3FYNA

Crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
152
Chain Sequence
NLYFQGLSPQVRTAHIGDVPVLVRLMSEFYQEAGFALPHDAAIRAFKALLGKPDLGRIWLIAEGTESVGYIVLTLGFSMEYGGLRGFVDDFFVRPNARGKGLGAAALQTVKQGCCDLGVRALLVETGVYSRAGFEESGRMLLGQALAPPIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron gene cassette protein HFX_CASS3
publication title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS3
rcsb
source organism Uncultured bacterium
molecule tags Structural genomics, unknown function
total genus 40
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fynA00
1ON0A 2P6EA 3ZZIA 3WR7A 1B6BA 3FBUA 4R3KA 4MY0A 4XPLA 3TCVA 4MBUA 1VHSA 2NMTA 4YRHA 3EY5A 4II9A 4BMHA 1KUXA 1QSRA 4XNHC 4MI4A 5EC4A 4M85A 3R9FA 2GE3A 4KVME 2WPWA 4RS2A 5C88A 1MK4A 4H6ZA 4UWIA 4E8OA 3TT2A 2B58A 4HNWB 4F0YA 3GYAA 1RO5A 2Q4VA 3ZJ0A 1J4JA 2ZW7A 1YGHA 4L8AA 5F48A 5F46A 2R98A 2ARHA 4QUSA 5F49A 1MJAA 4CS0B 3JUWA 3TO6A 2FT0A 4KOVA 3SHPA 4OADA 1YX0A 1S5KA 1GHEA 3GKRA 3P2HA 2OB0A 4ZBGA 4ORFA 4PSXA 2PR8A 1Y9WA 3TOBA 2G3TA 1M44A 2B5GA 2FXFA 2PRBA 2R8VA 2PQ8A 3D2MA 4KZTA 2VZYA 3QAHA 1B87A 2J8MA 4Y49C 3DR8A 1Q2YA 3CXSA 2JEVA 3TE4A 1I12A 2HUZA 5F47A 4M3SA 2JDDA 4XPDC 1KZFA 5GCNA 4CAVA 4JD6A 1QSTA 3TFYA 4OLLA 4JJXA 2D4PA 1L0CA 2Z10A 3R1KA 3FRMA 3R9EA 1YVOA 1M4GA 2Q44A 4EVYA 3BLNA 3UY5A 2FE7A 2ZW5A 3I9SA 3W6XA 4AG7A 4CRYB 2CNTA 4YFJA 1NMTA 4B5OA 3VWEA 2PC1A 5JQ4A 5CNPA 4E0AA 2HQYA 4PK3A 2FL4A 4KUAA 4PK2A 2R7HA 2FIAA 2VQYA 5DWNA 2OZGA 2P0WA 3EO4A 3EC4A 2B3VA 3TTHA 2BL1A 1I1DA 2K5TA 3F8KA 1S3ZA 4J3GA 2PSWA 4JXQA 3DR6A 1MJ9A 2AJ6A 1S60A 4R9MA 2CNSA 2VXKA 1S7FA 4GS4A 5FVJA 4IF5A 1U6MA 2EUIA 4B5PB 2B3UA 1XF8A 2FIWA 2OH1A 1YK3A 4JLYA 1BOBA 2J8NA 3TOAA 1S7LA 3PZJA 4MY3A 4KOTA 3EFAA 3S6GA 1MJBA 4KOXA 4R57A 4K30A 4HNYB 4RI1A 3S6KA 3SXOA 2ZW4A 2X7BA 5J8CA 4R3LA 5IX3A 4KLVA 2BEIA 2R1IA 1XEBA 4XPKA 4KORA 4PSWA 4FD4A 1NSLA 5H86A 1P4NA 2G3AA 3EXNA 3D8PA 3FB3A 4QB9A 2ZPAA 2FS5A 1NE9A 3KKWA 4X5KA 1Y9KA 1P0HA 4QC6A 4R87A 2OZUA 4U5YA 1S7KA 1V0CA 3R9GA 1IB1E 4KOSA 4H89A 2O28A 1XMTA 3OWCA 2ATRA 3B8GA 4KVXA 4DNCA 5H84A 2WPXA 3LD2A 4F6AA 1OZPA 2BSWA 5J8FA 2QIRA 4KUBA 4AVCA 4YGOA 2GANA 2PDOA 2JLMA 2IL4A 1CM0A 1K4JA 3G3SA 4AVAA 3F5BA 2Q7BA 4I49A 1Q2CA 2A4NA 4KLWA 5HH1A 1IICA 2VZZA 2VI7A 4CRZB 3IWGA 2VEZA 4JXRA 4B5PA 2I00A 2Y0MA 4NF1A 4CAWA 2CNMA 2REFA 2ZXVA 2C27A 2OU2A 2I79A 4QVTA 3T9YA 4U9YA 4KOYA 4FD5A 3K9UA 5KTCA 3W6SA 1S7NA 1IYLA 2Q4YA 1PUAA 3S6HA 4AG9A 4XPDB 4FD7A 1LRZA 1YR0A 3W91A 4NSQA 1QSOA 1IIDA 3TO9A 5KTDA 2H5MA 1QSMA 2OZHA 2REEA 3N7ZA 5KTAA 2RC4A 1CJWA 3I3GA 4KOWA 2FSRA 4LX9A 2G0BA 2KCWA 2BUEA 5ISVA 3C26A 3NE7A 4H6UA 3IGRA 3PGPA 3MGDA 3D3SA 1Q2DA 3BJ8A 1N71A 2Z11A 3S6FA 2P6FA 2P6GA 1SQHA 1KUVA 4FD6A 3TO7A 3D2PA 1Y7RA 4UBRA 2EVNA 3DSBA 1TIQA 4UA3A 1BO4A 1XIXA 2B4BA 3DDDA 2J8RA 3DNSA 4LUAA 3VWDA 1FY7A 5IB0A 2B4DB 4NEXA 3CXQA 4UWJA 1UFHA 3LODA 2CY2A 3QB8A 4NXYA 3PP9A 2QECA 3JVNA 4MJ8A 4XNHB 2D4OA 2JDCA 2VBQA 1I21A 1QSNA 4KOUA 3SXNA 1YREA 3CXPA 5E96A 3R95A 3P2FA 4KVOE 5C82A 1M4DA 2PR1A 3FXTA 1YLEA 4IUSA 2GIVA 3FYNA 3E0KA 2Q0YA 1Z4RA 4MHDA 1WWZA 5IV0A 1XE4A 3FIXA 3FNCA 4JWPA 1Z9UA 2DXQA 3GY9A 1VKCA 5I0CA 2Z0ZA 1R57A 2F5IA 3G8WA 4HNXB 1M1DA 1Z4EA 5JPHA 3F0AA 4ONUA 4L89A 2ZW6A 4Y49B 5DWMA 3R96A 4AVBA 2QMLA 4QBJA 2Q04A 4E2AA 4AB7A 2HV2A 1IYKA 4HKFA 2B5GB 1RXTA 3V8IA 1YVKA 4CAXA 2B4DA 4NCZA 4U9ZA 1WK4A 4PV6A 2AE6A 5HMNA 2FCKA 3H4QA 5EBVA 3BJ7A 1KUYA 1M4IA 3T90A 4OAEA 1PU9A 3RYOA
chains in the Genus database with same CATH superfamily
4C2XA 3CZXA 1ON0A 1PCAA 2P6EA 3K2KA 4NGRA 3WR7A 1B6BA 3FBUA 3ZZIA 4R3KA 4MY0A 2ZEHA 4C2ZA 1BLLE 4DYOA 3KASA 2AFZA 4XPLA 4CYOA 3TCVA 4M6IA 1CBXA 1CPXA 4P10A 4MBUA 2DPSA 3FEDA 3PB4X 1YLOA 1VHSA 2NMTA 4YRHA 3EY5A 3S9LA 4II9A 2J9AA 4RN7A 2BCOA 4BMHA 1KUXA 4M6HA 1QSRA 4NGSA 3KQZA 2ABZA 3H8EA 3WC6A 3LMSA 4MI4A 2QJ8A 2Q4ZA 4XNHC 5EC4A 4M85A 4OIWA 3R9FA 3PBEA 3CPXA 4CGOA 2BO9A 5LYDA 2GE3A 4KVME 2WPWA 2JBJA 2GU2A 4RS2A 5C88A 4Q38A 1MK4A 4H6ZA 4UWIA 4E8OA 4A95A 3TT2A 2B58A 2AFUA 2EO8A 3KI9A 4HNWB 4F0YA 3GYAA 1RO5A 1CP6A 2Q4VA 4MCSA 1J4JA 2ZW7A 3ZJ0A 1ZLHA 2C6GA 2ZOFA 1YGHA 4L8AA 5F48A 5F46A 1OBRA 2R98A 4MFQA 2WSAA 2PJ1A 2ARHA 4QUSA 5F49A 4CGMA 1MJAA 4CS0B 3JUWA 4PXBA 2WUUA 3TO6A 2FT0A 1ZG7A 3D7HA 4KOVA 3SHPA 4CPAA 3D7GA 4OADA 2C6CA 1YX0A 1S5KA 1TKJA 1GHEA 1ZLIA 1ZG9A 2CTCA 2ZEPA 3GKRA 4KS9A 4CYQA 4P6YA 1CPSA 3IFEA 3MN8A 2OB0A 3IWEA 3P2HA 4UEEA 4ORFA 4ZBGA 4CAEA 4MFLA 2EK9A 1NSAA 4PSXA 4OC5A 5LYIA 3GUXA 2PR8A 5IB9A 3PBBA 1Y9WA 3TOBA 4H2KA 2G3TA 4UEZA 5HVFA 4CYPA 1M44A 2B5GA 5CBMA 2FXFA 4P4FA 4JYWA 2Z3PA 1LAPA 2PRBA 2R8VA 4B13A 2PQ8A 1VIXA 3D2MA 4KZTA 2VZYA 3QAHA 3CDXA 2V8VA 4BINA 1B87A 2J8MA 4Y49C 3DR8A 1Q2YA 3CXSA 2JEVA 3TE4A 3VARA 1I12A 4ZI6A 1YW4A 1TF9A 2HUZA 5F47A 4M3SA 2JDDA 4B6ZA 3SJXA 4RUHA 4XPDC 1KZFA 3B3WA 5GCNA 4CAVA 2WZNA 4JD6A 1QSTA 1HDQA 2YNDA 2ZEEA 3QAYA 4MHPA 4PXDA 3TFYA 1F57A 2FVGA 4OLLA 1TXRA 4JJXA 4C68A 8CPAA 2D4PA 1R43A 3FJUA 2NSMA 1L0CA 2Z10A 3R1KA 4B12A 4WWVA 3FRMA 3R9EA 1YVOA 1M4GA 1TKFA 2Q44A 4EVYA 1ELLP 3BLNA 3UY5A 2FE7A 2ZW5A 3I9SA 3IC1A 3W6XA 4R76A 2G9DA 1UWYA 3LWUA 4AG7A 4CRYB 2CNTA 2PJ9A 4YFJA 1H8LA 3GB0A 1NMTA 2NYQA 4B5OA 3VWEA 3NFZA 1Z8XA 2PC1A 2XEGA 5JQ4A 4P4BA 4NJRA 5CNPA 4E0AA 2HQYA 3LACA 1X10A 2FL4A 3DGVA 4PK3A 4KUAA 4YU9A 5AG5A 3WC5A 4FBEA 4UEFA 3FMCA 4PK2A 2R7HA 2FIAA 2VQYA 5DWNA 2OOTA 4EFDA 5LRKA 2OZGA 2HC9A 2QVPA 1ELMP 2P0WA 3NH4A 3EO4A 4OC0A 2POKA 3EC4A 2B3VA 4LQ6A 4A2ZA 3FH4A 3TTHA 2BL1A 2PIYA 4KSFA 1I1DA 2K5TA 2AFMA 3F8KA 3PEIA 4LQGA 4PXEA 3V38A 1ZG8A 1S3ZA 4J3GA 2PSWA 4JXQA 3DR6A 1MJ9A 2AJ6A 4CGPA 1S60A 4IK2A 4R9MA 2CNSA 3NH5A 3SJGA 2VXKA 3QNVA 2RB7A 4UCNA 1S7FA 4GS4A 5FVJA 1BPMA 4IF5A 1U6MA 2EUIA 4B5PB 2B3UA 3SI1A 4UIAA 1IOIA 4M6GA 1XF8A 4MHYA 2FIWA 2Z3MA 2OH1A 2XEJA 1YK3A 4JLYA 1BOBA 2J8NA 3D68A 3TOAA 1YQEA 1S7LA 3PZJA 4MY3A 2PJAA 4KOTA 3EFAA 3S6GA 1MJBA 4KOXA 2IQ6A 4MHNA 5D29A 5G22A 4R57A 4K30A 4HNYB 1BPNA 4UFVA 4B10A 4RI1A 3S6KA 3SXOA 3B3VA 2PJ5A 3I1UA 4P44A 2ZEGA 1VGYA 2ZW4A 3S9NA 2PRQA 2PJ0A 2X7BA 5J8CA 1DTDA 1XJOA 3L2NA 4R3LA 5IX3A 1HEEA 4KLVA 2YGWA 3IIBA 2Q43A 4B11A 2BEIA 5THWA 4KSIA 2R1IA 1XEBA 3V7ZA 4XPKA 4KORA 4PSWA 4FD4A 1NSLA 5H86A 4AXVA 4O23A 1P4NA 2G3AA 4C7HA 3EXNA 4UFWA 2PJ8A 3D8PA 1BAVA 3BI1A 3FB3A 4QB9A 2ZPAA 2FS5A 1NE9A 3KKWA 3KR5A 4X5KA 1Y9KA 4R8FA 3HLPA 5AG4A 1P0HA 4QC6A 3IO1A 2F8HA 5J1QA 4R87A 1DE4C 2OZUA 4U5YA 1S7KA 3WC7A 2JBKA 1V0CA 4PPZA 3R9GA 3KL9A 1IB1E 3D67A 2PJBA 4KOSA 5LYFA 4H89A 2O28A 2GFQA 3GLJA 3D66A 4CGNA 1XMTA 3PRTA 4UF4A 3PFEA 3H5ZA 2AFWA 3ISZA 3OWCA 1XBUA 4A94A 2ATRA 4G1PA 1YW6A 4MRIA 1IY7A 1AYEA 3B8GA 1Y0YA 4EWTA 4OIDA 4X3RA 4KVXA 4DNCA 5H84A 2ZEFA 2WPXA 4OC2A 3LD2A 5AG7A 2WYRA 4F6AA 1HDUA 1OZPA 2BSWA 5J8FA 3TX8A 2QIRA 3BHXA 4KUBA 4AVCA 4YGOA 2GANA 1RTQA 2Q7SA 1QMUA 3CPAA 5LRGA 2C1CA 2PDOA 2JLMA 2DEAA 2IL4A 2ODFA 3B3TA 1CM0A 1K4JA 4K3NA 3G3SA 4AVAA 3K9TA 3F5BA 2Q7BA 4I49A 4YWYA 1Q2CA 3B35A 4CYNA 5G1ZA 3SJFA 2A4NA 4KLWA 1LCPA 1XOVA 5HH1A 1IICA 2VZZA 2VI7A 3FVLA 1XRYA 2ZELA 4CRZB 1M4LA 1A2ZA 3IWGA 4MXUA 2VEZA 4JXRA 4B5PA 4GXHA 3A9LA 4A32A 4NGQA 4OC1A 2DPTA 2I00A 4F0XA 1IU8A 2PIZA 3BXMA 4P4EA 2ZEOA 2Y0MA 4NF1A 4CAWA 1Y0RA 5JH9A 2OR4A 2YNEA 3B7IA 2PJ7A 7CPAA 5K8MA 2PJ6A 2CNMA 6CPAA 1VHEA 4NJQA 3KHXA 1Z2LA 1F2PA 2REFA 2ZXVA 1LOKA 3SI0A 4A38A 2C27A 1F2OA 2ZEMA 5LYLA 2XEFA 2V8HA 2OU2A 3IEHA 2I79A 3D4UA 4QVTA 3T9YA 2YNCA 3D7DA 4U9YA 2PVWA 4KOYA 4PXCA 3FECA 4A30A 4FD5A 2DF5A 3K9UA 1Y7EA 1Z8LA 2EK8A 5KTCA 2CF4A 3W6SA 1S7NA 1IYLA 2Q4YA 3NA6A 4TWEA 1PUAA 3S6HA 4AG9A 4NGTA 4XPDB 4FD7A 1LRZA 1YR0A 4EMEA 3W91A 4NSQA 1QSOA 4UCMA 1IIDA 1QQ9A 4WJBA 3TO9A 5KTDA 3B3SA 4A37A 2H5MA 1QSMA 2CIJA 2AFSA 2YNCC 3RNZA 4MFZA 4IHMA 3IJ3A 2OZHA 2REEA 3N7ZA 5KTAA 3B3CA 2RC4A 1CJWA 2F7VA 3RAMA 4W9YA 3I3GA 4Q7AA 2ZEDA 4OC4A 2Z3LA 1LAMA 4KOWA 5K8OA 1AMPA 4FWUA 3GIUA 4NGNA 3TC8A 1AUGA 2FSRA 4LX9A 4P4DA 2O53A 3D7FA 2GLFA 4OC3A 4F8ZA 5AGEA 4A31A 4UIBA 1GYTA 4MFPA 2AFXA 3PB9X 2G0BA 1R3NA 2KCWA 1TKHA 2Q51A 2BUEA 2JEWA 5ISVA 4P4JA 3C26A 1Z5RA 3H8FA 3IGRA 2EWBA 1X12A 3NE7A 3PGPA 4H6UA 4MCPA 3MGDA 3D3SA 1Q2DA 3BJ8A 3JRUA 1N71A 1XFOA 4ZX8A 2Z11A 3S6FA 2P6FA 2PVVA 2P6GA 4MHZA 1SQHA 1KUVA 4UFXA 4FD6A 4HPSA 3TO7A 4KSAA 3D2PA 3KZWA 5ELYA 1Y7RA 4UBRA 1IGBA 3KHZA 2EVNA 3DSBA 3IU2A 2CTBA 3WT4A 3MRUA 4MFJA 5D8NA 3FEEA 1TIQA 3SI2A 4X2TA 4UA3A 1BO4A 3PB6X 5HVGA 3RBUA 1CP7A 1XIXA 3KR4A 3PFOA 3IWWA 2B4BA 3DDDA 2J8RA 3DNSA 4LUAA 4PQAA 3VWDA 5I4MA 1FY7A 4ZY2A 3S9MA 2B4DB 4OP4A 5IB0A 4NEXA 2V8DA 1ARMA 5LRJA 4BD9A 5G20A 3NH8A 3CXQA 1XMBA 4UWJA 5EMIA 1UFHA 3LODA 5HVHA 1CG2A 2EBJA 2CY2A 3QB8A 4NXYA 3PP9A 2QECA 3IU1A 5A28A 3JVNA 4MJ8A 4XNHB 2D4OA 4C2YA 2JDCA 3B2YA 2AFOA 1I21A 2VBQA 4IAVA 2VL1A 1QSNA 4KOUA 4B14A 3SXNA 1YREA 3CXPA 4BBHA 5E96A 4DUKA 3R95A 2GLJA 3P2FA 1Z8WA 4F9UA 2ZENA 5JGFA 5HXDA 4ZY1A 4KVOE 1VHOA 3HUVA 5C82A 1YSJA 4NGMA 1TF8A 4Q36A 1M4DA 2PR1A 3FXTA 1YLEA 4IUSA 2GIVA 4ONWA 5A27A 4OMEA 3BI0A 3FYNA 3E0KA 5AG6A 1IOFA 2XEIA 3RZAA 1FT7A 3KQXA 2Q0YA 2Z3NA 2ZOGA 1Z4RA 2CXAA 4Z65A 4MHDA 5BWAB 4TNUA 2HB6A 1LANA 2PE3A 1WWZA 5K8PA 5IV0A 2PJ4A 5G21A 1XE4A 4A39A 1PYTB 3FIXA 4GM5A 2IJZA 2O4HA 4R6TA 3FNCA 4JWPA 1Z9UA 4MMOA 2BOAA 2DXQA 5CPAA 4ZGYB 5JM6A 3GY9A 3PB7X 1VKCA 1KWMA 2Z0ZA 1JQGA 1LFWA 3JTKA 4ZX9A 1R57A 2F5IA 3G8WA 2PJCA 2RFHA 2QYVA 4HNXB 1M1DA 1Z4EA 2PCUA 3DLJA 5JPHA 3F0AA 4ONUA 4L89A 1Z8TA 1ZO0A 2I3CA 2ZW6A 3H8GA 4P4IA 4Y49B 5DWMA 3R96A 4NGPA 4AVBA 1FNOA 2QMLA 2PJ2A 4MCQA 3VATA 3WABA 1YMEA 2ANPA 3SJEA 4QBJA 4UCPA 2Q04A 1Q7LA 5K8NA 2PJ3A 2V77A 4E2AA 4CAFA 4CGLA 5I0CA 1ARLA 4OKOA 4R7MA 2HV2A 4AB7A 1IYKA 4F9VA 2Z3KA 4HKFA 4DJLA 1JWQA 2B5GB 2GREA 1RXTA 2IMOA 4FUUA 3V8IA 3FF3A 2C6PA 4ZY0A 1YVKA 4MCRA 2V8GA 4CAXA 5F09A 4FAIA 4C7IA 4A33A 2Z3OA 3KGQA 2B4DA 4ZYQA 4NFRA 3RO0A 4NCZA 3NE8A 3ISXA 4U9ZA 4JZ0A 3N5FA 1WK4A 5DS0A 4PV6A 1CX8A 2AE6A 3FX6A 5HMNA 2FCKA 3H4QA 5EBVA 3BJ7A 4P45A 1KUYA 4MFKA 3VH9A 1M4IA 3T90A 4OAEA 3T8WA 3CT9A 3PB8X 1PU9A 4X8IA 3RYOA 1EE3P
chains in the Genus database with same CATH topology
4C2XA 1ON0A 2P6EA 3ZZIA 3WR7A 1B6BA 3FBUA 4R3KA 4MY0A 4C2ZA 4XPLA 4CYOA 3TCVA 4MBUA 2DPSA 1VHSA 2NMTA 4YRHA 3EY5A 4II9A 4BMHA 1KUXA 1QSRA 4XNHC 4MI4A 5EC4A 4CGOA 4M85A 3R9FA 2GE3A 4KVME 2WPWA 4RS2A 5C88A 4Q38A 1MK4A 4H6ZA 4UWIA 4E8OA 4A95A 3TT2A 2B58A 4HNWB 4F0YA 3GYAA 1RO5A 2Q4VA 3ZJ0A 1J4JA 2ZW7A 1YGHA 4L8AA 5F48A 5F46A 2R98A 4MFQA 2WSAA 2ARHA 4QUSA 5F49A 4CGMA 1MJAA 4CS0B 3JUWA 2WUUA 3TO6A 2FT0A 4KOVA 3SHPA 4OADA 1YX0A 1S5KA 1GHEA 3GKRA 4CYQA 4KS9A 4CAEA 3P2HA 2OB0A 3IWEA 4ZBGA 4ORFA 4MFLA 4PSXA 2PR8A 1Y9WA 3TOBA 2G3TA 4CYPA 1M44A 2B5GA 2FXFA 2Z3PA 2PRBA 2R8VA 4B13A 2PQ8A 3D2MA 4KZTA 2VZYA 3QAHA 1B87A 2J8MA 4Y49C 3DR8A 1Q2YA 3CXSA 2JEVA 3TE4A 1I12A 2HUZA 5F47A 4M3SA 2JDDA 4XPDC 1KZFA 5GCNA 4CAVA 4JD6A 1QSTA 2YNDA 3TFYA 4OLLA 4JJXA 4C68A 2D4PA 1L0CA 2Z10A 3R1KA 4B12A 3FRMA 3R9EA 1YVOA 1M4GA 2Q44A 4EVYA 3BLNA 3UY5A 2FE7A 2ZW5A 3I9SA 3W6XA 4AG7A 4CRYB 2CNTA 4YFJA 1NMTA 4B5OA 3VWEA 2PC1A 5JQ4A 5CNPA 4E0AA 2HQYA 4PK3A 2FL4A 4KUAA 5AG5A 4PK2A 2R7HA 2FIAA 2VQYA 5DWNA 2OZGA 2P0WA 3EO4A 3EC4A 2B3VA 4A2ZA 3TTHA 2BL1A 4KSFA 1I1DA 2K5TA 3F8KA 1S3ZA 4J3GA 2PSWA 4JXQA 3DR6A 1MJ9A 2AJ6A 4CGPA 1S60A 4R9MA 2CNSA 2VXKA 4UCNA 1S7FA 4GS4A 5FVJA 4IF5A 1U6MA 2EUIA 4B5PB 2B3UA 1XF8A 2FIWA 2Z3MA 2OH1A 1YK3A 4JLYA 1BOBA 2J8NA 3TOAA 1S7LA 3PZJA 4MY3A 4KOTA 3EFAA 3S6GA 1MJBA 4KOXA 5G22A 4R57A 4K30A 4HNYB 4UFVA 4B10A 4RI1A 3S6KA 3SXOA 2ZW4A 2X7BA 5J8CA 4R3LA 5IX3A 4KLVA 2YGWA 4B11A 2BEIA 2R1IA 1XEBA 4XPKA 4KORA 4PSWA 4FD4A 1NSLA 5H86A 1P4NA 2G3AA 4C7HA 3EXNA 4UFWA 3D8PA 3FB3A 4QB9A 2ZPAA 2FS5A 1NE9A 3KKWA 5AG4A 4X5KA 1Y9KA 1P0HA 4QC6A 4R87A 2OZUA 4U5YA 1S7KA 1V0CA 3R9GA 1IB1E 4KOSA 4H89A 2O28A 4CGNA 1XMTA 3H5ZA 3OWCA 2ATRA 3B8GA 4KVXA 4DNCA 5H84A 2WPXA 3LD2A 5AG7A 4F6AA 1OZPA 2BSWA 5J8FA 2QIRA 4KUBA 4AVCA 4YGOA 2GANA 2PDOA 2JLMA 2IL4A 1CM0A 1K4JA 3G3SA 4AVAA 3F5BA 2Q7BA 4I49A 1Q2CA 4CYNA 5G1ZA 2A4NA 4KLWA 5HH1A 1IICA 2VZZA 2VI7A 4CRZB 3IWGA 2VEZA 4JXRA 4B5PA 3A9LA 4A32A 2DPTA 2I00A 4F0XA 2Y0MA 4NF1A 4CAWA 2YNEA 2CNMA 2REFA 2ZXVA 2C27A 2OU2A 2I79A 4QVTA 3T9YA 2YNCA 4U9YA 4KOYA 4A30A 4FD5A 3K9UA 5KTCA 3W6SA 1S7NA 1IYLA 2Q4YA 1PUAA 3S6HA 4AG9A 4XPDB 4FD7A 1LRZA 1YR0A 3W91A 4NSQA 1QSOA 4UCMA 1IIDA 3TO9A 5KTDA 2H5MA 1QSMA 2YNCC 4MFZA 2OZHA 2REEA 3N7ZA 5KTAA 2RC4A 1CJWA 3I3GA 2Z3LA 4KOWA 2FSRA 4LX9A 5AGEA 4A31A 4MFPA 2G0BA 2KCWA 2BUEA 5ISVA 3C26A 3NE7A 4H6UA 3IGRA 3PGPA 3MGDA 3D3SA 1Q2DA 3BJ8A 1N71A 2Z11A 3S6FA 2P6FA 2P6GA 1SQHA 1KUVA 4UFXA 4FD6A 3TO7A 4KSAA 3D2PA 1Y7RA 4UBRA 2EVNA 3DSBA 3IU2A 4MFJA 1TIQA 4UA3A 1BO4A 1XIXA 2B4BA 3DDDA 2J8RA 3DNSA 4LUAA 3VWDA 1FY7A 5IB0A 2B4DB 4NEXA 5G20A 3CXQA 4UWJA 1UFHA 3LODA 2CY2A 3QB8A 4NXYA 3PP9A 2QECA 3IU1A 5A28A 3JVNA 4MJ8A 4XNHB 2D4OA 4C2YA 2JDCA 2VBQA 1I21A 1QSNA 4KOUA 4B14A 3SXNA 1YREA 3CXPA 4BBHA 5E96A 3R95A 3P2FA 4KVOE 5C82A 4Q36A 1M4DA 2PR1A 3FXTA 1YLEA 4IUSA 2GIVA 5A27A 3FYNA 3E0KA 5AG6A 2Q0YA 2Z3NA 1Z4RA 2CXAA 4MHDA 5BWAB 1WWZA 5IV0A 5G21A 1XE4A 3FIXA 3FNCA 4JWPA 1Z9UA 2DXQA 4ZGYB 3GY9A 1VKCA 5I0CA 2Z0ZA 3JTKA 1R57A 2F5IA 3G8WA 4HNXB 1M1DA 1Z4EA 5JPHA 3F0AA 4ONUA 4L89A 1ZO0A 2ZW6A 4Y49B 5DWMA 3R96A 4AVBA 2QMLA 4QBJA 4UCPA 2Q04A 4E2AA 4CAFA 4CGLA 4AB7A 2HV2A 1IYKA 4HKFA 2Z3KA 2B5GB 1RXTA 3V8IA 1YVKA 4CAXA 4C7IA 4A33A 2Z3OA 2B4DA 4NCZA 4U9ZA 1WK4A 4PV6A 2AE6A 5HMNA 2FCKA 3H4QA 5EBVA 3BJ7A 1KUYA 4MFKA 1M4IA 3T90A 4OAEA 1PU9A 3RYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON0 A;  2P6E A;  3ZZI A;  3WR7 A;  1B6B A;  3FBU A;  4R3K A;  4MY0 A;  4XPL A;  3TCV A;  4MBU A;  1VHS A;  2NMT A;  4YRH A;  3EY5 A;  4II9 A;  4BMH A;  1KUX A;  1QSR A;  4XNH C;  4MI4 A;  5EC4 A;  4M85 A;  3R9F A;  2GE3 A;  4KVM E;  2WPW A;  4RS2 A;  5C88 A;  1MK4 A;  4H6Z A;  4UWI A;  4E8O A;  3TT2 A;  2B58 A;  4HNW B;  4F0Y A;  3GYA A;  1RO5 A;  2Q4V A;  3ZJ0 A;  1J4J A;  2ZW7 A;  1YGH A;  4L8A A;  5F48 A;  5F46 A;  2R98 A;  2ARH A;  4QUS A;  5F49 A;  1MJA A;  4CS0 B;  3JUW A;  3TO6 A;  2FT0 A;  4KOV A;  3SHP A;  4OAD A;  1YX0 A;  1S5K A;  1GHE A;  3GKR A;  3P2H A;  2OB0 A;  4ZBG A;  4ORF A;  4PSX A;  2PR8 A;  1Y9W A;  3TOB A;  2G3T A;  1M44 A;  2B5G A;  2FXF A;  2PRB A;  2R8V A;  2PQ8 A;  3D2M A;  4KZT A;  2VZY A;  3QAH A;  1B87 A;  2J8M A;  4Y49 C;  3DR8 A;  1Q2Y A;  3CXS A;  2JEV A;  3TE4 A;  1I12 A;  2HUZ A;  5F47 A;  4M3S A;  2JDD A;  4XPD C;  1KZF A;  5GCN A;  4CAV A;  4JD6 A;  1QST A;  3TFY A;  4OLL A;  4JJX A;  2D4P A;  1L0C A;  2Z10 A;  3R1K A;  3FRM A;  3R9E A;  1YVO A;  1M4G A;  2Q44 A;  4EVY A;  3BLN A;  3UY5 A;  2FE7 A;  2ZW5 A;  3I9S A;  3W6X A;  4AG7 A;  4CRY B;  2CNT A;  4YFJ A;  1NMT A;  4B5O A;  3VWE A;  2PC1 A;  5JQ4 A;  5CNP A;  4E0A A;  2HQY A;  4PK3 A;  2FL4 A;  4KUA A;  4PK2 A;  2R7H A;  2FIA A;  2VQY A;  5DWN A;  2OZG A;  2P0W A;  3EO4 A;  3EC4 A;  2B3V A;  3TTH A;  2BL1 A;  1I1D A;  2K5T A;  3F8K A;  1S3Z A;  4J3G A;  2PSW A;  4JXQ A;  3DR6 A;  1MJ9 A;  2AJ6 A;  1S60 A;  4R9M A;  2CNS A;  2VXK A;  1S7F A;  4GS4 A;  5FVJ A;  4IF5 A;  1U6M A;  2EUI A;  4B5P B;  2B3U A;  1XF8 A;  2FIW A;  2OH1 A;  1YK3 A;  4JLY A;  1BOB A;  2J8N A;  3TOA A;  1S7L A;  3PZJ A;  4MY3 A;  4KOT A;  3EFA A;  3S6G A;  1MJB A;  4KOX A;  4R57 A;  4K30 A;  4HNY B;  4RI1 A;  3S6K A;  3SXO A;  2ZW4 A;  2X7B A;  5J8C A;  4R3L A;  5IX3 A;  4KLV A;  2BEI A;  2R1I A;  1XEB A;  4XPK A;  4KOR A;  4PSW A;  4FD4 A;  1NSL A;  5H86 A;  1P4N A;  2G3A A;  3EXN A;  3D8P A;  3FB3 A;  4QB9 A;  2ZPA A;  2FS5 A;  1NE9 A;  3KKW A;  4X5K A;  1Y9K A;  1P0H A;  4QC6 A;  4R87 A;  2OZU A;  4U5Y A;  1S7K A;  1V0C A;  3R9G A;  1IB1 E;  4KOS A;  4H89 A;  2O28 A;  1XMT A;  3OWC A;  2ATR A;  3B8G A;  4KVX A;  4DNC A;  5H84 A;  2WPX A;  3LD2 A;  4F6A A;  1OZP A;  2BSW A;  5J8F A;  2QIR A;  4KUB A;  4AVC A;  4YGO A;  2GAN A;  2PDO A;  2JLM A;  2IL4 A;  1CM0 A;  1K4J A;  3G3S A;  4AVA A;  3F5B A;  2Q7B A;  4I49 A;  1Q2C A;  2A4N A;  4KLW A;  5HH1 A;  1IIC A;  2VZZ A;  2VI7 A;  4CRZ B;  3IWG A;  2VEZ A;  4JXR A;  4B5P A;  2I00 A;  2Y0M A;  4NF1 A;  4CAW A;  2CNM A;  2REF A;  2ZXV A;  2C27 A;  2OU2 A;  2I79 A;  4QVT A;  3T9Y A;  4U9Y A;  4KOY A;  4FD5 A;  3K9U A;  5KTC A;  3W6S A;  1S7N A;  1IYL A;  2Q4Y A;  1PUA A;  3S6H A;  4AG9 A;  4XPD B;  4FD7 A;  1LRZ A;  1YR0 A;  3W91 A;  4NSQ A;  1QSO A;  1IID A;  3TO9 A;  5KTD A;  2H5M A;  1QSM A;  2OZH A;  2REE A;  3N7Z A;  5KTA A;  2RC4 A;  1CJW A;  3I3G A;  4KOW A;  2FSR A;  4LX9 A;  2G0B A;  2KCW A;  2BUE A;  5ISV A;  3C26 A;  3NE7 A;  4H6U A;  3IGR A;  3PGP A;  3MGD A;  3D3S A;  1Q2D A;  3BJ8 A;  1N71 A;  2Z11 A;  3S6F A;  2P6F A;  2P6G A;  1SQH A;  1KUV A;  4FD6 A;  3TO7 A;  3D2P A;  1Y7R A;  4UBR A;  2EVN A;  3DSB A;  1TIQ A;  4UA3 A;  1BO4 A;  1XIX A;  2B4B A;  3DDD A;  2J8R A;  3DNS A;  4LUA A;  3VWD A;  1FY7 A;  5IB0 A;  2B4D B;  4NEX A;  3CXQ A;  4UWJ A;  1UFH A;  3LOD A;  2CY2 A;  3QB8 A;  4NXY A;  3PP9 A;  2QEC A;  3JVN A;  4MJ8 A;  4XNH B;  2D4O A;  2JDC A;  2VBQ A;  1I21 A;  1QSN A;  4KOU A;  3SXN A;  1YRE A;  3CXP A;  5E96 A;  3R95 A;  3P2F A;  4KVO E;  5C82 A;  1M4D A;  2PR1 A;  3FXT A;  1YLE A;  4IUS A;  2GIV A;  3FYN A;  3E0K A;  2Q0Y A;  1Z4R A;  4MHD A;  1WWZ A;  5IV0 A;  1XE4 A;  3FIX A;  3FNC A;  4JWP A;  1Z9U A;  2DXQ A;  3GY9 A;  1VKC A;  5I0C A;  2Z0Z A;  1R57 A;  2F5I A;  3G8W A;  4HNX B;  1M1D A;  1Z4E A;  5JPH A;  3F0A A;  4ONU A;  4L89 A;  2ZW6 A;  4Y49 B;  5DWM A;  3R96 A;  4AVB A;  2QML A;  4QBJ A;  2Q04 A;  4E2A A;  4AB7 A;  2HV2 A;  1IYK A;  4HKF A;  2B5G B;  1RXT A;  3V8I A;  1YVK A;  4CAX A;  2B4D A;  4NCZ A;  4U9Z A;  1WK4 A;  4PV6 A;  2AE6 A;  5HMN A;  2FCK A;  3H4Q A;  5EBV A;  3BJ7 A;  1KUY A;  1M4I A;  3T90 A;  4OAE A;  1PU9 A;  3RYO A; 
#chains in the Genus database with same CATH topology
 4C2X A;  3CZX A;  1ON0 A;  1PCA A;  2P6E A;  3K2K A;  4NGR A;  3WR7 A;  1B6B A;  3FBU A;  3ZZI A;  4R3K A;  4MY0 A;  2ZEH A;  4C2Z A;  1BLL E;  4DYO A;  3KAS A;  2AFZ A;  4XPL A;  4CYO A;  3TCV A;  4M6I A;  1CBX A;  1CPX A;  4P10 A;  4MBU A;  2DPS A;  3FED A;  3PB4 X;  1YLO A;  1VHS A;  2NMT A;  4YRH A;  3EY5 A;  3S9L A;  4II9 A;  2J9A A;  4RN7 A;  2BCO A;  4BMH A;  1KUX A;  4M6H A;  1QSR A;  4NGS A;  3KQZ A;  2ABZ A;  3H8E A;  3WC6 A;  3LMS A;  4MI4 A;  2QJ8 A;  2Q4Z A;  4XNH C;  5EC4 A;  4M85 A;  4OIW A;  3R9F A;  3PBE A;  3CPX A;  4CGO A;  2BO9 A;  5LYD A;  2GE3 A;  4KVM E;  2WPW A;  2JBJ A;  2GU2 A;  4RS2 A;  5C88 A;  4Q38 A;  1MK4 A;  4H6Z A;  4UWI A;  4E8O A;  4A95 A;  3TT2 A;  2B58 A;  2AFU A;  2EO8 A;  3KI9 A;  4HNW B;  4F0Y A;  3GYA A;  1RO5 A;  1CP6 A;  2Q4V A;  4MCS A;  1J4J A;  2ZW7 A;  3ZJ0 A;  1ZLH A;  2C6G A;  2ZOF A;  1YGH A;  4L8A A;  5F48 A;  5F46 A;  1OBR A;  2R98 A;  4MFQ A;  2WSA A;  2PJ1 A;  2ARH A;  4QUS A;  5F49 A;  4CGM A;  1MJA A;  4CS0 B;  3JUW A;  4PXB A;  2WUU A;  3TO6 A;  2FT0 A;  1ZG7 A;  3D7H A;  4KOV A;  3SHP A;  4CPA A;  3D7G A;  4OAD A;  2C6C A;  1YX0 A;  1S5K A;  1TKJ A;  1GHE A;  1ZLI A;  1ZG9 A;  2CTC A;  2ZEP A;  3GKR A;  4KS9 A;  4CYQ A;  4P6Y A;  1CPS A;  3IFE A;  3MN8 A;  2OB0 A;  3IWE A;  3P2H A;  4UEE A;  4ORF A;  4ZBG A;  4CAE A;  4MFL A;  2EK9 A;  1NSA A;  4PSX A;  4OC5 A;  5LYI A;  3GUX A;  2PR8 A;  5IB9 A;  3PBB A;  1Y9W A;  3TOB A;  4H2K A;  2G3T A;  4UEZ A;  5HVF A;  4CYP A;  1M44 A;  2B5G A;  5CBM A;  2FXF A;  4P4F A;  4JYW A;  2Z3P A;  1LAP A;  2PRB A;  2R8V A;  4B13 A;  2PQ8 A;  1VIX A;  3D2M A;  4KZT A;  2VZY A;  3QAH A;  3CDX A;  2V8V A;  4BIN A;  1B87 A;  2J8M A;  4Y49 C;  3DR8 A;  1Q2Y A;  3CXS A;  2JEV A;  3TE4 A;  3VAR A;  1I12 A;  4ZI6 A;  1YW4 A;  1TF9 A;  2HUZ A;  5F47 A;  4M3S A;  2JDD A;  4B6Z A;  3SJX A;  4RUH A;  4XPD C;  1KZF A;  3B3W A;  5GCN A;  4CAV A;  2WZN A;  4JD6 A;  1QST A;  1HDQ A;  2YND A;  2ZEE A;  3QAY A;  4MHP A;  4PXD A;  3TFY A;  1F57 A;  2FVG A;  4OLL A;  1TXR A;  4JJX A;  4C68 A;  8CPA A;  2D4P A;  1R43 A;  3FJU A;  2NSM A;  1L0C A;  2Z10 A;  3R1K A;  4B12 A;  4WWV A;  3FRM A;  3R9E A;  1YVO A;  1M4G A;  1TKF A;  2Q44 A;  4EVY A;  1ELL P;  3BLN A;  3UY5 A;  2FE7 A;  2ZW5 A;  3I9S A;  3IC1 A;  3W6X A;  4R76 A;  2G9D A;  1UWY A;  3LWU A;  4AG7 A;  4CRY B;  2CNT A;  2PJ9 A;  4YFJ A;  1H8L A;  3GB0 A;  1NMT A;  2NYQ A;  4B5O A;  3VWE A;  3NFZ A;  1Z8X A;  2PC1 A;  2XEG A;  5JQ4 A;  4P4B A;  4NJR A;  5CNP A;  4E0A A;  2HQY A;  3LAC A;  1X10 A;  2FL4 A;  3DGV A;  4PK3 A;  4KUA A;  4YU9 A;  5AG5 A;  3WC5 A;  4FBE A;  4UEF A;  3FMC A;  4PK2 A;  2R7H A;  2FIA A;  2VQY A;  5DWN A;  2OOT A;  4EFD A;  5LRK A;  2OZG A;  2HC9 A;  2QVP A;  1ELM P;  2P0W A;  3NH4 A;  3EO4 A;  4OC0 A;  2POK A;  3EC4 A;  2B3V A;  4LQ6 A;  4A2Z A;  3FH4 A;  3TTH A;  2BL1 A;  2PIY A;  4KSF A;  1I1D A;  2K5T A;  2AFM A;  3F8K A;  3PEI A;  4LQG A;  4PXE A;  3V38 A;  1ZG8 A;  1S3Z A;  4J3G A;  2PSW A;  4JXQ A;  3DR6 A;  1MJ9 A;  2AJ6 A;  4CGP A;  1S60 A;  4IK2 A;  4R9M A;  2CNS A;  3NH5 A;  3SJG A;  2VXK A;  3QNV A;  2RB7 A;  4UCN A;  1S7F A;  4GS4 A;  5FVJ A;  1BPM A;  4IF5 A;  1U6M A;  2EUI A;  4B5P B;  2B3U A;  3SI1 A;  4UIA A;  1IOI A;  4M6G A;  1XF8 A;  4MHY A;  2FIW A;  2Z3M A;  2OH1 A;  2XEJ A;  1YK3 A;  4JLY A;  1BOB A;  2J8N A;  3D68 A;  3TOA A;  1YQE A;  1S7L A;  3PZJ A;  4MY3 A;  2PJA A;  4KOT A;  3EFA A;  3S6G A;  1MJB A;  4KOX A;  2IQ6 A;  4MHN A;  5D29 A;  5G22 A;  4R57 A;  4K30 A;  4HNY B;  1BPN A;  4UFV A;  4B10 A;  4RI1 A;  3S6K A;  3SXO A;  3B3V A;  2PJ5 A;  3I1U A;  4P44 A;  2ZEG A;  1VGY A;  2ZW4 A;  3S9N A;  2PRQ A;  2PJ0 A;  2X7B A;  5J8C A;  1DTD A;  1XJO A;  3L2N A;  4R3L A;  5IX3 A;  1HEE A;  4KLV A;  2YGW A;  3IIB A;  2Q43 A;  4B11 A;  2BEI A;  5THW A;  4KSI A;  2R1I A;  1XEB A;  3V7Z A;  4XPK A;  4KOR A;  4PSW A;  4FD4 A;  1NSL A;  5H86 A;  4AXV A;  4O23 A;  1P4N A;  2G3A A;  4C7H A;  3EXN A;  4UFW A;  2PJ8 A;  3D8P A;  1BAV A;  3BI1 A;  3FB3 A;  4QB9 A;  2ZPA A;  2FS5 A;  1NE9 A;  3KKW A;  3KR5 A;  4X5K A;  1Y9K A;  4R8F A;  3HLP A;  5AG4 A;  1P0H A;  4QC6 A;  3IO1 A;  2F8H A;  5J1Q A;  4R87 A;  1DE4 C;  2OZU A;  4U5Y A;  1S7K A;  3WC7 A;  2JBK A;  1V0C A;  4PPZ A;  3R9G A;  3KL9 A;  1IB1 E;  3D67 A;  2PJB A;  4KOS A;  5LYF A;  4H89 A;  2O28 A;  2GFQ A;  3GLJ A;  3D66 A;  4CGN A;  1XMT A;  3PRT A;  4UF4 A;  3PFE A;  3H5Z A;  2AFW A;  3ISZ A;  3OWC A;  1XBU A;  4A94 A;  2ATR A;  4G1P A;  1YW6 A;  4MRI A;  1IY7 A;  1AYE A;  3B8G A;  1Y0Y A;  4EWT A;  4OID A;  4X3R A;  4KVX A;  4DNC A;  5H84 A;  2ZEF A;  2WPX A;  4OC2 A;  3LD2 A;  5AG7 A;  2WYR A;  4F6A A;  1HDU A;  1OZP A;  2BSW A;  5J8F A;  3TX8 A;  2QIR A;  3BHX A;  4KUB A;  4AVC A;  4YGO A;  2GAN A;  1RTQ A;  2Q7S A;  1QMU A;  3CPA A;  5LRG A;  2C1C A;  2PDO A;  2JLM A;  2DEA A;  2IL4 A;  2ODF A;  3B3T A;  1CM0 A;  1K4J A;  4K3N A;  3G3S A;  4AVA A;  3K9T A;  3F5B A;  2Q7B A;  4I49 A;  4YWY A;  1Q2C A;  3B35 A;  4CYN A;  5G1Z A;  3SJF A;  2A4N A;  4KLW A;  1LCP A;  1XOV A;  5HH1 A;  1IIC A;  2VZZ A;  2VI7 A;  3FVL A;  1XRY A;  2ZEL A;  4CRZ B;  1M4L A;  1A2Z A;  3IWG A;  4MXU A;  2VEZ A;  4JXR A;  4B5P A;  4GXH A;  3A9L A;  4A32 A;  4NGQ A;  4OC1 A;  2DPT A;  2I00 A;  4F0X A;  1IU8 A;  2PIZ A;  3BXM A;  4P4E A;  2ZEO A;  2Y0M A;  4NF1 A;  4CAW A;  1Y0R A;  5JH9 A;  2OR4 A;  2YNE A;  3B7I A;  2PJ7 A;  7CPA A;  5K8M A;  2PJ6 A;  2CNM A;  6CPA A;  1VHE A;  4NJQ A;  3KHX A;  1Z2L A;  1F2P A;  2REF A;  2ZXV A;  1LOK A;  3SI0 A;  4A38 A;  2C27 A;  1F2O A;  2ZEM A;  5LYL A;  2XEF A;  2V8H A;  2OU2 A;  3IEH A;  2I79 A;  3D4U A;  4QVT A;  3T9Y A;  2YNC A;  3D7D A;  4U9Y A;  2PVW A;  4KOY A;  4PXC A;  3FEC A;  4A30 A;  4FD5 A;  2DF5 A;  3K9U A;  1Y7E A;  1Z8L A;  2EK8 A;  5KTC A;  2CF4 A;  3W6S A;  1S7N A;  1IYL A;  2Q4Y A;  3NA6 A;  4TWE A;  1PUA A;  3S6H A;  4AG9 A;  4NGT A;  4XPD B;  4FD7 A;  1LRZ A;  1YR0 A;  4EME A;  3W91 A;  4NSQ A;  1QSO A;  4UCM A;  1IID A;  1QQ9 A;  4WJB A;  3TO9 A;  5KTD A;  3B3S A;  4A37 A;  2H5M A;  1QSM A;  2CIJ A;  2AFS A;  2YNC C;  3RNZ A;  4MFZ A;  4IHM A;  3IJ3 A;  2OZH A;  2REE A;  3N7Z A;  5KTA A;  3B3C A;  2RC4 A;  1CJW A;  2F7V A;  3RAM A;  4W9Y A;  3I3G A;  4Q7A A;  2ZED A;  4OC4 A;  2Z3L A;  1LAM A;  4KOW A;  5K8O A;  1AMP A;  4FWU A;  3GIU A;  4NGN A;  3TC8 A;  1AUG A;  2FSR A;  4LX9 A;  4P4D A;  2O53 A;  3D7F A;  2GLF A;  4OC3 A;  4F8Z A;  5AGE A;  4A31 A;  4UIB A;  1GYT A;  4MFP A;  2AFX A;  3PB9 X;  2G0B A;  1R3N A;  2KCW A;  1TKH A;  2Q51 A;  2BUE A;  2JEW A;  5ISV A;  4P4J A;  3C26 A;  1Z5R A;  3H8F A;  3IGR A;  2EWB A;  1X12 A;  3NE7 A;  3PGP A;  4H6U A;  4MCP A;  3MGD A;  3D3S A;  1Q2D A;  3BJ8 A;  3JRU A;  1N71 A;  1XFO A;  4ZX8 A;  2Z11 A;  3S6F A;  2P6F A;  2PVV A;  2P6G A;  4MHZ A;  1SQH A;  1KUV A;  4UFX A;  4FD6 A;  4HPS A;  3TO7 A;  4KSA A;  3D2P A;  3KZW A;  5ELY A;  1Y7R A;  4UBR A;  1IGB A;  3KHZ A;  2EVN A;  3DSB A;  3IU2 A;  2CTB A;  3WT4 A;  3MRU A;  4MFJ A;  5D8N A;  3FEE A;  1TIQ A;  3SI2 A;  4X2T A;  4UA3 A;  1BO4 A;  3PB6 X;  5HVG A;  3RBU A;  1CP7 A;  1XIX A;  3KR4 A;  3PFO A;  3IWW A;  2B4B A;  3DDD A;  2J8R A;  3DNS A;  4LUA A;  4PQA A;  3VWD A;  5I4M A;  1FY7 A;  4ZY2 A;  3S9M A;  2B4D B;  4OP4 A;  5IB0 A;  4NEX A;  2V8D A;  1ARM A;  5LRJ A;  4BD9 A;  5G20 A;  3NH8 A;  3CXQ A;  1XMB A;  4UWJ A;  5EMI A;  1UFH A;  3LOD A;  5HVH A;  1CG2 A;  2EBJ A;  2CY2 A;  3QB8 A;  4NXY A;  3PP9 A;  2QEC A;  3IU1 A;  5A28 A;  3JVN A;  4MJ8 A;  4XNH B;  2D4O A;  4C2Y A;  2JDC A;  3B2Y A;  2AFO A;  1I21 A;  2VBQ A;  4IAV A;  2VL1 A;  1QSN A;  4KOU A;  4B14 A;  3SXN A;  1YRE A;  3CXP A;  4BBH A;  5E96 A;  4DUK A;  3R95 A;  2GLJ A;  3P2F A;  1Z8W A;  4F9U A;  2ZEN A;  5JGF A;  5HXD A;  4ZY1 A;  4KVO E;  1VHO A;  3HUV A;  5C82 A;  1YSJ A;  4NGM A;  1TF8 A;  4Q36 A;  1M4D A;  2PR1 A;  3FXT A;  1YLE A;  4IUS A;  2GIV A;  4ONW A;  5A27 A;  4OME A;  3BI0 A;  3FYN A;  3E0K A;  5AG6 A;  1IOF A;  2XEI A;  3RZA A;  1FT7 A;  3KQX A;  2Q0Y A;  2Z3N A;  2ZOG A;  1Z4R A;  2CXA A;  4Z65 A;  4MHD A;  5BWA B;  4TNU A;  2HB6 A;  1LAN A;  2PE3 A;  1WWZ A;  5K8P A;  5IV0 A;  2PJ4 A;  5G21 A;  1XE4 A;  4A39 A;  1PYT B;  3FIX A;  4GM5 A;  2IJZ A;  2O4H A;  4R6T A;  3FNC A;  4JWP A;  1Z9U A;  4MMO A;  2BOA A;  2DXQ A;  5CPA A;  4ZGY B;  5JM6 A;  3GY9 A;  3PB7 X;  1VKC A;  1KWM A;  2Z0Z A;  1JQG A;  1LFW A;  3JTK A;  4ZX9 A;  1R57 A;  2F5I A;  3G8W A;  2PJC A;  2RFH A;  2QYV A;  4HNX B;  1M1D A;  1Z4E A;  2PCU A;  3DLJ A;  5JPH A;  3F0A A;  4ONU A;  4L89 A;  1Z8T A;  1ZO0 A;  2I3C A;  2ZW6 A;  3H8G A;  4P4I A;  4Y49 B;  5DWM A;  3R96 A;  4NGP A;  4AVB A;  1FNO A;  2QML A;  2PJ2 A;  4MCQ A;  3VAT A;  3WAB A;  1YME A;  2ANP A;  3SJE A;  4QBJ A;  4UCP A;  2Q04 A;  1Q7L A;  5K8N A;  2PJ3 A;  2V77 A;  4E2A A;  4CAF A;  4CGL A;  5I0C A;  1ARL A;  4OKO A;  4R7M A;  2HV2 A;  4AB7 A;  1IYK A;  4F9V A;  2Z3K A;  4HKF A;  4DJL A;  1JWQ A;  2B5G B;  2GRE A;  1RXT A;  2IMO A;  4FUU A;  3V8I A;  3FF3 A;  2C6P A;  4ZY0 A;  1YVK A;  4MCR A;  2V8G A;  4CAX A;  5F09 A;  4FAI A;  4C7I A;  4A33 A;  2Z3O A;  3KGQ A;  2B4D A;  4ZYQ A;  4NFR A;  3RO0 A;  4NCZ A;  3NE8 A;  3ISX A;  4U9Z A;  4JZ0 A;  3N5F A;  1WK4 A;  5DS0 A;  4PV6 A;  1CX8 A;  2AE6 A;  3FX6 A;  5HMN A;  2FCK A;  3H4Q A;  5EBV A;  3BJ7 A;  4P45 A;  1KUY A;  4MFK A;  3VH9 A;  1M4I A;  3T90 A;  4OAE A;  3T8W A;  3CT9 A;  3PB8 X;  1PU9 A;  4X8I A;  3RYO A;  1EE3 P; 
#chains in the Genus database with same CATH homology
 4C2X A;  1ON0 A;  2P6E A;  3ZZI A;  3WR7 A;  1B6B A;  3FBU A;  4R3K A;  4MY0 A;  4C2Z A;  4XPL A;  4CYO A;  3TCV A;  4MBU A;  2DPS A;  1VHS A;  2NMT A;  4YRH A;  3EY5 A;  4II9 A;  4BMH A;  1KUX A;  1QSR A;  4XNH C;  4MI4 A;  5EC4 A;  4CGO A;  4M85 A;  3R9F A;  2GE3 A;  4KVM E;  2WPW A;  4RS2 A;  5C88 A;  4Q38 A;  1MK4 A;  4H6Z A;  4UWI A;  4E8O A;  4A95 A;  3TT2 A;  2B58 A;  4HNW B;  4F0Y A;  3GYA A;  1RO5 A;  2Q4V A;  3ZJ0 A;  1J4J A;  2ZW7 A;  1YGH A;  4L8A A;  5F48 A;  5F46 A;  2R98 A;  4MFQ A;  2WSA A;  2ARH A;  4QUS A;  5F49 A;  4CGM A;  1MJA A;  4CS0 B;  3JUW A;  2WUU A;  3TO6 A;  2FT0 A;  4KOV A;  3SHP A;  4OAD A;  1YX0 A;  1S5K A;  1GHE A;  3GKR A;  4CYQ A;  4KS9 A;  4CAE A;  3P2H A;  2OB0 A;  3IWE A;  4ZBG A;  4ORF A;  4MFL A;  4PSX A;  2PR8 A;  1Y9W A;  3TOB A;  2G3T A;  4CYP A;  1M44 A;  2B5G A;  2FXF A;  2Z3P A;  2PRB A;  2R8V A;  4B13 A;  2PQ8 A;  3D2M A;  4KZT A;  2VZY A;  3QAH A;  1B87 A;  2J8M A;  4Y49 C;  3DR8 A;  1Q2Y A;  3CXS A;  2JEV A;  3TE4 A;  1I12 A;  2HUZ A;  5F47 A;  4M3S A;  2JDD A;  4XPD C;  1KZF A;  5GCN A;  4CAV A;  4JD6 A;  1QST A;  2YND A;  3TFY A;  4OLL A;  4JJX A;  4C68 A;  2D4P A;  1L0C A;  2Z10 A;  3R1K A;  4B12 A;  3FRM A;  3R9E A;  1YVO A;  1M4G A;  2Q44 A;  4EVY A;  3BLN A;  3UY5 A;  2FE7 A;  2ZW5 A;  3I9S A;  3W6X A;  4AG7 A;  4CRY B;  2CNT A;  4YFJ A;  1NMT A;  4B5O A;  3VWE A;  2PC1 A;  5JQ4 A;  5CNP A;  4E0A A;  2HQY A;  4PK3 A;  2FL4 A;  4KUA A;  5AG5 A;  4PK2 A;  2R7H A;  2FIA A;  2VQY A;  5DWN A;  2OZG A;  2P0W A;  3EO4 A;  3EC4 A;  2B3V A;  4A2Z A;  3TTH A;  2BL1 A;  4KSF A;  1I1D A;  2K5T A;  3F8K A;  1S3Z A;  4J3G A;  2PSW A;  4JXQ A;  3DR6 A;  1MJ9 A;  2AJ6 A;  4CGP A;  1S60 A;  4R9M A;  2CNS A;  2VXK A;  4UCN A;  1S7F A;  4GS4 A;  5FVJ A;  4IF5 A;  1U6M A;  2EUI A;  4B5P B;  2B3U A;  1XF8 A;  2FIW A;  2Z3M A;  2OH1 A;  1YK3 A;  4JLY A;  1BOB A;  2J8N A;  3TOA A;  1S7L A;  3PZJ A;  4MY3 A;  4KOT A;  3EFA A;  3S6G A;  1MJB A;  4KOX A;  5G22 A;  4R57 A;  4K30 A;  4HNY B;  4UFV A;  4B10 A;  4RI1 A;  3S6K A;  3SXO A;  2ZW4 A;  2X7B A;  5J8C A;  4R3L A;  5IX3 A;  4KLV A;  2YGW A;  4B11 A;  2BEI A;  2R1I A;  1XEB A;  4XPK A;  4KOR A;  4PSW A;  4FD4 A;  1NSL A;  5H86 A;  1P4N A;  2G3A A;  4C7H A;  3EXN A;  4UFW A;  3D8P A;  3FB3 A;  4QB9 A;  2ZPA A;  2FS5 A;  1NE9 A;  3KKW A;  5AG4 A;  4X5K A;  1Y9K A;  1P0H A;  4QC6 A;  4R87 A;  2OZU A;  4U5Y A;  1S7K A;  1V0C A;  3R9G A;  1IB1 E;  4KOS A;  4H89 A;  2O28 A;  4CGN A;  1XMT A;  3H5Z A;  3OWC A;  2ATR A;  3B8G A;  4KVX A;  4DNC A;  5H84 A;  2WPX A;  3LD2 A;  5AG7 A;  4F6A A;  1OZP A;  2BSW A;  5J8F A;  2QIR A;  4KUB A;  4AVC A;  4YGO A;  2GAN A;  2PDO A;  2JLM A;  2IL4 A;  1CM0 A;  1K4J A;  3G3S A;  4AVA A;  3F5B A;  2Q7B A;  4I49 A;  1Q2C A;  4CYN A;  5G1Z A;  2A4N A;  4KLW A;  5HH1 A;  1IIC A;  2VZZ A;  2VI7 A;  4CRZ B;  3IWG A;  2VEZ A;  4JXR A;  4B5P A;  3A9L A;  4A32 A;  2DPT A;  2I00 A;  4F0X A;  2Y0M A;  4NF1 A;  4CAW A;  2YNE A;  2CNM A;  2REF A;  2ZXV A;  2C27 A;  2OU2 A;  2I79 A;  4QVT A;  3T9Y A;  2YNC A;  4U9Y A;  4KOY A;  4A30 A;  4FD5 A;  3K9U A;  5KTC A;  3W6S A;  1S7N A;  1IYL A;  2Q4Y A;  1PUA A;  3S6H A;  4AG9 A;  4XPD B;  4FD7 A;  1LRZ A;  1YR0 A;  3W91 A;  4NSQ A;  1QSO A;  4UCM A;  1IID A;  3TO9 A;  5KTD A;  2H5M A;  1QSM A;  2YNC C;  4MFZ A;  2OZH A;  2REE A;  3N7Z A;  5KTA A;  2RC4 A;  1CJW A;  3I3G A;  2Z3L A;  4KOW A;  2FSR A;  4LX9 A;  5AGE A;  4A31 A;  4MFP A;  2G0B A;  2KCW A;  2BUE A;  5ISV A;  3C26 A;  3NE7 A;  4H6U A;  3IGR A;  3PGP A;  3MGD A;  3D3S A;  1Q2D A;  3BJ8 A;  1N71 A;  2Z11 A;  3S6F A;  2P6F A;  2P6G A;  1SQH A;  1KUV A;  4UFX A;  4FD6 A;  3TO7 A;  4KSA A;  3D2P A;  1Y7R A;  4UBR A;  2EVN A;  3DSB A;  3IU2 A;  4MFJ A;  1TIQ A;  4UA3 A;  1BO4 A;  1XIX A;  2B4B A;  3DDD A;  2J8R A;  3DNS A;  4LUA A;  3VWD A;  1FY7 A;  5IB0 A;  2B4D B;  4NEX A;  5G20 A;  3CXQ A;  4UWJ A;  1UFH A;  3LOD A;  2CY2 A;  3QB8 A;  4NXY A;  3PP9 A;  2QEC A;  3IU1 A;  5A28 A;  3JVN A;  4MJ8 A;  4XNH B;  2D4O A;  4C2Y A;  2JDC A;  2VBQ A;  1I21 A;  1QSN A;  4KOU A;  4B14 A;  3SXN A;  1YRE A;  3CXP A;  4BBH A;  5E96 A;  3R95 A;  3P2F A;  4KVO E;  5C82 A;  4Q36 A;  1M4D A;  2PR1 A;  3FXT A;  1YLE A;  4IUS A;  2GIV A;  5A27 A;  3FYN A;  3E0K A;  5AG6 A;  2Q0Y A;  2Z3N A;  1Z4R A;  2CXA A;  4MHD A;  5BWA B;  1WWZ A;  5IV0 A;  5G21 A;  1XE4 A;  3FIX A;  3FNC A;  4JWP A;  1Z9U A;  2DXQ A;  4ZGY B;  3GY9 A;  1VKC A;  5I0C A;  2Z0Z A;  3JTK A;  1R57 A;  2F5I A;  3G8W A;  4HNX B;  1M1D A;  1Z4E A;  5JPH A;  3F0A A;  4ONU A;  4L89 A;  1ZO0 A;  2ZW6 A;  4Y49 B;  5DWM A;  3R96 A;  4AVB A;  2QML A;  4QBJ A;  4UCP A;  2Q04 A;  4E2A A;  4CAF A;  4CGL A;  4AB7 A;  2HV2 A;  1IYK A;  4HKF A;  2Z3K A;  2B5G B;  1RXT A;  3V8I A;  1YVK A;  4CAX A;  4C7I A;  4A33 A;  2Z3O A;  2B4D A;  4NCZ A;  4U9Z A;  1WK4 A;  4PV6 A;  2AE6 A;  5HMN A;  2FCK A;  3H4Q A;  5EBV A;  3BJ7 A;  1KUY A;  4MFK A;  1M4I A;  3T90 A;  4OAE A;  1PU9 A;  3RYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...