1S60 A;  4KOV A;  2FSR A;  4IF5 A;  3R9E A;  4II9 A;  1XE4 A;  4E8O A;  4OAD A;  5ISV A;  1PU9 A;  1YK3 A;  2JDC A;  4CAX A;  2PDO A;  5C88 A;  1YX0 A;  5CNP A;  1WWZ A;  4YFJ A;  1L0C A;  1UFH A;  2ZW6 A;  3TOA A;  2GAN A;  3TTH A;  2DXQ A;  4JD6 A;  2VI7 A;  3VWE A;  4YGO A;  3KKW A;  4KOR A;  4AVC A;  2VXK A;  4UWI A;  3D2M A;  1M4D A;  5IV0 A;  3F8K A;  2Q7B A;  4F0Y A;  4KOT A;  3W6X A;  4AVA A;  3SXN A;  2Q4V A;  4KVO E;  4R3L A;  3TFY A;  5C82 A;  4H6Z A;  3FYN A;  4KUA A;  5JPH A;  4X5K A;  4PK2 A;  3K9U A;  1Z9U A;  4NXY A;  2HUZ A;  3TO6 A;  3DSB A;  4R87 A;  2Z11 A;  3P2H A;  2FXF A;  4HNX B;  1XIX A;  4CAW A;  1OZP A;  3CXQ A;  1KUX A;  1TIQ A;  4KVM E;  4JLY A;  2VEZ A;  3D2P A;  1N71 A;  1YRE A;  2CY2 A;  1I21 A;  2EVN A;  4OLL A;  1Z4R A;  1CJW A;  3BJ8 A;  1NSL A;  3DR6 A;  1P0H A;  5F49 A;  1B87 A;  4CAV A;  1Y9W A;  5I0C A;  5J8C A;  4M3S A;  4MY0 A;  3UY5 A;  1K4J A;  2ZW4 A;  3S6K A;  1QSM A;  2Q0Y A;  3S6F A;  3F0A A;  4KVX A;  3R9F A;  5KTA A;  2OZU A;  4B5P A;  4MJ8 A;  3OWC A;  4R9M A;  4NF1 A;  5IX3 A;  4KLV A;  2D4O A;  1MJB A;  2B3V A;  2KCW A;  1Y7R A;  4GS4 A;  2G3T A;  3CXP A;  1NE9 A;  4H89 A;  5JQ4 A;  2PR8 A;  3B8G A;  4PV6 A;  4NEX A;  2ARH A;  1P4N A;  4BMH A;  4JXR A;  1IID A;  2OZG A;  4E2A A;  4JXQ A;  4KOY A;  1RO5 A;  4PSW A;  2B5G B;  5DWM A;  1NMT A;  4RS2 A;  3TT2 A;  1U6M A;  1Q2D A;  4HNY B;  4CS0 B;  1KUY A;  1GHE A;  2GIV A;  4L8A A;  1KUV A;  2X7B A;  4MY3 A;  1M44 A;  3EXN A;  1IIC A;  2JDD A;  1S3Z A;  4UBR A;  1XMT A;  5J8F A;  2J8R A;  1I1D A;  2OU2 A;  2B58 A;  2P6G A;  4U5Y A;  2VQY A;  3P2F A;  4F6A A;  2A4N A;  2P6F A;  3R95 A;  5DWN A;  2OB0 A;  2PC1 A;  1J4J A;  4EVY A;  2BUE A;  3IWG A;  2Q44 A;  4PK3 A;  4U9Z A;  2I00 A;  4CRZ B;  2CNS A;  2Q04 A;  1M4G A;  4OAE A;  3SHP A;  3TE4 A;  3EY5 A;  3RYO A;  3TCV A;  4FD4 A;  5KTC A;  2B3U A;  3PGP A;  2Q4Y A;  4L89 A;  2J8N A;  4JWP A;  4UWJ A;  2R1I A;  4J3G A;  3N7Z A;  2B4B A;  3FIX A;  2ZXV A;  3LD2 A;  1QST A;  2EUI A;  1Z4E A;  4R57 A;  1Y9K A;  4KZT A;  2HV2 A;  4I49 A;  2QIR A;  2PR1 A;  2P0W A;  2D4P A;  4QBJ A;  2C27 A;  4KOS A;  4R3K A;  3GKR A;  1RXT A;  4YRH A;  5HH1 A;  1ON0 A;  4AG7 A;  1B6B A;  3IGR A;  1QSN A;  1CM0 A;  4QVT A;  4MHD A;  2Z10 A;  1BO4 A;  3FB3 A;  3C26 A;  4ORF A;  3EFA A;  2H5M A;  4KOW A;  4KLW A;  4IUS A;  2FT0 A;  5HMN A;  3D3S A;  3FXT A;  4MBU A;  5E96 A;  3FNC A;  2CNT A;  1Q2Y A;  4LX9 A;  4RI1 A;  1MJ9 A;  1YLE A;  4QB9 A;  3T90 A;  2FE7 A;  4ONU A;  3CXS A;  3W91 A;  4B5P B;  2FIW A;  4H6U A;  4B5O A;  3R96 A;  1Q2C A;  3EO4 A;  2R98 A;  3SXO A;  2PSW A;  4NCZ A;  2B4D A;  4XPL A;  4XPD B;  2O28 A;  4QC6 A;  1QSO A;  3QB8 A;  2ZW7 A;  3E0K A;  2G0B A;  3R9G A;  3TOB A;  1S7K A;  5KTD A;  2ZW5 A;  3GYA A;  1SQH A;  2QML A;  2F5I A;  2REE A;  1BOB A;  3I9S A;  1YR0 A;  5F48 A;  4PSX A;  1KZF A;  1IYL A;  2OH1 A;  2R7H A;  3DDD A;  4DNC A;  3DNS A;  3NE7 A;  2PRB A;  3LOD A;  2FS5 A;  4XNH B;  4FD6 A;  3ZJ0 A;  4KUB A;  2ZPA A;  3V8I A;  3G3S A;  1YVO A;  5EC4 A;  2VBQ A;  3PZJ A;  2JEV A;  1QSR A;  3BLN A;  4LUA A;  2WPX A;  3F5B A;  2JLM A;  2BL1 A;  4XPD C;  4HNW B;  2WPW A;  4KOU A;  3FBU A;  5H84 A;  1S7F A;  4E0A A;  2GE3 A;  1MK4 A;  3I3G A;  4M85 A;  2HQY A;  4K30 A;  3GY9 A;  1R57 A;  4MI4 A;  3TO9 A;  4FD7 A;  3S6G A;  1S7L A;  3S6H A;  4FD5 A;  2BEI A;  1M4I A;  4KOX A;  1S7N A;  2OZH A;  3DR8 A;  2R8V A;  4AG9 A;  2NMT A;  5H86 A;  3MGD A;  2BSW A;  3D8P A;  1I12 A;  4U9Y A;  3BJ7 A;  3EC4 A;  3G8W A;  4XNH C;  4JJX A;  5EBV A;  1V0C A;  2G3A A;  1MJA A;  3T9Y A;  3JVN A;  4Y49 B;  2FL4 A;  1YVK A;  3ZZI A;  1VKC A;  1LRZ A;  1IB1 E;  2AJ6 A;  1M1D A;  5F46 A;  4UA3 A;  2Y0M A;  3WR7 A;  4ZBG A;  2VZY A;  5IB0 A;  1XEB A;  2K5T A;  2IL4 A;  2QEC A;  1PUA A;  3PP9 A;  2B5G A;  4XPK A;  4HKF A;  2FIA A;  1YGH A;  2CNM A;  1IYK A;  4CRY B;  2AE6 A;  2PQ8 A;  3H4Q A;  3R1K A;  2ATR A;  2P6E A;  2Z0Z A;  3JUW A;  2REF A;  5F47 A;  1WK4 A;  3VWD A;  3QAH A;  1S5K A;  5FVJ A;  3W6S A;  5GCN A;  4AB7 A;  1VHS A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  4NSQ A;  4NGR A;  3TO7 A;  2VZZ A;  4NGN A;  2FCK A;  4QUS A;  2J8M A;  3H5Z A;  2I79 A;  1XF8 A;  2B4D B;  4Y49 C;  3IJ3 A;  4AVB A;  1VGY A;  2PRQ A;  3PFE A;  1FY7 A;  3SJE A;  3FRM A;  1S60 A;  4KOV A;  4ZGY B;  2FSR A;  4IF5 A;  3R9E A;  1Z8W A;  3PRT A;  1XE4 A;  4E8O A;  4II9 A;  1X10 A;  1UWY A;  4OAD A;  5LRK A;  1PU9 A;  3NH4 A;  5ISV A;  1YK3 A;  2JDC A;  4CAX A;  3PBB A;  2PDO A;  5C88 A;  1ZLH A;  2JEW A;  4MFK A;  1YX0 A;  5CNP A;  3JTK A;  1EE3 P;  1WWZ A;  4OC0 A;  4YFJ A;  3FVL A;  1L0C A;  1UFH A;  2ZW6 A;  4A37 A;  4PPZ A;  2Z3M A;  3IWW A;  3TOA A;  5HVH A;  2GAN A;  5K8N A;  2ZEP A;  5A27 A;  4A39 A;  1Y0Y A;  3GUX A;  3TTH A;  2DEA A;  2PJ1 A;  2DXQ A;  4JD6 A;  2VI7 A;  3VWE A;  3K9T A;  5G22 A;  4YGO A;  2BCO A;  3KKW A;  4KOR A;  4AVC A;  2XEG A;  5LYD A;  4Z65 A;  2VXK A;  3IO1 A;  3B3S A;  3KI9 A;  4UWI A;  3SI2 A;  5D8N A;  4A95 A;  3D2M A;  1M4D A;  5IV0 A;  3B3T A;  2DPT A;  4MHZ A;  3F8K A;  2Q7B A;  2PE3 A;  1ELL P;  1H8L A;  3KHX A;  4F0Y A;  4KOT A;  2EBJ A;  4O23 A;  4P4D A;  4M6H A;  3SXN A;  3W6X A;  4AVA A;  5I4M A;  1YW6 A;  1X12 A;  2Q4V A;  4KVO E;  1ZLI A;  4R3L A;  3TFY A;  5C82 A;  3GIU A;  5JM6 A;  4UIB A;  4GM5 A;  3FYN A;  3B35 A;  2JBK A;  4H6Z A;  4KUA A;  6CPA A;  4DJL A;  4X5K A;  2Z3P A;  4FAI A;  5JPH A;  3S9N A;  4PK2 A;  2V8V A;  3K9U A;  3ISX A;  1Z9U A;  4NXY A;  2HUZ A;  3TO6 A;  3DSB A;  4R87 A;  2C6P A;  2Z11 A;  3P2H A;  2FXF A;  4HNX B;  3SJF A;  3PB4 X;  1XIX A;  4LQ6 A;  1FNO A;  4CAW A;  1R3N A;  1OZP A;  3CXQ A;  1KUX A;  1TIQ A;  2POK A;  3SI0 A;  4KVM E;  4JLY A;  2VEZ A;  3D2P A;  1N71 A;  1YRE A;  2CY2 A;  4MFP A;  2WYR A;  1I21 A;  2EVN A;  2ZEM A;  4CYP A;  4OLL A;  1Z4R A;  4MHY A;  5K8P A;  5AGE A;  1CJW A;  4MRI A;  4R7M A;  3HUV A;  3BJ8 A;  1NSL A;  3DR6 A;  4EWT A;  1P0H A;  5F49 A;  4UCN A;  2ZEH A;  2I3C A;  4X3R A;  4CYN A;  1B87 A;  2DPS A;  4CAV A;  1TF9 A;  1Y9W A;  5I0C A;  4M3S A;  1FT7 A;  4MY0 A;  3UY5 A;  5J8C A;  1K4J A;  2ZW4 A;  3D68 A;  3S6K A;  5K8O A;  1QSM A;  1Z8T A;  2Q0Y A;  3S6F A;  3F0A A;  4KVX A;  4C2Y A;  1Y7E A;  4RUH A;  3SJX A;  4UFX A;  1ARM A;  3PB6 X;  3R9F A;  5KTA A;  4B10 A;  2OZU A;  4B5P A;  2PJ8 A;  4MJ8 A;  3OWC A;  4R9M A;  4NF1 A;  2ZEL A;  2IQ6 A;  4KLV A;  5IX3 A;  5HVF A;  4FBE A;  2D4O A;  1MJB A;  2B3V A;  4P4F A;  3RAM A;  1IU8 A;  2AFX A;  4A33 A;  4PXC A;  2KCW A;  1Y7R A;  4GS4 A;  3DGV A;  2CXA A;  2G3T A;  3CXP A;  3PBE A;  1NE9 A;  4H89 A;  5JQ4 A;  2PVW A;  2Z3O A;  2RB7 A;  1CPS A;  2PJ7 A;  3WC5 A;  4IHM A;  2PR8 A;  5CPA A;  5F09 A;  1LAP A;  4F0X A;  3B8G A;  1ELM P;  4PV6 A;  1KWM A;  4TWE A;  4NEX A;  2ARH A;  2QVP A;  2PJB A;  4NFR A;  3D7H A;  1P4N A;  4M6G A;  4BMH A;  3PFO A;  4JXR A;  1Z8X A;  4ZYQ A;  1AUG A;  3NA6 A;  3IU2 A;  2QYV A;  4NGT A;  1IID A;  2OZG A;  3FEE A;  4E2A A;  4JXQ A;  4KOY A;  3RO0 A;  4CPA A;  3RBU A;  4DYO A;  1RO5 A;  3GLJ A;  2Q7S A;  4PSW A;  2B5G B;  4CAE A;  4UEF A;  1HEE A;  2GU2 A;  5DWM A;  1NMT A;  2YNE A;  2ZEG A;  3BHX A;  3D66 A;  3IIB A;  4RS2 A;  3TT2 A;  3WT4 A;  2PJ9 A;  4OP4 A;  2CTC A;  1U6M A;  3CPX A;  1LAN A;  2C6C A;  1Q2D A;  3FEC A;  2YNC A;  4HNY B;  4B6Z A;  1KUY A;  2Z3K A;  3PB8 X;  1GHE A;  4CS0 B;  2GIV A;  5LYL A;  1YW4 A;  4L8A A;  3PB9 X;  1KUV A;  5JGF A;  5K8M A;  1ZG8 A;  2X7B A;  4MY3 A;  2WUU A;  1M44 A;  3EXN A;  1IIC A;  2JDD A;  2ZED A;  4H2K A;  1S3Z A;  4P45 A;  2F8H A;  5EMI A;  3WC7 A;  1GYT A;  4AB7 A;  4UBR A;  1XMT A;  4MFJ A;  3IEH A;  4IK2 A;  4UFW A;  5J8F A;  1VIX A;  2J8R A;  1I1D A;  2NSM A;  2B58 A;  2OU2 A;  2P6G A;  4CAF A;  5AG7 A;  4U5Y A;  2VQY A;  1Z8L A;  4P6Y A;  3P2F A;  4C2Z A;  4F6A A;  1BLL E;  1CP6 A;  2A4N A;  2P6F A;  3H8G A;  1TF8 A;  3R95 A;  5DWN A;  2OB0 A;  2PC1 A;  1J4J A;  2BO9 A;  4NJQ A;  4Q7A A;  4EVY A;  4X2T A;  1XOV A;  4B12 A;  1IY7 A;  2Q4Z A;  1TKH A;  2BUE A;  3QAY A;  4K3N A;  2EK8 A;  3IWG A;  2PJ3 A;  4MHP A;  4MFL A;  2Q44 A;  4PK3 A;  4U9Z A;  2I00 A;  3LAC A;  4CRZ B;  2CNS A;  2Q04 A;  1M4G A;  4OAE A;  5HXD A;  3SHP A;  3TE4 A;  2CTB A;  3EY5 A;  3RYO A;  4MFQ A;  3TCV A;  4FD4 A;  1DTD A;  1VHO A;  4R76 A;  2WSA A;  5KTC A;  3V38 A;  2GRE A;  5ELY A;  3GB0 A;  4CGO A;  2B3U A;  3PGP A;  2AFS A;  1JWQ A;  2Q4Y A;  2GFQ A;  7CPA A;  4L89 A;  2AFM A;  3S9M A;  2J8N A;  4JWP A;  2ZEO A;  4UIA A;  1XMB A;  4GXH A;  3KZW A;  2AFO A;  3D7D A;  3CT9 A;  4UWJ A;  3KGQ A;  2R1I A;  4CGM A;  4A30 A;  4J3G A;  2BOA A;  3N7Z A;  4KS9 A;  3IFE A;  3KL9 A;  2B4B A;  3FIX A;  1Z2L A;  4RN7 A;  2ZXV A;  3LD2 A;  5AG4 A;  1QST A;  2EUI A;  1Z4E A;  2EO8 A;  4R57 A;  2AFU A;  4TNU A;  4CGL A;  1CG2 A;  1Y9K A;  1BAV A;  4F9U A;  4KZT A;  2HV2 A;  4UCM A;  1AYE A;  4I49 A;  2EK9 A;  3KR5 A;  4C2X A;  2QIR A;  2PR1 A;  2Z3N A;  2P0W A;  4CGP A;  2ZEF A;  4F9V A;  2D4P A;  4C7H A;  4QBJ A;  4OC5 A;  2V8H A;  1F2P A;  4ZY2 A;  3MN8 A;  4C68 A;  2C27 A;  2GLJ A;  4KOS A;  4OC2 A;  3GKR A;  4R3K A;  3TX8 A;  2PVV A;  4UCP A;  2AFW A;  1RXT A;  4YRH A;  5HH1 A;  1ON0 A;  5DS0 A;  4AG7 A;  1B6B A;  3IGR A;  1QSN A;  5THW A;  2Q51 A;  1CM0 A;  1BPM A;  4QVT A;  3H8F A;  4MHD A;  1F2O A;  2Z10 A;  1BO4 A;  2ZEN A;  3FB3 A;  4R8F A;  4X8I A;  3C26 A;  4ORF A;  4IAV A;  3EFA A;  2H5M A;  4KOW A;  4OIW A;  4KLW A;  4IUS A;  5LRG A;  2FT0 A;  5LRJ A;  3B3V A;  5HMN A;  3D3S A;  2XEJ A;  3FXT A;  5G1Z A;  1CBX A;  5HVG A;  2WZN A;  1XRY A;  4MCQ A;  4MBU A;  1BPN A;  5E96 A;  3FNC A;  2HC9 A;  4WJB A;  2CNT A;  1Q2Y A;  2V8D A;  4UEE A;  4B13 A;  3VAR A;  4LX9 A;  4RI1 A;  1HDU A;  1MJ9 A;  1YLE A;  2ABZ A;  2PJC A;  5AG6 A;  4QB9 A;  2ZEE A;  3B3C A;  3T90 A;  2FE7 A;  4ONU A;  1XFO A;  3KR4 A;  3HLP A;  4ONW A;  3CXS A;  4A32 A;  3W91 A;  3MRU A;  4B5P B;  3FX6 A;  5G21 A;  2FIW A;  1Z5R A;  4AXV A;  4H6U A;  4NGP A;  4B5O A;  5J1Q A;  2CIJ A;  3NFZ A;  3D7F A;  1IOI A;  2PCU A;  4UFV A;  3R96 A;  2C1C A;  4KSI A;  1Q2C A;  2PIZ A;  1Q7L A;  3EO4 A;  4ZX9 A;  2R98 A;  3SXO A;  2PSW A;  4MCR A;  2ODF A;  4NCZ A;  2B4D A;  2XEF A;  4OC1 A;  1YLO A;  4PXE A;  4YU9 A;  4XPL A;  4BIN A;  1ZO0 A;  1A2Z A;  1CPX A;  2HB6 A;  4XPD B;  4B11 A;  2O28 A;  1LOK A;  4EFD A;  4QC6 A;  1QMU A;  1OBR A;  1QSO A;  1TKJ A;  4YWY A;  3QB8 A;  1XBU A;  2ZW7 A;  3E0K A;  4OC3 A;  1LAM A;  2NYQ A;  4A31 A;  2G0B A;  3R9G A;  3TOB A;  1S7K A;  2V77 A;  5KTD A;  1Y0R A;  4KSA A;  1NSA A;  2ZW5 A;  3GYA A;  4A94 A;  4MMO A;  4ZY1 A;  4P10 A;  3KAS A;  1SQH A;  3D7G A;  2QML A;  4MXU A;  4ZX8 A;  3A9L A;  2F5I A;  2REE A;  4ZI6 A;  4PQA A;  4ZY0 A;  1BOB A;  3I9S A;  4Q36 A;  4BD9 A;  1YR0 A;  2PJA A;  1IOF A;  2CF4 A;  3JRU A;  5F48 A;  1ARL A;  4P4E A;  2YGW A;  1TXR A;  2IJZ A;  4PSX A;  3IWE A;  1KZF A;  5G20 A;  1IYL A;  1HDQ A;  2OH1 A;  4W9Y A;  8CPA A;  2R7H A;  2FVG A;  3DDD A;  2F7V A;  4DNC A;  2YND A;  3CDX A;  3DNS A;  3NE7 A;  2PRB A;  3FF3 A;  3LOD A;  2FS5 A;  4XNH B;  4PXD A;  4FD6 A;  3ZJ0 A;  4KUB A;  2EWB A;  1M4L A;  2IMO A;  1YQE A;  2ZPA A;  3V8I A;  3G3S A;  1YVO A;  3LMS A;  2VBQ A;  3FJU A;  3FED A;  4MCS A;  3PZJ A;  5EC4 A;  5JH9 A;  2OR4 A;  2ZOG A;  2AFZ A;  2JEV A;  3SI1 A;  1QSR A;  2RFH A;  3BLN A;  4MHN A;  2VL1 A;  2PJ0 A;  4LUA A;  4Q38 A;  4R6T A;  3KQX A;  3WC6 A;  4NGS A;  2WPX A;  3VH9 A;  3F5B A;  4P4J A;  2JLM A;  2BL1 A;  4XPD C;  4HNW B;  3TC8 A;  4PXB A;  2WPW A;  4KOU A;  2G9D A;  3FBU A;  5H84 A;  5BWA B;  1S7F A;  4CYQ A;  4E0A A;  3KQZ A;  4KSF A;  2GE3 A;  3RZA A;  1MK4 A;  2DF5 A;  3I3G A;  4M6I A;  3S9L A;  4M85 A;  2HQY A;  3D67 A;  2OOT A;  5A28 A;  3NH8 A;  4K30 A;  3GY9 A;  4JYW A;  4CYO A;  4DUK A;  1R57 A;  4MI4 A;  4P4I A;  2ANP A;  3TO9 A;  4FD7 A;  3S6G A;  1S7L A;  2J9A A;  2JBJ A;  4FD5 A;  3S6H A;  2BEI A;  5IB9 A;  2PJ5 A;  2PIY A;  5LYF A;  3LWU A;  1VHE A;  4UEZ A;  1M4I A;  3B3W A;  4JZ0 A;  2Z3L A;  4KOX A;  1R43 A;  1LFW A;  1S7N A;  4P4B A;  1F57 A;  2OZH A;  3DR8 A;  1IGB A;  1ZG7 A;  3K2K A;  2R8V A;  2YNC C;  2GLF A;  2QJ8 A;  4AG9 A;  1AMP A;  2PJ2 A;  2NMT A;  3PB7 X;  4NJR A;  3FMC A;  3V7Z A;  3VAT A;  1YME A;  5H86 A;  3MGD A;  4F8Z A;  2BSW A;  4WWV A;  1CP7 A;  1YSJ A;  2Q43 A;  3D8P A;  4OID A;  1I12 A;  4U9Y A;  3CPA A;  3B7I A;  3BJ7 A;  3EC4 A;  3G8W A;  4NGQ A;  3T8W A;  1JQG A;  4XNH C;  4P44 A;  3BI0 A;  4JJX A;  3SJG A;  5EBV A;  4NGM A;  3DLJ A;  4FUU A;  4OC4 A;  1V0C A;  2G3A A;  1MJA A;  4OME A;  3T9Y A;  4BBH A;  1CX8 A;  3JVN A;  4Y49 B;  3KHZ A;  2O53 A;  2FL4 A;  3CZX A;  3IC1 A;  3WAB A;  1YVK A;  5LYI A;  3ZZI A;  1VKC A;  3H8E A;  1XJO A;  4CGN A;  1LRZ A;  1IB1 E;  2AJ6 A;  3RNZ A;  1M1D A;  1DE4 C;  4C7I A;  5F46 A;  4UA3 A;  2Y0M A;  3B2Y A;  4LQG A;  3WR7 A;  4ZBG A;  1QQ9 A;  1LCP A;  2VZY A;  4A38 A;  5IB0 A;  1XEB A;  3IU1 A;  1PCA A;  2K5T A;  2IL4 A;  2QEC A;  4A2Z A;  1PUA A;  3ISZ A;  3PP9 A;  2B5G A;  5CBM A;  4HPS A;  1PYT B;  2PJ6 A;  3BI1 A;  2PJ4 A;  2C6G A;  2FIA A;  4HKF A;  4MFZ A;  4OKO A;  4XPK A;  5D29 A;  5AG5 A;  4FWU A;  1YGH A;  2CNM A;  2O4H A;  1IYK A;  4G1P A;  4MCP A;  4CRY B;  2AE6 A;  3BXM A;  4UF4 A;  2PQ8 A;  3H4Q A;  3R1K A;  2ATR A;  3N5F A;  3L2N A;  4B14 A;  2P6E A;  2Z0Z A;  3JUW A;  2REF A;  3NH5 A;  5F47 A;  3I1U A;  3FH4 A;  1WK4 A;  3PEI A;  3VWD A;  3QAH A;  1S5K A;  1ZG9 A;  3NE8 A;  3QNV A;  4EME A;  5FVJ A;  2V8G A;  3W6S A;  2ZOF A;  1TKF A;  3D4U A;  1RTQ A;  5GCN A;  1VHS A;  2XEI A; 
#chains in the Genus database with same CATH homology
 2RC4 A;  4NSQ A;  3TO7 A;  2VZZ A;  2FCK A;  4QUS A;  2J8M A;  3H5Z A;  2I79 A;  1XF8 A;  2B4D B;  4Y49 C;  4AVB A;  1FY7 A;  3FRM A;  1S60 A;  4KOV A;  4ZGY B;  2FSR A;  4IF5 A;  3R9E A;  4II9 A;  1XE4 A;  4E8O A;  4OAD A;  5ISV A;  1PU9 A;  1YK3 A;  2JDC A;  4CAX A;  2PDO A;  5C88 A;  4MFK A;  1YX0 A;  5CNP A;  3JTK A;  1WWZ A;  4YFJ A;  1L0C A;  1UFH A;  2ZW6 A;  2Z3M A;  3TOA A;  2GAN A;  5A27 A;  3TTH A;  2DXQ A;  4JD6 A;  2VI7 A;  3VWE A;  5G22 A;  4YGO A;  3KKW A;  4KOR A;  4AVC A;  2VXK A;  4UWI A;  4A95 A;  3D2M A;  1M4D A;  5IV0 A;  2DPT A;  3F8K A;  2Q7B A;  4F0Y A;  4KOT A;  3W6X A;  4AVA A;  3SXN A;  2Q4V A;  4KVO E;  4R3L A;  3TFY A;  5C82 A;  4H6Z A;  3FYN A;  4KUA A;  5JPH A;  4X5K A;  2Z3P A;  4PK2 A;  3K9U A;  1Z9U A;  4NXY A;  2HUZ A;  3TO6 A;  3DSB A;  4R87 A;  2Z11 A;  3P2H A;  2FXF A;  4HNX B;  1XIX A;  4CAW A;  1OZP A;  3CXQ A;  1KUX A;  1TIQ A;  4KVM E;  4JLY A;  2VEZ A;  3D2P A;  1N71 A;  1YRE A;  2CY2 A;  4MFP A;  1I21 A;  2EVN A;  4CYP A;  4OLL A;  1Z4R A;  5AGE A;  1CJW A;  3BJ8 A;  1NSL A;  3DR6 A;  1P0H A;  5F49 A;  4UCN A;  4CYN A;  1B87 A;  2DPS A;  4CAV A;  1Y9W A;  5I0C A;  5J8C A;  4M3S A;  4MY0 A;  3UY5 A;  1K4J A;  2ZW4 A;  3S6K A;  1QSM A;  2Q0Y A;  3S6F A;  3F0A A;  4KVX A;  4C2Y A;  4UFX A;  3R9F A;  5KTA A;  4B10 A;  2OZU A;  4B5P A;  4MJ8 A;  3OWC A;  4R9M A;  4NF1 A;  5IX3 A;  4KLV A;  2D4O A;  1MJB A;  2B3V A;  4A33 A;  2KCW A;  1Y7R A;  4GS4 A;  2CXA A;  2G3T A;  3CXP A;  1NE9 A;  4H89 A;  5JQ4 A;  2Z3O A;  2PR8 A;  4F0X A;  3B8G A;  4PV6 A;  4NEX A;  2ARH A;  1P4N A;  4BMH A;  4JXR A;  3IU2 A;  1IID A;  2OZG A;  4E2A A;  4JXQ A;  4KOY A;  1RO5 A;  4PSW A;  2B5G B;  4CAE A;  5DWM A;  1NMT A;  2YNE A;  4RS2 A;  3TT2 A;  1U6M A;  1Q2D A;  2YNC A;  4HNY B;  4CS0 B;  1KUY A;  2Z3K A;  1GHE A;  2GIV A;  4L8A A;  1KUV A;  2X7B A;  4MY3 A;  2WUU A;  1M44 A;  3EXN A;  1IIC A;  2JDD A;  1S3Z A;  4UBR A;  1XMT A;  4MFJ A;  4UFW A;  5J8F A;  2J8R A;  1I1D A;  2OU2 A;  2B58 A;  2P6G A;  4CAF A;  5AG7 A;  4U5Y A;  2VQY A;  4C2Z A;  3P2F A;  4F6A A;  2A4N A;  2P6F A;  3R95 A;  5DWN A;  2OB0 A;  2PC1 A;  1J4J A;  4EVY A;  4B12 A;  2BUE A;  3IWG A;  4MFL A;  2Q44 A;  4PK3 A;  4U9Z A;  2I00 A;  4CRZ B;  2CNS A;  2Q04 A;  1M4G A;  4OAE A;  3SHP A;  3TE4 A;  3EY5 A;  3RYO A;  4MFQ A;  3TCV A;  4FD4 A;  2WSA A;  5KTC A;  4CGO A;  2B3U A;  3PGP A;  2Q4Y A;  4L89 A;  2J8N A;  4JWP A;  4UWJ A;  2R1I A;  4CGM A;  4A30 A;  4J3G A;  3N7Z A;  4KS9 A;  2B4B A;  3FIX A;  2ZXV A;  3LD2 A;  5AG4 A;  1QST A;  2EUI A;  1Z4E A;  4R57 A;  4CGL A;  1Y9K A;  4KZT A;  2HV2 A;  4UCM A;  4I49 A;  4C2X A;  2QIR A;  2PR1 A;  2Z3N A;  2P0W A;  4CGP A;  2D4P A;  4C7H A;  4QBJ A;  4C68 A;  2C27 A;  4KOS A;  4R3K A;  3GKR A;  4UCP A;  1RXT A;  4YRH A;  5HH1 A;  1ON0 A;  4AG7 A;  1B6B A;  3IGR A;  1QSN A;  1CM0 A;  4QVT A;  4MHD A;  2Z10 A;  1BO4 A;  3FB3 A;  3C26 A;  4ORF A;  3EFA A;  2H5M A;  4KOW A;  4KLW A;  4IUS A;  2FT0 A;  5HMN A;  3D3S A;  3FXT A;  5G1Z A;  4MBU A;  5E96 A;  3FNC A;  2CNT A;  1Q2Y A;  4B13 A;  4LX9 A;  4RI1 A;  1MJ9 A;  1YLE A;  5AG6 A;  4QB9 A;  3T90 A;  2FE7 A;  4ONU A;  3CXS A;  4A32 A;  3W91 A;  4B5P B;  5G21 A;  2FIW A;  4H6U A;  4B5O A;  4UFV A;  3R96 A;  1Q2C A;  3EO4 A;  2R98 A;  3SXO A;  2PSW A;  4NCZ A;  2B4D A;  4XPL A;  1ZO0 A;  4XPD B;  4B11 A;  2O28 A;  4QC6 A;  1QSO A;  3QB8 A;  2ZW7 A;  3E0K A;  4A31 A;  2G0B A;  3R9G A;  3TOB A;  1S7K A;  5KTD A;  4KSA A;  2ZW5 A;  3GYA A;  1SQH A;  2QML A;  3A9L A;  2F5I A;  2REE A;  1BOB A;  3I9S A;  4Q36 A;  1YR0 A;  5F48 A;  2YGW A;  4PSX A;  3IWE A;  1KZF A;  5G20 A;  1IYL A;  2OH1 A;  2R7H A;  3DDD A;  4DNC A;  2YND A;  3DNS A;  3NE7 A;  2PRB A;  3LOD A;  2FS5 A;  4XNH B;  4FD6 A;  3ZJ0 A;  4KUB A;  2ZPA A;  3V8I A;  3G3S A;  1YVO A;  5EC4 A;  2VBQ A;  3PZJ A;  2JEV A;  1QSR A;  3BLN A;  4LUA A;  4Q38 A;  2WPX A;  3F5B A;  2JLM A;  2BL1 A;  4XPD C;  4HNW B;  2WPW A;  4KOU A;  3FBU A;  5H84 A;  5BWA B;  1S7F A;  4CYQ A;  4E0A A;  4KSF A;  2GE3 A;  1MK4 A;  3I3G A;  4M85 A;  2HQY A;  5A28 A;  4K30 A;  3GY9 A;  4CYO A;  1R57 A;  4MI4 A;  3TO9 A;  4FD7 A;  3S6G A;  1S7L A;  3S6H A;  4FD5 A;  2BEI A;  1M4I A;  2Z3L A;  4KOX A;  1S7N A;  2OZH A;  3DR8 A;  2R8V A;  2YNC C;  4AG9 A;  2NMT A;  5H86 A;  3MGD A;  2BSW A;  3D8P A;  1I12 A;  4U9Y A;  3BJ7 A;  3EC4 A;  3G8W A;  4XNH C;  4JJX A;  5EBV A;  1V0C A;  2G3A A;  1MJA A;  3T9Y A;  4BBH A;  3JVN A;  4Y49 B;  2FL4 A;  1YVK A;  3ZZI A;  1VKC A;  4CGN A;  1LRZ A;  1IB1 E;  2AJ6 A;  1M1D A;  4C7I A;  5F46 A;  4UA3 A;  2Y0M A;  3WR7 A;  4ZBG A;  2VZY A;  5IB0 A;  1XEB A;  3IU1 A;  2K5T A;  2IL4 A;  2QEC A;  4A2Z A;  1PUA A;  3PP9 A;  2B5G A;  4XPK A;  4HKF A;  2FIA A;  4MFZ A;  5AG5 A;  1YGH A;  2CNM A;  1IYK A;  4CRY B;  2AE6 A;  2PQ8 A;  3H4Q A;  3R1K A;  2ATR A;  4B14 A;  2P6E A;  2Z0Z A;  3JUW A;  2REF A;  5F47 A;  1WK4 A;  3VWD A;  3QAH A;  1S5K A;  5FVJ A;  3W6S A;  5GCN A;  4AB7 A;  1VHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...