2YNCA

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 117
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncA00
2WSAA 3JTKA 2YNDA 4UCNA 4CGPA 5G20A 4CYOA 4A30A 5A28A 5G1ZA 4CGOA 4B11A 3IU2A 4UFVA 3IU1A 4CGNA 2WUUA 4B10A 4A2ZA 4C7IA 4C2YA 4A33A 4C68A 4CAEA 5AG7A 4CYQA 5G21A 4CGLA 5A27A 4C7HA 4B14A 4CGMA 4A95A 4UFWA 4B12A 4CYPA 4UFXA 4CYNA 5AG6A 4UCMA 5AG4A 4C2ZA 4A32A 3H5ZA 4C2XA 4B13A 4CAFA 2YNCA 3IWEA 5AG5A 5AGEA 5G22A 4UCPA 4A31A 4BBHA 2YNEA 2YNCC
chains in the Genus database with same CATH superfamily
2BL1A 3VWDA 2DPSA 2VI7A 1YVKA 2PVWA 3MN8A 4JLYA 4LQGA 1VKCA 3V7ZA 5J8FA 4C7IA 3NH4A 1MJ9A 5CBMA 1R3NA 1DTDA 2OU2A 3DR6A 1OZPA 4DUKA 5AG7A 4R87A 1EE3P 1GYTA 2ZENA 2FSRA 4NGRA 2J8NA 2YGWA 3B35A 2Z3PA 3NFZA 1Z4EA 3V8IA 1LCPA 4KVME 4ZI6A 3FBUA 4B6ZA 4UFWA 4OC3A 2I00A 4CAVA 3DGVA 2XEGA 4UF4A 1CP7A 1I12A 2Q0YA 4K30A 2F5IA 4PPZA 4PQAA 2B58A 1Y0YA 4MFQA 2JDDA 2PJ4A 2ANPA 3FMCA 3PRTA 3T8WA 3S9LA 5ISVA 5LRGA 1WK4A 3TO6A 4H2KA 2QYVA 2AJ6A 3KHXA 4P6YA 4UWIA 3ISXA 4IUSA 4JD6A 4RS2A 4UCNA 5C82A 5G20A 1ELLP 2QIRA 4UEFA 5G1ZA 1TKFA 4NGPA 1IOIA 4QB9A 3TO9A 2QVPA 1XF8A 2PCUA 3QAHA 2Z3MA 3BJ8A 2BCOA 3BI0A 1Y0RA 1VHOA 1F2OA 5E96A 5KTAA 1CBXA 4MJ8A 3DDDA 1QSRA 1AMPA 3PFEA 2ZOFA 4HNYB 2OR4A 5DS0A 1TF9A 3PB9X 3PB7X 5D8NA 2VL1A 2PQ8A 2J8RA 2VEZA 3CT9A 3F8KA 4NFRA 1MJBA 1AYEA 2Q04A 3NH5A 4KOSA 4WJBA 4RUHA 1QSNA 4C2ZA 3T9YA 5HVHA 2Q4ZA 3GIUA 1CPXA 1SQHA 2Q44A 4IF5A 4CPAA 2FS5A 1S7KA 3VATA 1Q2YA 2V8DA 4UBRA 1B6BA 4OMEA 2HUZA 4CGPA 5LYFA 3TFYA 3SJEA 3TC8A 4P10A 4OC0A 4PK2A 4F0XA 4FBEA 2G0BA 2ZELA 2O28A 1A2ZA 1S7LA 3B3SA 2PJ2A 2B4DA 1J4JA 1Y9WA 4EWTA 2XEFA 2FL4A 1XOVA 2OH1A 1VIXA 3GKRA 3G3SA 3CXPA 5K8NA 2GANA 3FX6A 3H8GA 2CNMA 5EBVA 4YWYA 2EWBA 3IWWA 2Q51A 2Q7SA 3LMSA 4R8FA 2PJ0A 1CJWA 4MBUA 3FIXA 1CP6A 4MHPA 1PYTB 1HDUA 2HV2A 3KI9A 5JM6A 2CTCA 3SJGA 1YSJA 2I3CA 2C6PA 3SI1A 5BWAB 2NYQA 1HDQA 2IQ6A 3R9FA 5H84A 5H86A 4E8OA 4NEXA 3BLNA 3LODA 2DEAA 1NSAA 3CPAA 5JGFA 3DR8A 4ONWA 4A37A 1LAPA 3SHPA 1PCAA 4MFKA 5JH9A 1VHSA 3GLJA 3KZWA 4M85A 4X2TA 2XEJA 1LANA 4C7HA 4UIAA 5LRJA 1H8LA 1TXRA 4MY3A 4IAVA 3PP9A 4R3LA 2B3VA 2V77A 4NJQA 4CRZB 4ZY0A 4EVYA 2OZHA 3FXTA 5I4MA 4KOWA 1BO4A 1QSOA 1U6MA 3IWEA 2GREA 2PJ7A 3E0KA 4ORFA 4XPKA 5IX3A 3PZJA 1R43A 2CNTA 2Q43A 2Q4VA 4CYOA 1Q2DA 3HLPA 1X12A 1IYKA 3KQXA 1IIDA 2F7VA 4OC4A 1IY7A 4ONUA 4AB7A 4CGNA 4UA3A 1ZG9A 2PSWA 2C27A 2B5GA 3V38A 2O53A 2WZNA 1FNOA 2AFZA 2V8VA 2ZOGA 1LAMA 3PBEA 4R3KA 4Z65A 3NE8A 2AE6A 2PJCA 4M6IA 2R8VA 2ZW5A 3IWGA 3ZJ0A 3W6SA 4M6GA 3KQZA 2B4DB 2Z0ZA 3R96A 4O23A 1Z5RA 4DJLA 3I9SA 4PXBA 1BLLE 3VARA 5CNPA 4NGTA 5IB9A 2GE3A 4YRHA 4MHYA 3LWUA 4MI4A 3LACA 4RN7A 4OC1A 1X10A 1XIXA 1FY7A 4H6ZA 4NGNA 1LFWA 2CF4A 5J8CA 4ZX9A 4JXQA 3IU2A 3D4UA 5JPHA 1YVOA 1GHEA 3MGDA 4AG9A 4PXDA 2EK9A 2JEWA 3FJUA 2FT0A 3RZAA 4CAEA 4KOYA 2EBJA 1YREA 4WWVA 2OOTA 4GM5A 3W6XA 1JWQA 1ELMP 3PB4X 1F57A 2P6FA 4CYPA 4E2AA 1MJAA 1S7FA 4PXEA 2JDCA 3EY5A 2CTBA 1XEBA 2VQYA 3D68A 3ZZIA 3S6HA 3DSBA 2ARHA 3IC1A 2YNEA 4ZY1A 2DPTA 2PR8A 4X3RA 2RC4A 2PIZA 2WSAA 1ZG7A 2HQYA 1Q7LA 4A30A 1BOBA 3D7GA 4HNWB 2EO8A 2PC1A 3IO1A 4NF1A 2BO9A 3D2MA 3HUVA 3IU1A 4MCPA 4TWEA 2D4PA 3WC5A 4P4FA 2PR1A 4C2YA 4E0AA 4P4JA 1IOFA 1TKJA 2VBQA 2DXQA 1ON0A 4DYOA 3I1UA 4MHNA 4CGLA 4LX9A 2GU2A 3CPXA 2Y0MA 4MMOA 3S9MA 2B5GB 3BHXA 1M4DA 4L8AA 2PRQA 1RTQA 4OP4A 3FYNA 3WR7A 5LYLA 4FD5A 1QQ9A 2IJZA 1TIQA 3IGRA 3T90A 4OKOA 2FIAA 4XNHB 2PJ8A 4QC6A 4A31A 4B5OA 4CYQA 2EK8A 4CRYB 4DNCA 1I21A 2AFUA 1Z9UA 4BD9A 4MFJA 3PGPA 2POKA 3MRUA 4P45A 2OZGA 3SI2A 4A38A 1QSTA 3A9LA 1QSMA 4OIDA 4H89A 2CXAA 2XEIA 4HPSA 2OZUA 2BUEA 2PJAA 3OWCA 4R57A 4MCSA 4XPLA 2GFQA 4FUUA 4YGOA 2IMOA 4UEZA 4B5PA 4JXRA 3B7IA 2QJ8A 3BJ7A 2F8HA 3B8GA 5C88A 2FXFA 4MFZA 4F9UA 3KR4A 4XPDB 4L89A 1ZLIA 2Z3OA 2C6GA 4KUBA 2R1IA 3CXSA 5DWNA 4CYNA 4H6UA 1CPSA 3CXQA 1CG2A 1YR0A 2ABZA 2R7HA 2ZW6A 1KUYA 3B3TA 4KUAA 2P0WA 3CZXA 3GY9A 3TCVA 5AG5A 1M4IA 1LOKA 2J8MA 2C1CA 4OC5A 3H4QA 3KR5A 2AFMA 5K8MA 1OBRA 1YW4A 2ZW7A 1JQGA 4B10A 4JYWA 3K9TA 4Y49B 2PDOA 5K8PA 4OIWA 4JWPA 1AUGA 4AVCA 1IYLA 5F47A 2JLMA 4R76A 1ZG8A 1NSLA 2NMTA 4MCQA 3GB0A 3FEDA 5F49A 1Z8TA 3IIBA 3QNVA 4FD4A 4KS9A 4P4BA 4XNHC 1B87A 3JVNA 2Z3LA 3PBBA 1S5KA 2NSMA 5I0CA 3FRMA 4MHDA 2AFSA 3SXOA 2WPXA 2YNCA 4MXUA 4EMEA 2B3UA 2OB0A 4UCPA 1M4GA 5AGEA 7CPAA 4ZX8A 3JTKA 8CPAA 3I3GA 4MRIA 2JEVA 4PV6A 1MK4A 4TNUA 3B2YA 4UFVA 3CDXA 1CX8A 3IFEA 2WPWA 5LYDA 3R95A 3SI0A 5HVGA 3UY5A 4F9VA 2P6EA 4M6HA 5IB0A 4P44A 4LUAA 4XPDC 2HC9A 4A39A 1VGYA 3EO4A 3QAYA 1TKHA 2O4HA 2ZXVA 2BEIA 5A27A 1KZFA 4K3NA 3IEHA 4OLLA 1NMTA 1BPMA 4OC2A 3RYOA 2EUIA 4KOXA 5EMIA 2ZEEA 4B5PB 1UFHA 3KL9A 4KORA 3TX8A 3VH9A 2Q7BA 4QBJA 1Z4RA 1XJOA 2CY2A 5HVFA 5IV0A 3S9NA 4U5YA 4MHZA 2KCWA 1XRYA 5ELYA 3PFOA 1M44A 1P4NA 4FAIA 1S3ZA 3S6KA 4Y49C 4B11A 3RO0A 3R9EA 3KKWA 4P4EA 3P2HA 2V8GA 2B4BA 4A2ZA 4MCRA 4YU9A 3FVLA 3PEIA 2AFOA 4NXYA 2CIJA 5G21A 1FT7A 4P4DA 3S6GA 2BOAA 3NE7A 4MY0A 4Q36A 2PJ1A 2FCKA 4B12A 2X7BA 3FH4A 3SJXA 4RI1A 4F8ZA 1YX0A 4KOTA 3TOAA 3FNCA 2QECA 3QB8A 1IU8A 2REFA 3D7FA 3EC4A 2VZYA 1WWZA 3R1KA 4UEEA 2PVVA 2EVNA 4I49A 4KSIA 4AXVA 4II9A 4R7MA 3S6FA 1R57A 4BMHA 5F48A 3D7HA 1XE4A 4BINA 1ZO0A 1PU9A 4W9YA 2GIVA 2Z3NA 4P4IA 4C68A 1M4LA 4IHMA 3D3SA 4KLWA 4FWUA 5CPAA 1XMBA 4UIBA 3L2NA 2ZEOA 1RO5A 4EFDA 1YQEA 1Y7RA 2ZEPA 4CGMA 3K9UA 5AG6A 3KGQA 1F2PA 4F6AA 5LRKA 4HKFA 1KUXA 2REEA 3EFAA 2ZPAA 2PJBA 2JBKA 4ZYQA 2ATRA 4BBHA 2Q4YA 1KWMA 1YK3A 3RNZA 4MFPA 3RAMA 4CAWA 4R9MA 2D4OA 2G9DA 3WC6A 5HMNA 3N5FA 2AFXA 1IGBA 4Q7AA 4J3GA 3D2PA 3TT2A 1S60A 2GLJA 4CS0B 1XBUA 1QMUA 4U9YA 5F09A 2A4NA 3IJ3A 3ISZA 2IL4A 4ZY2A 5EC4A 1YGHA 5JQ4A 1Y9KA 1V0CA 4A94A 3KHZA 4UFXA 4ZGYB 4NGQA 4NSQA 4NJRA 5FVJA 3SXNA 1BAVA 1YW6A 4X5KA 4C2XA 1P0HA 2ZEDA 1ZLHA 3JUWA 4KOVA 4NGSA 4AVAA 2BSWA 2YNCC 5DWMA 4CAXA 2YNDA 1YMEA 2R98A 3B3WA 5LYIA 1UWYA 4FD6A 2ODFA 3WABA 4CGOA 1Q2CA 4AVBA 1I1DA 1KUVA 2G3AA 1XFOA 3B3VA 3EXNA 2WUUA 3W91A 2AFWA 3SJFA 5KTCA 2RFHA 3B3CA 1BPNA 3FECA 3BI1A 2PIYA 4KSAA 2PJ3A 3TO7A 2FE7A 4KVXA 4A95A 3K2KA 2PJ9A 1Z8LA 1Z2LA 1YLOA 4G1PA 3D67A 5D29A 1RXTA 3WT4A 3D66A 3NA6A 2FIWA 5KTDA 4IK2A 5F46A 3H5ZA 1HEEA 2Z11A 3BXMA 5THWA 2ZEGA 3DLJA 4NCZA 4R6TA 1K4JA 4U9ZA 1ARLA 2PE3A 2PJ5A 2PJ6A 2ZW4A 3PB6X 3F0AA 5A28A 3P2FA 2HB6A 2VXKA 3H8FA 1PUAA 3NH8A 4KZTA 1Z8XA 1VHEA 2J9AA 4AG7A 1LRZA 1Y7EA 4A33A 4F0YA 4FD7A 2JBJA 3WC7A 1N71A 2G3TA 4JJXA 3D8PA 3TTHA 4YFJA 1XMTA 6CPAA 3LD2A 3G8WA 3RBUA 2C6CA 4PK3A 2CNSA 4UCMA 3N7ZA 2ZEHA 4KLVA 4HNXB 2ZEMA 1Z8WA 3D7DA 1L0CA 2VZZA 3VWEA 4CAFA 2RB7A 5G22A 5J1QA 4A32A 2DF5A 2K5TA 2Z3KA 3FF3A 4KVOE 5K8OA 1DE4C 4JZ0A 4PXCA 2H5MA 4NGMA 3R9GA 2QMLA 4LQ6A 4Q38A 3JRUA 4KOUA 4ZBGA 4PSXA 3TOBA 4X8IA 5GCNA 5HXDA 3GUXA 4GXHA 1TF8A 2P6GA 3PB8X 4GS4A 2PRBA 4PSWA 1IB1E 1S7NA 2V8HA 2WYRA 1NE9A 2GLFA 3DNSA 2Z10A 4OADA 3GYAA 4B14A 4OAEA 4QVTA 3FEEA 1M1DA 1CM0A 3F5BA 1YLEA 1ARMA 2I79A 5AG4A 3FB3A 3H8EA 3KASA 3C26A 4QUSA 4MFLA 1IICA 5HH1A 4B13A 4KSFA 4UWJA 4M3SA 3TE4A 2ZEFA 2FVGA
chains in the Genus database with same CATH topology
2BL1A 3VWDA 2DPSA 2VI7A 1YVKA 4JLYA 1VKCA 5J8FA 4C7IA 1MJ9A 2OU2A 3DR6A 1OZPA 5AG7A 4R87A 2FSRA 2J8NA 2YGWA 2Z3PA 1Z4EA 3V8IA 4KVME 3FBUA 4UFWA 2I00A 4CAVA 4K30A 1I12A 2Q0YA 2F5IA 2B58A 4MFQA 2JDDA 5ISVA 1WK4A 3TO6A 2AJ6A 4UWIA 4IUSA 4JD6A 4RS2A 4UCNA 5C82A 5G20A 2QIRA 5G1ZA 4QB9A 3TO9A 1XF8A 3QAHA 2Z3MA 3BJ8A 5E96A 5KTAA 4MJ8A 3DDDA 1QSRA 4HNYB 2PQ8A 2J8RA 2VEZA 3F8KA 5AG6A 3ZJ0A 1MJBA 2Q04A 4KOSA 1QSNA 4C2ZA 3T9YA 4IF5A 1SQHA 2Q44A 2FS5A 1S7KA 1Q2YA 4UBRA 1B6BA 4CGPA 2HUZA 3TFYA 4PK2A 4F0XA 2G0BA 2O28A 1S7LA 2B4DA 1J4JA 1Y9WA 2FL4A 2OH1A 3GKRA 3G3SA 3CXPA 2GANA 2CNMA 5EBVA 4MBUA 1CJWA 3FIXA 2HV2A 5BWAB 3R9FA 5H84A 5H86A 4E8OA 4NEXA 3BLNA 3LODA 3DR8A 3SHPA 4MFKA 1VHSA 4M85A 4C7HA 4MY3A 3PP9A 4R3LA 2B3VA 4CRZB 4EVYA 2OZHA 3FXTA 4KOWA 1BO4A 1QSOA 1U6MA 3IWEA 3E0KA 4ORFA 4XPKA 5IX3A 3PZJA 2CNTA 2Q4VA 4CYOA 1Q2DA 1IYKA 1IIDA 4ONUA 4AB7A 4CGNA 4UA3A 2PSWA 2C27A 2B5GA 4R3KA 2AE6A 2R8VA 2ZW5A 3IWGA 3W6SA 2B4DB 2Z0ZA 3R96A 3I9SA 5CNPA 2GE3A 4YRHA 4MI4A 1XIXA 1FY7A 4H6ZA 5J8CA 4JXQA 3IU2A 5JPHA 1YVOA 1GHEA 3MGDA 4AG9A 2FT0A 4CAEA 4KOYA 1YREA 3W6XA 2P6FA 4CYPA 4E2AA 1MJAA 1S7FA 2JDCA 3EY5A 1XEBA 2VQYA 3ZZIA 3S6HA 3DSBA 2ARHA 2YNEA 2DPTA 2PR8A 2RC4A 2WSAA 2HQYA 4A30A 1BOBA 4HNWB 2PC1A 4NF1A 3D2MA 3IU1A 2D4PA 2PR1A 4C2YA 4E0AA 2VBQA 2DXQA 1ON0A 4CGLA 4LX9A 2Y0MA 2B5GB 1M4DA 4L8AA 3FYNA 3WR7A 4FD5A 3IGRA 1TIQA 3T90A 2FIAA 4XNHB 4QC6A 4A31A 4B5OA 4CYQA 4CRYB 4DNCA 1I21A 1Z9UA 4MFJA 3PGPA 2OZGA 1QSTA 3A9LA 1QSMA 4H89A 2CXAA 2OZUA 2BUEA 3OWCA 4R57A 4XPLA 4YGOA 4B5PA 4JXRA 3BJ7A 3B8GA 5C88A 2FXFA 4MFZA 4XPDB 4L89A 2Z3OA 4KUBA 5DWNA 2R1IA 3CXSA 4CYNA 4H6UA 3CXQA 1YR0A 2R7HA 2ZW6A 1KUYA 4KUAA 2P0WA 3GY9A 3TCVA 5AG5A 1M4IA 2J8MA 3H4QA 2ZW7A 4B10A 4Y49B 2PDOA 4JWPA 4AVCA 1IYLA 5F47A 2JLMA 1NSLA 2NMTA 5F49A 4KS9A 4FD4A 4XNHC 1B87A 3JVNA 2Z3LA 5I0CA 1S5KA 3FRMA 4MHDA 3SXOA 2WPXA 2YNCA 2B3UA 2OB0A 4UCPA 1M4GA 5AGEA 3JTKA 3I3GA 2JEVA 4PV6A 1MK4A 4UFVA 2WPWA 3R95A 3UY5A 2P6EA 5IB0A 4LUAA 4XPDC 5A27A 3EO4A 2ZXVA 2BEIA 1KZFA 4OLLA 1NMTA 3RYOA 2EUIA 4KOXA 4B5PB 1UFHA 4KORA 2Q7BA 4QBJA 1Z4RA 2CY2A 5IV0A 4U5YA 2KCWA 1M44A 1P4NA 1S3ZA 3S6KA 4Y49C 4B11A 3R9EA 3KKWA 3P2HA 2B4BA 4A2ZA 4NXYA 5G21A 3S6GA 3NE7A 4MY0A 4Q36A 2FCKA 4B12A 2X7BA 4RI1A 1YX0A 4KOTA 3TOAA 3FNCA 2QECA 3QB8A 2REFA 3EC4A 2VZYA 1WWZA 3R1KA 4II9A 2EVNA 4I49A 3S6FA 1R57A 4BMHA 5F48A 1XE4A 1ZO0A 1PU9A 2GIVA 2Z3NA 4C68A 3D3SA 4KLWA 1RO5A 1Y7RA 4CGMA 3K9UA 4F6AA 4HKFA 1KUXA 2REEA 3EFAA 2ZPAA 2ATRA 4BBHA 2Q4YA 1YK3A 4MFPA 4CAWA 4R9MA 2D4OA 5HMNA 4J3GA 3D2PA 3TT2A 1S60A 4CS0B 4U9YA 2A4NA 2IL4A 5EC4A 1YGHA 5JQ4A 1Y9KA 1V0CA 4UFXA 4ZGYB 4NSQA 5FVJA 3SXNA 4X5KA 4C2XA 1P0HA 4KOVA 3JUWA 4AVAA 2BSWA 2YNCC 5DWMA 4CAXA 2YNDA 2R98A 4FD6A 4CGOA 1Q2CA 4AVBA 1I1DA 1KUVA 2G3AA 3EXNA 2WUUA 3W91A 5KTCA 4KSAA 3TO7A 2FE7A 4KVXA 4A95A 1RXTA 2FIWA 5KTDA 5F46A 3H5ZA 2Z11A 4NCZA 1K4JA 4U9ZA 2ZW4A 3F0AA 5A28A 3P2FA 2VXKA 1PUAA 4KZTA 4AG7A 1LRZA 4A33A 4F0YA 4FD7A 1N71A 2G3TA 4JJXA 3D8PA 3TTHA 4YFJA 1XMTA 3LD2A 3G8WA 4PK3A 2CNSA 4UCMA 3N7ZA 4KLVA 4HNXB 1L0CA 2VZZA 3VWEA 4CAFA 5G22A 4A32A 2K5TA 2Z3KA 4KVOE 2H5MA 3R9GA 2QMLA 4Q38A 4KOUA 4ZBGA 4PSXA 3TOBA 5GCNA 2P6GA 4GS4A 2PRBA 4PSWA 1IB1E 1S7NA 3DNSA 1NE9A 2Z10A 4OADA 3GYAA 4B14A 4OAEA 4QVTA 1M1DA 1CM0A 3F5BA 1YLEA 2I79A 5AG4A 3FB3A 3C26A 4QUSA 4MFLA 1IICA 5HH1A 4B13A 4KSFA 4UWJA 4M3SA 3TE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSA A;  3JTK A;  2YND A;  4UCN A;  4CGP A;  5G20 A;  4CYO A;  4A30 A;  5A28 A;  5G1Z A;  4CGO A;  4B11 A;  3IU2 A;  4UFV A;  3IU1 A;  4CGN A;  2WUU A;  4B10 A;  4A2Z A;  4C7I A;  4C2Y A;  4A33 A;  4C68 A;  4CAE A;  5AG7 A;  4CYQ A;  5G21 A;  4CGL A;  5A27 A;  4C7H A;  4B14 A;  4CGM A;  4A95 A;  4UFW A;  4B12 A;  4CYP A;  4UFX A;  4CYN A;  5AG6 A;  4UCM A;  5AG4 A;  4C2Z A;  4A32 A;  3H5Z A;  4C2X A;  4B13 A;  4CAF A;  2YNC A;  3IWE A;  5AG5 A;  5AGE A;  5G22 A;  4UCP A;  4A31 A;  4BBH A;  2YNE A;  2YNC C; 
#chains in the Genus database with same CATH topology
 2BL1 A;  3VWD A;  2DPS A;  2VI7 A;  1YVK A;  2PVW A;  3MN8 A;  4JLY A;  4LQG A;  1VKC A;  3V7Z A;  5J8F A;  4C7I A;  3NH4 A;  1MJ9 A;  5CBM A;  1R3N A;  1DTD A;  2OU2 A;  3DR6 A;  1OZP A;  4DUK A;  5AG7 A;  4R87 A;  1EE3 P;  1GYT A;  2ZEN A;  2FSR A;  4NGR A;  2J8N A;  2YGW A;  3B35 A;  2Z3P A;  3NFZ A;  1Z4E A;  3V8I A;  1LCP A;  4KVM E;  4ZI6 A;  3FBU A;  4B6Z A;  4UFW A;  4OC3 A;  2I00 A;  4CAV A;  3DGV A;  2XEG A;  4UF4 A;  1CP7 A;  1I12 A;  2Q0Y A;  4K30 A;  2F5I A;  4PPZ A;  4PQA A;  2B58 A;  1Y0Y A;  4MFQ A;  2JDD A;  2PJ4 A;  2ANP A;  3FMC A;  3PRT A;  3T8W A;  3S9L A;  5ISV A;  5LRG A;  1WK4 A;  3TO6 A;  4H2K A;  2QYV A;  2AJ6 A;  3KHX A;  4P6Y A;  4UWI A;  3ISX A;  4IUS A;  4JD6 A;  4RS2 A;  4UCN A;  5C82 A;  5G20 A;  1ELL P;  2QIR A;  4UEF A;  5G1Z A;  1TKF A;  4NGP A;  1IOI A;  4QB9 A;  3TO9 A;  2QVP A;  1XF8 A;  2PCU A;  3QAH A;  2Z3M A;  3BJ8 A;  2BCO A;  3BI0 A;  1Y0R A;  1VHO A;  1F2O A;  5E96 A;  5KTA A;  1CBX A;  4MJ8 A;  3DDD A;  1QSR A;  1AMP A;  3PFE A;  2ZOF A;  4HNY B;  2OR4 A;  5DS0 A;  1TF9 A;  3PB9 X;  3PB7 X;  5D8N A;  2VL1 A;  2PQ8 A;  2J8R A;  2VEZ A;  3CT9 A;  3F8K A;  4NFR A;  1MJB A;  1AYE A;  2Q04 A;  3NH5 A;  4KOS A;  4WJB A;  4RUH A;  1QSN A;  4C2Z A;  3T9Y A;  5HVH A;  2Q4Z A;  3GIU A;  1CPX A;  1SQH A;  2Q44 A;  4IF5 A;  4CPA A;  2FS5 A;  1S7K A;  3VAT A;  1Q2Y A;  2V8D A;  4UBR A;  1B6B A;  4OME A;  2HUZ A;  4CGP A;  5LYF A;  3TFY A;  3SJE A;  3TC8 A;  4P10 A;  4OC0 A;  4PK2 A;  4F0X A;  4FBE A;  2G0B A;  2ZEL A;  2O28 A;  1A2Z A;  1S7L A;  3B3S A;  2PJ2 A;  2B4D A;  1J4J A;  1Y9W A;  4EWT A;  2XEF A;  2FL4 A;  1XOV A;  2OH1 A;  1VIX A;  3GKR A;  3G3S A;  3CXP A;  5K8N A;  2GAN A;  3FX6 A;  3H8G A;  2CNM A;  5EBV A;  4YWY A;  2EWB A;  3IWW A;  2Q51 A;  2Q7S A;  3LMS A;  4R8F A;  2PJ0 A;  1CJW A;  4MBU A;  3FIX A;  1CP6 A;  4MHP A;  1PYT B;  1HDU A;  2HV2 A;  3KI9 A;  5JM6 A;  2CTC A;  3SJG A;  1YSJ A;  2I3C A;  2C6P A;  3SI1 A;  5BWA B;  2NYQ A;  1HDQ A;  2IQ6 A;  3R9F A;  5H84 A;  5H86 A;  4E8O A;  4NEX A;  3BLN A;  3LOD A;  2DEA A;  1NSA A;  3CPA A;  5JGF A;  3DR8 A;  4ONW A;  4A37 A;  1LAP A;  3SHP A;  1PCA A;  4MFK A;  5JH9 A;  1VHS A;  3GLJ A;  3KZW A;  4M85 A;  4X2T A;  2XEJ A;  1LAN A;  4C7H A;  4UIA A;  5LRJ A;  1H8L A;  1TXR A;  4MY3 A;  4IAV A;  3PP9 A;  4R3L A;  2B3V A;  2V77 A;  4NJQ A;  4CRZ B;  4ZY0 A;  4EVY A;  2OZH A;  3FXT A;  5I4M A;  4KOW A;  1BO4 A;  1QSO A;  1U6M A;  3IWE A;  2GRE A;  2PJ7 A;  3E0K A;  4ORF A;  4XPK A;  5IX3 A;  3PZJ A;  1R43 A;  2CNT A;  2Q43 A;  2Q4V A;  4CYO A;  1Q2D A;  3HLP A;  1X12 A;  1IYK A;  3KQX A;  1IID A;  2F7V A;  4OC4 A;  1IY7 A;  4ONU A;  4AB7 A;  4CGN A;  4UA3 A;  1ZG9 A;  2PSW A;  2C27 A;  2B5G A;  3V38 A;  2O53 A;  2WZN A;  1FNO A;  2AFZ A;  2V8V A;  2ZOG A;  1LAM A;  3PBE A;  4R3K A;  4Z65 A;  3NE8 A;  2AE6 A;  2PJC A;  4M6I A;  2R8V A;  2ZW5 A;  3IWG A;  3ZJ0 A;  3W6S A;  4M6G A;  3KQZ A;  2B4D B;  2Z0Z A;  3R96 A;  4O23 A;  1Z5R A;  4DJL A;  3I9S A;  4PXB A;  1BLL E;  3VAR A;  5CNP A;  4NGT A;  5IB9 A;  2GE3 A;  4YRH A;  4MHY A;  3LWU A;  4MI4 A;  3LAC A;  4RN7 A;  4OC1 A;  1X10 A;  1XIX A;  1FY7 A;  4H6Z A;  4NGN A;  1LFW A;  2CF4 A;  5J8C A;  4ZX9 A;  4JXQ A;  3IU2 A;  3D4U A;  5JPH A;  1YVO A;  1GHE A;  3MGD A;  4AG9 A;  4PXD A;  2EK9 A;  2JEW A;  3FJU A;  2FT0 A;  3RZA A;  4CAE A;  4KOY A;  2EBJ A;  1YRE A;  4WWV A;  2OOT A;  4GM5 A;  3W6X A;  1JWQ A;  1ELM P;  3PB4 X;  1F57 A;  2P6F A;  4CYP A;  4E2A A;  1MJA A;  1S7F A;  4PXE A;  2JDC A;  3EY5 A;  2CTB A;  1XEB A;  2VQY A;  3D68 A;  3ZZI A;  3S6H A;  3DSB A;  2ARH A;  3IC1 A;  2YNE A;  4ZY1 A;  2DPT A;  2PR8 A;  4X3R A;  2RC4 A;  2PIZ A;  2WSA A;  1ZG7 A;  2HQY A;  1Q7L A;  4A30 A;  1BOB A;  3D7G A;  4HNW B;  2EO8 A;  2PC1 A;  3IO1 A;  4NF1 A;  2BO9 A;  3D2M A;  3HUV A;  3IU1 A;  4MCP A;  4TWE A;  2D4P A;  3WC5 A;  4P4F A;  2PR1 A;  4C2Y A;  4E0A A;  4P4J A;  1IOF A;  1TKJ A;  2VBQ A;  2DXQ A;  1ON0 A;  4DYO A;  3I1U A;  4MHN A;  4CGL A;  4LX9 A;  2GU2 A;  3CPX A;  2Y0M A;  4MMO A;  3S9M A;  2B5G B;  3BHX A;  1M4D A;  4L8A A;  2PRQ A;  1RTQ A;  4OP4 A;  3FYN A;  3WR7 A;  5LYL A;  4FD5 A;  1QQ9 A;  2IJZ A;  1TIQ A;  3IGR A;  3T90 A;  4OKO A;  2FIA A;  4XNH B;  2PJ8 A;  4QC6 A;  4A31 A;  4B5O A;  4CYQ A;  2EK8 A;  4CRY B;  4DNC A;  1I21 A;  2AFU A;  1Z9U A;  4BD9 A;  4MFJ A;  3PGP A;  2POK A;  3MRU A;  4P45 A;  2OZG A;  3SI2 A;  4A38 A;  1QST A;  3A9L A;  1QSM A;  4OID A;  4H89 A;  2CXA A;  2XEI A;  4HPS A;  2OZU A;  2BUE A;  2PJA A;  3OWC A;  4R57 A;  4MCS A;  4XPL A;  2GFQ A;  4FUU A;  4YGO A;  2IMO A;  4UEZ A;  4B5P A;  4JXR A;  3B7I A;  2QJ8 A;  3BJ7 A;  2F8H A;  3B8G A;  5C88 A;  2FXF A;  4MFZ A;  4F9U A;  3KR4 A;  4XPD B;  4L89 A;  1ZLI A;  2Z3O A;  2C6G A;  4KUB A;  2R1I A;  3CXS A;  5DWN A;  4CYN A;  4H6U A;  1CPS A;  3CXQ A;  1CG2 A;  1YR0 A;  2ABZ A;  2R7H A;  2ZW6 A;  1KUY A;  3B3T A;  4KUA A;  2P0W A;  3CZX A;  3GY9 A;  3TCV A;  5AG5 A;  1M4I A;  1LOK A;  2J8M A;  2C1C A;  4OC5 A;  3H4Q A;  3KR5 A;  2AFM A;  5K8M A;  1OBR A;  1YW4 A;  2ZW7 A;  1JQG A;  4B10 A;  4JYW A;  3K9T A;  4Y49 B;  2PDO A;  5K8P A;  4OIW A;  4JWP A;  1AUG A;  4AVC A;  1IYL A;  5F47 A;  2JLM A;  4R76 A;  1ZG8 A;  1NSL A;  2NMT A;  4MCQ A;  3GB0 A;  3FED A;  5F49 A;  1Z8T A;  3IIB A;  3QNV A;  4FD4 A;  4KS9 A;  4P4B A;  4XNH C;  1B87 A;  3JVN A;  2Z3L A;  3PBB A;  1S5K A;  2NSM A;  5I0C A;  3FRM A;  4MHD A;  2AFS A;  3SXO A;  2WPX A;  2YNC A;  4MXU A;  4EME A;  2B3U A;  2OB0 A;  4UCP A;  1M4G A;  5AGE A;  7CPA A;  4ZX8 A;  3JTK A;  8CPA A;  3I3G A;  4MRI A;  2JEV A;  4PV6 A;  1MK4 A;  4TNU A;  3B2Y A;  4UFV A;  3CDX A;  1CX8 A;  3IFE A;  2WPW A;  5LYD A;  3R95 A;  3SI0 A;  5HVG A;  3UY5 A;  4F9V A;  2P6E A;  4M6H A;  5IB0 A;  4P44 A;  4LUA A;  4XPD C;  2HC9 A;  4A39 A;  1VGY A;  3EO4 A;  3QAY A;  1TKH A;  2O4H A;  2ZXV A;  2BEI A;  5A27 A;  1KZF A;  4K3N A;  3IEH A;  4OLL A;  1NMT A;  1BPM A;  4OC2 A;  3RYO A;  2EUI A;  4KOX A;  5EMI A;  2ZEE A;  4B5P B;  1UFH A;  3KL9 A;  4KOR A;  3TX8 A;  3VH9 A;  2Q7B A;  4QBJ A;  1Z4R A;  1XJO A;  2CY2 A;  5HVF A;  5IV0 A;  3S9N A;  4U5Y A;  4MHZ A;  2KCW A;  1XRY A;  5ELY A;  3PFO A;  1M44 A;  1P4N A;  4FAI A;  1S3Z A;  3S6K A;  4Y49 C;  4B11 A;  3RO0 A;  3R9E A;  3KKW A;  4P4E A;  3P2H A;  2V8G A;  2B4B A;  4A2Z A;  4MCR A;  4YU9 A;  3FVL A;  3PEI A;  2AFO A;  4NXY A;  2CIJ A;  5G21 A;  1FT7 A;  4P4D A;  3S6G A;  2BOA A;  3NE7 A;  4MY0 A;  4Q36 A;  2PJ1 A;  2FCK A;  4B12 A;  2X7B A;  3FH4 A;  3SJX A;  4RI1 A;  4F8Z A;  1YX0 A;  4KOT A;  3TOA A;  3FNC A;  2QEC A;  3QB8 A;  1IU8 A;  2REF A;  3D7F A;  3EC4 A;  2VZY A;  1WWZ A;  3R1K A;  4UEE A;  2PVV A;  2EVN A;  4I49 A;  4KSI A;  4AXV A;  4II9 A;  4R7M A;  3S6F A;  1R57 A;  4BMH A;  5F48 A;  3D7H A;  1XE4 A;  4BIN A;  1ZO0 A;  1PU9 A;  4W9Y A;  2GIV A;  2Z3N A;  4P4I A;  4C68 A;  1M4L A;  4IHM A;  3D3S A;  4KLW A;  4FWU A;  5CPA A;  1XMB A;  4UIB A;  3L2N A;  2ZEO A;  1RO5 A;  4EFD A;  1YQE A;  1Y7R A;  2ZEP A;  4CGM A;  3K9U A;  5AG6 A;  3KGQ A;  1F2P A;  4F6A A;  5LRK A;  4HKF A;  1KUX A;  2REE A;  3EFA A;  2ZPA A;  2PJB A;  2JBK A;  4ZYQ A;  2ATR A;  4BBH A;  2Q4Y A;  1KWM A;  1YK3 A;  3RNZ A;  4MFP A;  3RAM A;  4CAW A;  4R9M A;  2D4O A;  2G9D A;  3WC6 A;  5HMN A;  3N5F A;  2AFX A;  1IGB A;  4Q7A A;  4J3G A;  3D2P A;  3TT2 A;  1S60 A;  2GLJ A;  4CS0 B;  1XBU A;  1QMU A;  4U9Y A;  5F09 A;  2A4N A;  3IJ3 A;  3ISZ A;  2IL4 A;  4ZY2 A;  5EC4 A;  1YGH A;  5JQ4 A;  1Y9K A;  1V0C A;  4A94 A;  3KHZ A;  4UFX A;  4ZGY B;  4NGQ A;  4NSQ A;  4NJR A;  5FVJ A;  3SXN A;  1BAV A;  1YW6 A;  4X5K A;  4C2X A;  1P0H A;  2ZED A;  1ZLH A;  3JUW A;  4KOV A;  4NGS A;  4AVA A;  2BSW A;  2YNC C;  5DWM A;  4CAX A;  2YND A;  1YME A;  2R98 A;  3B3W A;  5LYI A;  1UWY A;  4FD6 A;  2ODF A;  3WAB A;  4CGO A;  1Q2C A;  4AVB A;  1I1D A;  1KUV A;  2G3A A;  1XFO A;  3B3V A;  3EXN A;  2WUU A;  3W91 A;  2AFW A;  3SJF A;  5KTC A;  2RFH A;  3B3C A;  1BPN A;  3FEC A;  3BI1 A;  2PIY A;  4KSA A;  2PJ3 A;  3TO7 A;  2FE7 A;  4KVX A;  4A95 A;  3K2K A;  2PJ9 A;  1Z8L A;  1Z2L A;  1YLO A;  4G1P A;  3D67 A;  5D29 A;  1RXT A;  3WT4 A;  3D66 A;  3NA6 A;  2FIW A;  5KTD A;  4IK2 A;  5F46 A;  3H5Z A;  1HEE A;  2Z11 A;  3BXM A;  5THW A;  2ZEG A;  3DLJ A;  4NCZ A;  4R6T A;  1K4J A;  4U9Z A;  1ARL A;  2PE3 A;  2PJ5 A;  2PJ6 A;  2ZW4 A;  3PB6 X;  3F0A A;  5A28 A;  3P2F A;  2HB6 A;  2VXK A;  3H8F A;  1PUA A;  3NH8 A;  4KZT A;  1Z8X A;  1VHE A;  2J9A A;  4AG7 A;  1LRZ A;  1Y7E A;  4A33 A;  4F0Y A;  4FD7 A;  2JBJ A;  3WC7 A;  1N71 A;  2G3T A;  4JJX A;  3D8P A;  3TTH A;  4YFJ A;  1XMT A;  6CPA A;  3LD2 A;  3G8W A;  3RBU A;  2C6C A;  4PK3 A;  2CNS A;  4UCM A;  3N7Z A;  2ZEH A;  4KLV A;  4HNX B;  2ZEM A;  1Z8W A;  3D7D A;  1L0C A;  2VZZ A;  3VWE A;  4CAF A;  2RB7 A;  5G22 A;  5J1Q A;  4A32 A;  2DF5 A;  2K5T A;  2Z3K A;  3FF3 A;  4KVO E;  5K8O A;  1DE4 C;  4JZ0 A;  4PXC A;  2H5M A;  4NGM A;  3R9G A;  2QML A;  4LQ6 A;  4Q38 A;  3JRU A;  4KOU A;  4ZBG A;  4PSX A;  3TOB A;  4X8I A;  5GCN A;  5HXD A;  3GUX A;  4GXH A;  1TF8 A;  2P6G A;  3PB8 X;  4GS4 A;  2PRB A;  4PSW A;  1IB1 E;  1S7N A;  2V8H A;  2WYR A;  1NE9 A;  2GLF A;  3DNS A;  2Z10 A;  4OAD A;  3GYA A;  4B14 A;  4OAE A;  4QVT A;  3FEE A;  1M1D A;  1CM0 A;  3F5B A;  1YLE A;  1ARM A;  2I79 A;  5AG4 A;  3FB3 A;  3H8E A;  3KAS A;  3C26 A;  4QUS A;  4MFL A;  1IIC A;  5HH1 A;  4B13 A;  4KSF A;  4UWJ A;  4M3S A;  3TE4 A;  2ZEF A;  2FVG A; 
#chains in the Genus database with same CATH homology
 2BL1 A;  3VWD A;  2DPS A;  2VI7 A;  1YVK A;  4JLY A;  1VKC A;  5J8F A;  4C7I A;  1MJ9 A;  2OU2 A;  3DR6 A;  1OZP A;  5AG7 A;  4R87 A;  2FSR A;  2J8N A;  2YGW A;  2Z3P A;  1Z4E A;  3V8I A;  4KVM E;  3FBU A;  4UFW A;  2I00 A;  4CAV A;  4K30 A;  1I12 A;  2Q0Y A;  2F5I A;  2B58 A;  4MFQ A;  2JDD A;  5ISV A;  1WK4 A;  3TO6 A;  2AJ6 A;  4UWI A;  4IUS A;  4JD6 A;  4RS2 A;  4UCN A;  5C82 A;  5G20 A;  2QIR A;  5G1Z A;  4QB9 A;  3TO9 A;  1XF8 A;  3QAH A;  2Z3M A;  3BJ8 A;  5E96 A;  5KTA A;  4MJ8 A;  3DDD A;  1QSR A;  4HNY B;  2PQ8 A;  2J8R A;  2VEZ A;  3F8K A;  5AG6 A;  3ZJ0 A;  1MJB A;  2Q04 A;  4KOS A;  1QSN A;  4C2Z A;  3T9Y A;  4IF5 A;  1SQH A;  2Q44 A;  2FS5 A;  1S7K A;  1Q2Y A;  4UBR A;  1B6B A;  4CGP A;  2HUZ A;  3TFY A;  4PK2 A;  4F0X A;  2G0B A;  2O28 A;  1S7L A;  2B4D A;  1J4J A;  1Y9W A;  2FL4 A;  2OH1 A;  3GKR A;  3G3S A;  3CXP A;  2GAN A;  2CNM A;  5EBV A;  4MBU A;  1CJW A;  3FIX A;  2HV2 A;  5BWA B;  3R9F A;  5H84 A;  5H86 A;  4E8O A;  4NEX A;  3BLN A;  3LOD A;  3DR8 A;  3SHP A;  4MFK A;  1VHS A;  4M85 A;  4C7H A;  4MY3 A;  3PP9 A;  4R3L A;  2B3V A;  4CRZ B;  4EVY A;  2OZH A;  3FXT A;  4KOW A;  1BO4 A;  1QSO A;  1U6M A;  3IWE A;  3E0K A;  4ORF A;  4XPK A;  5IX3 A;  3PZJ A;  2CNT A;  2Q4V A;  4CYO A;  1Q2D A;  1IYK A;  1IID A;  4ONU A;  4AB7 A;  4CGN A;  4UA3 A;  2PSW A;  2C27 A;  2B5G A;  4R3K A;  2AE6 A;  2R8V A;  2ZW5 A;  3IWG A;  3W6S A;  2B4D B;  2Z0Z A;  3R96 A;  3I9S A;  5CNP A;  2GE3 A;  4YRH A;  4MI4 A;  1XIX A;  1FY7 A;  4H6Z A;  5J8C A;  4JXQ A;  3IU2 A;  5JPH A;  1YVO A;  1GHE A;  3MGD A;  4AG9 A;  2FT0 A;  4CAE A;  4KOY A;  1YRE A;  3W6X A;  2P6F A;  4CYP A;  4E2A A;  1MJA A;  1S7F A;  2JDC A;  3EY5 A;  1XEB A;  2VQY A;  3ZZI A;  3S6H A;  3DSB A;  2ARH A;  2YNE A;  2DPT A;  2PR8 A;  2RC4 A;  2WSA A;  2HQY A;  4A30 A;  1BOB A;  4HNW B;  2PC1 A;  4NF1 A;  3D2M A;  3IU1 A;  2D4P A;  2PR1 A;  4C2Y A;  4E0A A;  2VBQ A;  2DXQ A;  1ON0 A;  4CGL A;  4LX9 A;  2Y0M A;  2B5G B;  1M4D A;  4L8A A;  3FYN A;  3WR7 A;  4FD5 A;  3IGR A;  1TIQ A;  3T90 A;  2FIA A;  4XNH B;  4QC6 A;  4A31 A;  4B5O A;  4CYQ A;  4CRY B;  4DNC A;  1I21 A;  1Z9U A;  4MFJ A;  3PGP A;  2OZG A;  1QST A;  3A9L A;  1QSM A;  4H89 A;  2CXA A;  2OZU A;  2BUE A;  3OWC A;  4R57 A;  4XPL A;  4YGO A;  4B5P A;  4JXR A;  3BJ7 A;  3B8G A;  5C88 A;  2FXF A;  4MFZ A;  4XPD B;  4L89 A;  2Z3O A;  4KUB A;  5DWN A;  2R1I A;  3CXS A;  4CYN A;  4H6U A;  3CXQ A;  1YR0 A;  2R7H A;  2ZW6 A;  1KUY A;  4KUA A;  2P0W A;  3GY9 A;  3TCV A;  5AG5 A;  1M4I A;  2J8M A;  3H4Q A;  2ZW7 A;  4B10 A;  4Y49 B;  2PDO A;  4JWP A;  4AVC A;  1IYL A;  5F47 A;  2JLM A;  1NSL A;  2NMT A;  5F49 A;  4KS9 A;  4FD4 A;  4XNH C;  1B87 A;  3JVN A;  2Z3L A;  5I0C A;  1S5K A;  3FRM A;  4MHD A;  3SXO A;  2WPX A;  2YNC A;  2B3U A;  2OB0 A;  4UCP A;  1M4G A;  5AGE A;  3JTK A;  3I3G A;  2JEV A;  4PV6 A;  1MK4 A;  4UFV A;  2WPW A;  3R95 A;  3UY5 A;  2P6E A;  5IB0 A;  4LUA A;  4XPD C;  5A27 A;  3EO4 A;  2ZXV A;  2BEI A;  1KZF A;  4OLL A;  1NMT A;  3RYO A;  2EUI A;  4KOX A;  4B5P B;  1UFH A;  4KOR A;  2Q7B A;  4QBJ A;  1Z4R A;  2CY2 A;  5IV0 A;  4U5Y A;  2KCW A;  1M44 A;  1P4N A;  1S3Z A;  3S6K A;  4Y49 C;  4B11 A;  3R9E A;  3KKW A;  3P2H A;  2B4B A;  4A2Z A;  4NXY A;  5G21 A;  3S6G A;  3NE7 A;  4MY0 A;  4Q36 A;  2FCK A;  4B12 A;  2X7B A;  4RI1 A;  1YX0 A;  4KOT A;  3TOA A;  3FNC A;  2QEC A;  3QB8 A;  2REF A;  3EC4 A;  2VZY A;  1WWZ A;  3R1K A;  4II9 A;  2EVN A;  4I49 A;  3S6F A;  1R57 A;  4BMH A;  5F48 A;  1XE4 A;  1ZO0 A;  1PU9 A;  2GIV A;  2Z3N A;  4C68 A;  3D3S A;  4KLW A;  1RO5 A;  1Y7R A;  4CGM A;  3K9U A;  4F6A A;  4HKF A;  1KUX A;  2REE A;  3EFA A;  2ZPA A;  2ATR A;  4BBH A;  2Q4Y A;  1YK3 A;  4MFP A;  4CAW A;  4R9M A;  2D4O A;  5HMN A;  4J3G A;  3D2P A;  3TT2 A;  1S60 A;  4CS0 B;  4U9Y A;  2A4N A;  2IL4 A;  5EC4 A;  1YGH A;  5JQ4 A;  1Y9K A;  1V0C A;  4UFX A;  4ZGY B;  4NSQ A;  5FVJ A;  3SXN A;  4X5K A;  4C2X A;  1P0H A;  4KOV A;  3JUW A;  4AVA A;  2BSW A;  2YNC C;  5DWM A;  4CAX A;  2YND A;  2R98 A;  4FD6 A;  4CGO A;  1Q2C A;  4AVB A;  1I1D A;  1KUV A;  2G3A A;  3EXN A;  2WUU A;  3W91 A;  5KTC A;  4KSA A;  3TO7 A;  2FE7 A;  4KVX A;  4A95 A;  1RXT A;  2FIW A;  5KTD A;  5F46 A;  3H5Z A;  2Z11 A;  4NCZ A;  1K4J A;  4U9Z A;  2ZW4 A;  3F0A A;  5A28 A;  3P2F A;  2VXK A;  1PUA A;  4KZT A;  4AG7 A;  1LRZ A;  4A33 A;  4F0Y A;  4FD7 A;  1N71 A;  2G3T A;  4JJX A;  3D8P A;  3TTH A;  4YFJ A;  1XMT A;  3LD2 A;  3G8W A;  4PK3 A;  2CNS A;  4UCM A;  3N7Z A;  4KLV A;  4HNX B;  1L0C A;  2VZZ A;  3VWE A;  4CAF A;  5G22 A;  4A32 A;  2K5T A;  2Z3K A;  4KVO E;  2H5M A;  3R9G A;  2QML A;  4Q38 A;  4KOU A;  4ZBG A;  4PSX A;  3TOB A;  5GCN A;  2P6G A;  4GS4 A;  2PRB A;  4PSW A;  1IB1 E;  1S7N A;  3DNS A;  1NE9 A;  2Z10 A;  4OAD A;  3GYA A;  4B14 A;  4OAE A;  4QVT A;  1M1D A;  1CM0 A;  3F5B A;  1YLE A;  2I79 A;  5AG4 A;  3FB3 A;  3C26 A;  4QUS A;  4MFL A;  1IIC A;  5HH1 A;  4B13 A;  4KSF A;  4UWJ A;  4M3S A;  3TE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...