2YNCA

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 117
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncA00
4A2ZA 4C7HA 5A27A 4UCPA 4A31A 2YNCC 4A30A 4C68A 4CGLA 5AG7A 4UCMA 4B13A 4C2ZA 3IWEA 4CYQA 4CYNA 2YNEA 4CYOA 3JTKA 4BBHA 4CYPA 4C2XA 4UCNA 4B11A 4CGOA 5AGEA 3IU2A 4UFVA 4B12A 4UFWA 5A28A 5AG4A 4CGMA 5G21A 5G1ZA 4CGPA 4CGNA 2WSAA 5AG5A 4A32A 4A33A 3IU1A 4UFXA 5AG6A 4A95A 4B10A 4CAFA 2YNCA 4B14A 4C7IA 4CAEA 5G22A 4C2YA 2YNDA 3H5ZA 2WUUA 5G20A
chains in the Genus database with same CATH superfamily
4LX9A 2EWBA 4A94A 3DR6A 5LRKA 2GANA 1F57A 2R1IA 2GE3A 4JWPA 3EXNA 4X5KA 3B3WA 3QNVA 4R3KA 3DNSA 1ARMA 3GB0A 1YLEA 4KUAA 1HDUA 4L89A 4X2TA 3WABA 3KQZA 2YGWA 1TKFA 2G9DA 4FWUA 3FBUA 3FYNA 2CXAA 2WZNA 2AE6A 3V8IA 1H8LA 4FD5A 2JBKA 5HMNA 2Q51A 2PVVA 4UBRA 1LCPA 4KS9A 4NGSA 1XJOA 5IB0A 2PIZA 4P4JA 1YW4A 1JQGA 3IU1A 2PJ0A 3GYAA 4R8FA 1RXTA 4P44A 4C2YA 2PCUA 1YREA 1PCAA 2QMLA 4OADA 4R6TA 3FXTA 3D8PA 2YNCC 2Z3KA 3SI1A 3V38A 1QSTA 2WYRA 2HB6A 1ARLA 2Z3OA 3MRUA 3TE4A 2ODFA 3DGVA 2Q44A 3R9EA 2V8VA 1NMTA 1XRYA 5ELYA 4CAXA 4OMEA 4E8OA 2Q4YA 5HXDA 2BL1A 2Q04A 4UEFA 1AYEA 1P4NA 1YGHA 1M1DA 1KUVA 1EE3P 3B35A 1OBRA 4MFQA 3B3TA 4CGNA 4A33A 2AFUA 2AFXA 1HEEA 4PSWA 4H2KA 4I49A 1Y7EA 1B6BA 2QECA 2Z3MA 1ZLHA 4Q36A 3TOBA 1JWQA 3QB8A 4P6YA 3D7DA 1QMUA 3B7IA 3TOAA 1CX8A 4PPZA 2RC4A 3TO9A 4PQAA 2ARHA 4JZ0A 3TO6A 3WR7A 3JTKA 4PK3A 4Y49B 1QSNA 3EY5A 4F6AA 4C2XA 3BI1A 4CGOA 5EC4A 1Q2DA 4AVAA 4YU9A 4UFWA 2D4PA 3P2HA 3S6GA 4A39A 1M4IA 1MJAA 2D4OA 4MHPA 1MJ9A 1Z5RA 4FD4A 1TKJA 4M3SA 5D29A 2NMTA 1N71A 2BSWA 5J8FA 5F47A 1CJWA 4OC3A 1S7LA 4U5YA 2JDCA 3RO0A 4CAFA 3B3SA 3S9MA 3S9LA 1VHEA 4B6ZA 4U9ZA 1Y9WA 1ON0A 3SI0A 3FNCA 1IB1E 4NGPA 3SJEA 3F8KA 3KR4A 2OB0A 3D7HA 4MFZA 3KASA 4EMEA 4WJBA 3GIUA 4C2ZA 2CY2A 3IWEA 1CPXA 2GU2A 3JUWA 4OC1A 1ELLP 3KL9A 3OWCA 2BOAA 2ZPAA 2EUIA 2QVPA 4CYPA 3NFZA 4CRZB 4XNHB 4Q38A 5AG4A 4PK2A 1KWMA 2G0BA 4CGMA 1GYTA 2IJZA 1KUXA 2P0WA 3G8WA 3EFAA 2ZEFA 4JLYA 3W91A 3PEIA 4MRIA 4G1PA 1R43A 2K5TA 2GFQA 2PQ8A 2POKA 4NSQA 5G20A 1RTQA 4AVCA 2V8GA 5F09A 5JM6A 2FL4A 1BOBA 5A27A 2JLMA 5DS0A 1Z8TA 3SJGA 5I0CA 2XEIA 2PJCA 4KOUA 3UY5A 1IU8A 3MGDA 4CYQA 1K4JA 1S7NA 4JXQA 2G3TA 3FH4A 5FVJA 4MXUA 3TX8A 3BLNA 4Q7AA 3S6KA 2GIVA 3E0KA 8CPAA 5LRJA 2A4NA 1QSMA 3V7ZA 1MJBA 1F2PA 4PXCA 3VH9A 4MJ8A 2Z11A 4OP4A 3NE7A 2WSAA 1Z8WA 4UFXA 3FB3A 2FE7A 5CBMA 1LOKA 3PP9A 3NA6A 4MHYA 2Z10A 4KLWA 3RBUA 3NH5A 2PJ4A 2J9AA 3JVNA 3K2KA 3QAHA 3KGQA 3A9LA 5F46A 2VI7A 1PUAA 1TXRA 4UCPA 5KTDA 1XMBA 1QSRA 3FF3A 1CG2A 3S6HA 4U9YA 2AFMA 4KOVA 2HV2A 5K8OA 2VZYA 3SHPA 3SXOA 2ZW4A 1I12A 4YWYA 4QB9A 1QSOA 3MN8A 4UF4A 5C88A 2Q4VA 2EVNA 3LD2A 1Y9KA 4X3RA 2DPSA 4R9MA 3RZAA 3RNZA 4BD9A 2PC1A 2OZUA 1Q7LA 2PJ3A 3EC4A 1UWYA 2AFSA 3PB9X 2CNMA 4A37A 3CXPA 2P6GA 4KZTA 2AFOA 3S9NA 4DNCA 3PB8X 3T9YA 4CRYB 2ZOGA 4OC5A 4MFLA 4ZY2A 1YX0A 3DR8A 3PB4X 4KOXA 5LRGA 4CS0B 4KOSA 4RN7A 5LYDA 3R9FA 2G3AA 4CAWA 2FIAA 3KR5A 4J3GA 4OC2A 5ISVA 1VHOA 3PFOA 5LYFA 2V77A 4ONWA 1VKCA 3WC6A 1TF9A 4HKFA 4PV6A 2ZEEA 4B5OA 2XEGA 3IC1A 2PJ7A 2B5GB 4JD6A 5A28A 2HQYA 3H8FA 3FVLA 5G21A 1AMPA 4UEZA 5HVGA 2I3CA 4MCSA 3T8WA 2FVGA 1AUGA 4B10A 5JGFA 3PBEA 1PU9A 2ZEPA 4ZBGA 5G22A 4MFPA 3IWGA 1Q2YA 4KLVA 2B3VA 3DLJA 4QBJA 4LQ6A 3PGPA 1WK4A 4KORA 4W9YA 4ZYQA 1V0CA 2R98A 5C82A 4F0XA 5HH1A 1YSJA 2Z0ZA 3D7GA 3IEHA 2GLFA 4PXBA 3VWDA 2ANPA 1VIXA 2EK9A 3FX6A 2J8NA 2R7HA 2B5GA 4L8AA 1DE4C 4II9A 4JXRA 4KVXA 2ZEHA 4MFJA 1CM0A 3K9UA 4OC4A 5JQ4A 1ELMP 3IGRA 4B11A 4XPDB 3IFEA 1TKHA 3FRMA 4B12A 1X12A 4JYWA 4EVYA 2I79A 4H6UA 1S7FA 3HUVA 5F49A 4KSAA 4MCPA 4CGPA 1CBXA 4PXDA 3I9SA 5E96A 2PIYA 1RO5A 2FIWA 1M44A 1IY7A 1Z8LA 3LACA 3ISZA 3LODA 4DJLA 4R7MA 1I1DA 2P6FA 1J4JA 3CT9A 4K3NA 4NGTA 1Z4RA 4K30A 3IO1A 4KVME 3CPXA 5K8PA 3R1KA 3NE8A 4KOYA 4CGLA 5AG7A 5K8MA 1MK4A 4B13A 3D68A 2YNEA 1CP6A 3CZXA 1WWZA 1S7KA 4ORFA 4LQGA 2Z3LA 1S3ZA 3GY9A 4M6HA 4FAIA 4YFJA 4R57A 4XPKA 4PXEA 2O28A 4NJQA 2OZHA 2PJ6A 4ZI6A 1IYKA 1M4DA 4UEEA 4P4EA 2QYVA 2C6CA 2PR1A 2ZEOA 4EWTA 2F5IA 5HVFA 5BWAB 3CPAA 3NH4A 4YRHA 5J1QA 2FXFA 2VZZA 4ONUA 4OKOA 4NEXA 3D7FA 4UIBA 4GS4A 1CP7A 2VBQA 4NGQA 4FD6A 1PYTB 3TFYA 1S5KA 1R57A 2J8MA 4R87A 2VL1A 2Q7BA 4A30A 4FD7A 1X10A 3D67A 3B3CA 4XPLA 4QUSA 2OH1A 2AJ6A 2XEJA 1TF8A 1DTDA 1L0CA 4H6ZA 4ZX9A 5I4MA 4TNUA 4MHZA 3R95A 3C26A 4HNXB 3F5BA 1IOFA 5D8NA 4FBEA 3TT2A 2C1CA 4PSXA 1KUYA 2GREA 2ABZA 1FNOA 4MBUA 3R9GA 4A32A 4BINA 2YNCA 4ZX8A 3IIBA 3KKWA 4KSIA 3H5ZA 4KUBA 1ZLIA 1ZG8A 2PJAA 4B5PB 1LRZA 5H86A 2Q0YA 1YK3A 1XMTA 3WT4A 1U6MA 5JH9A 4MCQA 2ZOFA 1Z4EA 4NXYA 1IOIA 1IGBA 3W6SA 1F2OA 2B3UA 2EBJA 1Y0YA 4M6IA 4F8ZA 4Y49C 3VARA 2ZW7A 4P4FA 4UCNA 3S6FA 3TO7A 2GLJA 4A38A 2ATRA 3B2YA 4UWIA 5IB9A 3WC7A 2Q43A 5K8NA 2H5MA 4RS2A 2WPXA 3CDXA 5G1ZA 2ZW6A 2NSMA 4AG9A 2CF4A 2PRQA 4UA3A 4B5PA 3RAMA 5AG5A 1XBUA 3D2PA 2QIRA 1IYLA 4JJXA 1R3NA 3R96A 3T90A 4OIDA 4ZGYB 4M6GA 1YMEA 5THWA 1NSLA 2BO9A 2CNTA 2B4DA 2JDDA 2VEZA 4OIWA 4MFKA 4F0YA 2O4HA 2ZELA 3N7ZA 2ZEMA 3I1UA 4HNWB 5CNPA 4EFDA 2ZEGA 4Z65A 1HDQA 3BXMA 3LMSA 2NYQA 1LAPA 3QAYA 3PBBA 3ZZIA 2ZXVA 4CYNA 3PFEA 2CTCA 2DXQA 4BBHA 3H4QA 1S60A 3B3VA 4NCZA 2HUZA 1VHSA 2EO8A 2IQ6A 3F0AA 4UFVA 2PJ8A 3EO4A 1QQ9A 3PZJA 4CAVA 4F9UA 4XNHC 3VWEA 1M4GA 2PJ1A 3GKRA 3GLJA 2EK8A 2B58A 1NE9A 3D66A 5HVHA 3G3SA 3SXNA 4CYOA 2REFA 1Q2CA 4CAEA 4X8IA 1VGYA 4NGRA 1XFOA 1GHEA 2DEAA 3KQXA 2PVWA 4A2ZA 1XE4A 4KOWA 3KI9A 4AG7A 5DWMA 4GM5A 2JBJA 2ZEDA 1FY7A 4QVTA 4MY0A 2C6GA 2F7VA 2Z3PA 3FJUA 3TCVA 4P4IA 4RI1A 5F48A 1XF8A 3D3SA 4NF1A 2Q7SA 1Y0RA 4BMHA 5LYLA 3D2MA 5DWNA 4M85A 1SQHA 3FIXA 4YGOA 1ZG7A 4MY3A 3BI0A 4AXVA 4P10A 2BUEA 4E2AA 3CXQA 2CNSA 4OC0A 2ZW5A 2BEIA 2VQYA 2JEVA 2PR8A 4P45A 5AG6A 2PE3A 1YQEA 3FEDA 4KVOE 4B14A 3HLPA 4C7IA 4P4DA 3PB6X 6CPAA 5JPHA 5J8CA 4HPSA 1OZPA 4CPAA 3LWUA 1XEBA 1XOVA 1M4LA 5GCNA 1LANA 3SJXA 2KCWA 1LFWA 3IWWA 5H84A 5IV0A 2DPTA 2OOTA 2Q4ZA 2AFZA 4AB7A 5KTAA 2F8HA 1BPNA 4MHDA 4OLLA 4UCMA 2HC9A 1P0HA 3NH8A 2C6PA 3L2NA 2PDOA 2CIJA 3TC8A 3JRUA 2OR4A 3FEEA 2V8DA 4QC6A 4UWJA 3I3GA 3KHXA 2O53A 4IUSA 3CXSA 4MHNA 1A2ZA 3DSBA 4MI4A 3H8EA 1ZG9A 1YW6A 2PSWA 4HNYB 5CPAA 3W6XA 4AVBA 3PRTA 2PRBA 2R8VA 1BLLE 4R3LA 4F9VA 5LYIA 4ZY0A 4R76A 3D4UA 5KTCA 3KZWA 4IK2A 4C7HA 2I00A 4NJRA 2REEA 1NSAA 4ZY1A 1IICA 1YVOA 1UFHA 4DUKA 1CPSA 2Z3NA 4C68A 2PJ2A 1BPMA 1Z9UA 2AFWA 1Z2LA 1IIDA 3BHXA 1KZFA 3SJFA 4NGNA 3IJ3A 4LUAA 3ZJ0A 2Y0MA 5AGEA 3GUXA 4KOTA 2PJBA 2RB7A 3DDDA 3BJ7A 3BJ8A 3B8GA 3K9TA 4IAVA 4MMOA 2C27A 4UIAA 4FUUA 2OU2A 1ZO0A 4OAEA 4E0AA 1LAMA 2J8RA 2DF5A 4P4BA 2PJ5A 7CPAA 2CTBA 2IL4A 3ISXA 2FT0A 2FSRA 2X7BA 3SI2A 5IX3A 3PB7X 1Y7RA 1YLOA 1BO4A 4TWEA 4IF5A 3RYOA 2QJ8A 4A31A 2WPWA 3FMCA 4DYOA 2OZGA 3N5FA 2PJ9A 3FECA 4NFRA 4NGMA 2B4DB 2FCKA 3KHZA 3WC5A 2BCOA 2ZENA 1Z8XA 2IMOA 2JEWA 4IHMA 4O23A 3IU2A 4WWVA 4XPDC 5EMIA 3TTHA 2RFHA 1TIQA 4MCRA 2V8HA 2P6EA 4RUHA 2VXKA 2B4BA 3H8GA 1YR0A 5EBVA 1BAVA 2WUUA 3P2FA 4H89A 4A95A 1I21A 1XIXA 4KSFA 4GXHA 1YVKA 3VATA 1FT7A 2YNDA 1B87A 2XEFA 2FS5A
chains in the Genus database with same CATH topology
4LX9A 3DR6A 2GANA 2R1IA 2GE3A 4JWPA 3EXNA 4X5KA 4R3KA 3DNSA 1YLEA 4KUAA 4L89A 2YGWA 3FBUA 3FYNA 2CXAA 2AE6A 3V8IA 4FD5A 5HMNA 4UBRA 4KS9A 5IB0A 3IU1A 3GYAA 1RXTA 4C2YA 1YREA 2QMLA 4OADA 3FXTA 3D8PA 2YNCC 2Z3KA 1QSTA 2Z3OA 3TE4A 2Q44A 3R9EA 1NMTA 4CAXA 4E8OA 2Q4YA 2BL1A 2Q04A 1P4NA 1YGHA 1M1DA 1KUVA 4MFQA 4CGNA 4A33A 4PSWA 4I49A 1B6BA 2QECA 2Z3MA 4Q36A 3TOBA 3QB8A 3TOAA 2RC4A 3TO9A 2ARHA 3TO6A 3WR7A 3JTKA 4PK3A 4Y49B 1QSNA 3EY5A 4F6AA 4C2XA 4CGOA 5EC4A 1Q2DA 4AVAA 4UFWA 2D4PA 3P2HA 3S6GA 1M4IA 1MJAA 2D4OA 1MJ9A 4FD4A 4M3SA 2NMTA 1N71A 2BSWA 5J8FA 5F47A 1CJWA 1S7LA 4U5YA 2JDCA 4CAFA 4U9ZA 1Y9WA 1ON0A 3FNCA 1IB1E 3F8KA 2OB0A 4MFZA 4C2ZA 2CY2A 3IWEA 3JUWA 4CYPA 3OWCA 2ZPAA 2EUIA 4CRZB 4XNHB 4Q38A 5AG4A 4PK2A 2G0BA 4CGMA 1KUXA 2P0WA 3G8WA 3EFAA 4JLYA 3W91A 2K5TA 2PQ8A 4NSQA 5G20A 4AVCA 2FL4A 1BOBA 5A27A 2JLMA 5I0CA 4KOUA 3UY5A 3MGDA 4CYQA 1K4JA 1S7NA 4JXQA 2G3TA 5FVJA 3BLNA 3S6KA 2GIVA 3E0KA 2A4NA 1QSMA 1MJBA 4MJ8A 2Z11A 3NE7A 2WSAA 4UFXA 3FB3A 2FE7A 3PP9A 2Z10A 4KLWA 3QAHA 3JVNA 3A9LA 5F46A 2VI7A 1PUAA 4UCPA 5KTDA 1QSRA 3S6HA 4U9YA 4KOVA 2HV2A 2VZYA 3SHPA 3SXOA 2ZW4A 1I12A 4QB9A 1QSOA 5C88A 2Q4VA 2EVNA 3LD2A 1Y9KA 2DPSA 4R9MA 2PC1A 2OZUA 3EC4A 2CNMA 3CXPA 2P6GA 4KZTA 4DNCA 4CRYB 3T9YA 4MFLA 1YX0A 3DR8A 4KOXA 4CS0B 4KOSA 3R9FA 4CAWA 2G3AA 2FIAA 4J3GA 5ISVA 1VKCA 4HKFA 4PV6A 4B5OA 2B5GB 4JD6A 5A28A 2HQYA 5G21A 4B10A 1PU9A 4ZBGA 5G22A 4MFPA 3IWGA 1Q2YA 4KLVA 2B3VA 4QBJA 3PGPA 1WK4A 4KORA 1V0CA 2R98A 5C82A 4F0XA 5HH1A 2Z0ZA 3VWDA 2J8NA 1B87A 2B5GA 4L8AA 4II9A 4JXRA 4KVXA 4MFJA 1CM0A 3K9UA 5JQ4A 3IGRA 4B11A 4XPDB 3FRMA 4B12A 4EVYA 2I79A 4H6UA 1S7FA 5F49A 4KSAA 4CGPA 3I9SA 5E96A 1RO5A 2FIWA 1M44A 3LODA 1I1DA 2P6FA 1J4JA 1Z4RA 4K30A 4KVME 3R1KA 4KOYA 4CGLA 5AG7A 1MK4A 4B13A 2YNEA 1WWZA 1S7KA 4ORFA 2Z3LA 1S3ZA 3GY9A 4YFJA 4R57A 4XPKA 2O28A 2OZHA 1IYKA 1M4DA 2PR1A 2F5IA 5BWAB 4YRHA 2FXFA 2VZZA 4ONUA 4NEXA 4GS4A 2VBQA 4FD6A 3TFYA 1S5KA 1R57A 2J8MA 4R87A 2Q7BA 4A30A 4FD7A 4XPLA 4QUSA 2OH1A 2AJ6A 1L0CA 4H6ZA 3R95A 3C26A 4HNXB 3F5BA 3TT2A 4PSXA 1KUYA 3R9GA 4MBUA 4A32A 2YNCA 3KKWA 3H5ZA 4KUBA 4B5PB 1LRZA 5H86A 2Q0YA 1YK3A 1XMTA 1U6MA 1Z4EA 4NXYA 3W6SA 2B3UA 4Y49C 2ZW7A 4UCNA 3S6FA 3TO7A 2ATRA 4UWIA 2H5MA 4RS2A 2WPXA 5G1ZA 2ZW6A 4AG9A 4UA3A 4B5PA 5AG5A 3D2PA 3T90A 2QIRA 1IYLA 4JJXA 4ZGYB 3R96A 1NSLA 2CNTA 2B4DA 2JDDA 2VEZA 4MFKA 4F0YA 3N7ZA 5CNPA 4HNWB 3ZZIA 2ZXVA 4CYNA 2DXQA 4BBHA 3H4QA 1S60A 4NCZA 2HUZA 1VHSA 3F0AA 4UFVA 4CAVA 3EO4A 3PZJA 4XNHC 3VWEA 1M4GA 3GKRA 2B58A 1NE9A 3G3SA 3SXNA 4CYOA 2REFA 1Q2CA 4CAEA 1GHEA 4A2ZA 1XE4A 4KOWA 4AG7A 5DWMA 1FY7A 4QVTA 4MY0A 2Z3PA 3TCVA 4RI1A 5F48A 1XF8A 3D3SA 4NF1A 4BMHA 3D2MA 5DWNA 4M85A 1SQHA 3FIXA 4YGOA 4MY3A 2BUEA 4E2AA 3CXQA 2CNSA 2ZW5A 2BEIA 2VQYA 2JEVA 2PR8A 5AG6A 4KVOE 4B14A 4C7IA 5JPHA 5J8CA 1OZPA 1XEBA 5GCNA 2KCWA 5H84A 5IV0A 2DPTA 4AB7A 5KTAA 4OLLA 4MHDA 4UCMA 1P0HA 2PDOA 4QC6A 4UWJA 3I3GA 4IUSA 3CXSA 3DSBA 4MI4A 2PSWA 4HNYB 3W6XA 4AVBA 2PRBA 2R8VA 4R3LA 5KTCA 4C7HA 2I00A 2REEA 1IICA 1YVOA 1UFHA 2Z3NA 4C68A 1Z9UA 1IIDA 1KZFA 4LUAA 3ZJ0A 2Y0MA 5AGEA 4KOTA 3DDDA 3BJ7A 3BJ8A 3B8GA 2C27A 2OU2A 1ZO0A 4OAEA 4E0AA 2J8RA 2IL4A 2FT0A 2FSRA 2X7BA 5IX3A 1Y7RA 1BO4A 4IF5A 3RYOA 4A31A 2WPWA 2OZGA 2B4DB 2FCKA 4XPDC 3IU2A 3TTHA 1TIQA 2P6EA 2VXKA 2B4BA 5EBVA 1YR0A 2WUUA 3P2FA 4H89A 4A95A 1I21A 1XIXA 4KSFA 1YVKA 2YNDA 2R7HA 2FS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2Z A;  4C7H A;  5A27 A;  4UCP A;  4A31 A;  2YNC C;  4A30 A;  4C68 A;  4CGL A;  5AG7 A;  4UCM A;  4B13 A;  4C2Z A;  3IWE A;  4CYQ A;  4CYN A;  2YNE A;  4CYO A;  3JTK A;  4BBH A;  4CYP A;  4C2X A;  4UCN A;  4B11 A;  4CGO A;  5AGE A;  3IU2 A;  4UFV A;  4B12 A;  4UFW A;  5A28 A;  5AG4 A;  4CGM A;  5G21 A;  5G1Z A;  4CGP A;  4CGN A;  2WSA A;  5AG5 A;  4A32 A;  4A33 A;  3IU1 A;  4UFX A;  5AG6 A;  4A95 A;  4B10 A;  4CAF A;  2YNC A;  4B14 A;  4C7I A;  4CAE A;  5G22 A;  4C2Y A;  2YND A;  3H5Z A;  2WUU A;  5G20 A; 
#chains in the Genus database with same CATH topology
 4LX9 A;  2EWB A;  4A94 A;  3DR6 A;  5LRK A;  2GAN A;  1F57 A;  2R1I A;  2GE3 A;  4JWP A;  3EXN A;  4X5K A;  3B3W A;  3QNV A;  4R3K A;  3DNS A;  1ARM A;  3GB0 A;  1YLE A;  4KUA A;  1HDU A;  4L89 A;  4X2T A;  3WAB A;  3KQZ A;  2YGW A;  1TKF A;  2G9D A;  4FWU A;  3FBU A;  3FYN A;  2CXA A;  2WZN A;  2AE6 A;  3V8I A;  1H8L A;  4FD5 A;  2JBK A;  5HMN A;  2Q51 A;  2PVV A;  4UBR A;  1LCP A;  4KS9 A;  4NGS A;  1XJO A;  5IB0 A;  2PIZ A;  4P4J A;  1YW4 A;  1JQG A;  3IU1 A;  2PJ0 A;  3GYA A;  4R8F A;  1RXT A;  4P44 A;  4C2Y A;  2PCU A;  1YRE A;  1PCA A;  2QML A;  4OAD A;  4R6T A;  3FXT A;  3D8P A;  2YNC C;  2Z3K A;  3SI1 A;  3V38 A;  1QST A;  2WYR A;  2HB6 A;  1ARL A;  2Z3O A;  3MRU A;  3TE4 A;  2ODF A;  3DGV A;  2Q44 A;  3R9E A;  2V8V A;  1NMT A;  1XRY A;  5ELY A;  4CAX A;  4OME A;  4E8O A;  2Q4Y A;  5HXD A;  2BL1 A;  2Q04 A;  4UEF A;  1AYE A;  1P4N A;  1YGH A;  1M1D A;  1KUV A;  1EE3 P;  3B35 A;  1OBR A;  4MFQ A;  3B3T A;  4CGN A;  4A33 A;  2AFU A;  2AFX A;  1HEE A;  4PSW A;  4H2K A;  4I49 A;  1Y7E A;  1B6B A;  2QEC A;  2Z3M A;  1ZLH A;  4Q36 A;  3TOB A;  1JWQ A;  3QB8 A;  4P6Y A;  3D7D A;  1QMU A;  3B7I A;  3TOA A;  1CX8 A;  4PPZ A;  2RC4 A;  3TO9 A;  4PQA A;  2ARH A;  4JZ0 A;  3TO6 A;  3WR7 A;  3JTK A;  4PK3 A;  4Y49 B;  1QSN A;  3EY5 A;  4F6A A;  4C2X A;  3BI1 A;  4CGO A;  5EC4 A;  1Q2D A;  4AVA A;  4YU9 A;  4UFW A;  2D4P A;  3P2H A;  3S6G A;  4A39 A;  1M4I A;  1MJA A;  2D4O A;  4MHP A;  1MJ9 A;  1Z5R A;  4FD4 A;  1TKJ A;  4M3S A;  5D29 A;  2NMT A;  1N71 A;  2BSW A;  5J8F A;  5F47 A;  1CJW A;  4OC3 A;  1S7L A;  4U5Y A;  2JDC A;  3RO0 A;  4CAF A;  3B3S A;  3S9M A;  3S9L A;  1VHE A;  4B6Z A;  4U9Z A;  1Y9W A;  1ON0 A;  3SI0 A;  3FNC A;  1IB1 E;  4NGP A;  3SJE A;  3F8K A;  3KR4 A;  2OB0 A;  3D7H A;  4MFZ A;  3KAS A;  4EME A;  4WJB A;  3GIU A;  4C2Z A;  2CY2 A;  3IWE A;  1CPX A;  2GU2 A;  3JUW A;  4OC1 A;  1ELL P;  3KL9 A;  3OWC A;  2BOA A;  2ZPA A;  2EUI A;  2QVP A;  4CYP A;  3NFZ A;  4CRZ B;  4XNH B;  4Q38 A;  5AG4 A;  4PK2 A;  1KWM A;  2G0B A;  4CGM A;  1GYT A;  2IJZ A;  1KUX A;  2P0W A;  3G8W A;  3EFA A;  2ZEF A;  4JLY A;  3W91 A;  3PEI A;  4MRI A;  4G1P A;  1R43 A;  2K5T A;  2GFQ A;  2PQ8 A;  2POK A;  4NSQ A;  5G20 A;  1RTQ A;  4AVC A;  2V8G A;  5F09 A;  5JM6 A;  2FL4 A;  1BOB A;  5A27 A;  2JLM A;  5DS0 A;  1Z8T A;  3SJG A;  5I0C A;  2XEI A;  2PJC A;  4KOU A;  3UY5 A;  1IU8 A;  3MGD A;  4CYQ A;  1K4J A;  1S7N A;  4JXQ A;  2G3T A;  3FH4 A;  5FVJ A;  4MXU A;  3TX8 A;  3BLN A;  4Q7A A;  3S6K A;  2GIV A;  3E0K A;  8CPA A;  5LRJ A;  2A4N A;  1QSM A;  3V7Z A;  1MJB A;  1F2P A;  4PXC A;  3VH9 A;  4MJ8 A;  2Z11 A;  4OP4 A;  3NE7 A;  2WSA A;  1Z8W A;  4UFX A;  3FB3 A;  2FE7 A;  5CBM A;  1LOK A;  3PP9 A;  3NA6 A;  4MHY A;  2Z10 A;  4KLW A;  3RBU A;  3NH5 A;  2PJ4 A;  2J9A A;  3JVN A;  3K2K A;  3QAH A;  3KGQ A;  3A9L A;  5F46 A;  2VI7 A;  1PUA A;  1TXR A;  4UCP A;  5KTD A;  1XMB A;  1QSR A;  3FF3 A;  1CG2 A;  3S6H A;  4U9Y A;  2AFM A;  4KOV A;  2HV2 A;  5K8O A;  2VZY A;  3SHP A;  3SXO A;  2ZW4 A;  1I12 A;  4YWY A;  4QB9 A;  1QSO A;  3MN8 A;  4UF4 A;  5C88 A;  2Q4V A;  2EVN A;  3LD2 A;  1Y9K A;  4X3R A;  2DPS A;  4R9M A;  3RZA A;  3RNZ A;  4BD9 A;  2PC1 A;  2OZU A;  1Q7L A;  2PJ3 A;  3EC4 A;  1UWY A;  2AFS A;  3PB9 X;  2CNM A;  4A37 A;  3CXP A;  2P6G A;  4KZT A;  2AFO A;  3S9N A;  4DNC A;  3PB8 X;  3T9Y A;  4CRY B;  2ZOG A;  4OC5 A;  4MFL A;  4ZY2 A;  1YX0 A;  3DR8 A;  3PB4 X;  4KOX A;  5LRG A;  4CS0 B;  4KOS A;  4RN7 A;  5LYD A;  3R9F A;  2G3A A;  4CAW A;  2FIA A;  3KR5 A;  4J3G A;  4OC2 A;  5ISV A;  1VHO A;  3PFO A;  5LYF A;  2V77 A;  4ONW A;  1VKC A;  3WC6 A;  1TF9 A;  4HKF A;  4PV6 A;  2ZEE A;  4B5O A;  2XEG A;  3IC1 A;  2PJ7 A;  2B5G B;  4JD6 A;  5A28 A;  2HQY A;  3H8F A;  3FVL A;  5G21 A;  1AMP A;  4UEZ A;  5HVG A;  2I3C A;  4MCS A;  3T8W A;  2FVG A;  1AUG A;  4B10 A;  5JGF A;  3PBE A;  1PU9 A;  2ZEP A;  4ZBG A;  5G22 A;  4MFP A;  3IWG A;  1Q2Y A;  4KLV A;  2B3V A;  3DLJ A;  4QBJ A;  4LQ6 A;  3PGP A;  1WK4 A;  4KOR A;  4W9Y A;  4ZYQ A;  1V0C A;  2R98 A;  5C82 A;  4F0X A;  5HH1 A;  1YSJ A;  2Z0Z A;  3D7G A;  3IEH A;  2GLF A;  4PXB A;  3VWD A;  2ANP A;  1VIX A;  2EK9 A;  3FX6 A;  2J8N A;  2R7H A;  2B5G A;  4L8A A;  1DE4 C;  4II9 A;  4JXR A;  4KVX A;  2ZEH A;  4MFJ A;  1CM0 A;  3K9U A;  4OC4 A;  5JQ4 A;  1ELM P;  3IGR A;  4B11 A;  4XPD B;  3IFE A;  1TKH A;  3FRM A;  4B12 A;  1X12 A;  4JYW A;  4EVY A;  2I79 A;  4H6U A;  1S7F A;  3HUV A;  5F49 A;  4KSA A;  4MCP A;  4CGP A;  1CBX A;  4PXD A;  3I9S A;  5E96 A;  2PIY A;  1RO5 A;  2FIW A;  1M44 A;  1IY7 A;  1Z8L A;  3LAC A;  3ISZ A;  3LOD A;  4DJL A;  4R7M A;  1I1D A;  2P6F A;  1J4J A;  3CT9 A;  4K3N A;  4NGT A;  1Z4R A;  4K30 A;  3IO1 A;  4KVM E;  3CPX A;  5K8P A;  3R1K A;  3NE8 A;  4KOY A;  4CGL A;  5AG7 A;  5K8M A;  1MK4 A;  4B13 A;  3D68 A;  2YNE A;  1CP6 A;  3CZX A;  1WWZ A;  1S7K A;  4ORF A;  4LQG A;  2Z3L A;  1S3Z A;  3GY9 A;  4M6H A;  4FAI A;  4YFJ A;  4R57 A;  4XPK A;  4PXE A;  2O28 A;  4NJQ A;  2OZH A;  2PJ6 A;  4ZI6 A;  1IYK A;  1M4D A;  4UEE A;  4P4E A;  2QYV A;  2C6C A;  2PR1 A;  2ZEO A;  4EWT A;  2F5I A;  5HVF A;  5BWA B;  3CPA A;  3NH4 A;  4YRH A;  5J1Q A;  2FXF A;  2VZZ A;  4ONU A;  4OKO A;  4NEX A;  3D7F A;  4UIB A;  4GS4 A;  1CP7 A;  2VBQ A;  4NGQ A;  4FD6 A;  1PYT B;  3TFY A;  1S5K A;  1R57 A;  2J8M A;  4R87 A;  2VL1 A;  2Q7B A;  4A30 A;  4FD7 A;  1X10 A;  3D67 A;  3B3C A;  4XPL A;  4QUS A;  2OH1 A;  2AJ6 A;  2XEJ A;  1TF8 A;  1DTD A;  1L0C A;  4H6Z A;  4ZX9 A;  5I4M A;  4TNU A;  4MHZ A;  3R95 A;  3C26 A;  4HNX B;  3F5B A;  1IOF A;  5D8N A;  4FBE A;  3TT2 A;  2C1C A;  4PSX A;  1KUY A;  2GRE A;  2ABZ A;  1FNO A;  4MBU A;  3R9G A;  4A32 A;  4BIN A;  2YNC A;  4ZX8 A;  3IIB A;  3KKW A;  4KSI A;  3H5Z A;  4KUB A;  1ZLI A;  1ZG8 A;  2PJA A;  4B5P B;  1LRZ A;  5H86 A;  2Q0Y A;  1YK3 A;  1XMT A;  3WT4 A;  1U6M A;  5JH9 A;  4MCQ A;  2ZOF A;  1Z4E A;  4NXY A;  1IOI A;  1IGB A;  3W6S A;  1F2O A;  2B3U A;  2EBJ A;  1Y0Y A;  4M6I A;  4F8Z A;  4Y49 C;  3VAR A;  2ZW7 A;  4P4F A;  4UCN A;  3S6F A;  3TO7 A;  2GLJ A;  4A38 A;  2ATR A;  3B2Y A;  4UWI A;  5IB9 A;  3WC7 A;  2Q43 A;  5K8N A;  2H5M A;  4RS2 A;  2WPX A;  3CDX A;  5G1Z A;  2ZW6 A;  2NSM A;  4AG9 A;  2CF4 A;  2PRQ A;  4UA3 A;  4B5P A;  3RAM A;  5AG5 A;  1XBU A;  3D2P A;  2QIR A;  1IYL A;  4JJX A;  1R3N A;  3R96 A;  3T90 A;  4OID A;  4ZGY B;  4M6G A;  1YME A;  5THW A;  1NSL A;  2BO9 A;  2CNT A;  2B4D A;  2JDD A;  2VEZ A;  4OIW A;  4MFK A;  4F0Y A;  2O4H A;  2ZEL A;  3N7Z A;  2ZEM A;  3I1U A;  4HNW B;  5CNP A;  4EFD A;  2ZEG A;  4Z65 A;  1HDQ A;  3BXM A;  3LMS A;  2NYQ A;  1LAP A;  3QAY A;  3PBB A;  3ZZI A;  2ZXV A;  4CYN A;  3PFE A;  2CTC A;  2DXQ A;  4BBH A;  3H4Q A;  1S60 A;  3B3V A;  4NCZ A;  2HUZ A;  1VHS A;  2EO8 A;  2IQ6 A;  3F0A A;  4UFV A;  2PJ8 A;  3EO4 A;  1QQ9 A;  3PZJ A;  4CAV A;  4F9U A;  4XNH C;  3VWE A;  1M4G A;  2PJ1 A;  3GKR A;  3GLJ A;  2EK8 A;  2B58 A;  1NE9 A;  3D66 A;  5HVH A;  3G3S A;  3SXN A;  4CYO A;  2REF A;  1Q2C A;  4CAE A;  4X8I A;  1VGY A;  4NGR A;  1XFO A;  1GHE A;  2DEA A;  3KQX A;  2PVW A;  4A2Z A;  1XE4 A;  4KOW A;  3KI9 A;  4AG7 A;  5DWM A;  4GM5 A;  2JBJ A;  2ZED A;  1FY7 A;  4QVT A;  4MY0 A;  2C6G A;  2F7V A;  2Z3P A;  3FJU A;  3TCV A;  4P4I A;  4RI1 A;  5F48 A;  1XF8 A;  3D3S A;  4NF1 A;  2Q7S A;  1Y0R A;  4BMH A;  5LYL A;  3D2M A;  5DWN A;  4M85 A;  1SQH A;  3FIX A;  4YGO A;  1ZG7 A;  4MY3 A;  3BI0 A;  4AXV A;  4P10 A;  2BUE A;  4E2A A;  3CXQ A;  2CNS A;  4OC0 A;  2ZW5 A;  2BEI A;  2VQY A;  2JEV A;  2PR8 A;  4P45 A;  5AG6 A;  2PE3 A;  1YQE A;  3FED A;  4KVO E;  4B14 A;  3HLP A;  4C7I A;  4P4D A;  3PB6 X;  6CPA A;  5JPH A;  5J8C A;  4HPS A;  1OZP A;  4CPA A;  3LWU A;  1XEB A;  1XOV A;  1M4L A;  5GCN A;  1LAN A;  3SJX A;  2KCW A;  1LFW A;  3IWW A;  5H84 A;  5IV0 A;  2DPT A;  2OOT A;  2Q4Z A;  2AFZ A;  4AB7 A;  5KTA A;  2F8H A;  1BPN A;  4MHD A;  4OLL A;  4UCM A;  2HC9 A;  1P0H A;  3NH8 A;  2C6P A;  3L2N A;  2PDO A;  2CIJ A;  3TC8 A;  3JRU A;  2OR4 A;  3FEE A;  2V8D A;  4QC6 A;  4UWJ A;  3I3G A;  3KHX A;  2O53 A;  4IUS A;  3CXS A;  4MHN A;  1A2Z A;  3DSB A;  4MI4 A;  3H8E A;  1ZG9 A;  1YW6 A;  2PSW A;  4HNY B;  5CPA A;  3W6X A;  4AVB A;  3PRT A;  2PRB A;  2R8V A;  1BLL E;  4R3L A;  4F9V A;  5LYI A;  4ZY0 A;  4R76 A;  3D4U A;  5KTC A;  3KZW A;  4IK2 A;  4C7H A;  2I00 A;  4NJR A;  2REE A;  1NSA A;  4ZY1 A;  1IIC A;  1YVO A;  1UFH A;  4DUK A;  1CPS A;  2Z3N A;  4C68 A;  2PJ2 A;  1BPM A;  1Z9U A;  2AFW A;  1Z2L A;  1IID A;  3BHX A;  1KZF A;  3SJF A;  4NGN A;  3IJ3 A;  4LUA A;  3ZJ0 A;  2Y0M A;  5AGE A;  3GUX A;  4KOT A;  2PJB A;  2RB7 A;  3DDD A;  3BJ7 A;  3BJ8 A;  3B8G A;  3K9T A;  4IAV A;  4MMO A;  2C27 A;  4UIA A;  4FUU A;  2OU2 A;  1ZO0 A;  4OAE A;  4E0A A;  1LAM A;  2J8R A;  2DF5 A;  4P4B A;  2PJ5 A;  7CPA A;  2CTB A;  2IL4 A;  3ISX A;  2FT0 A;  2FSR A;  2X7B A;  3SI2 A;  5IX3 A;  3PB7 X;  1Y7R A;  1YLO A;  1BO4 A;  4TWE A;  4IF5 A;  3RYO A;  2QJ8 A;  4A31 A;  2WPW A;  3FMC A;  4DYO A;  2OZG A;  3N5F A;  2PJ9 A;  3FEC A;  4NFR A;  4NGM A;  2B4D B;  2FCK A;  3KHZ A;  3WC5 A;  2BCO A;  2ZEN A;  1Z8X A;  2IMO A;  2JEW A;  4IHM A;  4O23 A;  3IU2 A;  4WWV A;  4XPD C;  5EMI A;  3TTH A;  2RFH A;  1TIQ A;  4MCR A;  2V8H A;  2P6E A;  4RUH A;  2VXK A;  2B4B A;  3H8G A;  1YR0 A;  5EBV A;  1BAV A;  2WUU A;  3P2F A;  4H89 A;  4A95 A;  1I21 A;  1XIX A;  4KSF A;  4GXH A;  1YVK A;  3VAT A;  1FT7 A;  2YND A;  1B87 A;  2XEF A;  2FS5 A; 
#chains in the Genus database with same CATH homology
 4LX9 A;  3DR6 A;  2GAN A;  2R1I A;  2GE3 A;  4JWP A;  3EXN A;  4X5K A;  4R3K A;  3DNS A;  1YLE A;  4KUA A;  4L89 A;  2YGW A;  3FBU A;  3FYN A;  2CXA A;  2AE6 A;  3V8I A;  4FD5 A;  5HMN A;  4UBR A;  4KS9 A;  5IB0 A;  3IU1 A;  3GYA A;  1RXT A;  4C2Y A;  1YRE A;  2QML A;  4OAD A;  3FXT A;  3D8P A;  2YNC C;  2Z3K A;  1QST A;  2Z3O A;  3TE4 A;  2Q44 A;  3R9E A;  1NMT A;  4CAX A;  4E8O A;  2Q4Y A;  2BL1 A;  2Q04 A;  1P4N A;  1YGH A;  1M1D A;  1KUV A;  4MFQ A;  4CGN A;  4A33 A;  4PSW A;  4I49 A;  1B6B A;  2QEC A;  2Z3M A;  4Q36 A;  3TOB A;  3QB8 A;  3TOA A;  2RC4 A;  3TO9 A;  2ARH A;  3TO6 A;  3WR7 A;  3JTK A;  4PK3 A;  4Y49 B;  1QSN A;  3EY5 A;  4F6A A;  4C2X A;  4CGO A;  5EC4 A;  1Q2D A;  4AVA A;  4UFW A;  2D4P A;  3P2H A;  3S6G A;  1M4I A;  1MJA A;  2D4O A;  1MJ9 A;  4FD4 A;  4M3S A;  2NMT A;  1N71 A;  2BSW A;  5J8F A;  5F47 A;  1CJW A;  1S7L A;  4U5Y A;  2JDC A;  4CAF A;  4U9Z A;  1Y9W A;  1ON0 A;  3FNC A;  1IB1 E;  3F8K A;  2OB0 A;  4MFZ A;  4C2Z A;  2CY2 A;  3IWE A;  3JUW A;  4CYP A;  3OWC A;  2ZPA A;  2EUI A;  4CRZ B;  4XNH B;  4Q38 A;  5AG4 A;  4PK2 A;  2G0B A;  4CGM A;  1KUX A;  2P0W A;  3G8W A;  3EFA A;  4JLY A;  3W91 A;  2K5T A;  2PQ8 A;  4NSQ A;  5G20 A;  4AVC A;  2FL4 A;  1BOB A;  5A27 A;  2JLM A;  5I0C A;  4KOU A;  3UY5 A;  3MGD A;  4CYQ A;  1K4J A;  1S7N A;  4JXQ A;  2G3T A;  5FVJ A;  3BLN A;  3S6K A;  2GIV A;  3E0K A;  2A4N A;  1QSM A;  1MJB A;  4MJ8 A;  2Z11 A;  3NE7 A;  2WSA A;  4UFX A;  3FB3 A;  2FE7 A;  3PP9 A;  2Z10 A;  4KLW A;  3QAH A;  3JVN A;  3A9L A;  5F46 A;  2VI7 A;  1PUA A;  4UCP A;  5KTD A;  1QSR A;  3S6H A;  4U9Y A;  4KOV A;  2HV2 A;  2VZY A;  3SHP A;  3SXO A;  2ZW4 A;  1I12 A;  4QB9 A;  1QSO A;  5C88 A;  2Q4V A;  2EVN A;  3LD2 A;  1Y9K A;  2DPS A;  4R9M A;  2PC1 A;  2OZU A;  3EC4 A;  2CNM A;  3CXP A;  2P6G A;  4KZT A;  4DNC A;  4CRY B;  3T9Y A;  4MFL A;  1YX0 A;  3DR8 A;  4KOX A;  4CS0 B;  4KOS A;  3R9F A;  4CAW A;  2G3A A;  2FIA A;  4J3G A;  5ISV A;  1VKC A;  4HKF A;  4PV6 A;  4B5O A;  2B5G B;  4JD6 A;  5A28 A;  2HQY A;  5G21 A;  4B10 A;  1PU9 A;  4ZBG A;  5G22 A;  4MFP A;  3IWG A;  1Q2Y A;  4KLV A;  2B3V A;  4QBJ A;  3PGP A;  1WK4 A;  4KOR A;  1V0C A;  2R98 A;  5C82 A;  4F0X A;  5HH1 A;  2Z0Z A;  3VWD A;  2J8N A;  1B87 A;  2B5G A;  4L8A A;  4II9 A;  4JXR A;  4KVX A;  4MFJ A;  1CM0 A;  3K9U A;  5JQ4 A;  3IGR A;  4B11 A;  4XPD B;  3FRM A;  4B12 A;  4EVY A;  2I79 A;  4H6U A;  1S7F A;  5F49 A;  4KSA A;  4CGP A;  3I9S A;  5E96 A;  1RO5 A;  2FIW A;  1M44 A;  3LOD A;  1I1D A;  2P6F A;  1J4J A;  1Z4R A;  4K30 A;  4KVM E;  3R1K A;  4KOY A;  4CGL A;  5AG7 A;  1MK4 A;  4B13 A;  2YNE A;  1WWZ A;  1S7K A;  4ORF A;  2Z3L A;  1S3Z A;  3GY9 A;  4YFJ A;  4R57 A;  4XPK A;  2O28 A;  2OZH A;  1IYK A;  1M4D A;  2PR1 A;  2F5I A;  5BWA B;  4YRH A;  2FXF A;  2VZZ A;  4ONU A;  4NEX A;  4GS4 A;  2VBQ A;  4FD6 A;  3TFY A;  1S5K A;  1R57 A;  2J8M A;  4R87 A;  2Q7B A;  4A30 A;  4FD7 A;  4XPL A;  4QUS A;  2OH1 A;  2AJ6 A;  1L0C A;  4H6Z A;  3R95 A;  3C26 A;  4HNX B;  3F5B A;  3TT2 A;  4PSX A;  1KUY A;  3R9G A;  4MBU A;  4A32 A;  2YNC A;  3KKW A;  3H5Z A;  4KUB A;  4B5P B;  1LRZ A;  5H86 A;  2Q0Y A;  1YK3 A;  1XMT A;  1U6M A;  1Z4E A;  4NXY A;  3W6S A;  2B3U A;  4Y49 C;  2ZW7 A;  4UCN A;  3S6F A;  3TO7 A;  2ATR A;  4UWI A;  2H5M A;  4RS2 A;  2WPX A;  5G1Z A;  2ZW6 A;  4AG9 A;  4UA3 A;  4B5P A;  5AG5 A;  3D2P A;  3T90 A;  2QIR A;  1IYL A;  4JJX A;  4ZGY B;  3R96 A;  1NSL A;  2CNT A;  2B4D A;  2JDD A;  2VEZ A;  4MFK A;  4F0Y A;  3N7Z A;  5CNP A;  4HNW B;  3ZZI A;  2ZXV A;  4CYN A;  2DXQ A;  4BBH A;  3H4Q A;  1S60 A;  4NCZ A;  2HUZ A;  1VHS A;  3F0A A;  4UFV A;  4CAV A;  3EO4 A;  3PZJ A;  4XNH C;  3VWE A;  1M4G A;  3GKR A;  2B58 A;  1NE9 A;  3G3S A;  3SXN A;  4CYO A;  2REF A;  1Q2C A;  4CAE A;  1GHE A;  4A2Z A;  1XE4 A;  4KOW A;  4AG7 A;  5DWM A;  1FY7 A;  4QVT A;  4MY0 A;  2Z3P A;  3TCV A;  4RI1 A;  5F48 A;  1XF8 A;  3D3S A;  4NF1 A;  4BMH A;  3D2M A;  5DWN A;  4M85 A;  1SQH A;  3FIX A;  4YGO A;  4MY3 A;  2BUE A;  4E2A A;  3CXQ A;  2CNS A;  2ZW5 A;  2BEI A;  2VQY A;  2JEV A;  2PR8 A;  5AG6 A;  4KVO E;  4B14 A;  4C7I A;  5JPH A;  5J8C A;  1OZP A;  1XEB A;  5GCN A;  2KCW A;  5H84 A;  5IV0 A;  2DPT A;  4AB7 A;  5KTA A;  4OLL A;  4MHD A;  4UCM A;  1P0H A;  2PDO A;  4QC6 A;  4UWJ A;  3I3G A;  4IUS A;  3CXS A;  3DSB A;  4MI4 A;  2PSW A;  4HNY B;  3W6X A;  4AVB A;  2PRB A;  2R8V A;  4R3L A;  5KTC A;  4C7H A;  2I00 A;  2REE A;  1IIC A;  1YVO A;  1UFH A;  2Z3N A;  4C68 A;  1Z9U A;  1IID A;  1KZF A;  4LUA A;  3ZJ0 A;  2Y0M A;  5AGE A;  4KOT A;  3DDD A;  3BJ7 A;  3BJ8 A;  3B8G A;  2C27 A;  2OU2 A;  1ZO0 A;  4OAE A;  4E0A A;  2J8R A;  2IL4 A;  2FT0 A;  2FSR A;  2X7B A;  5IX3 A;  1Y7R A;  1BO4 A;  4IF5 A;  3RYO A;  4A31 A;  2WPW A;  2OZG A;  2B4D B;  2FCK A;  4XPD C;  3IU2 A;  3TTH A;  1TIQ A;  2P6E A;  2VXK A;  2B4B A;  5EBV A;  1YR0 A;  2WUU A;  3P2F A;  4H89 A;  4A95 A;  1I21 A;  1XIX A;  4KSF A;  1YVK A;  2YND A;  2R7H A;  2FS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...