3FYNA

Crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
152
Chain Sequence
NLYFQGLSPQVRTAHIGDVPVLVRLMSEFYQEAGFALPHDAAIRAFKALLGKPDLGRIWLIAEGTESVGYIVLTLGFSMEYGGLRGFVDDFFVRPNARGKGLGAAALQTVKQGCCDLGVRALLVETGVYSRAGFEESGRMLLGQALAPPIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Integron gene cassette protein HFX_CASS3
publication title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS3
rcsb
source organism Uncultured bacterium
total genus 40
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fynA00
1Y7RA 4PSWA 2P6FA 2PQ8A 5HH1A 2FSRA 4OADA 2Q0YA 3R9FA 2B4DA 4YGOA 1U6MA 2NMTA 4U9ZA 3R1KA 2WPWA 3TE4A 4F0YA 2VXKA 5ISVA 1PU9A 2P6EA 2I79A 4ZBGA 4NXYA 3JVNA 5E96A 4B5PB 1IB1E 2PRBA 4HNXB 1P4NA 4MI4A 2IL4A 4JWPA 5C88A 3LODA 3R9EA 4AVCA 2HV2A 2H5MA 4F6AA 1IYLA 4BMHA 1XMTA 3SXNA 1Y9KA 2Q7BA 2PR1A 4HNYB 3C26A 3VWEA 1R57A 1FY7A 2BUEA 2FL4A 2Z0ZA 3JUWA 4L89A 3TO7A 1I1DA 3VWDA 1YVKA 4UBRA 1M4DA 1SQHA 3CXPA 2I00A 2KCWA 2B3UA 4PV6A 2K5TA 1YR0A 2QIRA 5IV0A 1YLEA 4KVME 2D4PA 1XF8A 2QECA 2ZXVA 3CXSA 3W91A 2G0BA 4UWJA 5CNPA 3FXTA 4KORA 1QSMA 4R87A 1BO4A 1L0CA 3DR8A 2PDOA 1M4GA 2WPXA 3N7ZA 3UY5A 3MGDA 1WK4A 4CAXA 3H4QA 3TO9A 1MK4A 4QBJA 5KTAA 1S7FA 4RS2A 2FCKA 2BL1A 2RC4A 3F5BA 2OZUA 4CS0B 2P0WA 3F8KA 3RYOA 5J8FA 2O28A 4EVYA 1IICA 5KTCA 1Z4RA 2VZZA 1Z9UA 4KOVA 4X5KA 4PK3A 1Q2CA 3FRMA 4KVXA 2X7BA 1K4JA 3TCVA 1B87A 1TIQA 4KUBA 1YGHA 1M4IA 3T9YA 3R9GA 2REFA 4U5YA 5F49A 5H84A 2HUZA 1Z4EA 2Q4YA 4LUAA 1P0HA 2D4OA 3TOAA 1OZPA 4KLVA 2CNTA 4B5OA 2B3VA 2R7HA 5F47A 5C82A 1XEBA 2Y0MA 2VBQA 3EY5A 4I49A 4KLWA 1PUAA 2JDCA 2J8MA 2B5GA 2Z10A 5J8CA 3BJ7A 2AE6A 3P2FA 1BOBA 4QC6A 4IF5A 4H89A 3DSBA 1YVOA 4NCZA 3QAHA 1V0CA 3I3GA 4DNCA 2CNMA 3GYAA 2FT0A 4MY0A 4PK2A 5FVJA 4U9YA 2JEVA 4HNWB 4XPDB 4NSQA 3D3SA 1MJBA 4XPKA 1IYKA 5GCNA 2DXQA 4CAWA 4KZTA 3W6XA 3S6HA 2R98A 1CM0A 5KTDA 4JJXA 4R9MA 4R3LA 3PZJA 1KUXA 4E0AA 1NE9A 2FE7A 4KOYA 3EO4A 1Q2DA 1YK3A 2QMLA 4IUSA 2OZHA 4KOSA 5H86A 3FNCA 1VKCA 2J8RA 3SHPA 4XPDC 1XE4A 4J3GA 4JXQA 4AVBA 3T90A 1NSLA 2AJ6A 2GIVA 2ZPAA 3GKRA 4LX9A 2JLMA 1J4JA 3FB3A 4JD6A 4KOUA 3G3SA 2HQYA 4KOTA 2J8NA 3CXQA 1MJ9A 2FS5A 2PC1A 3EC4A 3W6SA 4FD5A 3K9UA 4B5PA 4KOXA 2A4NA 5F48A 3GY9A 4NF1A 2ARHA 3PP9A 4CRZB 3LD2A 3FYNA 1KUVA 3FIXA 2ATRA 4CRYB 3DR6A 4MBUA 3P2HA 4QVTA 4OLLA 4FD6A 3ZJ0A 2VQYA 1WWZA 3IWGA 2B4BA 4QB9A 2REEA 4UA3A 4XNHB 4AG9A 5JQ4A 5IX3A 3KKWA 1N71A 1CJWA 4M85A 4R3KA 3S6FA 3TOBA 3OWCA 1KZFA 2CNSA 4R57A 3TTHA 4E2AA 1GHEA 2ZW6A 4HKFA 1M1DA 3EXNA 2Z11A 2G3AA 4XNHC 5I0CA 3G8WA 4PSXA 3V8IA 1QSRA 1I21A 3B8GA 1UFHA 2R1IA 4NEXA 2G3TA 3R96A 2BEIA 1YX0A 2Q44A 2FXFA 1XIXA 4QUSA 4ORFA 3TO6A 1S60A 1YREA 1QSOA 4FD4A 5EBVA 1KUYA 4H6UA 1S7LA 3BJ8A 4KOWA 3DNSA 4L8AA 2B4DB 3D8PA 5IB0A 4RI1A 4MHDA 2OU2A 2VI7A 4YFJA 4MJ8A 3SXOA 1I12A 1IIDA 3D2MA 1LRZA 4XPLA 3R95A 3BLNA 2OH1A 3FBUA 4OAEA 1RXTA 1S3ZA 4E8OA 3S6KA 2B5GB 2FIAA 2VEZA 1QSTA 4KVOE 4H6ZA 3DDDA 3WR7A 4GS4A 1NMTA 2FIWA 4AB7A 2OB0A 2CY2A 4UWIA 2EVNA 1S7NA 2ZW5A 5JPHA 4Y49B 3D2PA 5DWMA 4FD7A 1S7KA 2GE3A 5HMNA 1S5KA 4MY3A 3NE7A 4AG7A 4YRHA 4K30A 4M3SA 3QB8A 1Q2YA 4AVAA 3S6GA 2VZYA 2C27A 4JXRA 2Q4VA 2EUIA 2PSWA 3TFYA 2ZW7A 2F5IA 2JDDA 4Y49C 4CAVA 1QSNA 1Y9WA 3EFAA 4II9A 2OZGA 3TT2A 2GANA 1ON0A 5F46A 1MJAA 1RO5A 1VHSA 1M44A 3I9SA 4JLYA 2R8VA 3E0KA 4KUAA 5DWNA 3IGRA 2PR8A 4ONUA 3F0AA 2B58A 1B6BA 5EC4A 3PGPA 3ZZIA 2P6GA 2ZW4A 2Q04A 2BSWA
chains in the Genus database with same CATH superfamily
1DE4C 2PE3A 1Y7RA 4PSWA 2P6FA 2AFUA 4CAEA 2PQ8A 5LYLA 5HH1A 3S9NA 2FSRA 4OADA 1BPNA 2Q0YA 1NSAA 3R9FA 4P4DA 2DF5A 2B4DA 4PXCA 4G1PA 3SJFA 4YGOA 1U6MA 2F7VA 1CG2A 2NMTA 4U9ZA 3R1KA 2PJ7A 2WPWA 4GM5A 3TE4A 4F0YA 2VXKA 5ISVA 1PU9A 2P6EA 2I79A 1Z2LA 4ZBGA 1KWMA 4NXYA 4Q38A 4EMEA 1UWYA 3JVNA 4CGLA 5E96A 4B5PB 2FVGA 1IB1E 3KGQA 2QVPA 2PRBA 4HNXB 4P6YA 1P4NA 3JRUA 4MMOA 4MI4A 4UFWA 2IL4A 1FNOA 4X8IA 2IJZA 3TX8A 3NH4A 4A37A 3B2YA 4JWPA 5C88A 1Z5RA 3D7HA 3FF3A 3LODA 1VGYA 4R76A 3D7GA 4P45A 2PVWA 3R9EA 2PJ1A 4AVCA 1IU8A 2H5MA 2HV2A 3PRTA 3PFEA 4F6AA 1IYLA 3VATA 4BMHA 1XMTA 3SXNA 1ELMP 1Y9KA 3KASA 2Q7BA 5HXDA 2PR1A 5HVFA 3ISZA 4HNYB 2PJCA 3C26A 3NE8A 4MCQA 2PJ2A 3VWEA 1R57A 1FY7A 2BUEA 2FL4A 2Z0ZA 3JUWA 4L89A 3TO7A 1I1DA 1Z8XA 3T8WA 4A39A 4AXVA 4MFPA 4R7MA 3VWDA 4NFRA 2EK9A 1YVKA 4WWVA 4UBRA 3SI1A 1M4DA 1SQHA 3CXPA 2I00A 2KCWA 3FH4A 3PB7X 2B3UA 3S9LA 2JBJA 4PV6A 4UFVA 2K5TA 1YR0A 2QIRA 4MCSA 5IV0A 4NGMA 1YLEA 3IIBA 2XEIA 3B7IA 4KVME 4PXEA 4EFDA 2C6PA 1TXRA 2WZNA 2D4PA 4IAVA 4NGQA 2ZEMA 1XF8A 5A27A 4P4IA 3MRUA 2QECA 3CDXA 2C6CA 1CBXA 2Q7SA 2ZXVA 2PCUA 3CXSA 3W91A 1BPMA 2G0BA 2I3CA 4UWJA 3VH9A 4NGNA 2PJ3A 4NGTA 1FT7A 5CNPA 4B13A 3CT9A 2RB7A 2V8VA 1HEEA 2YNEA 3FXTA 4P4FA 3RAMA 1QSMA 4KORA 4R87A 4MXUA 1BO4A 1L0CA 3DR8A 4IHMA 4PXBA 2PDOA 1M4GA 2WPXA 3N7ZA 4A30A 3UY5A 4CGPA 1OBRA 3MGDA 1WK4A 3PBEA 4RN7A 4CAXA 3FEEA 3WC7A 3H4QA 5LYIA 4WJBA 3TO9A 4CYOA 4X2TA 1MK4A 2PJAA 7CPAA 3NH5A 3S9MA 5A28A 4QBJA 5KTAA 3LACA 1JWQA 1H8LA 3K2KA 3D67A 1S7FA 4C2ZA 4MHZA 4RS2A 2FCKA 2BL1A 2RC4A 3B3SA 3H8EA 3F5BA 2OZUA 1ELLP 5JM6A 4B11A 1AMPA 4FWUA 4CS0B 2P0WA 3F8KA 3RYOA 4MCRA 4MFKA 3D7FA 4IK2A 5J8FA 2O28A 4EVYA 2PJ0A 2PIYA 5F09A 1IICA 5KTCA 1Z4RA 2VZZA 4OC0A 5IB9A 5HVGA 1Z9UA 4KSIA 3SI0A 4KOVA 4UCNA 2V77A 2AFOA 4X5KA 4PK3A 4W9YA 1Q2CA 4ZGYB 3FRMA 3KQXA 4KVXA 2X7BA 2XEFA 1Y0RA 1K4JA 4A2ZA 3TCVA 1B87A 3IEHA 4UCMA 1TIQA 2F8HA 1YGHA 1GYTA 1M4IA 4KUBA 2PJ5A 4OC2A 4FAIA 3T9YA 3R9GA 2XEGA 2AFMA 2REFA 4U5YA 1F2PA 5F49A 2V8DA 3TC8A 5H84A 2CXAA 2HUZA 1F2OA 3ISXA 4PXDA 4TNUA 1Z4EA 2Q4YA 4LUAA 1P0HA 2D4OA 4PPZA 3TOAA 3V38A 1YQEA 1OZPA 3BI1A 2HB6A 4M6GA 4KLVA 5LRGA 1M4LA 2CNTA 4B5OA 2B3VA 4M6IA 4R8FA 3H8GA 2R7HA 5F47A 3CPAA 2PJ6A 3BHXA 5C82A 1HDQA 1XEBA 2BCOA 2Y0MA 2VBQA 3EY5A 4I49A 1CPXA 4KLWA 4UIBA 1PUAA 2JDCA 2J8MA 3N5FA 3NH8A 8CPAA 2B5GA 4ZY2A 4FBEA 2Z10A 5J8CA 4DJLA 3LWUA 4TWEA 4HPSA 2CF4A 3BJ7A 4MFLA 2AE6A 3P2FA 1BOBA 4QC6A 3RO0A 4ZI6A 4YWYA 4IF5A 4UEZA 3GB0A 1ZG9A 4H89A 3DSBA 1YVOA 4NCZA 2PJ4A 3QAHA 4BD9A 5AG4A 4OP4A 1V0CA 2EO8A 3I3GA 4DNCA 4F0XA 5G1ZA 4CYQA 2CNMA 4JZ0A 1R3NA 2QYVA 1Z8TA 3GYAA 4MHYA 2FT0A 5THWA 4MY0A 2DEAA 4PK2A 5FVJA 4U9YA 2JEVA 2XEJA 4C7IA 1RTQA 4HNWB 4XPDB 4NSQA 1BLLE 4B14A 4MFJA 3D3SA 1MJBA 4OIWA 4XPKA 2YNCA 2C6GA 1IYKA 3IWEA 1ZLHA 5LRJA 5GCNA 2DXQA 2PIZA 4CAWA 4KZTA 2ZEDA 3S6HA 2R98A 1CM0A 3GLJA 3W6XA 1LOKA 5KTDA 2WUUA 4H2KA 4JJXA 4OC4A 4R9MA 4R3LA 3IO1A 3PZJA 1YW4A 1KUXA 4E0AA 1NE9A 1YSJA 4B6ZA 2FE7A 3NFZA 1PCAA 1TF8A 3EO4A 3IJ3A 4KOYA 4UCPA 1Q2DA 1YK3A 2ODFA 2QMLA 2OZHA 4FUUA 4IUSA 1ZG7A 4KOSA 4M6HA 2AFSA 2Q51A 4ZX9A 5H86A 3FNCA 2P6GA 4R6TA 4C2YA 1VKCA 2J8RA 5G22A 4XPDC 1XE4A 3SHPA 3VARA 2Z3MA 3H5ZA 4J3GA 4JXQA 4AVBA 3T90A 5K8PA 1NSLA 2AJ6A 1JQGA 2GIVA 2J9AA 3KHXA 3KL9A 1CX8A 2ZPAA 3GKRA 4LX9A 2JLMA 1TKFA 2G9DA 4P10A 1J4JA 3FB3A 2GLJA 4ZY1A 4DYOA 4JD6A 2EWBA 3FJUA 5BWAB 4KOUA 3DLJA 4P4EA 3DGVA 3G3SA 5K8MA 2HQYA 4MHNA 3GUXA 5EMIA 4KOTA 2J8NA 3RBUA 3CXQA 2EBJA 4C2XA 2YGWA 3I1UA 4P4BA 4KSFA 3SJEA 1MJ9A 2FS5A 1IY7A 1CP7A 2PC1A 3KR5A 1LAMA 3EC4A 1A2ZA 3KR4A 3W6SA 4B10A 2BOAA 1XJOA 4ZY0A 4NGSA 4FD5A 5G20A 3NA6A 4CAFA 5LRKA 4PQAA 3K9UA 2ZOFA 4B5PA 4MRIA 1AUGA 1EE3P 4KOXA 2YNDA 2A4NA 4OIDA 5F48A 4ZX8A 3GY9A 4NF1A 2IMOA 3CZXA 2DPSA 2ARHA 1YLOA 3PP9A 4CRZB 5HVHA 1Y7EA 2CTBA 3KQZA 3FYNA 3LD2A 1CP6A 1KUVA 3FIXA 2ATRA 3SJXA 2V8HA 4NGRA 3IFEA 1IOFA 4CYPA 4OC3A 1Z8WA 4CRYB 1XOVA 1ZO0A 4CGNA 1ARMA 1DTDA 1YMEA 5DS0A 2IQ6A 3DR6A 4MBUA 3P2HA 4QVTA 3BXMA 4Z65A 4OLLA 4FD6A 3ZJ0A 3SJGA 2JEWA 2Z3PA 2VQYA 1WWZA 1ARLA 4A95A 3IWGA 1YW6A 4KS9A 3A9LA 2B4BA 4MFZA 4NGPA 5CPAA 3HLPA 3FEDA 4QB9A 1BAVA 1LANA 6CPAA 2JBKA 1XBUA 2REEA 4UA3A 4XNHB 4NJRA 2DPTA 2GLFA 2ZENA 3B3WA 4UIAA 2ZEGA 3KHZA 4AG9A 5JQ4A 2O4HA 2PJ8A 5IX3A 2WSAA 2ZEHA 3KKWA 4BINA 1TKJA 1N71A 2PRQA 1CJWA 4RUHA 4M85A 3WC5A 4R3KA 5LYFA 3RNZA 3S6FA 1Q7LA 4A31A 2BO9A 3CPXA 3TOBA 1VHOA 1KZFA 2CNSA 3OWCA 4R57A 4A32A 3B3VA 3TTHA 4Q7AA 4E2AA 4F8ZA 5K8NA 4B12A 3FECA 1GHEA 2ZW6A 4O23A 4ZYQA 4OC1A 3PB9X 1X12A 2AFWA 1M1DA 4HKFA 1LCPA 4EWTA 3EXNA 2Z11A 3FX6A 5AGEA 2ZEOA 1LAPA 3B3CA 2G3AA 3RZAA 3H8FA 1TKHA 4XNHC 5I0CA 2ZEEA 2NSMA 3G8WA 4PSXA 2AFXA 2OR4A 3V8IA 1QSRA 5D8NA 5K8OA 4C7HA 1I21A 3KZWA 3B8GA 1UFHA 2R1IA 3IU2A 4NEXA 3PB6X 2Q43A 4A33A 3V7ZA 3BI0A 2G3TA 4OC5A 3R96A 2BEIA 3KI9A 1YX0A 2Q44A 1LFWA 2FXFA 3QNVA 1XIXA 4LQ6A 4QUSA 4ORFA 3TO6A 1S60A 4F9VA 3PBBA 1YREA 4GXHA 1QSOA 4FD4A 5EBVA 4F9UA 1XFOA 2ZOGA 1KUYA 4H6UA 4K3NA 4LQGA 4DUKA 5CBMA 1S7LA 5JH9A 2O53A 3PFOA 3BJ8A 2CTCA 1Y0YA 1IGBA 3L2NA 4CGOA 1F57A 1R43A 1ZLIA 2V8GA 3DNSA 4KOWA 4L8AA 2B4DB 4CYNA 3D8PA 4UEFA 4MCPA 2WYRA 4RI1A 5I4MA 5IB0A 4MHDA 4A38A 2QJ8A 5J1QA 4UF4A 2OU2A 2VI7A 3WC6A 4YFJA 4MJ8A 4UEEA 1PYTB 3B35A 2GFQA 1X10A 2Z3LA 1Z8LA 3SXOA 1CPSA 1I12A 5JGFA 3PEIA 1IIDA 3D2MA 3IC1A 3D7DA 3PB8X 1LRZA 4X3RA 2POKA 4OMEA 4XPLA 3R95A 4MHPA 3BLNA 1HDUA 2OH1A 5G21A 3FBUA 4CPAA 4OAEA 3IWWA 1AYEA 1RXTA 1S3ZA 3B3TA 3SI2A 4C68A 4E8OA 3S6KA 2B5GB 2FIAA 3JTKA 3WT4A 1XMBA 2VEZA 2Z3NA 1QSTA 1VHEA 2ZELA 3PB4X 4H6ZA 3DDDA 4KVOE 2C1CA 3HUVA 4GS4A 3WR7A 4CGMA 3IU1A 1NMTA 3D4UA 2FIWA 2ZEFA 4AB7A 2EK8A 2OB0A 2CY2A 2Q4ZA 4UWIA 2EVNA 1S7NA 2PJ9A 2ZW5A 2VL1A 5JPHA 4Y49B 4KSAA 3D2PA 4OKOA 5DWMA 4P44A 4FD7A 1S7KA 2OOTA 4YU9A 2GE3A 4BBHA 5AG5A 5HMNA 1QMUA 2PJBA 1S5KA 3D68A 3WABA 4MY3A 3NE7A 4AG7A 2ANPA 4YRHA 2Z3KA 4K30A 2RFHA 4M3SA 3QB8A 5LYDA 1Q2YA 4MFQA 4JYWA 4NJQA 4AVAA 3S6GA 2VZYA 2C27A 2GREA 2GU2A 4ONWA 3GIUA 4JXRA 1XRYA 2Q4VA 4Q36A 2EUIA 2PSWA 3MN8A 3TFYA 3QAYA 2ABZA 2ZW7A 2HC9A 2JDDA 2F5IA 4Y49C 1QSNA 4CAVA 2CIJA 1Y9WA 3EFAA 4II9A 2OZGA 3TT2A 2GANA 1ZG8A 1ON0A 4UFXA 2Z3OA 5AG6A 5AG7A 5F46A 1MJAA 2PVVA 1RO5A 1VHSA 1M44A 3I9SA 2ZEPA 4JLYA 5D29A 5ELYA 2R8VA 3FVLA 1TF9A 3E0KA 4KUAA 5DWNA 3FMCA 3IGRA 2PR8A 4ONUA 3D66A 1VIXA 2AFZA 4P4JA 3F0AA 2YNCC 2B58A 1B6BA 3K9TA 3PGPA 5EC4A 4A94A 1IOIA 2NYQA 3ZZIA 1QQ9A 2ZW4A 2Q04A 2BSWA 3LMSA
chains in the Genus database with same CATH topology
1Y7RA 4PSWA 2P6FA 4CAEA 2PQ8A 5HH1A 2FSRA 4OADA 2Q0YA 3R9FA 2B4DA 4YGOA 1U6MA 2NMTA 4U9ZA 3R1KA 2WPWA 3TE4A 4F0YA 2VXKA 5ISVA 1PU9A 2P6EA 2I79A 4ZBGA 4NXYA 4Q38A 3JVNA 4CGLA 5E96A 4B5PB 1IB1E 2PRBA 4HNXB 1P4NA 4MI4A 4UFWA 2IL4A 4JWPA 5C88A 3LODA 3R9EA 4AVCA 2HV2A 2H5MA 4F6AA 1IYLA 4BMHA 1XMTA 3SXNA 1Y9KA 2Q7BA 2PR1A 4HNYB 3C26A 3VWEA 1R57A 1FY7A 2BUEA 2FL4A 2Z0ZA 3JUWA 4L89A 3TO7A 1I1DA 4MFPA 3VWDA 1YVKA 4UBRA 1M4DA 1SQHA 3CXPA 2I00A 2KCWA 2B3UA 4PV6A 4UFVA 2K5TA 1YR0A 2QIRA 5IV0A 1YLEA 4KVME 2D4PA 1XF8A 5A27A 2QECA 2ZXVA 3CXSA 3W91A 2G0BA 4UWJA 5CNPA 4B13A 2YNEA 3FXTA 1QSMA 4KORA 4R87A 1BO4A 1L0CA 3DR8A 2PDOA 1M4GA 2WPXA 3N7ZA 4A30A 3UY5A 4CGPA 3MGDA 1WK4A 4CAXA 3H4QA 3TO9A 4CYOA 1MK4A 5A28A 4QBJA 5KTAA 1S7FA 4C2ZA 4RS2A 2FCKA 2BL1A 2RC4A 3F5BA 2OZUA 4B11A 4CS0B 2P0WA 3F8KA 3RYOA 4MFKA 5J8FA 2O28A 4EVYA 1IICA 5KTCA 1Z4RA 2VZZA 1Z9UA 4KOVA 4UCNA 4X5KA 4PK3A 1Q2CA 4ZGYB 3FRMA 4KVXA 2X7BA 1K4JA 4A2ZA 3TCVA 1B87A 4UCMA 1TIQA 4KUBA 1YGHA 1M4IA 3T9YA 3R9GA 2REFA 4U5YA 5F49A 5H84A 2CXAA 2HUZA 1Z4EA 2Q4YA 4LUAA 1P0HA 2D4OA 3TOAA 1OZPA 4KLVA 2CNTA 4B5OA 2B3VA 2R7HA 5F47A 5C82A 1XEBA 2Y0MA 2VBQA 3EY5A 4I49A 4KLWA 1PUAA 2JDCA 2J8MA 2B5GA 2Z10A 5J8CA 3BJ7A 4MFLA 2AE6A 3P2FA 1BOBA 4QC6A 4IF5A 4H89A 3DSBA 1YVOA 4NCZA 3QAHA 5AG4A 1V0CA 3I3GA 4DNCA 4F0XA 5G1ZA 4CYQA 2CNMA 3GYAA 2FT0A 4MY0A 4PK2A 5FVJA 4U9YA 2JEVA 4C7IA 4HNWB 4XPDB 4NSQA 4B14A 4MFJA 3D3SA 1MJBA 4XPKA 2YNCA 3IWEA 1IYKA 5GCNA 2DXQA 4CAWA 4KZTA 3W6XA 3S6HA 2R98A 1CM0A 5KTDA 2WUUA 4JJXA 4R9MA 4R3LA 3PZJA 1KUXA 4E0AA 1NE9A 2FE7A 4KOYA 3EO4A 4UCPA 4CGOA 1Q2DA 1YK3A 2QMLA 4IUSA 2OZHA 4KOSA 5H86A 3FNCA 4C2YA 1VKCA 2J8RA 5G22A 4XPDC 1XE4A 3SHPA 2Z3MA 3H5ZA 4J3GA 4JXQA 4AVBA 3T90A 1NSLA 2AJ6A 2GIVA 2ZPAA 3GKRA 4LX9A 2JLMA 1J4JA 3FB3A 4JD6A 5BWAB 4KOUA 3G3SA 2HQYA 4KOTA 2J8NA 3CXQA 4C2XA 2YGWA 4KSFA 1MJ9A 2FS5A 2PC1A 3EC4A 4B10A 3W6SA 4FD5A 5G20A 4CAFA 3K9UA 4B5PA 4KOXA 2YNDA 2A4NA 5F48A 3GY9A 4NF1A 2DPSA 2ARHA 3PP9A 4CRZB 3LD2A 3FYNA 1KUVA 3FIXA 2ATRA 4CYPA 4CRYB 1ZO0A 4CGNA 3DR6A 4MBUA 3P2HA 4QVTA 4OLLA 4FD6A 3ZJ0A 2Z3PA 2VQYA 1WWZA 4A95A 3IWGA 4KS9A 3A9LA 2B4BA 4MFZA 4QB9A 2REEA 4UA3A 4XNHB 2DPTA 4AG9A 5JQ4A 5IX3A 2WSAA 3KKWA 1N71A 1CJWA 4M85A 4R3KA 3S6FA 4A31A 3TOBA 3OWCA 1KZFA 2CNSA 4R57A 4A32A 3TTHA 4E2AA 4B12A 1GHEA 2ZW6A 4HKFA 1M1DA 3EXNA 2Z11A 5AGEA 2G3AA 4XNHC 5I0CA 3G8WA 4PSXA 3V8IA 1QSRA 4C7HA 1I21A 3B8GA 1UFHA 2R1IA 3IU2A 4NEXA 4A33A 2G3TA 3R96A 2BEIA 1YX0A 2Q44A 2FXFA 1XIXA 4QUSA 4ORFA 3TO6A 1S60A 1YREA 1QSOA 4FD4A 5EBVA 1KUYA 4H6UA 1S7LA 3BJ8A 4KOWA 3DNSA 4L8AA 2B4DB 4CYNA 3D8PA 5IB0A 4RI1A 4MHDA 2OU2A 2VI7A 4YFJA 4MJ8A 2Z3LA 3SXOA 1I12A 1IIDA 3D2MA 1LRZA 4XPLA 3R95A 3BLNA 2OH1A 5G21A 3FBUA 4OAEA 1RXTA 1S3ZA 4C68A 4E8OA 3S6KA 2B5GB 2FIAA 3JTKA 2VEZA 2Z3NA 1QSTA 4KVOE 4H6ZA 3DDDA 3WR7A 4GS4A 4CGMA 3IU1A 1NMTA 2FIWA 4AB7A 2OB0A 2CY2A 4UWIA 2EVNA 1S7NA 2ZW5A 5JPHA 4Y49B 4KSAA 3D2PA 5DWMA 4FD7A 1S7KA 4BBHA 2GE3A 5AG5A 5HMNA 1S5KA 4MY3A 3NE7A 4AG7A 4YRHA 2Z3KA 4K30A 4M3SA 3QB8A 1Q2YA 4MFQA 4AVAA 3S6GA 2VZYA 2C27A 4JXRA 2Q4VA 4Q36A 2EUIA 2PSWA 3TFYA 2ZW7A 2F5IA 2JDDA 4Y49C 4CAVA 1QSNA 1Y9WA 3EFAA 4II9A 2OZGA 3TT2A 2GANA 1ON0A 4UFXA 2Z3OA 5AG6A 5AG7A 5F46A 1MJAA 1RO5A 1VHSA 1M44A 3I9SA 4JLYA 2R8VA 3E0KA 4KUAA 5DWNA 3IGRA 2PR8A 4ONUA 3F0AA 2YNCC 2B58A 1B6BA 5EC4A 3PGPA 3ZZIA 2P6GA 2ZW4A 2Q04A 2BSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y7R A;  4PSW A;  2P6F A;  2PQ8 A;  5HH1 A;  2FSR A;  4OAD A;  2Q0Y A;  3R9F A;  2B4D A;  4YGO A;  1U6M A;  2NMT A;  4U9Z A;  3R1K A;  2WPW A;  3TE4 A;  4F0Y A;  2VXK A;  5ISV A;  1PU9 A;  2P6E A;  2I79 A;  4ZBG A;  4NXY A;  3JVN A;  5E96 A;  4B5P B;  1IB1 E;  2PRB A;  4HNX B;  1P4N A;  4MI4 A;  2IL4 A;  4JWP A;  5C88 A;  3LOD A;  3R9E A;  4AVC A;  2HV2 A;  2H5M A;  4F6A A;  1IYL A;  4BMH A;  1XMT A;  3SXN A;  1Y9K A;  2Q7B A;  2PR1 A;  4HNY B;  3C26 A;  3VWE A;  1R57 A;  1FY7 A;  2BUE A;  2FL4 A;  2Z0Z A;  3JUW A;  4L89 A;  3TO7 A;  1I1D A;  3VWD A;  1YVK A;  4UBR A;  1M4D A;  1SQH A;  3CXP A;  2I00 A;  2KCW A;  2B3U A;  4PV6 A;  2K5T A;  1YR0 A;  2QIR A;  5IV0 A;  1YLE A;  4KVM E;  2D4P A;  1XF8 A;  2QEC A;  2ZXV A;  3CXS A;  3W91 A;  2G0B A;  4UWJ A;  5CNP A;  3FXT A;  4KOR A;  1QSM A;  4R87 A;  1BO4 A;  1L0C A;  3DR8 A;  2PDO A;  1M4G A;  2WPX A;  3N7Z A;  3UY5 A;  3MGD A;  1WK4 A;  4CAX A;  3H4Q A;  3TO9 A;  1MK4 A;  4QBJ A;  5KTA A;  1S7F A;  4RS2 A;  2FCK A;  2BL1 A;  2RC4 A;  3F5B A;  2OZU A;  4CS0 B;  2P0W A;  3F8K A;  3RYO A;  5J8F A;  2O28 A;  4EVY A;  1IIC A;  5KTC A;  1Z4R A;  2VZZ A;  1Z9U A;  4KOV A;  4X5K A;  4PK3 A;  1Q2C A;  3FRM A;  4KVX A;  2X7B A;  1K4J A;  3TCV A;  1B87 A;  1TIQ A;  4KUB A;  1YGH A;  1M4I A;  3T9Y A;  3R9G A;  2REF A;  4U5Y A;  5F49 A;  5H84 A;  2HUZ A;  1Z4E A;  2Q4Y A;  4LUA A;  1P0H A;  2D4O A;  3TOA A;  1OZP A;  4KLV A;  2CNT A;  4B5O A;  2B3V A;  2R7H A;  5F47 A;  5C82 A;  1XEB A;  2Y0M A;  2VBQ A;  3EY5 A;  4I49 A;  4KLW A;  1PUA A;  2JDC A;  2J8M A;  2B5G A;  2Z10 A;  5J8C A;  3BJ7 A;  2AE6 A;  3P2F A;  1BOB A;  4QC6 A;  4IF5 A;  4H89 A;  3DSB A;  1YVO A;  4NCZ A;  3QAH A;  1V0C A;  3I3G A;  4DNC A;  2CNM A;  3GYA A;  2FT0 A;  4MY0 A;  4PK2 A;  5FVJ A;  4U9Y A;  2JEV A;  4HNW B;  4XPD B;  4NSQ A;  3D3S A;  1MJB A;  4XPK A;  1IYK A;  5GCN A;  2DXQ A;  4CAW A;  4KZT A;  3W6X A;  3S6H A;  2R98 A;  1CM0 A;  5KTD A;  4JJX A;  4R9M A;  4R3L A;  3PZJ A;  1KUX A;  4E0A A;  1NE9 A;  2FE7 A;  4KOY A;  3EO4 A;  1Q2D A;  1YK3 A;  2QML A;  4IUS A;  2OZH A;  4KOS A;  5H86 A;  3FNC A;  1VKC A;  2J8R A;  3SHP A;  4XPD C;  1XE4 A;  4J3G A;  4JXQ A;  4AVB A;  3T90 A;  1NSL A;  2AJ6 A;  2GIV A;  2ZPA A;  3GKR A;  4LX9 A;  2JLM A;  1J4J A;  3FB3 A;  4JD6 A;  4KOU A;  3G3S A;  2HQY A;  4KOT A;  2J8N A;  3CXQ A;  1MJ9 A;  2FS5 A;  2PC1 A;  3EC4 A;  3W6S A;  4FD5 A;  3K9U A;  4B5P A;  4KOX A;  2A4N A;  5F48 A;  3GY9 A;  4NF1 A;  2ARH A;  3PP9 A;  4CRZ B;  3LD2 A;  3FYN A;  1KUV A;  3FIX A;  2ATR A;  4CRY B;  3DR6 A;  4MBU A;  3P2H A;  4QVT A;  4OLL A;  4FD6 A;  3ZJ0 A;  2VQY A;  1WWZ A;  3IWG A;  2B4B A;  4QB9 A;  2REE A;  4UA3 A;  4XNH B;  4AG9 A;  5JQ4 A;  5IX3 A;  3KKW A;  1N71 A;  1CJW A;  4M85 A;  4R3K A;  3S6F A;  3TOB A;  3OWC A;  1KZF A;  2CNS A;  4R57 A;  3TTH A;  4E2A A;  1GHE A;  2ZW6 A;  4HKF A;  1M1D A;  3EXN A;  2Z11 A;  2G3A A;  4XNH C;  5I0C A;  3G8W A;  4PSX A;  3V8I A;  1QSR A;  1I21 A;  3B8G A;  1UFH A;  2R1I A;  4NEX A;  2G3T A;  3R96 A;  2BEI A;  1YX0 A;  2Q44 A;  2FXF A;  1XIX A;  4QUS A;  4ORF A;  3TO6 A;  1S60 A;  1YRE A;  1QSO A;  4FD4 A;  5EBV A;  1KUY A;  4H6U A;  1S7L A;  3BJ8 A;  4KOW A;  3DNS A;  4L8A A;  2B4D B;  3D8P A;  5IB0 A;  4RI1 A;  4MHD A;  2OU2 A;  2VI7 A;  4YFJ A;  4MJ8 A;  3SXO A;  1I12 A;  1IID A;  3D2M A;  1LRZ A;  4XPL A;  3R95 A;  3BLN A;  2OH1 A;  3FBU A;  4OAE A;  1RXT A;  1S3Z A;  4E8O A;  3S6K A;  2B5G B;  2FIA A;  2VEZ A;  1QST A;  4KVO E;  4H6Z A;  3DDD A;  3WR7 A;  4GS4 A;  1NMT A;  2FIW A;  4AB7 A;  2OB0 A;  2CY2 A;  4UWI A;  2EVN A;  1S7N A;  2ZW5 A;  5JPH A;  4Y49 B;  3D2P A;  5DWM A;  4FD7 A;  1S7K A;  2GE3 A;  5HMN A;  1S5K A;  4MY3 A;  3NE7 A;  4AG7 A;  4YRH A;  4K30 A;  4M3S A;  3QB8 A;  1Q2Y A;  4AVA A;  3S6G A;  2VZY A;  2C27 A;  4JXR A;  2Q4V A;  2EUI A;  2PSW A;  3TFY A;  2ZW7 A;  2F5I A;  2JDD A;  4Y49 C;  4CAV A;  1QSN A;  1Y9W A;  3EFA A;  4II9 A;  2OZG A;  3TT2 A;  2GAN A;  1ON0 A;  5F46 A;  1MJA A;  1RO5 A;  1VHS A;  1M44 A;  3I9S A;  4JLY A;  2R8V A;  3E0K A;  4KUA A;  5DWN A;  3IGR A;  2PR8 A;  4ONU A;  3F0A A;  2B58 A;  1B6B A;  5EC4 A;  3PGP A;  3ZZI A;  2P6G A;  2ZW4 A;  2Q04 A;  2BSW A; 
#chains in the Genus database with same CATH topology
 1DE4 C;  2PE3 A;  1Y7R A;  4PSW A;  2P6F A;  2AFU A;  4CAE A;  2PQ8 A;  5LYL A;  5HH1 A;  3S9N A;  2FSR A;  4OAD A;  1BPN A;  2Q0Y A;  1NSA A;  3R9F A;  4P4D A;  2DF5 A;  2B4D A;  4PXC A;  4G1P A;  3SJF A;  4YGO A;  1U6M A;  2F7V A;  1CG2 A;  2NMT A;  4U9Z A;  3R1K A;  2PJ7 A;  2WPW A;  4GM5 A;  3TE4 A;  4F0Y A;  2VXK A;  5ISV A;  1PU9 A;  2P6E A;  2I79 A;  1Z2L A;  4ZBG A;  1KWM A;  4NXY A;  4Q38 A;  4EME A;  1UWY A;  3JVN A;  4CGL A;  5E96 A;  4B5P B;  2FVG A;  1IB1 E;  3KGQ A;  2QVP A;  2PRB A;  4HNX B;  4P6Y A;  1P4N A;  3JRU A;  4MMO A;  4MI4 A;  4UFW A;  2IL4 A;  1FNO A;  4X8I A;  2IJZ A;  3TX8 A;  3NH4 A;  4A37 A;  3B2Y A;  4JWP A;  5C88 A;  1Z5R A;  3D7H A;  3FF3 A;  3LOD A;  1VGY A;  4R76 A;  3D7G A;  4P45 A;  2PVW A;  3R9E A;  2PJ1 A;  4AVC A;  1IU8 A;  2H5M A;  2HV2 A;  3PRT A;  3PFE A;  4F6A A;  1IYL A;  3VAT A;  4BMH A;  1XMT A;  3SXN A;  1ELM P;  1Y9K A;  3KAS A;  2Q7B A;  5HXD A;  2PR1 A;  5HVF A;  3ISZ A;  4HNY B;  2PJC A;  3C26 A;  3NE8 A;  4MCQ A;  2PJ2 A;  3VWE A;  1R57 A;  1FY7 A;  2BUE A;  2FL4 A;  2Z0Z A;  3JUW A;  4L89 A;  3TO7 A;  1I1D A;  1Z8X A;  3T8W A;  4A39 A;  4AXV A;  4MFP A;  4R7M A;  3VWD A;  4NFR A;  2EK9 A;  1YVK A;  4WWV A;  4UBR A;  3SI1 A;  1M4D A;  1SQH A;  3CXP A;  2I00 A;  2KCW A;  3FH4 A;  3PB7 X;  2B3U A;  3S9L A;  2JBJ A;  4PV6 A;  4UFV A;  2K5T A;  1YR0 A;  2QIR A;  4MCS A;  5IV0 A;  4NGM A;  1YLE A;  3IIB A;  2XEI A;  3B7I A;  4KVM E;  4PXE A;  4EFD A;  2C6P A;  1TXR A;  2WZN A;  2D4P A;  4IAV A;  4NGQ A;  2ZEM A;  1XF8 A;  5A27 A;  4P4I A;  3MRU A;  2QEC A;  3CDX A;  2C6C A;  1CBX A;  2Q7S A;  2ZXV A;  2PCU A;  3CXS A;  3W91 A;  1BPM A;  2G0B A;  2I3C A;  4UWJ A;  3VH9 A;  4NGN A;  2PJ3 A;  4NGT A;  1FT7 A;  5CNP A;  4B13 A;  3CT9 A;  2RB7 A;  2V8V A;  1HEE A;  2YNE A;  3FXT A;  4P4F A;  3RAM A;  1QSM A;  4KOR A;  4R87 A;  4MXU A;  1BO4 A;  1L0C A;  3DR8 A;  4IHM A;  4PXB A;  2PDO A;  1M4G A;  2WPX A;  3N7Z A;  4A30 A;  3UY5 A;  4CGP A;  1OBR A;  3MGD A;  1WK4 A;  3PBE A;  4RN7 A;  4CAX A;  3FEE A;  3WC7 A;  3H4Q A;  5LYI A;  4WJB A;  3TO9 A;  4CYO A;  4X2T A;  1MK4 A;  2PJA A;  7CPA A;  3NH5 A;  3S9M A;  5A28 A;  4QBJ A;  5KTA A;  3LAC A;  1JWQ A;  1H8L A;  3K2K A;  3D67 A;  1S7F A;  4C2Z A;  4MHZ A;  4RS2 A;  2FCK A;  2BL1 A;  2RC4 A;  3B3S A;  3H8E A;  3F5B A;  2OZU A;  1ELL P;  5JM6 A;  4B11 A;  1AMP A;  4FWU A;  4CS0 B;  2P0W A;  3F8K A;  3RYO A;  4MCR A;  4MFK A;  3D7F A;  4IK2 A;  5J8F A;  2O28 A;  4EVY A;  2PJ0 A;  2PIY A;  5F09 A;  1IIC A;  5KTC A;  1Z4R A;  2VZZ A;  4OC0 A;  5IB9 A;  5HVG A;  1Z9U A;  4KSI A;  3SI0 A;  4KOV A;  4UCN A;  2V77 A;  2AFO A;  4X5K A;  4PK3 A;  4W9Y A;  1Q2C A;  4ZGY B;  3FRM A;  3KQX A;  4KVX A;  2X7B A;  2XEF A;  1Y0R A;  1K4J A;  4A2Z A;  3TCV A;  1B87 A;  3IEH A;  4UCM A;  1TIQ A;  2F8H A;  1YGH A;  1GYT A;  1M4I A;  4KUB A;  2PJ5 A;  4OC2 A;  4FAI A;  3T9Y A;  3R9G A;  2XEG A;  2AFM A;  2REF A;  4U5Y A;  1F2P A;  5F49 A;  2V8D A;  3TC8 A;  5H84 A;  2CXA A;  2HUZ A;  1F2O A;  3ISX A;  4PXD A;  4TNU A;  1Z4E A;  2Q4Y A;  4LUA A;  1P0H A;  2D4O A;  4PPZ A;  3TOA A;  3V38 A;  1YQE A;  1OZP A;  3BI1 A;  2HB6 A;  4M6G A;  4KLV A;  5LRG A;  1M4L A;  2CNT A;  4B5O A;  2B3V A;  4M6I A;  4R8F A;  3H8G A;  2R7H A;  5F47 A;  3CPA A;  2PJ6 A;  3BHX A;  5C82 A;  1HDQ A;  1XEB A;  2BCO A;  2Y0M A;  2VBQ A;  3EY5 A;  4I49 A;  1CPX A;  4KLW A;  4UIB A;  1PUA A;  2JDC A;  2J8M A;  3N5F A;  3NH8 A;  8CPA A;  2B5G A;  4ZY2 A;  4FBE A;  2Z10 A;  5J8C A;  4DJL A;  3LWU A;  4TWE A;  4HPS A;  2CF4 A;  3BJ7 A;  4MFL A;  2AE6 A;  3P2F A;  1BOB A;  4QC6 A;  3RO0 A;  4ZI6 A;  4YWY A;  4IF5 A;  4UEZ A;  3GB0 A;  1ZG9 A;  4H89 A;  3DSB A;  1YVO A;  4NCZ A;  2PJ4 A;  3QAH A;  4BD9 A;  5AG4 A;  4OP4 A;  1V0C A;  2EO8 A;  3I3G A;  4DNC A;  4F0X A;  5G1Z A;  4CYQ A;  2CNM A;  4JZ0 A;  1R3N A;  2QYV A;  1Z8T A;  3GYA A;  4MHY A;  2FT0 A;  5THW A;  4MY0 A;  2DEA A;  4PK2 A;  5FVJ A;  4U9Y A;  2JEV A;  2XEJ A;  4C7I A;  1RTQ A;  4HNW B;  4XPD B;  4NSQ A;  1BLL E;  4B14 A;  4MFJ A;  3D3S A;  1MJB A;  4OIW A;  4XPK A;  2YNC A;  2C6G A;  1IYK A;  3IWE A;  1ZLH A;  5LRJ A;  5GCN A;  2DXQ A;  2PIZ A;  4CAW A;  4KZT A;  2ZED A;  3S6H A;  2R98 A;  1CM0 A;  3GLJ A;  3W6X A;  1LOK A;  5KTD A;  2WUU A;  4H2K A;  4JJX A;  4OC4 A;  4R9M A;  4R3L A;  3IO1 A;  3PZJ A;  1YW4 A;  1KUX A;  4E0A A;  1NE9 A;  1YSJ A;  4B6Z A;  2FE7 A;  3NFZ A;  1PCA A;  1TF8 A;  3EO4 A;  3IJ3 A;  4KOY A;  4UCP A;  1Q2D A;  1YK3 A;  2ODF A;  2QML A;  2OZH A;  4FUU A;  4IUS A;  1ZG7 A;  4KOS A;  4M6H A;  2AFS A;  2Q51 A;  4ZX9 A;  5H86 A;  3FNC A;  2P6G A;  4R6T A;  4C2Y A;  1VKC A;  2J8R A;  5G22 A;  4XPD C;  1XE4 A;  3SHP A;  3VAR A;  2Z3M A;  3H5Z A;  4J3G A;  4JXQ A;  4AVB A;  3T90 A;  5K8P A;  1NSL A;  2AJ6 A;  1JQG A;  2GIV A;  2J9A A;  3KHX A;  3KL9 A;  1CX8 A;  2ZPA A;  3GKR A;  4LX9 A;  2JLM A;  1TKF A;  2G9D A;  4P10 A;  1J4J A;  3FB3 A;  2GLJ A;  4ZY1 A;  4DYO A;  4JD6 A;  2EWB A;  3FJU A;  5BWA B;  4KOU A;  3DLJ A;  4P4E A;  3DGV A;  3G3S A;  5K8M A;  2HQY A;  4MHN A;  3GUX A;  5EMI A;  4KOT A;  2J8N A;  3RBU A;  3CXQ A;  2EBJ A;  4C2X A;  2YGW A;  3I1U A;  4P4B A;  4KSF A;  3SJE A;  1MJ9 A;  2FS5 A;  1IY7 A;  1CP7 A;  2PC1 A;  3KR5 A;  1LAM A;  3EC4 A;  1A2Z A;  3KR4 A;  3W6S A;  4B10 A;  2BOA A;  1XJO A;  4ZY0 A;  4NGS A;  4FD5 A;  5G20 A;  3NA6 A;  4CAF A;  5LRK A;  4PQA A;  3K9U A;  2ZOF A;  4B5P A;  4MRI A;  1AUG A;  1EE3 P;  4KOX A;  2YND A;  2A4N A;  4OID A;  5F48 A;  4ZX8 A;  3GY9 A;  4NF1 A;  2IMO A;  3CZX A;  2DPS A;  2ARH A;  1YLO A;  3PP9 A;  4CRZ B;  5HVH A;  1Y7E A;  2CTB A;  3KQZ A;  3FYN A;  3LD2 A;  1CP6 A;  1KUV A;  3FIX A;  2ATR A;  3SJX A;  2V8H A;  4NGR A;  3IFE A;  1IOF A;  4CYP A;  4OC3 A;  1Z8W A;  4CRY B;  1XOV A;  1ZO0 A;  4CGN A;  1ARM A;  1DTD A;  1YME A;  5DS0 A;  2IQ6 A;  3DR6 A;  4MBU A;  3P2H A;  4QVT A;  3BXM A;  4Z65 A;  4OLL A;  4FD6 A;  3ZJ0 A;  3SJG A;  2JEW A;  2Z3P A;  2VQY A;  1WWZ A;  1ARL A;  4A95 A;  3IWG A;  1YW6 A;  4KS9 A;  3A9L A;  2B4B A;  4MFZ A;  4NGP A;  5CPA A;  3HLP A;  3FED A;  4QB9 A;  1BAV A;  1LAN A;  6CPA A;  2JBK A;  1XBU A;  2REE A;  4UA3 A;  4XNH B;  4NJR A;  2DPT A;  2GLF A;  2ZEN A;  3B3W A;  4UIA A;  2ZEG A;  3KHZ A;  4AG9 A;  5JQ4 A;  2O4H A;  2PJ8 A;  5IX3 A;  2WSA A;  2ZEH A;  3KKW A;  4BIN A;  1TKJ A;  1N71 A;  2PRQ A;  1CJW A;  4RUH A;  4M85 A;  3WC5 A;  4R3K A;  5LYF A;  3RNZ A;  3S6F A;  1Q7L A;  4A31 A;  2BO9 A;  3CPX A;  3TOB A;  1VHO A;  1KZF A;  2CNS A;  3OWC A;  4R57 A;  4A32 A;  3B3V A;  3TTH A;  4Q7A A;  4E2A A;  4F8Z A;  5K8N A;  4B12 A;  3FEC A;  1GHE A;  2ZW6 A;  4O23 A;  4ZYQ A;  4OC1 A;  3PB9 X;  1X12 A;  2AFW A;  1M1D A;  4HKF A;  1LCP A;  4EWT A;  3EXN A;  2Z11 A;  3FX6 A;  5AGE A;  2ZEO A;  1LAP A;  3B3C A;  2G3A A;  3RZA A;  3H8F A;  1TKH A;  4XNH C;  5I0C A;  2ZEE A;  2NSM A;  3G8W A;  4PSX A;  2AFX A;  2OR4 A;  3V8I A;  1QSR A;  5D8N A;  5K8O A;  4C7H A;  1I21 A;  3KZW A;  3B8G A;  1UFH A;  2R1I A;  3IU2 A;  4NEX A;  3PB6 X;  2Q43 A;  4A33 A;  3V7Z A;  3BI0 A;  2G3T A;  4OC5 A;  3R96 A;  2BEI A;  3KI9 A;  1YX0 A;  2Q44 A;  1LFW A;  2FXF A;  3QNV A;  1XIX A;  4LQ6 A;  4QUS A;  4ORF A;  3TO6 A;  1S60 A;  4F9V A;  3PBB A;  1YRE A;  4GXH A;  1QSO A;  4FD4 A;  5EBV A;  4F9U A;  1XFO A;  2ZOG A;  1KUY A;  4H6U A;  4K3N A;  4LQG A;  4DUK A;  5CBM A;  1S7L A;  5JH9 A;  2O53 A;  3PFO A;  3BJ8 A;  2CTC A;  1Y0Y A;  1IGB A;  3L2N A;  4CGO A;  1F57 A;  1R43 A;  1ZLI A;  2V8G A;  3DNS A;  4KOW A;  4L8A A;  2B4D B;  4CYN A;  3D8P A;  4UEF A;  4MCP A;  2WYR A;  4RI1 A;  5I4M A;  5IB0 A;  4MHD A;  4A38 A;  2QJ8 A;  5J1Q A;  4UF4 A;  2OU2 A;  2VI7 A;  3WC6 A;  4YFJ A;  4MJ8 A;  4UEE A;  1PYT B;  3B35 A;  2GFQ A;  1X10 A;  2Z3L A;  1Z8L A;  3SXO A;  1CPS A;  1I12 A;  5JGF A;  3PEI A;  1IID A;  3D2M A;  3IC1 A;  3D7D A;  3PB8 X;  1LRZ A;  4X3R A;  2POK A;  4OME A;  4XPL A;  3R95 A;  4MHP A;  3BLN A;  1HDU A;  2OH1 A;  5G21 A;  3FBU A;  4CPA A;  4OAE A;  3IWW A;  1AYE A;  1RXT A;  1S3Z A;  3B3T A;  3SI2 A;  4C68 A;  4E8O A;  3S6K A;  2B5G B;  2FIA A;  3JTK A;  3WT4 A;  1XMB A;  2VEZ A;  2Z3N A;  1QST A;  1VHE A;  2ZEL A;  3PB4 X;  4H6Z A;  3DDD A;  4KVO E;  2C1C A;  3HUV A;  4GS4 A;  3WR7 A;  4CGM A;  3IU1 A;  1NMT A;  3D4U A;  2FIW A;  2ZEF A;  4AB7 A;  2EK8 A;  2OB0 A;  2CY2 A;  2Q4Z A;  4UWI A;  2EVN A;  1S7N A;  2PJ9 A;  2ZW5 A;  2VL1 A;  5JPH A;  4Y49 B;  4KSA A;  3D2P A;  4OKO A;  5DWM A;  4P44 A;  4FD7 A;  1S7K A;  2OOT A;  4YU9 A;  2GE3 A;  4BBH A;  5AG5 A;  5HMN A;  1QMU A;  2PJB A;  1S5K A;  3D68 A;  3WAB A;  4MY3 A;  3NE7 A;  4AG7 A;  2ANP A;  4YRH A;  2Z3K A;  4K30 A;  2RFH A;  4M3S A;  3QB8 A;  5LYD A;  1Q2Y A;  4MFQ A;  4JYW A;  4NJQ A;  4AVA A;  3S6G A;  2VZY A;  2C27 A;  2GRE A;  2GU2 A;  4ONW A;  3GIU A;  4JXR A;  1XRY A;  2Q4V A;  4Q36 A;  2EUI A;  2PSW A;  3MN8 A;  3TFY A;  3QAY A;  2ABZ A;  2ZW7 A;  2HC9 A;  2JDD A;  2F5I A;  4Y49 C;  1QSN A;  4CAV A;  2CIJ A;  1Y9W A;  3EFA A;  4II9 A;  2OZG A;  3TT2 A;  2GAN A;  1ZG8 A;  1ON0 A;  4UFX A;  2Z3O A;  5AG6 A;  5AG7 A;  5F46 A;  1MJA A;  2PVV A;  1RO5 A;  1VHS A;  1M44 A;  3I9S A;  2ZEP A;  4JLY A;  5D29 A;  5ELY A;  2R8V A;  3FVL A;  1TF9 A;  3E0K A;  4KUA A;  5DWN A;  3FMC A;  3IGR A;  2PR8 A;  4ONU A;  3D66 A;  1VIX A;  2AFZ A;  4P4J A;  3F0A A;  2YNC C;  2B58 A;  1B6B A;  3K9T A;  3PGP A;  5EC4 A;  4A94 A;  1IOI A;  2NYQ A;  3ZZI A;  1QQ9 A;  2ZW4 A;  2Q04 A;  2BSW A;  3LMS A; 
#chains in the Genus database with same CATH homology
 1Y7R A;  4PSW A;  2P6F A;  4CAE A;  2PQ8 A;  5HH1 A;  2FSR A;  4OAD A;  2Q0Y A;  3R9F A;  2B4D A;  4YGO A;  1U6M A;  2NMT A;  4U9Z A;  3R1K A;  2WPW A;  3TE4 A;  4F0Y A;  2VXK A;  5ISV A;  1PU9 A;  2P6E A;  2I79 A;  4ZBG A;  4NXY A;  4Q38 A;  3JVN A;  4CGL A;  5E96 A;  4B5P B;  1IB1 E;  2PRB A;  4HNX B;  1P4N A;  4MI4 A;  4UFW A;  2IL4 A;  4JWP A;  5C88 A;  3LOD A;  3R9E A;  4AVC A;  2HV2 A;  2H5M A;  4F6A A;  1IYL A;  4BMH A;  1XMT A;  3SXN A;  1Y9K A;  2Q7B A;  2PR1 A;  4HNY B;  3C26 A;  3VWE A;  1R57 A;  1FY7 A;  2BUE A;  2FL4 A;  2Z0Z A;  3JUW A;  4L89 A;  3TO7 A;  1I1D A;  4MFP A;  3VWD A;  1YVK A;  4UBR A;  1M4D A;  1SQH A;  3CXP A;  2I00 A;  2KCW A;  2B3U A;  4PV6 A;  4UFV A;  2K5T A;  1YR0 A;  2QIR A;  5IV0 A;  1YLE A;  4KVM E;  2D4P A;  1XF8 A;  5A27 A;  2QEC A;  2ZXV A;  3CXS A;  3W91 A;  2G0B A;  4UWJ A;  5CNP A;  4B13 A;  2YNE A;  3FXT A;  1QSM A;  4KOR A;  4R87 A;  1BO4 A;  1L0C A;  3DR8 A;  2PDO A;  1M4G A;  2WPX A;  3N7Z A;  4A30 A;  3UY5 A;  4CGP A;  3MGD A;  1WK4 A;  4CAX A;  3H4Q A;  3TO9 A;  4CYO A;  1MK4 A;  5A28 A;  4QBJ A;  5KTA A;  1S7F A;  4C2Z A;  4RS2 A;  2FCK A;  2BL1 A;  2RC4 A;  3F5B A;  2OZU A;  4B11 A;  4CS0 B;  2P0W A;  3F8K A;  3RYO A;  4MFK A;  5J8F A;  2O28 A;  4EVY A;  1IIC A;  5KTC A;  1Z4R A;  2VZZ A;  1Z9U A;  4KOV A;  4UCN A;  4X5K A;  4PK3 A;  1Q2C A;  4ZGY B;  3FRM A;  4KVX A;  2X7B A;  1K4J A;  4A2Z A;  3TCV A;  1B87 A;  4UCM A;  1TIQ A;  4KUB A;  1YGH A;  1M4I A;  3T9Y A;  3R9G A;  2REF A;  4U5Y A;  5F49 A;  5H84 A;  2CXA A;  2HUZ A;  1Z4E A;  2Q4Y A;  4LUA A;  1P0H A;  2D4O A;  3TOA A;  1OZP A;  4KLV A;  2CNT A;  4B5O A;  2B3V A;  2R7H A;  5F47 A;  5C82 A;  1XEB A;  2Y0M A;  2VBQ A;  3EY5 A;  4I49 A;  4KLW A;  1PUA A;  2JDC A;  2J8M A;  2B5G A;  2Z10 A;  5J8C A;  3BJ7 A;  4MFL A;  2AE6 A;  3P2F A;  1BOB A;  4QC6 A;  4IF5 A;  4H89 A;  3DSB A;  1YVO A;  4NCZ A;  3QAH A;  5AG4 A;  1V0C A;  3I3G A;  4DNC A;  4F0X A;  5G1Z A;  4CYQ A;  2CNM A;  3GYA A;  2FT0 A;  4MY0 A;  4PK2 A;  5FVJ A;  4U9Y A;  2JEV A;  4C7I A;  4HNW B;  4XPD B;  4NSQ A;  4B14 A;  4MFJ A;  3D3S A;  1MJB A;  4XPK A;  2YNC A;  3IWE A;  1IYK A;  5GCN A;  2DXQ A;  4CAW A;  4KZT A;  3W6X A;  3S6H A;  2R98 A;  1CM0 A;  5KTD A;  2WUU A;  4JJX A;  4R9M A;  4R3L A;  3PZJ A;  1KUX A;  4E0A A;  1NE9 A;  2FE7 A;  4KOY A;  3EO4 A;  4UCP A;  4CGO A;  1Q2D A;  1YK3 A;  2QML A;  4IUS A;  2OZH A;  4KOS A;  5H86 A;  3FNC A;  4C2Y A;  1VKC A;  2J8R A;  5G22 A;  4XPD C;  1XE4 A;  3SHP A;  2Z3M A;  3H5Z A;  4J3G A;  4JXQ A;  4AVB A;  3T90 A;  1NSL A;  2AJ6 A;  2GIV A;  2ZPA A;  3GKR A;  4LX9 A;  2JLM A;  1J4J A;  3FB3 A;  4JD6 A;  5BWA B;  4KOU A;  3G3S A;  2HQY A;  4KOT A;  2J8N A;  3CXQ A;  4C2X A;  2YGW A;  4KSF A;  1MJ9 A;  2FS5 A;  2PC1 A;  3EC4 A;  4B10 A;  3W6S A;  4FD5 A;  5G20 A;  4CAF A;  3K9U A;  4B5P A;  4KOX A;  2YND A;  2A4N A;  5F48 A;  3GY9 A;  4NF1 A;  2DPS A;  2ARH A;  3PP9 A;  4CRZ B;  3LD2 A;  3FYN A;  1KUV A;  3FIX A;  2ATR A;  4CYP A;  4CRY B;  1ZO0 A;  4CGN A;  3DR6 A;  4MBU A;  3P2H A;  4QVT A;  4OLL A;  4FD6 A;  3ZJ0 A;  2Z3P A;  2VQY A;  1WWZ A;  4A95 A;  3IWG A;  4KS9 A;  3A9L A;  2B4B A;  4MFZ A;  4QB9 A;  2REE A;  4UA3 A;  4XNH B;  2DPT A;  4AG9 A;  5JQ4 A;  5IX3 A;  2WSA A;  3KKW A;  1N71 A;  1CJW A;  4M85 A;  4R3K A;  3S6F A;  4A31 A;  3TOB A;  3OWC A;  1KZF A;  2CNS A;  4R57 A;  4A32 A;  3TTH A;  4E2A A;  4B12 A;  1GHE A;  2ZW6 A;  4HKF A;  1M1D A;  3EXN A;  2Z11 A;  5AGE A;  2G3A A;  4XNH C;  5I0C A;  3G8W A;  4PSX A;  3V8I A;  1QSR A;  4C7H A;  1I21 A;  3B8G A;  1UFH A;  2R1I A;  3IU2 A;  4NEX A;  4A33 A;  2G3T A;  3R96 A;  2BEI A;  1YX0 A;  2Q44 A;  2FXF A;  1XIX A;  4QUS A;  4ORF A;  3TO6 A;  1S60 A;  1YRE A;  1QSO A;  4FD4 A;  5EBV A;  1KUY A;  4H6U A;  1S7L A;  3BJ8 A;  4KOW A;  3DNS A;  4L8A A;  2B4D B;  4CYN A;  3D8P A;  5IB0 A;  4RI1 A;  4MHD A;  2OU2 A;  2VI7 A;  4YFJ A;  4MJ8 A;  2Z3L A;  3SXO A;  1I12 A;  1IID A;  3D2M A;  1LRZ A;  4XPL A;  3R95 A;  3BLN A;  2OH1 A;  5G21 A;  3FBU A;  4OAE A;  1RXT A;  1S3Z A;  4C68 A;  4E8O A;  3S6K A;  2B5G B;  2FIA A;  3JTK A;  2VEZ A;  2Z3N A;  1QST A;  4KVO E;  4H6Z A;  3DDD A;  3WR7 A;  4GS4 A;  4CGM A;  3IU1 A;  1NMT A;  2FIW A;  4AB7 A;  2OB0 A;  2CY2 A;  4UWI A;  2EVN A;  1S7N A;  2ZW5 A;  5JPH A;  4Y49 B;  4KSA A;  3D2P A;  5DWM A;  4FD7 A;  1S7K A;  4BBH A;  2GE3 A;  5AG5 A;  5HMN A;  1S5K A;  4MY3 A;  3NE7 A;  4AG7 A;  4YRH A;  2Z3K A;  4K30 A;  4M3S A;  3QB8 A;  1Q2Y A;  4MFQ A;  4AVA A;  3S6G A;  2VZY A;  2C27 A;  4JXR A;  2Q4V A;  4Q36 A;  2EUI A;  2PSW A;  3TFY A;  2ZW7 A;  2F5I A;  2JDD A;  4Y49 C;  4CAV A;  1QSN A;  1Y9W A;  3EFA A;  4II9 A;  2OZG A;  3TT2 A;  2GAN A;  1ON0 A;  4UFX A;  2Z3O A;  5AG6 A;  5AG7 A;  5F46 A;  1MJA A;  1RO5 A;  1VHS A;  1M44 A;  3I9S A;  4JLY A;  2R8V A;  3E0K A;  4KUA A;  5DWN A;  3IGR A;  2PR8 A;  4ONU A;  3F0A A;  2YNC C;  2B58 A;  1B6B A;  5EC4 A;  3PGP A;  3ZZI A;  2P6G A;  2ZW4 A;  2Q04 A;  2BSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...