1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
molecule keywords Ply protein
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
1GFDA 3VS2A 1AWOA 1I1JA 1JXOA 4LUDA 1ABQA 2A28A 2GBQA 1WX6A 1OEBA 2J6FA 2SRCA 1YCSB 1WA7A 1NLOC 1X6GA 1MV0B 4ZNXA 2EBPA 2VWFA 1I0CA 2AK5A 3R6NA 1HSQA 3IQLA 1ZUKA 2GTOA 1WXUA 4JJDA 1T0JA 2JT4A 5IHIA 1VA7A 2VVKA 2JMAA 4Z88A 3H41A 4ORZA 1MUZA 4DEXA 2EW3A 1JEGA 2EPDA 1T0HA 2O88A 2FPFA 2DRMA 2LJ3A 2F2XA 1NEBA 2ED0A 3REBB 4DEYA 1UJ0A 5IHKA 2KROA 3VS0A 1MV3A 3O5ZA 1JWQA 2DRKA 1UHCA 3QAYA 2CSIA 4CC3A 2D8JA 2MCNA 1SEMA 1LCKA 4Y92A 1I07A 1ZX6A 4A63B 2LX7A 2V1RA 2W10A 2RQWA 2LMJA 1J3TA 1JU5C 2K9GA 1PRLC 2C0OA 2J6KA 2A37A 3I9QA 3EHRA 5FWCA 3M0RA 2D0NA 4BINA 1SSHA 4OMLA 3H0FA 1UJYA 1G2BA 3KFVA 1NYGA 1U3OA 1CSKA 1UE9A 2DL4A 3VS7A 1PRMC 1RLPC 1N5ZA 1VYUA 3PVQA 2KRMA 2O9SA 3TSWA 4IIOA 4KRTA 5GJVB 4OMMA 4J9GA 1NLPC 2GTJA 1GCQA 1K76A 1K0XA 2AKKA 2DBKA 1UGVA 2BTTA 2DBMA 2J06A 2K79A 3VS6A 3H0IA 5FWBA 5GJWB 2HDAA 4X1VA 1NYFA 1X2QA 4AG2C 1ZUYA 1B07A 2RQRA 1X6BA 3M0UA 4F17A 4CC4B 4J9CA 2LP5A 1W70A 2L3QA 2JM9A 1XOVA 2OI3A 4RTTA 2L3SA 1M8MA 1X27A 4RTYA 1H92A 2NWMA 3SEMA 2LJ0A 3VS1A 2D8HA 2RQVA 1X69A 2BZXA 1W6XA 1AVZC 1JO8A 2K2MA 1UHFA 4F14A 3I5RA 2KBTA 2DJQA 2EYZA 2O31A 2J7IA 2YDLA 2HCKA 4LNPA 2KE9A 2EYWA 3EGUA 4M4ZA 2LZ6B 3M0PA 2JM8A 1GFCA 2ESWA 3VS4A 1S1NA 4JZ3A 1ZSGA 1IO6A 2YUOA 4Z89A 1QCFA 4OMOA 2LNHB 3PE0A 1PWTA 2AKLA 4HVVA 4OMNA 4M6HA 1TUDA 3NGPA 1G83A 1UDLA 1AOJA 3A98A 2D1XA 2FO0A 1BK2A 1JXMA 1WYXA 1QLYA 1RI9A 2KEAA 1H3HA 2DL3A 2KGTA 4M6GA 5I11A 4HVWA 3TVTA 3NMZC 2E5KA 2CH4A 2JS0A 1UUEA 2JW4A 5ECAA 3UATA 5IHNA 1WXTA 1U5SA 4ESRA 2EQIA 2KR3A 2IIMA 1WI7A 3THKA 3VRZA 3PVLA 3LH5A 5L23A 4JJBA 2DNUA 1WIEA 3ULRB 1YWOA 1K0SA 4J9DA 4J9BA 2DMOA 2AZSA 5IXFA 2W0ZA 1BU1A 1KJWA 2X3XD 3VRYA 1U06A 2GGRA 3UA7A 1WLPB 3FJ5A 2L0AA 2ROLA 3QWXX 1M27C 2YUQA 4FSSA 1M3AA 2NUZA 2AZVA 2DYBA 4JZ4A 4AG1C 4M6IA 3EG0A 4J9HA 1M3BA 1E7OA 2KT1A 2M0YA 1KIKA 2XMFA 4J9FA 2ODFA 1K9AA 2VKNA 1AD5A 1CKAA 2LCSA 3H0HA 3VS5A 2DL5A 1T3LA 5EMIA 2H8HA 2EYXA 3C0CA 1PHTA 2DL7A 3GBQA 1X2KA 2FRWA 2CT3A 2KRSA 2C0TA 3RBBB 4HCKA 2KXDA 4OMQA 2EVRA 2FRYA 5EC7A 2ED1A 2FEIA 4RTUA 2FG0A 1UFFA 2I0NA 2DILA 3TSZA 2YUNA 4EIKA 4AFZC 1SRMA 2CH4W 4E6RA 3M0SA 2K6DA 1BB9A 3M0TA 2JMCA 3I35A 2GQIA 2OAWA 2B86A 1WFWA 2M51A 1YN8A 3I5SA 3CZXA 1UTIA 2BZ8A 2FPEA 2PZ1A 4RN7A 2YT6A 1AWXA 2RQTA 4RTVA 1SRLA 4GLMA 1GCPA 1EFNA 1RUWA 1WXBA 2KNBB 1QWEA 2EKHA 1CKBA 3NPFA 4CC2A 1OOTA 2BZYA 2EGAA 2GNCA 1Y57A 4AFSC 3ZL7C 5I22A 2RNAA 1NEGA 1ABOA 2DM1A 2PNIA 4R0KA 3EG3A 4J9EA 5HCKA 2J05A 1Y0MA 1FMKA 3REAB 1ZBJA 2Q7SA 1H8KA 2DX1A 3CQTA 1K4US 4IIMA 2DF6A 3NE8A 4OMPA 1Z9QA 1YNZA 2DA9A 1TG0A 1W1FA 1GBQA 2V1QA 1AWWA 4CC7A 2YUPA 3EG1A 4D8DA 2JXBA 2K7AA 1NM7A 4K11A 1AZEA 2KYMA 2HSPA 2O9VA 2FPDA 1HD3A 1PKSA 2CT4A 4RTZA 3EHQA 1X43A 4RUGA 4Z8AA 2RN8A 1PKTA 2A08A 2A36A 2KXCA 1UECA 2L2PA 1YWPA 1AEYA 1M30A 4GBQA 4LE9A 2F2VA 1VYTA 1BBZA 1GBRA 2ENMA 1QKXA 4HXJA 1SHFA 4D8KA 2G6FX 4QT7A 4LQ6A 1HJDA 3JV3A 2J6OA 5FW9A 2CUBA 1QWFA 3NHNA 1JQQA 2L3PA 1E6HA 2KYBA 1NG2A 2EYYA 3VS3A 5IH2A 2OJ2A 3UF4A 1RLQC 1A0NB 2CUDA 2ABLA 2ECZA 1VYVA 2MOXA 2JS2A 1OPLA 4WCIA 2SEMA 1GCQC 2RQUA 5IXBA 4RTWA 4LN2A 3UA6A 2PTKA 1OV3A 3RNJA 2X3WD 2LQNA 1YP5A 4F16A 2DE0X 2P4RA 1TUCA 1PNJA 1UG1A 1B3QA 4JJCA 1FYNA 2O2OA 2ROTA 1GL5A 3U23A 1OPKA 1V1CA 2DLPA 1KSWA 2HEQA 2LQWA 1E6GA 1K1ZA 2CDTA 4J9IA 1GRIA 1QKWA 2LJ1A 1AZGB 1SHGA 4RTXA 4JPBW 1ZLMA 2RMOA 1M3CA 2QDLA 2RF0A 1AWJA 3M0QA 4HVUA 2C0IA 1KFZA 2DL8A 2KT8A 4AFQC 3EG2A 2RPNA 3QWYA 1SPKA 2K3BA 1ARKA 2CSQA 1Z9ZA 1WDXA 2DVJA 2EGEA 2F2WA 3SHWA 2EGCA 1ZUUA 4LUEA 2CREA 2MIOA 1T3SA 2HBWA 2JTEA 4AFUC 2KRNA 2YSQA
chains in the Genus database with same CATH superfamily
3NE7A 1R3NA 3VS2A 3E9GA 1AWOA 1YW4A 1RO5A 3FJPA 3LWIA 3R1KA 3BI1A 4B5PA 3IU1A 4JLGA 2A28A 2KSSA 1KC8U 5K8MA 2F8HA 2EKOA 2SRCA 2PJ7A 2QASA 4CAEA 3CCSA 3L1AA 3BE3A 4FUUA 5D29A 4ZNXA 4KH0B 2VZZA 2OU2A 1XJWB 3RZAA 2AK5A 2EWNA 1HSQA 3IQLA 3FRNA 4C8QE 3IIBA 3TE4A 1NZ9A 2FIAA 3H9NA 1Z8LA 1VA7A 4FD6A 1I8FA 2DD5A 4Z88A 2QYVA 3H5ZA 3IFEA 3BJ7A 1JJ2P 2D6FA 1H8LA 5CKFA 3PEIA 2EW3A 3MEUA 4JUVA 2HL5C 5DWNA 2EPDA 3X20B 1T0HA 3G1JA 5CCAA 2ZW5A 1LJOA 2FPFA 2F2XA 3RKYA 2OTJA 1ZO0A 1RABB 2QXFA 2EK9A 2HZYA 4FYYB 4J6XA 3F0AA 3D7GA 4DEYA 2JBJA 1ZA1B 4BE1A 5IHKA 3EH1A 2AFZA 1MV3A 1SG5A 4H2KA 3X24B 1JWQA 1V29B 2DRKA 4IURA 4VUBA 2VYTA 4C5GA 1P0HA 5LL6S 2XEIA 1LCKA 1YX0A 1IZ6A 1YSJA 4V2SA 4E7JA 3QDFA 4CAXA 4FYWB 4QB9A 4Q5WA 2V1RA 1MJAA 7CPAA 1F2OA 2QYZA 1J3TA 2Y4XA 1VQ7A 1PRLC 3X25B 2ZOGA 2DPSA 2O28A 2J6KA 3JB9G 2PJ6A 1LAPA 5LRJA 3EHRA 3M0RA 4H6ZA 4IUUA 2Y90A 2JTMA 4OMLA 3GUXA 4DBFA 3OYAA 3KFVA 4C92C 1P4NA 3HP9A 5GAOr 2X4JA 3TFYA 2B4DB 2RI2A 1I12A 5G22A 2KRMA 2PIZA 4KOUA 3H8FA 2QTXA 3GPLA 4OMMA 4J9GA 3BW1A 1W2BS 1NLPC 1O75A 2IG0A 4M7AC 3FEDA 4U5YA 2LT4A 3LW5E 1TF8A 3VS6A 1CX8A 2FIWA 5GJWB 5DY9A 3TU4K 1X2QA 3M4YA 4AG2C 3CCLT 3FVLA 2NYSA 4UC4A 3E2UA 3A8HB 2XI9A 4CC4B 4J9CA 5A0LA 2F5IA 2LP5A 2JUFA 1KD1R 1B34A 3J80E 3KR4A 1YBYA 2OI3A 2WACA 4RTTA 2L3SA 3CCLA 1VQMT 2R1IA 4RTYA 3LACA 3SEMA 4P44A 3VS1A 1TXQA 1NPPA 4DOWA 4A95A 2V8IA 2HQYA 2DTOA 4B5OA 1BIBA 4A53A 3CPWP 1G3WA 2RJDA 1KQSA 3S6WA 1VQKT 4MY3A 5LJ3j 2K2MA 5K8PA 1WJSA 2HSEB 1AUGA 2J7IA 2C06A 3LGFA 4M75G 1M90C 2KE9A 5KTAA 4F7UB 4XTVA 1QMCA 2EYWA 2VXKA 3PFSA 1VQKA 1Q82R 1Y0RA 1BCOA 4JZ3A 4MFJA 3QG1A 4PJOD 1VHSA 1YK3A 2B5GA 2RI3A 3AHUA 2AKLA 4HVVA 3NH4A 4KUIA 1G83A 5CBMA 1AOJA 2L8DA 3KR5A 1I5OB 2ZEFA 3R9FA 3OMGA 1H3HA 4E7SA 3TVTA 2RI5A 2K2VA 1M2OA 3OYBA 3NMZC 1BLLE 4KGXB 3MEVA 2ZW6A 3EAEA 1Q7LA 1YIJQ 4IUTA 5ECAA 1UEBA 2CP6A 3JCMV 4ESRA 1K8AU 4M78A 5FROA 2QDYB 3OYHA 3L2WA 2CNTA 1VQ9A 4KVXA 3LH5A 2YXYA 4PKCC 5LJ3g 1HK9A 3EFOB 4Y28E 1VQ8A 5L23A 4JJBA 3L2VA 3MPUB 4M75F 2PVWA 1QP2A 5I4MA 2EJ9A 2BO9A 3RUXA 2YNCA 4FD5A 3S3MA 3QSUA 4L6V5 2AZSA 2GFUA 4L8AA 1KJWA 2QTVA 4R3LA 1YIJA 3VRYA 3S6HA 1QP3A 4C7HA 1Y07A 3ME9A 3A8OB 5GAN6 5GMKm 3I55A 2ZEEA 4PK4A 1VHOA 1MMDA 3TO9A 4ZGDB 4AG9A 3G71T 1M27C 2DXBA 4FSSA 4OADA 1CPXA 2AZVA 1BO4A 4CAWA 3SI2A 4JZ4A 1NE9A 5CVIA 4P4IA 4KOVA 4J9HA 5LJ5f 4KUDK 4MRIA 3OYEA 1E7OA 2M0YA 4J9FA 4C92E 4QVCA 2ODFA 5FU6B 2RD1A 1VQPQ 2VKNA 1AD5A 2FYKA 4C0GA 1F2PA 2LCSA 1CP7A 1XFOA 4IUSA 4DBHA 1S7NA 3VS5A 1Q82C 3X28B 1QVFS 1Z4EA 3V8IA 2V77A 4NJRA 2MWPA 5E96A 4KLWA 3C0CA 4B9WA 3GBQA 4JDSA 2FRWA 4A4KA 3D2PA 4OC1A 4EPCA 4FL6A 4MHYA 2RJCA 2YRDA 4O6JA 4HNWB 2EVRA 1FXXA 5EC7A 1I1DA 2RC4A 1K9MU 1K9MR 5C88A 3S9MA 4M77G 1Z8TA 2I0NA 3OYNA 3TSZA 3N5FA 4M78B 1FY7A 1Q7YR 2CH4W 2KK4A 4E6RA 2CP0A 4E2AA 2K6DA 4DJLA 2K5LA 3M0TA 1K73C 2ZEOA 3K9UA 4I49A 3JB9F 2X4WA 3R9EA 2CZ7B 1WWZA 1WFWA 4R8FA 5HXDA 3CMEA 2WSFE 3CZXA 2FPEA 3CMAQ 1ZSZC 2Y0MA 2LDMA 4LDYA 4PXDA 2FT0A 3JUWA 4R55A 4QC6A 4RTVA 4M78G 1U1SA 1B87A 4JRQA 1EFNA 4M77B 4E47A 1Q86U 2RB7A 1OYXA 1YGHA 1XMTA 3HPWA 1RUWA 1YREA 3CMET 1OZPA 1V76A 2MF2A 3NPFA 2QQSA 4QQ6A 1FWZA 3VYGA 3KGQA 2GNCA 3PMIA 4P5NA 3META 3IJ3A 1NMTA 3SJEA 4ZI6A 3OYYA 3EY5A 4QBJA 1ABOA 2FVUA 4XK8E 2V8KA 4BDZA 1KQ1A 2VXEA 3G6ET 1TWBA 2J05A 1N71A 4KUAA 1ZBJA 1M1DA 3RYOA 2IMOA 1WHMA 1G3TA 2DX1A 4KGZB 2CP7A 3PT9A 4LXCA 2DF6A 2J8MA 4XPLA 4CRZB 3WVDB 3M54A 1KUVA 1Q2YA 1D0YA 2DEQA 3KL9A 4CRYB 5GAMd 5HH1A 2OR4A 3MJXA 2DA9A 4HA8A 2BIVA 4EWTA 2GFAA 1GBQA 2V1QA 1ZSZB 4PJOA 2L3RA 2YUPA 2GCXA 2Z3MA 2HSPA 1VQMQ 1G5VA 3VARA 1X43A 3RNZA 2YRCA 1KHCA 7AT1B 1Z8XA 1Y96B 4FYVB 2AFUA 2A08A 3A5ZB 4GBQA 4UEZA 4F7UA 4C2XA 1VYTA 8ATCB 1DE4C 1GBRA 1IHVA 2VC8A 1MJBA 5F48A 3NH8A 1NE8A 2A7YA 1CP6A 1PC0A 1JRIA 1LVKA 4J83A 1WHKA 3NTKA 4QT7A 1NPRA 1IB8A 3JV3A 5JPHA 1IGQA 4F04B 2L3PA 4P4EA 5LRKA 2OJ2A 1N27A 4ZGJB 3EC4A 1A0NB 3JCMf 1YVOA 3DB3A 4MFQA 1MMGA 2R5MA 3CCMA 2XDDA 4WCIA 3QPHA 2SEMA 2RJFA 5D6YA 5IXBA 1IOIA 2P4TA 4JWPA 2PCUA 2PTKA 1UGPB 2WYRA 3RNJA 2X3WD 3JRZA 4GY5A 4WJBA 2JZ2A 3T9NA 1H3ZA 4LD6A 4LQGA 4FM4B 2EUIA 2VQYA 3S6GA 3FF3A 1I21A 1ARMA 4P4FA 4N4HA 6CPAA 3OW2S 1GL5A 3QZ5B 3K9TA 3EFOA 1V1CA 3PZJA 4NS5A 2OH1A 5D8NA 4UCPA 1X6OA 3CCQQ 1K1ZA 2CDTA 4C5IA 2OZHA 3FMCA 1GRIA 1QKWA 2HAXA 1AZGB 3TO6A 3NTHA 3OYFA 1ZSZA 3C4SA 4PJOB 4DBRA 4KSFA 1M3CA 2HNIA 3DR6A 2ZPGB 1KD1U 4CGNA 2GLFA 4HVUA 3GOXA 5GMKe 3OYLA 4P45A 2DL8A 2E5QA 3EGDB 4ANJA 3TCVA 3NTIA 4M85A 3EG2A 1BOBA 1Y96A 2RPNA 3QWYA 1Z4RA 4K3NA 4FW2A 1ZG9A 4M7AD 1N8RR 2IJZA 3HLPA 2KY9A 2EQUA 1BI1A 4YGOA 3FRMA 3RDVA 4R6TA 2O01E 2DO3A 5DWMA 3OYGA 4RKUE 4J6YA 4LUEA 1NJIC 5IX3A 2ZPBB 5CQXA 4C5EA 3JVNA 3EFAA 4M77E 4II9A 3NGPA 2GANA 4Y49C 3G7ZA 1I1JA 1ZBXA 4M77D 2QA4A 1YJWT 4LUDA 2R8VA 4UWIA 4ATOA 1WX6A 2EFIA 2J6FA 1BIAA 3HSBA 1Z8WA 2Q43A 3MHXA 1Z5RA 1WA7A 4R7MA 1GHEA 1SKUB 4NSQA 3AT1B 3PRTA 1QVGP 1WXUA 4JJDA 2G0BA 4M78E 3QDRB 4ORZA 1MUZA 3QHSA 4M78D 2GU2A 1JEGA 1Q81U 1B7TA 1YIJT 4JD6A 1M5Q1 3LWHA 2DF5A 2BE9B 3FIFA 2RJEA 1JQGA 2Z3NA 2EQMA 2LJ3A 3PIOA 3DKMA 1C0MA 4XAXB 3HFNA 5AG5A 1UJ0A 4ELZC 4RCBA 3GB0A 3VS0A 2OB0A 3HFOA 4PFZA 4NL2A 3A8LB 1IYLA 3N7ZA 4FAIA 3IC1A 4LDVA 3MP6A 3SDZA 2PJ0A 1YJNQ 2MCNA 2LNVA 1SEMA 4B9XA 3W6SA 5KYUA 5KCHA 3V7RA 5GAN7 2W10A 2RQWA 1NBEB 4YWYA 2PSWA 2MI6A 3CCUA 3B3WA 4MCPA 4LDWA 2A37A 2K5TA 3V7SA 1MNEA 3G4ST 1KQSP 4FBEA 4BINA 1R57A 5EC4A 1QSTA 2QEXA 5ELYA 2NSMA 4CYPA 2RO0A 1G2BA 4JXRA 1NYGA 1VQOA 2C1CA 3CPXA 3VS7A 3JB9D 1RLPC 1N5ZA 1WHLA 3IU2A 5D7UA 5GANd 2OTJT 2O9SA 3PB9X 4U9ZA 2HQXA 2Q51A 4B10A 1OI1A 1OQKA 2MK5A 1TIQA 2DEUA 1S7KA 1TKFA 4R76A 1OX8A 3CCUQ 1K76A 1WQWA 2AKKA 2YLBA 1EZZB 4UIBA 1WHGA 2J06A 1JBMA 3QYGB 4KH1B 2K79A 3I9SA 4R56A 1VQ5T 2BKDN 5KYNA 5FWBA 2QGGA 4F8ZA 5GAOn 2GLJA 5LJ5e 3VUBA 2VBQA 3W6XA 4JYWA 1R0BG 2JDCA 2CKKA 1CBXA 3IWWA 2I3CA 2D4PA 3T8WA 1ZLHA 1W70A 1VQ5A 2JM9A 5F49A 3E9FA 4LUAA 4NGMA 1XOVA 3HKSA 1I4K1 4PXBA 1YHQA 1X27A 4KT0E 1H92A 2NWMA 4BD3A 3MP1A 2C27A 4M75B 1OZ2A 2XEGA 2Z3KA 4AMCA 1O9SA 3P2FA 3RBUA 3L2QA 1AVZC 2ZPHB 1TKHA 3QJYA 3RIRA 3PFOA 2G9DA 2DJQA 2I2LA 3INZA 1S7FA 4B14A 1Q95G 1VQPT 4OB2B 2EIFA 3JCMe 2E70A 2AFWA 3ASKA 1UGQB 4FWUA 5LJ5j 1S72Q 2OTLT 4M4ZA 2PQ8A 2LZ6B 4AG7A 1XMBA 1GFCA 2CYZB 2ESWA 1UGRB 4E7ZA 3RMQA 3WC5A 3NFCA 3CBPA 1ZSGA 2ZPEB 3M5AA 4KBMB 3OA6A 3G71Q 1IO6A 2CZ0B 2YUOA 2BSWA 2WPWA 1QCFA 2Y4YA 2LNHB 4OMOA 4G1PA 4B5PB 5JQ4A 3CXCS 3EGDA 1PWTA 3FIXA 1QVGS 3PP9A 3RO0A 2CTBA 5FRNA 4E0AA 4IUVA 2DTHA 3A98A 2WSCE 2RHUA 1LCPA 5A0DA 1N9RA 4KSIA 1JXMA 1QLYA 1RI9A 3B3VA 4HNYB 4M6GA 3PMTA 3BLNA 1MK4A 3KHXA 2A0FB 5I11A 4M7AE 3CXCP 2LCLA 3CCMT 3Q1JA 5GANe 3CC2Q 1W2BP 4AXVA 2VGMA 4R9MA 5IHNA 1WXTA 1U5SA 3MP8A 2KR3A 2IIMA 4A54A 2VL1A 1Z9UA 4A4FA 1KUYA 6AT1B 2X9HA 1VIXA 1G3YA 2DXQA 2V8GA 4H89A 4FD4A 5GAOm 5GCNA 2DNUA 4MCQA 1RAFB 5C0MA 2DYIA 3VH9A 4M75A 2PDOA 2R58A 2PJCA 2LRQA 3FYNA 1BU1A 1TKJA 4X8IA 3KI9A 5A0GA 3FJ5A 4KLVA 2L0AA 1EE3P 2LQ8A 2QECA 5HVGA 1ON0A 4RUHA 2YUQA 2AHJB 2DEAA 3QKJA 5H86A 1XBUA 3OY9A 3O8VA 4QVZA 3WR7A 3GP8A 3L42A 2YHTA 3ZJ0A 4B6MA 3GNFB 3OMCA 3ZBDA 2XMFA 1CJWA 2AFOA 2RK2A 4EMKB 1CKAA 4BD9A 4BE0A 1WJQA 3H0HA 4HKFA 3H4QA 3RKWA 4B6ZA 1T3LA 5LJ5d 1VQ9T 1HEEA 1YCYA 3WXMB 2B4DA 1VQ8T 3SXNA 1PU9A 3TOAA 5GAMe 2FB7A 2C0TA 3RBBB 2PJAA 5A27A 4HCKA 1FX7A 2KXDA 1H641 4OMQA 1M1KC 1X75C 1F1BB 4R3KA 2BOAA 4M75C 4RTUA 3CC2T 1IGBA 5L8RE 2YUNA 1G8XA 5GAN3 2Q04A 4ZGYB 3LWUA 3TQ7P 1SRMA 3G71A 2E4HA 1IHWA 1MMNA 3M0SA 2G3TA 2PJ2A 4PLLA 4OGEA 1ELMP 2JMCA 2V8VA 2JTFA 3FECA 4J8OA 3KUFA 1ZG8A 1B6BA 1YITT 1IY7A 5GAOq 3I5SA 3OS5A 1UTIA 2BZ8A 4RN7A 2P0KA 4C68A 4CGMA 1AWXA 3UWNA 5C82A 1C1AA 2P84A 2RQTA 1SRLA 4OC2A 3SJGA 3FEOA 1TF9A 3MKDA 3OB9A 2CF4A 3TTHA 4KOWA 4J6WA 1WXBA 2EKHA 3OYKA 1CKBA 1VIFA 3BI0A 4J7IA 3F8KA 3TT2A 3V7ZA 1OOTA 2BZYA 4XTYA 2GE3A 2EGAA 5DS0A 2NYQA 4NGRA 2ZW7A 3CCMQ 2BUEA 4AFSC 3ZL7C 5I22A 5I21A 4F7UE 4ZBGA 2RNAA 4LDUA 2DM1A 1QSMA 2DIQA 2VB6A 4UFWA 1FMKA 3LLRA 2Q7SA 1H8KA 3FDRA 4E7LA 2CXAA 1YJWQ 4OC3A 4C7IA 4M77C 5IB9A 2XDBA 4PJOE 2YGWA 1YNZA 3I56Q 3CC7T 4XTWA 1TG0A 1W1FA 2JOYA 2V8HA 1AWWA 4CC7A 1LRZA 3EG1A 4ONUA 2O9VA 2LVMA 2B58A 4Z8AA 4RUGA 2RN8A 5G21A 2KXCA 2L2PA 2RA2A 4A37A 1M30A 4P10A 3CXCA 2C6CA 4KOTA 2RHXA 3D7DA 4M78C 3M53A 3JCMW 2KMTA 4M7DA 3PB8X 2ENMA 4RCCA 3FB9A 4MDWA 2X51A 5GAN4 2PRQA 4HKEA 3VU3C 1LANA 3MO8A 5C6SA 2ATCB 1QWFA 3NHNA 3EGXA 1E6HA 1HDUA 4J3GA 2EYYA 5IH2A 1YJ9T 4ZX9A 3PBEA 1RLQC 5CKDA 3JCMJ 1YI2A 2ABLA 2XKOC 1X01A 1VQNA 3BY7A 4ZTFA 1EX4A 1VQNQ 4KUBA 1GCQC 2CZ6B 3I3GA 2JEVA 2F5TX 2GFQA 3UA6A 2VUBA 3TO7A 1YHQT 1M1KU 3QZ9B 3OWCA 3SJFA 2HUZA 1OBRA 2LQNA 1YP5A 1XNIA 4CAVA 4X2TA 3VWEA 2WZNA 4CYNA 1TUCA 4OP4A 2DFUA 5G20A 1B3QA 1FYNA 2O2OA 2ROTA 4X3RA 4UIAA 4F9UA 4F7UF 3CMAA 4XTZA 1QQ9A 1UGSB 1YJNT 5KYWB 2LQWA 2QQRA 2Z11A 2X4XA 5EBVA 4RS2A 3RMSA 5KCOA 2IVWA 4CS0B 5I2MA 2HC9A 1Q7YC 2JBKA 4F0YA 1SHGA 4JPBW 2RMOA 3OW2P 5LYIA 2B3VA 2Z3LA 1VQLQ 2MWOA 2KT8A 5IN1A 4CYOA 4KSAA 1U1TA 3P8BB 1V0CA 2PJBA 3PBBA 4KOXA 4OLLA 1VQKQ 3I56A 1KHIA 1PUAA 4KOSA 2CSQA 1M8VA 3ISXA 1WDXA 1R0CB 3N5BB 4MFPA 2Z0WA 4WF2A 4ZY1A 1TTHB 2I79A 3SHWA 5F47A 2EGCA 3CCEQ 3JB9H 1GYTA 1TXRA 4XU0A 2LT1A 1WJRA 1DJ7B 1T3SA 2HBWA 2JTEA 4M7AG 4R87A 1MHNA 4OIWA 3E19A 2QA4Q 2IL4A 1JXOA 2QK0A 2Z3OA 1ABQA 2R57A 3UPUA 2A4NA 1I5LA 2L5QA 1QSOA 1OEBA 3LX7A 3JCMP 4N4GA 2BEIA 4FT2A 3OYDA 4Z02A 2K5IA 1CPSA 2OX7A 1ACMB 1MV0B 3HRTA 4P4JA 2EBPA 3C94A 2F1LA 3C95A 3R6NA 2ATRA 2OZGA 1ELLP 1ZUKA 3T9YA 4MFKA 5IHIA 4C8QD 3SHPA 2JMAA 4ZY2A 3H41A 3OS2A 2F5KA 3CXQA 2OOTA 2O4XB 5D6XA 3M9QA 1KC8C 4MXUA 3BJ8A 1K73R 4QW2A 2FCKA 4Y91A 5GAN2 2DPPB 4BB7A 2VASA 3SFMA 2J8RA 5KYWA 1S72T 2PVGB 2COYA 5GAOl 1Z2LA 1M1GA 4AVAA 4OP0A 3REBB 2QQBA 1NJIR 2VV5A 4C92B 2H5MA 3D4UA 2KROA 4E2FB 2C6GA 5IB0A 2P6FA 3WVEB 3O5ZA 5FU7C 1QSRA 2PVVA 3KBGA 3QAYA 4CC3A 1QCOA 1ZA2B 2D8JA 1VQOQ 3VATA 4MHPA 2HQEA 3GYAA 4YRHA 2QJ8A 3HL8A 4BI4A 1I07A 2OAUA 1D1AA 5JM6A 2LX7A 3DNSA 3GF5A 2FL4A 3JCMX 5A2QE 2CZ1B 4PSWA 2K9GA 3JTKA 3P8HA 2L89A 2DAQA 3DB4A 2C0OA 5GAN8 5GAOp 1XF8A 1Y7RA 1Q81C 1OU9A 4JRKA 2COWA 5LJ3h 4JZ0A 3DLLA 1SSHA 4W9YA 3H0FA 1UJYA 3CC2A 3BDLA 2DK3A 1Y7XA 1U3OA 2F69A 1UE9A 1KK7A 2DL4A 1PRMC 3BFMA 3PVQA 4MDXA 1KD1C 2D0QB 3TSWA 4C0DB 1IXDA 5KTCA 5J1QA 3SWNB 3JCMh 2B4BA 1YITA 1GCQA 5KYXA 1K0XA 1UGVA 2BTTA 2DBMA 2O4XA 4PJJA 4JLYA 3PGPA 3L2ZA 1TH7A 3VYHB 4JS5A 2HDAA 4X1VA 3CCVQ 5LJ3f 1S60A 1RADB 2C6PA 4BACA 2CP5A 1WK4A 2RQRA 1YW6A 1X6BA 2V8DA 4Q36A 1QVGA 3EGXB 4F17A 3ZEHA 2ZPFB 1M90R 3ZFJA 1HXDA 2HQHA 4KGVB 3OW2A 2IPOB 4OMFB 3CCJA 3IWEA 1Y9KA 4B12A 1M8MA 1FMVA 5CR2A 2GIVA 1KQSS 1Q81R 2MMPA 2Z3PA 2DXCA 4MZTA 4TWEA 2PR8A 5KH6A 2KI7A 2D8HA 1QSNA 1VQ8Q 2ZZDA 3QUIA 3CPAA 4Q7AA 4LD9K 3NFZA 1K8AR 4BE2A 3P2HA 3CC7A 2DTIA 4PPZA 4NF1A 1XQHA 4F14A 3I5RA 4A2ZA 2KBTA 3LMSA 3HTRA 2EYZA 2O31A 2VEZA 3DDDA 2M9UA 2YDLA 3JB9J 4HCBA 2HCKA 4IK2A 3D8PA 4LNPA 1UWYA 3D7HA 2EJFA 3D2MA 2EWBA 5KYYA 4EVYA 4FU6A 4IKFA 3OBYA 3MEWA 3SD4A 1QW1A 4NGQA 3M4GA 3VS4A 2XDPA 5LRGA 4GLKA 4OVAA 3TREA 4AT1B 4C0ZA 2E3IA 2E3HA 1RAGB 3F5BA 1IRXA 3JCMc 3RAMA 4PQAA 4OMNA 3G6EQ 3CC4T 1TUDA 4M6HA 4GS4A 4PFOA 3OS1A 2DZ9A 2D1XA 3B2YA 4BBHA 3TCJA 2P0PA 3PFEA 1BK2A 1WYXA 1XTDA 3CCQA 1VUBA 2DL3A 4CGPA 4E7IA 4AVBA 4U9YA 5CPAA 1VQNT 4MMOA 1OX9A 2AIRB 2AFXA 5AYFA 2CH4A 2QEXQ 4CAFA 4YU9A 2EQIA 2KAFA 4UCNA 3EG9A 1G3SA 3THKA 2PUKB 3L2NA 2EQJA 3CPFA 3B3SA 1WZOA 5J26A 3QO3A 5G1ZA 2V26A 1K0SA 2OTLA 4A32A 4KZTA 2K4YA 4P4DA 4X5KA 2RM4A 1MNDA 3CCLQ 1K9MC 5IXFA 4PJOC 4XNHB 3UDCA 2W0ZA 3JAME 1W2BA 5FVJA 2RHYA 3JCMg 2X3XD 4J7FA 4TNUA 1U06A 5H84A 3UA7A 4CGLA 3MRUA 2PQWA 3D67A 5LJ5h 1D3BA 4XQ3A 3OYJA 3WABA 5KYUB 4NL3A 2CTCA 1M3AA 2NUZA 3FLGA 4E7HA 4OAEA 1R8OB 4M7AF 4AG1C 1Q86R 4BY6C 5F46A 2OZUA 3FH4A 4PFPA 1DTDA 2M0OA 4PXCA 4QKUA 2OTLQ 3UY5A 3I56T 1M3BA 1WNLA 1KIKA 2ABZA 1BYMA 3LD2A 4C92A 2CP2A 2X4YA 5KTDA 1RI0A 4HCZA 1QMUA 1NSAA 4Z65A 2QQ9A 1YLEA 4C2YA 4D6WA 3S6FA 3FB3A 3EFRA 2ZAEA 3TX8A 1D1CA 4JRIA 2WUUA 2H8HA 2EYXA 1R77A 1UFHA 2HMAA 4ZN1A 3CCEA 3GKRA 2DL7A 1S7LA 2G3AA 4MY0A 1BI2A 2KRSA 3CCRQ 1PD1A 2ED1A 1RL2A 3GY9A 2A3LA 2XK0A 4MI4A 1IYKA 2YNCC 4BDYA 1YVKA 1UFFA 4X9CA 3CCET 1KQ2A 4NCZA 1M2VA 4DBQA 4DQ2A 3G3SA 3NH5A 1XIXA 5F09A 5J8CA 1BB9A 2DXUA 3SI0A 4LDXA 3GLJA 1TOVA 4A31A 1QCNA 2OAWA 2Q4YA 4QQDA 3SWNC 5LYLA 2PZ1A 3SJXA 1VQ4Q 4ZX8A 2EAYA 1AMPA 3D3SA 5KYXB 4GLMA 4AVCA 1GCPA 2QG9B 4HCCA 4M7AA 5LYFA 1CM0A 4R57A 2PVOB 4RG8A 2Z0ZA 5CKHA 4C8QF 3OS0A 2HKNA 3V8JA 5GANh 4OC5A 2P0QA 2KNBB 1QWEA 4M77A 2BCOA 3ISZA 5K8OA 2RHIA 1FT7A 2ZW4A 1WGSA 2LC4A 5KE3A 1YQEA 5THWA 2PNIA 3G4SQ 3QBYA 4J9EA 4DOVA 1VQ5Q 1A2ZA 2LX9A 4M75D 4ELYC 4MHDA 1Y0MA 2PIYA 3REAB 3CCJQ 3S6KA 3TC8A 2QA4T 3NE8A 4WWVA 3FEEA 2DKGA 3KKWA 3CCSQ 1Z9QA 3OYCA 4XPKA 5DM7R 4RI1A 1D09B 2CS7A 2Q4ZA 2D4OA 1WHJA 4CRIA 3FX6A 5J8FA 1MMAA 4D8DA 5I2SA 2K7AA 1NM7A 4K11A 1D1BA 4KULA 3S3NA 1HYOA 2KYMA 1AZEA 4NGTA 1S3ZA 2FPDA 1HD3A 1PKSA 2CT4A 4XU3A 3EHQA 3B35A 5M9OA 5HY6A 2E64A 4UCMA 4PLIA 4M7DC 5HVHA 1VIEA 3B8GA 3ER0A 1IICA 3IWGA 1YWPA 1LPLA 4LE9A 2PR1A 5BWAB 4N0AC 2ZCFB 2XG8D 1BPNA 2AE6A 1QKXA 4HXJA 2FZGB 4D8KA 2K3YA 4O5VA 4PJNA 3TOBA 4LQ6A 1HJDA 3CT9A 2J6OA 3M59A 2CUBA 2DZCA 4FYXB 1JQQA 1TUGB 2MYSA 1NG2A 3A8MB 3S9LA 5CKEA 3R96A 5GAMh 3QB8A 3CPWS 1Q82U 2CUDA 3K2KA 3KXTA 2ECZA 4M7AB 4MZMA 4UFVA 4JS4A 1VYVA 1N8RU 3CD6T 2E41A 2HD0A 2JS2A 4L59A 4FT4A 1JB0E 2ZGWA 4EMEA 3CCJT 4RTWA 2CP3A 4LN2A 1JJ2A 4UFXA 2E6NA 2ANPA 1OV3A 3RR6A 2DVEA 3BXMA 5J3BA 5A28A 2Q44A 2CNMA 4GXHA 2AT1B 2AFMA 2BE7D 2E12A 2RFHA 3HRUA 4M7DE 3DSBA 4OC0A 1Y7EA 4FSXA 1PNJA 3EG9B 1IIDA 3CD6Q 4JJCA 4NGPA 1N8RC 2DIGA 5AT1B 3UT1A 3PB4X 3U23A 1OPKA 3DLJA 3G4SA 4QVTA 1B34B 1QVFP 2DLPA 2HEQA 4RG2A 4OIDA 4ZY0A 1VHEA 4P6YA 1Q2DA 5ISVA 1TSFA 2QAZA 4UEFA 1VQOT 3BDUA 4RTXA 2ZEHA 5FRMA 1YI2Q 3H8ZA 2QDLA 1PD0A 3DR8A 2ZXVA 1AWJA 4YFJA 3M0QA 4M78F 3D7FA 1KFZA 1OULA 1KG1A 4JJXA 4AFQC 3D68A 1YJ9A 2HBPA 2VGNA 5CO7A 2ZEGA 2EJGA 1YI2T 2K3BA 1X10A 1ARKA 4X9DA 1BI0A 4UF4A 2ARHA 1D0ZA 1WPYA 2PUOB 4NGNA 2EGEA 2F2WA 5IV0A 2XEFA 3FC3A 3EFSA 4NEXA 1YR0A 3TEEA 3T90A 2VZYA 5AG4A 3G6EA 3DLMA 3CCQT 1CG2A 3QNVA 4HT9A 4AFUC 2KRNA 2YSQA 3A9LA 3JRUA 1GFDA 4M77F 3JB9I 5GAMg 2CNSA 2FVGA 4PXEA 2DETA 3A8GB 1IU8A 2AJ6A 2B5GB 1PCAA 3VUZA 2QVPA 4IF5A 2PJ3A 1K8AC 1IREB 3WT4A 2O4HA 2GBQA 4M7DG 3WC7A 2COZA 1YCSB 3QJ6A 4YTLA 5IAYA 1FNOA 4KVME 1NLOC 1X6GA 4PSXA 4MJ8A 4AB7A 1Q7YU 4EMHA 1BPMA 2KCWA 2VWFA 1I0CA 4MZPA 4WTOB 2O53A 3KQXA 4NGSA 1IOFA 1VQ7T 2WSAA 2GTOA 1T0JA 2JT4A 5AGEA 3CMEQ 2VVKA 4NOYA 1VQ6A 3IGRA 2HKQB 3B7IA 4DEXA 3OYIA 2CY2A 3D66A 8AT1B 3PNWC 2JDDA 1N6AA 4II1A 3S3OA 1SQHA 2LCCA 2O88A 2REFA 1M9SA 1Q2CA 2DRMA 3H6ZA 3M56A 1NEBA 3GIUA 2ED0A 1WQ7A 2PU9B 4MFLA 1JJ2S 4C2ZA 1M44A 3FNCA 5I0CA 1RAIB 1NJIU 3BHXA 1QVFA 4ZYQA 3M55A 2PJ1A 2H3EB 4IUQA 3ZZIA 1P92A 4KS9A 9ATCB 1UHCA 2J8NA 2CSIA 5FU7B 5GMKj 2IQ6A 3PIPA 3LGLA 1M4DA 1M4GA 4EFDA 2X7BA 4Y92A 1ZX6A 1BI3A 4A63B 5GANg 2ZEPA 4JXQA 3PB6X 3LH0A 2LMJA 1EIFA 3M57A 1VKCA 2QIRA 5LYDA 4B13A 1JU5C 4BMHA 4DUKA 5AG7A 2CGHA 2K5FA 3I9QA 3HHTB 5FWCA 1VQMA 3HUVA 2D0NA 1Y0YA 4C92G 4IHMA 3IO1A 1X12A 2E65A 4EDUA 4JRPA 1K4JA 3KZWA 2X35A 1CSKA 4ZN3A 2BUDA 2FL7A 2R98A 2R7HA 1S72A 1VYUA 2E6ZA 3MGDA 1Y9WA 3FBUA 5FU6C 4IIOA 4KRTA 5GJVB 2G3RA 3L2RA 4Q38A 1BAVA 4LX9A 3V7CA 4XPDB 2REEA 4PJMA 1VQ7Q 3CC7Q 2GTJA 4TVRA 2XEJA 1RAAB 2DBKA 2RH2A 4A33A 4BI8B 1M90U 3H0IA 2PVDB 2JLMA 3GLXA 3W91A 1NYFA 3GIBA 1YLOA 4K30A 1XRYA 1ZUYA 1B07A 4MCSA 4M75E 3SXOA 3M0UA 1M1FA 4MFZA 2L3QA 4NXYA 3A1PA 2QI2A 1M4LA 4L5GA 3OSVA 3C12A 2CIJA 4CYQA 3CBOA 2ZEMA 4C5HA 1RXTA 2P6GA 1K73U 2P6EA 2LJ0A 4MBUA 5FLXE 2RQVA 5CNPA 1X69A 4UWJA 2BZXA 1W6XA 4NJQA 4ORFA 1AT1B 1JO8A 4F6AA 5JH9A 1UHFA 3G8WA 5LJ5g 4XU1A 4M7DF 4ZTJA 3B3TA 1M1KR 2FSRA 4C92F 2WPXA 2NUPB 3LYIA 3KHZA 1TU0B 2GQVA 4N4IA 4C0FA 2LTOA 2NUTB 2FS5A 2NMTA 3EGUA 4CPAA 2HV2A 4OC4A 2M1HA 3E0KA 3M0PA 2JM8A 2ZOFA 2QGFB 2XU8A 1S1NA 5GMKh 4UEEA 1PSEA 3E1SA 4QUSA 5LJ3e 2LQKA 5IT9E 2YLCA 2GF7A 4Z89A 2GREA 1RTQA 3PE0A 1VQLA 4A38A 2R5AA 4X34A 2PJ4A 4PK2A 1UDLA 1OZ3A 2MPXC 3J81E 2FO0A 1Q86C 2PJ8A 4OF1A 4B11A 2KEAA 1D0XA 2KGTA 3CC4Q 2BL1A 1VQLT 1C6VX 4HVWA 1LAMA 2E1HA 3CD6A 5GMKl 2E5KA 2PRBA 2XHCA 2JS0A 3OQ5A 5CKBA 1KUXA 1UUEA 2JW4A 3UATA 3CCUT 2J9AA 3FJUA 3H8EA 2Q4VA 4N0AA 1WI7A 2KQWA 2Q0YA 1RAEB 3VRZA 3CCST 5HMNA 3PVLA 3B3CA 2QEXT 3VKIA 3CDXA 4C92D 2EBJA 1XJOA 2ZEDA 1ZHIA 2RB6A 1WIEA 4NFRA 3ULRB 1YWOA 5CK9A 1RAHB 4J9DA 1XE4A 4J9BA 1IGUA 3IEHA 1WHHA 2DMOA 2JVVA 2K57A 2VXFA 1AYEA 1PCXA 4E8OA 4BY6B 2GGRA 3J7AF 1VQ6Q 1LOJA 1WLPB 2M16A 4FCYA 1VQ4A 1U6MA 1FMWA 2ROLA 4ONWA 3KASA 3CEYA 4PJLA 4M3SA 2FZCB 3QWXX 4C8QB 3CC4A 2QQAA 4L89A 2H3JA 4M7DD 4QVDA 4EMKC 2RK1A 1ZLIA 2DYBA 1ZG7A 3L2UA 3JCMb 4M6IA 2WSEE 3EG0A 2OTJQ 1Y71A 3CCVA 4DYOA 2EO8A 1VQ4T 2KT1A 2KVQG 4XU2A 2DERA 1K9AA 4A4GA 8CPAA 3JCMQ 1QVPA 2EK8A 2RHZA 2HL3A 5GANf 1LFWA 3I1UA 5GMKi 4FD7A 2DL5A 1VGYA 4EMKA 3EXNA 2Z10A 1TS9A 5EMIA 3CCVT 4XTXA 1PHTA 4UA3A 1X2KA 2CT3A 1UB4A 3R9GA 3SWNA 2F7VA 3NA6A 2FRYA 2MAMA 4IUPA 2FEIA 2HB6A 1R43A 3MN8A 1YJ9Q 2I00A 1VQPA 2FG0A 1YMEA 3LODA 4F9VA 2YNDA 2DILA 4EIKA 4ZGEB 2ZPIB 3SI1A 4AFZC 5HVFA 2D9TA 4BI3A 2DJZA 4PJOF 4DA4A 4OMEA 3CMAT 1VQ6T 1YJNA 3V8LA 3I35A 3V8KA 2GQIA 1YHQQ 2YRVA 2B86A 4MHZA 1YN8A 2JJ9A 2M51A 2JN0A 4PV6A 2YT6A 4FW1A 4OGCA 2FXFA 5GAMj 5D6WA 2ZELA 1NSLA 4EMGA 3CXPA 3F70A 4C8QG 3H8GA 3CXSA 2JEWA 4MMKA 2YWWA 5CQYA 2B3UA 1LNXA 4CC2A 1GXIE 4BUGA 4XPDC 4MHNA 1QQJA 3DGVA 1Y57A 5GAMf 5JGFA 4F7UG 5DLOA 3VJPA 1NEGA 4R0KA 3EG3A 1VOMA 2DD4A 4A30A 1YITQ 5HCKA 5KE2A 2VI7A 2V8JA 2EYQA 1SF9A 5KYYB 3GNGA 4OB3B 3CQTA 1K4US 4IIMA 1ARLA 3FXTA 3QAHA 4XTUA 2FHDA 5EG2A 1OU8A 3MCAB 4OMPA 5HK3A 4DNCA 2PC1A 1PM3A 1LOKA 2E10A 1XEBA 4C0DC 1KZFA 2FE7A 3QXEB 5HK0A 1PYTB 4E7KA 3EO4A 3RESA 2JXBA 3PGGA 3CCRT 4RTZA 4OB0B 3P8DA 5GAN5 2FZKB 2NUPA 4F0XA 1PKTA 2A36A 1UECA 1AEYA 4KOYA 4M7DB 4KORA 4A39A 2NUTA 2F2VA 2ZPAA 1BBZA 2PJ5A 3JCMd 2KDSA 1BCMA 3JSCA 1PG5B 3CCRA 4OKOA 5HKCA 3SB2A 4CGOA 1M4IA 1SHFA 3D7SB 4FIBA 2AFSA 2G6FX 3I55Q 1HDQA 4MMLA 3MEAA 3X26B 5GANj 4UBRA 2DPTA 4QQGA 1S5KA 5FW9A 2KYBA 4H6UA 1MGQA 3VS3A 3PB7X 5J39A 3UF4A 1RACB 1ZQ1A 1N9SA 4ME7A 2Q7BA 2MOXA 3OYMA 3WC6A 1W4SA 1MJ9A 1J4JA 1OPLA 4MCRA 4O23A 4J5YA 2RQUA 4A4EA 3HRSA 1VQ9Q 3KQZA 2QMLA 1BKBA 4HT8A 4Y49B 5CIUA 1I81A 1F57A 1YFNA 4A4HA 3CBMA 4GM5A 3QIIA 2ZENA 1D3BB 2DE0X 2P4RA 2XICA 4F16A 1YJWA 2PJ9A 1UG1A 3M58A 3RKXA 3RERA 3R6OA 3CPWA 4JJNK 5LJ3d 1L0CA 1KSWA 1SSFA 4HNXB 4RMOA 2M02A 2XD0A 3R95A 3EH2A 1AHJB 3S9NA 1E6GA 2EQKA 4J9IA 1PSFA 2DXTA 2PE3A 2LJ1A 4OB1B 4PK3A 4XNHC 4CI0C 3VV0A 1IB1E 3I55T 5CAIA 2NLUA 3OSSC 1M4ZA 1ZLMA 4HPSA 2EVNA 2RF0A 5AG6A 3V38A 2C0IA 2YNEA 3URGA 4C8QC 2XIDA 1KC8R 4C8QA 4PL6A 1KWMA 5K8NA 4P4BA 1SPKA 4IAVA 1U8RA 2P0WA 1Z9ZA 4PNOA 2DVJA 3C26A 3VWDA 2POKA 2B8AA 3QYHB 4PJOG 4KVOE 2K3XA 1ZUUA 2JNGA 2CREA 2MIOA 4A94A 3PTAA 1M2VB 5DLQE 3OBWA 4JLIA
chains in the Genus database with same CATH topology
3VS2A 3E9GA 1AWOA 3FJPA 3LWIA 4JLGA 2A28A 2KSSA 1KC8U 2SRCA 2EKOA 3CCSA 3L1AA 4ZNXA 2AK5A 2EWNA 1HSQA 3IQLA 3FRNA 4C8QE 1NZ9A 1VA7A 1I8FA 2DD5A 4Z88A 2D6FA 5CKFA 2EW3A 3MEUA 4JUVA 2EPDA 3X20B 1T0HA 5CCAA 1LJOA 2FPFA 2F2XA 3RKYA 2OTJA 2QXFA 4J6XA 4DEYA 4BE1A 5IHKA 1MV3A 3X24B 1JWQA 2DRKA 1V29B 4IURA 4VUBA 2VYTA 4C5GA 5LL6S 1LCKA 1IZ6A 4V2SA 4E7JA 4Q5WA 2V1RA 1J3TA 2Y4XA 1VQ7A 1PRLC 3X25B 2J6KA 3JB9G 3EHRA 3M0RA 4IUUA 2Y90A 2JTMA 4OMLA 3OYAA 3KFVA 4C92C 3HP9A 5GAOr 2X4JA 2RI2A 2KRMA 2QTXA 3GPLA 4OMMA 4J9GA 3BW1A 1W2BS 1NLPC 1O75A 2IG0A 4M7AC 2LT4A 3LW5E 3VS6A 5GJWB 5DY9A 3TU4K 1X2QA 4AG2C 3M4YA 3CCLT 4UC4A 3A8HB 2XI9A 4CC4B 4J9CA 5A0LA 2LP5A 2JUFA 1B34A 3J80E 1YBYA 2OI3A 2WACA 4RTTA 2L3SA 3CCLA 1VQMT 4RTYA 3SEMA 3VS1A 1NPPA 4DOWA 2V8IA 2DTOA 1BIBA 4A53A 1G3WA 2RJDA 1KQSA 3S6WA 1VQKT 5LJ3j 2K2MA 1WJSA 2J7IA 2C06A 3LGFA 4M75G 1M90C 2KE9A 4F7UB 4XTVA 2EYWA 3PFSA 1VQKA 4JZ3A 3QG1A 4PJOD 2RI3A 3AHUA 2AKLA 4HVVA 4KUIA 1G83A 1AOJA 2L8DA 3OMGA 1H3HA 3TVTA 2RI5A 2K2VA 3OYBA 3NMZC 3MEVA 3EAEA 5ECAA 4IUTA 1UEBA 4ESRA 3JCMV 1K8AU 4M78A 5FROA 2QDYB 3OYHA 3L2WA 1VQ9A 3LH5A 4PKCC 5LJ3g 1HK9A 4Y28E 1VQ8A 5L23A 4JJBA 3L2VA 4M75F 1QP2A 2EJ9A 3RUXA 3S3MA 3QSUA 4L6V5 2AZSA 2GFUA 1KJWA 1YIJA 3VRYA 1QP3A 1Y07A 3ME9A 3A8OB 5GAN6 5GMKm 3I55A 4ZGDB 3G71T 1M27C 4FSSA 2DXBA 2AZVA 4JZ4A 5CVIA 4J9HA 5LJ5f 4KUDK 3OYEA 1E7OA 2M0YA 4J9FA 4C92E 4QVCA 2ODFA 5FU6B 2RD1A 2VKNA 1AD5A 2FYKA 4C0GA 2LCSA 3VS5A 1Q82C 3X28B 1QVFS 2MWPA 3C0CA 4B9WA 3GBQA 4JDSA 2FRWA 4A4KA 4EPCA 4FL6A 2RJCA 4O6JA 2EVRA 1FXXA 5EC7A 1K9MU 4M77G 2I0NA 3OYNA 3TSZA 4M78B 2CH4W 2KK4A 4E6RA 2K6DA 3M0TA 2K5LA 1K73C 3JB9F 2X4WA 2CZ7B 1WFWA 3CMEA 2WSFE 3CZXA 2FPEA 2LDMA 4LDYA 4R55A 4RTVA 4M78G 1U1SA 4JRQA 1EFNA 4M77B 4E47A 1Q86U 1OYXA 3HPWA 1RUWA 3CMET 2MF2A 3NPFA 2QQSA 4QQ6A 1FWZA 3VYGA 2GNCA 3PMIA 4P5NA 3META 3OYYA 1ABOA 2FVUA 4XK8E 2V8KA 4BDZA 1KQ1A 2VXEA 3G6ET 2J05A 1ZBJA 1G3TA 2DX1A 3PT9A 2DF6A 3WVDB 3M54A 2DEQA 5GAMd 2DA9A 4HA8A 2BIVA 2GFAA 1GBQA 2V1QA 4PJOA 2L3RA 2YUPA 2GCXA 2HSPA 1G5VA 1X43A 1KHCA 1Y96B 2A08A 3A5ZB 4GBQA 4F7UA 1VYTA 1GBRA 2VC8A 1NE8A 2A7YA 1JRIA 4J83A 3NTKA 4QT7A 1NPRA 3JV3A 2L3PA 2OJ2A 1N27A 4ZGJB 1A0NB 3JCMf 3DB3A 2R5MA 3CCMA 2XDDA 4WCIA 3QPHA 2SEMA 5IXBA 2RJFA 5D6YA 2P4TA 2PTKA 1UGPB 3RNJA 2X3WD 3JRZA 4GY5A 2JZ2A 3T9NA 1H3ZA 4LD6A 4FM4B 4N4HA 1GL5A 3OW2S 3QZ5B 1V1CA 4NS5A 1X6OA 1K1ZA 4C5IA 2CDTA 1GRIA 1QKWA 2HAXA 1AZGB 3NTHA 3OYFA 3C4SA 4PJOB 1M3CA 2HNIA 2ZPGB 1KD1U 4HVUA 3GOXA 5GMKe 3OYLA 2DL8A 2E5QA 3NTIA 3EG2A 2RPNA 1Y96A 3QWYA 4M7AD 2KY9A 2EQUA 1BI1A 2O01E 2DO3A 3OYGA 4RKUE 4J6YA 4LUEA 1NJIC 2ZPBB 5CQXA 4C5EA 4M77E 3NGPA 3G7ZA 1I1JA 1ZBXA 4M77D 2QA4A 1YJWT 4LUDA 4ATOA 1WX6A 2J6FA 2EFIA 1BIAA 3HSBA 3MHXA 1WA7A 1WXUA 4JJDA 4M78E 3QDRB 4ORZA 1MUZA 3QHSA 4M78D 1JEGA 1Q81U 1YIJT 1M5Q1 3LWHA 3FIFA 2RJEA 2EQMA 2LJ3A 3PIOA 3DKMA 4XAXB 3HFNA 1UJ0A 4ELZC 4RCBA 3VS0A 3HFOA 4NL2A 3A8LB 4LDVA 3MP6A 3SDZA 2MCNA 2LNVA 1SEMA 4B9XA 5KCHA 3V7RA 5GAN7 2W10A 2RQWA 2MI6A 3CCUA 4LDWA 2A37A 3V7SA 3G4ST 4BINA 2QEXA 2RO0A 1G2BA 1NYGA 1VQOA 3VS7A 3JB9D 1RLPC 1N5ZA 5GANd 2OTJT 2O9SA 2HQXA 1OI1A 1K76A 1WQWA 2AKKA 2YLBA 2J06A 1JBMA 3QYGB 2K79A 4R56A 1VQ5T 2BKDN 5FWBA 5GAOn 5LJ5e 3VUBA 2CKKA 1W70A 1VQ5A 2JM9A 3E9FA 1XOVA 3HKSA 1I4K1 1YHQA 1X27A 4KT0E 1H92A 2NWMA 4BD3A 3MP1A 4M75B 1OZ2A 1O9SA 3L2QA 1AVZC 2ZPHB 3QJYA 3RIRA 2DJQA 2I2LA 3INZA 1VQPT 4OB2B 2EIFA 3JCMe 2E70A 3ASKA 1UGQB 2OTLT 4M4ZA 2LZ6B 1GFCA 2CYZB 2ESWA 1UGRB 3RMQA 3NFCA 3CBPA 1ZSGA 2ZPEB 3M5AA 4KBMB 3OA6A 1IO6A 2YUOA 2CZ0B 1QCFA 4OMOA 2LNHB 2Y4YA 3CXCS 1PWTA 1QVGS 5FRNA 4IUVA 2DTHA 3A98A 2WSCE 2RHUA 5A0DA 1N9RA 1JXMA 1QLYA 1RI9A 4M6GA 3PMTA 5I11A 4M7AE 2LCLA 3CCMT 3Q1JA 5GANe 2VGMA 5IHNA 1WXTA 1U5SA 3MP8A 2KR3A 2IIMA 4A54A 4A4FA 1G3YA 5GAOm 2DNUA 5C0MA 4M75A 2R58A 3OBWA 2LRQA 1BU1A 5A0GA 3FJ5A 2L0AA 2LQ8A 2YUQA 2AHJB 3QKJA 3OY9A 3O8VA 4QVZA 3GP8A 3L42A 2YHTA 3GNFB 3OMCA 3ZBDA 2XMFA 2RK2A 4EMKB 1CKAA 4BE0A 1WJQA 3H0HA 3RKWA 1T3LA 5LJ5d 1VQ9T 1YCYA 3WXMB 1VQ8T 5GAMe 2FB7A 2C0TA 3RBBB 4HCKA 1FX7A 2KXDA 1H641 4OMQA 1M1KC 1X75C 4RTUA 4M75C 3CC2T 5L8RE 2YUNA 5GAN3 1SRMA 3G71A 3M0SA 4PLLA 4OGEA 2JMCA 2JTFA 4J8OA 3KUFA 1YITT 5GAOq 3I5SA 3OS5A 1UTIA 2BZ8A 4RN7A 2P0KA 1AWXA 3UWNA 2RQTA 1SRLA 3FEOA 3OB9A 4J6WA 1WXBA 2EKHA 3OYKA 1CKBA 1VIFA 4J7IA 1OOTA 2BZYA 4XTYA 2EGAA 4AFSC 3ZL7C 5I22A 5I21A 4F7UE 2RNAA 4LDUA 2DM1A 2DIQA 1FMKA 3LLRA 2Q7SA 1H8KA 3FDRA 4E7LA 4M77C 2XDBA 4PJOE 1YNZA 3CC7T 4XTWA 1TG0A 1W1FA 2JOYA 1AWWA 4CC7A 3EG1A 2O9VA 2LVMA 4RUGA 4Z8AA 2RN8A 2KXCA 2L2PA 2RA2A 1M30A 3CXCA 2RHXA 4M78C 3M53A 3JCMW 2KMTA 4M7DA 2ENMA 4RCCA 3FB9A 4MDWA 5GAN4 4HKEA 3VU3C 5C6SA 3MO8A 1QWFA 3NHNA 1E6HA 2EYYA 5IH2A 1YJ9T 1RLQC 5CKDA 3JCMJ 1YI2A 2ABLA 2XKOC 1X01A 1VQNA 3BY7A 4ZTFA 1GCQC 2CZ6B 2F5TX 3UA6A 2VUBA 1YHQT 1M1KU 3QZ9B 2LQNA 1YP5A 1XNIA 1TUCA 1B3QA 1FYNA 2O2OA 2ROTA 4F7UF 3CMAA 4XTZA 1UGSB 1YJNT 2LQWA 2QQRA 2X4XA 3RMSA 5KCOA 2IVWA 5I2MA 2HC9A 1Q7YC 1SHGA 4JPBW 2RMOA 2MWOA 2KT8A 5IN1A 1U1TA 3P8BB 3I56A 1KHIA 2CSQA 1M8VA 1WDXA 3N5BB 4WF2A 3SHWA 2EGCA 3JB9H 4XU0A 2LT1A 1WJRA 1DJ7B 1T3SA 2HBWA 2JTEA 4M7AG 1MHNA 3E19A 1JXOA 1ABQA 2R57A 3UPUA 1I5LA 2L5QA 1OEBA 3LX7A 3JCMP 4N4GA 4FT2A 3OYDA 4Z02A 2K5IA 1MV0B 3HRTA 2EBPA 3C94A 3C95A 3R6NA 1ZUKA 5IHIA 4C8QD 2JMAA 3H41A 3OS2A 2F5KA 2O4XB 5D6XA 3M9QA 1KC8C 4QW2A 4Y91A 5GAN2 2DPPB 4BB7A 3SFMA 1S72T 2PVGB 5GAOl 1M1GA 3REBB 4OP0A 2QQBA 2VV5A 4C92B 2KROA 3WVEB 3O5ZA 5FU7C 3KBGA 3QAYA 4CC3A 2D8JA 2HQEA 3HL8A 4BI4A 1I07A 2OAUA 2LX7A 3GF5A 3JCMX 5A2QE 2CZ1B 2K9GA 3P8HA 2L89A 2DAQA 3DB4A 2C0OA 5GAN8 5GAOp 1Q81C 4JRKA 5LJ3h 3DLLA 1SSHA 3H0FA 1UJYA 3CC2A 3BDLA 2DK3A 1Y7XA 1U3OA 2F69A 1UE9A 2DL4A 1PRMC 3BFMA 3PVQA 4MDXA 1KD1C 2D0QB 3TSWA 4C0DB 3SWNB 3JCMh 1YITA 1GCQA 1K0XA 1UGVA 2BTTA 2DBMA 2O4XA 3L2ZA 1TH7A 3VYHB 4JS5A 2HDAA 4X1VA 5LJ3f 4BACA 2RQRA 1X6BA 1QVGA 4F17A 3ZEHA 2ZPFB 3ZFJA 1HXDA 3OW2A 4OMFB 3CCJA 1M8MA 5CR2A 1KQSS 2MMPA 2DXCA 4MZTA 5KH6A 2D8HA 2ZZDA 3QUIA 4LD9K 4BE2A 3CC7A 2DTIA 1XQHA 4F14A 3I5RA 2KBTA 2EYZA 2O31A 2M9UA 2YDLA 3JB9J 4HCBA 2HCKA 4LNPA 2EJFA 4FU6A 4IKFA 3OBYA 3MEWA 3SD4A 1QW1A 3M4GA 3VS4A 2XDPA 4GLKA 4OVAA 3TREA 4C0ZA 3JCMc 4OMNA 3CC4T 1TUDA 4M6HA 3OS1A 2DZ9A 2D1XA 3TCJA 2P0PA 1BK2A 1WYXA 1XTDA 3CCQA 1VUBA 2DL3A 4E7IA 1VQNT 5AYFA 2CH4A 2EQIA 2KAFA 3THKA 1G3SA 2PUKB 2EQJA 3CPFA 5J26A 3QO3A 1K0SA 2OTLA 2K4YA 2RM4A 1K9MC 5IXFA 4PJOC 3UDCA 2W0ZA 3JAME 1W2BA 2RHYA 3JCMg 2X3XD 4J7FA 1U06A 3UA7A 2PQWA 5LJ5h 1D3BA 4XQ3A 3OYJA 4NL3A 1M3AA 2NUZA 3FLGA 4E7HA 1R8OB 4M7AF 4AG1C 4BY6C 2M0OA 3I56T 1M3BA 1WNLA 1KIKA 1BYMA 4C92A 2X4YA 1RI0A 4HCZA 2QQ9A 4D6WA 3EFRA 4JRIA 2H8HA 2EYXA 4ZN1A 3CCEA 2DL7A 2KRSA 1BI2A 2ED1A 1RL2A 2A3LA 2XK0A 4BDYA 1UFFA 4X9CA 3CCET 1KQ2A 4DQ2A 1BB9A 2DXUA 4LDXA 2OAWA 4QQDA 3SWNC 2PZ1A 2EAYA 4GLMA 1GCPA 4HCCA 4M7AA 2PVOB 4RG8A 5CKHA 4C8QF 3OS0A 3V8JA 5GANh 2P0QA 2KNBB 1QWEA 4M77A 2RHIA 1WGSA 2LC4A 5KE3A 2PNIA 3QBYA 4J9EA 4DOVA 2LX9A 4M75D 4ELYC 1Y0MA 3REAB 2QA4T 3NE8A 2DKGA 1Z9QA 3OYCA 5DM7R 2CS7A 4CRIA 4D8DA 5I2SA 2K7AA 1NM7A 4K11A 4KULA 1AZEA 3S3NA 2KYMA 2FPDA 1HD3A 1PKSA 2CT4A 4XU3A 3EHQA 5M9OA 5HY6A 2E64A 4PLIA 4M7DC 1VIEA 3ER0A 1YWPA 4LE9A 4N0AC 2ZCFB 2XG8D 1QKXA 4HXJA 4D8KA 2K3YA 4O5VA 4LQ6A 1HJDA 2J6OA 2CUBA 3M59A 2DZCA 1JQQA 1NG2A 3A8MB 5CKEA 5GAMh 3CPWS 1Q82U 2CUDA 3KXTA 2ECZA 4M7AB 4MZMA 4JS4A 1VYVA 1N8RU 3CD6T 2JS2A 2E41A 2HD0A 4L59A 4FT4A 1JB0E 2ZGWA 3CCJT 4RTWA 4LN2A 1JJ2A 2E6NA 1OV3A 2DVEA 5J3BA 2E12A 3HRUA 4M7DE 4FSXA 1PNJA 4JJCA 1N8RC 2DIGA 3UT1A 3U23A 1OPKA 3G4SA 1B34B 2DLPA 2HEQA 4RG2A 1VQOT 3BDUA 4RTXA 5FRMA 3H8ZA 2QDLA 1AWJA 3M0QA 4M78F 1KFZA 1KG1A 4AFQC 1YJ9A 2HBPA 2VGNA 5CO7A 2EJGA 1YI2T 2K3BA 1ARKA 4X9DA 1BI0A 1WPYA 2PUOB 2EGEA 2F2WA 3FC3A 3EFSA 3TEEA 3G6EA 3DLMA 3CCQT 4HT9A 4AFUC 2KRNA 2YSQA 1GFDA 4M77F 3JB9I 5GAMg 3A8GB 3VUZA 1K8AC 1IREB 2GBQA 4M7DG 1YCSB 3QJ6A 4YTLA 5IAYA 1NLOC 1X6GA 1Q7YU 4EMHA 2VWFA 1I0CA 4MZPA 1VQ7T 2GTOA 1T0JA 2JT4A 2VVKA 4NOYA 1VQ6A 4DEXA 3OYIA 3PNWC 1N6AA 4II1A 3S3OA 2LCCA 2O88A 1M9SA 2DRMA 3H6ZA 3M56A 1NEBA 2ED0A 1WQ7A 2PU9B 1JJ2S 1NJIU 1QVFA 3M55A 4IUQA 1P92A 1UHCA 2CSIA 5FU7B 5GMKj 3PIPA 3LGLA 4EFDA 4Y92A 1ZX6A 1BI3A 4A63B 5GANg 3LH0A 2LMJA 1EIFA 3M57A 1JU5C 2CGHA 2K5FA 3I9QA 3HHTB 5FWCA 1VQMA 2D0NA 4C92G 2E65A 4EDUA 4JRPA 2X35A 1CSKA 4ZN3A 2BUDA 2FL7A 1S72A 1VYUA 2E6ZA 5FU6C 4IIOA 4KRTA 5GJVB 2G3RA 3L2RA 3V7CA 2GTJA 4TVRA 2DBKA 2RH2A 4BI8B 1M90U 3H0IA 2PVDB 3GLXA 1NYFA 3GIBA 1ZUYA 1B07A 4M75E 3M0UA 1M1FA 2L3QA 2QI2A 4L5GA 3OSVA 3C12A 3CBOA 4C5HA 1K73U 2LJ0A 5FLXE 2RQVA 1X69A 2BZXA 1W6XA 1JO8A 1UHFA 5LJ5g 4XU1A 4M7DF 4ZTJA 4C92F 3LYIA 2GQVA 4N4IA 4C0FA 2LTOA 3EGUA 2M1HA 3M0PA 2JM8A 2XU8A 1S1NA 5GMKh 1PSEA 3E1SA 5LJ3e 2LQKA 5IT9E 2YLCA 4Z89A 2GF7A 3PE0A 1VQLA 2R5AA 4X34A 1UDLA 1OZ3A 3J81E 2FO0A 1Q86C 4OF1A 2KEAA 2KGTA 1VQLT 4HVWA 2E1HA 3CD6A 5GMKl 2E5KA 2XHCA 2JS0A 3OQ5A 5CKBA 1UUEA 2JW4A 3UATA 3CCUT 4N0AA 1WI7A 2KQWA 3CCST 3VRZA 3PVLA 2QEXT 3VKIA 4C92D 1ZHIA 2RB6A 1WIEA 3ULRB 1YWOA 5CK9A 4J9DA 4J9BA 2DMOA 2JVVA 2K57A 2VXFA 4BY6B 2GGRA 3J7AF 1LOJA 1WLPB 2M16A 1VQ4A 2ROLA 3CEYA 3QWXX 4C8QB 3CC4A 2QQAA 2H3JA 4M7DD 4QVDA 4EMKC 2RK1A 2DYBA 3L2UA 3JCMb 4M6IA 2WSEE 3EG0A 1Y71A 3CCVA 1VQ4T 2KT1A 2KVQG 4XU2A 1K9AA 4A4GA 3JCMQ 1QVPA 2RHZA 5GANf 5GMKi 2DL5A 4EMKA 5EMIA 3CCVT 4XTXA 1PHTA 1X2KA 2CT3A 1UB4A 3SWNA 2FRYA 2MAMA 4IUPA 2FEIA 2HB6A 1VQPA 2FG0A 2DILA 4EIKA 4ZGEB 2ZPIB 4AFZC 2D9TA 4BI3A 2DJZA 4PJOF 4DA4A 3CMAT 1VQ6T 1YJNA 3V8LA 3I35A 3V8KA 2GQIA 2YRVA 2B86A 2M51A 1YN8A 2JN0A 2YT6A 4OGCA 5GAMj 5D6WA 4EMGA 3F70A 4C8QG 4MMKA 5CQYA 1LNXA 4CC2A 1GXIE 4BUGA 1Y57A 5GAMf 4F7UG 5DLOA 3VJPA 1NEGA 4R0KA 3EG3A 2DD4A 5KE2A 5HCKA 2V8JA 2EYQA 3GNGA 4OB3B 3CQTA 1K4US 4IIMA 4XTUA 2FHDA 5EG2A 4OMPA 3MCAB 5HK3A 2E10A 4C0DC 3QXEB 5HK0A 4E7KA 2JXBA 3PGGA 3RESA 3CCRT 4RTZA 4OB0B 3P8DA 5GAN5 1PKTA 2A36A 1UECA 1AEYA 4M7DB 2F2VA 1BBZA 3JCMd 2KDSA 3JSCA 3CCRA 5HKCA 3SB2A 1SHFA 4FIBA 2G6FX 4MMLA 3MEAA 3X26B 5GANj 4QQGA 5FW9A 2KYBA 1MGQA 3VS3A 5J39A 3UF4A 1ZQ1A 1N9SA 4ME7A 2MOXA 3OYMA 1W4SA 1OPLA 4J5YA 4A4EA 2RQUA 3HRSA 1BKBA 4HT8A 5CIUA 1I81A 4A4HA 3CBMA 3QIIA 4F16A 2DE0X 2P4RA 1D3BB 2XICA 1YJWA 1UG1A 3M58A 3RKXA 3RERA 3R6OA 3CPWA 4JJNK 5LJ3d 1KSWA 1SSFA 4RMOA 2XD0A 1AHJB 1E6GA 2EQKA 4J9IA 1PSFA 2DXTA 2LJ1A 4OB1B 4CI0C 3VV0A 3I55T 5CAIA 2NLUA 3OSSC 1ZLMA 1M4ZA 2RF0A 2C0IA 3URGA 4C8QC 2XIDA 4C8QA 4PL6A 1SPKA 1U8RA 1Z9ZA 4PNOA 2DVJA 2B8AA 3QYHB 4PJOG 2K3XA 1ZUUA 2JNGA 2CREA 2MIOA 3PTAA 5DLQE 5LJ5j 4JLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFD A;  3VS2 A;  1AWO A;  1I1J A;  1JXO A;  4LUD A;  1ABQ A;  2A28 A;  2GBQ A;  1WX6 A;  1OEB A;  2J6F A;  2SRC A;  1YCS B;  1WA7 A;  1NLO C;  1X6G A;  1MV0 B;  4ZNX A;  2EBP A;  2VWF A;  1I0C A;  2AK5 A;  3R6N A;  1HSQ A;  3IQL A;  1ZUK A;  2GTO A;  1WXU A;  4JJD A;  1T0J A;  2JT4 A;  5IHI A;  1VA7 A;  2VVK A;  2JMA A;  4Z88 A;  3H41 A;  4ORZ A;  1MUZ A;  4DEX A;  2EW3 A;  1JEG A;  2EPD A;  1T0H A;  2O88 A;  2FPF A;  2DRM A;  2LJ3 A;  2F2X A;  1NEB A;  2ED0 A;  3REB B;  4DEY A;  1UJ0 A;  5IHK A;  2KRO A;  3VS0 A;  1MV3 A;  3O5Z A;  1JWQ A;  2DRK A;  1UHC A;  3QAY A;  2CSI A;  4CC3 A;  2D8J A;  2MCN A;  1SEM A;  1LCK A;  4Y92 A;  1I07 A;  1ZX6 A;  4A63 B;  2LX7 A;  2V1R A;  2W10 A;  2RQW A;  2LMJ A;  1J3T A;  1JU5 C;  2K9G A;  1PRL C;  2C0O A;  2J6K A;  2A37 A;  3I9Q A;  3EHR A;  5FWC A;  3M0R A;  2D0N A;  4BIN A;  1SSH A;  4OML A;  3H0F A;  1UJY A;  1G2B A;  3KFV A;  1NYG A;  1U3O A;  1CSK A;  1UE9 A;  2DL4 A;  3VS7 A;  1PRM C;  1RLP C;  1N5Z A;  1VYU A;  3PVQ A;  2KRM A;  2O9S A;  3TSW A;  4IIO A;  4KRT A;  5GJV B;  4OMM A;  4J9G A;  1NLP C;  2GTJ A;  1GCQ A;  1K76 A;  1K0X A;  2AKK A;  2DBK A;  1UGV A;  2BTT A;  2DBM A;  2J06 A;  2K79 A;  3VS6 A;  3H0I A;  5FWB A;  5GJW B;  2HDA A;  4X1V A;  1NYF A;  1X2Q A;  4AG2 C;  1ZUY A;  1B07 A;  2RQR A;  1X6B A;  3M0U A;  4F17 A;  4CC4 B;  4J9C A;  2LP5 A;  1W70 A;  2L3Q A;  2JM9 A;  1XOV A;  2OI3 A;  4RTT A;  2L3S A;  1M8M A;  1X27 A;  4RTY A;  1H92 A;  2NWM A;  3SEM A;  2LJ0 A;  3VS1 A;  2D8H A;  2RQV A;  1X69 A;  2BZX A;  1W6X A;  1AVZ C;  1JO8 A;  2K2M A;  1UHF A;  4F14 A;  3I5R A;  2KBT A;  2DJQ A;  2EYZ A;  2O31 A;  2J7I A;  2YDL A;  2HCK A;  4LNP A;  2KE9 A;  2EYW A;  3EGU A;  4M4Z A;  2LZ6 B;  3M0P A;  2JM8 A;  1GFC A;  2ESW A;  3VS4 A;  1S1N A;  4JZ3 A;  1ZSG A;  1IO6 A;  2YUO A;  4Z89 A;  1QCF A;  4OMO A;  2LNH B;  3PE0 A;  1PWT A;  2AKL A;  4HVV A;  4OMN A;  4M6H A;  1TUD A;  3NGP A;  1G83 A;  1UDL A;  1AOJ A;  3A98 A;  2D1X A;  2FO0 A;  1BK2 A;  1JXM A;  1WYX A;  1QLY A;  1RI9 A;  2KEA A;  1H3H A;  2DL3 A;  2KGT A;  4M6G A;  5I11 A;  4HVW A;  3TVT A;  3NMZ C;  2E5K A;  2CH4 A;  2JS0 A;  1UUE A;  2JW4 A;  5ECA A;  3UAT A;  5IHN A;  1WXT A;  1U5S A;  4ESR A;  2EQI A;  2KR3 A;  2IIM A;  1WI7 A;  3THK A;  3VRZ A;  3PVL A;  3LH5 A;  5L23 A;  4JJB A;  2DNU A;  1WIE A;  3ULR B;  1YWO A;  1K0S A;  4J9D A;  4J9B A;  2DMO A;  2AZS A;  5IXF A;  2W0Z A;  1BU1 A;  1KJW A;  2X3X D;  3VRY A;  1U06 A;  2GGR A;  3UA7 A;  1WLP B;  3FJ5 A;  2L0A A;  2ROL A;  3QWX X;  1M27 C;  2YUQ A;  4FSS A;  1M3A A;  2NUZ A;  2AZV A;  2DYB A;  4JZ4 A;  4AG1 C;  4M6I A;  3EG0 A;  4J9H A;  1M3B A;  1E7O A;  2KT1 A;  2M0Y A;  1KIK A;  2XMF A;  4J9F A;  2ODF A;  1K9A A;  2VKN A;  1AD5 A;  1CKA A;  2LCS A;  3H0H A;  3VS5 A;  2DL5 A;  1T3L A;  5EMI A;  2H8H A;  2EYX A;  3C0C A;  1PHT A;  2DL7 A;  3GBQ A;  1X2K A;  2FRW A;  2CT3 A;  2KRS A;  2C0T A;  3RBB B;  4HCK A;  2KXD A;  4OMQ A;  2EVR A;  2FRY A;  5EC7 A;  2ED1 A;  2FEI A;  4RTU A;  2FG0 A;  1UFF A;  2I0N A;  2DIL A;  3TSZ A;  2YUN A;  4EIK A;  4AFZ C;  1SRM A;  2CH4 W;  4E6R A;  3M0S A;  2K6D A;  1BB9 A;  3M0T A;  2JMC A;  3I35 A;  2GQI A;  2OAW A;  2B86 A;  1WFW A;  2M51 A;  1YN8 A;  3I5S A;  3CZX A;  1UTI A;  2BZ8 A;  2FPE A;  2PZ1 A;  4RN7 A;  2YT6 A;  1AWX A;  2RQT A;  4RTV A;  1SRL A;  4GLM A;  1GCP A;  1EFN A;  1RUW A;  1WXB A;  2KNB B;  1QWE A;  2EKH A;  1CKB A;  3NPF A;  4CC2 A;  1OOT A;  2BZY A;  2EGA A;  2GNC A;  1Y57 A;  4AFS C;  3ZL7 C;  5I22 A;  2RNA A;  1NEG A;  1ABO A;  2DM1 A;  2PNI A;  4R0K A;  3EG3 A;  4J9E A;  5HCK A;  2J05 A;  1Y0M A;  1FMK A;  3REA B;  1ZBJ A;  2Q7S A;  1H8K A;  2DX1 A;  3CQT A;  1K4U S;  4IIM A;  2DF6 A;  3NE8 A;  4OMP A;  1Z9Q A;  1YNZ A;  2DA9 A;  1TG0 A;  1W1F A;  1GBQ A;  2V1Q A;  1AWW A;  4CC7 A;  2YUP A;  3EG1 A;  4D8D A;  2JXB A;  2K7A A;  1NM7 A;  4K11 A;  1AZE A;  2KYM A;  2HSP A;  2O9V A;  2FPD A;  1HD3 A;  1PKS A;  2CT4 A;  4RTZ A;  3EHQ A;  1X43 A;  4RUG A;  4Z8A A;  2RN8 A;  1PKT A;  2A08 A;  2A36 A;  2KXC A;  1UEC A;  2L2P A;  1YWP A;  1AEY A;  1M30 A;  4GBQ A;  4LE9 A;  2F2V A;  1VYT A;  1BBZ A;  1GBR A;  2ENM A;  1QKX A;  4HXJ A;  1SHF A;  4D8K A;  2G6F X;  4QT7 A;  4LQ6 A;  1HJD A;  3JV3 A;  2J6O A;  5FW9 A;  2CUB A;  1QWF A;  3NHN A;  1JQQ A;  2L3P A;  1E6H A;  2KYB A;  1NG2 A;  2EYY A;  3VS3 A;  5IH2 A;  2OJ2 A;  3UF4 A;  1RLQ C;  1A0N B;  2CUD A;  2ABL A;  2ECZ A;  1VYV A;  2MOX A;  2JS2 A;  1OPL A;  4WCI A;  2SEM A;  1GCQ C;  2RQU A;  5IXB A;  4RTW A;  4LN2 A;  3UA6 A;  2PTK A;  1OV3 A;  3RNJ A;  2X3W D;  2LQN A;  1YP5 A;  4F16 A;  2DE0 X;  2P4R A;  1TUC A;  1PNJ A;  1UG1 A;  1B3Q A;  4JJC A;  1FYN A;  2O2O A;  2ROT A;  1GL5 A;  3U23 A;  1OPK A;  1V1C A;  2DLP A;  1KSW A;  2HEQ A;  2LQW A;  1E6G A;  1K1Z A;  2CDT A;  4J9I A;  1GRI A;  1QKW A;  2LJ1 A;  1AZG B;  1SHG A;  4RTX A;  4JPB W;  1ZLM A;  2RMO A;  1M3C A;  2QDL A;  2RF0 A;  1AWJ A;  3M0Q A;  4HVU A;  2C0I A;  1KFZ A;  2DL8 A;  2KT8 A;  4AFQ C;  3EG2 A;  2RPN A;  3QWY A;  1SPK A;  2K3B A;  1ARK A;  2CSQ A;  1Z9Z A;  1WDX A;  2DVJ A;  2EGE A;  2F2W A;  3SHW A;  2EGC A;  1ZUU A;  4LUE A;  2CRE A;  2MIO A;  1T3S A;  2HBW A;  2JTE A;  4AFU C;  2KRN A;  2YSQ A; 
#chains in the Genus database with same CATH topology
 3NE7 A;  1R3N A;  3VS2 A;  3E9G A;  1AWO A;  1YW4 A;  1RO5 A;  3FJP A;  3LWI A;  3R1K A;  3BI1 A;  4B5P A;  3IU1 A;  4JLG A;  2A28 A;  2KSS A;  1KC8 U;  5K8M A;  2F8H A;  2EKO A;  2SRC A;  2PJ7 A;  2QAS A;  4CAE A;  3CCS A;  3L1A A;  3BE3 A;  4FUU A;  5D29 A;  4ZNX A;  4KH0 B;  2VZZ A;  2OU2 A;  1XJW B;  3RZA A;  2AK5 A;  2EWN A;  1HSQ A;  3IQL A;  3FRN A;  4C8Q E;  3IIB A;  3TE4 A;  1NZ9 A;  2FIA A;  3H9N A;  1Z8L A;  1VA7 A;  4FD6 A;  1I8F A;  2DD5 A;  4Z88 A;  2QYV A;  3H5Z A;  3IFE A;  3BJ7 A;  1JJ2 P;  2D6F A;  1H8L A;  5CKF A;  3PEI A;  2EW3 A;  3MEU A;  4JUV A;  2HL5 C;  5DWN A;  2EPD A;  3X20 B;  1T0H A;  3G1J A;  5CCA A;  2ZW5 A;  1LJO A;  2FPF A;  2F2X A;  3RKY A;  2OTJ A;  1ZO0 A;  1RAB B;  2QXF A;  2EK9 A;  2HZY A;  4FYY B;  4J6X A;  3F0A A;  3D7G A;  4DEY A;  2JBJ A;  1ZA1 B;  4BE1 A;  5IHK A;  3EH1 A;  2AFZ A;  1MV3 A;  1SG5 A;  4H2K A;  3X24 B;  1JWQ A;  1V29 B;  2DRK A;  4IUR A;  4VUB A;  2VYT A;  4C5G A;  1P0H A;  5LL6 S;  2XEI A;  1LCK A;  1YX0 A;  1IZ6 A;  1YSJ A;  4V2S A;  4E7J A;  3QDF A;  4CAX A;  4FYW B;  4QB9 A;  4Q5W A;  2V1R A;  1MJA A;  7CPA A;  1F2O A;  2QYZ A;  1J3T A;  2Y4X A;  1VQ7 A;  1PRL C;  3X25 B;  2ZOG A;  2DPS A;  2O28 A;  2J6K A;  3JB9 G;  2PJ6 A;  1LAP A;  5LRJ A;  3EHR A;  3M0R A;  4H6Z A;  4IUU A;  2Y90 A;  2JTM A;  4OML A;  3GUX A;  4DBF A;  3OYA A;  3KFV A;  4C92 C;  1P4N A;  3HP9 A;  5GAO r;  2X4J A;  3TFY A;  2B4D B;  2RI2 A;  1I12 A;  5G22 A;  2KRM A;  2PIZ A;  4KOU A;  3H8F A;  2QTX A;  3GPL A;  4OMM A;  4J9G A;  3BW1 A;  1W2B S;  1NLP C;  1O75 A;  2IG0 A;  4M7A C;  3FED A;  4U5Y A;  2LT4 A;  3LW5 E;  1TF8 A;  3VS6 A;  1CX8 A;  2FIW A;  5GJW B;  5DY9 A;  3TU4 K;  1X2Q A;  3M4Y A;  4AG2 C;  3CCL T;  3FVL A;  2NYS A;  4UC4 A;  3E2U A;  3A8H B;  2XI9 A;  4CC4 B;  4J9C A;  5A0L A;  2F5I A;  2LP5 A;  2JUF A;  1KD1 R;  1B34 A;  3J80 E;  3KR4 A;  1YBY A;  2OI3 A;  2WAC A;  4RTT A;  2L3S A;  3CCL A;  1VQM T;  2R1I A;  4RTY A;  3LAC A;  3SEM A;  4P44 A;  3VS1 A;  1TXQ A;  1NPP A;  4DOW A;  4A95 A;  2V8I A;  2HQY A;  2DTO A;  4B5O A;  1BIB A;  4A53 A;  3CPW P;  1G3W A;  2RJD A;  1KQS A;  3S6W A;  1VQK T;  4MY3 A;  5LJ3 j;  2K2M A;  5K8P A;  1WJS A;  2HSE B;  1AUG A;  2J7I A;  2C06 A;  3LGF A;  4M75 G;  1M90 C;  2KE9 A;  5KTA A;  4F7U B;  4XTV A;  1QMC A;  2EYW A;  2VXK A;  3PFS A;  1VQK A;  1Q82 R;  1Y0R A;  1BCO A;  4JZ3 A;  4MFJ A;  3QG1 A;  4PJO D;  1VHS A;  1YK3 A;  2B5G A;  2RI3 A;  3AHU A;  2AKL A;  4HVV A;  3NH4 A;  4KUI A;  1G83 A;  5CBM A;  1AOJ A;  2L8D A;  3KR5 A;  1I5O B;  2ZEF A;  3R9F A;  3OMG A;  1H3H A;  4E7S A;  3TVT A;  2RI5 A;  2K2V A;  1M2O A;  3OYB A;  3NMZ C;  1BLL E;  4KGX B;  3MEV A;  2ZW6 A;  3EAE A;  1Q7L A;  1YIJ Q;  4IUT A;  5ECA A;  1UEB A;  2CP6 A;  3JCM V;  4ESR A;  1K8A U;  4M78 A;  5FRO A;  2QDY B;  3OYH A;  3L2W A;  2CNT A;  1VQ9 A;  4KVX A;  3LH5 A;  2YXY A;  4PKC C;  5LJ3 g;  1HK9 A;  3EFO B;  4Y28 E;  1VQ8 A;  5L23 A;  4JJB A;  3L2V A;  3MPU B;  4M75 F;  2PVW A;  1QP2 A;  5I4M A;  2EJ9 A;  2BO9 A;  3RUX A;  2YNC A;  4FD5 A;  3S3M A;  3QSU A;  4L6V 5;  2AZS A;  2GFU A;  4L8A A;  1KJW A;  2QTV A;  4R3L A;  1YIJ A;  3VRY A;  3S6H A;  1QP3 A;  4C7H A;  1Y07 A;  3ME9 A;  3A8O B;  5GAN 6;  5GMK m;  3I55 A;  2ZEE A;  4PK4 A;  1VHO A;  1MMD A;  3TO9 A;  4ZGD B;  4AG9 A;  3G71 T;  1M27 C;  2DXB A;  4FSS A;  4OAD A;  1CPX A;  2AZV A;  1BO4 A;  4CAW A;  3SI2 A;  4JZ4 A;  1NE9 A;  5CVI A;  4P4I A;  4KOV A;  4J9H A;  5LJ5 f;  4KUD K;  4MRI A;  3OYE A;  1E7O A;  2M0Y A;  4J9F A;  4C92 E;  4QVC A;  2ODF A;  5FU6 B;  2RD1 A;  1VQP Q;  2VKN A;  1AD5 A;  2FYK A;  4C0G A;  1F2P A;  2LCS A;  1CP7 A;  1XFO A;  4IUS A;  4DBH A;  1S7N A;  3VS5 A;  1Q82 C;  3X28 B;  1QVF S;  1Z4E A;  3V8I A;  2V77 A;  4NJR A;  2MWP A;  5E96 A;  4KLW A;  3C0C A;  4B9W A;  3GBQ A;  4JDS A;  2FRW A;  4A4K A;  3D2P A;  4OC1 A;  4EPC A;  4FL6 A;  4MHY A;  2RJC A;  2YRD A;  4O6J A;  4HNW B;  2EVR A;  1FXX A;  5EC7 A;  1I1D A;  2RC4 A;  1K9M U;  1K9M R;  5C88 A;  3S9M A;  4M77 G;  1Z8T A;  2I0N A;  3OYN A;  3TSZ A;  3N5F A;  4M78 B;  1FY7 A;  1Q7Y R;  2CH4 W;  2KK4 A;  4E6R A;  2CP0 A;  4E2A A;  2K6D A;  4DJL A;  2K5L A;  3M0T A;  1K73 C;  2ZEO A;  3K9U A;  4I49 A;  3JB9 F;  2X4W A;  3R9E A;  2CZ7 B;  1WWZ A;  1WFW A;  4R8F A;  5HXD A;  3CME A;  2WSF E;  3CZX A;  2FPE A;  3CMA Q;  1ZSZ C;  2Y0M A;  2LDM A;  4LDY A;  4PXD A;  2FT0 A;  3JUW A;  4R55 A;  4QC6 A;  4RTV A;  4M78 G;  1U1S A;  1B87 A;  4JRQ A;  1EFN A;  4M77 B;  4E47 A;  1Q86 U;  2RB7 A;  1OYX A;  1YGH A;  1XMT A;  3HPW A;  1RUW A;  1YRE A;  3CME T;  1OZP A;  1V76 A;  2MF2 A;  3NPF A;  2QQS A;  4QQ6 A;  1FWZ A;  3VYG A;  3KGQ A;  2GNC A;  3PMI A;  4P5N A;  3MET A;  3IJ3 A;  1NMT A;  3SJE A;  4ZI6 A;  3OYY A;  3EY5 A;  4QBJ A;  1ABO A;  2FVU A;  4XK8 E;  2V8K A;  4BDZ A;  1KQ1 A;  2VXE A;  3G6E T;  1TWB A;  2J05 A;  1N71 A;  4KUA A;  1ZBJ A;  1M1D A;  3RYO A;  2IMO A;  1WHM A;  1G3T A;  2DX1 A;  4KGZ B;  2CP7 A;  3PT9 A;  4LXC A;  2DF6 A;  2J8M A;  4XPL A;  4CRZ B;  3WVD B;  3M54 A;  1KUV A;  1Q2Y A;  1D0Y A;  2DEQ A;  3KL9 A;  4CRY B;  5GAM d;  5HH1 A;  2OR4 A;  3MJX A;  2DA9 A;  4HA8 A;  2BIV A;  4EWT A;  2GFA A;  1GBQ A;  2V1Q A;  1ZSZ B;  4PJO A;  2L3R A;  2YUP A;  2GCX A;  2Z3M A;  2HSP A;  1VQM Q;  1G5V A;  3VAR A;  1X43 A;  3RNZ A;  2YRC A;  1KHC A;  7AT1 B;  1Z8X A;  1Y96 B;  4FYV B;  2AFU A;  2A08 A;  3A5Z B;  4GBQ A;  4UEZ A;  4F7U A;  4C2X A;  1VYT A;  8ATC B;  1DE4 C;  1GBR A;  1IHV A;  2VC8 A;  1MJB A;  5F48 A;  3NH8 A;  1NE8 A;  2A7Y A;  1CP6 A;  1PC0 A;  1JRI A;  1LVK A;  4J83 A;  1WHK A;  3NTK A;  4QT7 A;  1NPR A;  1IB8 A;  3JV3 A;  5JPH A;  1IGQ A;  4F04 B;  2L3P A;  4P4E A;  5LRK A;  2OJ2 A;  1N27 A;  4ZGJ B;  3EC4 A;  1A0N B;  3JCM f;  1YVO A;  3DB3 A;  4MFQ A;  1MMG A;  2R5M A;  3CCM A;  2XDD A;  4WCI A;  3QPH A;  2SEM A;  2RJF A;  5D6Y A;  5IXB A;  1IOI A;  2P4T A;  4JWP A;  2PCU A;  2PTK A;  1UGP B;  2WYR A;  3RNJ A;  2X3W D;  3JRZ A;  4GY5 A;  4WJB A;  2JZ2 A;  3T9N A;  1H3Z A;  4LD6 A;  4LQG A;  4FM4 B;  2EUI A;  2VQY A;  3S6G A;  3FF3 A;  1I21 A;  1ARM A;  4P4F A;  4N4H A;  6CPA A;  3OW2 S;  1GL5 A;  3QZ5 B;  3K9T A;  3EFO A;  1V1C A;  3PZJ A;  4NS5 A;  2OH1 A;  5D8N A;  4UCP A;  1X6O A;  3CCQ Q;  1K1Z A;  2CDT A;  4C5I A;  2OZH A;  3FMC A;  1GRI A;  1QKW A;  2HAX A;  1AZG B;  3TO6 A;  3NTH A;  3OYF A;  1ZSZ A;  3C4S A;  4PJO B;  4DBR A;  4KSF A;  1M3C A;  2HNI A;  3DR6 A;  2ZPG B;  1KD1 U;  4CGN A;  2GLF A;  4HVU A;  3GOX A;  5GMK e;  3OYL A;  4P45 A;  2DL8 A;  2E5Q A;  3EGD B;  4ANJ A;  3TCV A;  3NTI A;  4M85 A;  3EG2 A;  1BOB A;  1Y96 A;  2RPN A;  3QWY A;  1Z4R A;  4K3N A;  4FW2 A;  1ZG9 A;  4M7A D;  1N8R R;  2IJZ A;  3HLP A;  2KY9 A;  2EQU A;  1BI1 A;  4YGO A;  3FRM A;  3RDV A;  4R6T A;  2O01 E;  2DO3 A;  5DWM A;  3OYG A;  4RKU E;  4J6Y A;  4LUE A;  1NJI C;  5IX3 A;  2ZPB B;  5CQX A;  4C5E A;  3JVN A;  3EFA A;  4M77 E;  4II9 A;  3NGP A;  2GAN A;  4Y49 C;  3G7Z A;  1I1J A;  1ZBX A;  4M77 D;  2QA4 A;  1YJW T;  4LUD A;  2R8V A;  4UWI A;  4ATO A;  1WX6 A;  2EFI A;  2J6F A;  1BIA A;  3HSB A;  1Z8W A;  2Q43 A;  3MHX A;  1Z5R A;  1WA7 A;  4R7M A;  1GHE A;  1SKU B;  4NSQ A;  3AT1 B;  3PRT A;  1QVG P;  1WXU A;  4JJD A;  2G0B A;  4M78 E;  3QDR B;  4ORZ A;  1MUZ A;  3QHS A;  4M78 D;  2GU2 A;  1JEG A;  1Q81 U;  1B7T A;  1YIJ T;  4JD6 A;  1M5Q 1;  3LWH A;  2DF5 A;  2BE9 B;  3FIF A;  2RJE A;  1JQG A;  2Z3N A;  2EQM A;  2LJ3 A;  3PIO A;  3DKM A;  1C0M A;  4XAX B;  3HFN A;  5AG5 A;  1UJ0 A;  4ELZ C;  4RCB A;  3GB0 A;  3VS0 A;  2OB0 A;  3HFO A;  4PFZ A;  4NL2 A;  3A8L B;  1IYL A;  3N7Z A;  4FAI A;  3IC1 A;  4LDV A;  3MP6 A;  3SDZ A;  2PJ0 A;  1YJN Q;  2MCN A;  2LNV A;  1SEM A;  4B9X A;  3W6S A;  5KYU A;  5KCH A;  3V7R A;  5GAN 7;  2W10 A;  2RQW A;  1NBE B;  4YWY A;  2PSW A;  2MI6 A;  3CCU A;  3B3W A;  4MCP A;  4LDW A;  2A37 A;  2K5T A;  3V7S A;  1MNE A;  3G4S T;  1KQS P;  4FBE A;  4BIN A;  1R57 A;  5EC4 A;  1QST A;  2QEX A;  5ELY A;  2NSM A;  4CYP A;  2RO0 A;  1G2B A;  4JXR A;  1NYG A;  1VQO A;  2C1C A;  3CPX A;  3VS7 A;  3JB9 D;  1RLP C;  1N5Z A;  1WHL A;  3IU2 A;  5D7U A;  5GAN d;  2OTJ T;  2O9S A;  3PB9 X;  4U9Z A;  2HQX A;  2Q51 A;  4B10 A;  1OI1 A;  1OQK A;  2MK5 A;  1TIQ A;  2DEU A;  1S7K A;  1TKF A;  4R76 A;  1OX8 A;  3CCU Q;  1K76 A;  1WQW A;  2AKK A;  2YLB A;  1EZZ B;  4UIB A;  1WHG A;  2J06 A;  1JBM A;  3QYG B;  4KH1 B;  2K79 A;  3I9S A;  4R56 A;  1VQ5 T;  2BKD N;  5KYN A;  5FWB A;  2QGG A;  4F8Z A;  5GAO n;  2GLJ A;  5LJ5 e;  3VUB A;  2VBQ A;  3W6X A;  4JYW A;  1R0B G;  2JDC A;  2CKK A;  1CBX A;  3IWW A;  2I3C A;  2D4P A;  3T8W A;  1ZLH A;  1W70 A;  1VQ5 A;  2JM9 A;  5F49 A;  3E9F A;  4LUA A;  4NGM A;  1XOV A;  3HKS A;  1I4K 1;  4PXB A;  1YHQ A;  1X27 A;  4KT0 E;  1H92 A;  2NWM A;  4BD3 A;  3MP1 A;  2C27 A;  4M75 B;  1OZ2 A;  2XEG A;  2Z3K A;  4AMC A;  1O9S A;  3P2F A;  3RBU A;  3L2Q A;  1AVZ C;  2ZPH B;  1TKH A;  3QJY A;  3RIR A;  3PFO A;  2G9D A;  2DJQ A;  2I2L A;  3INZ A;  1S7F A;  4B14 A;  1Q95 G;  1VQP T;  4OB2 B;  2EIF A;  3JCM e;  2E70 A;  2AFW A;  3ASK A;  1UGQ B;  4FWU A;  5LJ5 j;  1S72 Q;  2OTL T;  4M4Z A;  2PQ8 A;  2LZ6 B;  4AG7 A;  1XMB A;  1GFC A;  2CYZ B;  2ESW A;  1UGR B;  4E7Z A;  3RMQ A;  3WC5 A;  3NFC A;  3CBP A;  1ZSG A;  2ZPE B;  3M5A A;  4KBM B;  3OA6 A;  3G71 Q;  1IO6 A;  2CZ0 B;  2YUO A;  2BSW A;  2WPW A;  1QCF A;  2Y4Y A;  2LNH B;  4OMO A;  4G1P A;  4B5P B;  5JQ4 A;  3CXC S;  3EGD A;  1PWT A;  3FIX A;  1QVG S;  3PP9 A;  3RO0 A;  2CTB A;  5FRN A;  4E0A A;  4IUV A;  2DTH A;  3A98 A;  2WSC E;  2RHU A;  1LCP A;  5A0D A;  1N9R A;  4KSI A;  1JXM A;  1QLY A;  1RI9 A;  3B3V A;  4HNY B;  4M6G A;  3PMT A;  3BLN A;  1MK4 A;  3KHX A;  2A0F B;  5I11 A;  4M7A E;  3CXC P;  2LCL A;  3CCM T;  3Q1J A;  5GAN e;  3CC2 Q;  1W2B P;  4AXV A;  2VGM A;  4R9M A;  5IHN A;  1WXT A;  1U5S A;  3MP8 A;  2KR3 A;  2IIM A;  4A54 A;  2VL1 A;  1Z9U A;  4A4F A;  1KUY A;  6AT1 B;  2X9H A;  1VIX A;  1G3Y A;  2DXQ A;  2V8G A;  4H89 A;  4FD4 A;  5GAO m;  5GCN A;  2DNU A;  4MCQ A;  1RAF B;  5C0M A;  2DYI A;  3VH9 A;  4M75 A;  2PDO A;  2R58 A;  2PJC A;  2LRQ A;  3FYN A;  1BU1 A;  1TKJ A;  4X8I A;  3KI9 A;  5A0G A;  3FJ5 A;  4KLV A;  2L0A A;  1EE3 P;  2LQ8 A;  2QEC A;  5HVG A;  1ON0 A;  4RUH A;  2YUQ A;  2AHJ B;  2DEA A;  3QKJ A;  5H86 A;  1XBU A;  3OY9 A;  3O8V A;  4QVZ A;  3WR7 A;  3GP8 A;  3L42 A;  2YHT A;  3ZJ0 A;  4B6M A;  3GNF B;  3OMC A;  3ZBD A;  2XMF A;  1CJW A;  2AFO A;  2RK2 A;  4EMK B;  1CKA A;  4BD9 A;  4BE0 A;  1WJQ A;  3H0H A;  4HKF A;  3H4Q A;  3RKW A;  4B6Z A;  1T3L A;  5LJ5 d;  1VQ9 T;  1HEE A;  1YCY A;  3WXM B;  2B4D A;  1VQ8 T;  3SXN A;  1PU9 A;  3TOA A;  5GAM e;  2FB7 A;  2C0T A;  3RBB B;  2PJA A;  5A27 A;  4HCK A;  1FX7 A;  2KXD A;  1H64 1;  4OMQ A;  1M1K C;  1X75 C;  1F1B B;  4R3K A;  2BOA A;  4M75 C;  4RTU A;  3CC2 T;  1IGB A;  5L8R E;  2YUN A;  1G8X A;  5GAN 3;  2Q04 A;  4ZGY B;  3LWU A;  3TQ7 P;  1SRM A;  3G71 A;  2E4H A;  1IHW A;  1MMN A;  3M0S A;  2G3T A;  2PJ2 A;  4PLL A;  4OGE A;  1ELM P;  2JMC A;  2V8V A;  2JTF A;  3FEC A;  4J8O A;  3KUF A;  1ZG8 A;  1B6B A;  1YIT T;  1IY7 A;  5GAO q;  3I5S A;  3OS5 A;  1UTI A;  2BZ8 A;  4RN7 A;  2P0K A;  4C68 A;  4CGM A;  1AWX A;  3UWN A;  5C82 A;  1C1A A;  2P84 A;  2RQT A;  1SRL A;  4OC2 A;  3SJG A;  3FEO A;  1TF9 A;  3MKD A;  3OB9 A;  2CF4 A;  3TTH A;  4KOW A;  4J6W A;  1WXB A;  2EKH A;  3OYK A;  1CKB A;  1VIF A;  3BI0 A;  4J7I A;  3F8K A;  3TT2 A;  3V7Z A;  1OOT A;  2BZY A;  4XTY A;  2GE3 A;  2EGA A;  5DS0 A;  2NYQ A;  4NGR A;  2ZW7 A;  3CCM Q;  2BUE A;  4AFS C;  3ZL7 C;  5I22 A;  5I21 A;  4F7U E;  4ZBG A;  2RNA A;  4LDU A;  2DM1 A;  1QSM A;  2DIQ A;  2VB6 A;  4UFW A;  1FMK A;  3LLR A;  2Q7S A;  1H8K A;  3FDR A;  4E7L A;  2CXA A;  1YJW Q;  4OC3 A;  4C7I A;  4M77 C;  5IB9 A;  2XDB A;  4PJO E;  2YGW A;  1YNZ A;  3I56 Q;  3CC7 T;  4XTW A;  1TG0 A;  1W1F A;  2JOY A;  2V8H A;  1AWW A;  4CC7 A;  1LRZ A;  3EG1 A;  4ONU A;  2O9V A;  2LVM A;  2B58 A;  4Z8A A;  4RUG A;  2RN8 A;  5G21 A;  2KXC A;  2L2P A;  2RA2 A;  4A37 A;  1M30 A;  4P10 A;  3CXC A;  2C6C A;  4KOT A;  2RHX A;  3D7D A;  4M78 C;  3M53 A;  3JCM W;  2KMT A;  4M7D A;  3PB8 X;  2ENM A;  4RCC A;  3FB9 A;  4MDW A;  2X51 A;  5GAN 4;  2PRQ A;  4HKE A;  3VU3 C;  1LAN A;  3MO8 A;  5C6S A;  2ATC B;  1QWF A;  3NHN A;  3EGX A;  1E6H A;  1HDU A;  4J3G A;  2EYY A;  5IH2 A;  1YJ9 T;  4ZX9 A;  3PBE A;  1RLQ C;  5CKD A;  3JCM J;  1YI2 A;  2ABL A;  2XKO C;  1X01 A;  1VQN A;  3BY7 A;  4ZTF A;  1EX4 A;  1VQN Q;  4KUB A;  1GCQ C;  2CZ6 B;  3I3G A;  2JEV A;  2F5T X;  2GFQ A;  3UA6 A;  2VUB A;  3TO7 A;  1YHQ T;  1M1K U;  3QZ9 B;  3OWC A;  3SJF A;  2HUZ A;  1OBR A;  2LQN A;  1YP5 A;  1XNI A;  4CAV A;  4X2T A;  3VWE A;  2WZN A;  4CYN A;  1TUC A;  4OP4 A;  2DFU A;  5G20 A;  1B3Q A;  1FYN A;  2O2O A;  2ROT A;  4X3R A;  4UIA A;  4F9U A;  4F7U F;  3CMA A;  4XTZ A;  1QQ9 A;  1UGS B;  1YJN T;  5KYW B;  2LQW A;  2QQR A;  2Z11 A;  2X4X A;  5EBV A;  4RS2 A;  3RMS A;  5KCO A;  2IVW A;  4CS0 B;  5I2M A;  2HC9 A;  1Q7Y C;  2JBK A;  4F0Y A;  1SHG A;  4JPB W;  2RMO A;  3OW2 P;  5LYI A;  2B3V A;  2Z3L A;  1VQL Q;  2MWO A;  2KT8 A;  5IN1 A;  4CYO A;  4KSA A;  1U1T A;  3P8B B;  1V0C A;  2PJB A;  3PBB A;  4KOX A;  4OLL A;  1VQK Q;  3I56 A;  1KHI A;  1PUA A;  4KOS A;  2CSQ A;  1M8V A;  3ISX A;  1WDX A;  1R0C B;  3N5B B;  4MFP A;  2Z0W A;  4WF2 A;  4ZY1 A;  1TTH B;  2I79 A;  3SHW A;  5F47 A;  2EGC A;  3CCE Q;  3JB9 H;  1GYT A;  1TXR A;  4XU0 A;  2LT1 A;  1WJR A;  1DJ7 B;  1T3S A;  2HBW A;  2JTE A;  4M7A G;  4R87 A;  1MHN A;  4OIW A;  3E19 A;  2QA4 Q;  2IL4 A;  1JXO A;  2QK0 A;  2Z3O A;  1ABQ A;  2R57 A;  3UPU A;  2A4N A;  1I5L A;  2L5Q A;  1QSO A;  1OEB A;  3LX7 A;  3JCM P;  4N4G A;  2BEI A;  4FT2 A;  3OYD A;  4Z02 A;  2K5I A;  1CPS A;  2OX7 A;  1ACM B;  1MV0 B;  3HRT A;  4P4J A;  2EBP A;  3C94 A;  2F1L A;  3C95 A;  3R6N A;  2ATR A;  2OZG A;  1ELL P;  1ZUK A;  3T9Y A;  4MFK A;  5IHI A;  4C8Q D;  3SHP A;  2JMA A;  4ZY2 A;  3H41 A;  3OS2 A;  2F5K A;  3CXQ A;  2OOT A;  2O4X B;  5D6X A;  3M9Q A;  1KC8 C;  4MXU A;  3BJ8 A;  1K73 R;  4QW2 A;  2FCK A;  4Y91 A;  5GAN 2;  2DPP B;  4BB7 A;  2VAS A;  3SFM A;  2J8R A;  5KYW A;  1S72 T;  2PVG B;  2COY A;  5GAO l;  1Z2L A;  1M1G A;  4AVA A;  4OP0 A;  3REB B;  2QQB A;  1NJI R;  2VV5 A;  4C92 B;  2H5M A;  3D4U A;  2KRO A;  4E2F B;  2C6G A;  5IB0 A;  2P6F A;  3WVE B;  3O5Z A;  5FU7 C;  1QSR A;  2PVV A;  3KBG A;  3QAY A;  4CC3 A;  1QCO A;  1ZA2 B;  2D8J A;  1VQO Q;  3VAT A;  4MHP A;  2HQE A;  3GYA A;  4YRH A;  2QJ8 A;  3HL8 A;  4BI4 A;  1I07 A;  2OAU A;  1D1A A;  5JM6 A;  2LX7 A;  3DNS A;  3GF5 A;  2FL4 A;  3JCM X;  5A2Q E;  2CZ1 B;  4PSW A;  2K9G A;  3JTK A;  3P8H A;  2L89 A;  2DAQ A;  3DB4 A;  2C0O A;  5GAN 8;  5GAO p;  1XF8 A;  1Y7R A;  1Q81 C;  1OU9 A;  4JRK A;  2COW A;  5LJ3 h;  4JZ0 A;  3DLL A;  1SSH A;  4W9Y A;  3H0F A;  1UJY A;  3CC2 A;  3BDL A;  2DK3 A;  1Y7X A;  1U3O A;  2F69 A;  1UE9 A;  1KK7 A;  2DL4 A;  1PRM C;  3BFM A;  3PVQ A;  4MDX A;  1KD1 C;  2D0Q B;  3TSW A;  4C0D B;  1IXD A;  5KTC A;  5J1Q A;  3SWN B;  3JCM h;  2B4B A;  1YIT A;  1GCQ A;  5KYX A;  1K0X A;  1UGV A;  2BTT A;  2DBM A;  2O4X A;  4PJJ A;  4JLY A;  3PGP A;  3L2Z A;  1TH7 A;  3VYH B;  4JS5 A;  2HDA A;  4X1V A;  3CCV Q;  5LJ3 f;  1S60 A;  1RAD B;  2C6P A;  4BAC A;  2CP5 A;  1WK4 A;  2RQR A;  1YW6 A;  1X6B A;  2V8D A;  4Q36 A;  1QVG A;  3EGX B;  4F17 A;  3ZEH A;  2ZPF B;  1M90 R;  3ZFJ A;  1HXD A;  2HQH A;  4KGV B;  3OW2 A;  2IPO B;  4OMF B;  3CCJ A;  3IWE A;  1Y9K A;  4B12 A;  1M8M A;  1FMV A;  5CR2 A;  2GIV A;  1KQS S;  1Q81 R;  2MMP A;  2Z3P A;  2DXC A;  4MZT A;  4TWE A;  2PR8 A;  5KH6 A;  2KI7 A;  2D8H A;  1QSN A;  1VQ8 Q;  2ZZD A;  3QUI A;  3CPA A;  4Q7A A;  4LD9 K;  3NFZ A;  1K8A R;  4BE2 A;  3P2H A;  3CC7 A;  2DTI A;  4PPZ A;  4NF1 A;  1XQH A;  4F14 A;  3I5R A;  4A2Z A;  2KBT A;  3LMS A;  3HTR A;  2EYZ A;  2O31 A;  2VEZ A;  3DDD A;  2M9U A;  2YDL A;  3JB9 J;  4HCB A;  2HCK A;  4IK2 A;  3D8P A;  4LNP A;  1UWY A;  3D7H A;  2EJF A;  3D2M A;  2EWB A;  5KYY A;  4EVY A;  4FU6 A;  4IKF A;  3OBY A;  3MEW A;  3SD4 A;  1QW1 A;  4NGQ A;  3M4G A;  3VS4 A;  2XDP A;  5LRG A;  4GLK A;  4OVA A;  3TRE A;  4AT1 B;  4C0Z A;  2E3I A;  2E3H A;  1RAG B;  3F5B A;  1IRX A;  3JCM c;  3RAM A;  4PQA A;  4OMN A;  3G6E Q;  3CC4 T;  1TUD A;  4M6H A;  4GS4 A;  4PFO A;  3OS1 A;  2DZ9 A;  2D1X A;  3B2Y A;  4BBH A;  3TCJ A;  2P0P A;  3PFE A;  1BK2 A;  1WYX A;  1XTD A;  3CCQ A;  1VUB A;  2DL3 A;  4CGP A;  4E7I A;  4AVB A;  4U9Y A;  5CPA A;  1VQN T;  4MMO A;  1OX9 A;  2AIR B;  2AFX A;  5AYF A;  2CH4 A;  2QEX Q;  4CAF A;  4YU9 A;  2EQI A;  2KAF A;  4UCN A;  3EG9 A;  1G3S A;  3THK A;  2PUK B;  3L2N A;  2EQJ A;  3CPF A;  3B3S A;  1WZO A;  5J26 A;  3QO3 A;  5G1Z A;  2V26 A;  1K0S A;  2OTL A;  4A32 A;  4KZT A;  2K4Y A;  4P4D A;  4X5K A;  2RM4 A;  1MND A;  3CCL Q;  1K9M C;  5IXF A;  4PJO C;  4XNH B;  3UDC A;  2W0Z A;  3JAM E;  1W2B A;  5FVJ A;  2RHY A;  3JCM g;  2X3X D;  4J7F A;  4TNU A;  1U06 A;  5H84 A;  3UA7 A;  4CGL A;  3MRU A;  2PQW A;  3D67 A;  5LJ5 h;  1D3B A;  4XQ3 A;  3OYJ A;  3WAB A;  5KYU B;  4NL3 A;  2CTC A;  1M3A A;  2NUZ A;  3FLG A;  4E7H A;  4OAE A;  1R8O B;  4M7A F;  4AG1 C;  1Q86 R;  4BY6 C;  5F46 A;  2OZU A;  3FH4 A;  4PFP A;  1DTD A;  2M0O A;  4PXC A;  4QKU A;  2OTL Q;  3UY5 A;  3I56 T;  1M3B A;  1WNL A;  1KIK A;  2ABZ A;  1BYM A;  3LD2 A;  4C92 A;  2CP2 A;  2X4Y A;  5KTD A;  1RI0 A;  4HCZ A;  1QMU A;  1NSA A;  4Z65 A;  2QQ9 A;  1YLE A;  4C2Y A;  4D6W A;  3S6F A;  3FB3 A;  3EFR A;  2ZAE A;  3TX8 A;  1D1C A;  4JRI A;  2WUU A;  2H8H A;  2EYX A;  1R77 A;  1UFH A;  2HMA A;  4ZN1 A;  3CCE A;  3GKR A;  2DL7 A;  1S7L A;  2G3A A;  4MY0 A;  1BI2 A;  2KRS A;  3CCR Q;  1PD1 A;  2ED1 A;  1RL2 A;  3GY9 A;  2A3L A;  2XK0 A;  4MI4 A;  1IYK A;  2YNC C;  4BDY A;  1YVK A;  1UFF A;  4X9C A;  3CCE T;  1KQ2 A;  4NCZ A;  1M2V A;  4DBQ A;  4DQ2 A;  3G3S A;  3NH5 A;  1XIX A;  5F09 A;  5J8C A;  1BB9 A;  2DXU A;  3SI0 A;  4LDX A;  3GLJ A;  1TOV A;  4A31 A;  1QCN A;  2OAW A;  2Q4Y A;  4QQD A;  3SWN C;  5LYL A;  2PZ1 A;  3SJX A;  1VQ4 Q;  4ZX8 A;  2EAY A;  1AMP A;  3D3S A;  5KYX B;  4GLM A;  4AVC A;  1GCP A;  2QG9 B;  4HCC A;  4M7A A;  5LYF A;  1CM0 A;  4R57 A;  2PVO B;  4RG8 A;  2Z0Z A;  5CKH A;  4C8Q F;  3OS0 A;  2HKN A;  3V8J A;  5GAN h;  4OC5 A;  2P0Q A;  2KNB B;  1QWE A;  4M77 A;  2BCO A;  3ISZ A;  5K8O A;  2RHI A;  1FT7 A;  2ZW4 A;  1WGS A;  2LC4 A;  5KE3 A;  1YQE A;  5THW A;  2PNI A;  3G4S Q;  3QBY A;  4J9E A;  4DOV A;  1VQ5 Q;  1A2Z A;  2LX9 A;  4M75 D;  4ELY C;  4MHD A;  1Y0M A;  2PIY A;  3REA B;  3CCJ Q;  3S6K A;  3TC8 A;  2QA4 T;  3NE8 A;  4WWV A;  3FEE A;  2DKG A;  3KKW A;  3CCS Q;  1Z9Q A;  3OYC A;  4XPK A;  5DM7 R;  4RI1 A;  1D09 B;  2CS7 A;  2Q4Z A;  2D4O A;  1WHJ A;  4CRI A;  3FX6 A;  5J8F A;  1MMA A;  4D8D A;  5I2S A;  2K7A A;  1NM7 A;  4K11 A;  1D1B A;  4KUL A;  3S3N A;  1HYO A;  2KYM A;  1AZE A;  4NGT A;  1S3Z A;  2FPD A;  1HD3 A;  1PKS A;  2CT4 A;  4XU3 A;  3EHQ A;  3B35 A;  5M9O A;  5HY6 A;  2E64 A;  4UCM A;  4PLI A;  4M7D C;  5HVH A;  1VIE A;  3B8G A;  3ER0 A;  1IIC A;  3IWG A;  1YWP A;  1LPL A;  4LE9 A;  2PR1 A;  5BWA B;  4N0A C;  2ZCF B;  2XG8 D;  1BPN A;  2AE6 A;  1QKX A;  4HXJ A;  2FZG B;  4D8K A;  2K3Y A;  4O5V A;  4PJN A;  3TOB A;  4LQ6 A;  1HJD A;  3CT9 A;  2J6O A;  3M59 A;  2CUB A;  2DZC A;  4FYX B;  1JQQ A;  1TUG B;  2MYS A;  1NG2 A;  3A8M B;  3S9L A;  5CKE A;  3R96 A;  5GAM h;  3QB8 A;  3CPW S;  1Q82 U;  2CUD A;  3K2K A;  3KXT A;  2ECZ A;  4M7A B;  4MZM A;  4UFV A;  4JS4 A;  1VYV A;  1N8R U;  3CD6 T;  2E41 A;  2HD0 A;  2JS2 A;  4L59 A;  4FT4 A;  1JB0 E;  2ZGW A;  4EME A;  3CCJ T;  4RTW A;  2CP3 A;  4LN2 A;  1JJ2 A;  4UFX A;  2E6N A;  2ANP A;  1OV3 A;  3RR6 A;  2DVE A;  3BXM A;  5J3B A;  5A28 A;  2Q44 A;  2CNM A;  4GXH A;  2AT1 B;  2AFM A;  2BE7 D;  2E12 A;  2RFH A;  3HRU A;  4M7D E;  3DSB A;  4OC0 A;  1Y7E A;  4FSX A;  1PNJ A;  3EG9 B;  1IID A;  3CD6 Q;  4JJC A;  4NGP A;  1N8R C;  2DIG A;  5AT1 B;  3UT1 A;  3PB4 X;  3U23 A;  1OPK A;  3DLJ A;  3G4S A;  4QVT A;  1B34 B;  1QVF P;  2DLP A;  2HEQ A;  4RG2 A;  4OID A;  4ZY0 A;  1VHE A;  4P6Y A;  1Q2D A;  5ISV A;  1TSF A;  2QAZ A;  4UEF A;  1VQO T;  3BDU A;  4RTX A;  2ZEH A;  5FRM A;  1YI2 Q;  3H8Z A;  2QDL A;  1PD0 A;  3DR8 A;  2ZXV A;  1AWJ A;  4YFJ A;  3M0Q A;  4M78 F;  3D7F A;  1KFZ A;  1OUL A;  1KG1 A;  4JJX A;  4AFQ C;  3D68 A;  1YJ9 A;  2HBP A;  2VGN A;  5CO7 A;  2ZEG A;  2EJG A;  1YI2 T;  2K3B A;  1X10 A;  1ARK A;  4X9D A;  1BI0 A;  4UF4 A;  2ARH A;  1D0Z A;  1WPY A;  2PUO B;  4NGN A;  2EGE A;  2F2W A;  5IV0 A;  2XEF A;  3FC3 A;  3EFS A;  4NEX A;  1YR0 A;  3TEE A;  3T90 A;  2VZY A;  5AG4 A;  3G6E A;  3DLM A;  3CCQ T;  1CG2 A;  3QNV A;  4HT9 A;  4AFU C;  2KRN A;  2YSQ A;  3A9L A;  3JRU A;  1GFD A;  4M77 F;  3JB9 I;  5GAM g;  2CNS A;  2FVG A;  4PXE A;  2DET A;  3A8G B;  1IU8 A;  2AJ6 A;  2B5G B;  1PCA A;  3VUZ A;  2QVP A;  4IF5 A;  2PJ3 A;  1K8A C;  1IRE B;  3WT4 A;  2O4H A;  2GBQ A;  4M7D G;  3WC7 A;  2COZ A;  1YCS B;  3QJ6 A;  4YTL A;  5IAY A;  1FNO A;  4KVM E;  1NLO C;  1X6G A;  4PSX A;  4MJ8 A;  4AB7 A;  1Q7Y U;  4EMH A;  1BPM A;  2KCW A;  2VWF A;  1I0C A;  4MZP A;  4WTO B;  2O53 A;  3KQX A;  4NGS A;  1IOF A;  1VQ7 T;  2WSA A;  2GTO A;  1T0J A;  2JT4 A;  5AGE A;  3CME Q;  2VVK A;  4NOY A;  1VQ6 A;  3IGR A;  2HKQ B;  3B7I A;  4DEX A;  3OYI A;  2CY2 A;  3D66 A;  8AT1 B;  3PNW C;  2JDD A;  1N6A A;  4II1 A;  3S3O A;  1SQH A;  2LCC A;  2O88 A;  2REF A;  1M9S A;  1Q2C A;  2DRM A;  3H6Z A;  3M56 A;  1NEB A;  3GIU A;  2ED0 A;  1WQ7 A;  2PU9 B;  4MFL A;  1JJ2 S;  4C2Z A;  1M44 A;  3FNC A;  5I0C A;  1RAI B;  1NJI U;  3BHX A;  1QVF A;  4ZYQ A;  3M55 A;  2PJ1 A;  2H3E B;  4IUQ A;  3ZZI A;  1P92 A;  4KS9 A;  9ATC B;  1UHC A;  2J8N A;  2CSI A;  5FU7 B;  5GMK j;  2IQ6 A;  3PIP A;  3LGL A;  1M4D A;  1M4G A;  4EFD A;  2X7B A;  4Y92 A;  1ZX6 A;  1BI3 A;  4A63 B;  5GAN g;  2ZEP A;  4JXQ A;  3PB6 X;  3LH0 A;  2LMJ A;  1EIF A;  3M57 A;  1VKC A;  2QIR A;  5LYD A;  4B13 A;  1JU5 C;  4BMH A;  4DUK A;  5AG7 A;  2CGH A;  2K5F A;  3I9Q A;  3HHT B;  5FWC A;  1VQM A;  3HUV A;  2D0N A;  1Y0Y A;  4C92 G;  4IHM A;  3IO1 A;  1X12 A;  2E65 A;  4EDU A;  4JRP A;  1K4J A;  3KZW A;  2X35 A;  1CSK A;  4ZN3 A;  2BUD A;  2FL7 A;  2R98 A;  2R7H A;  1S72 A;  1VYU A;  2E6Z A;  3MGD A;  1Y9W A;  3FBU A;  5FU6 C;  4IIO A;  4KRT A;  5GJV B;  2G3R A;  3L2R A;  4Q38 A;  1BAV A;  4LX9 A;  3V7C A;  4XPD B;  2REE A;  4PJM A;  1VQ7 Q;  3CC7 Q;  2GTJ A;  4TVR A;  2XEJ A;  1RAA B;  2DBK A;  2RH2 A;  4A33 A;  4BI8 B;  1M90 U;  3H0I A;  2PVD B;  2JLM A;  3GLX A;  3W91 A;  1NYF A;  3GIB A;  1YLO A;  4K30 A;  1XRY A;  1ZUY A;  1B07 A;  4MCS A;  4M75 E;  3SXO A;  3M0U A;  1M1F A;  4MFZ A;  2L3Q A;  4NXY A;  3A1P A;  2QI2 A;  1M4L A;  4L5G A;  3OSV A;  3C12 A;  2CIJ A;  4CYQ A;  3CBO A;  2ZEM A;  4C5H A;  1RXT A;  2P6G A;  1K73 U;  2P6E A;  2LJ0 A;  4MBU A;  5FLX E;  2RQV A;  5CNP A;  1X69 A;  4UWJ A;  2BZX A;  1W6X A;  4NJQ A;  4ORF A;  1AT1 B;  1JO8 A;  4F6A A;  5JH9 A;  1UHF A;  3G8W A;  5LJ5 g;  4XU1 A;  4M7D F;  4ZTJ A;  3B3T A;  1M1K R;  2FSR A;  4C92 F;  2WPX A;  2NUP B;  3LYI A;  3KHZ A;  1TU0 B;  2GQV A;  4N4I A;  4C0F A;  2LTO A;  2NUT B;  2FS5 A;  2NMT A;  3EGU A;  4CPA A;  2HV2 A;  4OC4 A;  2M1H A;  3E0K A;  3M0P A;  2JM8 A;  2ZOF A;  2QGF B;  2XU8 A;  1S1N A;  5GMK h;  4UEE A;  1PSE A;  3E1S A;  4QUS A;  5LJ3 e;  2LQK A;  5IT9 E;  2YLC A;  2GF7 A;  4Z89 A;  2GRE A;  1RTQ A;  3PE0 A;  1VQL A;  4A38 A;  2R5A A;  4X34 A;  2PJ4 A;  4PK2 A;  1UDL A;  1OZ3 A;  2MPX C;  3J81 E;  2FO0 A;  1Q86 C;  2PJ8 A;  4OF1 A;  4B11 A;  2KEA A;  1D0X A;  2KGT A;  3CC4 Q;  2BL1 A;  1VQL T;  1C6V X;  4HVW A;  1LAM A;  2E1H A;  3CD6 A;  5GMK l;  2E5K A;  2PRB A;  2XHC A;  2JS0 A;  3OQ5 A;  5CKB A;  1KUX A;  1UUE A;  2JW4 A;  3UAT A;  3CCU T;  2J9A A;  3FJU A;  3H8E A;  2Q4V A;  4N0A A;  1WI7 A;  2KQW A;  2Q0Y A;  1RAE B;  3VRZ A;  3CCS T;  5HMN A;  3PVL A;  3B3C A;  2QEX T;  3VKI A;  3CDX A;  4C92 D;  2EBJ A;  1XJO A;  2ZED A;  1ZHI A;  2RB6 A;  1WIE A;  4NFR A;  3ULR B;  1YWO A;  5CK9 A;  1RAH B;  4J9D A;  1XE4 A;  4J9B A;  1IGU A;  3IEH A;  1WHH A;  2DMO A;  2JVV A;  2K57 A;  2VXF A;  1AYE A;  1PCX A;  4E8O A;  4BY6 B;  2GGR A;  3J7A F;  1VQ6 Q;  1LOJ A;  1WLP B;  2M16 A;  4FCY A;  1VQ4 A;  1U6M A;  1FMW A;  2ROL A;  4ONW A;  3KAS A;  3CEY A;  4PJL A;  4M3S A;  2FZC B;  3QWX X;  4C8Q B;  3CC4 A;  2QQA A;  4L89 A;  2H3J A;  4M7D D;  4QVD A;  4EMK C;  2RK1 A;  1ZLI A;  2DYB A;  1ZG7 A;  3L2U A;  3JCM b;  4M6I A;  2WSE E;  3EG0 A;  2OTJ Q;  1Y71 A;  3CCV A;  4DYO A;  2EO8 A;  1VQ4 T;  2KT1 A;  2KVQ G;  4XU2 A;  2DER A;  1K9A A;  4A4G A;  8CPA A;  3JCM Q;  1QVP A;  2EK8 A;  2RHZ A;  2HL3 A;  5GAN f;  1LFW A;  3I1U A;  5GMK i;  4FD7 A;  2DL5 A;  1VGY A;  4EMK A;  3EXN A;  2Z10 A;  1TS9 A;  5EMI A;  3CCV T;  4XTX A;  1PHT A;  4UA3 A;  1X2K A;  2CT3 A;  1UB4 A;  3R9G A;  3SWN A;  2F7V A;  3NA6 A;  2FRY A;  2MAM A;  4IUP A;  2FEI A;  2HB6 A;  1R43 A;  3MN8 A;  1YJ9 Q;  2I00 A;  1VQP A;  2FG0 A;  1YME A;  3LOD A;  4F9V A;  2YND A;  2DIL A;  4EIK A;  4ZGE B;  2ZPI B;  3SI1 A;  4AFZ C;  5HVF A;  2D9T A;  4BI3 A;  2DJZ A;  4PJO F;  4DA4 A;  4OME A;  3CMA T;  1VQ6 T;  1YJN A;  3V8L A;  3I35 A;  3V8K A;  2GQI A;  1YHQ Q;  2YRV A;  2B86 A;  4MHZ A;  1YN8 A;  2JJ9 A;  2M51 A;  2JN0 A;  4PV6 A;  2YT6 A;  4FW1 A;  4OGC A;  2FXF A;  5GAM j;  5D6W A;  2ZEL A;  1NSL A;  4EMG A;  3CXP A;  3F70 A;  4C8Q G;  3H8G A;  3CXS A;  2JEW A;  4MMK A;  2YWW A;  5CQY A;  2B3U A;  1LNX A;  4CC2 A;  1GXI E;  4BUG A;  4XPD C;  4MHN A;  1QQJ A;  3DGV A;  1Y57 A;  5GAM f;  5JGF A;  4F7U G;  5DLO A;  3VJP A;  1NEG A;  4R0K A;  3EG3 A;  1VOM A;  2DD4 A;  4A30 A;  1YIT Q;  5HCK A;  5KE2 A;  2VI7 A;  2V8J A;  2EYQ A;  1SF9 A;  5KYY B;  3GNG A;  4OB3 B;  3CQT A;  1K4U S;  4IIM A;  1ARL A;  3FXT A;  3QAH A;  4XTU A;  2FHD A;  5EG2 A;  1OU8 A;  3MCA B;  4OMP A;  5HK3 A;  4DNC A;  2PC1 A;  1PM3 A;  1LOK A;  2E10 A;  1XEB A;  4C0D C;  1KZF A;  2FE7 A;  3QXE B;  5HK0 A;  1PYT B;  4E7K A;  3EO4 A;  3RES A;  2JXB A;  3PGG A;  3CCR T;  4RTZ A;  4OB0 B;  3P8D A;  5GAN 5;  2FZK B;  2NUP A;  4F0X A;  1PKT A;  2A36 A;  1UEC A;  1AEY A;  4KOY A;  4M7D B;  4KOR A;  4A39 A;  2NUT A;  2F2V A;  2ZPA A;  1BBZ A;  2PJ5 A;  3JCM d;  2KDS A;  1BCM A;  3JSC A;  1PG5 B;  3CCR A;  4OKO A;  5HKC A;  3SB2 A;  4CGO A;  1M4I A;  1SHF A;  3D7S B;  4FIB A;  2AFS A;  2G6F X;  3I55 Q;  1HDQ A;  4MML A;  3MEA A;  3X26 B;  5GAN j;  4UBR A;  2DPT A;  4QQG A;  1S5K A;  5FW9 A;  2KYB A;  4H6U A;  1MGQ A;  3VS3 A;  3PB7 X;  5J39 A;  3UF4 A;  1RAC B;  1ZQ1 A;  1N9S A;  4ME7 A;  2Q7B A;  2MOX A;  3OYM A;  3WC6 A;  1W4S A;  1MJ9 A;  1J4J A;  1OPL A;  4MCR A;  4O23 A;  4J5Y A;  2RQU A;  4A4E A;  3HRS A;  1VQ9 Q;  3KQZ A;  2QML A;  1BKB A;  4HT8 A;  4Y49 B;  5CIU A;  1I81 A;  1F57 A;  1YFN A;  4A4H A;  3CBM A;  4GM5 A;  3QII A;  2ZEN A;  1D3B B;  2DE0 X;  2P4R A;  2XIC A;  4F16 A;  1YJW A;  2PJ9 A;  1UG1 A;  3M58 A;  3RKX A;  3RER A;  3R6O A;  3CPW A;  4JJN K;  5LJ3 d;  1L0C A;  1KSW A;  1SSF A;  4HNX B;  4RMO A;  2M02 A;  2XD0 A;  3R95 A;  3EH2 A;  1AHJ B;  3S9N A;  1E6G A;  2EQK A;  4J9I A;  1PSF A;  2DXT A;  2PE3 A;  2LJ1 A;  4OB1 B;  4PK3 A;  4XNH C;  4CI0 C;  3VV0 A;  1IB1 E;  3I55 T;  5CAI A;  2NLU A;  3OSS C;  1M4Z A;  1ZLM A;  4HPS A;  2EVN A;  2RF0 A;  5AG6 A;  3V38 A;  2C0I A;  2YNE A;  3URG A;  4C8Q C;  2XID A;  1KC8 R;  4C8Q A;  4PL6 A;  1KWM A;  5K8N A;  4P4B A;  1SPK A;  4IAV A;  1U8R A;  2P0W A;  1Z9Z A;  4PNO A;  2DVJ A;  3C26 A;  3VWD A;  2POK A;  2B8A A;  3QYH B;  4PJO G;  4KVO E;  2K3X A;  1ZUU A;  2JNG A;  2CRE A;  2MIO A;  4A94 A;  3PTA A;  1M2V B;  5DLQ E;  3OBW A;  4JLI A; 
#chains in the Genus database with same CATH homology
 3VS2 A;  3E9G A;  1AWO A;  3FJP A;  3LWI A;  4JLG A;  2A28 A;  2KSS A;  1KC8 U;  2SRC A;  2EKO A;  3CCS A;  3L1A A;  4ZNX A;  2AK5 A;  2EWN A;  1HSQ A;  3IQL A;  3FRN A;  4C8Q E;  1NZ9 A;  1VA7 A;  1I8F A;  2DD5 A;  4Z88 A;  2D6F A;  5CKF A;  2EW3 A;  3MEU A;  4JUV A;  2EPD A;  3X20 B;  1T0H A;  5CCA A;  1LJO A;  2FPF A;  2F2X A;  3RKY A;  2OTJ A;  2QXF A;  4J6X A;  4DEY A;  4BE1 A;  5IHK A;  1MV3 A;  3X24 B;  1JWQ A;  2DRK A;  1V29 B;  4IUR A;  4VUB A;  2VYT A;  4C5G A;  5LL6 S;  1LCK A;  1IZ6 A;  4V2S A;  4E7J A;  4Q5W A;  2V1R A;  1J3T A;  2Y4X A;  1VQ7 A;  1PRL C;  3X25 B;  2J6K A;  3JB9 G;  3EHR A;  3M0R A;  4IUU A;  2Y90 A;  2JTM A;  4OML A;  3OYA A;  3KFV A;  4C92 C;  3HP9 A;  5GAO r;  2X4J A;  2RI2 A;  2KRM A;  2QTX A;  3GPL A;  4OMM A;  4J9G A;  3BW1 A;  1W2B S;  1NLP C;  1O75 A;  2IG0 A;  4M7A C;  2LT4 A;  3LW5 E;  3VS6 A;  5GJW B;  5DY9 A;  3TU4 K;  1X2Q A;  4AG2 C;  3M4Y A;  3CCL T;  4UC4 A;  3A8H B;  2XI9 A;  4CC4 B;  4J9C A;  5A0L A;  2LP5 A;  2JUF A;  1B34 A;  3J80 E;  1YBY A;  2OI3 A;  2WAC A;  4RTT A;  2L3S A;  3CCL A;  1VQM T;  4RTY A;  3SEM A;  3VS1 A;  1NPP A;  4DOW A;  2V8I A;  2DTO A;  1BIB A;  4A53 A;  1G3W A;  2RJD A;  1KQS A;  3S6W A;  1VQK T;  5LJ3 j;  2K2M A;  1WJS A;  2J7I A;  2C06 A;  3LGF A;  4M75 G;  1M90 C;  2KE9 A;  4F7U B;  4XTV A;  2EYW A;  3PFS A;  1VQK A;  4JZ3 A;  3QG1 A;  4PJO D;  2RI3 A;  3AHU A;  2AKL A;  4HVV A;  4KUI A;  1G83 A;  1AOJ A;  2L8D A;  3OMG A;  1H3H A;  3TVT A;  2RI5 A;  2K2V A;  3OYB A;  3NMZ C;  3MEV A;  3EAE A;  5ECA A;  4IUT A;  1UEB A;  4ESR A;  3JCM V;  1K8A U;  4M78 A;  5FRO A;  2QDY B;  3OYH A;  3L2W A;  1VQ9 A;  3LH5 A;  4PKC C;  5LJ3 g;  1HK9 A;  4Y28 E;  1VQ8 A;  5L23 A;  4JJB A;  3L2V A;  4M75 F;  1QP2 A;  2EJ9 A;  3RUX A;  3S3M A;  3QSU A;  4L6V 5;  2AZS A;  2GFU A;  1KJW A;  1YIJ A;  3VRY A;  1QP3 A;  1Y07 A;  3ME9 A;  3A8O B;  5GAN 6;  5GMK m;  3I55 A;  4ZGD B;  3G71 T;  1M27 C;  4FSS A;  2DXB A;  2AZV A;  4JZ4 A;  5CVI A;  4J9H A;  5LJ5 f;  4KUD K;  3OYE A;  1E7O A;  2M0Y A;  4J9F A;  4C92 E;  4QVC A;  2ODF A;  5FU6 B;  2RD1 A;  2VKN A;  1AD5 A;  2FYK A;  4C0G A;  2LCS A;  3VS5 A;  1Q82 C;  3X28 B;  1QVF S;  2MWP A;  3C0C A;  4B9W A;  3GBQ A;  4JDS A;  2FRW A;  4A4K A;  4EPC A;  4FL6 A;  2RJC A;  4O6J A;  2EVR A;  1FXX A;  5EC7 A;  1K9M U;  4M77 G;  2I0N A;  3OYN A;  3TSZ A;  4M78 B;  2CH4 W;  2KK4 A;  4E6R A;  2K6D A;  3M0T A;  2K5L A;  1K73 C;  3JB9 F;  2X4W A;  2CZ7 B;  1WFW A;  3CME A;  2WSF E;  3CZX A;  2FPE A;  2LDM A;  4LDY A;  4R55 A;  4RTV A;  4M78 G;  1U1S A;  4JRQ A;  1EFN A;  4M77 B;  4E47 A;  1Q86 U;  1OYX A;  3HPW A;  1RUW A;  3CME T;  2MF2 A;  3NPF A;  2QQS A;  4QQ6 A;  1FWZ A;  3VYG A;  2GNC A;  3PMI A;  4P5N A;  3MET A;  3OYY A;  1ABO A;  2FVU A;  4XK8 E;  2V8K A;  4BDZ A;  1KQ1 A;  2VXE A;  3G6E T;  2J05 A;  1ZBJ A;  1G3T A;  2DX1 A;  3PT9 A;  2DF6 A;  3WVD B;  3M54 A;  2DEQ A;  5GAM d;  2DA9 A;  4HA8 A;  2BIV A;  2GFA A;  1GBQ A;  2V1Q A;  4PJO A;  2L3R A;  2YUP A;  2GCX A;  2HSP A;  1G5V A;  1X43 A;  1KHC A;  1Y96 B;  2A08 A;  3A5Z B;  4GBQ A;  4F7U A;  1VYT A;  1GBR A;  2VC8 A;  1NE8 A;  2A7Y A;  1JRI A;  4J83 A;  3NTK A;  4QT7 A;  1NPR A;  3JV3 A;  2L3P A;  2OJ2 A;  1N27 A;  4ZGJ B;  1A0N B;  3JCM f;  3DB3 A;  2R5M A;  3CCM A;  2XDD A;  4WCI A;  3QPH A;  2SEM A;  5IXB A;  2RJF A;  5D6Y A;  2P4T A;  2PTK A;  1UGP B;  3RNJ A;  2X3W D;  3JRZ A;  4GY5 A;  2JZ2 A;  3T9N A;  1H3Z A;  4LD6 A;  4FM4 B;  4N4H A;  1GL5 A;  3OW2 S;  3QZ5 B;  1V1C A;  4NS5 A;  1X6O A;  1K1Z A;  4C5I A;  2CDT A;  1GRI A;  1QKW A;  2HAX A;  1AZG B;  3NTH A;  3OYF A;  3C4S A;  4PJO B;  1M3C A;  2HNI A;  2ZPG B;  1KD1 U;  4HVU A;  3GOX A;  5GMK e;  3OYL A;  2DL8 A;  2E5Q A;  3NTI A;  3EG2 A;  2RPN A;  1Y96 A;  3QWY A;  4M7A D;  2KY9 A;  2EQU A;  1BI1 A;  2O01 E;  2DO3 A;  3OYG A;  4RKU E;  4J6Y A;  4LUE A;  1NJI C;  2ZPB B;  5CQX A;  4C5E A;  4M77 E;  3NGP A;  3G7Z A;  1I1J A;  1ZBX A;  4M77 D;  2QA4 A;  1YJW T;  4LUD A;  4ATO A;  1WX6 A;  2J6F A;  2EFI A;  1BIA A;  3HSB A;  3MHX A;  1WA7 A;  1WXU A;  4JJD A;  4M78 E;  3QDR B;  4ORZ A;  1MUZ A;  3QHS A;  4M78 D;  1JEG A;  1Q81 U;  1YIJ T;  1M5Q 1;  3LWH A;  3FIF A;  2RJE A;  2EQM A;  2LJ3 A;  3PIO A;  3DKM A;  4XAX B;  3HFN A;  1UJ0 A;  4ELZ C;  4RCB A;  3VS0 A;  3HFO A;  4NL2 A;  3A8L B;  4LDV A;  3MP6 A;  3SDZ A;  2MCN A;  2LNV A;  1SEM A;  4B9X A;  5KCH A;  3V7R A;  5GAN 7;  2W10 A;  2RQW A;  2MI6 A;  3CCU A;  4LDW A;  2A37 A;  3V7S A;  3G4S T;  4BIN A;  2QEX A;  2RO0 A;  1G2B A;  1NYG A;  1VQO A;  3VS7 A;  3JB9 D;  1RLP C;  1N5Z A;  5GAN d;  2OTJ T;  2O9S A;  2HQX A;  1OI1 A;  1K76 A;  1WQW A;  2AKK A;  2YLB A;  2J06 A;  1JBM A;  3QYG B;  2K79 A;  4R56 A;  1VQ5 T;  2BKD N;  5FWB A;  5GAO n;  5LJ5 e;  3VUB A;  2CKK A;  1W70 A;  1VQ5 A;  2JM9 A;  3E9F A;  1XOV A;  3HKS A;  1I4K 1;  1YHQ A;  1X27 A;  4KT0 E;  1H92 A;  2NWM A;  4BD3 A;  3MP1 A;  4M75 B;  1OZ2 A;  1O9S A;  3L2Q A;  1AVZ C;  2ZPH B;  3QJY A;  3RIR A;  2DJQ A;  2I2L A;  3INZ A;  1VQP T;  4OB2 B;  2EIF A;  3JCM e;  2E70 A;  3ASK A;  1UGQ B;  2OTL T;  4M4Z A;  2LZ6 B;  1GFC A;  2CYZ B;  2ESW A;  1UGR B;  3RMQ A;  3NFC A;  3CBP A;  1ZSG A;  2ZPE B;  3M5A A;  4KBM B;  3OA6 A;  1IO6 A;  2YUO A;  2CZ0 B;  1QCF A;  4OMO A;  2LNH B;  2Y4Y A;  3CXC S;  1PWT A;  1QVG S;  5FRN A;  4IUV A;  2DTH A;  3A98 A;  2WSC E;  2RHU A;  5A0D A;  1N9R A;  1JXM A;  1QLY A;  1RI9 A;  4M6G A;  3PMT A;  5I11 A;  4M7A E;  2LCL A;  3CCM T;  3Q1J A;  5GAN e;  2VGM A;  5IHN A;  1WXT A;  1U5S A;  3MP8 A;  2KR3 A;  2IIM A;  4A54 A;  4A4F A;  1G3Y A;  5GAO m;  2DNU A;  5C0M A;  4M75 A;  2R58 A;  3OBW A;  2LRQ A;  1BU1 A;  5A0G A;  3FJ5 A;  2L0A A;  2LQ8 A;  2YUQ A;  2AHJ B;  3QKJ A;  3OY9 A;  3O8V A;  4QVZ A;  3GP8 A;  3L42 A;  2YHT A;  3GNF B;  3OMC A;  3ZBD A;  2XMF A;  2RK2 A;  4EMK B;  1CKA A;  4BE0 A;  1WJQ A;  3H0H A;  3RKW A;  1T3L A;  5LJ5 d;  1VQ9 T;  1YCY A;  3WXM B;  1VQ8 T;  5GAM e;  2FB7 A;  2C0T A;  3RBB B;  4HCK A;  1FX7 A;  2KXD A;  1H64 1;  4OMQ A;  1M1K C;  1X75 C;  4RTU A;  4M75 C;  3CC2 T;  5L8R E;  2YUN A;  5GAN 3;  1SRM A;  3G71 A;  3M0S A;  4PLL A;  4OGE A;  2JMC A;  2JTF A;  4J8O A;  3KUF A;  1YIT T;  5GAO q;  3I5S A;  3OS5 A;  1UTI A;  2BZ8 A;  4RN7 A;  2P0K A;  1AWX A;  3UWN A;  2RQT A;  1SRL A;  3FEO A;  3OB9 A;  4J6W A;  1WXB A;  2EKH A;  3OYK A;  1CKB A;  1VIF A;  4J7I A;  1OOT A;  2BZY A;  4XTY A;  2EGA A;  4AFS C;  3ZL7 C;  5I22 A;  5I21 A;  4F7U E;  2RNA A;  4LDU A;  2DM1 A;  2DIQ A;  1FMK A;  3LLR A;  2Q7S A;  1H8K A;  3FDR A;  4E7L A;  4M77 C;  2XDB A;  4PJO E;  1YNZ A;  3CC7 T;  4XTW A;  1TG0 A;  1W1F A;  2JOY A;  1AWW A;  4CC7 A;  3EG1 A;  2O9V A;  2LVM A;  4RUG A;  4Z8A A;  2RN8 A;  2KXC A;  2L2P A;  2RA2 A;  1M30 A;  3CXC A;  2RHX A;  4M78 C;  3M53 A;  3JCM W;  2KMT A;  4M7D A;  2ENM A;  4RCC A;  3FB9 A;  4MDW A;  5GAN 4;  4HKE A;  3VU3 C;  5C6S A;  3MO8 A;  1QWF A;  3NHN A;  1E6H A;  2EYY A;  5IH2 A;  1YJ9 T;  1RLQ C;  5CKD A;  3JCM J;  1YI2 A;  2ABL A;  2XKO C;  1X01 A;  1VQN A;  3BY7 A;  4ZTF A;  1GCQ C;  2CZ6 B;  2F5T X;  3UA6 A;  2VUB A;  1YHQ T;  1M1K U;  3QZ9 B;  2LQN A;  1YP5 A;  1XNI A;  1TUC A;  1B3Q A;  1FYN A;  2O2O A;  2ROT A;  4F7U F;  3CMA A;  4XTZ A;  1UGS B;  1YJN T;  2LQW A;  2QQR A;  2X4X A;  3RMS A;  5KCO A;  2IVW A;  5I2M A;  2HC9 A;  1Q7Y C;  1SHG A;  4JPB W;  2RMO A;  2MWO A;  2KT8 A;  5IN1 A;  1U1T A;  3P8B B;  3I56 A;  1KHI A;  2CSQ A;  1M8V A;  1WDX A;  3N5B B;  4WF2 A;  3SHW A;  2EGC A;  3JB9 H;  4XU0 A;  2LT1 A;  1WJR A;  1DJ7 B;  1T3S A;  2HBW A;  2JTE A;  4M7A G;  1MHN A;  3E19 A;  1JXO A;  1ABQ A;  2R57 A;  3UPU A;  1I5L A;  2L5Q A;  1OEB A;  3LX7 A;  3JCM P;  4N4G A;  4FT2 A;  3OYD A;  4Z02 A;  2K5I A;  1MV0 B;  3HRT A;  2EBP A;  3C94 A;  3C95 A;  3R6N A;  1ZUK A;  5IHI A;  4C8Q D;  2JMA A;  3H41 A;  3OS2 A;  2F5K A;  2O4X B;  5D6X A;  3M9Q A;  1KC8 C;  4QW2 A;  4Y91 A;  5GAN 2;  2DPP B;  4BB7 A;  3SFM A;  1S72 T;  2PVG B;  5GAO l;  1M1G A;  3REB B;  4OP0 A;  2QQB A;  2VV5 A;  4C92 B;  2KRO A;  3WVE B;  3O5Z A;  5FU7 C;  3KBG A;  3QAY A;  4CC3 A;  2D8J A;  2HQE A;  3HL8 A;  4BI4 A;  1I07 A;  2OAU A;  2LX7 A;  3GF5 A;  3JCM X;  5A2Q E;  2CZ1 B;  2K9G A;  3P8H A;  2L89 A;  2DAQ A;  3DB4 A;  2C0O A;  5GAN 8;  5GAO p;  1Q81 C;  4JRK A;  5LJ3 h;  3DLL A;  1SSH A;  3H0F A;  1UJY A;  3CC2 A;  3BDL A;  2DK3 A;  1Y7X A;  1U3O A;  2F69 A;  1UE9 A;  2DL4 A;  1PRM C;  3BFM A;  3PVQ A;  4MDX A;  1KD1 C;  2D0Q B;  3TSW A;  4C0D B;  3SWN B;  3JCM h;  1YIT A;  1GCQ A;  1K0X A;  1UGV A;  2BTT A;  2DBM A;  2O4X A;  3L2Z A;  1TH7 A;  3VYH B;  4JS5 A;  2HDA A;  4X1V A;  5LJ3 f;  4BAC A;  2RQR A;  1X6B A;  1QVG A;  4F17 A;  3ZEH A;  2ZPF B;  3ZFJ A;  1HXD A;  3OW2 A;  4OMF B;  3CCJ A;  1M8M A;  5CR2 A;  1KQS S;  2MMP A;  2DXC A;  4MZT A;  5KH6 A;  2D8H A;  2ZZD A;  3QUI A;  4LD9 K;  4BE2 A;  3CC7 A;  2DTI A;  1XQH A;  4F14 A;  3I5R A;  2KBT A;  2EYZ A;  2O31 A;  2M9U A;  2YDL A;  3JB9 J;  4HCB A;  2HCK A;  4LNP A;  2EJF A;  4FU6 A;  4IKF A;  3OBY A;  3MEW A;  3SD4 A;  1QW1 A;  3M4G A;  3VS4 A;  2XDP A;  4GLK A;  4OVA A;  3TRE A;  4C0Z A;  3JCM c;  4OMN A;  3CC4 T;  1TUD A;  4M6H A;  3OS1 A;  2DZ9 A;  2D1X A;  3TCJ A;  2P0P A;  1BK2 A;  1WYX A;  1XTD A;  3CCQ A;  1VUB A;  2DL3 A;  4E7I A;  1VQN T;  5AYF A;  2CH4 A;  2EQI A;  2KAF A;  3THK A;  1G3S A;  2PUK B;  2EQJ A;  3CPF A;  5J26 A;  3QO3 A;  1K0S A;  2OTL A;  2K4Y A;  2RM4 A;  1K9M C;  5IXF A;  4PJO C;  3UDC A;  2W0Z A;  3JAM E;  1W2B A;  2RHY A;  3JCM g;  2X3X D;  4J7F A;  1U06 A;  3UA7 A;  2PQW A;  5LJ5 h;  1D3B A;  4XQ3 A;  3OYJ A;  4NL3 A;  1M3A A;  2NUZ A;  3FLG A;  4E7H A;  1R8O B;  4M7A F;  4AG1 C;  4BY6 C;  2M0O A;  3I56 T;  1M3B A;  1WNL A;  1KIK A;  1BYM A;  4C92 A;  2X4Y A;  1RI0 A;  4HCZ A;  2QQ9 A;  4D6W A;  3EFR A;  4JRI A;  2H8H A;  2EYX A;  4ZN1 A;  3CCE A;  2DL7 A;  2KRS A;  1BI2 A;  2ED1 A;  1RL2 A;  2A3L A;  2XK0 A;  4BDY A;  1UFF A;  4X9C A;  3CCE T;  1KQ2 A;  4DQ2 A;  1BB9 A;  2DXU A;  4LDX A;  2OAW A;  4QQD A;  3SWN C;  2PZ1 A;  2EAY A;  4GLM A;  1GCP A;  4HCC A;  4M7A A;  2PVO B;  4RG8 A;  5CKH A;  4C8Q F;  3OS0 A;  3V8J A;  5GAN h;  2P0Q A;  2KNB B;  1QWE A;  4M77 A;  2RHI A;  1WGS A;  2LC4 A;  5KE3 A;  2PNI A;  3QBY A;  4J9E A;  4DOV A;  2LX9 A;  4M75 D;  4ELY C;  1Y0M A;  3REA B;  2QA4 T;  3NE8 A;  2DKG A;  1Z9Q A;  3OYC A;  5DM7 R;  2CS7 A;  4CRI A;  4D8D A;  5I2S A;  2K7A A;  1NM7 A;  4K11 A;  4KUL A;  1AZE A;  3S3N A;  2KYM A;  2FPD A;  1HD3 A;  1PKS A;  2CT4 A;  4XU3 A;  3EHQ A;  5M9O A;  5HY6 A;  2E64 A;  4PLI A;  4M7D C;  1VIE A;  3ER0 A;  1YWP A;  4LE9 A;  4N0A C;  2ZCF B;  2XG8 D;  1QKX A;  4HXJ A;  4D8K A;  2K3Y A;  4O5V A;  4LQ6 A;  1HJD A;  2J6O A;  2CUB A;  3M59 A;  2DZC A;  1JQQ A;  1NG2 A;  3A8M B;  5CKE A;  5GAM h;  3CPW S;  1Q82 U;  2CUD A;  3KXT A;  2ECZ A;  4M7A B;  4MZM A;  4JS4 A;  1VYV A;  1N8R U;  3CD6 T;  2JS2 A;  2E41 A;  2HD0 A;  4L59 A;  4FT4 A;  1JB0 E;  2ZGW A;  3CCJ T;  4RTW A;  4LN2 A;  1JJ2 A;  2E6N A;  1OV3 A;  2DVE A;  5J3B A;  2E12 A;  3HRU A;  4M7D E;  4FSX A;  1PNJ A;  4JJC A;  1N8R C;  2DIG A;  3UT1 A;  3U23 A;  1OPK A;  3G4S A;  1B34 B;  2DLP A;  2HEQ A;  4RG2 A;  1VQO T;  3BDU A;  4RTX A;  5FRM A;  3H8Z A;  2QDL A;  1AWJ A;  3M0Q A;  4M78 F;  1KFZ A;  1KG1 A;  4AFQ C;  1YJ9 A;  2HBP A;  2VGN A;  5CO7 A;  2EJG A;  1YI2 T;  2K3B A;  1ARK A;  4X9D A;  1BI0 A;  1WPY A;  2PUO B;  2EGE A;  2F2W A;  3FC3 A;  3EFS A;  3TEE A;  3G6E A;  3DLM A;  3CCQ T;  4HT9 A;  4AFU C;  2KRN A;  2YSQ A;  1GFD A;  4M77 F;  3JB9 I;  5GAM g;  3A8G B;  3VUZ A;  1K8A C;  1IRE B;  2GBQ A;  4M7D G;  1YCS B;  3QJ6 A;  4YTL A;  5IAY A;  1NLO C;  1X6G A;  1Q7Y U;  4EMH A;  2VWF A;  1I0C A;  4MZP A;  1VQ7 T;  2GTO A;  1T0J A;  2JT4 A;  2VVK A;  4NOY A;  1VQ6 A;  4DEX A;  3OYI A;  3PNW C;  1N6A A;  4II1 A;  3S3O A;  2LCC A;  2O88 A;  1M9S A;  2DRM A;  3H6Z A;  3M56 A;  1NEB A;  2ED0 A;  1WQ7 A;  2PU9 B;  1JJ2 S;  1NJI U;  1QVF A;  3M55 A;  4IUQ A;  1P92 A;  1UHC A;  2CSI A;  5FU7 B;  5GMK j;  3PIP A;  3LGL A;  4EFD A;  4Y92 A;  1ZX6 A;  1BI3 A;  4A63 B;  5GAN g;  3LH0 A;  2LMJ A;  1EIF A;  3M57 A;  1JU5 C;  2CGH A;  2K5F A;  3I9Q A;  3HHT B;  5FWC A;  1VQM A;  2D0N A;  4C92 G;  2E65 A;  4EDU A;  4JRP A;  2X35 A;  1CSK A;  4ZN3 A;  2BUD A;  2FL7 A;  1S72 A;  1VYU A;  2E6Z A;  5FU6 C;  4IIO A;  4KRT A;  5GJV B;  2G3R A;  3L2R A;  3V7C A;  2GTJ A;  4TVR A;  2DBK A;  2RH2 A;  4BI8 B;  1M90 U;  3H0I A;  2PVD B;  3GLX A;  1NYF A;  3GIB A;  1ZUY A;  1B07 A;  4M75 E;  3M0U A;  1M1F A;  2L3Q A;  2QI2 A;  4L5G A;  3OSV A;  3C12 A;  3CBO A;  4C5H A;  1K73 U;  2LJ0 A;  5FLX E;  2RQV A;  1X69 A;  2BZX A;  1W6X A;  1JO8 A;  1UHF A;  5LJ5 g;  4XU1 A;  4M7D F;  4ZTJ A;  4C92 F;  3LYI A;  2GQV A;  4N4I A;  4C0F A;  2LTO A;  3EGU A;  2M1H A;  3M0P A;  2JM8 A;  2XU8 A;  1S1N A;  5GMK h;  1PSE A;  3E1S A;  5LJ3 e;  2LQK A;  5IT9 E;  2YLC A;  4Z89 A;  2GF7 A;  3PE0 A;  1VQL A;  2R5A A;  4X34 A;  1UDL A;  1OZ3 A;  3J81 E;  2FO0 A;  1Q86 C;  4OF1 A;  2KEA A;  2KGT A;  1VQL T;  4HVW A;  2E1H A;  3CD6 A;  5GMK l;  2E5K A;  2XHC A;  2JS0 A;  3OQ5 A;  5CKB A;  1UUE A;  2JW4 A;  3UAT A;  3CCU T;  4N0A A;  1WI7 A;  2KQW A;  3CCS T;  3VRZ A;  3PVL A;  2QEX T;  3VKI A;  4C92 D;  1ZHI A;  2RB6 A;  1WIE A;  3ULR B;  1YWO A;  5CK9 A;  4J9D A;  4J9B A;  2DMO A;  2JVV A;  2K57 A;  2VXF A;  4BY6 B;  2GGR A;  3J7A F;  1LOJ A;  1WLP B;  2M16 A;  1VQ4 A;  2ROL A;  3CEY A;  3QWX X;  4C8Q B;  3CC4 A;  2QQA A;  2H3J A;  4M7D D;  4QVD A;  4EMK C;  2RK1 A;  2DYB A;  3L2U A;  3JCM b;  4M6I A;  2WSE E;  3EG0 A;  1Y71 A;  3CCV A;  1VQ4 T;  2KT1 A;  2KVQ G;  4XU2 A;  1K9A A;  4A4G A;  3JCM Q;  1QVP A;  2RHZ A;  5GAN f;  5GMK i;  2DL5 A;  4EMK A;  5EMI A;  3CCV T;  4XTX A;  1PHT A;  1X2K A;  2CT3 A;  1UB4 A;  3SWN A;  2FRY A;  2MAM A;  4IUP A;  2FEI A;  2HB6 A;  1VQP A;  2FG0 A;  2DIL A;  4EIK A;  4ZGE B;  2ZPI B;  4AFZ C;  2D9T A;  4BI3 A;  2DJZ A;  4PJO F;  4DA4 A;  3CMA T;  1VQ6 T;  1YJN A;  3V8L A;  3I35 A;  3V8K A;  2GQI A;  2YRV A;  2B86 A;  2M51 A;  1YN8 A;  2JN0 A;  2YT6 A;  4OGC A;  5GAM j;  5D6W A;  4EMG A;  3F70 A;  4C8Q G;  4MMK A;  5CQY A;  1LNX A;  4CC2 A;  1GXI E;  4BUG A;  1Y57 A;  5GAM f;  4F7U G;  5DLO A;  3VJP A;  1NEG A;  4R0K A;  3EG3 A;  2DD4 A;  5KE2 A;  5HCK A;  2V8J A;  2EYQ A;  3GNG A;  4OB3 B;  3CQT A;  1K4U S;  4IIM A;  4XTU A;  2FHD A;  5EG2 A;  4OMP A;  3MCA B;  5HK3 A;  2E10 A;  4C0D C;  3QXE B;  5HK0 A;  4E7K A;  2JXB A;  3PGG A;  3RES A;  3CCR T;  4RTZ A;  4OB0 B;  3P8D A;  5GAN 5;  1PKT A;  2A36 A;  1UEC A;  1AEY A;  4M7D B;  2F2V A;  1BBZ A;  3JCM d;  2KDS A;  3JSC A;  3CCR A;  5HKC A;  3SB2 A;  1SHF A;  4FIB A;  2G6F X;  4MML A;  3MEA A;  3X26 B;  5GAN j;  4QQG A;  5FW9 A;  2KYB A;  1MGQ A;  3VS3 A;  5J39 A;  3UF4 A;  1ZQ1 A;  1N9S A;  4ME7 A;  2MOX A;  3OYM A;  1W4S A;  1OPL A;  4J5Y A;  4A4E A;  2RQU A;  3HRS A;  1BKB A;  4HT8 A;  5CIU A;  1I81 A;  4A4H A;  3CBM A;  3QII A;  4F16 A;  2DE0 X;  2P4R A;  1D3B B;  2XIC A;  1YJW A;  1UG1 A;  3M58 A;  3RKX A;  3RER A;  3R6O A;  3CPW A;  4JJN K;  5LJ3 d;  1KSW A;  1SSF A;  4RMO A;  2XD0 A;  1AHJ B;  1E6G A;  2EQK A;  4J9I A;  1PSF A;  2DXT A;  2LJ1 A;  4OB1 B;  4CI0 C;  3VV0 A;  3I55 T;  5CAI A;  2NLU A;  3OSS C;  1ZLM A;  1M4Z A;  2RF0 A;  2C0I A;  3URG A;  4C8Q C;  2XID A;  4C8Q A;  4PL6 A;  1SPK A;  1U8R A;  1Z9Z A;  4PNO A;  2DVJ A;  2B8A A;  3QYH B;  4PJO G;  2K3X A;  1ZUU A;  2JNG A;  2CRE A;  2MIO A;  3PTA A;  5DLQ E;  5LJ5 j;  4JLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...