2YNCA

Plasmodium vivax n-myristoyltransferase in complex with ync12-coa thioester.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
384
structure length
384
Chain Sequence
DYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Validation of N-Myristoyltransferase as an Antimalarial Drug Target Using an Integrated Chemical Biology Approach.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 117
structure length 384
sequence length 384
chains with identical sequence B
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2yncA00
4A31A 3H5ZA 4A30A 4C2ZA 4CAFA 3IU2A 5G21A 2YNEA 4C7IA 4UCNA 4A2ZA 4BBHA 4UCPA 4B12A 3IU1A 5G22A 4A33A 4CYOA 4C2XA 4UFWA 4B10A 3IWEA 3JTKA 4UFXA 4A32A 4CGOA 4CYQA 4CGLA 5G1ZA 4CGNA 2YNDA 5AG6A 4C2YA 4CGPA 5AG4A 5A27A 4B11A 4A95A 4B14A 5AGEA 4CYNA 4CYPA 2WUUA 2WSAA 2YNCA 5G20A 4B13A 4C7HA 4CGMA 2YNCC 4C68A 5A28A 4CAEA 5AG7A 4UFVA 5AG5A 4UCMA
chains in the Genus database with same CATH superfamily
4K3NA 4O23A 3R96A 2AFXA 4F9VA 4OIWA 1PYTB 5F48A 1IB1E 4X5KA 4UCPA 2BO9A 4UEEA 5K8PA 2PRQA 1WWZA 1LCPA 3K2KA 3BHXA 1KUVA 2EUIA 3SJFA 3FXTA 1L0CA 2J8RA 1Y0RA 1CJWA 1VHSA 2Y0MA 2FL4A 1ZG7A 1Y9WA 4JLYA 4WJBA 2QJ8A 4ZY1A 1KUXA 3ISZA 1V0CA 4A95A 1YREA 3F8KA 4JYWA 4OC3A 2Q4YA 1ZLIA 2ZEFA 2X7BA 3TO7A 2ARHA 5LRKA 1MK4A 1PUAA 1LRZA 1XMBA 5J8CA 4CAEA 3LD2A 5AG5A 2CNTA 4MHZA 5BWAB 4XPDC 1KWMA 2Q51A 1M4IA 1GHEA 4UIBA 3S6FA 4BMHA 5G21A 1VKCA 3TC8A 4C2ZA 4YFJA 4FD5A 2VEZA 2AFMA 4UEZA 2V8HA 1X10A 2PC1A 3BJ7A 3D67A 3IJ3A 3FJUA 4NGTA 5LYIA 3E0KA 3F0AA 4R6TA 3B3TA 1R3NA 5F46A 2Q4ZA 3KI9A 4CAXA 4CYQA 3WT4A 4CRZB 1XIXA 2AFWA 2HUZA 2OB0A 2G9DA 1TKFA 4BINA 4F6AA 4GS4A 3FBUA 3CDXA 4II9A 3B3VA 3VH9A 3H4QA 4P45A 1BLLE 5LYFA 3IC1A 2EVNA 4CAVA 2D4OA 1RXTA 5JH9A 2DPTA 5EC4A 4UEFA 1OZPA 3TOAA 3KR4A 4C68A 4QVTA 1R43A 3LACA 4NF1A 1GYTA 2VBQA 4NGSA 1Q2DA 2Q7SA 4PV6A 3S6KA 4FBEA 2FVGA 2OZGA 1RO5A 4EWTA 4GM5A 4AG9A 1P4NA 4UBRA 1CBXA 1BOBA 4ZBGA 2Q0YA 4MFKA 3WC7A 4MMOA 1XE4A 2R1IA 1IIDA 2VZZA 2OZUA 3B3WA 3DDDA 2I79A 2ZW7A 4MRIA 5GCNA 4HNXB 5AG6A 3WC5A 4EMEA 2Z3NA 2ZEMA 3FNCA 3FIXA 3B3SA 4AVCA 2GE3A 1B6BA 2B58A 4MFPA 4NJRA 3VWDA 4B14A 1I21A 1S60A 3S9MA 4OC2A 4MY3A 4AVBA 3PP9A 4M85A 4P4BA 3S9LA 2GFQA 1K4JA 2GLFA 3PB4X 4MCRA 3DGVA 4PK3A 2CTCA 3R95A 2PJ2A 1VHEA 4KOTA 2J9AA 4AXVA 2HB6A 4TWEA 4U9ZA 4ZX9A 3FRMA 4NEXA 1IICA 4IHMA 4KOVA 2AFZA 2BCOA 8CPAA 3QB8A 4CGNA 5JM6A 3T90A 2P6GA 5LRJA 3DR8A 5C82A 1MJBA 4ZGYB 3BI0A 5IX3A 2JLMA 3D7GA 2Q7BA 2PVVA 4RS2A 5LYDA 3TT2A 5CPAA 4Y49C 1VGYA 3B35A 2G3TA 4XNHC 3IWWA 4ZY0A 5THWA 4B5PA 1M4LA 5F09A 3PBBA 4CPAA 5K8OA 4CRYB 4RUHA 2HV2A 4R76A 4XPKA 2KCWA 4KSIA 2XEGA 3SXOA 2ZEEA 1Z5RA 2QMLA 2VZYA 2A4NA 3CT9A 4KLVA 4KVXA 3UY5A 3NH4A 3N7ZA 3JUWA 4IF5A 3R9GA 5D29A 1HEEA 2JDCA 4MHDA 4P4IA 5A27A 4MCQA 4DYOA 1XEBA 2PJ6A 5EBVA 3VWEA 5CBMA 3SJXA 1F2OA 1BPMA 2FCKA 2ZEOA 3DSBA 6CPAA 3GKRA 4I49A 2FS5A 1IOIA 5IV0A 3PFOA 4P10A 3MGDA 1FT7A 2WZNA 4P4JA 4A31A 3EY5A 1TF8A 4NGRA 3D2MA 4MI4A 2BUEA 3H8FA 1YLOA 5F49A 1Q2CA 2QECA 1BAVA 1Q2YA 3CXPA 4GXHA 3GY9A 3MN8A 7CPAA 2GIVA 5DS0A 5HXDA 2C27A 1M44A 1RTQA 3FMCA 3RO0A 4A32A 2ANPA 1DE4C 3CPAA 4AB7A 4FAIA 3JRUA 2GREA 1QSRA 2B3UA 3WABA 4CYPA 3D66A 4UWJA 4NJQA 3T8WA 4B13A 1FY7A 1HDQA 2CTBA 4KSFA 4E2AA 4KUAA 4HNWB 2P6FA 2QIRA 4JZ0A 3IFEA 3A9LA 4HPSA 4MFJA 4ORFA 3NA6A 5DWNA 4NGMA 2PIYA 1F57A 2ZELA 1ELLP 2AJ6A 1XFOA 2PJAA 2WYRA 3LODA 4OC4A 2Z3MA 2PJ7A 3D3SA 4OP4A 4CS0B 3R1KA 1EE3P 1M4DA 1QQ9A 3CPXA 3TFYA 5HVFA 3ZJ0A 3NH8A 3CXSA 4Q7AA 3S9NA 5JQ4A 2WSAA 4XPDB 4A38A 2ABZA 5K8MA 1LAMA 2PJ9A 2HQYA 2RFHA 4E8OA 3TE4A 2VI7A 4UCMA 4CAWA 1CP7A 2BSWA 4UA3A 3KKWA 5I0CA 1SQHA 3P2FA 1Z8XA 4PPZA 5KTDA 2F8HA 3G8WA 4JXQA 4MHYA 3GLJA 3H8EA 5HVHA 2ZXVA 1AYEA 5H84A 5KTAA 5IB0A 2ZW4A 1VIXA 2EK9A 4QB9A 1YW4A 1F2PA 1QSMA 4IAVA 4MJ8A 3DNSA 4R7MA 2BOAA 4TNUA 2PSWA 4KZTA 2POKA 4M3SA 3BLNA 4PSXA 2VQYA 2EK8A 3TTHA 2PQ8A 1Y0YA 3SI1A 3VARA 5JGFA 4ONUA 4EVYA 2RC4A 1I1DA 1R57A 3G3SA 3KQXA 4H89A 2F5IA 4OKOA 3S6HA 1XRYA 2J8MA 2OZHA 4MFQA 4ZX8A 2BEIA 1Z4RA 3K9TA 3B7IA 4MBUA 4DJLA 5AG7A 3I3GA 2XEIA 2EWBA 1M4GA 4M6HA 2Z3OA 5J1QA 2PR1A 2IMOA 4R8FA 4BBHA 5IB9A 3GIUA 4OLLA 4HKFA 3RYOA 5G22A 4NSQA 3B8GA 4OIDA 5C88A 4AG7A 4P44A 4OAEA 4RI1A 2B4DA 4NCZA 2HC9A 2JEVA 4CGLA 2CNSA 4X2TA 3FVLA 4M6GA 4KOYA 3HUVA 4DUKA 4FWUA 1U6MA 2V8DA 3BJ8A 2BL1A 4CYNA 1BPNA 5LRGA 2CIJA 1ZO0A 4EFDA 4OMEA 1BO4A 3I1UA 3QAHA 1CP6A 1YX0A 2Q04A 3FF3A 2AFOA 4NGPA 3SHPA 3VATA 4F9UA 1ARMA 2ATRA 3PB9X 4CAFA 4JD6A 4MFZA 4P4FA 1S7KA 3D2PA 3GB0A 3GUXA 2ZW6A 1TXRA 1Q7LA 2Z11A 2PJBA 1YQEA 1YVKA 3T9YA 1YR0A 2JDDA 1CM0A 2PJ5A 4XPLA 3RZAA 5G1ZA 2V8GA 3QAYA 2FE7A 2PJ1A 4ONWA 2REFA 3WR7A 4JJXA 4LUAA 1MJ9A 4IUSA 2PRBA 1Y7EA 4KVME 2R98A 1YMEA 3D68A 3PB6X 4H6ZA 2B5GB 3D7FA 3F5BA 3TCVA 3D7DA 2R7HA 4X8IA 1X12A 4B5PB 5I4MA 2Z3KA 3R9EA 4ZYQA 4P4DA 3IWGA 4K30A 4KS9A 1PU9A 3L2NA 2R8VA 4WWVA 4MY0A 1XOVA 3BXMA 1Y9KA 2Z3LA 3FB3A 4R3LA 4R9MA 2Z10A 3SJGA 1S5KA 2B4BA 4C2XA 1QSTA 2PE3A 1A2ZA 4QUSA 1MJAA 2ODFA 2ZEDA 1N71A 3PEIA 3PZJA 3KQZA 4A94A 4QC6A 1AUGA 1QSNA 2YNDA 3V8IA 2CXAA 2PJ3A 2J8NA 1PCAA 4MFLA 4KVOE 1Z8LA 2JBKA 1NSLA 3PBEA 3V7ZA 5AGEA 2PJ4A 1QMUA 3TX8A 3N5FA 5G20A 4H6UA 4AVAA 2NMTA 1J4JA 3FEDA 1YVOA 2DXQA 2V8VA 4PK2A 3KR5A 4ZI6A 1JQGA 4UFVA 2PVWA 2Z3PA 3PRTA 4LQ6A 3PGPA 4YU9A 4KOWA 2AFSA 3S6GA 1YW6A 1XF8A 4L8AA 2F7VA 2YNEA 4W9YA 5HVGA 4KLWA 2C1CA 3CXQA 1M1DA 2P0WA 1IU8A 2AFUA 2K5TA 3B3CA 3IO1A 3QNVA 1P0HA 2YGWA 2AE6A 1KZFA 2XEJA 1LOKA 1S3ZA 2PCUA 3CZXA 4A39A 1LAPA 1Z8WA 4Y49B 2RB7A 4PXDA 4B11A 1B87A 3IEHA 4F0YA 1NMTA 2WUUA 2EBJA 5EMIA 1LANA 4C7HA 4CGMA 3KHZA 2PJ8A 4NGQA 4BD9A 5ELYA 2I00A 1Y7RA 3EFAA 2OU2A 5JPHA 2NSMA 3H5ZA 1ON0A 2D4PA 2VL1A 2O28A 3EC4A 3I9SA 4FD6A 5DWMA 4FD4A 4A30A 1Z4EA 3BI1A 1ARLA 4HNYB 3FEEA 3KASA 2QYVA 2C6GA 3PB7X 4P6YA 4P4EA 3SI2A 1JWQA 4MHPA 3D8PA 3FECA 3TO6A 3MRUA 5E96A 4Z65A 1XMTA 2ZENA 1S7FA 3JTKA 2V77A 4JWPA 2ZPAA 1S7LA 2ZOGA 4R3KA 4C2YA 3DR6A 1NSAA 4MCSA 5CNPA 4YWYA 4CGPA 3K9UA 4OC1A 2DPSA 4Q36A 2FXFA 4F0XA 4KOXA 1WK4A 4RN7A 2PJ0A 5HH1A 4QBJA 1TF9A 2CF4A 2FSRA 2GANA 2PIZA 2WPXA 3NH5A 4KUBA 3W6SA 1CPSA 1YK3A 3KGQA 3KL9A 3LMSA 4JXRA 4Q38A 1CG2A 3IU2A 3TO9A 1ZG8A 2G3AA 2FIAA 4C7IA 2ZOFA 2ZEGA 4A2ZA 3ZZIA 4R57A 2B3VA 2C6PA 3EXNA 4YRHA 3OWCA 4PQAA 2DF5A 1XBUA 4NXYA 4A37A 4FD7A 2VXKA 4UFWA 4B10A 3IWEA 4PSWA 1IYLA 2IL4A 4NGNA 3NE7A 4PXCA 3EO4A 2NYQA 2B4DB 4G1PA 4KOUA 4OADA 3GYAA 1OBRA 3P2HA 1IGBA 4F8ZA 1VHOA 1TIQA 3H8GA 4OC5A 2OOTA 4IK2A 1TKJA 1UFHA 3FYNA 3HLPA 1IY7A 4MHNA 4B6ZA 3SXNA 4L89A 1YGHA 4YGOA 4FUUA 4H2KA 2REEA 3KZWA 3IGRA 5A28A 3W91A 2ZEPA 3D4UA 2Q44A 4NFRA 5FVJA 2I3CA 3ISXA 1LFWA 1FNOA 2C6CA 1CPXA 1CX8A 4LX9A 4UCNA 3JVNA 5HMNA 4XNHB 3PFEA 4CYOA 1I12A 4OC0A 4DNCA 1H8LA 4B5OA 4UFXA 4CGOA 3LWUA 2CY2A 3IIBA 4KSAA 2G0BA 2IJZA 5F47A 4LQGA 3V38A 5AG4A 1S7NA 5ISVA 2PR8A 2O4HA 4PXEA 3W6XA 4MCPA 2CNMA 2Z0ZA 3NFZA 4X3RA 1Z9UA 1ZLHA 3B2YA 2YNCA 4UIAA 5J8FA 4UF4A 1NE9A 2FT0A 3TOBA 1ZG9A 2QVPA 2DEAA 2PDOA 2YNCC 2FIWA 3KHXA 5H86A 4PXBA 4UWIA 2PJCA 4U5YA 5D8NA 4ZY2A 5KTCA 3RAMA 3WC6A 3FH4A 5LYLA 2GLJA 2O53A 1YSJA 3FX6A 2Q43A 1Z8TA 1Z2LA 4M6IA 3IU1A 3NE8A 4A33A 2H5MA 1ELMP 2ZW5A 3RBUA 2JBJA 3D7HA 1YLEA 1HDUA 2P6EA 4R87A 3SJEA 1DTDA 1UWYA 2GU2A 2JEWA 2XEFA 2ZEHA 4E0AA 5K8NA 2B5GA 3RNZA 3SI0A 2EO8A 1XJOA 2OR4A 2IQ6A 2WPWA 4U9YA 1TKHA 1KUYA 3DLJA 4KOSA 1AMPA 2OH1A 1QSOA 4MXUA 2Q4VA 3C26A 1IOFA 4J3GA 1IYKA 3R9FA 4B12A 4KORA 3PB8X
chains in the Genus database with same CATH topology
3R96A 5F48A 1IB1E 4X5KA 4UCPA 1WWZA 1KUVA 2EUIA 3FXTA 1L0CA 2J8RA 1CJWA 1VHSA 2Y0MA 2FL4A 4JLYA 1Y9WA 1KUXA 4A95A 1V0CA 1YREA 3F8KA 2Q4YA 2X7BA 3TO7A 2ARHA 1MK4A 1PUAA 1LRZA 5J8CA 4CAEA 3LD2A 5AG5A 2CNTA 5BWAB 4XPDC 3TFYA 1M4IA 1GHEA 3S6FA 4BMHA 4C2ZA 5G21A 1VKCA 4YFJA 4FD5A 2VEZA 3BJ7A 2PC1A 3E0KA 3F0AA 5F46A 4CAXA 4CYQA 4CRZB 1XIXA 2HUZA 2OB0A 4F6AA 4GS4A 3FBUA 4II9A 3H4QA 2EVNA 4CAVA 2D4OA 1RXTA 2DPTA 5EC4A 1OZPA 3TOAA 4C68A 4QVTA 4NF1A 2VBQA 1Q2DA 4PV6A 3S6KA 2OZGA 1RO5A 4AG9A 1P4NA 4UBRA 1BOBA 4ZBGA 2Q0YA 4MFKA 1XE4A 3DDDA 2R1IA 1IIDA 2OZUA 2VZZA 2I79A 2ZW7A 5GCNA 4HNXB 5AG6A 2Z3NA 3FNCA 3FIXA 4AVCA 2GE3A 1B6BA 2B58A 4MFPA 3VWDA 4B14A 1I21A 1S60A 4MY3A 4AVBA 3PP9A 4M85A 1K4JA 4PK3A 3R95A 4KOTA 4U9ZA 3FRMA 4NEXA 1IICA 4KOVA 3QB8A 4CGNA 3T90A 2P6GA 3DR8A 5C82A 1MJBA 4ZGYB 5IX3A 2JLMA 2Q7BA 3TT2A 4RS2A 4Y49C 2G3TA 4XNHC 4B5PA 4CRYB 2HV2A 4XPKA 2KCWA 3SXOA 2QMLA 2VZYA 2A4NA 3UY5A 4KVXA 4KLVA 3N7ZA 3JUWA 4IF5A 3R9GA 2JDCA 4MHDA 5A27A 1XEBA 5EBVA 3VWEA 2FCKA 3DSBA 3GKRA 4I49A 2FS5A 5IV0A 3MGDA 4A31A 3EY5A 3D2MA 4MI4A 2BUEA 5F49A 1Q2CA 2QECA 1Q2YA 3CXPA 3GY9A 2GIVA 2C27A 1M44A 4A32A 4AB7A 1QSRA 2B3UA 4CYPA 4UWJA 4B13A 1FY7A 4E2AA 4KSFA 4KUAA 4HNWB 2P6FA 2QIRA 3A9LA 4MFJA 4ORFA 5DWNA 2AJ6A 3LODA 4CS0B 2Z3MA 3D3SA 3R1KA 1M4DA 3ZJ0A 3CXSA 5JQ4A 2WSAA 4XPDB 4E8OA 2HQYA 3TE4A 2VI7A 4UCMA 4CAWA 4UA3A 2BSWA 3KKWA 1SQHA 3P2FA 5KTDA 3G8WA 4JXQA 2ZXVA 5H84A 5KTAA 5IB0A 2ZW4A 4QB9A 1QSMA 4MJ8A 3DNSA 2PSWA 4KZTA 4M3SA 3BLNA 4PSXA 2VQYA 3TTHA 2PQ8A 4ONUA 4EVYA 2RC4A 1I1DA 1R57A 3G3SA 4H89A 2F5IA 3S6HA 2J8MA 2OZHA 4MFQA 2BEIA 1Z4RA 4MBUA 5AG7A 3I3GA 1M4GA 2Z3OA 2PR1A 4BBHA 4OLLA 3RYOA 4HKFA 5G22A 4NSQA 3B8GA 5C88A 4AG7A 4OAEA 4RI1A 2B4DA 4NCZA 2JEVA 4CGLA 2CNSA 4KOYA 1U6MA 3BJ8A 2BL1A 4CYNA 1ZO0A 1BO4A 3QAHA 1YX0A 2Q04A 3SHPA 2ATRA 4CAFA 4JD6A 4MFZA 1S7KA 3D2PA 2ZW6A 2Z11A 1YVKA 3T9YA 1YR0A 2JDDA 1CM0A 4XPLA 5G1ZA 2FE7A 2REFA 3WR7A 4JJXA 4LUAA 1MJ9A 4IUSA 2PRBA 4KVME 2R98A 4H6ZA 2B5GB 3F5BA 3TCVA 2R7HA 4B5PB 2Z3KA 3R9EA 3IWGA 4K30A 4KS9A 1PU9A 2R8VA 4MY0A 1Y9KA 2Z3LA 3FB3A 4R3LA 4R9MA 2Z10A 1S5KA 2B4BA 4C2XA 1QSTA 4QUSA 1MJAA 1N71A 3PZJA 4QC6A 1QSNA 2YNDA 3V8IA 2CXAA 2J8NA 4MFLA 4KVOE 1NSLA 5AGEA 5G20A 4H6UA 4AVAA 2NMTA 1J4JA 1YVOA 2DXQA 4PK2A 4UFVA 2Z3PA 3PGPA 4KOWA 3S6GA 1XF8A 4L8AA 2YNEA 4KLWA 3CXQA 1M1DA 2P0WA 2K5TA 1P0HA 2YGWA 2AE6A 1KZFA 1S3ZA 4Y49B 4B11A 1B87A 4F0YA 1NMTA 2WUUA 4C7HA 4CGMA 2I00A 1Y7RA 3EFAA 2OU2A 5JPHA 3H5ZA 1ON0A 2D4PA 3EC4A 2O28A 5DWMA 3I9SA 4FD6A 4A30A 4FD4A 1Z4EA 4HNYB 3TO6A 3D8PA 5E96A 1XMTA 1S7FA 3JTKA 4JWPA 2ZPAA 1S7LA 4R3KA 4C2YA 3DR6A 4CGPA 5CNPA 3K9UA 2DPSA 4Q36A 2FXFA 4F0XA 4KOXA 1WK4A 5HH1A 4QBJA 3W6SA 2FSRA 2GANA 2WPXA 5I0CA 4KUBA 1YK3A 4JXRA 4Q38A 3IU2A 3TO9A 2G3AA 2FIAA 4C7IA 4A2ZA 3ZZIA 4R57A 2B3VA 3EXNA 4YRHA 3OWCA 4NXYA 4FD7A 2VXKA 4UFWA 4B10A 3IWEA 4PSWA 1IYLA 2IL4A 3NE7A 3EO4A 2B4DB 4KOUA 4OADA 3GYAA 3P2HA 1TIQA 1UFHA 3FYNA 3SXNA 4L89A 1YGHA 4YGOA 2REEA 3IGRA 5A28A 3W91A 2Q44A 5FVJA 4LX9A 4UCNA 3JVNA 5HMNA 4XNHB 4CYOA 1I12A 4DNCA 4B5OA 4UFXA 4CGOA 2CY2A 4KSAA 2G0BA 5F47A 5AG4A 1S7NA 5ISVA 2PR8A 3W6XA 2CNMA 2Z0ZA 1Z9UA 5J8FA 2YNCA 1NE9A 2FT0A 3TOBA 2YNCC 2PDOA 5H86A 2FIWA 4UWIA 4U5YA 5KTCA 3IU1A 4A33A 2H5MA 2ZW5A 1YLEA 2P6EA 4R87A 4E0AA 2B5GA 2WPWA 4U9YA 1KUYA 4KOSA 2OH1A 1QSOA 2Q4VA 3C26A 4J3GA 1IYKA 3R9FA 4B12A 4KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  3H5Z A;  4A30 A;  4C2Z A;  4CAF A;  3IU2 A;  5G21 A;  2YNE A;  4C7I A;  4UCN A;  4A2Z A;  4BBH A;  4UCP A;  4B12 A;  3IU1 A;  5G22 A;  4A33 A;  4CYO A;  4C2X A;  4UFW A;  4B10 A;  3IWE A;  3JTK A;  4UFX A;  4A32 A;  4CGO A;  4CYQ A;  4CGL A;  5G1Z A;  4CGN A;  2YND A;  5AG6 A;  4C2Y A;  4CGP A;  5AG4 A;  5A27 A;  4B11 A;  4A95 A;  4B14 A;  5AGE A;  4CYN A;  4CYP A;  2WUU A;  2WSA A;  2YNC A;  5G20 A;  4B13 A;  4C7H A;  4CGM A;  2YNC C;  4C68 A;  5A28 A;  4CAE A;  5AG7 A;  4UFV A;  5AG5 A;  4UCM A; 
#chains in the Genus database with same CATH topology
 4K3N A;  4O23 A;  3R96 A;  2AFX A;  4F9V A;  4OIW A;  1PYT B;  5F48 A;  1IB1 E;  4X5K A;  4UCP A;  2BO9 A;  4UEE A;  5K8P A;  2PRQ A;  1WWZ A;  1LCP A;  3K2K A;  3BHX A;  1KUV A;  2EUI A;  3SJF A;  3FXT A;  1L0C A;  2J8R A;  1Y0R A;  1CJW A;  1VHS A;  2Y0M A;  2FL4 A;  1ZG7 A;  1Y9W A;  4JLY A;  4WJB A;  2QJ8 A;  4ZY1 A;  1KUX A;  3ISZ A;  1V0C A;  4A95 A;  1YRE A;  3F8K A;  4JYW A;  4OC3 A;  2Q4Y A;  1ZLI A;  2ZEF A;  2X7B A;  3TO7 A;  2ARH A;  5LRK A;  1MK4 A;  1PUA A;  1LRZ A;  1XMB A;  5J8C A;  4CAE A;  3LD2 A;  5AG5 A;  2CNT A;  4MHZ A;  5BWA B;  4XPD C;  1KWM A;  2Q51 A;  1M4I A;  1GHE A;  4UIB A;  3S6F A;  4BMH A;  5G21 A;  1VKC A;  3TC8 A;  4C2Z A;  4YFJ A;  4FD5 A;  2VEZ A;  2AFM A;  4UEZ A;  2V8H A;  1X10 A;  2PC1 A;  3BJ7 A;  3D67 A;  3IJ3 A;  3FJU A;  4NGT A;  5LYI A;  3E0K A;  3F0A A;  4R6T A;  3B3T A;  1R3N A;  5F46 A;  2Q4Z A;  3KI9 A;  4CAX A;  4CYQ A;  3WT4 A;  4CRZ B;  1XIX A;  2AFW A;  2HUZ A;  2OB0 A;  2G9D A;  1TKF A;  4BIN A;  4F6A A;  4GS4 A;  3FBU A;  3CDX A;  4II9 A;  3B3V A;  3VH9 A;  3H4Q A;  4P45 A;  1BLL E;  5LYF A;  3IC1 A;  2EVN A;  4CAV A;  2D4O A;  1RXT A;  5JH9 A;  2DPT A;  5EC4 A;  4UEF A;  1OZP A;  3TOA A;  3KR4 A;  4C68 A;  4QVT A;  1R43 A;  3LAC A;  4NF1 A;  1GYT A;  2VBQ A;  4NGS A;  1Q2D A;  2Q7S A;  4PV6 A;  3S6K A;  4FBE A;  2FVG A;  2OZG A;  1RO5 A;  4EWT A;  4GM5 A;  4AG9 A;  1P4N A;  4UBR A;  1CBX A;  1BOB A;  4ZBG A;  2Q0Y A;  4MFK A;  3WC7 A;  4MMO A;  1XE4 A;  2R1I A;  1IID A;  2VZZ A;  2OZU A;  3B3W A;  3DDD A;  2I79 A;  2ZW7 A;  4MRI A;  5GCN A;  4HNX B;  5AG6 A;  3WC5 A;  4EME A;  2Z3N A;  2ZEM A;  3FNC A;  3FIX A;  3B3S A;  4AVC A;  2GE3 A;  1B6B A;  2B58 A;  4MFP A;  4NJR A;  3VWD A;  4B14 A;  1I21 A;  1S60 A;  3S9M A;  4OC2 A;  4MY3 A;  4AVB A;  3PP9 A;  4M85 A;  4P4B A;  3S9L A;  2GFQ A;  1K4J A;  2GLF A;  3PB4 X;  4MCR A;  3DGV A;  4PK3 A;  2CTC A;  3R95 A;  2PJ2 A;  1VHE A;  4KOT A;  2J9A A;  4AXV A;  2HB6 A;  4TWE A;  4U9Z A;  4ZX9 A;  3FRM A;  4NEX A;  1IIC A;  4IHM A;  4KOV A;  2AFZ A;  2BCO A;  8CPA A;  3QB8 A;  4CGN A;  5JM6 A;  3T90 A;  2P6G A;  5LRJ A;  3DR8 A;  5C82 A;  1MJB A;  4ZGY B;  3BI0 A;  5IX3 A;  2JLM A;  3D7G A;  2Q7B A;  2PVV A;  4RS2 A;  5LYD A;  3TT2 A;  5CPA A;  4Y49 C;  1VGY A;  3B35 A;  2G3T A;  4XNH C;  3IWW A;  4ZY0 A;  5THW A;  4B5P A;  1M4L A;  5F09 A;  3PBB A;  4CPA A;  5K8O A;  4CRY B;  4RUH A;  2HV2 A;  4R76 A;  4XPK A;  2KCW A;  4KSI A;  2XEG A;  3SXO A;  2ZEE A;  1Z5R A;  2QML A;  2VZY A;  2A4N A;  3CT9 A;  4KLV A;  4KVX A;  3UY5 A;  3NH4 A;  3N7Z A;  3JUW A;  4IF5 A;  3R9G A;  5D29 A;  1HEE A;  2JDC A;  4MHD A;  4P4I A;  5A27 A;  4MCQ A;  4DYO A;  1XEB A;  2PJ6 A;  5EBV A;  3VWE A;  5CBM A;  3SJX A;  1F2O A;  1BPM A;  2FCK A;  2ZEO A;  3DSB A;  6CPA A;  3GKR A;  4I49 A;  2FS5 A;  1IOI A;  5IV0 A;  3PFO A;  4P10 A;  3MGD A;  1FT7 A;  2WZN A;  4P4J A;  4A31 A;  3EY5 A;  1TF8 A;  4NGR A;  3D2M A;  4MI4 A;  2BUE A;  3H8F A;  1YLO A;  5F49 A;  1Q2C A;  2QEC A;  1BAV A;  1Q2Y A;  3CXP A;  4GXH A;  3GY9 A;  3MN8 A;  7CPA A;  2GIV A;  5DS0 A;  5HXD A;  2C27 A;  1M44 A;  1RTQ A;  3FMC A;  3RO0 A;  4A32 A;  2ANP A;  1DE4 C;  3CPA A;  4AB7 A;  4FAI A;  3JRU A;  2GRE A;  1QSR A;  2B3U A;  3WAB A;  4CYP A;  3D66 A;  4UWJ A;  4NJQ A;  3T8W A;  4B13 A;  1FY7 A;  1HDQ A;  2CTB A;  4KSF A;  4E2A A;  4KUA A;  4HNW B;  2P6F A;  2QIR A;  4JZ0 A;  3IFE A;  3A9L A;  4HPS A;  4MFJ A;  4ORF A;  3NA6 A;  5DWN A;  4NGM A;  2PIY A;  1F57 A;  2ZEL A;  1ELL P;  2AJ6 A;  1XFO A;  2PJA A;  2WYR A;  3LOD A;  4OC4 A;  2Z3M A;  2PJ7 A;  3D3S A;  4OP4 A;  4CS0 B;  3R1K A;  1EE3 P;  1M4D A;  1QQ9 A;  3CPX A;  3TFY A;  5HVF A;  3ZJ0 A;  3NH8 A;  3CXS A;  4Q7A A;  3S9N A;  5JQ4 A;  2WSA A;  4XPD B;  4A38 A;  2ABZ A;  5K8M A;  1LAM A;  2PJ9 A;  2HQY A;  2RFH A;  4E8O A;  3TE4 A;  2VI7 A;  4UCM A;  4CAW A;  1CP7 A;  2BSW A;  4UA3 A;  3KKW A;  5I0C A;  1SQH A;  3P2F A;  1Z8X A;  4PPZ A;  5KTD A;  2F8H A;  3G8W A;  4JXQ A;  4MHY A;  3GLJ A;  3H8E A;  5HVH A;  2ZXV A;  1AYE A;  5H84 A;  5KTA A;  5IB0 A;  2ZW4 A;  1VIX A;  2EK9 A;  4QB9 A;  1YW4 A;  1F2P A;  1QSM A;  4IAV A;  4MJ8 A;  3DNS A;  4R7M A;  2BOA A;  4TNU A;  2PSW A;  4KZT A;  2POK A;  4M3S A;  3BLN A;  4PSX A;  2VQY A;  2EK8 A;  3TTH A;  2PQ8 A;  1Y0Y A;  3SI1 A;  3VAR A;  5JGF A;  4ONU A;  4EVY A;  2RC4 A;  1I1D A;  1R57 A;  3G3S A;  3KQX A;  4H89 A;  2F5I A;  4OKO A;  3S6H A;  1XRY A;  2J8M A;  2OZH A;  4MFQ A;  4ZX8 A;  2BEI A;  1Z4R A;  3K9T A;  3B7I A;  4MBU A;  4DJL A;  5AG7 A;  3I3G A;  2XEI A;  2EWB A;  1M4G A;  4M6H A;  2Z3O A;  5J1Q A;  2PR1 A;  2IMO A;  4R8F A;  4BBH A;  5IB9 A;  3GIU A;  4OLL A;  4HKF A;  3RYO A;  5G22 A;  4NSQ A;  3B8G A;  4OID A;  5C88 A;  4AG7 A;  4P44 A;  4OAE A;  4RI1 A;  2B4D A;  4NCZ A;  2HC9 A;  2JEV A;  4CGL A;  2CNS A;  4X2T A;  3FVL A;  4M6G A;  4KOY A;  3HUV A;  4DUK A;  4FWU A;  1U6M A;  2V8D A;  3BJ8 A;  2BL1 A;  4CYN A;  1BPN A;  5LRG A;  2CIJ A;  1ZO0 A;  4EFD A;  4OME A;  1BO4 A;  3I1U A;  3QAH A;  1CP6 A;  1YX0 A;  2Q04 A;  3FF3 A;  2AFO A;  4NGP A;  3SHP A;  3VAT A;  4F9U A;  1ARM A;  2ATR A;  3PB9 X;  4CAF A;  4JD6 A;  4MFZ A;  4P4F A;  1S7K A;  3D2P A;  3GB0 A;  3GUX A;  2ZW6 A;  1TXR A;  1Q7L A;  2Z11 A;  2PJB A;  1YQE A;  1YVK A;  3T9Y A;  1YR0 A;  2JDD A;  1CM0 A;  2PJ5 A;  4XPL A;  3RZA A;  5G1Z A;  2V8G A;  3QAY A;  2FE7 A;  2PJ1 A;  4ONW A;  2REF A;  3WR7 A;  4JJX A;  4LUA A;  1MJ9 A;  4IUS A;  2PRB A;  1Y7E A;  4KVM E;  2R98 A;  1YME A;  3D68 A;  3PB6 X;  4H6Z A;  2B5G B;  3D7F A;  3F5B A;  3TCV A;  3D7D A;  2R7H A;  4X8I A;  1X12 A;  4B5P B;  5I4M A;  2Z3K A;  3R9E A;  4ZYQ A;  4P4D A;  3IWG A;  4K30 A;  4KS9 A;  1PU9 A;  3L2N A;  2R8V A;  4WWV A;  4MY0 A;  1XOV A;  3BXM A;  1Y9K A;  2Z3L A;  3FB3 A;  4R3L A;  4R9M A;  2Z10 A;  3SJG A;  1S5K A;  2B4B A;  4C2X A;  1QST A;  2PE3 A;  1A2Z A;  4QUS A;  1MJA A;  2ODF A;  2ZED A;  1N71 A;  3PEI A;  3PZJ A;  3KQZ A;  4A94 A;  4QC6 A;  1AUG A;  1QSN A;  2YND A;  3V8I A;  2CXA A;  2PJ3 A;  2J8N A;  1PCA A;  4MFL A;  4KVO E;  1Z8L A;  2JBK A;  1NSL A;  3PBE A;  3V7Z A;  5AGE A;  2PJ4 A;  1QMU A;  3TX8 A;  3N5F A;  5G20 A;  4H6U A;  4AVA A;  2NMT A;  1J4J A;  3FED A;  1YVO A;  2DXQ A;  2V8V A;  4PK2 A;  3KR5 A;  4ZI6 A;  1JQG A;  4UFV A;  2PVW A;  2Z3P A;  3PRT A;  4LQ6 A;  3PGP A;  4YU9 A;  4KOW A;  2AFS A;  3S6G A;  1YW6 A;  1XF8 A;  4L8A A;  2F7V A;  2YNE A;  4W9Y A;  5HVG A;  4KLW A;  2C1C A;  3CXQ A;  1M1D A;  2P0W A;  1IU8 A;  2AFU A;  2K5T A;  3B3C A;  3IO1 A;  3QNV A;  1P0H A;  2YGW A;  2AE6 A;  1KZF A;  2XEJ A;  1LOK A;  1S3Z A;  2PCU A;  3CZX A;  4A39 A;  1LAP A;  1Z8W A;  4Y49 B;  2RB7 A;  4PXD A;  4B11 A;  1B87 A;  3IEH A;  4F0Y A;  1NMT A;  2WUU A;  2EBJ A;  5EMI A;  1LAN A;  4C7H A;  4CGM A;  3KHZ A;  2PJ8 A;  4NGQ A;  4BD9 A;  5ELY A;  2I00 A;  1Y7R A;  3EFA A;  2OU2 A;  5JPH A;  2NSM A;  3H5Z A;  1ON0 A;  2D4P A;  2VL1 A;  2O28 A;  3EC4 A;  3I9S A;  4FD6 A;  5DWM A;  4FD4 A;  4A30 A;  1Z4E A;  3BI1 A;  1ARL A;  4HNY B;  3FEE A;  3KAS A;  2QYV A;  2C6G A;  3PB7 X;  4P6Y A;  4P4E A;  3SI2 A;  1JWQ A;  4MHP A;  3D8P A;  3FEC A;  3TO6 A;  3MRU A;  5E96 A;  4Z65 A;  1XMT A;  2ZEN A;  1S7F A;  3JTK A;  2V77 A;  4JWP A;  2ZPA A;  1S7L A;  2ZOG A;  4R3K A;  4C2Y A;  3DR6 A;  1NSA A;  4MCS A;  5CNP A;  4YWY A;  4CGP A;  3K9U A;  4OC1 A;  2DPS A;  4Q36 A;  2FXF A;  4F0X A;  4KOX A;  1WK4 A;  4RN7 A;  2PJ0 A;  5HH1 A;  4QBJ A;  1TF9 A;  2CF4 A;  2FSR A;  2GAN A;  2PIZ A;  2WPX A;  3NH5 A;  4KUB A;  3W6S A;  1CPS A;  1YK3 A;  3KGQ A;  3KL9 A;  3LMS A;  4JXR A;  4Q38 A;  1CG2 A;  3IU2 A;  3TO9 A;  1ZG8 A;  2G3A A;  2FIA A;  4C7I A;  2ZOF A;  2ZEG A;  4A2Z A;  3ZZI A;  4R57 A;  2B3V A;  2C6P A;  3EXN A;  4YRH A;  3OWC A;  4PQA A;  2DF5 A;  1XBU A;  4NXY A;  4A37 A;  4FD7 A;  2VXK A;  4UFW A;  4B10 A;  3IWE A;  4PSW A;  1IYL A;  2IL4 A;  4NGN A;  3NE7 A;  4PXC A;  3EO4 A;  2NYQ A;  2B4D B;  4G1P A;  4KOU A;  4OAD A;  3GYA A;  1OBR A;  3P2H A;  1IGB A;  4F8Z A;  1VHO A;  1TIQ A;  3H8G A;  4OC5 A;  2OOT A;  4IK2 A;  1TKJ A;  1UFH A;  3FYN A;  3HLP A;  1IY7 A;  4MHN A;  4B6Z A;  3SXN A;  4L89 A;  1YGH A;  4YGO A;  4FUU A;  4H2K A;  2REE A;  3KZW A;  3IGR A;  5A28 A;  3W91 A;  2ZEP A;  3D4U A;  2Q44 A;  4NFR A;  5FVJ A;  2I3C A;  3ISX A;  1LFW A;  1FNO A;  2C6C A;  1CPX A;  1CX8 A;  4LX9 A;  4UCN A;  3JVN A;  5HMN A;  4XNH B;  3PFE A;  4CYO A;  1I12 A;  4OC0 A;  4DNC A;  1H8L A;  4B5O A;  4UFX A;  4CGO A;  3LWU A;  2CY2 A;  3IIB A;  4KSA A;  2G0B A;  2IJZ A;  5F47 A;  4LQG A;  3V38 A;  5AG4 A;  1S7N A;  5ISV A;  2PR8 A;  2O4H A;  4PXE A;  3W6X A;  4MCP A;  2CNM A;  2Z0Z A;  3NFZ A;  4X3R A;  1Z9U A;  1ZLH A;  3B2Y A;  2YNC A;  4UIA A;  5J8F A;  4UF4 A;  1NE9 A;  2FT0 A;  3TOB A;  1ZG9 A;  2QVP A;  2DEA A;  2PDO A;  2YNC C;  2FIW A;  3KHX A;  5H86 A;  4PXB A;  4UWI A;  2PJC A;  4U5Y A;  5D8N A;  4ZY2 A;  5KTC A;  3RAM A;  3WC6 A;  3FH4 A;  5LYL A;  2GLJ A;  2O53 A;  1YSJ A;  3FX6 A;  2Q43 A;  1Z8T A;  1Z2L A;  4M6I A;  3IU1 A;  3NE8 A;  4A33 A;  2H5M A;  1ELM P;  2ZW5 A;  3RBU A;  2JBJ A;  3D7H A;  1YLE A;  1HDU A;  2P6E A;  4R87 A;  3SJE A;  1DTD A;  1UWY A;  2GU2 A;  2JEW A;  2XEF A;  2ZEH A;  4E0A A;  5K8N A;  2B5G A;  3RNZ A;  3SI0 A;  2EO8 A;  1XJO A;  2OR4 A;  2IQ6 A;  2WPW A;  4U9Y A;  1TKH A;  1KUY A;  3DLJ A;  4KOS A;  1AMP A;  2OH1 A;  1QSO A;  4MXU A;  2Q4V A;  3C26 A;  1IOF A;  4J3G A;  1IYK A;  3R9F A;  4B12 A;  4KOR A;  3PB8 X; 
#chains in the Genus database with same CATH homology
 3R96 A;  5F48 A;  1IB1 E;  4X5K A;  4UCP A;  1WWZ A;  1KUV A;  2EUI A;  3FXT A;  1L0C A;  2J8R A;  1CJW A;  1VHS A;  2Y0M A;  2FL4 A;  4JLY A;  1Y9W A;  1KUX A;  4A95 A;  1V0C A;  1YRE A;  3F8K A;  2Q4Y A;  2X7B A;  3TO7 A;  2ARH A;  1MK4 A;  1PUA A;  1LRZ A;  5J8C A;  4CAE A;  3LD2 A;  5AG5 A;  2CNT A;  5BWA B;  4XPD C;  3TFY A;  1M4I A;  1GHE A;  3S6F A;  4BMH A;  4C2Z A;  5G21 A;  1VKC A;  4YFJ A;  4FD5 A;  2VEZ A;  3BJ7 A;  2PC1 A;  3E0K A;  3F0A A;  5F46 A;  4CAX A;  4CYQ A;  4CRZ B;  1XIX A;  2HUZ A;  2OB0 A;  4F6A A;  4GS4 A;  3FBU A;  4II9 A;  3H4Q A;  2EVN A;  4CAV A;  2D4O A;  1RXT A;  2DPT A;  5EC4 A;  1OZP A;  3TOA A;  4C68 A;  4QVT A;  4NF1 A;  2VBQ A;  1Q2D A;  4PV6 A;  3S6K A;  2OZG A;  1RO5 A;  4AG9 A;  1P4N A;  4UBR A;  1BOB A;  4ZBG A;  2Q0Y A;  4MFK A;  1XE4 A;  3DDD A;  2R1I A;  1IID A;  2OZU A;  2VZZ A;  2I79 A;  2ZW7 A;  5GCN A;  4HNX B;  5AG6 A;  2Z3N A;  3FNC A;  3FIX A;  4AVC A;  2GE3 A;  1B6B A;  2B58 A;  4MFP A;  3VWD A;  4B14 A;  1I21 A;  1S60 A;  4MY3 A;  4AVB A;  3PP9 A;  4M85 A;  1K4J A;  4PK3 A;  3R95 A;  4KOT A;  4U9Z A;  3FRM A;  4NEX A;  1IIC A;  4KOV A;  3QB8 A;  4CGN A;  3T90 A;  2P6G A;  3DR8 A;  5C82 A;  1MJB A;  4ZGY B;  5IX3 A;  2JLM A;  2Q7B A;  3TT2 A;  4RS2 A;  4Y49 C;  2G3T A;  4XNH C;  4B5P A;  4CRY B;  2HV2 A;  4XPK A;  2KCW A;  3SXO A;  2QML A;  2VZY A;  2A4N A;  3UY5 A;  4KVX A;  4KLV A;  3N7Z A;  3JUW A;  4IF5 A;  3R9G A;  2JDC A;  4MHD A;  5A27 A;  1XEB A;  5EBV A;  3VWE A;  2FCK A;  3DSB A;  3GKR A;  4I49 A;  2FS5 A;  5IV0 A;  3MGD A;  4A31 A;  3EY5 A;  3D2M A;  4MI4 A;  2BUE A;  5F49 A;  1Q2C A;  2QEC A;  1Q2Y A;  3CXP A;  3GY9 A;  2GIV A;  2C27 A;  1M44 A;  4A32 A;  4AB7 A;  1QSR A;  2B3U A;  4CYP A;  4UWJ A;  4B13 A;  1FY7 A;  4E2A A;  4KSF A;  4KUA A;  4HNW B;  2P6F A;  2QIR A;  3A9L A;  4MFJ A;  4ORF A;  5DWN A;  2AJ6 A;  3LOD A;  4CS0 B;  2Z3M A;  3D3S A;  3R1K A;  1M4D A;  3ZJ0 A;  3CXS A;  5JQ4 A;  2WSA A;  4XPD B;  4E8O A;  2HQY A;  3TE4 A;  2VI7 A;  4UCM A;  4CAW A;  4UA3 A;  2BSW A;  3KKW A;  1SQH A;  3P2F A;  5KTD A;  3G8W A;  4JXQ A;  2ZXV A;  5H84 A;  5KTA A;  5IB0 A;  2ZW4 A;  4QB9 A;  1QSM A;  4MJ8 A;  3DNS A;  2PSW A;  4KZT A;  4M3S A;  3BLN A;  4PSX A;  2VQY A;  3TTH A;  2PQ8 A;  4ONU A;  4EVY A;  2RC4 A;  1I1D A;  1R57 A;  3G3S A;  4H89 A;  2F5I A;  3S6H A;  2J8M A;  2OZH A;  4MFQ A;  2BEI A;  1Z4R A;  4MBU A;  5AG7 A;  3I3G A;  1M4G A;  2Z3O A;  2PR1 A;  4BBH A;  4OLL A;  3RYO A;  4HKF A;  5G22 A;  4NSQ A;  3B8G A;  5C88 A;  4AG7 A;  4OAE A;  4RI1 A;  2B4D A;  4NCZ A;  2JEV A;  4CGL A;  2CNS A;  4KOY A;  1U6M A;  3BJ8 A;  2BL1 A;  4CYN A;  1ZO0 A;  1BO4 A;  3QAH A;  1YX0 A;  2Q04 A;  3SHP A;  2ATR A;  4CAF A;  4JD6 A;  4MFZ A;  1S7K A;  3D2P A;  2ZW6 A;  2Z11 A;  1YVK A;  3T9Y A;  1YR0 A;  2JDD A;  1CM0 A;  4XPL A;  5G1Z A;  2FE7 A;  2REF A;  3WR7 A;  4JJX A;  4LUA A;  1MJ9 A;  4IUS A;  2PRB A;  4KVM E;  2R98 A;  4H6Z A;  2B5G B;  3F5B A;  3TCV A;  2R7H A;  4B5P B;  2Z3K A;  3R9E A;  3IWG A;  4K30 A;  4KS9 A;  1PU9 A;  2R8V A;  4MY0 A;  1Y9K A;  2Z3L A;  3FB3 A;  4R3L A;  4R9M A;  2Z10 A;  1S5K A;  2B4B A;  4C2X A;  1QST A;  4QUS A;  1MJA A;  1N71 A;  3PZJ A;  4QC6 A;  1QSN A;  2YND A;  3V8I A;  2CXA A;  2J8N A;  4MFL A;  4KVO E;  1NSL A;  5AGE A;  5G20 A;  4H6U A;  4AVA A;  2NMT A;  1J4J A;  1YVO A;  2DXQ A;  4PK2 A;  4UFV A;  2Z3P A;  3PGP A;  4KOW A;  3S6G A;  1XF8 A;  4L8A A;  2YNE A;  4KLW A;  3CXQ A;  1M1D A;  2P0W A;  2K5T A;  1P0H A;  2YGW A;  2AE6 A;  1KZF A;  1S3Z A;  4Y49 B;  4B11 A;  1B87 A;  4F0Y A;  1NMT A;  2WUU A;  4C7H A;  4CGM A;  2I00 A;  1Y7R A;  3EFA A;  2OU2 A;  5JPH A;  3H5Z A;  1ON0 A;  2D4P A;  3EC4 A;  2O28 A;  5DWM A;  3I9S A;  4FD6 A;  4A30 A;  4FD4 A;  1Z4E A;  4HNY B;  3TO6 A;  3D8P A;  5E96 A;  1XMT A;  1S7F A;  3JTK A;  4JWP A;  2ZPA A;  1S7L A;  4R3K A;  4C2Y A;  3DR6 A;  4CGP A;  5CNP A;  3K9U A;  2DPS A;  4Q36 A;  2FXF A;  4F0X A;  4KOX A;  1WK4 A;  5HH1 A;  4QBJ A;  3W6S A;  2FSR A;  2GAN A;  2WPX A;  5I0C A;  4KUB A;  1YK3 A;  4JXR A;  4Q38 A;  3IU2 A;  3TO9 A;  2G3A A;  2FIA A;  4C7I A;  4A2Z A;  3ZZI A;  4R57 A;  2B3V A;  3EXN A;  4YRH A;  3OWC A;  4NXY A;  4FD7 A;  2VXK A;  4UFW A;  4B10 A;  3IWE A;  4PSW A;  1IYL A;  2IL4 A;  3NE7 A;  3EO4 A;  2B4D B;  4KOU A;  4OAD A;  3GYA A;  3P2H A;  1TIQ A;  1UFH A;  3FYN A;  3SXN A;  4L89 A;  1YGH A;  4YGO A;  2REE A;  3IGR A;  5A28 A;  3W91 A;  2Q44 A;  5FVJ A;  4LX9 A;  4UCN A;  3JVN A;  5HMN A;  4XNH B;  4CYO A;  1I12 A;  4DNC A;  4B5O A;  4UFX A;  4CGO A;  2CY2 A;  4KSA A;  2G0B A;  5F47 A;  5AG4 A;  1S7N A;  5ISV A;  2PR8 A;  3W6X A;  2CNM A;  2Z0Z A;  1Z9U A;  5J8F A;  2YNC A;  1NE9 A;  2FT0 A;  3TOB A;  2YNC C;  2PDO A;  5H86 A;  2FIW A;  4UWI A;  4U5Y A;  5KTC A;  3IU1 A;  4A33 A;  2H5M A;  2ZW5 A;  1YLE A;  2P6E A;  4R87 A;  4E0A A;  2B5G A;  2WPW A;  4U9Y A;  1KUY A;  4KOS A;  2OH1 A;  1QSO A;  2Q4V A;  3C26 A;  4J3G A;  1IYK A;  3R9F A;  4B12 A;  4KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...