3FYNA

Crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
160
structure length
152
Chain Sequence
b'NLYFQGLSPQVRTAHIGDVPVLVRLMSEFYQEAGFALPHDAAIRAFKALLGKPDLGRIWLIAEGTESVGYIVLTLGFSMEYGGLRGFVDDFFVRPNARGKGLGAAALQTVKQGCCDLGVRALLVETGVYSRAGFEESGRMLLGQALAPPIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integron gene cassette protein HFX_CASS3
publication title Structure from the mobile metagenome of Cole Harbour Salt Marsh: Integron Cassette Protein HFX_CASS3
rcsb
source organism Uncultured bacterium
molecule tags Structural genomics, unknown function
total genus 40
structure length 152
sequence length 160
ec nomenclature
pdb deposition date 2009-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3fynA00
4XNHC 2R8VA 4XNHB 3TOAA 3D2PA 3P2FA 4JLYA 2FS5A 3FB3A 4KZTA 1PUAA 1S3ZA 1QSOA 2Q7BA 1M44A 4CRZB 2FIAA 5E96A 5H86A 1VKCA 2G0BA 2H5MA 2Z11A 2B58A 3W6SA 5F49A 2CNSA 1OZPA 2VI7A 1M1DA 2ATRA 3VWDA 4ONUA 1Q2DA 4II9A 3RYOA 2NMTA 2OH1A 5F48A 4XPKA 1M4IA 3NE7A 3TCVA 4R3LA 3FXTA 1XIXA 2P0WA 2P6FA 2J8MA 2OZHA 4AVAA 4OADA 2D4OA 2PR1A 4AG7A 4KLVA 3W91A 4CAVA 1WK4A 4HNYB 1XEBA 1BOBA 3UY5A 1Y7RA 4JJXA 4U5YA 1QSMA 1XF8A 4F0YA 2FIWA 2FL4A 5DWMA 4QUSA 1FY7A 3R9FA 4PSWA 4KUAA 4KOTA 2JLMA 3PGPA 2KCWA 2OB0A 4MJ8A 2FCKA 2Z10A 3GKRA 2ZXVA 4KOVA 2K5TA 1P0HA 1MJAA 3JUWA 4AVBA 1IIDA 4CS0B 1S7LA 2BUEA 4GS4A 4YGOA 5C82A 5DWNA 3EFAA 4B5PB 2B5GA 4XPDB 1Z9UA 1IB1E 4ORFA 1XE4A 2REEA 2P6GA 4U9YA 3SXNA 1IYKA 2D4PA 2WPWA 2AJ6A 4Y49B 3FYNA 1LRZA 4JD6A 3OWCA 4NXYA 4XPLA 2C27A 4AVCA 4QB9A 4AG9A 3EO4A 3I9SA 3N7ZA 4E8OA 4MI4A 1BO4A 4BMHA 3ZZIA 3F8KA 2PR8A 5J8FA 1S7FA 3W6XA 4NCZA 2O28A 4M3SA 2A4NA 5IB0A 2B4BA 4KVOE 3DR6A 2B4DB 2OU2A 1RXTA 1J4JA 2FXFA 4JXQA 2VBQA 3D8PA 2GE3A 1S7KA 2DXQA 2FE7A 2Q4VA 5C88A 3H4QA 3S6KA 4UWJA 1B87A 2IL4A 4HNWB 3QB8A 1TIQA 2Q44A 1YLEA 4LX9A 3PZJA 2VZYA 3ZJ0A 4B5PA 2RC4A 2GIVA 4KOWA 2JEVA 1RO5A 3IWGA 4U9ZA 4E2AA 1YR0A 2FSRA 2PSWA 2CNTA 3MGDA 3D2MA 1YVKA 1KZFA 2J8RA 4NF1A 4KOUA 4B5OA 2G3TA 1YK3A 4KOXA 4HNXB 1VHSA 4QVTA 1I12A 5J8CA 4MY0A 1Y9WA 2J8NA 1XMTA 3FRMA 4HKFA 3TO9A 3TOBA 1K4JA 2B4DA 2AE6A 3FNCA 4K30A 2QIRA 4H6ZA 2FT0A 1I21A 2EVNA 1Z4EA 2PC1A 1YVOA 4CRYB 3SHPA 3PP9A 5KTDA 2BL1A 3P2HA 4E0AA 4KUBA 4PSXA 3WR7A 5CNPA 3EC4A 1M4DA 1WWZA 2OZGA 1QSRA 2X7BA 3S6HA 2GANA 3V8IA 4KOYA 3T9YA 5HH1A 5IV0A 2HQYA 4KORA 1V0CA 3SXOA 1SQHA 3GY9A 1YX0A 4R9MA 3D3SA 4AB7A 5EC4A 2B3VA 1YREA 1MJBA 1IYLA 5EBVA 2I79A 4F6AA 2PDOA 4JXRA 2ZPAA 1NSLA 5HMNA 3TO6A 3F0AA 3C26A 4IF5A 3EXNA 5FVJA 2R1IA 4R3KA 4M85A 2ZW4A 4RS2A 5KTAA 5H84A 4YRHA 3DSBA 3CXQA 2Z0ZA 1R57A 4L8AA 3R9GA 5IX3A 3VWEA 2R98A 3LD2A 3K9UA 1ON0A 2PRBA 2REFA 4OLLA 2VQYA 3R96A 3R9EA 3T90A 4NSQA 1PU9A 4CAWA 2ZW7A 3DDDA 4PV6A 4J3GA 4UWIA 1Q2YA 3R95A 4UA3A 1Q2CA 3BJ7A 2QMLA 2BEIA 4FD6A 2BSWA 2R7HA 4R87A 5KTCA 3TE4A 1CM0A 2B5GB 1S5KA 2CNMA 1Z4RA 1MJ9A 2EUIA 4RI1A 2VZZA 3CXSA 2QECA 1NE9A 4CAXA 3B8GA 3DR8A 2B3UA 1B6BA 2ZW5A 4LUAA 2HV2A 2VXKA 2JDCA 3EY5A 3F5BA 4KVXA 4JWPA 2PQ8A 4I49A 1CJWA 3BJ8A 1Y9KA 4KOSA 5F46A 4OAEA 3KKWA 3FIXA 3DNSA 3GYAA 4PK2A 2CY2A 1UFHA 3JVNA 1M4GA 1MK4A 4X5KA 2ARHA 2JDDA 1P4NA 3G8WA 1N71A 3FBUA 5I0CA 2WPXA 1I1DA 5F47A 3QAHA 4FD5A 5JPHA 4UBRA 1L0CA 4ZBGA 3R1KA 1YGHA 4XPDC 3TTHA 3S6GA 3TT2A 2Q4YA 3G3SA 4L89A 2F5IA 4R57A 1S7NA 4Y49C 4DNCA 2G3AA 3CXPA 3TFYA 4NEXA 2P6EA 4KVME 1KUYA 1KUVA 3TO7A 4MBUA 2Q04A 5ISVA 4IUSA 4YFJA 5GCNA 4QC6A 3S6FA 2VEZA 4PK3A 4QBJA 1IICA 1S60A 2Y0MA 1QSNA 2HUZA 1QSTA 1KUXA 3BLNA 2ZW6A 4KLWA 3I3GA 2OZUA 2I00A 2Q0YA 5JQ4A 4MHDA 4FD7A 1U6MA 4MY3A 4H6UA 1GHEA 3LODA 4H89A 1NMTA 3E0KA 4EVYA 3IGRA 4FD4A
chains in the Genus database with same CATH superfamily
4XNHC 2R8VA 3NH4A 2C6GA 4ZI6A 4XNHB 3TOAA 3D2PA 3P2FA 5K8OA 3PBEA 2GLFA 4JLYA 2FS5A 2PJCA 2ZENA 3FB3A 3PFOA 3TX8A 4CPAA 3VH9A 2CXAA 4KZTA 1PUAA 5G22A 4NGNA 1S3ZA 1QSOA 2Q7BA 1M44A 4CRZB 2FIAA 2O53A 5E96A 1YW4A 1VKCA 2G0BA 2H5MA 2ZEMA 5H86A 4P4IA 4F9UA 2GFQA 2Z11A 2B58A 2Z3MA 3IIBA 5LRGA 5F49A 3W6SA 2HB6A 2CNSA 3CPXA 2AFMA 4EFDA 1OZPA 1Y7EA 2WZNA 2VI7A 5D8NA 3IEHA 1M1DA 4WWVA 1F2PA 2ATRA 3VWDA 5HVGA 4ONUA 4FWUA 4UEEA 1Q2DA 4II9A 3RYOA 3B3VA 2NMTA 2OH1A 2PJAA 4W9YA 5F48A 4XPKA 1BPNA 1M4IA 4C68A 3NE7A 2AFXA 3TCVA 1PCAA 5JH9A 4UCPA 4R3LA 3FXTA 1XIXA 2P0WA 2P6FA 2J8MA 2OZHA 4AVAA 4OADA 2D4OA 4F8ZA 2ZEEA 2PR1A 4AG7A 4KLVA 2PIZA 1XFOA 3W91A 4ONWA 4CAVA 3S9LA 1WK4A 4HNYB 1XEBA 1Y0RA 1BOBA 4A32A 3UY5A 5HXDA 3IO1A 1Y7RA 4JJXA 4U5YA 1IGBA 1QSMA 1XF8A 1Z5RA 4P4DA 4F0YA 1XJOA 1YW6A 2FIWA 3BHXA 2PJ9A 2FL4A 3NH5A 4IHMA 1A2ZA 5DWMA 4QUSA 1BPMA 3V7ZA 3D68A 1FY7A 4NGRA 3R9FA 4PSWA 4KUAA 2PJ3A 4KOTA 3JTKA 2JLMA 2KCWA 3PGPA 2OB0A 3DGVA 4MJ8A 2FCKA 2Z10A 3GKRA 2ZXVA 4KOVA 2K5TA 1P0HA 5G21A 1MJAA 2EBJA 4LQGA 2QYVA 3JUWA 4P10A 5LYDA 1RTQA 1ELMP 4AVBA 3WT4A 1IIDA 4CS0B 2EWBA 1S7LA 1LCPA 2GLJA 3HLPA 3GIUA 2BUEA 4GS4A 2PJ5A 4YGOA 3I1UA 4RUHA 1OBRA 1PYTB 3SJGA 2AFUA 5C82A 5LRJA 5DWNA 2RFHA 3NE8A 3BXMA 4ZYQA 3EFAA 4B5PB 2B5GA 4XPDB 1CBXA 1Z9UA 4MCPA 1IB1E 4ORFA 1XE4A 2PJ0A 2REEA 2P6GA 4ZX9A 1VIXA 4U9YA 3SXNA 1IYKA 2D4PA 4OC4A 2CTBA 4NFRA 2WPWA 5G1ZA 2AJ6A 2IQ6A 4Y49B 3FYNA 1LRZA 4JD6A 3OWCA 4KSFA 4MHPA 4NXYA 4OC0A 4XPLA 5IB9A 2C27A 4AVCA 4CAEA 3KQZA 4CYPA 2ZEOA 4Q7AA 2O4HA 4MHYA 4QB9A 4AG9A 4UCNA 1H8LA 3B3SA 2Q7SA 3WABA 4A33A 3EO4A 3I9SA 3N7ZA 4NGSA 4MI4A 4MHNA 2BOAA 1BO4A 3KQXA 4BMHA 3KI9A 4E8OA 4X2TA 1ZG7A 3LWUA 3ZZIA 2ZOGA 3F8KA 2PR8A 2PJ6A 5J8FA 1S7FA 2Z3KA 2V8GA 3CPAA 4NCZA 3W6XA 2O28A 2AFOA 2A4NA 3KHXA 4M3SA 2B4BA 4UIBA 5IB0A 4KVOE 3BI0A 2JBJA 3DR6A 1Z8TA 2B4DB 2OU2A 3VATA 3WC7A 3SJXA 1RXTA 1J4JA 2Z3LA 2FXFA 1R3NA 5THWA 3H8GA 2YNCA 4JXQA 1ZO0A 4BD9A 3ISZA 1LFWA 3IC1A 2VBQA 4MXUA 4CGMA 3D8PA 2GE3A 1LOKA 1IY7A 1S7KA 2DXQA 3FF3A 3GUXA 2CTCA 2FE7A 2Q4VA 4HPSA 4A31A 1EE3P 4K3NA 5C88A 2BO9A 3H4QA 4CGPA 1YLOA 3S6KA 4UWJA 3QNVA 2XEFA 1B87A 4H2KA 5F09A 5LRKA 2Q4ZA 2IL4A 4ZY0A 2PJ8A 3LMSA 4HNWB 1Z8XA 3QB8A 1TIQA 2Q44A 2PJBA 2POKA 4UCMA 1YLEA 4B14A 4LX9A 3IU2A 1CPSA 4CYOA 4PXBA 3D67A 3KASA 3PZJA 4ZGYB 5BWAB 2VZYA 3DLJA 3FEDA 3ZJ0A 2RC4A 4B5PA 3SI2A 4ZY1A 2GIVA 4KOWA 2JEVA 3S9NA 4OC1A 2Q51A 3NH8A 4FBEA 3IWWA 3PB7X 1RO5A 4OC5A 4PXDA 1ARLA 2DPTA 4O23A 3IWGA 1HDUA 2PJ4A 2V8VA 2Z3PA 4U9ZA 4WJBA 5CBMA 4MCSA 4E2AA 1YR0A 5JM6A 3D7GA 4CYQA 2FSRA 2FVGA 1FNOA 1JQGA 2PSWA 2PJ1A 3BI1A 5G20A 2CNTA 3D7HA 3MGDA 4R8FA 1F2OA 3D2MA 1ZLIA 1YVKA 4PXCA 3L2NA 1KZFA 2J8RA 2C1CA 4KOUA 4NF1A 4B5OA 5J1QA 2G3TA 1YK3A 3WC6A 3PFEA 3FEEA 3IFEA 2YGWA 2QJ8A 4KOXA 1QMUA 4HNXB 3CZXA 1VHSA 4QVTA 4UEFA 1I12A 1LAMA 2AFZA 1CX8A 2ANPA 2PJ7A 3H5ZA 3IGRA 3KR5A 4MY0A 4P4EA 1Y9WA 4A39A 2J8NA 3FVLA 2AFSA 2CF4A 5J8CA 1XMTA 3FRMA 3B3TA 3ISXA 4HKFA 4A95A 3TO9A 3TOBA 1K4JA 1Z8LA 2B4DA 3IJ3A 2AE6A 3FNCA 3FMCA 3K2KA 4M6GA 4K30A 4B10A 1XBUA 2QIRA 3PB9X 3RO0A 2RB7A 4KSIA 1IU8A 4H6ZA 4OC2A 2FT0A 3B2YA 1I21A 2PJ2A 4EWTA 2EVNA 4M6HA 1Z4EA 2C6PA 2PC1A 5K8PA 1Q7LA 3LACA 4UFVA 3D66A 1JWQA 1YVOA 1F57A 3SHPA 4CRYB 3PP9A 5KTDA 4MHZA 2EK9A 5AG5A 5A27A 2BL1A 3D7FA 3P2HA 4E0AA 1HDQA 2DF5A 4KUBA 2XEIA 4C2XA 2IJZA 4PSXA 2OOTA 3WR7A 5CNPA 3EC4A 1M4DA 1WWZA 5CPAA 2OZGA 1QSRA 2X7BA 3S6HA 2GANA 4KS9A 1X12A 3V8IA 4KOYA 3T9YA 5HH1A 5IV0A 2HQYA 2WSAA 1CPXA 3SJEA 4KORA 1GYTA 1V0CA 3SXOA 1NSAA 1SQHA 3GY9A 1YX0A 3SI1A 2NSMA 4R9MA 2IMOA 3D3SA 4AB7A 4CYNA 4R6TA 3RAMA 5EC4A 2B3VA 1YREA 3T8WA 2ZOFA 4UF4A 3PEIA 4EMEA 3KZWA 3V38A 3A9LA 1CP7A 1MJBA 3D4UA 1ELLP 2Z3NA 4OP4A 2CIJA 2JBKA 1IYLA 2JEWA 4MMOA 4X8IA 5LYFA 4GXHA 5LYIA 4Q36A 5EBVA 3TC8A 2I79A 4F6AA 3PRTA 4DYOA 3B3CA 2PDOA 4JXRA 5HVFA 2ZPAA 1NSLA 1Z8WA 5HMNA 3CDXA 4P44A 5AG7A 3TO6A 3F0AA 3C26A 5EMIA 3NA6A 4G1PA 3CT9A 1DTDA 1FT7A 4IF5A 4JYWA 3EXNA 5FVJA 2NYQA 1BLLE 4OIDA 2R1IA 4CGNA 4R3KA 1UWYA 4M85A 1BAVA 2ZW4A 4RS2A 5H84A 5KTAA 3FECA 5AG6A 4YRHA 2EO8A 3D7DA 3DSBA 3CXQA 4NGTA 2Z0ZA 1R57A 2F7VA 4L8AA 4ZY2A 3R9GA 1CG2A 4BINA 5IX3A 1YSJA 2VL1A 5JGFA 3PB4X 3VWEA 2R98A 3LD2A 4P45A 4C2YA 1Y0YA 3KR4A 3K9UA 5A28A 1ON0A 4B12A 2PRBA 2REFA 1Z2LA 3KHZA 4MFPA 4OLLA 3RZAA 2VQYA 3R96A 3R9EA 2PRQA 3IU1A 4NSQA 1AUGA 2ZEHA 3T90A 2V8HA 4NGPA 1PU9A 4CAWA 2ZW7A 4P4FA 3DDDA 1TKHA 3VARA 3B3WA 4PV6A 4UEZA 4J3GA 2YNDA 2HC9A 1M4LA 4UWIA 1Q2YA 1CP6A 2WUUA 3R95A 5AGEA 4UA3A 1KWMA 1Q2CA 2V77A 4PXEA 4FUUA 1ZG9A 3BJ7A 2QMLA 2BEIA 4FD6A 2XEJA 2BCOA 2ZEGA 1AMPA 3B35A 2BSWA 1VHEA 2R7HA 4R87A 5KTCA 3TE4A 3KL9A 4P4JA 2GU2A 1CM0A 2B5GB 1S5KA 2CNMA 1Z4RA 1MJ9A 3N5FA 2G9DA 3FJUA 1TXRA 1VHOA 2EUIA 4RI1A 2VZZA 3CXSA 2QECA 1HEEA 4CGLA 1NE9A 4JZ0A 4CAXA 2V8DA 1TF9A 4X3RA 3RBUA 4GM5A 3B8GA 3PBBA 3PB6X 3DR8A 4MCQA 4TNUA 4MFJA 4YWYA 4F9VA 2B3UA 1B6BA 2ZW5A 4LUAA 1DE4C 2ZEDA 4FAIA 4UFXA 3SI0A 2HV2A 2VXKA 2JDCA 2PVWA 2GREA 2DPSA 3EY5A 3F5BA 1TKJA 3MRUA 4JWPA 4KVXA 5DS0A 6CPAA 3S9MA 2PQ8A 4OKOA 3SJFA 4B13A 4I49A 1ZLHA 2ZELA 4Q38A 1CJWA 5K8MA 4A94A 4PPZA 2ZEPA 4UFWA 4IK2A 3RNZA 3BJ8A 4MFKA 1Y9KA 4KOSA 2PE3A 2ZEFA 5F46A 1XOVA 4OAEA 4Z65A 3KKWA 3FIXA 1R43A 2Z3OA 3DNSA 4MFZA 1AYEA 5LYLA 2YNCC 3GYAA 1X10A 2QVPA 4PK2A 3NFZA 1IOIA 2CY2A 4UIAA 1UFHA 2XEGA 3JVNA 4YU9A 1M4GA 4AXVA 1MK4A 4X5KA 2ARHA 3FX6A 4P6YA 2JDDA 1P4NA 4A38A 1N71A 3FBUA 1ARMA 3G8WA 4A2ZA 4C7IA 2OR4A 5ELYA 5I0CA 4OC3A 5I4MA 2PVVA 2WPXA 4A30A 1I1DA 5F47A 3QAHA 4FD5A 4F0XA 5JPHA 2F8HA 1L0CA 4UBRA 1YMEA 4DJLA 5K8NA 4DUKA 4NJRA 4NGMA 4OIWA 4ZBGA 3R1KA 1YGHA 3HUVA 4FD4A 4B6ZA 4M6IA 3GLJA 4XPDC 3TTHA 3S6GA 3TT2A 2Q4YA 2J9AA 3G3SA 4L89A 4ZX8A 2F5IA 4C2ZA 4R57A 1S7NA 2WYRA 4Y49C 1TF8A 4KSAA 4DNCA 2G3AA 4LQ6A 5AG4A 3CXPA 3TFYA 1IOFA 4NJQA 4NEXA 1LANA 2P6EA 4R76A 4RN7A 4P4BA 4KVME 3WC5A 4R7MA 1KUYA 4PQAA 1KUVA 2PCUA 3H8FA 3TO7A 3B7IA 3MN8A 2ABZA 4MBUA 4TWEA 4MRIA 2Q04A 4B11A 5ISVA 3PB8X 3GB0A 2EK8A 4IUSA 4YFJA 4NGQA 4CAFA 5GCNA 4QC6A 3S6FA 2VEZA 4PK3A 4QBJA 1XMBA 1IICA 1S60A 2Y0MA 1TKFA 5D29A 2YNEA 1QSNA 2HUZA 1QSTA 1KUXA 2I3CA 2C6CA 1QQ9A 3BLNA 4MFLA 7CPAA 2ZW6A 3JRUA 4IAVA 3I3GA 4KLWA 2OZUA 4BBHA 4MFQA 1ZG8A 2I00A 2Q0YA 8CPAA 5JQ4A 4MHDA 3IWEA 3KGQA 4FD7A 4A37A 4C7HA 1VGYA 3K9TA 1U6MA 4MY3A 4MCRA 4H6UA 1GHEA 3QAYA 2Q43A 4OMEA 3LODA 3FH4A 1XRYA 1YQEA 2PIYA 4H89A 1NMTA 3E0KA 5HVHA 4CGOA 4EVYA 2AFWA 3H8EA 2ODFA 1LAPA 2DEAA
chains in the Genus database with same CATH topology
4XNHC 2R8VA 4XNHB 3TOAA 3D2PA 3P2FA 4JLYA 2FS5A 3FB3A 2CXAA 4KZTA 1PUAA 5G22A 1S3ZA 1QSOA 2Q7BA 1M44A 4CRZB 2FIAA 5E96A 5H86A 1VKCA 2G0BA 2H5MA 2Z11A 2B58A 2Z3MA 3W6SA 5F49A 2CNSA 1OZPA 2VI7A 1M1DA 2ATRA 3VWDA 4ONUA 1Q2DA 4II9A 3RYOA 2NMTA 2OH1A 5F48A 4XPKA 1M4IA 4C68A 3NE7A 3TCVA 4UCPA 4R3LA 3FXTA 1XIXA 2P0WA 2P6FA 2J8MA 2OZHA 4AVAA 4OADA 2D4OA 2PR1A 4AG7A 4KLVA 3W91A 4CAVA 1WK4A 4HNYB 1XEBA 4A32A 1BOBA 3UY5A 1Y7RA 4JJXA 4U5YA 1QSMA 1XF8A 4F0YA 2FIWA 2FL4A 5DWMA 4QUSA 1FY7A 3R9FA 4PSWA 4KUAA 4KOTA 3JTKA 2JLMA 3PGPA 2KCWA 2OB0A 4MJ8A 2FCKA 2Z10A 3GKRA 2ZXVA 4KOVA 2K5TA 1P0HA 5G21A 1MJAA 3JUWA 4AVBA 1IIDA 4CS0B 1S7LA 2BUEA 4GS4A 4YGOA 5C82A 5DWNA 3EFAA 4B5PB 2B5GA 4XPDB 1Z9UA 1IB1E 4ORFA 1XE4A 2REEA 2P6GA 4U9YA 3SXNA 1IYKA 2D4PA 2WPWA 5G1ZA 2AJ6A 4Y49B 3FYNA 1LRZA 4JD6A 3OWCA 4KSFA 4NXYA 4XPLA 2C27A 4AVCA 4CAEA 4CYPA 4QB9A 4AG9A 4UCNA 4A33A 3EO4A 3I9SA 3N7ZA 4E8OA 4MI4A 1BO4A 4BMHA 3ZZIA 3F8KA 2PR8A 5J8FA 1S7FA 2Z3KA 3W6XA 4NCZA 2O28A 4M3SA 2A4NA 5IB0A 2B4BA 4KVOE 3DR6A 2B4DB 2OU2A 1RXTA 1J4JA 2Z3LA 2FXFA 4JXQA 2YNCA 1ZO0A 2VBQA 4CGMA 3D8PA 2GE3A 1S7KA 2DXQA 4A31A 2FE7A 2Q4VA 5C88A 3H4QA 4CGPA 3S6KA 4UWJA 1B87A 2IL4A 4HNWB 3QB8A 1TIQA 2Q44A 4UCMA 1YLEA 4B14A 4LX9A 3IU2A 4CYOA 3PZJA 4ZGYB 5BWAB 2VZYA 3ZJ0A 4B5PA 2RC4A 2GIVA 4KOWA 2JEVA 1RO5A 2DPTA 3IWGA 4U9ZA 2Z3PA 4E2AA 1YR0A 4CYQA 2FSRA 2PSWA 5G20A 2CNTA 3MGDA 3D2MA 1YVKA 1KZFA 2J8RA 4NF1A 4KOUA 4B5OA 2G3TA 1YK3A 2YGWA 4KOXA 4HNXB 1VHSA 4QVTA 1I12A 3H5ZA 5J8CA 4MY0A 1Y9WA 2J8NA 1XMTA 3FRMA 4HKFA 4A95A 3TO9A 3TOBA 1K4JA 2B4DA 2AE6A 3FNCA 4K30A 4B10A 2QIRA 4H6ZA 2FT0A 1I21A 2EVNA 1Z4EA 2PC1A 4UFVA 1YVOA 4CRYB 3SHPA 3PP9A 5KTDA 5AG5A 5A27A 2BL1A 3P2HA 4E0AA 4KUBA 4C2XA 4PSXA 3WR7A 5CNPA 3EC4A 1M4DA 1WWZA 2OZGA 1QSRA 2X7BA 3S6HA 2GANA 4KS9A 3V8IA 4KOYA 3T9YA 5HH1A 5IV0A 2HQYA 2WSAA 4KORA 1V0CA 3SXOA 1SQHA 3GY9A 1YX0A 4R9MA 3D3SA 4AB7A 4CYNA 5EC4A 2B3VA 1YREA 3A9LA 1MJBA 2Z3NA 1IYLA 4Q36A 5EBVA 2I79A 4F6AA 2PDOA 4JXRA 2ZPAA 1NSLA 5HMNA 5AG7A 3TO6A 3F0AA 3C26A 4IF5A 3EXNA 5FVJA 2R1IA 4CGNA 4R3KA 4M85A 2ZW4A 4RS2A 5KTAA 5H84A 5AG6A 4YRHA 3DSBA 3CXQA 2Z0ZA 1R57A 4L8AA 3R9GA 5IX3A 3VWEA 2R98A 3LD2A 4C2YA 3K9UA 5A28A 1ON0A 4B12A 2PRBA 2REFA 4MFPA 4OLLA 2VQYA 3R96A 3R9EA 3T90A 3IU1A 4NSQA 1PU9A 4CAWA 2ZW7A 3DDDA 4PV6A 4J3GA 2YNDA 4UWIA 1Q2YA 2WUUA 3R95A 4UA3A 1Q2CA 3BJ7A 2QMLA 2BEIA 4FD6A 2BSWA 2R7HA 4R87A 5KTCA 3TE4A 1CM0A 2B5GB 1S5KA 2CNMA 1Z4RA 1MJ9A 2EUIA 4RI1A 2VZZA 3CXSA 2QECA 4CGLA 1NE9A 4CAXA 3B8GA 3DR8A 4MFJA 2B3UA 1B6BA 2ZW5A 4LUAA 4UFXA 2HV2A 2VXKA 2JDCA 3EY5A 2DPSA 3F5BA 4KVXA 4JWPA 2PQ8A 4B13A 4I49A 4Q38A 1CJWA 4UFWA 3BJ8A 4MFKA 1Y9KA 4KOSA 5F46A 4OAEA 3KKWA 3FIXA 2Z3OA 3DNSA 4MFZA 2YNCC 3GYAA 4PK2A 2CY2A 1UFHA 3JVNA 1M4GA 1MK4A 4X5KA 2ARHA 2JDDA 1P4NA 3G8WA 1N71A 3FBUA 4A2ZA 4C7IA 5I0CA 2WPXA 4A30A 1I1DA 5F47A 3QAHA 4FD5A 4F0XA 5JPHA 4UBRA 1L0CA 4ZBGA 3R1KA 1YGHA 4XPDC 3TTHA 3S6GA 3TT2A 2Q4YA 3G3SA 4L89A 2F5IA 4C2ZA 4R57A 1S7NA 4Y49C 4KSAA 4DNCA 2G3AA 5AG4A 3CXPA 3TFYA 4NEXA 2P6EA 4KVME 1KUYA 1KUVA 3TO7A 4MBUA 4B11A 2Q04A 5ISVA 4IUSA 4YFJA 4CAFA 5GCNA 4QC6A 3S6FA 2VEZA 4PK3A 4QBJA 1IICA 1S60A 2Y0MA 2YNEA 1QSNA 2HUZA 1QSTA 1KUXA 3BLNA 4MFLA 2ZW6A 4BBHA 4KLWA 3I3GA 2OZUA 4MFQA 2I00A 2Q0YA 5JQ4A 4MHDA 3IWEA 4FD7A 4C7HA 1U6MA 4MY3A 4H6UA 1GHEA 3LODA 4H89A 1NMTA 3E0KA 4CGOA 4EVYA 3IGRA 4FD4A 5AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNH C;  2R8V A;  4XNH B;  3TOA A;  3D2P A;  3P2F A;  4JLY A;  2FS5 A;  3FB3 A;  4KZT A;  1PUA A;  1S3Z A;  1QSO A;  2Q7B A;  1M44 A;  4CRZ B;  2FIA A;  5E96 A;  5H86 A;  1VKC A;  2G0B A;  2H5M A;  2Z11 A;  2B58 A;  3W6S A;  5F49 A;  2CNS A;  1OZP A;  2VI7 A;  1M1D A;  2ATR A;  3VWD A;  4ONU A;  1Q2D A;  4II9 A;  3RYO A;  2NMT A;  2OH1 A;  5F48 A;  4XPK A;  1M4I A;  3NE7 A;  3TCV A;  4R3L A;  3FXT A;  1XIX A;  2P0W A;  2P6F A;  2J8M A;  2OZH A;  4AVA A;  4OAD A;  2D4O A;  2PR1 A;  4AG7 A;  4KLV A;  3W91 A;  4CAV A;  1WK4 A;  4HNY B;  1XEB A;  1BOB A;  3UY5 A;  1Y7R A;  4JJX A;  4U5Y A;  1QSM A;  1XF8 A;  4F0Y A;  2FIW A;  2FL4 A;  5DWM A;  4QUS A;  1FY7 A;  3R9F A;  4PSW A;  4KUA A;  4KOT A;  2JLM A;  3PGP A;  2KCW A;  2OB0 A;  4MJ8 A;  2FCK A;  2Z10 A;  3GKR A;  2ZXV A;  4KOV A;  2K5T A;  1P0H A;  1MJA A;  3JUW A;  4AVB A;  1IID A;  4CS0 B;  1S7L A;  2BUE A;  4GS4 A;  4YGO A;  5C82 A;  5DWN A;  3EFA A;  4B5P B;  2B5G A;  4XPD B;  1Z9U A;  1IB1 E;  4ORF A;  1XE4 A;  2REE A;  2P6G A;  4U9Y A;  3SXN A;  1IYK A;  2D4P A;  2WPW A;  2AJ6 A;  4Y49 B;  3FYN A;  1LRZ A;  4JD6 A;  3OWC A;  4NXY A;  4XPL A;  2C27 A;  4AVC A;  4QB9 A;  4AG9 A;  3EO4 A;  3I9S A;  3N7Z A;  4E8O A;  4MI4 A;  1BO4 A;  4BMH A;  3ZZI A;  3F8K A;  2PR8 A;  5J8F A;  1S7F A;  3W6X A;  4NCZ A;  2O28 A;  4M3S A;  2A4N A;  5IB0 A;  2B4B A;  4KVO E;  3DR6 A;  2B4D B;  2OU2 A;  1RXT A;  1J4J A;  2FXF A;  4JXQ A;  2VBQ A;  3D8P A;  2GE3 A;  1S7K A;  2DXQ A;  2FE7 A;  2Q4V A;  5C88 A;  3H4Q A;  3S6K A;  4UWJ A;  1B87 A;  2IL4 A;  4HNW B;  3QB8 A;  1TIQ A;  2Q44 A;  1YLE A;  4LX9 A;  3PZJ A;  2VZY A;  3ZJ0 A;  4B5P A;  2RC4 A;  2GIV A;  4KOW A;  2JEV A;  1RO5 A;  3IWG A;  4U9Z A;  4E2A A;  1YR0 A;  2FSR A;  2PSW A;  2CNT A;  3MGD A;  3D2M A;  1YVK A;  1KZF A;  2J8R A;  4NF1 A;  4KOU A;  4B5O A;  2G3T A;  1YK3 A;  4KOX A;  4HNX B;  1VHS A;  4QVT A;  1I12 A;  5J8C A;  4MY0 A;  1Y9W A;  2J8N A;  1XMT A;  3FRM A;  4HKF A;  3TO9 A;  3TOB A;  1K4J A;  2B4D A;  2AE6 A;  3FNC A;  4K30 A;  2QIR A;  4H6Z A;  2FT0 A;  1I21 A;  2EVN A;  1Z4E A;  2PC1 A;  1YVO A;  4CRY B;  3SHP A;  3PP9 A;  5KTD A;  2BL1 A;  3P2H A;  4E0A A;  4KUB A;  4PSX A;  3WR7 A;  5CNP A;  3EC4 A;  1M4D A;  1WWZ A;  2OZG A;  1QSR A;  2X7B A;  3S6H A;  2GAN A;  3V8I A;  4KOY A;  3T9Y A;  5HH1 A;  5IV0 A;  2HQY A;  4KOR A;  1V0C A;  3SXO A;  1SQH A;  3GY9 A;  1YX0 A;  4R9M A;  3D3S A;  4AB7 A;  5EC4 A;  2B3V A;  1YRE A;  1MJB A;  1IYL A;  5EBV A;  2I79 A;  4F6A A;  2PDO A;  4JXR A;  2ZPA A;  1NSL A;  5HMN A;  3TO6 A;  3F0A A;  3C26 A;  4IF5 A;  3EXN A;  5FVJ A;  2R1I A;  4R3K A;  4M85 A;  2ZW4 A;  4RS2 A;  5KTA A;  5H84 A;  4YRH A;  3DSB A;  3CXQ A;  2Z0Z A;  1R57 A;  4L8A A;  3R9G A;  5IX3 A;  3VWE A;  2R98 A;  3LD2 A;  3K9U A;  1ON0 A;  2PRB A;  2REF A;  4OLL A;  2VQY A;  3R96 A;  3R9E A;  3T90 A;  4NSQ A;  1PU9 A;  4CAW A;  2ZW7 A;  3DDD A;  4PV6 A;  4J3G A;  4UWI A;  1Q2Y A;  3R95 A;  4UA3 A;  1Q2C A;  3BJ7 A;  2QML A;  2BEI A;  4FD6 A;  2BSW A;  2R7H A;  4R87 A;  5KTC A;  3TE4 A;  1CM0 A;  2B5G B;  1S5K A;  2CNM A;  1Z4R A;  1MJ9 A;  2EUI A;  4RI1 A;  2VZZ A;  3CXS A;  2QEC A;  1NE9 A;  4CAX A;  3B8G A;  3DR8 A;  2B3U A;  1B6B A;  2ZW5 A;  4LUA A;  2HV2 A;  2VXK A;  2JDC A;  3EY5 A;  3F5B A;  4KVX A;  4JWP A;  2PQ8 A;  4I49 A;  1CJW A;  3BJ8 A;  1Y9K A;  4KOS A;  5F46 A;  4OAE A;  3KKW A;  3FIX A;  3DNS A;  3GYA A;  4PK2 A;  2CY2 A;  1UFH A;  3JVN A;  1M4G A;  1MK4 A;  4X5K A;  2ARH A;  2JDD A;  1P4N A;  3G8W A;  1N71 A;  3FBU A;  5I0C A;  2WPX A;  1I1D A;  5F47 A;  3QAH A;  4FD5 A;  5JPH A;  4UBR A;  1L0C A;  4ZBG A;  3R1K A;  1YGH A;  4XPD C;  3TTH A;  3S6G A;  3TT2 A;  2Q4Y A;  3G3S A;  4L89 A;  2F5I A;  4R57 A;  1S7N A;  4Y49 C;  4DNC A;  2G3A A;  3CXP A;  3TFY A;  4NEX A;  2P6E A;  4KVM E;  1KUY A;  1KUV A;  3TO7 A;  4MBU A;  2Q04 A;  5ISV A;  4IUS A;  4YFJ A;  5GCN A;  4QC6 A;  3S6F A;  2VEZ A;  4PK3 A;  4QBJ A;  1IIC A;  1S60 A;  2Y0M A;  1QSN A;  2HUZ A;  1QST A;  1KUX A;  3BLN A;  2ZW6 A;  4KLW A;  3I3G A;  2OZU A;  2I00 A;  2Q0Y A;  5JQ4 A;  4MHD A;  4FD7 A;  1U6M A;  4MY3 A;  4H6U A;  1GHE A;  3LOD A;  4H89 A;  1NMT A;  3E0K A;  4EVY A;  3IGR A;  4FD4 A; 
#chains in the Genus database with same CATH topology
 4XNH C;  2R8V A;  3NH4 A;  2C6G A;  4ZI6 A;  4XNH B;  3TOA A;  3D2P A;  3P2F A;  5K8O A;  3PBE A;  2GLF A;  4JLY A;  2FS5 A;  2PJC A;  2ZEN A;  3FB3 A;  3PFO A;  3TX8 A;  4CPA A;  3VH9 A;  2CXA A;  4KZT A;  1PUA A;  5G22 A;  4NGN A;  1S3Z A;  1QSO A;  2Q7B A;  1M44 A;  4CRZ B;  2FIA A;  2O53 A;  5E96 A;  1YW4 A;  1VKC A;  2G0B A;  2H5M A;  2ZEM A;  5H86 A;  4P4I A;  4F9U A;  2GFQ A;  2Z11 A;  2B58 A;  2Z3M A;  3IIB A;  5LRG A;  5F49 A;  3W6S A;  2HB6 A;  2CNS A;  3CPX A;  2AFM A;  4EFD A;  1OZP A;  1Y7E A;  2WZN A;  2VI7 A;  5D8N A;  3IEH A;  1M1D A;  4WWV A;  1F2P A;  2ATR A;  3VWD A;  5HVG A;  4ONU A;  4FWU A;  4UEE A;  1Q2D A;  4II9 A;  3RYO A;  3B3V A;  2NMT A;  2OH1 A;  2PJA A;  4W9Y A;  5F48 A;  4XPK A;  1BPN A;  1M4I A;  4C68 A;  3NE7 A;  2AFX A;  3TCV A;  1PCA A;  5JH9 A;  4UCP A;  4R3L A;  3FXT A;  1XIX A;  2P0W A;  2P6F A;  2J8M A;  2OZH A;  4AVA A;  4OAD A;  2D4O A;  4F8Z A;  2ZEE A;  2PR1 A;  4AG7 A;  4KLV A;  2PIZ A;  1XFO A;  3W91 A;  4ONW A;  4CAV A;  3S9L A;  1WK4 A;  4HNY B;  1XEB A;  1Y0R A;  1BOB A;  4A32 A;  3UY5 A;  5HXD A;  3IO1 A;  1Y7R A;  4JJX A;  4U5Y A;  1IGB A;  1QSM A;  1XF8 A;  1Z5R A;  4P4D A;  4F0Y A;  1XJO A;  1YW6 A;  2FIW A;  3BHX A;  2PJ9 A;  2FL4 A;  3NH5 A;  4IHM A;  1A2Z A;  5DWM A;  4QUS A;  1BPM A;  3V7Z A;  3D68 A;  1FY7 A;  4NGR A;  3R9F A;  4PSW A;  4KUA A;  2PJ3 A;  4KOT A;  3JTK A;  2JLM A;  2KCW A;  3PGP A;  2OB0 A;  3DGV A;  4MJ8 A;  2FCK A;  2Z10 A;  3GKR A;  2ZXV A;  4KOV A;  2K5T A;  1P0H A;  5G21 A;  1MJA A;  2EBJ A;  4LQG A;  2QYV A;  3JUW A;  4P10 A;  5LYD A;  1RTQ A;  1ELM P;  4AVB A;  3WT4 A;  1IID A;  4CS0 B;  2EWB A;  1S7L A;  1LCP A;  2GLJ A;  3HLP A;  3GIU A;  2BUE A;  4GS4 A;  2PJ5 A;  4YGO A;  3I1U A;  4RUH A;  1OBR A;  1PYT B;  3SJG A;  2AFU A;  5C82 A;  5LRJ A;  5DWN A;  2RFH A;  3NE8 A;  3BXM A;  4ZYQ A;  3EFA A;  4B5P B;  2B5G A;  4XPD B;  1CBX A;  1Z9U A;  4MCP A;  1IB1 E;  4ORF A;  1XE4 A;  2PJ0 A;  2REE A;  2P6G A;  4ZX9 A;  1VIX A;  4U9Y A;  3SXN A;  1IYK A;  2D4P A;  4OC4 A;  2CTB A;  4NFR A;  2WPW A;  5G1Z A;  2AJ6 A;  2IQ6 A;  4Y49 B;  3FYN A;  1LRZ A;  4JD6 A;  3OWC A;  4KSF A;  4MHP A;  4NXY A;  4OC0 A;  4XPL A;  5IB9 A;  2C27 A;  4AVC A;  4CAE A;  3KQZ A;  4CYP A;  2ZEO A;  4Q7A A;  2O4H A;  4MHY A;  4QB9 A;  4AG9 A;  4UCN A;  1H8L A;  3B3S A;  2Q7S A;  3WAB A;  4A33 A;  3EO4 A;  3I9S A;  3N7Z A;  4NGS A;  4MI4 A;  4MHN A;  2BOA A;  1BO4 A;  3KQX A;  4BMH A;  3KI9 A;  4E8O A;  4X2T A;  1ZG7 A;  3LWU A;  3ZZI A;  2ZOG A;  3F8K A;  2PR8 A;  2PJ6 A;  5J8F A;  1S7F A;  2Z3K A;  2V8G A;  3CPA A;  4NCZ A;  3W6X A;  2O28 A;  2AFO A;  2A4N A;  3KHX A;  4M3S A;  2B4B A;  4UIB A;  5IB0 A;  4KVO E;  3BI0 A;  2JBJ A;  3DR6 A;  1Z8T A;  2B4D B;  2OU2 A;  3VAT A;  3WC7 A;  3SJX A;  1RXT A;  1J4J A;  2Z3L A;  2FXF A;  1R3N A;  5THW A;  3H8G A;  2YNC A;  4JXQ A;  1ZO0 A;  4BD9 A;  3ISZ A;  1LFW A;  3IC1 A;  2VBQ A;  4MXU A;  4CGM A;  3D8P A;  2GE3 A;  1LOK A;  1IY7 A;  1S7K A;  2DXQ A;  3FF3 A;  3GUX A;  2CTC A;  2FE7 A;  2Q4V A;  4HPS A;  4A31 A;  1EE3 P;  4K3N A;  5C88 A;  2BO9 A;  3H4Q A;  4CGP A;  1YLO A;  3S6K A;  4UWJ A;  3QNV A;  2XEF A;  1B87 A;  4H2K A;  5F09 A;  5LRK A;  2Q4Z A;  2IL4 A;  4ZY0 A;  2PJ8 A;  3LMS A;  4HNW B;  1Z8X A;  3QB8 A;  1TIQ A;  2Q44 A;  2PJB A;  2POK A;  4UCM A;  1YLE A;  4B14 A;  4LX9 A;  3IU2 A;  1CPS A;  4CYO A;  4PXB A;  3D67 A;  3KAS A;  3PZJ A;  4ZGY B;  5BWA B;  2VZY A;  3DLJ A;  3FED A;  3ZJ0 A;  2RC4 A;  4B5P A;  3SI2 A;  4ZY1 A;  2GIV A;  4KOW A;  2JEV A;  3S9N A;  4OC1 A;  2Q51 A;  3NH8 A;  4FBE A;  3IWW A;  3PB7 X;  1RO5 A;  4OC5 A;  4PXD A;  1ARL A;  2DPT A;  4O23 A;  3IWG A;  1HDU A;  2PJ4 A;  2V8V A;  2Z3P A;  4U9Z A;  4WJB A;  5CBM A;  4MCS A;  4E2A A;  1YR0 A;  5JM6 A;  3D7G A;  4CYQ A;  2FSR A;  2FVG A;  1FNO A;  1JQG A;  2PSW A;  2PJ1 A;  3BI1 A;  5G20 A;  2CNT A;  3D7H A;  3MGD A;  4R8F A;  1F2O A;  3D2M A;  1ZLI A;  1YVK A;  4PXC A;  3L2N A;  1KZF A;  2J8R A;  2C1C A;  4KOU A;  4NF1 A;  4B5O A;  5J1Q A;  2G3T A;  1YK3 A;  3WC6 A;  3PFE A;  3FEE A;  3IFE A;  2YGW A;  2QJ8 A;  4KOX A;  1QMU A;  4HNX B;  3CZX A;  1VHS A;  4QVT A;  4UEF A;  1I12 A;  1LAM A;  2AFZ A;  1CX8 A;  2ANP A;  2PJ7 A;  3H5Z A;  3IGR A;  3KR5 A;  4MY0 A;  4P4E A;  1Y9W A;  4A39 A;  2J8N A;  3FVL A;  2AFS A;  2CF4 A;  5J8C A;  1XMT A;  3FRM A;  3B3T A;  3ISX A;  4HKF A;  4A95 A;  3TO9 A;  3TOB A;  1K4J A;  1Z8L A;  2B4D A;  3IJ3 A;  2AE6 A;  3FNC A;  3FMC A;  3K2K A;  4M6G A;  4K30 A;  4B10 A;  1XBU A;  2QIR A;  3PB9 X;  3RO0 A;  2RB7 A;  4KSI A;  1IU8 A;  4H6Z A;  4OC2 A;  2FT0 A;  3B2Y A;  1I21 A;  2PJ2 A;  4EWT A;  2EVN A;  4M6H A;  1Z4E A;  2C6P A;  2PC1 A;  5K8P A;  1Q7L A;  3LAC A;  4UFV A;  3D66 A;  1JWQ A;  1YVO A;  1F57 A;  3SHP A;  4CRY B;  3PP9 A;  5KTD A;  4MHZ A;  2EK9 A;  5AG5 A;  5A27 A;  2BL1 A;  3D7F A;  3P2H A;  4E0A A;  1HDQ A;  2DF5 A;  4KUB A;  2XEI A;  4C2X A;  2IJZ A;  4PSX A;  2OOT A;  3WR7 A;  5CNP A;  3EC4 A;  1M4D A;  1WWZ A;  5CPA A;  2OZG A;  1QSR A;  2X7B A;  3S6H A;  2GAN A;  4KS9 A;  1X12 A;  3V8I A;  4KOY A;  3T9Y A;  5HH1 A;  5IV0 A;  2HQY A;  2WSA A;  1CPX A;  3SJE A;  4KOR A;  1GYT A;  1V0C A;  3SXO A;  1NSA A;  1SQH A;  3GY9 A;  1YX0 A;  3SI1 A;  2NSM A;  4R9M A;  2IMO A;  3D3S A;  4AB7 A;  4CYN A;  4R6T A;  3RAM A;  5EC4 A;  2B3V A;  1YRE A;  3T8W A;  2ZOF A;  4UF4 A;  3PEI A;  4EME A;  3KZW A;  3V38 A;  3A9L A;  1CP7 A;  1MJB A;  3D4U A;  1ELL P;  2Z3N A;  4OP4 A;  2CIJ A;  2JBK A;  1IYL A;  2JEW A;  4MMO A;  4X8I A;  5LYF A;  4GXH A;  5LYI A;  4Q36 A;  5EBV A;  3TC8 A;  2I79 A;  4F6A A;  3PRT A;  4DYO A;  3B3C A;  2PDO A;  4JXR A;  5HVF A;  2ZPA A;  1NSL A;  1Z8W A;  5HMN A;  3CDX A;  4P44 A;  5AG7 A;  3TO6 A;  3F0A A;  3C26 A;  5EMI A;  3NA6 A;  4G1P A;  3CT9 A;  1DTD A;  1FT7 A;  4IF5 A;  4JYW A;  3EXN A;  5FVJ A;  2NYQ A;  1BLL E;  4OID A;  2R1I A;  4CGN A;  4R3K A;  1UWY A;  4M85 A;  1BAV A;  2ZW4 A;  4RS2 A;  5H84 A;  5KTA A;  3FEC A;  5AG6 A;  4YRH A;  2EO8 A;  3D7D A;  3DSB A;  3CXQ A;  4NGT A;  2Z0Z A;  1R57 A;  2F7V A;  4L8A A;  4ZY2 A;  3R9G A;  1CG2 A;  4BIN A;  5IX3 A;  1YSJ A;  2VL1 A;  5JGF A;  3PB4 X;  3VWE A;  2R98 A;  3LD2 A;  4P45 A;  4C2Y A;  1Y0Y A;  3KR4 A;  3K9U A;  5A28 A;  1ON0 A;  4B12 A;  2PRB A;  2REF A;  1Z2L A;  3KHZ A;  4MFP A;  4OLL A;  3RZA A;  2VQY A;  3R96 A;  3R9E A;  2PRQ A;  3IU1 A;  4NSQ A;  1AUG A;  2ZEH A;  3T90 A;  2V8H A;  4NGP A;  1PU9 A;  4CAW A;  2ZW7 A;  4P4F A;  3DDD A;  1TKH A;  3VAR A;  3B3W A;  4PV6 A;  4UEZ A;  4J3G A;  2YND A;  2HC9 A;  1M4L A;  4UWI A;  1Q2Y A;  1CP6 A;  2WUU A;  3R95 A;  5AGE A;  4UA3 A;  1KWM A;  1Q2C A;  2V77 A;  4PXE A;  4FUU A;  1ZG9 A;  3BJ7 A;  2QML A;  2BEI A;  4FD6 A;  2XEJ A;  2BCO A;  2ZEG A;  1AMP A;  3B35 A;  2BSW A;  1VHE A;  2R7H A;  4R87 A;  5KTC A;  3TE4 A;  3KL9 A;  4P4J A;  2GU2 A;  1CM0 A;  2B5G B;  1S5K A;  2CNM A;  1Z4R A;  1MJ9 A;  3N5F A;  2G9D A;  3FJU A;  1TXR A;  1VHO A;  2EUI A;  4RI1 A;  2VZZ A;  3CXS A;  2QEC A;  1HEE A;  4CGL A;  1NE9 A;  4JZ0 A;  4CAX A;  2V8D A;  1TF9 A;  4X3R A;  3RBU A;  4GM5 A;  3B8G A;  3PBB A;  3PB6 X;  3DR8 A;  4MCQ A;  4TNU A;  4MFJ A;  4YWY A;  4F9V A;  2B3U A;  1B6B A;  2ZW5 A;  4LUA A;  1DE4 C;  2ZED A;  4FAI A;  4UFX A;  3SI0 A;  2HV2 A;  2VXK A;  2JDC A;  2PVW A;  2GRE A;  2DPS A;  3EY5 A;  3F5B A;  1TKJ A;  3MRU A;  4JWP A;  4KVX A;  5DS0 A;  6CPA A;  3S9M A;  2PQ8 A;  4OKO A;  3SJF A;  4B13 A;  4I49 A;  1ZLH A;  2ZEL A;  4Q38 A;  1CJW A;  5K8M A;  4A94 A;  4PPZ A;  2ZEP A;  4UFW A;  4IK2 A;  3RNZ A;  3BJ8 A;  4MFK A;  1Y9K A;  4KOS A;  2PE3 A;  2ZEF A;  5F46 A;  1XOV A;  4OAE A;  4Z65 A;  3KKW A;  3FIX A;  1R43 A;  2Z3O A;  3DNS A;  4MFZ A;  1AYE A;  5LYL A;  2YNC C;  3GYA A;  1X10 A;  2QVP A;  4PK2 A;  3NFZ A;  1IOI A;  2CY2 A;  4UIA A;  1UFH A;  2XEG A;  3JVN A;  4YU9 A;  1M4G A;  4AXV A;  1MK4 A;  4X5K A;  2ARH A;  3FX6 A;  4P6Y A;  2JDD A;  1P4N A;  4A38 A;  1N71 A;  3FBU A;  1ARM A;  3G8W A;  4A2Z A;  4C7I A;  2OR4 A;  5ELY A;  5I0C A;  4OC3 A;  5I4M A;  2PVV A;  2WPX A;  4A30 A;  1I1D A;  5F47 A;  3QAH A;  4FD5 A;  4F0X A;  5JPH A;  2F8H A;  1L0C A;  4UBR A;  1YME A;  4DJL A;  5K8N A;  4DUK A;  4NJR A;  4NGM A;  4OIW A;  4ZBG A;  3R1K A;  1YGH A;  3HUV A;  4FD4 A;  4B6Z A;  4M6I A;  3GLJ A;  4XPD C;  3TTH A;  3S6G A;  3TT2 A;  2Q4Y A;  2J9A A;  3G3S A;  4L89 A;  4ZX8 A;  2F5I A;  4C2Z A;  4R57 A;  1S7N A;  2WYR A;  4Y49 C;  1TF8 A;  4KSA A;  4DNC A;  2G3A A;  4LQ6 A;  5AG4 A;  3CXP A;  3TFY A;  1IOF A;  4NJQ A;  4NEX A;  1LAN A;  2P6E A;  4R76 A;  4RN7 A;  4P4B A;  4KVM E;  3WC5 A;  4R7M A;  1KUY A;  4PQA A;  1KUV A;  2PCU A;  3H8F A;  3TO7 A;  3B7I A;  3MN8 A;  2ABZ A;  4MBU A;  4TWE A;  4MRI A;  2Q04 A;  4B11 A;  5ISV A;  3PB8 X;  3GB0 A;  2EK8 A;  4IUS A;  4YFJ A;  4NGQ A;  4CAF A;  5GCN A;  4QC6 A;  3S6F A;  2VEZ A;  4PK3 A;  4QBJ A;  1XMB A;  1IIC A;  1S60 A;  2Y0M A;  1TKF A;  5D29 A;  2YNE A;  1QSN A;  2HUZ A;  1QST A;  1KUX A;  2I3C A;  2C6C A;  1QQ9 A;  3BLN A;  4MFL A;  7CPA A;  2ZW6 A;  3JRU A;  4IAV A;  3I3G A;  4KLW A;  2OZU A;  4BBH A;  4MFQ A;  1ZG8 A;  2I00 A;  2Q0Y A;  8CPA A;  5JQ4 A;  4MHD A;  3IWE A;  3KGQ A;  4FD7 A;  4A37 A;  4C7H A;  1VGY A;  3K9T A;  1U6M A;  4MY3 A;  4MCR A;  4H6U A;  1GHE A;  3QAY A;  2Q43 A;  4OME A;  3LOD A;  3FH4 A;  1XRY A;  1YQE A;  2PIY A;  4H89 A;  1NMT A;  3E0K A;  5HVH A;  4CGO A;  4EVY A;  2AFW A;  3H8E A;  2ODF A;  1LAP A;  2DEA A; 
#chains in the Genus database with same CATH homology
 4XNH C;  2R8V A;  4XNH B;  3TOA A;  3D2P A;  3P2F A;  4JLY A;  2FS5 A;  3FB3 A;  2CXA A;  4KZT A;  1PUA A;  5G22 A;  1S3Z A;  1QSO A;  2Q7B A;  1M44 A;  4CRZ B;  2FIA A;  5E96 A;  5H86 A;  1VKC A;  2G0B A;  2H5M A;  2Z11 A;  2B58 A;  2Z3M A;  3W6S A;  5F49 A;  2CNS A;  1OZP A;  2VI7 A;  1M1D A;  2ATR A;  3VWD A;  4ONU A;  1Q2D A;  4II9 A;  3RYO A;  2NMT A;  2OH1 A;  5F48 A;  4XPK A;  1M4I A;  4C68 A;  3NE7 A;  3TCV A;  4UCP A;  4R3L A;  3FXT A;  1XIX A;  2P0W A;  2P6F A;  2J8M A;  2OZH A;  4AVA A;  4OAD A;  2D4O A;  2PR1 A;  4AG7 A;  4KLV A;  3W91 A;  4CAV A;  1WK4 A;  4HNY B;  1XEB A;  4A32 A;  1BOB A;  3UY5 A;  1Y7R A;  4JJX A;  4U5Y A;  1QSM A;  1XF8 A;  4F0Y A;  2FIW A;  2FL4 A;  5DWM A;  4QUS A;  1FY7 A;  3R9F A;  4PSW A;  4KUA A;  4KOT A;  3JTK A;  2JLM A;  3PGP A;  2KCW A;  2OB0 A;  4MJ8 A;  2FCK A;  2Z10 A;  3GKR A;  2ZXV A;  4KOV A;  2K5T A;  1P0H A;  5G21 A;  1MJA A;  3JUW A;  4AVB A;  1IID A;  4CS0 B;  1S7L A;  2BUE A;  4GS4 A;  4YGO A;  5C82 A;  5DWN A;  3EFA A;  4B5P B;  2B5G A;  4XPD B;  1Z9U A;  1IB1 E;  4ORF A;  1XE4 A;  2REE A;  2P6G A;  4U9Y A;  3SXN A;  1IYK A;  2D4P A;  2WPW A;  5G1Z A;  2AJ6 A;  4Y49 B;  3FYN A;  1LRZ A;  4JD6 A;  3OWC A;  4KSF A;  4NXY A;  4XPL A;  2C27 A;  4AVC A;  4CAE A;  4CYP A;  4QB9 A;  4AG9 A;  4UCN A;  4A33 A;  3EO4 A;  3I9S A;  3N7Z A;  4E8O A;  4MI4 A;  1BO4 A;  4BMH A;  3ZZI A;  3F8K A;  2PR8 A;  5J8F A;  1S7F A;  2Z3K A;  3W6X A;  4NCZ A;  2O28 A;  4M3S A;  2A4N A;  5IB0 A;  2B4B A;  4KVO E;  3DR6 A;  2B4D B;  2OU2 A;  1RXT A;  1J4J A;  2Z3L A;  2FXF A;  4JXQ A;  2YNC A;  1ZO0 A;  2VBQ A;  4CGM A;  3D8P A;  2GE3 A;  1S7K A;  2DXQ A;  4A31 A;  2FE7 A;  2Q4V A;  5C88 A;  3H4Q A;  4CGP A;  3S6K A;  4UWJ A;  1B87 A;  2IL4 A;  4HNW B;  3QB8 A;  1TIQ A;  2Q44 A;  4UCM A;  1YLE A;  4B14 A;  4LX9 A;  3IU2 A;  4CYO A;  3PZJ A;  4ZGY B;  5BWA B;  2VZY A;  3ZJ0 A;  4B5P A;  2RC4 A;  2GIV A;  4KOW A;  2JEV A;  1RO5 A;  2DPT A;  3IWG A;  4U9Z A;  2Z3P A;  4E2A A;  1YR0 A;  4CYQ A;  2FSR A;  2PSW A;  5G20 A;  2CNT A;  3MGD A;  3D2M A;  1YVK A;  1KZF A;  2J8R A;  4NF1 A;  4KOU A;  4B5O A;  2G3T A;  1YK3 A;  2YGW A;  4KOX A;  4HNX B;  1VHS A;  4QVT A;  1I12 A;  3H5Z A;  5J8C A;  4MY0 A;  1Y9W A;  2J8N A;  1XMT A;  3FRM A;  4HKF A;  4A95 A;  3TO9 A;  3TOB A;  1K4J A;  2B4D A;  2AE6 A;  3FNC A;  4K30 A;  4B10 A;  2QIR A;  4H6Z A;  2FT0 A;  1I21 A;  2EVN A;  1Z4E A;  2PC1 A;  4UFV A;  1YVO A;  4CRY B;  3SHP A;  3PP9 A;  5KTD A;  5AG5 A;  5A27 A;  2BL1 A;  3P2H A;  4E0A A;  4KUB A;  4C2X A;  4PSX A;  3WR7 A;  5CNP A;  3EC4 A;  1M4D A;  1WWZ A;  2OZG A;  1QSR A;  2X7B A;  3S6H A;  2GAN A;  4KS9 A;  3V8I A;  4KOY A;  3T9Y A;  5HH1 A;  5IV0 A;  2HQY A;  2WSA A;  4KOR A;  1V0C A;  3SXO A;  1SQH A;  3GY9 A;  1YX0 A;  4R9M A;  3D3S A;  4AB7 A;  4CYN A;  5EC4 A;  2B3V A;  1YRE A;  3A9L A;  1MJB A;  2Z3N A;  1IYL A;  4Q36 A;  5EBV A;  2I79 A;  4F6A A;  2PDO A;  4JXR A;  2ZPA A;  1NSL A;  5HMN A;  5AG7 A;  3TO6 A;  3F0A A;  3C26 A;  4IF5 A;  3EXN A;  5FVJ A;  2R1I A;  4CGN A;  4R3K A;  4M85 A;  2ZW4 A;  4RS2 A;  5KTA A;  5H84 A;  5AG6 A;  4YRH A;  3DSB A;  3CXQ A;  2Z0Z A;  1R57 A;  4L8A A;  3R9G A;  5IX3 A;  3VWE A;  2R98 A;  3LD2 A;  4C2Y A;  3K9U A;  5A28 A;  1ON0 A;  4B12 A;  2PRB A;  2REF A;  4MFP A;  4OLL A;  2VQY A;  3R96 A;  3R9E A;  3T90 A;  3IU1 A;  4NSQ A;  1PU9 A;  4CAW A;  2ZW7 A;  3DDD A;  4PV6 A;  4J3G A;  2YND A;  4UWI A;  1Q2Y A;  2WUU A;  3R95 A;  4UA3 A;  1Q2C A;  3BJ7 A;  2QML A;  2BEI A;  4FD6 A;  2BSW A;  2R7H A;  4R87 A;  5KTC A;  3TE4 A;  1CM0 A;  2B5G B;  1S5K A;  2CNM A;  1Z4R A;  1MJ9 A;  2EUI A;  4RI1 A;  2VZZ A;  3CXS A;  2QEC A;  4CGL A;  1NE9 A;  4CAX A;  3B8G A;  3DR8 A;  4MFJ A;  2B3U A;  1B6B A;  2ZW5 A;  4LUA A;  4UFX A;  2HV2 A;  2VXK A;  2JDC A;  3EY5 A;  2DPS A;  3F5B A;  4KVX A;  4JWP A;  2PQ8 A;  4B13 A;  4I49 A;  4Q38 A;  1CJW A;  4UFW A;  3BJ8 A;  4MFK A;  1Y9K A;  4KOS A;  5F46 A;  4OAE A;  3KKW A;  3FIX A;  2Z3O A;  3DNS A;  4MFZ A;  2YNC C;  3GYA A;  4PK2 A;  2CY2 A;  1UFH A;  3JVN A;  1M4G A;  1MK4 A;  4X5K A;  2ARH A;  2JDD A;  1P4N A;  3G8W A;  1N71 A;  3FBU A;  4A2Z A;  4C7I A;  5I0C A;  2WPX A;  4A30 A;  1I1D A;  5F47 A;  3QAH A;  4FD5 A;  4F0X A;  5JPH A;  4UBR A;  1L0C A;  4ZBG A;  3R1K A;  1YGH A;  4XPD C;  3TTH A;  3S6G A;  3TT2 A;  2Q4Y A;  3G3S A;  4L89 A;  2F5I A;  4C2Z A;  4R57 A;  1S7N A;  4Y49 C;  4KSA A;  4DNC A;  2G3A A;  5AG4 A;  3CXP A;  3TFY A;  4NEX A;  2P6E A;  4KVM E;  1KUY A;  1KUV A;  3TO7 A;  4MBU A;  4B11 A;  2Q04 A;  5ISV A;  4IUS A;  4YFJ A;  4CAF A;  5GCN A;  4QC6 A;  3S6F A;  2VEZ A;  4PK3 A;  4QBJ A;  1IIC A;  1S60 A;  2Y0M A;  2YNE A;  1QSN A;  2HUZ A;  1QST A;  1KUX A;  3BLN A;  4MFL A;  2ZW6 A;  4BBH A;  4KLW A;  3I3G A;  2OZU A;  4MFQ A;  2I00 A;  2Q0Y A;  5JQ4 A;  4MHD A;  3IWE A;  4FD7 A;  4C7H A;  1U6M A;  4MY3 A;  4H6U A;  1GHE A;  3LOD A;  4H89 A;  1NMT A;  3E0K A;  4CGO A;  4EVY A;  3IGR A;  4FD4 A;  5AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...