3FYNA

Crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
152
Chain Sequence
NLYFQGLSPQVRTAHIGDVPVLVRLMSEFYQEAGFALPHDAAIRAFKALLGKPDLGRIWLIAEGTESVGYIVLTLGFSMEYGGLRGFVDDFFVRPNARGKGLGAAALQTVKQGCCDLGVRALLVETGVYSRAGFEESGRMLLGQALAPPIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS3
rcsb
source organism Uncultured bacterium
molecule tags Structural genomics, unknown function
molecule keywords Integron gene cassette protein HFX_CASS3
total genus 40
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fynA00
2FS5A 2JEVA 4OADA 4KZTA 4K30A 5ISVA 1WK4A 4E0AA 2HUZA 4HNYB 4KVXA 3TO6A 4JXQA 2FE7A 5J8FA 3SHPA 5HMNA 1NMTA 3S6KA 2C27A 3TOBA 3W91A 4F0YA 2I79A 3FRMA 1KUVA 2I00A 5KTCA 1MJ9A 1CJWA 4KVOE 5F46A 4CAWA 4KUAA 2CNTA 1B6BA 2VI7A 4Y49B 1Q2CA 4NXYA 3NE7A 2B4DB 3PZJA 2G3AA 4GS4A 3EFAA 4KOVA 4JXRA 1XMTA 4YGOA 4PSWA 5DWNA 1QSMA 2VZYA 3S6GA 2D4OA 4LX9A 1MJAA 1QSNA 3DDDA 4PK2A 2P0WA 3DSBA 3UY5A 5EBVA 5FVJA 2HV2A 2GANA 3VWDA 1B87A 4QC6A 4MY0A 1PU9A 1ON0A 3RYOA 1KUXA 4NSQA 3PP9A 4H89A 4AVCA 2ZPAA 3S6FA 3G3SA 2R98A 1XEBA 5F49A 4JWPA 2PR1A 4AVBA 1NSLA 5KTAA 4M3SA 3FB3A 3I3GA 3K9UA 2BUEA 4XPKA 4B5PB 2ZW6A 3S6HA 4OLLA 2EVNA 1IYKA 2FIWA 4PSXA 3TO9A 2Z10A 5JQ4A 2VQYA 3T90A 4U5YA 2PDOA 3IGRA 5H86A 3QB8A 4MBUA 4H6UA 4F6AA 2G3TA 3N7ZA 4RI1A 1IYLA 2FL4A 2GIVA 3GYAA 3BLNA 2O28A 1N71A 4MJ8A 1P0HA 1P4NA 4R3KA 2FCKA 2EUIA 3D3SA 5CNPA 2ZXVA 3CXQA 1IICA 1BOBA 2J8MA 4LUAA 3D2PA 2ZW5A 3EO4A 3OWCA 4IUSA 4Y49C 2BEIA 4KLVA 4CS0B 4KORA 5JPHA 2CY2A 1I12A 5F48A 1SQHA 4R3LA 5I0CA 5C82A 1PUAA 3H4QA 1YVOA 5EC4A 2VXKA 2P6EA 4KUBA 2OU2A 1YREA 4XPLA 1OZPA 1Z4EA 3R9EA 4KOTA 2Q0YA 2R7HA 1KZFA 4H6ZA 4QVTA 2R8VA 2BSWA 2B5GA 3TO7A 5C88A 3R9GA 2H5MA 3FNCA 2NMTA 2FIAA 4KOWA 2PSWA 4NEXA 2Q4YA 3QAHA 4KOSA 2QIRA 2P6FA 3ZJ0A 3LODA 2Q7BA 2JDDA 3SXNA 5F47A 1S7FA 2JDCA 1YX0A 4MY3A 5IV0A 4OAEA 3W6SA 3B8GA 3R96A 2X7BA 1M4GA 4R87A 3BJ8A 4NF1A 3GY9A 1KUYA 2ATRA 5DWMA 4ZBGA 5HH1A 2REFA 4X5KA 4XPDB 1S5KA 2J8NA 1XE4A 3R95A 1V0CA 2FT0A 4BMHA 2VBQA 3P2FA 2DXQA 3TFYA 1YK3A 4MI4A 3TE4A 3G8WA 3T9YA 3TTHA 1Z4RA 4RS2A 2QECA 1MK4A 1Y9WA 2D4PA 3P2HA 5IB0A 3TOAA 4U9YA 4XPDC 4M85A 1VKCA 4PV6A 2OZHA 4I49A 4QUSA 1L0CA 2OB0A 2B4BA 4B5PA 3IWGA 2FSRA 4XNHC 3R1KA 1M4DA 2ZW7A 1YR0A 2K5TA 2RC4A 1RO5A 1QSOA 1NE9A 4L89A 2P6GA 1XF8A 2Q44A 3LD2A 3W6XA 1Q2YA 4KVME 2VEZA 3PGPA 4FD6A 1IIDA 2B3VA 3F8KA 4UA3A 4KLWA 4HKFA 3I9SA 1UFHA 3GKRA 3E0KA 4CRYB 3DR6A 3D2MA 1Y7RA 4R57A 1S7NA 2JLMA 4QBJA 4AG7A 5IX3A 1I1DA 4JLYA 5E96A 2PQ8A 1WWZA 2ARHA 2OH1A 4CRZB 2WPWA 3TCVA 3FIXA 2AJ6A 3CXPA 3TT2A 2Q4VA 4II9A 1S7KA 3ZZIA 1VHSA 2B58A 1QSTA 4KOYA 2CNSA 4KOXA 4XNHB 3SXOA 4HNXB 4AVAA 4FD7A 4CAXA 2A4NA 1S60A 2PRBA 3FYNA 4NCZA 3VWEA 4EVYA 3JUWA 4E2AA 3F0AA 5KTDA 1S7LA 3BJ7A 3FXTA 3WR7A 2F5IA 2OZUA 2OZGA 1M1DA 4DNCA 5J8CA 3V8IA 4AG9A 1R57A 4YRHA 4L8AA 1RXTA 1Z9UA 3MGDA 1YVKA 2PC1A 4ONUA 4CAVA 2B5GB 4FD5A 1Y9KA 2WPXA 1BO4A 4ORFA 2Z0ZA 3F5BA 2GE3A 4AB7A 4UBRA 4E8OA 2G0BA 2QMLA 3KKWA 1CM0A 4UWJA 1QSRA 2ZW4A 1YGHA 3CXSA 1J4JA 2KCWA 4FD4A 1Q2DA 1MJBA 5GCNA 2CNMA 4U9ZA 4YFJA 1S3ZA 2BL1A 2AE6A 3D8PA 4KOUA 4MHDA 4B5OA 2FXFA 1LRZA 1XIXA 1M44A 2Z11A 3EXNA 1YLEA 3DR8A 4UWIA 2HQYA 1IB1E 4PK3A 1K4JA 2Q04A 1I21A 4QB9A 4R9MA 1M4IA 3EC4A 3C26A 2B3UA 1GHEA 3DNSA 3EY5A 3JVNA 3FBUA 2B4DA 1FY7A 2VZZA 4JD6A 5H84A 1TIQA 3R9FA 2J8RA 2PR8A 2Y0MA 4J3GA 4JJXA 4IF5A 2REEA 2R1IA 1U6MA 4HNWB 2IL4A
chains in the Genus database with same CATH superfamily
1BAVA 1ARMA 2FS5A 2JEVA 1IOFA 4OADA 4OMEA 2YNCC 2ZOFA 4KZTA 4K30A 3TC8A 3NH8A 5ISVA 2ZEOA 4O23A 1WK4A 4P10A 2HUZA 2AFOA 3ISXA 3KR5A 4E0AA 3WT4A 4HNYB 4KVXA 3TO6A 4JXQA 3VH9A 3S9NA 2CTBA 2FE7A 2ZEDA 4Q7AA 4PXCA 3SHPA 4A30A 1ZLHA 5HMNA 5J8FA 4AXVA 4OC0A 1NMTA 3S6KA 5LRKA 4P4IA 4B10A 3B3VA 1IGBA 2C27A 3IWWA 5JH9A 4BD9A 3TOBA 4OC2A 3W91A 1LAMA 1A2ZA 4F0YA 4MRIA 1JWQA 2I79A 2ZEMA 2PJ1A 2PRQA 3IFEA 3IO1A 3FRMA 4MHNA 1AUGA 4NGMA 1KUVA 2G9DA 2I00A 4Q38A 4CAEA 5KTCA 2JEWA 1MJ9A 1CJWA 1HDUA 2RFHA 2FVGA 4KVOE 4OP4A 1VHOA 1UWYA 2BOAA 3B7IA 2Q7SA 2F7VA 1VIXA 5F46A 4CAWA 4KUAA 2CNTA 1B6BA 3PEIA 1CPXA 1XMBA 2VI7A 4Y49B 5K8MA 1Q2CA 4NXYA 3NE7A 4WJBA 4MCSA 2B4DB 2ANPA 3NFZA 3PZJA 2G3AA 4FUUA 4GS4A 4K3NA 3EFAA 4KOVA 4JXRA 4NGNA 4UF4A 3DGVA 3LACA 1YMEA 1XMTA 3CDXA 3FF3A 4P44A 4YGOA 3FEEA 4PSWA 2PJ0A 5DWNA 1QSMA 2VZYA 3S6GA 2D4OA 4CYQA 4LX9A 1MJAA 4ZI6A 1QSNA 4B12A 4MMOA 3DDDA 4PK2A 1YW4A 4IAVA 4MCQA 4F0XA 2P0WA 3DSBA 2PJ5A 2JBJA 2ZEEA 3UY5A 5EBVA 3K9TA 5FVJA 3A9LA 2HV2A 2ZOGA 2WSAA 2GANA 5HVFA 4EWTA 3NH4A 3VWDA 3SI1A 3KGQA 1B87A 2BO9A 4P45A 5JM6A 5AGEA 4R6TA 4QC6A 1CP6A 1F57A 4MY0A 3WABA 4ZGYB 1PU9A 2Q4ZA 1ON0A 3RYOA 1KUXA 4GXHA 4NSQA 3B3CA 3H8EA 4CGOA 5F09A 1Y7EA 3PP9A 4H89A 4ZY2A 3B3WA 4AVCA 2ZPAA 2V77A 4KSIA 3S6FA 4P4DA 3G3SA 4CYOA 2R98A 1XEBA 4PXDA 5F49A 3SJFA 4Z65A 4JWPA 2PR1A 3SJXA 4CPAA 3V7ZA 3SJGA 4TWEA 1XRYA 4AVBA 1NSLA 5KTAA 3IC1A 4FAIA 3IJ3A 2VL1A 4M3SA 1M4LA 3FB3A 3I3GA 3I1UA 3K9UA 2BUEA 4G1PA 4EFDA 1Z8TA 4XPKA 4B5PB 4CGMA 2ZW6A 3S6HA 4OLLA 4IHMA 2EVNA 1IYKA 2FIWA 2HB6A 4PSXA 4BBHA 5I4MA 2GREA 3TO9A 4NFRA 3D7DA 4DYOA 3KI9A 4OC1A 1QQ9A 2Z10A 5AG4A 5JQ4A 2VQYA 3KR4A 3D7GA 3T90A 5LYIA 2WZNA 4PPZA 3B35A 4U5YA 4UCPA 2PDOA 2ZEGA 4FBEA 3IGRA 3PRTA 4UFVA 5H86A 3CPAA 3QB8A 4MBUA 3B3SA 1ZG7A 2PJ3A 4H6UA 1Z8WA 4F6AA 2G3TA 3N7ZA 4RI1A 4R8FA 1ZLIA 1IYLA 2FL4A 2GIVA 4PQAA 3GYAA 3BLNA 2O28A 1N71A 4C2YA 3RO0A 3PB8X 4MJ8A 1P0HA 3ISZA 1ZG8A 1P4NA 4A32A 4P4FA 2YGWA 3BI0A 2Z3KA 5A28A 2BCOA 2Z3NA 4R3KA 2Z3MA 4M6GA 2FCKA 2EUIA 3D3SA 5CNPA 5JGFA 2WYRA 4MXUA 4A37A 2GFQA 3IU1A 4NJRA 2ZXVA 3CXQA 1IICA 4CGNA 1BOBA 1FT7A 2ZEPA 4NJQA 2CIJA 2JBKA 1F2OA 1NSAA 2J8MA 4LUAA 2ZENA 3D2PA 2ZW5A 3EO4A 3OWCA 4IUSA 4UEZA 2BEIA 4Y49C 4KLVA 4RN7A 3SI0A 4CS0B 4ONWA 4KORA 3FEDA 5JPHA 1TKFA 2CY2A 2PJBA 1I12A 3KQZA 3N5FA 1SQHA 4R3LA 5F48A 5I0CA 5C82A 5LYLA 1PUAA 2GU2A 1CBXA 1F2PA 2XEFA 3H4QA 3BI1A 2C6PA 3PFEA 1YVOA 5EC4A 3KL9A 2EK9A 2VXKA 2P6EA 4R7MA 1VGYA 4UEFA 4KUBA 2OU2A 1YREA 2XEIA 2V8GA 4XPLA 1Z5RA 1OZPA 4B13A 1Z4EA 3HLPA 3S9MA 3PB7X 1XFOA 3R9EA 4A31A 4KOTA 1H8LA 2Q0YA 2R7HA 1KZFA 3GB0A 4H6ZA 2PVWA 2OOTA 2PVVA 4QVTA 2R8VA 4C7HA 3NH5A 2BSWA 4F9UA 8CPAA 2B5GA 3D67A 3QAYA 4ZY1A 2Z3LA 3TO7A 3GLJA 4A38A 5C88A 3RAMA 4GM5A 4B14A 4C2ZA 2NSMA 3R9GA 2H5MA 2PJAA 1DTDA 2CF4A 3FNCA 2GLFA 2NMTA 2FIAA 5G1ZA 4A39A 1LOKA 1Z8XA 4KOWA 4W9YA 2PSWA 4NEXA 2Q4YA 4X3RA 3RBUA 3QAHA 4KOSA 2QIRA 3KASA 2P6FA 4HPSA 3D66A 5J1QA 1XOVA 3SI2A 3RZAA 2YNEA 3ZJ0A 2PJ4A 5ELYA 3LODA 2Q7BA 3KZWA 4M6HA 2JDDA 4EMEA 3SXNA 2I3CA 2IJZA 3HUVA 1TKJA 4MHPA 2CTCA 2J9AA 1Y0RA 5F47A 1S7FA 4UFXA 2JDCA 1YX0A 4MY3A 5K8NA 5IV0A 4OAEA 2V8DA 4LQGA 3KQXA 1Y0YA 2IQ6A 3W6SA 2AFZA 3B8GA 3R96A 1LFWA 5K8OA 2X7BA 1M4GA 4R87A 3BJ8A 4NF1A 3GY9A 1KUYA 1FNOA 2EO8A 2ATRA 1YW6A 2F8HA 5A27A 5DWMA 4ZBGA 5HH1A 2V8HA 1TKHA 5D29A 2REFA 2PIZA 3CZXA 4X5KA 4XPDB 4F8ZA 1RTQA 1AMPA 1S5KA 4NGRA 5LRGA 2J8NA 2GLJA 3RNZA 1XE4A 3H5ZA 3R95A 1R3NA 1V0CA 2FT0A 2PJ2A 2VBQA 1YQEA 3P2FA 1CG2A 2DXQA 4FWUA 4M6IA 4UCMA 4BMHA 3WC6A 3TFYA 1YK3A 4MI4A 4DUKA 1YSJA 3G8WA 3TE4A 3T9YA 3QNVA 3TTHA 1Z4RA 4RS2A 1R43A 4CYNA 2QECA 3PB9X 1MK4A 1Y9WA 3GUXA 2D4PA 2ODFA 1QMUA 3P2HA 4MFQA 4MFJA 3TX8A 1Q7LA 4Q36A 5AG7A 5IB0A 3TOAA 4U9YA 3VATA 4KSFA 2YNDA 4XPDC 5BWAB 4M85A 1LANA 1VKCA 3IIBA 4TNUA 4PV6A 3PBEA 4LQ6A 3H8FA 3WC5A 5LRJA 4MFZA 2OZHA 4I49A 3PBBA 4QUSA 4PXEA 1L0CA 2OB0A 2B4BA 2YNCA 4KSAA 4NGPA 2XEJA 3MN8A 4B5PA 3IWGA 5THWA 2FSRA 2AFXA 2C6GA 3K2KA 4HNWB 4XNHC 3R1KA 1M4DA 2DPSA 4WWVA 1CPSA 4ZX9A 1TF9A 2ZW7A 5G22A 1YR0A 3JTKA 2Z3OA 2DPTA 2K5TA 2RC4A 1RO5A 1QSOA 4NGSA 3BXMA 5HVHA 1NE9A 3T8WA 4L89A 4P4JA 2AFSA 1KWMA 2P6GA 1XF8A 5CBMA 3KHZA 2Q44A 3LD2A 4CAFA 1VHEA 3W6XA 4X8IA 1Q2YA 1Z2LA 4KVME 2VEZA 3PGPA 4FD6A 4OC4A 4MCPA 1PCAA 2PJCA 3JRUA 4ZY0A 1IIDA 2B3VA 4A95A 4JZ0A 5LYFA 2CXAA 3F8KA 4IK2A 4UA3A 4UFWA 1BPNA 2C1CA 3FJUA 4HKFA 4KLWA 3I9SA 4UEEA 1UFHA 1BLLE 3E0KA 3GKRA 2AFMA 3DR6A 4CRYB 2ZELA 2Q51A 3D2MA 1Y7RA 4UCNA 4R57A 4YU9A 4ZX8A 3PB4X 1S7NA 2NYQA 2PJ6A 2JLMA 4QBJA 4C2XA 1PYTB 4NGQA 4AG7A 2AFUA 5AG6A 3FVLA 3IU2A 1I1DA 5IX3A 4JLYA 5E96A 2PQ8A 1WWZA 1HEEA 3B3TA 2ARHA 1X10A 2OH1A 2OR4A 2AFWA 5CPAA 5LYDA 4CRZB 3S9LA 2WPWA 3TCVA 1ZG9A 3FIXA 2AJ6A 1X12A 3CXPA 3TT2A 2Q4VA 3IWEA 1HDQA 4R76A 2PJ7A 4MFPA 4II9A 3GIUA 1S7KA 1TF8A 1OBRA 2ABZA 3SJEA 4ZYQA 1BPMA 3ZZIA 1YLOA 1VHSA 2B58A 1QSTA 2PJ9A 2CNSA 4KOYA 1XJOA 4KOXA 4PXBA 4XNHB 3SXOA 1ELMP 4HNXB 4FD7A 4X2TA 1GYTA 4AVAA 4CAXA 2A4NA 7CPAA 2ZEFA 4KS9A 1S60A 2PRBA 3FYNA 4NCZA 3VWEA 4C68A 6CPAA 3MRUA 4EVYA 3KHXA 3JUWA 3D68A 4MCRA 2EBJA 4E2AA 3F0AA 5KTDA 1S7LA 1TXRA 3BJ7A 3FXTA 5G21A 4YWYA 3WR7A 2F5IA 2OZUA 2OZGA 5G20A 1M1DA 4MFLA 4DNCA 5J8CA 4H2KA 3V8IA 2QJ8A 3NE8A 4AG9A 4BINA 1R57A 4YRHA 1Z8LA 2C6CA 3CT9A 4L8AA 5EMIA 3D7FA 1RXTA 1Z9UA 3MGDA 1AYEA 5DS0A 1YVKA 2PC1A 4B6ZA 4ONUA 5HXDA 2PCUA 3LMSA 2QVPA 4CAVA 2B5GB 4OIDA 3D7HA 2POKA 2WUUA 3NA6A 4FD5A 2EK8A 1Y9KA 5K8PA 2WPXA 1BO4A 2ZEHA 4ORFA 2Z0ZA 3F5BA 2GE3A 2DF5A 3FMCA 4UBRA 4AB7A 4E8OA 4P6YA 2G0BA 2QMLA 3KKWA 1CM0A 4UWJA 1QSRA 2Z3PA 2ZW4A 4MHYA 1YGHA 3CXSA 4DJLA 1J4JA 4OC5A 1XBUA 4OKOA 2KCWA 4FD4A 3VARA 2PE3A 1Q2DA 1MJBA 3FECA 5AG5A 2CNMA 5GCNA 4B11A 4U9ZA 4CGPA 3WC7A 2EWBA 2O53A 4YFJA 1DE4C 1S3ZA 2PJ8A 2IMOA 2O4HA 3BHXA 1LAPA 2BL1A 2AE6A 3D8PA 4KOUA 4MHDA 4A33A 1IOIA 3FX6A 2FXFA 4P4BA 4B5OA 3L2NA 3H8GA 1EE3P 2QYVA 3IEHA 1LRZA 4MHZA 1ARLA 2DEAA 2HC9A 1XIXA 3CPXA 5IB9A 1M44A 4F9VA 2Z11A 4OC3A 3EXNA 2Q43A 4UIAA 1YLEA 3DLJA 3DR8A 1JQGA 2XEGA 4UWIA 3LWUA 2HQYA 1IB1E 1K4JA 4PK3A 4CGLA 5D8NA 2Q04A 1I21A 4RUHA 4JYWA 4QB9A 4R9MA 1LCPA 1M4IA 2RB7A 1IU8A 3EC4A 3C26A 3B2YA 2PIYA 2B3UA 4UIBA 4C7IA 1CP7A 1ZO0A 1GHEA 3DNSA 3EY5A 3JVNA 3FH4A 3PFOA 3FBUA 3V38A 2B4DA 1FY7A 2VZZA 4JD6A 5H84A 1TIQA 3R9FA 2J8RA 2PR8A 4P4EA 2Y0MA 4J3GA 3D4UA 4MFKA 4A2ZA 5HVGA 4JJXA 4IF5A 1CX8A 4CYPA 2V8VA 2REEA 1ELLP 2R1IA 4A94A 1U6MA 1IY7A 2IL4A 4OIWA 4NGTA 3PB6X
chains in the Genus database with same CATH topology
2FS5A 2JEVA 4OADA 2YNCC 4KZTA 4K30A 5ISVA 1WK4A 4E0AA 2HUZA 4HNYB 4KVXA 3TO6A 4JXQA 2FE7A 5J8FA 3SHPA 4A30A 5HMNA 1NMTA 3S6KA 4B10A 2C27A 3TOBA 3W91A 4F0YA 2I79A 3FRMA 4Q38A 4CAEA 1KUVA 2I00A 5KTCA 1MJ9A 1CJWA 4KVOE 5F46A 4CAWA 4KUAA 2CNTA 1B6BA 2VI7A 4Y49B 1Q2CA 4NXYA 3NE7A 2B4DB 3PZJA 2G3AA 4GS4A 3EFAA 4KOVA 4JXRA 1XMTA 4YGOA 4PSWA 5DWNA 1QSMA 2VZYA 3S6GA 2D4OA 4CYQA 4LX9A 1MJAA 1QSNA 4B12A 3DDDA 4PK2A 4F0XA 2P0WA 3DSBA 3UY5A 5EBVA 5FVJA 3A9LA 2HV2A 2WSAA 2GANA 3VWDA 1B87A 5AGEA 4QC6A 4MY0A 4ZGYB 1PU9A 1ON0A 3RYOA 1KUXA 4NSQA 4CGOA 3PP9A 4H89A 4AVCA 2ZPAA 3S6FA 4CYOA 3G3SA 2R98A 1XEBA 5F49A 4JWPA 2PR1A 4AVBA 1NSLA 5KTAA 4M3SA 3FB3A 3I3GA 3K9UA 2BUEA 4XPKA 4B5PB 4CGMA 2ZW6A 3S6HA 4OLLA 2EVNA 1IYKA 2FIWA 4PSXA 4BBHA 3TO9A 2Z10A 5AG4A 5JQ4A 2VQYA 3T90A 4UCPA 4U5YA 2PDOA 3IGRA 4UFVA 5H86A 3QB8A 4MBUA 4H6UA 4F6AA 2G3TA 3N7ZA 4RI1A 1IYLA 2FL4A 2GIVA 3GYAA 3BLNA 2O28A 1N71A 4C2YA 4MJ8A 1P0HA 1P4NA 4A32A 2YGWA 2Z3KA 5A28A 2Z3NA 4R3KA 2Z3MA 2FCKA 2EUIA 3D3SA 5CNPA 3IU1A 2ZXVA 3CXQA 1IICA 4CGNA 1BOBA 2J8MA 4LUAA 3D2PA 2ZW5A 3EO4A 4IUSA 3OWCA 4Y49C 2BEIA 4KLVA 4CS0B 4KORA 5JPHA 2CY2A 1I12A 5F48A 1SQHA 4R3LA 5I0CA 5C82A 1PUAA 3H4QA 1YVOA 5EC4A 2VXKA 2P6EA 4KUBA 2OU2A 1YREA 4XPLA 1OZPA 4B13A 1Z4EA 3R9EA 4A31A 4KOTA 2Q0YA 2R7HA 1KZFA 4H6ZA 4QVTA 2R8VA 4C7HA 2BSWA 2B5GA 2Z3LA 3TO7A 5C88A 4B14A 4C2ZA 3R9GA 2H5MA 3FNCA 2NMTA 2FIAA 5G1ZA 4KOWA 2PSWA 4NEXA 2Q4YA 3QAHA 4KOSA 2QIRA 2P6FA 2YNEA 3ZJ0A 3LODA 2Q7BA 2JDDA 3SXNA 5F47A 1S7FA 4UFXA 2JDCA 1YX0A 4MY3A 5IV0A 4OAEA 3W6SA 3B8GA 3R96A 2X7BA 1M4GA 4R87A 3BJ8A 4NF1A 3GY9A 1KUYA 2ATRA 5A27A 5DWMA 4ZBGA 5HH1A 2REFA 4X5KA 4XPDB 1S5KA 2J8NA 1XE4A 3H5ZA 3R95A 1V0CA 2FT0A 4BMHA 2VBQA 3P2FA 2DXQA 4UCMA 3TFYA 1YK3A 4MI4A 3TE4A 3G8WA 3T9YA 3TTHA 1Z4RA 4RS2A 4CYNA 2QECA 1MK4A 1Y9WA 2D4PA 3P2HA 4MFQA 4MFJA 4Q36A 5AG7A 5IB0A 3TOAA 4U9YA 5BWAB 4KSFA 2YNDA 4XPDC 4M85A 1VKCA 4PV6A 4MFZA 2OZHA 4I49A 4QUSA 1L0CA 2OB0A 2B4BA 2YNCA 4KSAA 4B5PA 3IWGA 2FSRA 4XNHC 3R1KA 1M4DA 2DPSA 2ZW7A 5G22A 1YR0A 3JTKA 2Z3OA 2DPTA 2K5TA 2RC4A 1RO5A 1QSOA 1NE9A 4L89A 2P6GA 1XF8A 2Q44A 3LD2A 4CAFA 3W6XA 1Q2YA 4KVME 2VEZA 3PGPA 4FD6A 1IIDA 2B3VA 4A95A 2CXAA 3F8KA 4UA3A 4UFWA 4KLWA 4HKFA 3I9SA 1UFHA 3GKRA 3E0KA 4CRYB 3DR6A 4UCNA 3D2MA 1Y7RA 4R57A 1S7NA 2JLMA 4QBJA 4C2XA 4AG7A 5AG6A 3IU2A 5IX3A 1I1DA 4JLYA 5E96A 2PQ8A 1WWZA 2ARHA 2OH1A 4CRZB 2WPWA 3TCVA 3FIXA 2AJ6A 3CXPA 3TT2A 2Q4VA 3IWEA 4MFPA 4II9A 1S7KA 3ZZIA 1VHSA 2B58A 1QSTA 4KOYA 2CNSA 4KOXA 4XNHB 3SXOA 4HNXB 4AVAA 4FD7A 4CAXA 2A4NA 4KS9A 4C68A 1S60A 2PRBA 3FYNA 4NCZA 3VWEA 4EVYA 3JUWA 4E2AA 3F0AA 5KTDA 1S7LA 3BJ7A 3FXTA 5G21A 3WR7A 2F5IA 2OZUA 2OZGA 5G20A 1M1DA 4MFLA 4DNCA 5J8CA 3V8IA 4AG9A 1R57A 4YRHA 4L8AA 1RXTA 1Z9UA 3MGDA 1YVKA 2PC1A 4ONUA 4CAVA 2B5GB 2WUUA 4FD5A 1Y9KA 2WPXA 1BO4A 4ORFA 2Z0ZA 3F5BA 2GE3A 4AB7A 4UBRA 4E8OA 2G0BA 2QMLA 3KKWA 1CM0A 4UWJA 1QSRA 2Z3PA 2ZW4A 1YGHA 3CXSA 1J4JA 2KCWA 4FD4A 4B11A 1Q2DA 1MJBA 5AG5A 5GCNA 2CNMA 4U9ZA 4CGPA 4YFJA 1S3ZA 2BL1A 2AE6A 4KOUA 3D8PA 4MHDA 4A33A 4B5OA 2FXFA 1LRZA 1XIXA 1M44A 2Z11A 3EXNA 1YLEA 3DR8A 4UWIA 2HQYA 1IB1E 1K4JA 4PK3A 4CGLA 2Q04A 1I21A 4QB9A 4R9MA 1M4IA 3EC4A 3C26A 2B3UA 4C7IA 1ZO0A 1GHEA 3DNSA 3EY5A 3JVNA 3FBUA 2B4DA 1FY7A 2VZZA 4JD6A 5H84A 1TIQA 3R9FA 2J8RA 2PR8A 2Y0MA 4J3GA 4MFKA 4A2ZA 4JJXA 4IF5A 4CYPA 2REEA 2R1IA 1U6MA 4HNWB 2IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  2JEV A;  4OAD A;  4KZT A;  4K30 A;  5ISV A;  1WK4 A;  4E0A A;  2HUZ A;  4HNY B;  4KVX A;  3TO6 A;  4JXQ A;  2FE7 A;  5J8F A;  3SHP A;  5HMN A;  1NMT A;  3S6K A;  2C27 A;  3TOB A;  3W91 A;  4F0Y A;  2I79 A;  3FRM A;  1KUV A;  2I00 A;  5KTC A;  1MJ9 A;  1CJW A;  4KVO E;  5F46 A;  4CAW A;  4KUA A;  2CNT A;  1B6B A;  2VI7 A;  4Y49 B;  1Q2C A;  4NXY A;  3NE7 A;  2B4D B;  3PZJ A;  2G3A A;  4GS4 A;  3EFA A;  4KOV A;  4JXR A;  1XMT A;  4YGO A;  4PSW A;  5DWN A;  1QSM A;  2VZY A;  3S6G A;  2D4O A;  4LX9 A;  1MJA A;  1QSN A;  3DDD A;  4PK2 A;  2P0W A;  3DSB A;  3UY5 A;  5EBV A;  5FVJ A;  2HV2 A;  2GAN A;  3VWD A;  1B87 A;  4QC6 A;  4MY0 A;  1PU9 A;  1ON0 A;  3RYO A;  1KUX A;  4NSQ A;  3PP9 A;  4H89 A;  4AVC A;  2ZPA A;  3S6F A;  3G3S A;  2R98 A;  1XEB A;  5F49 A;  4JWP A;  2PR1 A;  4AVB A;  1NSL A;  5KTA A;  4M3S A;  3FB3 A;  3I3G A;  3K9U A;  2BUE A;  4XPK A;  4B5P B;  2ZW6 A;  3S6H A;  4OLL A;  2EVN A;  1IYK A;  2FIW A;  4PSX A;  3TO9 A;  2Z10 A;  5JQ4 A;  2VQY A;  3T90 A;  4U5Y A;  2PDO A;  3IGR A;  5H86 A;  3QB8 A;  4MBU A;  4H6U A;  4F6A A;  2G3T A;  3N7Z A;  4RI1 A;  1IYL A;  2FL4 A;  2GIV A;  3GYA A;  3BLN A;  2O28 A;  1N71 A;  4MJ8 A;  1P0H A;  1P4N A;  4R3K A;  2FCK A;  2EUI A;  3D3S A;  5CNP A;  2ZXV A;  3CXQ A;  1IIC A;  1BOB A;  2J8M A;  4LUA A;  3D2P A;  2ZW5 A;  3EO4 A;  3OWC A;  4IUS A;  4Y49 C;  2BEI A;  4KLV A;  4CS0 B;  4KOR A;  5JPH A;  2CY2 A;  1I12 A;  5F48 A;  1SQH A;  4R3L A;  5I0C A;  5C82 A;  1PUA A;  3H4Q A;  1YVO A;  5EC4 A;  2VXK A;  2P6E A;  4KUB A;  2OU2 A;  1YRE A;  4XPL A;  1OZP A;  1Z4E A;  3R9E A;  4KOT A;  2Q0Y A;  2R7H A;  1KZF A;  4H6Z A;  4QVT A;  2R8V A;  2BSW A;  2B5G A;  3TO7 A;  5C88 A;  3R9G A;  2H5M A;  3FNC A;  2NMT A;  2FIA A;  4KOW A;  2PSW A;  4NEX A;  2Q4Y A;  3QAH A;  4KOS A;  2QIR A;  2P6F A;  3ZJ0 A;  3LOD A;  2Q7B A;  2JDD A;  3SXN A;  5F47 A;  1S7F A;  2JDC A;  1YX0 A;  4MY3 A;  5IV0 A;  4OAE A;  3W6S A;  3B8G A;  3R96 A;  2X7B A;  1M4G A;  4R87 A;  3BJ8 A;  4NF1 A;  3GY9 A;  1KUY A;  2ATR A;  5DWM A;  4ZBG A;  5HH1 A;  2REF A;  4X5K A;  4XPD B;  1S5K A;  2J8N A;  1XE4 A;  3R95 A;  1V0C A;  2FT0 A;  4BMH A;  2VBQ A;  3P2F A;  2DXQ A;  3TFY A;  1YK3 A;  4MI4 A;  3TE4 A;  3G8W A;  3T9Y A;  3TTH A;  1Z4R A;  4RS2 A;  2QEC A;  1MK4 A;  1Y9W A;  2D4P A;  3P2H A;  5IB0 A;  3TOA A;  4U9Y A;  4XPD C;  4M85 A;  1VKC A;  4PV6 A;  2OZH A;  4I49 A;  4QUS A;  1L0C A;  2OB0 A;  2B4B A;  4B5P A;  3IWG A;  2FSR A;  4XNH C;  3R1K A;  1M4D A;  2ZW7 A;  1YR0 A;  2K5T A;  2RC4 A;  1RO5 A;  1QSO A;  1NE9 A;  4L89 A;  2P6G A;  1XF8 A;  2Q44 A;  3LD2 A;  3W6X A;  1Q2Y A;  4KVM E;  2VEZ A;  3PGP A;  4FD6 A;  1IID A;  2B3V A;  3F8K A;  4UA3 A;  4KLW A;  4HKF A;  3I9S A;  1UFH A;  3GKR A;  3E0K A;  4CRY B;  3DR6 A;  3D2M A;  1Y7R A;  4R57 A;  1S7N A;  2JLM A;  4QBJ A;  4AG7 A;  5IX3 A;  1I1D A;  4JLY A;  5E96 A;  2PQ8 A;  1WWZ A;  2ARH A;  2OH1 A;  4CRZ B;  2WPW A;  3TCV A;  3FIX A;  2AJ6 A;  3CXP A;  3TT2 A;  2Q4V A;  4II9 A;  1S7K A;  3ZZI A;  1VHS A;  2B58 A;  1QST A;  4KOY A;  2CNS A;  4KOX A;  4XNH B;  3SXO A;  4HNX B;  4AVA A;  4FD7 A;  4CAX A;  2A4N A;  1S60 A;  2PRB A;  3FYN A;  4NCZ A;  3VWE A;  4EVY A;  3JUW A;  4E2A A;  3F0A A;  5KTD A;  1S7L A;  3BJ7 A;  3FXT A;  3WR7 A;  2F5I A;  2OZU A;  2OZG A;  1M1D A;  4DNC A;  5J8C A;  3V8I A;  4AG9 A;  1R57 A;  4YRH A;  4L8A A;  1RXT A;  1Z9U A;  3MGD A;  1YVK A;  2PC1 A;  4ONU A;  4CAV A;  2B5G B;  4FD5 A;  1Y9K A;  2WPX A;  1BO4 A;  4ORF A;  2Z0Z A;  3F5B A;  2GE3 A;  4AB7 A;  4UBR A;  4E8O A;  2G0B A;  2QML A;  3KKW A;  1CM0 A;  4UWJ A;  1QSR A;  2ZW4 A;  1YGH A;  3CXS A;  1J4J A;  2KCW A;  4FD4 A;  1Q2D A;  1MJB A;  5GCN A;  2CNM A;  4U9Z A;  4YFJ A;  1S3Z A;  2BL1 A;  2AE6 A;  3D8P A;  4KOU A;  4MHD A;  4B5O A;  2FXF A;  1LRZ A;  1XIX A;  1M44 A;  2Z11 A;  3EXN A;  1YLE A;  3DR8 A;  4UWI A;  2HQY A;  1IB1 E;  4PK3 A;  1K4J A;  2Q04 A;  1I21 A;  4QB9 A;  4R9M A;  1M4I A;  3EC4 A;  3C26 A;  2B3U A;  1GHE A;  3DNS A;  3EY5 A;  3JVN A;  3FBU A;  2B4D A;  1FY7 A;  2VZZ A;  4JD6 A;  5H84 A;  1TIQ A;  3R9F A;  2J8R A;  2PR8 A;  2Y0M A;  4J3G A;  4JJX A;  4IF5 A;  2REE A;  2R1I A;  1U6M A;  4HNW B;  2IL4 A; 
#chains in the Genus database with same CATH topology
 1BAV A;  1ARM A;  2FS5 A;  2JEV A;  1IOF A;  4OAD A;  4OME A;  2YNC C;  2ZOF A;  4KZT A;  4K30 A;  3TC8 A;  3NH8 A;  5ISV A;  2ZEO A;  4O23 A;  1WK4 A;  4P10 A;  2HUZ A;  2AFO A;  3ISX A;  3KR5 A;  4E0A A;  3WT4 A;  4HNY B;  4KVX A;  3TO6 A;  4JXQ A;  3VH9 A;  3S9N A;  2CTB A;  2FE7 A;  2ZED A;  4Q7A A;  4PXC A;  3SHP A;  4A30 A;  1ZLH A;  5HMN A;  5J8F A;  4AXV A;  4OC0 A;  1NMT A;  3S6K A;  5LRK A;  4P4I A;  4B10 A;  3B3V A;  1IGB A;  2C27 A;  3IWW A;  5JH9 A;  4BD9 A;  3TOB A;  4OC2 A;  3W91 A;  1LAM A;  1A2Z A;  4F0Y A;  4MRI A;  1JWQ A;  2I79 A;  2ZEM A;  2PJ1 A;  2PRQ A;  3IFE A;  3IO1 A;  3FRM A;  4MHN A;  1AUG A;  4NGM A;  1KUV A;  2G9D A;  2I00 A;  4Q38 A;  4CAE A;  5KTC A;  2JEW A;  1MJ9 A;  1CJW A;  1HDU A;  2RFH A;  2FVG A;  4KVO E;  4OP4 A;  1VHO A;  1UWY A;  2BOA A;  3B7I A;  2Q7S A;  2F7V A;  1VIX A;  5F46 A;  4CAW A;  4KUA A;  2CNT A;  1B6B A;  3PEI A;  1CPX A;  1XMB A;  2VI7 A;  4Y49 B;  5K8M A;  1Q2C A;  4NXY A;  3NE7 A;  4WJB A;  4MCS A;  2B4D B;  2ANP A;  3NFZ A;  3PZJ A;  2G3A A;  4FUU A;  4GS4 A;  4K3N A;  3EFA A;  4KOV A;  4JXR A;  4NGN A;  4UF4 A;  3DGV A;  3LAC A;  1YME A;  1XMT A;  3CDX A;  3FF3 A;  4P44 A;  4YGO A;  3FEE A;  4PSW A;  2PJ0 A;  5DWN A;  1QSM A;  2VZY A;  3S6G A;  2D4O A;  4CYQ A;  4LX9 A;  1MJA A;  4ZI6 A;  1QSN A;  4B12 A;  4MMO A;  3DDD A;  4PK2 A;  1YW4 A;  4IAV A;  4MCQ A;  4F0X A;  2P0W A;  3DSB A;  2PJ5 A;  2JBJ A;  2ZEE A;  3UY5 A;  5EBV A;  3K9T A;  5FVJ A;  3A9L A;  2HV2 A;  2ZOG A;  2WSA A;  2GAN A;  5HVF A;  4EWT A;  3NH4 A;  3VWD A;  3SI1 A;  3KGQ A;  1B87 A;  2BO9 A;  4P45 A;  5JM6 A;  5AGE A;  4R6T A;  4QC6 A;  1CP6 A;  1F57 A;  4MY0 A;  3WAB A;  4ZGY B;  1PU9 A;  2Q4Z A;  1ON0 A;  3RYO A;  1KUX A;  4GXH A;  4NSQ A;  3B3C A;  3H8E A;  4CGO A;  5F09 A;  1Y7E A;  3PP9 A;  4H89 A;  4ZY2 A;  3B3W A;  4AVC A;  2ZPA A;  2V77 A;  4KSI A;  3S6F A;  4P4D A;  3G3S A;  4CYO A;  2R98 A;  1XEB A;  4PXD A;  5F49 A;  3SJF A;  4Z65 A;  4JWP A;  2PR1 A;  3SJX A;  4CPA A;  3V7Z A;  3SJG A;  4TWE A;  1XRY A;  4AVB A;  1NSL A;  5KTA A;  3IC1 A;  4FAI A;  3IJ3 A;  2VL1 A;  4M3S A;  1M4L A;  3FB3 A;  3I3G A;  3I1U A;  3K9U A;  2BUE A;  4G1P A;  4EFD A;  1Z8T A;  4XPK A;  4B5P B;  4CGM A;  2ZW6 A;  3S6H A;  4OLL A;  4IHM A;  2EVN A;  1IYK A;  2FIW A;  2HB6 A;  4PSX A;  4BBH A;  5I4M A;  2GRE A;  3TO9 A;  4NFR A;  3D7D A;  4DYO A;  3KI9 A;  4OC1 A;  1QQ9 A;  2Z10 A;  5AG4 A;  5JQ4 A;  2VQY A;  3KR4 A;  3D7G A;  3T90 A;  5LYI A;  2WZN A;  4PPZ A;  3B35 A;  4U5Y A;  4UCP A;  2PDO A;  2ZEG A;  4FBE A;  3IGR A;  3PRT A;  4UFV A;  5H86 A;  3CPA A;  3QB8 A;  4MBU A;  3B3S A;  1ZG7 A;  2PJ3 A;  4H6U A;  1Z8W A;  4F6A A;  2G3T A;  3N7Z A;  4RI1 A;  4R8F A;  1ZLI A;  1IYL A;  2FL4 A;  2GIV A;  4PQA A;  3GYA A;  3BLN A;  2O28 A;  1N71 A;  4C2Y A;  3RO0 A;  3PB8 X;  4MJ8 A;  1P0H A;  3ISZ A;  1ZG8 A;  1P4N A;  4A32 A;  4P4F A;  2YGW A;  3BI0 A;  2Z3K A;  5A28 A;  2BCO A;  2Z3N A;  4R3K A;  2Z3M A;  4M6G A;  2FCK A;  2EUI A;  3D3S A;  5CNP A;  5JGF A;  2WYR A;  4MXU A;  4A37 A;  2GFQ A;  3IU1 A;  4NJR A;  2ZXV A;  3CXQ A;  1IIC A;  4CGN A;  1BOB A;  1FT7 A;  2ZEP A;  4NJQ A;  2CIJ A;  2JBK A;  1F2O A;  1NSA A;  2J8M A;  4LUA A;  2ZEN A;  3D2P A;  2ZW5 A;  3EO4 A;  3OWC A;  4IUS A;  4UEZ A;  2BEI A;  4Y49 C;  4KLV A;  4RN7 A;  3SI0 A;  4CS0 B;  4ONW A;  4KOR A;  3FED A;  5JPH A;  1TKF A;  2CY2 A;  2PJB A;  1I12 A;  3KQZ A;  3N5F A;  1SQH A;  4R3L A;  5F48 A;  5I0C A;  5C82 A;  5LYL A;  1PUA A;  2GU2 A;  1CBX A;  1F2P A;  2XEF A;  3H4Q A;  3BI1 A;  2C6P A;  3PFE A;  1YVO A;  5EC4 A;  3KL9 A;  2EK9 A;  2VXK A;  2P6E A;  4R7M A;  1VGY A;  4UEF A;  4KUB A;  2OU2 A;  1YRE A;  2XEI A;  2V8G A;  4XPL A;  1Z5R A;  1OZP A;  4B13 A;  1Z4E A;  3HLP A;  3S9M A;  3PB7 X;  1XFO A;  3R9E A;  4A31 A;  4KOT A;  1H8L A;  2Q0Y A;  2R7H A;  1KZF A;  3GB0 A;  4H6Z A;  2PVW A;  2OOT A;  2PVV A;  4QVT A;  2R8V A;  4C7H A;  3NH5 A;  2BSW A;  4F9U A;  8CPA A;  2B5G A;  3D67 A;  3QAY A;  4ZY1 A;  2Z3L A;  3TO7 A;  3GLJ A;  4A38 A;  5C88 A;  3RAM A;  4GM5 A;  4B14 A;  4C2Z A;  2NSM A;  3R9G A;  2H5M A;  2PJA A;  1DTD A;  2CF4 A;  3FNC A;  2GLF A;  2NMT A;  2FIA A;  5G1Z A;  4A39 A;  1LOK A;  1Z8X A;  4KOW A;  4W9Y A;  2PSW A;  4NEX A;  2Q4Y A;  4X3R A;  3RBU A;  3QAH A;  4KOS A;  2QIR A;  3KAS A;  2P6F A;  4HPS A;  3D66 A;  5J1Q A;  1XOV A;  3SI2 A;  3RZA A;  2YNE A;  3ZJ0 A;  2PJ4 A;  5ELY A;  3LOD A;  2Q7B A;  3KZW A;  4M6H A;  2JDD A;  4EME A;  3SXN A;  2I3C A;  2IJZ A;  3HUV A;  1TKJ A;  4MHP A;  2CTC A;  2J9A A;  1Y0R A;  5F47 A;  1S7F A;  4UFX A;  2JDC A;  1YX0 A;  4MY3 A;  5K8N A;  5IV0 A;  4OAE A;  2V8D A;  4LQG A;  3KQX A;  1Y0Y A;  2IQ6 A;  3W6S A;  2AFZ A;  3B8G A;  3R96 A;  1LFW A;  5K8O A;  2X7B A;  1M4G A;  4R87 A;  3BJ8 A;  4NF1 A;  3GY9 A;  1KUY A;  1FNO A;  2EO8 A;  2ATR A;  1YW6 A;  2F8H A;  5A27 A;  5DWM A;  4ZBG A;  5HH1 A;  2V8H A;  1TKH A;  5D29 A;  2REF A;  2PIZ A;  3CZX A;  4X5K A;  4XPD B;  4F8Z A;  1RTQ A;  1AMP A;  1S5K A;  4NGR A;  5LRG A;  2J8N A;  2GLJ A;  3RNZ A;  1XE4 A;  3H5Z A;  3R95 A;  1R3N A;  1V0C A;  2FT0 A;  2PJ2 A;  2VBQ A;  1YQE A;  3P2F A;  1CG2 A;  2DXQ A;  4FWU A;  4M6I A;  4UCM A;  4BMH A;  3WC6 A;  3TFY A;  1YK3 A;  4MI4 A;  4DUK A;  1YSJ A;  3G8W A;  3TE4 A;  3T9Y A;  3QNV A;  3TTH A;  1Z4R A;  4RS2 A;  1R43 A;  4CYN A;  2QEC A;  3PB9 X;  1MK4 A;  1Y9W A;  3GUX A;  2D4P A;  2ODF A;  1QMU A;  3P2H A;  4MFQ A;  4MFJ A;  3TX8 A;  1Q7L A;  4Q36 A;  5AG7 A;  5IB0 A;  3TOA A;  4U9Y A;  3VAT A;  4KSF A;  2YND A;  4XPD C;  5BWA B;  4M85 A;  1LAN A;  1VKC A;  3IIB A;  4TNU A;  4PV6 A;  3PBE A;  4LQ6 A;  3H8F A;  3WC5 A;  5LRJ A;  4MFZ A;  2OZH A;  4I49 A;  3PBB A;  4QUS A;  4PXE A;  1L0C A;  2OB0 A;  2B4B A;  2YNC A;  4KSA A;  4NGP A;  2XEJ A;  3MN8 A;  4B5P A;  3IWG A;  5THW A;  2FSR A;  2AFX A;  2C6G A;  3K2K A;  4HNW B;  4XNH C;  3R1K A;  1M4D A;  2DPS A;  4WWV A;  1CPS A;  4ZX9 A;  1TF9 A;  2ZW7 A;  5G22 A;  1YR0 A;  3JTK A;  2Z3O A;  2DPT A;  2K5T A;  2RC4 A;  1RO5 A;  1QSO A;  4NGS A;  3BXM A;  5HVH A;  1NE9 A;  3T8W A;  4L89 A;  4P4J A;  2AFS A;  1KWM A;  2P6G A;  1XF8 A;  5CBM A;  3KHZ A;  2Q44 A;  3LD2 A;  4CAF A;  1VHE A;  3W6X A;  4X8I A;  1Q2Y A;  1Z2L A;  4KVM E;  2VEZ A;  3PGP A;  4FD6 A;  4OC4 A;  4MCP A;  1PCA A;  2PJC A;  3JRU A;  4ZY0 A;  1IID A;  2B3V A;  4A95 A;  4JZ0 A;  5LYF A;  2CXA A;  3F8K A;  4IK2 A;  4UA3 A;  4UFW A;  1BPN A;  2C1C A;  3FJU A;  4HKF A;  4KLW A;  3I9S A;  4UEE A;  1UFH A;  1BLL E;  3E0K A;  3GKR A;  2AFM A;  3DR6 A;  4CRY B;  2ZEL A;  2Q51 A;  3D2M A;  1Y7R A;  4UCN A;  4R57 A;  4YU9 A;  4ZX8 A;  3PB4 X;  1S7N A;  2NYQ A;  2PJ6 A;  2JLM A;  4QBJ A;  4C2X A;  1PYT B;  4NGQ A;  4AG7 A;  2AFU A;  5AG6 A;  3FVL A;  3IU2 A;  1I1D A;  5IX3 A;  4JLY A;  5E96 A;  2PQ8 A;  1WWZ A;  1HEE A;  3B3T A;  2ARH A;  1X10 A;  2OH1 A;  2OR4 A;  2AFW A;  5CPA A;  5LYD A;  4CRZ B;  3S9L A;  2WPW A;  3TCV A;  1ZG9 A;  3FIX A;  2AJ6 A;  1X12 A;  3CXP A;  3TT2 A;  2Q4V A;  3IWE A;  1HDQ A;  4R76 A;  2PJ7 A;  4MFP A;  4II9 A;  3GIU A;  1S7K A;  1TF8 A;  1OBR A;  2ABZ A;  3SJE A;  4ZYQ A;  1BPM A;  3ZZI A;  1YLO A;  1VHS A;  2B58 A;  1QST A;  2PJ9 A;  2CNS A;  4KOY A;  1XJO A;  4KOX A;  4PXB A;  4XNH B;  3SXO A;  1ELM P;  4HNX B;  4FD7 A;  4X2T A;  1GYT A;  4AVA A;  4CAX A;  2A4N A;  7CPA A;  2ZEF A;  4KS9 A;  1S60 A;  2PRB A;  3FYN A;  4NCZ A;  3VWE A;  4C68 A;  6CPA A;  3MRU A;  4EVY A;  3KHX A;  3JUW A;  3D68 A;  4MCR A;  2EBJ A;  4E2A A;  3F0A A;  5KTD A;  1S7L A;  1TXR A;  3BJ7 A;  3FXT A;  5G21 A;  4YWY A;  3WR7 A;  2F5I A;  2OZU A;  2OZG A;  5G20 A;  1M1D A;  4MFL A;  4DNC A;  5J8C A;  4H2K A;  3V8I A;  2QJ8 A;  3NE8 A;  4AG9 A;  4BIN A;  1R57 A;  4YRH A;  1Z8L A;  2C6C A;  3CT9 A;  4L8A A;  5EMI A;  3D7F A;  1RXT A;  1Z9U A;  3MGD A;  1AYE A;  5DS0 A;  1YVK A;  2PC1 A;  4B6Z A;  4ONU A;  5HXD A;  2PCU A;  3LMS A;  2QVP A;  4CAV A;  2B5G B;  4OID A;  3D7H A;  2POK A;  2WUU A;  3NA6 A;  4FD5 A;  2EK8 A;  1Y9K A;  5K8P A;  2WPX A;  1BO4 A;  2ZEH A;  4ORF A;  2Z0Z A;  3F5B A;  2GE3 A;  2DF5 A;  3FMC A;  4UBR A;  4AB7 A;  4E8O A;  4P6Y A;  2G0B A;  2QML A;  3KKW A;  1CM0 A;  4UWJ A;  1QSR A;  2Z3P A;  2ZW4 A;  4MHY A;  1YGH A;  3CXS A;  4DJL A;  1J4J A;  4OC5 A;  1XBU A;  4OKO A;  2KCW A;  4FD4 A;  3VAR A;  2PE3 A;  1Q2D A;  1MJB A;  3FEC A;  5AG5 A;  2CNM A;  5GCN A;  4B11 A;  4U9Z A;  4CGP A;  3WC7 A;  2EWB A;  2O53 A;  4YFJ A;  1DE4 C;  1S3Z A;  2PJ8 A;  2IMO A;  2O4H A;  3BHX A;  1LAP A;  2BL1 A;  2AE6 A;  3D8P A;  4KOU A;  4MHD A;  4A33 A;  1IOI A;  3FX6 A;  2FXF A;  4P4B A;  4B5O A;  3L2N A;  3H8G A;  1EE3 P;  2QYV A;  3IEH A;  1LRZ A;  4MHZ A;  1ARL A;  2DEA A;  2HC9 A;  1XIX A;  3CPX A;  5IB9 A;  1M44 A;  4F9V A;  2Z11 A;  4OC3 A;  3EXN A;  2Q43 A;  4UIA A;  1YLE A;  3DLJ A;  3DR8 A;  1JQG A;  2XEG A;  4UWI A;  3LWU A;  2HQY A;  1IB1 E;  1K4J A;  4PK3 A;  4CGL A;  5D8N A;  2Q04 A;  1I21 A;  4RUH A;  4JYW A;  4QB9 A;  4R9M A;  1LCP A;  1M4I A;  2RB7 A;  1IU8 A;  3EC4 A;  3C26 A;  3B2Y A;  2PIY A;  2B3U A;  4UIB A;  4C7I A;  1CP7 A;  1ZO0 A;  1GHE A;  3DNS A;  3EY5 A;  3JVN A;  3FH4 A;  3PFO A;  3FBU A;  3V38 A;  2B4D A;  1FY7 A;  2VZZ A;  4JD6 A;  5H84 A;  1TIQ A;  3R9F A;  2J8R A;  2PR8 A;  4P4E A;  2Y0M A;  4J3G A;  3D4U A;  4MFK A;  4A2Z A;  5HVG A;  4JJX A;  4IF5 A;  1CX8 A;  4CYP A;  2V8V A;  2REE A;  1ELL P;  2R1I A;  4A94 A;  1U6M A;  1IY7 A;  2IL4 A;  4OIW A;  4NGT A;  3PB6 X; 
#chains in the Genus database with same CATH homology
 2FS5 A;  2JEV A;  4OAD A;  2YNC C;  4KZT A;  4K30 A;  5ISV A;  1WK4 A;  4E0A A;  2HUZ A;  4HNY B;  4KVX A;  3TO6 A;  4JXQ A;  2FE7 A;  5J8F A;  3SHP A;  4A30 A;  5HMN A;  1NMT A;  3S6K A;  4B10 A;  2C27 A;  3TOB A;  3W91 A;  4F0Y A;  2I79 A;  3FRM A;  4Q38 A;  4CAE A;  1KUV A;  2I00 A;  5KTC A;  1MJ9 A;  1CJW A;  4KVO E;  5F46 A;  4CAW A;  4KUA A;  2CNT A;  1B6B A;  2VI7 A;  4Y49 B;  1Q2C A;  4NXY A;  3NE7 A;  2B4D B;  3PZJ A;  2G3A A;  4GS4 A;  3EFA A;  4KOV A;  4JXR A;  1XMT A;  4YGO A;  4PSW A;  5DWN A;  1QSM A;  2VZY A;  3S6G A;  2D4O A;  4CYQ A;  4LX9 A;  1MJA A;  1QSN A;  4B12 A;  3DDD A;  4PK2 A;  4F0X A;  2P0W A;  3DSB A;  3UY5 A;  5EBV A;  5FVJ A;  3A9L A;  2HV2 A;  2WSA A;  2GAN A;  3VWD A;  1B87 A;  5AGE A;  4QC6 A;  4MY0 A;  4ZGY B;  1PU9 A;  1ON0 A;  3RYO A;  1KUX A;  4NSQ A;  4CGO A;  3PP9 A;  4H89 A;  4AVC A;  2ZPA A;  3S6F A;  4CYO A;  3G3S A;  2R98 A;  1XEB A;  5F49 A;  4JWP A;  2PR1 A;  4AVB A;  1NSL A;  5KTA A;  4M3S A;  3FB3 A;  3I3G A;  3K9U A;  2BUE A;  4XPK A;  4B5P B;  4CGM A;  2ZW6 A;  3S6H A;  4OLL A;  2EVN A;  1IYK A;  2FIW A;  4PSX A;  4BBH A;  3TO9 A;  2Z10 A;  5AG4 A;  5JQ4 A;  2VQY A;  3T90 A;  4UCP A;  4U5Y A;  2PDO A;  3IGR A;  4UFV A;  5H86 A;  3QB8 A;  4MBU A;  4H6U A;  4F6A A;  2G3T A;  3N7Z A;  4RI1 A;  1IYL A;  2FL4 A;  2GIV A;  3GYA A;  3BLN A;  2O28 A;  1N71 A;  4C2Y A;  4MJ8 A;  1P0H A;  1P4N A;  4A32 A;  2YGW A;  2Z3K A;  5A28 A;  2Z3N A;  4R3K A;  2Z3M A;  2FCK A;  2EUI A;  3D3S A;  5CNP A;  3IU1 A;  2ZXV A;  3CXQ A;  1IIC A;  4CGN A;  1BOB A;  2J8M A;  4LUA A;  3D2P A;  2ZW5 A;  3EO4 A;  4IUS A;  3OWC A;  4Y49 C;  2BEI A;  4KLV A;  4CS0 B;  4KOR A;  5JPH A;  2CY2 A;  1I12 A;  5F48 A;  1SQH A;  4R3L A;  5I0C A;  5C82 A;  1PUA A;  3H4Q A;  1YVO A;  5EC4 A;  2VXK A;  2P6E A;  4KUB A;  2OU2 A;  1YRE A;  4XPL A;  1OZP A;  4B13 A;  1Z4E A;  3R9E A;  4A31 A;  4KOT A;  2Q0Y A;  2R7H A;  1KZF A;  4H6Z A;  4QVT A;  2R8V A;  4C7H A;  2BSW A;  2B5G A;  2Z3L A;  3TO7 A;  5C88 A;  4B14 A;  4C2Z A;  3R9G A;  2H5M A;  3FNC A;  2NMT A;  2FIA A;  5G1Z A;  4KOW A;  2PSW A;  4NEX A;  2Q4Y A;  3QAH A;  4KOS A;  2QIR A;  2P6F A;  2YNE A;  3ZJ0 A;  3LOD A;  2Q7B A;  2JDD A;  3SXN A;  5F47 A;  1S7F A;  4UFX A;  2JDC A;  1YX0 A;  4MY3 A;  5IV0 A;  4OAE A;  3W6S A;  3B8G A;  3R96 A;  2X7B A;  1M4G A;  4R87 A;  3BJ8 A;  4NF1 A;  3GY9 A;  1KUY A;  2ATR A;  5A27 A;  5DWM A;  4ZBG A;  5HH1 A;  2REF A;  4X5K A;  4XPD B;  1S5K A;  2J8N A;  1XE4 A;  3H5Z A;  3R95 A;  1V0C A;  2FT0 A;  4BMH A;  2VBQ A;  3P2F A;  2DXQ A;  4UCM A;  3TFY A;  1YK3 A;  4MI4 A;  3TE4 A;  3G8W A;  3T9Y A;  3TTH A;  1Z4R A;  4RS2 A;  4CYN A;  2QEC A;  1MK4 A;  1Y9W A;  2D4P A;  3P2H A;  4MFQ A;  4MFJ A;  4Q36 A;  5AG7 A;  5IB0 A;  3TOA A;  4U9Y A;  5BWA B;  4KSF A;  2YND A;  4XPD C;  4M85 A;  1VKC A;  4PV6 A;  4MFZ A;  2OZH A;  4I49 A;  4QUS A;  1L0C A;  2OB0 A;  2B4B A;  2YNC A;  4KSA A;  4B5P A;  3IWG A;  2FSR A;  4XNH C;  3R1K A;  1M4D A;  2DPS A;  2ZW7 A;  5G22 A;  1YR0 A;  3JTK A;  2Z3O A;  2DPT A;  2K5T A;  2RC4 A;  1RO5 A;  1QSO A;  1NE9 A;  4L89 A;  2P6G A;  1XF8 A;  2Q44 A;  3LD2 A;  4CAF A;  3W6X A;  1Q2Y A;  4KVM E;  2VEZ A;  3PGP A;  4FD6 A;  1IID A;  2B3V A;  4A95 A;  2CXA A;  3F8K A;  4UA3 A;  4UFW A;  4KLW A;  4HKF A;  3I9S A;  1UFH A;  3GKR A;  3E0K A;  4CRY B;  3DR6 A;  4UCN A;  3D2M A;  1Y7R A;  4R57 A;  1S7N A;  2JLM A;  4QBJ A;  4C2X A;  4AG7 A;  5AG6 A;  3IU2 A;  5IX3 A;  1I1D A;  4JLY A;  5E96 A;  2PQ8 A;  1WWZ A;  2ARH A;  2OH1 A;  4CRZ B;  2WPW A;  3TCV A;  3FIX A;  2AJ6 A;  3CXP A;  3TT2 A;  2Q4V A;  3IWE A;  4MFP A;  4II9 A;  1S7K A;  3ZZI A;  1VHS A;  2B58 A;  1QST A;  4KOY A;  2CNS A;  4KOX A;  4XNH B;  3SXO A;  4HNX B;  4AVA A;  4FD7 A;  4CAX A;  2A4N A;  4KS9 A;  4C68 A;  1S60 A;  2PRB A;  3FYN A;  4NCZ A;  3VWE A;  4EVY A;  3JUW A;  4E2A A;  3F0A A;  5KTD A;  1S7L A;  3BJ7 A;  3FXT A;  5G21 A;  3WR7 A;  2F5I A;  2OZU A;  2OZG A;  5G20 A;  1M1D A;  4MFL A;  4DNC A;  5J8C A;  3V8I A;  4AG9 A;  1R57 A;  4YRH A;  4L8A A;  1RXT A;  1Z9U A;  3MGD A;  1YVK A;  2PC1 A;  4ONU A;  4CAV A;  2B5G B;  2WUU A;  4FD5 A;  1Y9K A;  2WPX A;  1BO4 A;  4ORF A;  2Z0Z A;  3F5B A;  2GE3 A;  4AB7 A;  4UBR A;  4E8O A;  2G0B A;  2QML A;  3KKW A;  1CM0 A;  4UWJ A;  1QSR A;  2Z3P A;  2ZW4 A;  1YGH A;  3CXS A;  1J4J A;  2KCW A;  4FD4 A;  4B11 A;  1Q2D A;  1MJB A;  5AG5 A;  5GCN A;  2CNM A;  4U9Z A;  4CGP A;  4YFJ A;  1S3Z A;  2BL1 A;  2AE6 A;  4KOU A;  3D8P A;  4MHD A;  4A33 A;  4B5O A;  2FXF A;  1LRZ A;  1XIX A;  1M44 A;  2Z11 A;  3EXN A;  1YLE A;  3DR8 A;  4UWI A;  2HQY A;  1IB1 E;  1K4J A;  4PK3 A;  4CGL A;  2Q04 A;  1I21 A;  4QB9 A;  4R9M A;  1M4I A;  3EC4 A;  3C26 A;  2B3U A;  4C7I A;  1ZO0 A;  1GHE A;  3DNS A;  3EY5 A;  3JVN A;  3FBU A;  2B4D A;  1FY7 A;  2VZZ A;  4JD6 A;  5H84 A;  1TIQ A;  3R9F A;  2J8R A;  2PR8 A;  2Y0M A;  4J3G A;  4MFK A;  4A2Z A;  4JJX A;  4IF5 A;  4CYP A;  2REE A;  2R1I A;  1U6M A;  4HNW B;  2IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...