1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ply protein
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
3EG2A 5ECAA 1GCQC 3IQLA 1B07A 2RQTA 4AG2C 4D8KA 2RMOA 2A36A 2FPFA 4RTZA 2Q7SA 2LMJA 1JXMA 1ARKA 3I5SA 3M0QA 1J3TA 1AD5A 1K9AA 1NYFA 4LNPA 3FJ5A 2DRKA 3I9QA 4AFZC 1PRMC 2DBMA 4DEXA 2GGRA 4ORZA 1FYNA 1VA7A 1HSQA 1GBRA 4GLMA 2K9GA 1UUEA 1UG1A 1JEGA 2EVRA 4AG1C 1M8MA 5I11A 1LCKA 2JTEA 1ZUUA 1BU1A 5IHNA 3PE0A 2P4RA 1YP5A 4LQ6A 2YDLA 3M0SA 2CH4A 2KXCA 2RQUA 2ECZA 5L23A 2L0AA 3I5RA 1EFNA 4F16A 4K11A 2KRMA 2DRMA 2JMCA 2KYBA 3UA6A 1AZEA 5EMIA 2J6KA 5GJWB 2JM8A 2PTKA 5IHKA 2JS0A 1YN8A 2D8JA 3UATA 4RTWA 2C0TA 1QKWA 2OI3A 2KXDA 1CKAA 4AFUC 1PHTA 1K0SA 1RUWA 1MUZA 5FW9A 1HD3A 4OMPA 4ZNXA 1K0XA 3H41A 4IIOA 2LJ0A 2RQRA 2V1QA 2EGCA 4CC3A 1A0NB 1SRMA 1WXUA 2O31A 1ZLMA 3EG0A 2DL4A 2J7IA 1OV3A 1UHCA 2RN8A 2SEMA 1AWJA 3RNJA 2F2VA 2ESWA 1SPKA 1OPKA 4J9CA 1ABQA 5HCKA 4JPBW 2M51A 1BB9A 3REAB 3SEMA 1E6HA 3H0FA 1NG2A 1AZGB 2I0NA 2BZ8A 1UGVA 4F14A 1JWQA 1X6GA 2FRYA 2FRWA 1GBQA 2D1XA 5I22A 2IIMA 2EYXA 4A63B 1BK2A 2L3PA 1RI9A 2D0NA 2LNHB 4J9EA 3TVTA 1ABOA 3I35A 1MV0B 1K4US 1RLPC 1NLPC 2PZ1A 1UTIA 4OMNA 2ROLA 3ZL7C 4HCKA 2KRNA 4OMMA 1Z9ZA 2J6FA 3VS7A 2J06A 1JXOA 2LJ1A 1Y57A 4CC4B 1OEBA 2X3XD 2CUDA 1PKSA 2A08A 2AKLA 2O88A 4Z89A 3NE8A 4RUGA 3VRYA 3EG1A 1ZUYA 3EG3A 1NEBA 1GCQA 4BINA 4RTYA 1YWOA 2DL8A 1QKXA 2OJ2A 2DNUA 4J9GA 4QT7A 1W6XA 4J9IA 1NLOC 1JU5C 2YUQA 2DVJA 3PVLA 2J05A 2RF0A 1E6GA 1X6BA 3VRZA 2YSQA 2DILA 2YUNA 4JZ4A 1OOTA 1QWFA 3UA7A 4RTXA 4M6IA 1WIEA 1N5ZA 1NM7A 3REBB 1FMKA 2EGAA 1V1CA 3QWXX 1Y0MA 2KNBB 1K1ZA 1GL5A 3EHRA 2M0YA 1WXTA 1AVZC 2DL3A 3VS5A 4HXJA 3GBQA 1WLPB 2HBWA 5IXBA 1PRLC 1U3OA 3TSWA 2LQNA 4M6GA 1U5SA 2A28A 5IH2A 2W10A 2AKKA 4LUDA 1M27C 2G6FX 1M3CA 2DYBA 2KEAA 1M3AA 1K76A 3CZXA 2ED1A 2JM9A 2HSPA 4LUEA 3TSZA 2B86A 2RNAA 2JT4A 4GBQA 4LN2A 4KRTA 2K3BA 1VYTA 1IO6A 2XMFA 1YCSB 2EW3A 4Z8AA 1G2BA 2L3SA 4RTUA 3EGUA 2DM1A 1UDLA 2GTJA 3EHQA 4F17A 2AK5A 1HJDA 1TG0A 5FWBA 2BZYA 2ROTA 2KT8A 1X27A 3H0HA 2LQWA 2CH4W 2O9SA 4JJCA 1QWEA 2RPNA 2ENMA 2KBTA 1AWWA 1WXBA 2YUOA 3C0CA 2CREA 4Z88A 4JZ3A 2KYMA 4J9BA 2K2MA 2VWFA 2RQWA 2DL5A 2HCKA 2V1RA 1QCFA 2DJQA 1X43A 2ABLA 4OMOA 2EYWA 1Z9QA 2DLPA 2X3WD 2J6OA 2ED0A 4AFSC 3VS1A 2KGTA 2CSQA 1PKTA 2CT4A 3R6NA 3VS6A 1AWXA 2GTOA 2JXBA 2JMAA 4RTTA 1JO8A 2EYYA 2GQIA 3H0IA 1GFCA 2LX7A 2CUBA 5IHIA 2AZSA 1AEYA 2LCSA 2LJ3A 3ULRB 3M0RA 3VS4A 3NPFA 1NEGA 1QLYA 4OMQA 1S1NA 3U23A 5FWCA 2L2PA 2KR3A 4J9DA 3QWYA 4M6HA 4X1VA 2DBKA 2MCNA 3M0UA 3A98A 4D8DA 1WYXA 2NWMA 1YNZA 2A37A 1UJ0A 4RTVA 1T0JA 3NHNA 1WDXA 4EIKA 4LE9A 1SSHA 4HVWA 1NYGA 3RBBB 1UFFA 1VYUA 2MOXA 2PNIA 1KFZA 1SRLA 2FEIA 2HDAA 3M0PA 1UHFA 3NGPA 1CKBA 1W1FA 1SEMA 2F2WA 3M0TA 1PNJA 1X69A 1X2QA 2DF6A 1PWTA 1I07A 2QDLA 3THKA 2CT3A 4OMLA 5GJVB 2AZVA 1JQQA 4J9FA 4RN7A 2FPDA 2VKNA 1XOVA 1ZX6A 2ODFA 1M3BA 1U06A 1T0HA 4JJDA 3VS0A 4Y92A 1CSKA 2NUZA 2SRCA 3VS2A 4AFQC 2YUPA 1KSWA 4CC7A 1UE9A 4JJBA 1VYVA 2C0IA 3LH5A 1H3HA 2K7AA 1KIKA 1WX6A 2DL7A 1G83A 2O2OA 2EPDA 1YWPA 2FG0A 2EKHA 2CSIA 2LZ6B 1RLQC 4R0KA 2KRSA 1ZUKA 2JW4A 2RQVA 2DX1A 4ESRA 2EGEA 2FO0A 1MV3A 2DA9A 3UF4A 1ZBJA 4J9HA 4IIMA 1WI7A 2KROA 1ZSGA 1AWOA 2OAWA 2O9VA 2K6DA 1I1JA 1WA7A 2FPEA 2L3QA 4CC2A 2CDTA 1OPLA 1SHFA 1GRIA 3QAYA 1W70A 3VS3A 1WFWA 1E7OA 2EQIA 3PVQA 1T3LA 1AOJA 1UECA 1GCPA 2E5KA 4HVVA 2K79A 1H92A 2EBPA 2H8HA 1H8KA 1TUDA 1BBZA 3CQTA 3SHWA 2F2XA 2W0ZA 2EYZA 2JS2A 3KFVA 2BZXA 4DEYA 2GNCA 2GBQA 1KJWA 2MIOA 2YT6A 2HEQA 5IXFA 2LP5A 4FSSA 2DE0X 3JV3A 1X2KA 2C0OA 4HVUA 2BTTA 4E6RA 1I0CA 3O5ZA 2DMOA 4WCIA 3NMZC 1UJYA 2KT1A 5EC7A 1M30A 2VVKA 1B3QA 2D8HA 4M4ZA 1SHGA 1GFDA 1TUCA 2KE9A 1T3SA
chains in the Genus database with same CATH superfamily
3EG2A 2VL1A 3IQLA 1S7FA 1DJ7B 2RMOA 2A36A 4XU0A 4MDXA 2PJ1A 2PJ9A 3VYHB 2LMJA 1JXMA 3X25B 4BY6C 5KYWA 1ARKA 1AD5A 4RMOA 1K9AA 1NYFA 4AVBA 3I9QA 2OU2A 4CYPA 1PRMC 2DBMA 4C2YA 4R8FA 6CPAA 1SKUB 2B4BA 2GGRA 1RO5A 4ORZA 4LD9K 2FIAA 4U9ZA 2V77A 1VQ9Q 4P10A 4GLMA 1M4LA 2REEA 2QK0A 5LJ3j 5AG6A 5GANd 4AG1C 2RJEA 1M8MA 4BI3A 4WTOB 5I11A 3R96A 4M78D 2PJ8A 1BU1A 3PEIA 4P4FA 5FU7B 5CR2A 4MDWA 4MHDA 3S3MA 4LQ6A 2CH4A 2RQUA 1VQ8Q 1I12A 4A2ZA 5IB9A 4Y91A 3DDDA 3EH2A 4OF1A 4OP0A 4Z65A 1UGQB 1OBRA 1TTHB 8AT1B 4PNOA 2KRMA 1VQMQ 3CPWS 5GJWB 1QVGP 2JNGA 4PL6A 1B7TA 4MMLA 2JS0A 4MMKA 3M59A 1HDUA 4NCZA 1YN8A 1G3SA 2VEZA 3UATA 3CCMQ 3CCLQ 1TIQA 4XQ3A 2ZCFB 1F2PA 2OI3A 2RJDA 4RKUE 2KXDA 3PMTA 3G4ST 1R77A 3DGVA 4C8QE 1O9SA 3S6GA 1RUWA 1ZLIA 5FW9A 2JEVA 5KCHA 4ZNXA 4UWJA 5HVHA 4B6ZA 2LJ0A 4XU2A 5KH6A 2LCLA 4C5HA 1PSEA 2I3CA 1WXUA 4OIWA 1PCAA 3RKWA 1Z4EA 1OV3A 5J3BA 1UHCA 2RN8A 4KGZB 1AWJA 2DF5A 3JVNA 5AGEA 2ESWA 1SPKA 3O8VA 3P8HA 1OPKA 2WSFE 3K2KA 2OH1A 3V7RA 3NFCA 2OTJT 4IF5A 3SEMA 2JJ9A 1YJ9A 5HVGA 1E6HA 3FH4A 3H0FA 5H84A 1ELMP 1NG2A 2F5TX 2DZCA 2R5AA 4X5KA 3OMGA 2EK9A 3SJXA 4FT4A 4OADA 2BZ8A 3JUWA 4QVZA 2BOAA 1I5LA 3S6FA 5LYFA 2FRWA 5C0MA 5CKBA 2YNCA 4NSQA 5I22A 1CPSA 2EYXA 2JBKA 4NL3A 1VQ4Q 4FYYB 2ZPGB 2WACA 2XDBA 3TVTA 1ABOA 2BKDN 1MV0B 2V8HA 3PT9A 1K4US 1LAMA 4ZY2A 2REFA 4JLYA 2AFWA 1UTIA 4OMNA 4C7IA 1XQHA 2KRNA 4OMMA 2B3VA 3A1PA 3JCMh 1ZG8A 4R3LA 3QG1A 1D0XA 1RAAB 2ZEMA 2RHZA 4RS2A 1ZO0A 3LACA 2CP2A 5FU6C 2A08A 4JJNK 3S9MA 1QQ9A 1IY7A 1D0YA 4PLIA 3QKJA 4KS9A 3H4QA 1JJ2P 4RUGA 3JB9H 3CC4A 2HSEB 1NEBA 2OB0A 3OW2S 5CVIA 2WPWA 3QUIA 4M3SA 4ZGDB 1M1GA 2VZZA 1QW1A 2XEGA 3FX6A 1FMVA 2D4OA 4ZGYB 3LWIA 2C6PA 2F5KA 3OYIA 1QKXA 4CAEA 3DB3A 4J9GA 5GAOq 5LJ5f 1VQLA 5GAMf 1SG5A 2LX9A 2YUQA 2DVJA 3PVLA 2NLUA 4M85A 2RF0A 4X9DA 1N71A 4XTYA 1MMAA 1RACB 4PPZA 2YSQA 5CIUA 3CEYA 4JZ4A 3OMCA 1S72A 1WZOA 2IVWA 3A8HB 4M75B 2QIRA 1VQNT 4M6IA 1WQWA 5IB0A 1NM7A 4KUDK 4XNHC 2LT4A 1CBXA 2AFZA 2E41A 2CZ1B 2DETA 2PIYA 4P4IA 5IX3A 2HC9A 3CXQA 3FF3A 4II1A 1QP2A 1B87A 1N9SA 3BHXA 1BPNA 1K1ZA 3R1KA 4OB2B 2C6CA 1MK4A 2COZA 1BI0A 2K3YA 2CXAA 5IXBA 1X12A 2GLJA 1H3ZA 4P4EA 4UC4A 5HXDA 5J8CA 4CYOA 3TEEA 1IOIA 1WHGA 2DAQA 3E9FA 4RI1A 2KEAA 2NUPB 1M4GA 2JOYA 1VHSA 4DYOA 4KULA 4DNCA 2HKQB 1QVFA 3D8PA 1OI1A 3TSZA 2EJGA 2X4XA 2B86A 2FL4A 3GNFB 3CCJT 5CKHA 1KG1A 1XE4A 1QMCA 4GBQA 4R56A 3VJPA 4YFJA 1G5VA 3VYGA 4LN2A 4KRTA 3CPXA 2GU2A 4GM5A 4OKOA 2CNTA 3MCAB 2X7BA 2DKGA 3QZ9B 1QCOA 4M75G 2OZGA 2MI6A 3MKDA 1YSJA 4PJOE 1C6VX 2L3SA 5F46A 1MNDA 3G6EA 2DXBA 4QB9A 3JRUA 3OYCA 1I5OB 3RKYA 1TG0A 3JCMc 2BO9A 2BZYA 2ANPA 2ROTA 2KT8A 4M75D 4C0DC 1NZ9A 5D8NA 1P92A 3KUFA 2ENMA 2XEIA 1AWWA 2IQ6A 1M4IA 1WXBA 3IIBA 4NF1A 4R87A 2Q44A 2BUDA 3KKWA 4RCBA 1VQPT 1G3YA 4A4EA 1Y7XA 4UA3A 3FIFA 2BL1A 3ZFJA 2VWFA 2RQWA 1K9MU 2Q04A 4B12A 4XU1A 4CRIA 2CP0A 4OMOA 2CNMA 2EYWA 2OAUA 3RMQA 2P0WA 3D2PA 2X3WD 3PNWC 2OTJQ 5KYNA 4EMKB 1VQ7A 4M7DC 3N7ZA 2KGTA 3D7HA 1AUGA 4TNUA 4R3KA 1BIAA 3VV0A 1YW6A 3CXSA 1PKTA 3R6NA 3VS6A 2G3AA 2KSSA 4LDUA 2H3EB 2GCXA 2GTOA 2J8MA 4M77F 4RTTA 2FXFA 1JO8A 3MEUA 4BMHA 4BACA 3EGDA 2X4WA 4M77B 5AG4A 1AEYA 2O4HA 2LCSA 5HVFA 4EMKA 2D0QB 4IUVA 2CZ7B 2GE3A 2E70A 4E47A 3SI2A 1VUBA 4WJBA 1I21A 4II9A 5EBVA 1YFNA 4E7SA 3I55A 2RA2A 3M58A 3NTKA 1N9RA 3QWYA 4MHYA 1TOVA 4XU3A 4D8DA 2VC8A 3JCMg 3CC7A 4CGLA 2ZPBB 1YNZA 5G21A 3DR8A 4M77A 4LDWA 2IPOB 4EIKA 1ZHIA 2CIJA 3CXCP 3SI1A 4N4GA 4J7IA 2QASA 3TO6A 2PJ4A 2PNIA 4OB1B 2DERA 2CNSA 2VI7A 2MF2A 4CGMA 1QSOA 2PVDB 2Q4VA 2PJ0A 4ZY1A 3G4SA 1QSNA 1K9MR 1YIJT 4JXQA 1CKBA 3UPUA 2Q4ZA 3MP1A 1YJWQ 4BB7A 3QXEB 3CCQT 2B5GB 2YNDA 3D67A 4OIDA 1PNJA 3HHTB 4Q36A 5GAOn 2DF6A 1NJIU 2QQBA 3VKIA 3L2VA 1YI2Q 2E5QA 3H8ZA 3G7ZA 2FB7A 2P6FA 4DQ2A 2QECA 4OMEA 2PSWA 4A4KA 5GANe 1M9SA 2L89A 1LNXA 1XOVA 2Q4YA 1VQNQ 1P4NA 1VQ5Q 2GREA 3FDRA 3QJYA 5GAMj 2ODFA 4RUHA 1M3BA 2B5GA 1U06A 3PBBA 1KD1U 1IICA 4E8OA 4B5PB 1W2BS 1AMPA 1F2OA 2RM4A 1IU8A 5FU7C 3FEEA 4A31A 4IHMA 4AFQC 1VYVA 5FLXE 5GANg 3LH5A 2RHXA 5IV0A 1WX6A 3M56A 1WHHA 2DXTA 2DXUA 4QVTA 1KQSA 4GXHA 1NJIC 1ZG7A 1N6AA 4B5PA 4F8ZA 3LGLA 5CKEA 2KRSA 4P45A 1Q2CA 2DX1A 4ESRA 1I4K1 3IGRA 3OSVA 5CBMA 2DTHA 4AG9A 4J9HA 4IIMA 5HH1A 1G3WA 1Z5RA 3CCJQ 4AXVA 4QUSA 4C8QF 2O9VA 1RXTA 1MMGA 1HEEA 2MAMA 2BCOA 1K73U 1ON0A 4C8QB 1SHFA 4XTZA 1S60A 3QAYA 2CP5A 1W70A 3MEWA 4HNYB 1WFWA 1SF9A 1NJIR 3META 4BD9A 1GCPA 2YNCC 3A9LA 3D7DA 4KVME 3PGGA 3GF5A 2K79A 2RD1A 1N8RU 3GIUA 4X2TA 3M53A 3CQTA 5CK9A 1MJ9A 2H3JA 4ORFA 3W6SA 3V8LA 1KQSP 4A39A 5LRGA 2QEXA 1KD1R 4FT2A 4C8QA 3G71Q 5JQ4A 2EUIA 3HRUA 2B3UA 2GNCA 3A8LB 1VQKT 1VQOQ 1YJ9T 1KJWA 4JLGA 4M7AE 2HEQA 2R1IA 1VHOA 3B8GA 1VQPQ 2LP5A 4EWTA 4FSSA 3JV3A 1X2KA 3OYLA 1K73C 4GY5A 5GAN2 4HNXB 1FMWA 1RAGB 1BYMA 1M2VB 2V8KA 4ZTFA 1NMTA 4HVUA 3PIPA 4IKFA 3PP9A 2PJ2A 2D6FA 2ARHA 5F47A 3V7ZA 2LQKA 1F1BB 2KT1A 4OGEA 5A0GA 5ISVA 2QGGA 2Q43A 3VU3C 5BWAB 4Y49B 5J1QA 3GP8A 3HUVA 2A3LA 2GIVA 1RAEB 2A4NA 1U1SA 4C8QG 4CRZB 2FPFA 5GMKj 2Q7SA 1RABB 1C0MA 1M2VA 4CAXA 2VUBA 2NUTA 1K73R 2DRKA 4LXCA 4N4HA 4R55A 3GOXA 4P4BA 5A0LA 4MHNA 3JCMQ 3HPWA 3QDFA 1M4DA 2K9GA 1N27A 3B7IA 1UUEA 3CC4T 1N8RR 1IYLA 2EVRA 3J80E 2CZ0B 2FSRA 3R9EA 4HT9A 4J7FA 2EYQA 1XJOA 1S5KA 3M54A 2PRBA 1YP5A 2KXCA 3OYDA 1VQLT 1LRZA 3SB2A 2ECZA 2RHUA 1EFNA 4HCZA 5LJ3h 4F16A 3VATA 1YK3A 4K11A 4C92E 4L89A 3CMEA 2WYRA 2KYBA 1AZEA 1YW4A 3GIBA 2MPXC 2J6KA 5D6WA 2JM8A 1S72T 2XD0A 3DNSA 4UCMA 5LRJA 1JRIA 2PTKA 3FYNA 2HL5C 3F8KA 4BD3A 2D8JA 1FY7A 4H2KA 2ZELA 2C0TA 2CKKA 2DJZA 3SJFA 4AFUC 1PHTA 4OLLA 2EQKA 1QCNA 2G0BA 2PR1A 3JCMJ 2NYQA 1K0XA 3RYOA 5HY6A 4R7MA 4IIOA 2PDOA 2EQMA 3CBMA 2EGCA 4CC3A 2JN0A 3C26A 4QW2A 3JCMb 4DUKA 4FYXB 4NEXA 1WPYA 2J7IA 3PZJA 3SJGA 4TVRA 3R9GA 4JS4A 4M7DB 3RDVA 3V7SA 2AHJB 4JPBW 2M51A 4MHPA 3H6ZA 4YTLA 1YVKA 5ELYA 1YHQQ 4AT1B 2I0NA 2PR8A 1Q2DA 1UGVA 3SDZA 4F14A 4KVXA 1X6GA 5LYDA 4JDSA 2RHYA 2AFSA 3EFRA 1GBQA 2D1XA 1BO4A 1ELLP 2O53A 4U9YA 3QSUA 4I49A 2KQWA 4A63B 2L3PA 2J8RA 3F70A 2AT1B 4JRQA 4FYWB 3G6ET 3RESA 3KR5A 3GUXA 5I21A 1B34B 3GPLA 4MFZA 4DBRA 2EJ9A 4FD7A 2VGMA 4HCKA 2MWPA 1M2OA 3PFEA 1Z9ZA 2AIRB 3LMSA 2LJ1A 4FU6A 4CS0B 5KYWB 3EGXA 1LCPA 5LRKA 4MCQA 4K3NA 1YIJA 1QSMA 2L8DA 3VUZA 4UWIA 4LD6A 5AG5A 3NH5A 4Z89A 1RI0A 4M7DG 2BIVA 3D68A 1X6OA 4EMKC 2DK3A 2COWA 3BFMA 2C6GA 3A8OB 1QVGA 4XPKA 1JB0E 3INZA 2M16A 3S9LA 2Y4YA 2AE6A 1YJ9Q 1YWOA 4M7DD 1VQ7T 2FVUA 2DNUA 1TH7A 1IB8A 4QT7A 5C6SA 2J05A 2HZYA 4M77C 3GY9A 3JCMW 4QQDA 4UEFA 1X6BA 3VRZA 1OOTA 2LDMA 3F0AA 3PB8X 1KC8R 2EBJA 4C68A 3TOBA 3PB4X 3E19A 2QVPA 3FNCA 2ZAEA 1XJWB 4ZBGA 1V1CA 4MY0A 5A27A 2VQYA 4ZYQA 3I55T 1QVFS 2PVVA 4E7ZA 3IFEA 4EMGA 2M0YA 2PQ8A 1WXTA 2AFUA 5K8PA 3CC7T 3ME9A 3PFOA 1Y96B 3JB9F 1QMUA 2ZEEA 2LQ8A 2ZPHB 4QVDA 1U5SA 3MJXA 2NYSA 4OVAA 4E7KA 1KUXA 2EWNA 1I1DA 3B3TA 2G6FX 2CTCA 3CC4Q 1M3AA 1KUVA 3H5ZA 7AT1B 2ED1A 4PKCC 3KR4A 2K3XA 1PD1A 5LJ5d 4NJQA 1Y96A 5GAMd 4A37A 5FRNA 3FMCA 2GFAA 1VQLQ 2ZOGA 1LVKA 3QYHB 1FX7A 1TUGB 2QA4Q 3FRMA 2K3BA 4OGCA 2JDDA 2PU9B 2X4YA 3KHZA 1YCSB 3CBOA 3D3SA 4UFXA 1ZA1B 4Z8AA 1OYXA 2IG0A 2DM1A 2XK0A 1S72Q 2GTJA 3C94A 4KOXA 1YJNA 1XTDA 2QQSA 2AK5A 1XEBA 2V8GA 1VQKA 1HJDA 1Q7LA 3EFSA 3G8WA 4G1PA 5FWBA 2LQWA 3H8FA 1JJ2A 4KGVB 2CH4W 3T90A 3JCMV 3RAMA 2RPNA 4J83A 3IC1A 3CMAA 5KYXB 1JBMA 1OX9A 4PJNA 3GLJA 3C0CA 2C06A 4ZY0A 3OYMA 1K8AU 2KAFA 2B4DA 2KYMA 1R0CB 2RI5A 3JB9G 4EMEA 3CPFA 2PE3A 2JVVA 4J9BA 1U1TA 4ME7A 2OOTA 2KY9A 2K2MA 1SSFA 3OYYA 4KH0B 4UIBA 3E2UA 3TCJA 3QHSA 3L2UA 4PLLA 2HCKA 2V1RA 1QCFA 2GQVA 1X43A 3CCUA 2VB6A 1Z9QA 3JB9D 3TOAA 3ZEHA 5KYXA 2RC4A 2QQRA 1FXXA 3FJPA 4LX9A 2FL7A 5A0DA 2NMTA 3CPAA 3EY5A 4XK8E 2M02A 3PBEA 4C8QC 5KE3A 4JRPA 3C12A 2YHTA 2A0FB 3VARA 2JXBA 2LT1A 4OMFB 4PFOA 4R6TA 5GANf 4QVCA 5K8NA 1PSFA 3JAME 3ASKA 1VGYA 2GQIA 2LC4A 2LX7A 4E2FB 3CXPA 1K8AC 1FT7A 2YRDA 1VQ8A 4OC1A 4DA4A 4AB7A 2AZSA 4ELZC 1VKCA 3PB9X 3G6EQ 2LJ3A 3ULRB 3M0RA 1KWMA 4O23A 2RI3A 1Q82U 3D66A 1QLYA 4OMQA 3RO0A 3U23A 5FWCA 1WJRA 2KR3A 2P4TA 5GAOl 2ZEGA 2MK5A 3LGFA 3M55A 2QEXT 2DBKA 4MXUA 3A98A 2DTIA 2QMLA 4A30A 3CCMA 4A95A 4UBRA 1TKHA 1QQJA 2Z3PA 3NHNA 1EIFA 2FE7A 4QQ6A 2E6ZA 4LE9A 3CCSA 3RBBB 4BE0A 3VWEA 1K8AR 1EX4A 2RHIA 3M5AA 2ZENA 4UEZA 1KFZA 3TX8A 2HDAA 2FEIA 1Z8XA 4NGSA 2HAXA 3M0PA 4C2ZA 4Y49C 4MFJA 3Q1JA 2M1HA 4JRIA 1IGUA 3EXNA 1HDQA 3P2FA 3IWWA 1Q82C 3V8IA 2AJ6A 5DS0A 3L2RA 1X69A 3X24B 3TTHA 3MP6A 1I07A 2QDLA 4FUUA 2G9DA 2CT3A 4OMLA 3QPHA 4J6WA 3IEHA 5GJVB 1LAPA 8ATCB 4J9FA 3CCVA 3MRUA 4L8AA 1XMBA 2VKNA 1Y0YA 2I00A 1Z2LA 2R57A 1ZX6A 1Z8TA 3MO8A 4CGPA 2Y0MA 1BCOA 2DIGA 3I55Q 1Q82R 2PVOB 2VZYA 1D3BB 2HQEA 3OSSC 1CSKA 3VS2A 1KSWA 4JJBA 1NE9A 1NBEB 2K57A 4VUBA 4XAXB 4Q5WA 3CC7Q 4UCNA 1KIKA 3KXTA 2DL7A 1ZA2B 2EPDA 4ZX9A 2FG0A 5LJ5h 4PXDA 2DD4A 5CQYA 3RR6A 5GAMh 2CSIA 4C92F 3OYNA 2R7HA 3CDXA 4KOVA 3MEVA 5JM6A 3V7CA 2YGWA 2LNVA 4FAIA 4FL6A 3IU2A 1D3BA 2X35A 3OYAA 3CMET 4FWUA 5A28A 4B14A 3G4SQ 3WR7A 1VQ6A 3CPWA 2GF7A 4XTXA 3UF4A 2JTMA 1KK7A 2KROA 1X10A 3PMIA 1AWOA 4M78E 1X75C 2PVWA 2K6DA 4XTUA 2MYSA 3KQXA 2PJ7A 4L59A 1PCXA 3IU1A 1AYEA 2V8IA 3A5ZB 1YVOA 2QI2A 3VS3A 4C92A 2EQIA 3PVQA 4FYVB 2HBPA 3EGDB 4UIAA 5HMNA 2XDPA 4HVVA 2I79A 2KI7A 4KOSA 4HKFA 3CXCA 1H8KA 4JD6A 5J8FA 3A8MB 3EFOA 3WT4A 4CPAA 2GFQA 2Z11A 3HLPA 4BBHA 1UWYA 1YREA 5DWNA 2EYZA 2BZXA 4DEYA 5CAIA 3CBPA 1BPMA 1DE4C 2PRQA 2MIOA 3BJ7A 3ISZA 4ANJA 2A7YA 5IXFA 3JCMe 2HKNA 3CPWP 3CCRT 4PSWA 4XPLA 1M90U 2DE0X 4MMOA 3LYIA 2Q51A 3EC4A 2Z3NA 1K4JA 1K9MC 4E6RA 4NFRA 1I0CA 3P8BB 4WCIA 5GAN8 2XDDA 1UFHA 1RAHB 4N4IA 5EC7A 3FRNA 1B3QA 5CKFA 4PQAA 1U8RA 1MNEA 3F5BA 1SHGA 3D7SB 2KE9A 1RTQA 1X01A 2QTVA 3CC2A 1XIXA 2XHCA 1B07A 4AG2C 5K8OA 4ATOA 1J3TA 3X26B 4LNPA 2KVQG 1AHJB 3VUBA 3BDLA 2K4YA 2RK1A 4HKEA 3T9NA 1RL2A 1CP6A 1M90C 3VH9A 5GCNA 1NSLA 2JEWA 3M9QA 1FYNA 4JXRA 1VA7A 2ZPIB 1GBRA 4OC5A 5GANj 1LPLA 5GMKh 5KYUA 3RZAA 2QEXQ 4NGRA 5LJ3d 2Z0ZA 3OW2A 1UEBA 2M0OA 1CX8A 4M77G 4CYNA 2YRVA 5IHNA 4MCPA 3PE0A 2CF4A 2P4RA 3WVEB 3M0SA 4IUQA 2RB7A 3OYKA 4ZGEB 4Q7AA 5L23A 2L0AA 2QQ9A 4M77D 3R6OA 5AT1B 3EH1A 3J7AF 4HNWB 1M90R 1OU9A 1QP3A 2DRMA 2JMCA 4JS5A 3UA6A 5A2QE 3M57A 1BAVA 5EMIA 2Z3OA 3SJEA 5I0CA 2ZEDA 1M5Q1 3D2MA 1OX8A 1WWZA 3GLXA 1BI1A 1UGSB 4RTWA 3OS1A 1WHKA 1M1FA 1Y71A 3L42A 1WHMA 1QKWA 1CPXA 1YBYA 1CKAA 1K0SA 3C4SA 2DO3A 3FB3A 4NGMA 4BE2A 4NGTA 4QBJA 3TE4A 2OTLA 2DTOA 4ZTJA 1PC0A 3H41A 5GAN7 1Z9UA 3OW2P 4BDZA 4HT8A 2IMOA 2V1QA 1NSAA 5LJ5e 2O31A 3EG0A 2DL4A 1KD1C 2WSAA 4MFPA 3RNJA 2SEMA 2F2VA 1G3TA 4J9CA 3RUXA 1ABQA 3S6HA 4JUVA 3REAB 3IWGA 3TT2A 1UB4A 2ZEHA 3LX7A 3W6XA 2ATRA 5LJ5g 5HKCA 5GAMg 1JWQA 4F6AA 1YITA 2IL4A 1M1DA 4BE1A 4UFWA 3RMSA 5F48A 1BK2A 4ONWA 3CMEQ 2MWOA 4PV6A 3HTRA 2XI9A 4L6V5 2D0NA 4EVYA 2LNHB 3CT9A 3GKRA 4PJMA 1M8VA 4XPDB 4YGOA 4J9EA 1Q86U 1PUAA 1YJNT 4X9CA 4MI4A 3I35A 4J3GA 5HK3A 2K2VA 4MCRA 4KGXB 1IGBA 3HFNA 1ARMA 1BOBA 2NSMA 4J6XA 3KHXA 1NLPC 4KUBA 2RK2A 3TU4K 4CAVA 2J6FA 4O5VA 2HV2A 3H8GA 3VS7A 3X28B 3CMAT 2J06A 1YJWA 3MN8A 1TKJA 2HUZA 4IUPA 4CC4B 2RB6A 2NUTB 2X3XD 4CGNA 4C5GA 1OZ2A 1EZZB 3UY5A 4EDUA 4KOUA 2DEUA 4ELYC 3DLLA 2K5FA 3V38A 1IGQA 5C82A 1N8RC 2PCUA 2PJ5A 3QJ6A 4MJ8A 4OP4A 3BLNA 3EG3A 2R5MA 3E9GA 4M75E 4B9XA 2ZW4A 1GCQA 3CCUT 1WK4A 2L5QA 5KCOA 1Q86C 3BJ8A 5EG2A 4BINA 4RTYA 4ZI6A 1D0ZA 2DL8A 2OJ2A 4C8QD 2VXKA 1NLOC 1JU5C 4FW2A 5M9OA 3K9UA 1IZ6A 2EIFA 5L8RE 4OC2A 4LDVA 1KQ1A 4W9YA 5D6XA 3E1SA 2OZHA 2YUNA 3AHUA 2CTBA 1HXDA 1VQ8T 1BI2A 1OZ3A 4RTXA 3URGA 3S9NA 1Q95G 2Z3KA 1CJWA 4E2AA 3SI0A 4N0AA 2X9HA 3HRTA 1FMKA 3T8WA 1Q86R 2EGAA 1Y0MA 3B3CA 3OS5A 3TQ7P 3HP9A 1GL5A 2Z10A 3LH0A 2X51A 1AVZC 2DL3A 3SD4A 1Z8WA 4HXJA 3JSCA 2RJFA 3CCMT 2PC1A 2QJ8A 2ZEOA 5G1ZA 1YIJQ 1NPPA 1PRLC 2LQNA 3NA6A 3ER0A 3CCST 4FIBA 3P2HA 4C2XA 2A28A 3V8JA 2QYZA 3ZJ0A 3QDRB 5IH2A 3CCQQ 5I4MA 4E7LA 2AKKA 4LUDA 3R95A 1M27C 1XF8A 1M3CA 4NGQA 3OA6A 1KUYA 2ATCB 2E12A 2RNAA 4KOYA 2XG8D 4WF2A 3G71A 4FCYA 4BI8B 1Q7YU 2BE9B 2V26A 3OS0A 1VYTA 2XMFA 1VQOA 4GS4A 1XRYA 3R9FA 1IB1E 2EW3A 2ZW7A 2YRCA 2ZXVA 4UCPA 1BCMA 3CCVT 1UDLA 3RIRA 4F17A 2C1CA 2BEIA 3NH4A 1ZSZB 3TO7A 2R98A 4X34A 4DBHA 3SXNA 1BKBA 2FIWA 3QZ5B 3CCRA 2QYVA 1W2BA 2O9SA 2PQWA 2HD0A 2FYKA 1TXQA 2KBTA 4PJOF 2OZUA 4PSXA 4F9VA 1KC8U 2CREA 4Z88A 3J81E 3EGXB 4JZ3A 2PJ6A 4KH1B 3S3NA 1HK9A 4PJOB 1M4ZA 1ZSZA 2ZGWA 4C92C 1Q7YC 1H8LA 4CRYB 4XTVA 5GMKm 1Y7EA 3H8EA 4RG2A 5THWA 4LQGA 4GLKA 2ABLA 3P8DA 3OQ5A 2GLFA 1MHNA 2DLPA 2CGHA 2DYIA 4M78F 2XIDA 1VQ6T 2J6OA 3KASA 5JGFA 4L5GA 3NE7A 3UDCA 4AFSC 3VS1A 4AMCA 2KDSA 4AG7A 3I9SA 4PJOA 4M78B 2CSQA 4UEEA 1AWXA 1R8OB 3CCEA 4C5EA 5KTDA 3HL8A 1Q81R 1V29B 1S7NA 2JMAA 2PJBA 4ZX8A 2EYYA 2B58A 1GFCA 1KC8C 1Y7RA 4PXBA 4QQGA 1W2BP 1Q7YR 5D7UA 5IHIA 3OY9A 4MFLA 2VASA 1YJNQ 2ZEPA 2WPXA 3VS4A 4KSIA 1VQKQ 1NEGA 4K30A 1S1NA 4M78A 4JLIA 2B8AA 1UGPB 1L0CA 4NL2A 1Q2YA 2YLCA 4MZPA 4F7UE 4M6HA 4X1VA 4ONUA 3CMAQ 1YR0A 3M0UA 3SWNA 1D1CA 1WYXA 4P6YA 3DKMA 2NWMA 4PJOG 2A37A 4PXCA 2JTFA 4RTVA 1Y9KA 2P0KA 1GYTA 3SHPA 1SSHA 3JCMP 1LFWA 4PJJA 1EE3P 2P6EA 4H6ZA 4A38A 4DOWA 4PJOD 2CYZB 2E4HA 1SRLA 2E6NA 3G1JA 4PK4A 3KI9A 3CCUQ 4A94A 5GAOm 3MPUB 5I2SA 2XEFA 3JB9J 3CD6A 4M78G 1W1FA 1SEMA 2DD5A 3M0TA 4B6MA 1F57A 2E3IA 4MCSA 3CC2T 3QIIA 1X2QA 5CKDA 2COYA 4A4FA 1PWTA 3THKA 4KUIA 3WC6A 1YHQA 2AZVA 3HRSA 4RN7A 2M9UA 5LJ3e 4KLWA 3PTAA 4EFDA 3OS2A 3FEOA 4LDYA 1YLOA 3D4UA 3SFMA 3L2NA 1TS9A 2G3TA 4JJDA 3VS0A 3TREA 3B2YA 4IAVA 5DM7R 4C7HA 1S7LA 2SRCA 1D1AA 2YUPA 3MEAA 3JCMf 4CC7A 3NTHA 3I56A 4J8OA 2BUEA 5LJ3g 1H3HA 2DXQA 2K7AA 3I3GA 2O2OA 1G83A 2YNEA 3X20B 4DJLA 3QYGB 2EKHA 2VXFA 2RI2A 3L2ZA 3TC8A 3BDUA 2ABZA 3CCSQ 2B4DB 5GMKl 2LZ6B 4R0KA 3L2WA 4UFVA 5AG7A 1ZUKA 4E7JA 2CY2A 1P0HA 2RQVA 3CXCS 5GAOr 1NE8A 2ZEFA 4WWVA 4YU9A 2DA9A 1WI7A 3L2QA 2RJCA 2RO0A 4MZTA 2Z0WA 2LTOA 1ZQ1A 3KBGA 3DSBA 4B11A 1PYTB 1WA7A 2L3QA 4UF4A 5H86A 1R0BG 1GRIA 1OULA 2PUKB 1V76A 5GAN5 1R43A 1E7OA 3FB9A 9ATCB 3GNGA 3MHXA 3CCVQ 2OTLT 1IYKA 1MGQA 3B3WA 4NOYA 2O4XB 5K8MA 3KQZA 2HMAA 1VQ9A 2F8HA 5C88A 4NJRA 5LYIA 3NH8A 2F2XA 1BI3A 2R58A 2W0ZA 1MJAA 1H641 2JS2A 3KFVA 3FECA 3QB8A 2Z3MA 2GBQA 4A54A 1IOFA 3KL9A 1KHCA 1TWBA 4PJLA 2GANA 2O4XA 2AFXA 2BE7D 2K5LA 1YITT 2C0OA 5FVJA 3OYEA 3A8GB 4XPDC 2EQUA 2QDYB 1VQMA 3FIXA 3O5ZA 1UJYA 1M30A 3OYBA 2VVKA 1VQ6Q 3NTIA 1YCYA 4M7AF 1IXDA 1GFDA 1TUCA 4CAFA 4HCCA 5ECAA 3PIOA 3CCLA 1GCQC 2POKA 2RQTA 3LLRA 4M7AB 4D8KA 2QXFA 1TF8A 2YWWA 4OAEA 2DEQA 2WSCE 2XU8A 4RTZA 2O28A 3I5SA 3M0QA 3JB9I 1YJWT 1IHVA 3FJ5A 5EC4A 4AFZC 4H89A 4DEXA 2EJFA 2QA4A 4A4HA 1VQ7Q 4M75F 4MY3A 1YI2T 1HSQA 3FBUA 4EMHA 4M7AA 2D9TA 2OR4A 1UG1A 1JEGA 5CNPA 4CI0C 2EK8A 2DXCA 1LCKA 2HNIA 1VQ5T 3D7FA 2JTEA 4N0AC 1WHJA 1ZUUA 5FRMA 4TWEA 4J5YA 5I2MA 3OYJA 4EPCA 2YDLA 1KQSS 4FD4A 3RBUA 3RERA 1LOJA 4MZMA 2JLMA 1GXIE 3I5RA 4JJXA 5GANh 3L1AA 2V8DA 5IAYA 3BXMA 4KOTA 1VQ4A 4M75A 1CP7A 1RAFB 3MP8A 4P4DA 4PK3A 3ISXA 1M44A 2RFHA 4CGOA 5IHKA 4M7AG 5DY9A 3FLGA 2C27A 1IIDA 4C0FA 2E65A 3CC2Q 4M7DE 4NXYA 5AYFA 5HK0A 1OZPA 4FM4B 4M7AD 1MUZA 2WUUA 1SQHA 4F0XA 2ZZDA 2PJCA 3UT1A 1HD3A 4OMPA 2E64A 3PRTA 3PGPA 4JRKA 4C92B 4U5YA 2CP6A 2DPTA 2RQRA 2R8VA 2Y4XA 3OB9A 2IJZA 1W4SA 5GAN3 1A0NB 3RNZA 1SRMA 3I1UA 5IT9E 1ZLMA 4IK2A 3KZWA 3EFOB 2NUPA 3K9TA 4DOVA 2DZ9A 2FZCB 5J39A 1MMDA 3G3SA 4KORA 3EAEA 5HCKA 4PFZA 4YRHA 1BB9A 3TFYA 3E0KA 4NS5A 1AZGB 4C0GA 3BY7A 1UGRB 4O6JA 2FRYA 3G71T 2EAYA 1BIBA 2OX7A 1FNOA 3ZZIA 1VOMA 2IIMA 2LCCA 4B13A 1VQOT 1KHIA 5KTCA 3N5BB 4AVCA 1ZSZC 1RI9A 4BUGA 1Y9WA 2QAZA 4P44A 2DIQA 4OC0A 3C95A 1QVFP 1TF9A 1KZFA 1NPRA 3DB4A 3HSBA 4J6YA 2ZPFB 2PVGB 4E7IA 3TCVA 1RLPC 2F5IA 4FD5A 2PZ1A 1YX0A 2VBQA 3GB0A 2ROLA 3ZL7C 1XMTA 5CCAA 4E0AA 1ZBXA 3DLJA 4C92G 1JXOA 4PJOC 1Y57A 3M4YA 1OEBA 2OTLQ 2CUDA 4BY6B 2Y90A 1PKSA 4OC3A 3FJUA 1JQGA 2AKLA 4C92D 2O88A 5KE2A 4B5OA 3NE8A 1TSFA 3VRYA 1PM3A 2HQHA 2P0PA 3EG1A 1ZUYA 1WHLA 5KYUB 3IO1A 4X8IA 1ZLHA 1IHWA 4Q38A 4M78C 5GAN6 2XICA 4FBEA 3IJ3A 4ZN1A 1ARLA 2EO8A 3OYFA 1W6XA 4J9IA 3QO3A 2EVNA 3SWNC 3CCET 1YITQ 1I8FA 4ZGJB 3OBWA 5KYYB 3WC7A 1E6GA 1M1KU 3DR6A 1MJBA 3QBYA 3WVDB 3FVLA 2CP3A 1Y07A 2DILA 2HL3A 5GAN4 1WGSA 4BI4A 3JTKA 4KLVA 1QWFA 3UA7A 2J8NA 2PJ3A 1WIEA 8CPAA 1N5ZA 4A4GA 5F49A 4F7UF 3REBB 4OC4A 4KUAA 4C0ZA 3QWXX 4AVAA 2JBJA 4P4JA 2AFMA 2DPSA 2KNBB 5KYYA 2XEJA 4F7UB 3OWCA 4H6UA 1O75A 3EHRA 4KSAA 4F9UA 2JUFA 3VS5A 3GBQA 1WLPB 2FT0A 2FHDA 2HBWA 1U3OA 3TSWA 4M6GA 4KT0E 2E3HA 2W10A 1M1KC 3LODA 2DYBA 4HPSA 2PUOB 2RH2A 4R76A 1K76A 2L3RA 1RADB 5J26A 4F7UA 2F7VA 4MBUA 3CZXA 5JH9A 2OTJA 5LJ5j 5LL6S 4B9WA 2JM9A 2HSPA 4LUEA 3CD6T 1LJOA 1WNLA 1WQ7A 1YGHA 1DTDA 2JT4A 1IRXA 4JWPA 1YQEA 4DBQA 3B3SA 5LYLA 2FZKB 1IO6A 2PJAA 1HYOA 5GAMe 2X4JA 2PIZA 1IREB 1G2BA 4RTUA 3EGUA 1YHQT 1M1KR 3OBYA 1ZG9A 3WABA 3EHQA 2ZW6A 4PK2A 1LOKA 3H0HA 1X27A 1XFOA 4F7UG 1MMNA 3HKSA 2E10A 4JJCA 1QWEA 1XBUA 4D6WA 3LWUA 1I81A 2MMPA 3GYAA 2YUOA 5CQXA 4Z02A 3I56T 2QQAA 2JDCA 2V8JA 2LVMA 2DVEA 1OQKA 3B3VA 3BI1A 3EO4A 5DLOA 3OYHA 3JRZA 5FU6B 2DL5A 4NGNA 4R9MA 2DJQA 2ZOFA 2P6GA 4IUSA 1QVGS 4E7HA 3B35A 5CO7A 2KMTA 1AT1B 2ED0A 1BLLE 3D7GA 1QSTA 4A33A 2CT4A 5G20A 1Y0RA 2H5MA 1TU0B 5LJ3f 1YI2A 3H0IA 2K5TA 2HQYA 2CUBA 1VQNA 4R57A 2DPPB 1VQ5A 3T9YA 2DFUA 3PB7X 2VGNA 3H9NA 3RKXA 3MGDA 1J4JA 4OB0B 5FROA 1VIFA 3NPFA 2FZGB 4A32A 4QKUA 4YWYA 1RAIB 1TXRA 2GFUA 1VQ9T 2L2PA 3N5FA 2VXEA 4J9DA 4XNHB 1VIEA 3UWNA 3CCRQ 3BE3A 4MHZA 4MFKA 2K5IA 1YLEA 4FD6A 2P0QA 2MCNA 2HB6A 3W91A 4A53A 4LUAA 4KSFA 3JCMX 3KGQA 1UJ0A 1B6BA 4NGPA 1T0JA 1WDXA 2P84A 4HVWA 1YMEA 1NYGA 2QG9B 1UFFA 3IWEA 3OYGA 1VYUA 4F04B 1WJQA 2MOXA 4IURA 4QC6A 1D09B 4KZTA 4OB3B 4CAWA 3QAHA 1VQMT 1UHFA 1KQ2A 1G8XA 2VYTA 1C1AA 3FC3A 1PU9A 3NGPA 5GMKi 1U6MA 1R57A 5GMKe 4M7AC 3SXOA 3PB6X 3CCJA 2F2WA 2WZNA 2BSWA 5GAOp 4HCBA 3V8KA 3CCLT 2F1LA 4DBFA 2J9AA 5KTAA 1S7KA 3CCEQ 1PD0A 3BW1A 1LANA 2XKOC 2FCKA 4KVOE 2WSEE 1JQQA 2E1HA 2QTXA 2CS7A 2FPDA 4BDYA 5JPHA 2QGFB 3S6KA 2QA4T 3PFSA 1VIXA 2EFIA 3AT1B 4M75C 1T0HA 1JJ2S 2KCWA 1QVPA 4Y92A 1Q81U 2YXYA 4V2SA 2EKOA 3LWHA 2NUZA 4MRIA 4JYWA 2Z3LA 1UE9A 1S3ZA 2C0IA 4C0DB 3VWDA 5DLQE 3LW5E 2JZ2A 1R3NA 4F0YA 1TKFA 3BI0A 1VQPA 1YWPA 5E96A 4IUUA 2D4PA 2KK4A 4JZ0A 4KBMB 1RLQC 2YLBA 2FS5A 1D1BA 4X3RA 2JW4A 1VHEA 2ZPAA 2EWBA 4FW1A 1VQ4T 5CPAA 4MFQA 2Q7BA 3LD2A 2CZ6B 2EGEA 2FO0A 1MV3A 1GHEA 1ZBJA 4M7DF 4PFPA 3CD6Q 1CM0A 1ZSGA 2I2LA 2OAWA 2DEAA 1OU8A 1XNIA 3ZBDA 4ZN3A 1Q81C 4FSXA 1I1JA 3WC5A 2FPEA 1PG5B 2V8VA 4CC2A 2CDTA 1ACMB 1FWZA 3M4GA 1OPLA 4XTWA 3WXMB 5D29A 1Z4RA 4M77E 2ZPEB 1Z8LA 1T3LA 1AOJA 3NFZA 1UECA 3EG9B 3QNVA 2E5KA 5IN1A 3FEDA 3S6WA 2LRQA 5F09A 1H92A 2EBPA 6AT1B 2H8HA 1CG2A 4PXEA 1TUDA 1BBZA 1V0CA 2FVGA 3SHWA 4M7DA 2AFOA 4B10A 1QSRA 3JCMd 4P5NA 3EFAA 2F69A 3HFOA 4KOWA 3I56Q 7CPAA 2HQXA 3SWNB 3FXTA 2YT6A 4IUTA 3EG9A 4RG8A 3TO9A 2Q0YA 5D6YA 1A2ZA 4Y28E 2VV5A 2EQJA 4HA8A 2ZW5A 4C5IA 2O01E 4RCCA 4CYQA 3DLMA 2BTTA 2G3RA 3S3OA 2DMOA 5DWMA 3NMZC 2CP7A 1WJSA 4M4ZA 2D8HA 4LDXA 5G22A 3CCQA 1B34A 1T3SA
chains in the Genus database with same CATH topology
3EG2A 3IQLA 1DJ7B 2RMOA 2A36A 4XU0A 4MDXA 3VYHB 2LMJA 1JXMA 1ARKA 3X25B 4BY6C 1AD5A 4RMOA 1K9AA 1NYFA 3I9QA 1PRMC 2DBMA 2GGRA 4ORZA 4LD9K 4GLMA 5LJ3j 5GANd 4AG1C 2RJEA 1M8MA 4BI3A 5I11A 4M78D 1BU1A 5FU7B 5CR2A 4MDWA 3S3MA 4LQ6A 2CH4A 2RQUA 4Y91A 4OF1A 4OP0A 1UGQB 4PNOA 2KRMA 3CPWS 5GJWB 2JNGA 4PL6A 4MMLA 2JS0A 4MMKA 3M59A 1YN8A 1G3SA 3UATA 4XQ3A 2ZCFB 2OI3A 2RJDA 4RKUE 2KXDA 3PMTA 3G4ST 4C8QE 1O9SA 1RUWA 5FW9A 5KCHA 4ZNXA 2LJ0A 4XU2A 5KH6A 2LCLA 4C5HA 1PSEA 1WXUA 3RKWA 1OV3A 5J3BA 1UHCA 2RN8A 1AWJA 2ESWA 1SPKA 3O8VA 3P8HA 1OPKA 2WSFE 3V7RA 3NFCA 2OTJT 3SEMA 1YJ9A 1E6HA 3H0FA 1NG2A 2F5TX 2DZCA 2R5AA 3OMGA 4FT4A 2BZ8A 4QVZA 1I5LA 2FRWA 5C0MA 5CKBA 5I22A 2EYXA 4NL3A 2ZPGB 2WACA 2XDBA 3TVTA 1ABOA 2BKDN 1MV0B 3PT9A 1K4US 1UTIA 4OMNA 1XQHA 2KRNA 4OMMA 3JCMh 3QG1A 2RHZA 5FU6C 2A08A 4JJNK 4PLIA 3QKJA 3JB9H 4RUGA 3CC4A 1NEBA 3OW2S 5CVIA 3QUIA 4ZGDB 1M1GA 1QW1A 3LWIA 2F5KA 3OYIA 1QKXA 3DB3A 4J9GA 5GAOq 5LJ5f 1VQLA 5GAMf 2YUQA 2LX9A 2DVJA 3PVLA 2NLUA 2RF0A 4X9DA 4XTYA 2YSQA 5CIUA 3CEYA 4JZ4A 3OMCA 1S72A 2IVWA 3A8HB 4M75B 1VQNT 4M6IA 1WQWA 1NM7A 4KUDK 2LT4A 2E41A 2CZ1B 2HC9A 4II1A 1QP2A 1N9SA 1K1ZA 4OB2B 1BI0A 2K3YA 5IXBA 1H3ZA 4UC4A 3TEEA 2DAQA 3E9FA 2KEAA 2JOYA 4KULA 1QVFA 1OI1A 3TSZA 2EJGA 2X4XA 2B86A 3GNFB 3CCJT 5CKHA 1KG1A 4GBQA 4R56A 3VJPA 1G5VA 3VYGA 4LN2A 4KRTA 3MCAB 2DKGA 3QZ9B 4M75G 2MI6A 4PJOE 2L3SA 3G6EA 2DXBA 3OYCA 3RKYA 1TG0A 3JCMc 2BZYA 2ROTA 2KT8A 4M75D 4C0DC 1NZ9A 1P92A 3KUFA 2ENMA 1AWWA 1WXBA 2BUDA 4RCBA 1VQPT 1G3YA 4A4EA 1Y7XA 3FIFA 3ZFJA 2VWFA 2RQWA 1K9MU 4XU1A 4CRIA 4OMOA 2EYWA 2OAUA 3RMQA 2X3WD 3PNWC 4EMKB 1VQ7A 4M7DC 2KGTA 1BIAA 3VV0A 1PKTA 3R6NA 3VS6A 2KSSA 4LDUA 2GTOA 2GCXA 4M77F 4RTTA 1JO8A 3MEUA 4BACA 2X4WA 4M77B 1AEYA 2LCSA 4EMKA 2D0QB 4IUVA 2CZ7B 2E70A 4E47A 1VUBA 3I55A 2RA2A 3M58A 3NTKA 1N9RA 3QWYA 4XU3A 4D8DA 2VC8A 3JCMg 3CC7A 2ZPBB 1YNZA 4M77A 4LDWA 4EIKA 1ZHIA 4N4GA 4J7IA 2PNIA 4OB1B 2MF2A 2PVDB 3G4SA 1YIJT 1CKBA 3UPUA 3MP1A 4BB7A 3QXEB 3CCQT 1PNJA 3HHTB 5GAOn 2DF6A 1NJIU 2QQBA 3VKIA 3L2VA 2E5QA 3H8ZA 3G7ZA 2FB7A 4DQ2A 4A4KA 5GANe 1M9SA 2L89A 1LNXA 1XOVA 3FDRA 3QJYA 5GAMj 2ODFA 1M3BA 1U06A 1KD1U 1W2BS 2RM4A 5FU7C 4AFQC 1VYVA 5FLXE 5GANg 3LH5A 2RHXA 1WX6A 3M56A 2DXTA 2DXUA 1KQSA 1NJIC 1N6AA 3LGLA 5CKEA 2KRSA 2DX1A 4ESRA 1I4K1 3OSVA 2DTHA 4J9HA 4IIMA 1G3WA 4C8QF 2O9VA 2MAMA 1K73U 4C8QB 1SHFA 4XTZA 3QAYA 1W70A 3MEWA 1WFWA 3META 1GCPA 3PGGA 3GF5A 2K79A 2RD1A 1N8RU 3M53A 3CQTA 5CK9A 2H3JA 3V8LA 2QEXA 4FT2A 4C8QA 3HRUA 2GNCA 3A8LB 1VQKT 1YJ9T 1KJWA 4JLGA 4M7AE 2HEQA 2LP5A 4FSSA 3JV3A 1X2KA 3OYLA 1K73C 4GY5A 5GAN2 1BYMA 2V8KA 4ZTFA 4HVUA 3PIPA 4IKFA 2D6FA 2LQKA 2KT1A 4OGEA 5A0GA 3VU3C 3GP8A 2A3LA 1U1SA 4C8QG 2FPFA 5GMKj 2Q7SA 2VUBA 2DRKA 4N4HA 4R55A 3GOXA 5A0LA 3JCMQ 3HPWA 2K9GA 1N27A 1UUEA 3CC4T 2EVRA 3J80E 2CZ0B 4HT9A 4J7FA 2EYQA 3M54A 1YP5A 2KXCA 3OYDA 1VQLT 3SB2A 2ECZA 2RHUA 1EFNA 4F16A 4HCZA 5LJ3h 4K11A 4C92E 3CMEA 2KYBA 1AZEA 3GIBA 2J6KA 5D6WA 2JM8A 1S72T 2XD0A 2PTKA 1JRIA 4BD3A 2D8JA 2C0TA 2CKKA 2DJZA 4AFUC 1PHTA 2EQKA 3JCMJ 1K0XA 5HY6A 4IIOA 2EQMA 3CBMA 2EGCA 4CC3A 2JN0A 4QW2A 3JCMb 1WPYA 2J7IA 4TVRA 4JS4A 4M7DB 3V7SA 2AHJB 4JPBW 2M51A 3H6ZA 4YTLA 2I0NA 1UGVA 4F14A 3SDZA 1X6GA 4JDSA 2RHYA 3EFRA 1GBQA 2D1XA 3QSUA 4A63B 2KQWA 2L3PA 3F70A 4JRQA 3G6ET 3RESA 5I21A 1B34B 3GPLA 2EJ9A 2VGMA 4HCKA 2MWPA 1Z9ZA 2LJ1A 4FU6A 1YIJA 2L8DA 3VUZA 4LD6A 4Z89A 1RI0A 4M7DG 2BIVA 1X6OA 4EMKC 2DK3A 3BFMA 3A8OB 1QVGA 1JB0E 3INZA 2M16A 2Y4YA 4M7DD 1YWOA 1VQ7T 2FVUA 2DNUA 1TH7A 4QT7A 5C6SA 2J05A 4M77C 3JCMW 4QQDA 1X6BA 3VRZA 1OOTA 2LDMA 3E19A 1V1CA 3I55T 1QVFS 4EMGA 2M0YA 1WXTA 3CC7T 3ME9A 1Y96B 3JB9F 2LQ8A 2ZPHB 4QVDA 1U5SA 4OVAA 4E7KA 2EWNA 2G6FX 1M3AA 2ED1A 4PKCC 2K3XA 5LJ5d 1Y96A 5GAMd 5FRNA 2GFAA 3QYHB 1FX7A 2K3BA 4OGCA 2PU9B 2X4YA 1YCSB 3CBOA 4Z8AA 1OYXA 2IG0A 2DM1A 2XK0A 2GTJA 3C94A 1YJNA 1XTDA 2QQSA 2AK5A 1HJDA 1VQKA 3EFSA 5FWBA 2LQWA 1JJ2A 2CH4W 3JCMV 2RPNA 4J83A 3CMAA 1JBMA 3C0CA 2C06A 3OYMA 1K8AU 2KAFA 2KYMA 2RI5A 3JB9G 3CPFA 2JVVA 4J9BA 1U1TA 4ME7A 2KY9A 2K2MA 1SSFA 3OYYA 3TCJA 3QHSA 3L2UA 4PLLA 2HCKA 2V1RA 1QCFA 2GQVA 1X43A 3CCUA 3JB9D 1Z9QA 3ZEHA 2QQRA 1FXXA 3FJPA 2FL7A 5A0DA 4XK8E 4C8QC 5KE3A 4JRPA 3C12A 2YHTA 2JXBA 2LT1A 4OMFB 5GANf 4QVCA 1PSFA 3JAME 3ASKA 2GQIA 2LX7A 2LC4A 1K8AC 1VQ8A 4DA4A 2AZSA 4ELZC 2LJ3A 3ULRB 3M0RA 2RI3A 1Q82U 1QLYA 4OMQA 3U23A 5FWCA 1WJRA 2KR3A 2P4TA 5GAOl 3M55A 3LGFA 2QEXT 2DBKA 3A98A 2DTIA 3CCMA 3NHNA 1EIFA 4QQ6A 2E6ZA 4LE9A 3CCSA 3RBBB 4BE0A 2RHIA 3M5AA 1KFZA 2HDAA 2FEIA 2HAXA 3M0PA 3Q1JA 2M1HA 4JRIA 1Q82C 3L2RA 1X69A 3X24B 3MP6A 1I07A 2QDLA 2CT3A 4OMLA 3QPHA 4J6WA 5GJVB 4J9FA 3CCVA 2VKNA 2R57A 1ZX6A 3MO8A 2DIGA 2PVOB 1D3BB 2HQEA 3OSSC 1CSKA 3VS2A 1KSWA 4JJBA 4VUBA 2K57A 4XAXB 4Q5WA 1KIKA 3KXTA 2DL7A 2EPDA 2FG0A 5LJ5h 2DD4A 5CQYA 5GAMh 2CSIA 4C92F 3OYNA 3MEVA 3V7CA 2LNVA 4FL6A 1D3BA 2X35A 3OYAA 3CMET 1VQ6A 3CPWA 2GF7A 4XTXA 3UF4A 2JTMA 2KROA 3PMIA 1AWOA 4M78E 1X75C 2K6DA 4XTUA 4L59A 2V8IA 3A5ZB 2QI2A 3VS3A 4C92A 2EQIA 3PVQA 2HBPA 2XDPA 4HVVA 3CXCA 1H8KA 3A8MB 2EYZA 2BZXA 4DEYA 5CAIA 3CBPA 2MIOA 2A7YA 5IXFA 3JCMe 3CCRT 1M90U 2DE0X 3LYIA 1K9MC 4E6RA 1I0CA 4WCIA 3P8BB 5GAN8 2XDDA 5EC7A 4N4IA 3FRNA 1B3QA 5CKFA 1U8RA 1SHGA 2KE9A 1X01A 3CC2A 2XHCA 1B07A 4AG2C 4ATOA 1J3TA 3X26B 4LNPA 2KVQG 1AHJB 3VUBA 3BDLA 2K4YA 2RK1A 4HKEA 3T9NA 1RL2A 1M90C 3M9QA 1FYNA 1VA7A 2ZPIB 1GBRA 5GANj 5GMKh 5LJ3d 3OW2A 1UEBA 2M0OA 4M77G 2YRVA 5IHNA 3PE0A 2P4RA 3WVEB 3M0SA 4IUQA 3OYKA 4ZGEB 5L23A 2L0AA 2QQ9A 4M77D 3R6OA 3J7AF 1QP3A 2DRMA 2JMCA 4JS5A 3UA6A 5A2QE 3M57A 5EMIA 1M5Q1 3GLXA 1BI1A 1UGSB 4RTWA 3OS1A 1M1FA 1Y71A 3L42A 1QKWA 1YBYA 1CKAA 1K0SA 3C4SA 2DO3A 4BE2A 2OTLA 2DTOA 4ZTJA 3H41A 5GAN7 4BDZA 4HT8A 2V1QA 5LJ5e 2O31A 3EG0A 2DL4A 1KD1C 3RNJA 2SEMA 2F2VA 1G3TA 4J9CA 3RUXA 1ABQA 4JUVA 3REAB 1UB4A 3LX7A 5LJ5g 5HKCA 5GAMg 1JWQA 1YITA 4BE1A 3RMSA 1BK2A 2MWOA 2XI9A 4L6V5 2D0NA 2LNHB 1M8VA 4J9EA 1Q86U 1YJNT 4X9CA 3I35A 5HK3A 2K2VA 3HFNA 4J6XA 1NLPC 2RK2A 3TU4K 2J6FA 4O5VA 3VS7A 3X28B 3CMAT 2J06A 1YJWA 4CC4B 4IUPA 2RB6A 2X3XD 4C5GA 1OZ2A 4EDUA 4ELYC 3DLLA 2K5FA 1N8RC 3QJ6A 3EG3A 2R5MA 3E9GA 4M75E 4B9XA 1GCQA 3CCUT 2L5QA 5KCOA 1Q86C 5EG2A 4BINA 4RTYA 2DL8A 2OJ2A 4C8QD 1NLOC 1JU5C 5M9OA 1IZ6A 2EIFA 5L8RE 4LDVA 1KQ1A 5D6XA 3E1SA 2YUNA 3AHUA 1HXDA 1VQ8T 1BI2A 1OZ3A 4RTXA 3URGA 4N0AA 3HRTA 1FMKA 2EGAA 1Y0MA 3OS5A 3HP9A 1GL5A 3LH0A 1AVZC 2DL3A 3SD4A 4HXJA 3JSCA 2RJFA 3CCMT 1NPPA 1PRLC 2LQNA 3ER0A 3CCST 4FIBA 2A28A 3V8JA 3QDRB 5IH2A 4E7LA 2AKKA 4LUDA 1M27C 1M3CA 3OA6A 2E12A 2RNAA 2XG8D 4WF2A 3G71A 4BI8B 1Q7YU 3OS0A 1VYTA 2XMFA 1VQOA 2EW3A 3CCVT 1UDLA 3RIRA 4F17A 4X34A 1BKBA 3QZ5B 3CCRA 1W2BA 2O9SA 2PQWA 2HD0A 2FYKA 2KBTA 4PJOF 1KC8U 2CREA 4Z88A 3J81E 4JZ3A 3S3NA 1HK9A 4PJOB 1M4ZA 2ZGWA 4C92C 1Q7YC 4XTVA 5GMKm 4RG2A 4GLKA 2ABLA 3P8DA 3OQ5A 1MHNA 2DLPA 2CGHA 4M78F 2XIDA 1VQ6T 2J6OA 4L5GA 4AFSC 3UDCA 3VS1A 2KDSA 4PJOA 4M78B 2CSQA 1AWXA 1R8OB 3CCEA 4C5EA 3HL8A 1V29B 2JMAA 2EYYA 1GFCA 1KC8C 4QQGA 5IHIA 3OY9A 3VS4A 1NEGA 1S1NA 4M78A 4JLIA 2B8AA 1UGPB 4NL2A 2YLCA 4MZPA 4F7UE 4M6HA 4X1VA 3M0UA 3SWNA 1WYXA 3DKMA 2NWMA 4PJOG 2A37A 4RTVA 2JTFA 2P0KA 1SSHA 3JCMP 4DOWA 4PJOD 2CYZB 2E6NA 1SRLA 5GAOm 5I2SA 3JB9J 3CD6A 4M78G 1W1FA 1SEMA 2DD5A 3M0TA 3CC2T 3QIIA 1X2QA 5CKDA 4A4FA 1PWTA 3THKA 4KUIA 1YHQA 2AZVA 3HRSA 4RN7A 2M9UA 5LJ3e 3PTAA 4EFDA 3OS2A 3FEOA 4LDYA 3SFMA 4JJDA 3VS0A 3TREA 5DM7R 2SRCA 3MEAA 2YUPA 4CC7A 3JCMf 3NTHA 3I56A 4J8OA 1H3HA 5LJ3g 2K7AA 2O2OA 1G83A 3X20B 3QYGB 2EKHA 2VXFA 2RI2A 3L2ZA 3BDUA 5GMKl 2LZ6B 4R0KA 3L2WA 1ZUKA 4E7JA 2RQVA 3CXCS 5GAOr 1NE8A 2DA9A 1WI7A 3L2QA 2RJCA 2RO0A 4MZTA 2LTOA 1ZQ1A 3KBGA 1WA7A 2L3QA 1GRIA 2PUKB 5GAN5 1E7OA 3FB9A 3GNGA 3MHXA 2OTLT 1MGQA 4NOYA 2O4XB 1VQ9A 2F2XA 1BI3A 2R58A 2W0ZA 1H641 2JS2A 3KFVA 2GBQA 4A54A 1KHCA 2O4XA 2K5LA 1YITT 2C0OA 3OYEA 3A8GB 2EQUA 2QDYB 1VQMA 3O5ZA 1UJYA 1M30A 3OYBA 2VVKA 3NTIA 1YCYA 4M7AF 1GFDA 1TUCA 4HCCA 5ECAA 3PIOA 3CCLA 1GCQC 2RQTA 4D8KA 3LLRA 4M7AB 2QXFA 2DEQA 2WSCE 4RTZA 2XU8A 3I5SA 3M0QA 3JB9I 1YJWT 3FJ5A 4AFZC 4DEXA 2EJFA 2QA4A 4A4HA 4M75F 1YI2T 1HSQA 4EMHA 4M7AA 2D9TA 1UG1A 1JEGA 4CI0C 2DXCA 1LCKA 2HNIA 1VQ5T 2JTEA 4N0AC 1ZUUA 5FRMA 4J5YA 5I2MA 3OYJA 4EPCA 2YDLA 1KQSS 3RERA 1LOJA 4MZMA 1GXIE 3I5RA 5GANh 3L1AA 5IAYA 1VQ4A 4M75A 3MP8A 5IHKA 4M7AG 5DY9A 3FLGA 4C0FA 2E65A 4M7DE 5AYFA 5HK0A 4FM4B 4M7AD 1MUZA 2ZZDA 3UT1A 1HD3A 4OMPA 2E64A 4JRKA 4C92B 2RQRA 2Y4XA 3OB9A 1W4SA 1A0NB 5GAN3 1SRMA 5IT9E 1ZLMA 4DOVA 2DZ9A 5J39A 5HCKA 3EAEA 1BB9A 4NS5A 1AZGB 4C0GA 3BY7A 1UGRB 4O6JA 2FRYA 3G71T 2EAYA 1BIBA 2IIMA 2LCCA 1VQOT 1KHIA 3N5BB 1RI9A 4BUGA 2DIQA 3C95A 1NPRA 3DB4A 3HSBA 4J6YA 2ZPFB 2PVGB 4E7IA 1RLPC 2PZ1A 2ROLA 3ZL7C 5CCAA 1ZBXA 4C92G 1JXOA 4PJOC 1Y57A 3M4YA 1OEBA 2CUDA 4BY6B 2Y90A 1PKSA 2AKLA 4C92D 2O88A 5KE2A 3NE8A 3VRYA 2P0PA 3EG1A 1ZUYA 4M78C 5GAN6 2XICA 4ZN1A 3OYFA 1W6XA 4J9IA 3QO3A 3SWNC 3CCET 1I8FA 4ZGJB 3OBWA 1E6GA 1M1KU 3QBYA 3WVDB 2DILA 1Y07A 5GAN4 1WGSA 4BI4A 1QWFA 3UA7A 1WIEA 1N5ZA 4A4GA 4F7UF 3REBB 4C0ZA 3QWXX 2KNBB 4F7UB 3EHRA 1O75A 2JUFA 3VS5A 3GBQA 1WLPB 2FHDA 2HBWA 1U3OA 3TSWA 4M6GA 4KT0E 2W10A 1M1KC 2DYBA 2PUOB 2RH2A 1K76A 2L3RA 5J26A 4F7UA 3CZXA 2OTJA 5LJ5j 5LL6S 4B9WA 2JM9A 2HSPA 4LUEA 3CD6T 1LJOA 1WNLA 1WQ7A 2JT4A 1IO6A 5GAMe 2X4JA 1IREB 1G2BA 4RTUA 3EGUA 1YHQT 3OBYA 3EHQA 3H0HA 1X27A 4F7UG 3HKSA 2E10A 4JJCA 1QWEA 4D6WA 1I81A 2MMPA 2YUOA 5CQXA 4Z02A 3I56T 2QQAA 2V8JA 2LVMA 2DVEA 5DLOA 3OYHA 3JRZA 5FU6B 2DL5A 2DJQA 1QVGS 4E7HA 5CO7A 2KMTA 2ED0A 2CT4A 5LJ3f 1YI2A 3H0IA 2CUBA 1VQNA 2DPPB 1VQ5A 2VGNA 3RKXA 4OB0B 5FROA 1VIFA 3NPFA 2GFUA 1VQ9T 2L2PA 2VXEA 4J9DA 1VIEA 3UWNA 2K5IA 2P0QA 2MCNA 2HB6A 4A53A 3JCMX 1UJ0A 1T0JA 1WDXA 4HVWA 1NYGA 1UFFA 3OYGA 1VYUA 1WJQA 2MOXA 4IURA 4OB3B 1VQMT 1UHFA 1KQ2A 2VYTA 3FC3A 3NGPA 5GMKi 5GMKe 4M7AC 3CCJA 2F2WA 5GAOp 4HCBA 3V8KA 3CCLT 3BW1A 2XKOC 2WSEE 1JQQA 2E1HA 2QTXA 2CS7A 2FPDA 4BDYA 2QA4T 3PFSA 2EFIA 4M75C 1T0HA 1JJ2S 1QVPA 4Y92A 1Q81U 4V2SA 2EKOA 3LWHA 2NUZA 1UE9A 2C0IA 4C0DB 5DLQE 3LW5E 2JZ2A 1VQPA 1YWPA 4IUUA 2KK4A 4KBMB 1RLQC 2YLBA 2JW4A 1VQ4T 2CZ6B 2EGEA 2FO0A 1MV3A 1ZBJA 4M7DF 1ZSGA 2OAWA 2I2LA 1XNIA 3ZBDA 4ZN3A 1Q81C 4FSXA 1I1JA 2FPEA 4CC2A 2CDTA 1FWZA 3M4GA 1OPLA 4XTWA 3WXMB 4M77E 2ZPEB 1T3LA 1AOJA 1UECA 2E5KA 5IN1A 3S6WA 2LRQA 1H92A 2EBPA 2H8HA 1TUDA 1BBZA 3SHWA 4M7DA 3JCMd 4P5NA 2F69A 3HFOA 2HQXA 3SWNB 2YT6A 4IUTA 4RG8A 5D6YA 4Y28E 2VV5A 2EQJA 4HA8A 4C5IA 2O01E 4RCCA 3DLMA 2BTTA 2G3RA 3S3OA 2DMOA 3NMZC 1WJSA 4M4ZA 2D8HA 4LDXA 3CCQA 1B34A 1T3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG2 A;  5ECA A;  1GCQ C;  3IQL A;  1B07 A;  2RQT A;  4AG2 C;  4D8K A;  2RMO A;  2A36 A;  2FPF A;  4RTZ A;  2Q7S A;  2LMJ A;  1JXM A;  1ARK A;  3I5S A;  3M0Q A;  1J3T A;  1AD5 A;  1K9A A;  1NYF A;  4LNP A;  3FJ5 A;  2DRK A;  3I9Q A;  4AFZ C;  1PRM C;  2DBM A;  4DEX A;  2GGR A;  4ORZ A;  1FYN A;  1VA7 A;  1HSQ A;  1GBR A;  4GLM A;  2K9G A;  1UUE A;  1UG1 A;  1JEG A;  2EVR A;  4AG1 C;  1M8M A;  5I11 A;  1LCK A;  2JTE A;  1ZUU A;  1BU1 A;  5IHN A;  3PE0 A;  2P4R A;  1YP5 A;  4LQ6 A;  2YDL A;  3M0S A;  2CH4 A;  2KXC A;  2RQU A;  2ECZ A;  5L23 A;  2L0A A;  3I5R A;  1EFN A;  4F16 A;  4K11 A;  2KRM A;  2DRM A;  2JMC A;  2KYB A;  3UA6 A;  1AZE A;  5EMI A;  2J6K A;  5GJW B;  2JM8 A;  2PTK A;  5IHK A;  2JS0 A;  1YN8 A;  2D8J A;  3UAT A;  4RTW A;  2C0T A;  1QKW A;  2OI3 A;  2KXD A;  1CKA A;  4AFU C;  1PHT A;  1K0S A;  1RUW A;  1MUZ A;  5FW9 A;  1HD3 A;  4OMP A;  4ZNX A;  1K0X A;  3H41 A;  4IIO A;  2LJ0 A;  2RQR A;  2V1Q A;  2EGC A;  4CC3 A;  1A0N B;  1SRM A;  1WXU A;  2O31 A;  1ZLM A;  3EG0 A;  2DL4 A;  2J7I A;  1OV3 A;  1UHC A;  2RN8 A;  2SEM A;  1AWJ A;  3RNJ A;  2F2V A;  2ESW A;  1SPK A;  1OPK A;  4J9C A;  1ABQ A;  5HCK A;  4JPB W;  2M51 A;  1BB9 A;  3REA B;  3SEM A;  1E6H A;  3H0F A;  1NG2 A;  1AZG B;  2I0N A;  2BZ8 A;  1UGV A;  4F14 A;  1JWQ A;  1X6G A;  2FRY A;  2FRW A;  1GBQ A;  2D1X A;  5I22 A;  2IIM A;  2EYX A;  4A63 B;  1BK2 A;  2L3P A;  1RI9 A;  2D0N A;  2LNH B;  4J9E A;  3TVT A;  1ABO A;  3I35 A;  1MV0 B;  1K4U S;  1RLP C;  1NLP C;  2PZ1 A;  1UTI A;  4OMN A;  2ROL A;  3ZL7 C;  4HCK A;  2KRN A;  4OMM A;  1Z9Z A;  2J6F A;  3VS7 A;  2J06 A;  1JXO A;  2LJ1 A;  1Y57 A;  4CC4 B;  1OEB A;  2X3X D;  2CUD A;  1PKS A;  2A08 A;  2AKL A;  2O88 A;  4Z89 A;  3NE8 A;  4RUG A;  3VRY A;  3EG1 A;  1ZUY A;  3EG3 A;  1NEB A;  1GCQ A;  4BIN A;  4RTY A;  1YWO A;  2DL8 A;  1QKX A;  2OJ2 A;  2DNU A;  4J9G A;  4QT7 A;  1W6X A;  4J9I A;  1NLO C;  1JU5 C;  2YUQ A;  2DVJ A;  3PVL A;  2J05 A;  2RF0 A;  1E6G A;  1X6B A;  3VRZ A;  2YSQ A;  2DIL A;  2YUN A;  4JZ4 A;  1OOT A;  1QWF A;  3UA7 A;  4RTX A;  4M6I A;  1WIE A;  1N5Z A;  1NM7 A;  3REB B;  1FMK A;  2EGA A;  1V1C A;  3QWX X;  1Y0M A;  2KNB B;  1K1Z A;  1GL5 A;  3EHR A;  2M0Y A;  1WXT A;  1AVZ C;  2DL3 A;  3VS5 A;  4HXJ A;  3GBQ A;  1WLP B;  2HBW A;  5IXB A;  1PRL C;  1U3O A;  3TSW A;  2LQN A;  4M6G A;  1U5S A;  2A28 A;  5IH2 A;  2W10 A;  2AKK A;  4LUD A;  1M27 C;  2G6F X;  1M3C A;  2DYB A;  2KEA A;  1M3A A;  1K76 A;  3CZX A;  2ED1 A;  2JM9 A;  2HSP A;  4LUE A;  3TSZ A;  2B86 A;  2RNA A;  2JT4 A;  4GBQ A;  4LN2 A;  4KRT A;  2K3B A;  1VYT A;  1IO6 A;  2XMF A;  1YCS B;  2EW3 A;  4Z8A A;  1G2B A;  2L3S A;  4RTU A;  3EGU A;  2DM1 A;  1UDL A;  2GTJ A;  3EHQ A;  4F17 A;  2AK5 A;  1HJD A;  1TG0 A;  5FWB A;  2BZY A;  2ROT A;  2KT8 A;  1X27 A;  3H0H A;  2LQW A;  2CH4 W;  2O9S A;  4JJC A;  1QWE A;  2RPN A;  2ENM A;  2KBT A;  1AWW A;  1WXB A;  2YUO A;  3C0C A;  2CRE A;  4Z88 A;  4JZ3 A;  2KYM A;  4J9B A;  2K2M A;  2VWF A;  2RQW A;  2DL5 A;  2HCK A;  2V1R A;  1QCF A;  2DJQ A;  1X43 A;  2ABL A;  4OMO A;  2EYW A;  1Z9Q A;  2DLP A;  2X3W D;  2J6O A;  2ED0 A;  4AFS C;  3VS1 A;  2KGT A;  2CSQ A;  1PKT A;  2CT4 A;  3R6N A;  3VS6 A;  1AWX A;  2GTO A;  2JXB A;  2JMA A;  4RTT A;  1JO8 A;  2EYY A;  2GQI A;  3H0I A;  1GFC A;  2LX7 A;  2CUB A;  5IHI A;  2AZS A;  1AEY A;  2LCS A;  2LJ3 A;  3ULR B;  3M0R A;  3VS4 A;  3NPF A;  1NEG A;  1QLY A;  4OMQ A;  1S1N A;  3U23 A;  5FWC A;  2L2P A;  2KR3 A;  4J9D A;  3QWY A;  4M6H A;  4X1V A;  2DBK A;  2MCN A;  3M0U A;  3A98 A;  4D8D A;  1WYX A;  2NWM A;  1YNZ A;  2A37 A;  1UJ0 A;  4RTV A;  1T0J A;  3NHN A;  1WDX A;  4EIK A;  4LE9 A;  1SSH A;  4HVW A;  1NYG A;  3RBB B;  1UFF A;  1VYU A;  2MOX A;  2PNI A;  1KFZ A;  1SRL A;  2FEI A;  2HDA A;  3M0P A;  1UHF A;  3NGP A;  1CKB A;  1W1F A;  1SEM A;  2F2W A;  3M0T A;  1PNJ A;  1X69 A;  1X2Q A;  2DF6 A;  1PWT A;  1I07 A;  2QDL A;  3THK A;  2CT3 A;  4OML A;  5GJV B;  2AZV A;  1JQQ A;  4J9F A;  4RN7 A;  2FPD A;  2VKN A;  1XOV A;  1ZX6 A;  2ODF A;  1M3B A;  1U06 A;  1T0H A;  4JJD A;  3VS0 A;  4Y92 A;  1CSK A;  2NUZ A;  2SRC A;  3VS2 A;  4AFQ C;  2YUP A;  1KSW A;  4CC7 A;  1UE9 A;  4JJB A;  1VYV A;  2C0I A;  3LH5 A;  1H3H A;  2K7A A;  1KIK A;  1WX6 A;  2DL7 A;  1G83 A;  2O2O A;  2EPD A;  1YWP A;  2FG0 A;  2EKH A;  2CSI A;  2LZ6 B;  1RLQ C;  4R0K A;  2KRS A;  1ZUK A;  2JW4 A;  2RQV A;  2DX1 A;  4ESR A;  2EGE A;  2FO0 A;  1MV3 A;  2DA9 A;  3UF4 A;  1ZBJ A;  4J9H A;  4IIM A;  1WI7 A;  2KRO A;  1ZSG A;  1AWO A;  2OAW A;  2O9V A;  2K6D A;  1I1J A;  1WA7 A;  2FPE A;  2L3Q A;  4CC2 A;  2CDT A;  1OPL A;  1SHF A;  1GRI A;  3QAY A;  1W70 A;  3VS3 A;  1WFW A;  1E7O A;  2EQI A;  3PVQ A;  1T3L A;  1AOJ A;  1UEC A;  1GCP A;  2E5K A;  4HVV A;  2K79 A;  1H92 A;  2EBP A;  2H8H A;  1H8K A;  1TUD A;  1BBZ A;  3CQT A;  3SHW A;  2F2X A;  2W0Z A;  2EYZ A;  2JS2 A;  3KFV A;  2BZX A;  4DEY A;  2GNC A;  2GBQ A;  1KJW A;  2MIO A;  2YT6 A;  2HEQ A;  5IXF A;  2LP5 A;  4FSS A;  2DE0 X;  3JV3 A;  1X2K A;  2C0O A;  4HVU A;  2BTT A;  4E6R A;  1I0C A;  3O5Z A;  2DMO A;  4WCI A;  3NMZ C;  1UJY A;  2KT1 A;  5EC7 A;  1M30 A;  2VVK A;  1B3Q A;  2D8H A;  4M4Z A;  1SHG A;  1GFD A;  1TUC A;  2KE9 A;  1T3S A; 
#chains in the Genus database with same CATH topology
 3EG2 A;  2VL1 A;  3IQL A;  1S7F A;  1DJ7 B;  2RMO A;  2A36 A;  4XU0 A;  4MDX A;  2PJ1 A;  2PJ9 A;  3VYH B;  2LMJ A;  1JXM A;  3X25 B;  4BY6 C;  5KYW A;  1ARK A;  1AD5 A;  4RMO A;  1K9A A;  1NYF A;  4AVB A;  3I9Q A;  2OU2 A;  4CYP A;  1PRM C;  2DBM A;  4C2Y A;  4R8F A;  6CPA A;  1SKU B;  2B4B A;  2GGR A;  1RO5 A;  4ORZ A;  4LD9 K;  2FIA A;  4U9Z A;  2V77 A;  1VQ9 Q;  4P10 A;  4GLM A;  1M4L A;  2REE A;  2QK0 A;  5LJ3 j;  5AG6 A;  5GAN d;  4AG1 C;  2RJE A;  1M8M A;  4BI3 A;  4WTO B;  5I11 A;  3R96 A;  4M78 D;  2PJ8 A;  1BU1 A;  3PEI A;  4P4F A;  5FU7 B;  5CR2 A;  4MDW A;  4MHD A;  3S3M A;  4LQ6 A;  2CH4 A;  2RQU A;  1VQ8 Q;  1I12 A;  4A2Z A;  5IB9 A;  4Y91 A;  3DDD A;  3EH2 A;  4OF1 A;  4OP0 A;  4Z65 A;  1UGQ B;  1OBR A;  1TTH B;  8AT1 B;  4PNO A;  2KRM A;  1VQM Q;  3CPW S;  5GJW B;  1QVG P;  2JNG A;  4PL6 A;  1B7T A;  4MML A;  2JS0 A;  4MMK A;  3M59 A;  1HDU A;  4NCZ A;  1YN8 A;  1G3S A;  2VEZ A;  3UAT A;  3CCM Q;  3CCL Q;  1TIQ A;  4XQ3 A;  2ZCF B;  1F2P A;  2OI3 A;  2RJD A;  4RKU E;  2KXD A;  3PMT A;  3G4S T;  1R77 A;  3DGV A;  4C8Q E;  1O9S A;  3S6G A;  1RUW A;  1ZLI A;  5FW9 A;  2JEV A;  5KCH A;  4ZNX A;  4UWJ A;  5HVH A;  4B6Z A;  2LJ0 A;  4XU2 A;  5KH6 A;  2LCL A;  4C5H A;  1PSE A;  2I3C A;  1WXU A;  4OIW A;  1PCA A;  3RKW A;  1Z4E A;  1OV3 A;  5J3B A;  1UHC A;  2RN8 A;  4KGZ B;  1AWJ A;  2DF5 A;  3JVN A;  5AGE A;  2ESW A;  1SPK A;  3O8V A;  3P8H A;  1OPK A;  2WSF E;  3K2K A;  2OH1 A;  3V7R A;  3NFC A;  2OTJ T;  4IF5 A;  3SEM A;  2JJ9 A;  1YJ9 A;  5HVG A;  1E6H A;  3FH4 A;  3H0F A;  5H84 A;  1ELM P;  1NG2 A;  2F5T X;  2DZC A;  2R5A A;  4X5K A;  3OMG A;  2EK9 A;  3SJX A;  4FT4 A;  4OAD A;  2BZ8 A;  3JUW A;  4QVZ A;  2BOA A;  1I5L A;  3S6F A;  5LYF A;  2FRW A;  5C0M A;  5CKB A;  2YNC A;  4NSQ A;  5I22 A;  1CPS A;  2EYX A;  2JBK A;  4NL3 A;  1VQ4 Q;  4FYY B;  2ZPG B;  2WAC A;  2XDB A;  3TVT A;  1ABO A;  2BKD N;  1MV0 B;  2V8H A;  3PT9 A;  1K4U S;  1LAM A;  4ZY2 A;  2REF A;  4JLY A;  2AFW A;  1UTI A;  4OMN A;  4C7I A;  1XQH A;  2KRN A;  4OMM A;  2B3V A;  3A1P A;  3JCM h;  1ZG8 A;  4R3L A;  3QG1 A;  1D0X A;  1RAA B;  2ZEM A;  2RHZ A;  4RS2 A;  1ZO0 A;  3LAC A;  2CP2 A;  5FU6 C;  2A08 A;  4JJN K;  3S9M A;  1QQ9 A;  1IY7 A;  1D0Y A;  4PLI A;  3QKJ A;  4KS9 A;  3H4Q A;  1JJ2 P;  4RUG A;  3JB9 H;  3CC4 A;  2HSE B;  1NEB A;  2OB0 A;  3OW2 S;  5CVI A;  2WPW A;  3QUI A;  4M3S A;  4ZGD B;  1M1G A;  2VZZ A;  1QW1 A;  2XEG A;  3FX6 A;  1FMV A;  2D4O A;  4ZGY B;  3LWI A;  2C6P A;  2F5K A;  3OYI A;  1QKX A;  4CAE A;  3DB3 A;  4J9G A;  5GAO q;  5LJ5 f;  1VQL A;  5GAM f;  1SG5 A;  2LX9 A;  2YUQ A;  2DVJ A;  3PVL A;  2NLU A;  4M85 A;  2RF0 A;  4X9D A;  1N71 A;  4XTY A;  1MMA A;  1RAC B;  4PPZ A;  2YSQ A;  5CIU A;  3CEY A;  4JZ4 A;  3OMC A;  1S72 A;  1WZO A;  2IVW A;  3A8H B;  4M75 B;  2QIR A;  1VQN T;  4M6I A;  1WQW A;  5IB0 A;  1NM7 A;  4KUD K;  4XNH C;  2LT4 A;  1CBX A;  2AFZ A;  2E41 A;  2CZ1 B;  2DET A;  2PIY A;  4P4I A;  5IX3 A;  2HC9 A;  3CXQ A;  3FF3 A;  4II1 A;  1QP2 A;  1B87 A;  1N9S A;  3BHX A;  1BPN A;  1K1Z A;  3R1K A;  4OB2 B;  2C6C A;  1MK4 A;  2COZ A;  1BI0 A;  2K3Y A;  2CXA A;  5IXB A;  1X12 A;  2GLJ A;  1H3Z A;  4P4E A;  4UC4 A;  5HXD A;  5J8C A;  4CYO A;  3TEE A;  1IOI A;  1WHG A;  2DAQ A;  3E9F A;  4RI1 A;  2KEA A;  2NUP B;  1M4G A;  2JOY A;  1VHS A;  4DYO A;  4KUL A;  4DNC A;  2HKQ B;  1QVF A;  3D8P A;  1OI1 A;  3TSZ A;  2EJG A;  2X4X A;  2B86 A;  2FL4 A;  3GNF B;  3CCJ T;  5CKH A;  1KG1 A;  1XE4 A;  1QMC A;  4GBQ A;  4R56 A;  3VJP A;  4YFJ A;  1G5V A;  3VYG A;  4LN2 A;  4KRT A;  3CPX A;  2GU2 A;  4GM5 A;  4OKO A;  2CNT A;  3MCA B;  2X7B A;  2DKG A;  3QZ9 B;  1QCO A;  4M75 G;  2OZG A;  2MI6 A;  3MKD A;  1YSJ A;  4PJO E;  1C6V X;  2L3S A;  5F46 A;  1MND A;  3G6E A;  2DXB A;  4QB9 A;  3JRU A;  3OYC A;  1I5O B;  3RKY A;  1TG0 A;  3JCM c;  2BO9 A;  2BZY A;  2ANP A;  2ROT A;  2KT8 A;  4M75 D;  4C0D C;  1NZ9 A;  5D8N A;  1P92 A;  3KUF A;  2ENM A;  2XEI A;  1AWW A;  2IQ6 A;  1M4I A;  1WXB A;  3IIB A;  4NF1 A;  4R87 A;  2Q44 A;  2BUD A;  3KKW A;  4RCB A;  1VQP T;  1G3Y A;  4A4E A;  1Y7X A;  4UA3 A;  3FIF A;  2BL1 A;  3ZFJ A;  2VWF A;  2RQW A;  1K9M U;  2Q04 A;  4B12 A;  4XU1 A;  4CRI A;  2CP0 A;  4OMO A;  2CNM A;  2EYW A;  2OAU A;  3RMQ A;  2P0W A;  3D2P A;  2X3W D;  3PNW C;  2OTJ Q;  5KYN A;  4EMK B;  1VQ7 A;  4M7D C;  3N7Z A;  2KGT A;  3D7H A;  1AUG A;  4TNU A;  4R3K A;  1BIA A;  3VV0 A;  1YW6 A;  3CXS A;  1PKT A;  3R6N A;  3VS6 A;  2G3A A;  2KSS A;  4LDU A;  2H3E B;  2GCX A;  2GTO A;  2J8M A;  4M77 F;  4RTT A;  2FXF A;  1JO8 A;  3MEU A;  4BMH A;  4BAC A;  3EGD A;  2X4W A;  4M77 B;  5AG4 A;  1AEY A;  2O4H A;  2LCS A;  5HVF A;  4EMK A;  2D0Q B;  4IUV A;  2CZ7 B;  2GE3 A;  2E70 A;  4E47 A;  3SI2 A;  1VUB A;  4WJB A;  1I21 A;  4II9 A;  5EBV A;  1YFN A;  4E7S A;  3I55 A;  2RA2 A;  3M58 A;  3NTK A;  1N9R A;  3QWY A;  4MHY A;  1TOV A;  4XU3 A;  4D8D A;  2VC8 A;  3JCM g;  3CC7 A;  4CGL A;  2ZPB B;  1YNZ A;  5G21 A;  3DR8 A;  4M77 A;  4LDW A;  2IPO B;  4EIK A;  1ZHI A;  2CIJ A;  3CXC P;  3SI1 A;  4N4G A;  4J7I A;  2QAS A;  3TO6 A;  2PJ4 A;  2PNI A;  4OB1 B;  2DER A;  2CNS A;  2VI7 A;  2MF2 A;  4CGM A;  1QSO A;  2PVD B;  2Q4V A;  2PJ0 A;  4ZY1 A;  3G4S A;  1QSN A;  1K9M R;  1YIJ T;  4JXQ A;  1CKB A;  3UPU A;  2Q4Z A;  3MP1 A;  1YJW Q;  4BB7 A;  3QXE B;  3CCQ T;  2B5G B;  2YND A;  3D67 A;  4OID A;  1PNJ A;  3HHT B;  4Q36 A;  5GAO n;  2DF6 A;  1NJI U;  2QQB A;  3VKI A;  3L2V A;  1YI2 Q;  2E5Q A;  3H8Z A;  3G7Z A;  2FB7 A;  2P6F A;  4DQ2 A;  2QEC A;  4OME A;  2PSW A;  4A4K A;  5GAN e;  1M9S A;  2L89 A;  1LNX A;  1XOV A;  2Q4Y A;  1VQN Q;  1P4N A;  1VQ5 Q;  2GRE A;  3FDR A;  3QJY A;  5GAM j;  2ODF A;  4RUH A;  1M3B A;  2B5G A;  1U06 A;  3PBB A;  1KD1 U;  1IIC A;  4E8O A;  4B5P B;  1W2B S;  1AMP A;  1F2O A;  2RM4 A;  1IU8 A;  5FU7 C;  3FEE A;  4A31 A;  4IHM A;  4AFQ C;  1VYV A;  5FLX E;  5GAN g;  3LH5 A;  2RHX A;  5IV0 A;  1WX6 A;  3M56 A;  1WHH A;  2DXT A;  2DXU A;  4QVT A;  1KQS A;  4GXH A;  1NJI C;  1ZG7 A;  1N6A A;  4B5P A;  4F8Z A;  3LGL A;  5CKE A;  2KRS A;  4P45 A;  1Q2C A;  2DX1 A;  4ESR A;  1I4K 1;  3IGR A;  3OSV A;  5CBM A;  2DTH A;  4AG9 A;  4J9H A;  4IIM A;  5HH1 A;  1G3W A;  1Z5R A;  3CCJ Q;  4AXV A;  4QUS A;  4C8Q F;  2O9V A;  1RXT A;  1MMG A;  1HEE A;  2MAM A;  2BCO A;  1K73 U;  1ON0 A;  4C8Q B;  1SHF A;  4XTZ A;  1S60 A;  3QAY A;  2CP5 A;  1W70 A;  3MEW A;  4HNY B;  1WFW A;  1SF9 A;  1NJI R;  3MET A;  4BD9 A;  1GCP A;  2YNC C;  3A9L A;  3D7D A;  4KVM E;  3PGG A;  3GF5 A;  2K79 A;  2RD1 A;  1N8R U;  3GIU A;  4X2T A;  3M53 A;  3CQT A;  5CK9 A;  1MJ9 A;  2H3J A;  4ORF A;  3W6S A;  3V8L A;  1KQS P;  4A39 A;  5LRG A;  2QEX A;  1KD1 R;  4FT2 A;  4C8Q A;  3G71 Q;  5JQ4 A;  2EUI A;  3HRU A;  2B3U A;  2GNC A;  3A8L B;  1VQK T;  1VQO Q;  1YJ9 T;  1KJW A;  4JLG A;  4M7A E;  2HEQ A;  2R1I A;  1VHO A;  3B8G A;  1VQP Q;  2LP5 A;  4EWT A;  4FSS A;  3JV3 A;  1X2K A;  3OYL A;  1K73 C;  4GY5 A;  5GAN 2;  4HNX B;  1FMW A;  1RAG B;  1BYM A;  1M2V B;  2V8K A;  4ZTF A;  1NMT A;  4HVU A;  3PIP A;  4IKF A;  3PP9 A;  2PJ2 A;  2D6F A;  2ARH A;  5F47 A;  3V7Z A;  2LQK A;  1F1B B;  2KT1 A;  4OGE A;  5A0G A;  5ISV A;  2QGG A;  2Q43 A;  3VU3 C;  5BWA B;  4Y49 B;  5J1Q A;  3GP8 A;  3HUV A;  2A3L A;  2GIV A;  1RAE B;  2A4N A;  1U1S A;  4C8Q G;  4CRZ B;  2FPF A;  5GMK j;  2Q7S A;  1RAB B;  1C0M A;  1M2V A;  4CAX A;  2VUB A;  2NUT A;  1K73 R;  2DRK A;  4LXC A;  4N4H A;  4R55 A;  3GOX A;  4P4B A;  5A0L A;  4MHN A;  3JCM Q;  3HPW A;  3QDF A;  1M4D A;  2K9G A;  1N27 A;  3B7I A;  1UUE A;  3CC4 T;  1N8R R;  1IYL A;  2EVR A;  3J80 E;  2CZ0 B;  2FSR A;  3R9E A;  4HT9 A;  4J7F A;  2EYQ A;  1XJO A;  1S5K A;  3M54 A;  2PRB A;  1YP5 A;  2KXC A;  3OYD A;  1VQL T;  1LRZ A;  3SB2 A;  2ECZ A;  2RHU A;  1EFN A;  4HCZ A;  5LJ3 h;  4F16 A;  3VAT A;  1YK3 A;  4K11 A;  4C92 E;  4L89 A;  3CME A;  2WYR A;  2KYB A;  1AZE A;  1YW4 A;  3GIB A;  2MPX C;  2J6K A;  5D6W A;  2JM8 A;  1S72 T;  2XD0 A;  3DNS A;  4UCM A;  5LRJ A;  1JRI A;  2PTK A;  3FYN A;  2HL5 C;  3F8K A;  4BD3 A;  2D8J A;  1FY7 A;  4H2K A;  2ZEL A;  2C0T A;  2CKK A;  2DJZ A;  3SJF A;  4AFU C;  1PHT A;  4OLL A;  2EQK A;  1QCN A;  2G0B A;  2PR1 A;  3JCM J;  2NYQ A;  1K0X A;  3RYO A;  5HY6 A;  4R7M A;  4IIO A;  2PDO A;  2EQM A;  3CBM A;  2EGC A;  4CC3 A;  2JN0 A;  3C26 A;  4QW2 A;  3JCM b;  4DUK A;  4FYX B;  4NEX A;  1WPY A;  2J7I A;  3PZJ A;  3SJG A;  4TVR A;  3R9G A;  4JS4 A;  4M7D B;  3RDV A;  3V7S A;  2AHJ B;  4JPB W;  2M51 A;  4MHP A;  3H6Z A;  4YTL A;  1YVK A;  5ELY A;  1YHQ Q;  4AT1 B;  2I0N A;  2PR8 A;  1Q2D A;  1UGV A;  3SDZ A;  4F14 A;  4KVX A;  1X6G A;  5LYD A;  4JDS A;  2RHY A;  2AFS A;  3EFR A;  1GBQ A;  2D1X A;  1BO4 A;  1ELL P;  2O53 A;  4U9Y A;  3QSU A;  4I49 A;  2KQW A;  4A63 B;  2L3P A;  2J8R A;  3F70 A;  2AT1 B;  4JRQ A;  4FYW B;  3G6E T;  3RES A;  3KR5 A;  3GUX A;  5I21 A;  1B34 B;  3GPL A;  4MFZ A;  4DBR A;  2EJ9 A;  4FD7 A;  2VGM A;  4HCK A;  2MWP A;  1M2O A;  3PFE A;  1Z9Z A;  2AIR B;  3LMS A;  2LJ1 A;  4FU6 A;  4CS0 B;  5KYW B;  3EGX A;  1LCP A;  5LRK A;  4MCQ A;  4K3N A;  1YIJ A;  1QSM A;  2L8D A;  3VUZ A;  4UWI A;  4LD6 A;  5AG5 A;  3NH5 A;  4Z89 A;  1RI0 A;  4M7D G;  2BIV A;  3D68 A;  1X6O A;  4EMK C;  2DK3 A;  2COW A;  3BFM A;  2C6G A;  3A8O B;  1QVG A;  4XPK A;  1JB0 E;  3INZ A;  2M16 A;  3S9L A;  2Y4Y A;  2AE6 A;  1YJ9 Q;  1YWO A;  4M7D D;  1VQ7 T;  2FVU A;  2DNU A;  1TH7 A;  1IB8 A;  4QT7 A;  5C6S A;  2J05 A;  2HZY A;  4M77 C;  3GY9 A;  3JCM W;  4QQD A;  4UEF A;  1X6B A;  3VRZ A;  1OOT A;  2LDM A;  3F0A A;  3PB8 X;  1KC8 R;  2EBJ A;  4C68 A;  3TOB A;  3PB4 X;  3E19 A;  2QVP A;  3FNC A;  2ZAE A;  1XJW B;  4ZBG A;  1V1C A;  4MY0 A;  5A27 A;  2VQY A;  4ZYQ A;  3I55 T;  1QVF S;  2PVV A;  4E7Z A;  3IFE A;  4EMG A;  2M0Y A;  2PQ8 A;  1WXT A;  2AFU A;  5K8P A;  3CC7 T;  3ME9 A;  3PFO A;  1Y96 B;  3JB9 F;  1QMU A;  2ZEE A;  2LQ8 A;  2ZPH B;  4QVD A;  1U5S A;  3MJX A;  2NYS A;  4OVA A;  4E7K A;  1KUX A;  2EWN A;  1I1D A;  3B3T A;  2G6F X;  2CTC A;  3CC4 Q;  1M3A A;  1KUV A;  3H5Z A;  7AT1 B;  2ED1 A;  4PKC C;  3KR4 A;  2K3X A;  1PD1 A;  5LJ5 d;  4NJQ A;  1Y96 A;  5GAM d;  4A37 A;  5FRN A;  3FMC A;  2GFA A;  1VQL Q;  2ZOG A;  1LVK A;  3QYH B;  1FX7 A;  1TUG B;  2QA4 Q;  3FRM A;  2K3B A;  4OGC A;  2JDD A;  2PU9 B;  2X4Y A;  3KHZ A;  1YCS B;  3CBO A;  3D3S A;  4UFX A;  1ZA1 B;  4Z8A A;  1OYX A;  2IG0 A;  2DM1 A;  2XK0 A;  1S72 Q;  2GTJ A;  3C94 A;  4KOX A;  1YJN A;  1XTD A;  2QQS A;  2AK5 A;  1XEB A;  2V8G A;  1VQK A;  1HJD A;  1Q7L A;  3EFS A;  3G8W A;  4G1P A;  5FWB A;  2LQW A;  3H8F A;  1JJ2 A;  4KGV B;  2CH4 W;  3T90 A;  3JCM V;  3RAM A;  2RPN A;  4J83 A;  3IC1 A;  3CMA A;  5KYX B;  1JBM A;  1OX9 A;  4PJN A;  3GLJ A;  3C0C A;  2C06 A;  4ZY0 A;  3OYM A;  1K8A U;  2KAF A;  2B4D A;  2KYM A;  1R0C B;  2RI5 A;  3JB9 G;  4EME A;  3CPF A;  2PE3 A;  2JVV A;  4J9B A;  1U1T A;  4ME7 A;  2OOT A;  2KY9 A;  2K2M A;  1SSF A;  3OYY A;  4KH0 B;  4UIB A;  3E2U A;  3TCJ A;  3QHS A;  3L2U A;  4PLL A;  2HCK A;  2V1R A;  1QCF A;  2GQV A;  1X43 A;  3CCU A;  2VB6 A;  1Z9Q A;  3JB9 D;  3TOA A;  3ZEH A;  5KYX A;  2RC4 A;  2QQR A;  1FXX A;  3FJP A;  4LX9 A;  2FL7 A;  5A0D A;  2NMT A;  3CPA A;  3EY5 A;  4XK8 E;  2M02 A;  3PBE A;  4C8Q C;  5KE3 A;  4JRP A;  3C12 A;  2YHT A;  2A0F B;  3VAR A;  2JXB A;  2LT1 A;  4OMF B;  4PFO A;  4R6T A;  5GAN f;  4QVC A;  5K8N A;  1PSF A;  3JAM E;  3ASK A;  1VGY A;  2GQI A;  2LC4 A;  2LX7 A;  4E2F B;  3CXP A;  1K8A C;  1FT7 A;  2YRD A;  1VQ8 A;  4OC1 A;  4DA4 A;  4AB7 A;  2AZS A;  4ELZ C;  1VKC A;  3PB9 X;  3G6E Q;  2LJ3 A;  3ULR B;  3M0R A;  1KWM A;  4O23 A;  2RI3 A;  1Q82 U;  3D66 A;  1QLY A;  4OMQ A;  3RO0 A;  3U23 A;  5FWC A;  1WJR A;  2KR3 A;  2P4T A;  5GAO l;  2ZEG A;  2MK5 A;  3LGF A;  3M55 A;  2QEX T;  2DBK A;  4MXU A;  3A98 A;  2DTI A;  2QML A;  4A30 A;  3CCM A;  4A95 A;  4UBR A;  1TKH A;  1QQJ A;  2Z3P A;  3NHN A;  1EIF A;  2FE7 A;  4QQ6 A;  2E6Z A;  4LE9 A;  3CCS A;  3RBB B;  4BE0 A;  3VWE A;  1K8A R;  1EX4 A;  2RHI A;  3M5A A;  2ZEN A;  4UEZ A;  1KFZ A;  3TX8 A;  2HDA A;  2FEI A;  1Z8X A;  4NGS A;  2HAX A;  3M0P A;  4C2Z A;  4Y49 C;  4MFJ A;  3Q1J A;  2M1H A;  4JRI A;  1IGU A;  3EXN A;  1HDQ A;  3P2F A;  3IWW A;  1Q82 C;  3V8I A;  2AJ6 A;  5DS0 A;  3L2R A;  1X69 A;  3X24 B;  3TTH A;  3MP6 A;  1I07 A;  2QDL A;  4FUU A;  2G9D A;  2CT3 A;  4OML A;  3QPH A;  4J6W A;  3IEH A;  5GJV B;  1LAP A;  8ATC B;  4J9F A;  3CCV A;  3MRU A;  4L8A A;  1XMB A;  2VKN A;  1Y0Y A;  2I00 A;  1Z2L A;  2R57 A;  1ZX6 A;  1Z8T A;  3MO8 A;  4CGP A;  2Y0M A;  1BCO A;  2DIG A;  3I55 Q;  1Q82 R;  2PVO B;  2VZY A;  1D3B B;  2HQE A;  3OSS C;  1CSK A;  3VS2 A;  1KSW A;  4JJB A;  1NE9 A;  1NBE B;  2K57 A;  4VUB A;  4XAX B;  4Q5W A;  3CC7 Q;  4UCN A;  1KIK A;  3KXT A;  2DL7 A;  1ZA2 B;  2EPD A;  4ZX9 A;  2FG0 A;  5LJ5 h;  4PXD A;  2DD4 A;  5CQY A;  3RR6 A;  5GAM h;  2CSI A;  4C92 F;  3OYN A;  2R7H A;  3CDX A;  4KOV A;  3MEV A;  5JM6 A;  3V7C A;  2YGW A;  2LNV A;  4FAI A;  4FL6 A;  3IU2 A;  1D3B A;  2X35 A;  3OYA A;  3CME T;  4FWU A;  5A28 A;  4B14 A;  3G4S Q;  3WR7 A;  1VQ6 A;  3CPW A;  2GF7 A;  4XTX A;  3UF4 A;  2JTM A;  1KK7 A;  2KRO A;  1X10 A;  3PMI A;  1AWO A;  4M78 E;  1X75 C;  2PVW A;  2K6D A;  4XTU A;  2MYS A;  3KQX A;  2PJ7 A;  4L59 A;  1PCX A;  3IU1 A;  1AYE A;  2V8I A;  3A5Z B;  1YVO A;  2QI2 A;  3VS3 A;  4C92 A;  2EQI A;  3PVQ A;  4FYV B;  2HBP A;  3EGD B;  4UIA A;  5HMN A;  2XDP A;  4HVV A;  2I79 A;  2KI7 A;  4KOS A;  4HKF A;  3CXC A;  1H8K A;  4JD6 A;  5J8F A;  3A8M B;  3EFO A;  3WT4 A;  4CPA A;  2GFQ A;  2Z11 A;  3HLP A;  4BBH A;  1UWY A;  1YRE A;  5DWN A;  2EYZ A;  2BZX A;  4DEY A;  5CAI A;  3CBP A;  1BPM A;  1DE4 C;  2PRQ A;  2MIO A;  3BJ7 A;  3ISZ A;  4ANJ A;  2A7Y A;  5IXF A;  3JCM e;  2HKN A;  3CPW P;  3CCR T;  4PSW A;  4XPL A;  1M90 U;  2DE0 X;  4MMO A;  3LYI A;  2Q51 A;  3EC4 A;  2Z3N A;  1K4J A;  1K9M C;  4E6R A;  4NFR A;  1I0C A;  3P8B B;  4WCI A;  5GAN 8;  2XDD A;  1UFH A;  1RAH B;  4N4I A;  5EC7 A;  3FRN A;  1B3Q A;  5CKF A;  4PQA A;  1U8R A;  1MNE A;  3F5B A;  1SHG A;  3D7S B;  2KE9 A;  1RTQ A;  1X01 A;  2QTV A;  3CC2 A;  1XIX A;  2XHC A;  1B07 A;  4AG2 C;  5K8O A;  4ATO A;  1J3T A;  3X26 B;  4LNP A;  2KVQ G;  1AHJ B;  3VUB A;  3BDL A;  2K4Y A;  2RK1 A;  4HKE A;  3T9N A;  1RL2 A;  1CP6 A;  1M90 C;  3VH9 A;  5GCN A;  1NSL A;  2JEW A;  3M9Q A;  1FYN A;  4JXR A;  1VA7 A;  2ZPI B;  1GBR A;  4OC5 A;  5GAN j;  1LPL A;  5GMK h;  5KYU A;  3RZA A;  2QEX Q;  4NGR A;  5LJ3 d;  2Z0Z A;  3OW2 A;  1UEB A;  2M0O A;  1CX8 A;  4M77 G;  4CYN A;  2YRV A;  5IHN A;  4MCP A;  3PE0 A;  2CF4 A;  2P4R A;  3WVE B;  3M0S A;  4IUQ A;  2RB7 A;  3OYK A;  4ZGE B;  4Q7A A;  5L23 A;  2L0A A;  2QQ9 A;  4M77 D;  3R6O A;  5AT1 B;  3EH1 A;  3J7A F;  4HNW B;  1M90 R;  1OU9 A;  1QP3 A;  2DRM A;  2JMC A;  4JS5 A;  3UA6 A;  5A2Q E;  3M57 A;  1BAV A;  5EMI A;  2Z3O A;  3SJE A;  5I0C A;  2ZED A;  1M5Q 1;  3D2M A;  1OX8 A;  1WWZ A;  3GLX A;  1BI1 A;  1UGS B;  4RTW A;  3OS1 A;  1WHK A;  1M1F A;  1Y71 A;  3L42 A;  1WHM A;  1QKW A;  1CPX A;  1YBY A;  1CKA A;  1K0S A;  3C4S A;  2DO3 A;  3FB3 A;  4NGM A;  4BE2 A;  4NGT A;  4QBJ A;  3TE4 A;  2OTL A;  2DTO A;  4ZTJ A;  1PC0 A;  3H41 A;  5GAN 7;  1Z9U A;  3OW2 P;  4BDZ A;  4HT8 A;  2IMO A;  2V1Q A;  1NSA A;  5LJ5 e;  2O31 A;  3EG0 A;  2DL4 A;  1KD1 C;  2WSA A;  4MFP A;  3RNJ A;  2SEM A;  2F2V A;  1G3T A;  4J9C A;  3RUX A;  1ABQ A;  3S6H A;  4JUV A;  3REA B;  3IWG A;  3TT2 A;  1UB4 A;  2ZEH A;  3LX7 A;  3W6X A;  2ATR A;  5LJ5 g;  5HKC A;  5GAM g;  1JWQ A;  4F6A A;  1YIT A;  2IL4 A;  1M1D A;  4BE1 A;  4UFW A;  3RMS A;  5F48 A;  1BK2 A;  4ONW A;  3CME Q;  2MWO A;  4PV6 A;  3HTR A;  2XI9 A;  4L6V 5;  2D0N A;  4EVY A;  2LNH B;  3CT9 A;  3GKR A;  4PJM A;  1M8V A;  4XPD B;  4YGO A;  4J9E A;  1Q86 U;  1PUA A;  1YJN T;  4X9C A;  4MI4 A;  3I35 A;  4J3G A;  5HK3 A;  2K2V A;  4MCR A;  4KGX B;  1IGB A;  3HFN A;  1ARM A;  1BOB A;  2NSM A;  4J6X A;  3KHX A;  1NLP C;  4KUB A;  2RK2 A;  3TU4 K;  4CAV A;  2J6F A;  4O5V A;  2HV2 A;  3H8G A;  3VS7 A;  3X28 B;  3CMA T;  2J06 A;  1YJW A;  3MN8 A;  1TKJ A;  2HUZ A;  4IUP A;  4CC4 B;  2RB6 A;  2NUT B;  2X3X D;  4CGN A;  4C5G A;  1OZ2 A;  1EZZ B;  3UY5 A;  4EDU A;  4KOU A;  2DEU A;  4ELY C;  3DLL A;  2K5F A;  3V38 A;  1IGQ A;  5C82 A;  1N8R C;  2PCU A;  2PJ5 A;  3QJ6 A;  4MJ8 A;  4OP4 A;  3BLN A;  3EG3 A;  2R5M A;  3E9G A;  4M75 E;  4B9X A;  2ZW4 A;  1GCQ A;  3CCU T;  1WK4 A;  2L5Q A;  5KCO A;  1Q86 C;  3BJ8 A;  5EG2 A;  4BIN A;  4RTY A;  4ZI6 A;  1D0Z A;  2DL8 A;  2OJ2 A;  4C8Q D;  2VXK A;  1NLO C;  1JU5 C;  4FW2 A;  5M9O A;  3K9U A;  1IZ6 A;  2EIF A;  5L8R E;  4OC2 A;  4LDV A;  1KQ1 A;  4W9Y A;  5D6X A;  3E1S A;  2OZH A;  2YUN A;  3AHU A;  2CTB A;  1HXD A;  1VQ8 T;  1BI2 A;  1OZ3 A;  4RTX A;  3URG A;  3S9N A;  1Q95 G;  2Z3K A;  1CJW A;  4E2A A;  3SI0 A;  4N0A A;  2X9H A;  3HRT A;  1FMK A;  3T8W A;  1Q86 R;  2EGA A;  1Y0M A;  3B3C A;  3OS5 A;  3TQ7 P;  3HP9 A;  1GL5 A;  2Z10 A;  3LH0 A;  2X51 A;  1AVZ C;  2DL3 A;  3SD4 A;  1Z8W A;  4HXJ A;  3JSC A;  2RJF A;  3CCM T;  2PC1 A;  2QJ8 A;  2ZEO A;  5G1Z A;  1YIJ Q;  1NPP A;  1PRL C;  2LQN A;  3NA6 A;  3ER0 A;  3CCS T;  4FIB A;  3P2H A;  4C2X A;  2A28 A;  3V8J A;  2QYZ A;  3ZJ0 A;  3QDR B;  5IH2 A;  3CCQ Q;  5I4M A;  4E7L A;  2AKK A;  4LUD A;  3R95 A;  1M27 C;  1XF8 A;  1M3C A;  4NGQ A;  3OA6 A;  1KUY A;  2ATC B;  2E12 A;  2RNA A;  4KOY A;  2XG8 D;  4WF2 A;  3G71 A;  4FCY A;  4BI8 B;  1Q7Y U;  2BE9 B;  2V26 A;  3OS0 A;  1VYT A;  2XMF A;  1VQO A;  4GS4 A;  1XRY A;  3R9F A;  1IB1 E;  2EW3 A;  2ZW7 A;  2YRC A;  2ZXV A;  4UCP A;  1BCM A;  3CCV T;  1UDL A;  3RIR A;  4F17 A;  2C1C A;  2BEI A;  3NH4 A;  1ZSZ B;  3TO7 A;  2R98 A;  4X34 A;  4DBH A;  3SXN A;  1BKB A;  2FIW A;  3QZ5 B;  3CCR A;  2QYV A;  1W2B A;  2O9S A;  2PQW A;  2HD0 A;  2FYK A;  1TXQ A;  2KBT A;  4PJO F;  2OZU A;  4PSX A;  4F9V A;  1KC8 U;  2CRE A;  4Z88 A;  3J81 E;  3EGX B;  4JZ3 A;  2PJ6 A;  4KH1 B;  3S3N A;  1HK9 A;  4PJO B;  1M4Z A;  1ZSZ A;  2ZGW A;  4C92 C;  1Q7Y C;  1H8L A;  4CRY B;  4XTV A;  5GMK m;  1Y7E A;  3H8E A;  4RG2 A;  5THW A;  4LQG A;  4GLK A;  2ABL A;  3P8D A;  3OQ5 A;  2GLF A;  1MHN A;  2DLP A;  2CGH A;  2DYI A;  4M78 F;  2XID A;  1VQ6 T;  2J6O A;  3KAS A;  5JGF A;  4L5G A;  3NE7 A;  3UDC A;  4AFS C;  3VS1 A;  4AMC A;  2KDS A;  4AG7 A;  3I9S A;  4PJO A;  4M78 B;  2CSQ A;  4UEE A;  1AWX A;  1R8O B;  3CCE A;  4C5E A;  5KTD A;  3HL8 A;  1Q81 R;  1V29 B;  1S7N A;  2JMA A;  2PJB A;  4ZX8 A;  2EYY A;  2B58 A;  1GFC A;  1KC8 C;  1Y7R A;  4PXB A;  4QQG A;  1W2B P;  1Q7Y R;  5D7U A;  5IHI A;  3OY9 A;  4MFL A;  2VAS A;  1YJN Q;  2ZEP A;  2WPX A;  3VS4 A;  4KSI A;  1VQK Q;  1NEG A;  4K30 A;  1S1N A;  4M78 A;  4JLI A;  2B8A A;  1UGP B;  1L0C A;  4NL2 A;  1Q2Y A;  2YLC A;  4MZP A;  4F7U E;  4M6H A;  4X1V A;  4ONU A;  3CMA Q;  1YR0 A;  3M0U A;  3SWN A;  1D1C A;  1WYX A;  4P6Y A;  3DKM A;  2NWM A;  4PJO G;  2A37 A;  4PXC A;  2JTF A;  4RTV A;  1Y9K A;  2P0K A;  1GYT A;  3SHP A;  1SSH A;  3JCM P;  1LFW A;  4PJJ A;  1EE3 P;  2P6E A;  4H6Z A;  4A38 A;  4DOW A;  4PJO D;  2CYZ B;  2E4H A;  1SRL A;  2E6N A;  3G1J A;  4PK4 A;  3KI9 A;  3CCU Q;  4A94 A;  5GAO m;  3MPU B;  5I2S A;  2XEF A;  3JB9 J;  3CD6 A;  4M78 G;  1W1F A;  1SEM A;  2DD5 A;  3M0T A;  4B6M A;  1F57 A;  2E3I A;  4MCS A;  3CC2 T;  3QII A;  1X2Q A;  5CKD A;  2COY A;  4A4F A;  1PWT A;  3THK A;  4KUI A;  3WC6 A;  1YHQ A;  2AZV A;  3HRS A;  4RN7 A;  2M9U A;  5LJ3 e;  4KLW A;  3PTA A;  4EFD A;  3OS2 A;  3FEO A;  4LDY A;  1YLO A;  3D4U A;  3SFM A;  3L2N A;  1TS9 A;  2G3T A;  4JJD A;  3VS0 A;  3TRE A;  3B2Y A;  4IAV A;  5DM7 R;  4C7H A;  1S7L A;  2SRC A;  1D1A A;  2YUP A;  3MEA A;  3JCM f;  4CC7 A;  3NTH A;  3I56 A;  4J8O A;  2BUE A;  5LJ3 g;  1H3H A;  2DXQ A;  2K7A A;  3I3G A;  2O2O A;  1G83 A;  2YNE A;  3X20 B;  4DJL A;  3QYG B;  2EKH A;  2VXF A;  2RI2 A;  3L2Z A;  3TC8 A;  3BDU A;  2ABZ A;  3CCS Q;  2B4D B;  5GMK l;  2LZ6 B;  4R0K A;  3L2W A;  4UFV A;  5AG7 A;  1ZUK A;  4E7J A;  2CY2 A;  1P0H A;  2RQV A;  3CXC S;  5GAO r;  1NE8 A;  2ZEF A;  4WWV A;  4YU9 A;  2DA9 A;  1WI7 A;  3L2Q A;  2RJC A;  2RO0 A;  4MZT A;  2Z0W A;  2LTO A;  1ZQ1 A;  3KBG A;  3DSB A;  4B11 A;  1PYT B;  1WA7 A;  2L3Q A;  4UF4 A;  5H86 A;  1R0B G;  1GRI A;  1OUL A;  2PUK B;  1V76 A;  5GAN 5;  1R43 A;  1E7O A;  3FB9 A;  9ATC B;  3GNG A;  3MHX A;  3CCV Q;  2OTL T;  1IYK A;  1MGQ A;  3B3W A;  4NOY A;  2O4X B;  5K8M A;  3KQZ A;  2HMA A;  1VQ9 A;  2F8H A;  5C88 A;  4NJR A;  5LYI A;  3NH8 A;  2F2X A;  1BI3 A;  2R58 A;  2W0Z A;  1MJA A;  1H64 1;  2JS2 A;  3KFV A;  3FEC A;  3QB8 A;  2Z3M A;  2GBQ A;  4A54 A;  1IOF A;  3KL9 A;  1KHC A;  1TWB A;  4PJL A;  2GAN A;  2O4X A;  2AFX A;  2BE7 D;  2K5L A;  1YIT T;  2C0O A;  5FVJ A;  3OYE A;  3A8G B;  4XPD C;  2EQU A;  2QDY B;  1VQM A;  3FIX A;  3O5Z A;  1UJY A;  1M30 A;  3OYB A;  2VVK A;  1VQ6 Q;  3NTI A;  1YCY A;  4M7A F;  1IXD A;  1GFD A;  1TUC A;  4CAF A;  4HCC A;  5ECA A;  3PIO A;  3CCL A;  1GCQ C;  2POK A;  2RQT A;  3LLR A;  4M7A B;  4D8K A;  2QXF A;  1TF8 A;  2YWW A;  4OAE A;  2DEQ A;  2WSC E;  2XU8 A;  4RTZ A;  2O28 A;  3I5S A;  3M0Q A;  3JB9 I;  1YJW T;  1IHV A;  3FJ5 A;  5EC4 A;  4AFZ C;  4H89 A;  4DEX A;  2EJF A;  2QA4 A;  4A4H A;  1VQ7 Q;  4M75 F;  4MY3 A;  1YI2 T;  1HSQ A;  3FBU A;  4EMH A;  4M7A A;  2D9T A;  2OR4 A;  1UG1 A;  1JEG A;  5CNP A;  4CI0 C;  2EK8 A;  2DXC A;  1LCK A;  2HNI A;  1VQ5 T;  3D7F A;  2JTE A;  4N0A C;  1WHJ A;  1ZUU A;  5FRM A;  4TWE A;  4J5Y A;  5I2M A;  3OYJ A;  4EPC A;  2YDL A;  1KQS S;  4FD4 A;  3RBU A;  3RER A;  1LOJ A;  4MZM A;  2JLM A;  1GXI E;  3I5R A;  4JJX A;  5GAN h;  3L1A A;  2V8D A;  5IAY A;  3BXM A;  4KOT A;  1VQ4 A;  4M75 A;  1CP7 A;  1RAF B;  3MP8 A;  4P4D A;  4PK3 A;  3ISX A;  1M44 A;  2RFH A;  4CGO A;  5IHK A;  4M7A G;  5DY9 A;  3FLG A;  2C27 A;  1IID A;  4C0F A;  2E65 A;  3CC2 Q;  4M7D E;  4NXY A;  5AYF A;  5HK0 A;  1OZP A;  4FM4 B;  4M7A D;  1MUZ A;  2WUU A;  1SQH A;  4F0X A;  2ZZD A;  2PJC A;  3UT1 A;  1HD3 A;  4OMP A;  2E64 A;  3PRT A;  3PGP A;  4JRK A;  4C92 B;  4U5Y A;  2CP6 A;  2DPT A;  2RQR A;  2R8V A;  2Y4X A;  3OB9 A;  2IJZ A;  1W4S A;  5GAN 3;  1A0N B;  3RNZ A;  1SRM A;  3I1U A;  5IT9 E;  1ZLM A;  4IK2 A;  3KZW A;  3EFO B;  2NUP A;  3K9T A;  4DOV A;  2DZ9 A;  2FZC B;  5J39 A;  1MMD A;  3G3S A;  4KOR A;  3EAE A;  5HCK A;  4PFZ A;  4YRH A;  1BB9 A;  3TFY A;  3E0K A;  4NS5 A;  1AZG B;  4C0G A;  3BY7 A;  1UGR B;  4O6J A;  2FRY A;  3G71 T;  2EAY A;  1BIB A;  2OX7 A;  1FNO A;  3ZZI A;  1VOM A;  2IIM A;  2LCC A;  4B13 A;  1VQO T;  1KHI A;  5KTC A;  3N5B B;  4AVC A;  1ZSZ C;  1RI9 A;  4BUG A;  1Y9W A;  2QAZ A;  4P44 A;  2DIQ A;  4OC0 A;  3C95 A;  1QVF P;  1TF9 A;  1KZF A;  1NPR A;  3DB4 A;  3HSB A;  4J6Y A;  2ZPF B;  2PVG B;  4E7I A;  3TCV A;  1RLP C;  2F5I A;  4FD5 A;  2PZ1 A;  1YX0 A;  2VBQ A;  3GB0 A;  2ROL A;  3ZL7 C;  1XMT A;  5CCA A;  4E0A A;  1ZBX A;  3DLJ A;  4C92 G;  1JXO A;  4PJO C;  1Y57 A;  3M4Y A;  1OEB A;  2OTL Q;  2CUD A;  4BY6 B;  2Y90 A;  1PKS A;  4OC3 A;  3FJU A;  1JQG A;  2AKL A;  4C92 D;  2O88 A;  5KE2 A;  4B5O A;  3NE8 A;  1TSF A;  3VRY A;  1PM3 A;  2HQH A;  2P0P A;  3EG1 A;  1ZUY A;  1WHL A;  5KYU B;  3IO1 A;  4X8I A;  1ZLH A;  1IHW A;  4Q38 A;  4M78 C;  5GAN 6;  2XIC A;  4FBE A;  3IJ3 A;  4ZN1 A;  1ARL A;  2EO8 A;  3OYF A;  1W6X A;  4J9I A;  3QO3 A;  2EVN A;  3SWN C;  3CCE T;  1YIT Q;  1I8F A;  4ZGJ B;  3OBW A;  5KYY B;  3WC7 A;  1E6G A;  1M1K U;  3DR6 A;  1MJB A;  3QBY A;  3WVD B;  3FVL A;  2CP3 A;  1Y07 A;  2DIL A;  2HL3 A;  5GAN 4;  1WGS A;  4BI4 A;  3JTK A;  4KLV A;  1QWF A;  3UA7 A;  2J8N A;  2PJ3 A;  1WIE A;  8CPA A;  1N5Z A;  4A4G A;  5F49 A;  4F7U F;  3REB B;  4OC4 A;  4KUA A;  4C0Z A;  3QWX X;  4AVA A;  2JBJ A;  4P4J A;  2AFM A;  2DPS A;  2KNB B;  5KYY A;  2XEJ A;  4F7U B;  3OWC A;  4H6U A;  1O75 A;  3EHR A;  4KSA A;  4F9U A;  2JUF A;  3VS5 A;  3GBQ A;  1WLP B;  2FT0 A;  2FHD A;  2HBW A;  1U3O A;  3TSW A;  4M6G A;  4KT0 E;  2E3H A;  2W10 A;  1M1K C;  3LOD A;  2DYB A;  4HPS A;  2PUO B;  2RH2 A;  4R76 A;  1K76 A;  2L3R A;  1RAD B;  5J26 A;  4F7U A;  2F7V A;  4MBU A;  3CZX A;  5JH9 A;  2OTJ A;  5LJ5 j;  5LL6 S;  4B9W A;  2JM9 A;  2HSP A;  4LUE A;  3CD6 T;  1LJO A;  1WNL A;  1WQ7 A;  1YGH A;  1DTD A;  2JT4 A;  1IRX A;  4JWP A;  1YQE A;  4DBQ A;  3B3S A;  5LYL A;  2FZK B;  1IO6 A;  2PJA A;  1HYO A;  5GAM e;  2X4J A;  2PIZ A;  1IRE B;  1G2B A;  4RTU A;  3EGU A;  1YHQ T;  1M1K R;  3OBY A;  1ZG9 A;  3WAB A;  3EHQ A;  2ZW6 A;  4PK2 A;  1LOK A;  3H0H A;  1X27 A;  1XFO A;  4F7U G;  1MMN A;  3HKS A;  2E10 A;  4JJC A;  1QWE A;  1XBU A;  4D6W A;  3LWU A;  1I81 A;  2MMP A;  3GYA A;  2YUO A;  5CQX A;  4Z02 A;  3I56 T;  2QQA A;  2JDC A;  2V8J A;  2LVM A;  2DVE A;  1OQK A;  3B3V A;  3BI1 A;  3EO4 A;  5DLO A;  3OYH A;  3JRZ A;  5FU6 B;  2DL5 A;  4NGN A;  4R9M A;  2DJQ A;  2ZOF A;  2P6G A;  4IUS A;  1QVG S;  4E7H A;  3B35 A;  5CO7 A;  2KMT A;  1AT1 B;  2ED0 A;  1BLL E;  3D7G A;  1QST A;  4A33 A;  2CT4 A;  5G20 A;  1Y0R A;  2H5M A;  1TU0 B;  5LJ3 f;  1YI2 A;  3H0I A;  2K5T A;  2HQY A;  2CUB A;  1VQN A;  4R57 A;  2DPP B;  1VQ5 A;  3T9Y A;  2DFU A;  3PB7 X;  2VGN A;  3H9N A;  3RKX A;  3MGD A;  1J4J A;  4OB0 B;  5FRO A;  1VIF A;  3NPF A;  2FZG B;  4A32 A;  4QKU A;  4YWY A;  1RAI B;  1TXR A;  2GFU A;  1VQ9 T;  2L2P A;  3N5F A;  2VXE A;  4J9D A;  4XNH B;  1VIE A;  3UWN A;  3CCR Q;  3BE3 A;  4MHZ A;  4MFK A;  2K5I A;  1YLE A;  4FD6 A;  2P0Q A;  2MCN A;  2HB6 A;  3W91 A;  4A53 A;  4LUA A;  4KSF A;  3JCM X;  3KGQ A;  1UJ0 A;  1B6B A;  4NGP A;  1T0J A;  1WDX A;  2P84 A;  4HVW A;  1YME A;  1NYG A;  2QG9 B;  1UFF A;  3IWE A;  3OYG A;  1VYU A;  4F04 B;  1WJQ A;  2MOX A;  4IUR A;  4QC6 A;  1D09 B;  4KZT A;  4OB3 B;  4CAW A;  3QAH A;  1VQM T;  1UHF A;  1KQ2 A;  1G8X A;  2VYT A;  1C1A A;  3FC3 A;  1PU9 A;  3NGP A;  5GMK i;  1U6M A;  1R57 A;  5GMK e;  4M7A C;  3SXO A;  3PB6 X;  3CCJ A;  2F2W A;  2WZN A;  2BSW A;  5GAO p;  4HCB A;  3V8K A;  3CCL T;  2F1L A;  4DBF A;  2J9A A;  5KTA A;  1S7K A;  3CCE Q;  1PD0 A;  3BW1 A;  1LAN A;  2XKO C;  2FCK A;  4KVO E;  2WSE E;  1JQQ A;  2E1H A;  2QTX A;  2CS7 A;  2FPD A;  4BDY A;  5JPH A;  2QGF B;  3S6K A;  2QA4 T;  3PFS A;  1VIX A;  2EFI A;  3AT1 B;  4M75 C;  1T0H A;  1JJ2 S;  2KCW A;  1QVP A;  4Y92 A;  1Q81 U;  2YXY A;  4V2S A;  2EKO A;  3LWH A;  2NUZ A;  4MRI A;  4JYW A;  2Z3L A;  1UE9 A;  1S3Z A;  2C0I A;  4C0D B;  3VWD A;  5DLQ E;  3LW5 E;  2JZ2 A;  1R3N A;  4F0Y A;  1TKF A;  3BI0 A;  1VQP A;  1YWP A;  5E96 A;  4IUU A;  2D4P A;  2KK4 A;  4JZ0 A;  4KBM B;  1RLQ C;  2YLB A;  2FS5 A;  1D1B A;  4X3R A;  2JW4 A;  1VHE A;  2ZPA A;  2EWB A;  4FW1 A;  1VQ4 T;  5CPA A;  4MFQ A;  2Q7B A;  3LD2 A;  2CZ6 B;  2EGE A;  2FO0 A;  1MV3 A;  1GHE A;  1ZBJ A;  4M7D F;  4PFP A;  3CD6 Q;  1CM0 A;  1ZSG A;  2I2L A;  2OAW A;  2DEA A;  1OU8 A;  1XNI A;  3ZBD A;  4ZN3 A;  1Q81 C;  4FSX A;  1I1J A;  3WC5 A;  2FPE A;  1PG5 B;  2V8V A;  4CC2 A;  2CDT A;  1ACM B;  1FWZ A;  3M4G A;  1OPL A;  4XTW A;  3WXM B;  5D29 A;  1Z4R A;  4M77 E;  2ZPE B;  1Z8L A;  1T3L A;  1AOJ A;  3NFZ A;  1UEC A;  3EG9 B;  3QNV A;  2E5K A;  5IN1 A;  3FED A;  3S6W A;  2LRQ A;  5F09 A;  1H92 A;  2EBP A;  6AT1 B;  2H8H A;  1CG2 A;  4PXE A;  1TUD A;  1BBZ A;  1V0C A;  2FVG A;  3SHW A;  4M7D A;  2AFO A;  4B10 A;  1QSR A;  3JCM d;  4P5N A;  3EFA A;  2F69 A;  3HFO A;  4KOW A;  3I56 Q;  7CPA A;  2HQX A;  3SWN B;  3FXT A;  2YT6 A;  4IUT A;  3EG9 A;  4RG8 A;  3TO9 A;  2Q0Y A;  5D6Y A;  1A2Z A;  4Y28 E;  2VV5 A;  2EQJ A;  4HA8 A;  2ZW5 A;  4C5I A;  2O01 E;  4RCC A;  4CYQ A;  3DLM A;  2BTT A;  2G3R A;  3S3O A;  2DMO A;  5DWM A;  3NMZ C;  2CP7 A;  1WJS A;  4M4Z A;  2D8H A;  4LDX A;  5G22 A;  3CCQ A;  1B34 A;  1T3S A; 
#chains in the Genus database with same CATH homology
 3EG2 A;  3IQL A;  1DJ7 B;  2RMO A;  2A36 A;  4XU0 A;  4MDX A;  3VYH B;  2LMJ A;  1JXM A;  1ARK A;  3X25 B;  4BY6 C;  1AD5 A;  4RMO A;  1K9A A;  1NYF A;  3I9Q A;  1PRM C;  2DBM A;  2GGR A;  4ORZ A;  4LD9 K;  4GLM A;  5LJ3 j;  5GAN d;  4AG1 C;  2RJE A;  1M8M A;  4BI3 A;  5I11 A;  4M78 D;  1BU1 A;  5FU7 B;  5CR2 A;  4MDW A;  3S3M A;  4LQ6 A;  2CH4 A;  2RQU A;  4Y91 A;  4OF1 A;  4OP0 A;  1UGQ B;  4PNO A;  2KRM A;  3CPW S;  5GJW B;  2JNG A;  4PL6 A;  4MML A;  2JS0 A;  4MMK A;  3M59 A;  1YN8 A;  1G3S A;  3UAT A;  4XQ3 A;  2ZCF B;  2OI3 A;  2RJD A;  4RKU E;  2KXD A;  3PMT A;  3G4S T;  4C8Q E;  1O9S A;  1RUW A;  5FW9 A;  5KCH A;  4ZNX A;  2LJ0 A;  4XU2 A;  5KH6 A;  2LCL A;  4C5H A;  1PSE A;  1WXU A;  3RKW A;  1OV3 A;  5J3B A;  1UHC A;  2RN8 A;  1AWJ A;  2ESW A;  1SPK A;  3O8V A;  3P8H A;  1OPK A;  2WSF E;  3V7R A;  3NFC A;  2OTJ T;  3SEM A;  1YJ9 A;  1E6H A;  3H0F A;  1NG2 A;  2F5T X;  2DZC A;  2R5A A;  3OMG A;  4FT4 A;  2BZ8 A;  4QVZ A;  1I5L A;  2FRW A;  5C0M A;  5CKB A;  5I22 A;  2EYX A;  4NL3 A;  2ZPG B;  2WAC A;  2XDB A;  3TVT A;  1ABO A;  2BKD N;  1MV0 B;  3PT9 A;  1K4U S;  1UTI A;  4OMN A;  1XQH A;  2KRN A;  4OMM A;  3JCM h;  3QG1 A;  2RHZ A;  5FU6 C;  2A08 A;  4JJN K;  4PLI A;  3QKJ A;  3JB9 H;  4RUG A;  3CC4 A;  1NEB A;  3OW2 S;  5CVI A;  3QUI A;  4ZGD B;  1M1G A;  1QW1 A;  3LWI A;  2F5K A;  3OYI A;  1QKX A;  3DB3 A;  4J9G A;  5GAO q;  5LJ5 f;  1VQL A;  5GAM f;  2YUQ A;  2LX9 A;  2DVJ A;  3PVL A;  2NLU A;  2RF0 A;  4X9D A;  4XTY A;  2YSQ A;  5CIU A;  3CEY A;  4JZ4 A;  3OMC A;  1S72 A;  2IVW A;  3A8H B;  4M75 B;  1VQN T;  4M6I A;  1WQW A;  1NM7 A;  4KUD K;  2LT4 A;  2E41 A;  2CZ1 B;  2HC9 A;  4II1 A;  1QP2 A;  1N9S A;  1K1Z A;  4OB2 B;  1BI0 A;  2K3Y A;  5IXB A;  1H3Z A;  4UC4 A;  3TEE A;  2DAQ A;  3E9F A;  2KEA A;  2JOY A;  4KUL A;  1QVF A;  1OI1 A;  3TSZ A;  2EJG A;  2X4X A;  2B86 A;  3GNF B;  3CCJ T;  5CKH A;  1KG1 A;  4GBQ A;  4R56 A;  3VJP A;  1G5V A;  3VYG A;  4LN2 A;  4KRT A;  3MCA B;  2DKG A;  3QZ9 B;  4M75 G;  2MI6 A;  4PJO E;  2L3S A;  3G6E A;  2DXB A;  3OYC A;  3RKY A;  1TG0 A;  3JCM c;  2BZY A;  2ROT A;  2KT8 A;  4M75 D;  4C0D C;  1NZ9 A;  1P92 A;  3KUF A;  2ENM A;  1AWW A;  1WXB A;  2BUD A;  4RCB A;  1VQP T;  1G3Y A;  4A4E A;  1Y7X A;  3FIF A;  3ZFJ A;  2VWF A;  2RQW A;  1K9M U;  4XU1 A;  4CRI A;  4OMO A;  2EYW A;  2OAU A;  3RMQ A;  2X3W D;  3PNW C;  4EMK B;  1VQ7 A;  4M7D C;  2KGT A;  1BIA A;  3VV0 A;  1PKT A;  3R6N A;  3VS6 A;  2KSS A;  4LDU A;  2GTO A;  2GCX A;  4M77 F;  4RTT A;  1JO8 A;  3MEU A;  4BAC A;  2X4W A;  4M77 B;  1AEY A;  2LCS A;  4EMK A;  2D0Q B;  4IUV A;  2CZ7 B;  2E70 A;  4E47 A;  1VUB A;  3I55 A;  2RA2 A;  3M58 A;  3NTK A;  1N9R A;  3QWY A;  4XU3 A;  4D8D A;  2VC8 A;  3JCM g;  3CC7 A;  2ZPB B;  1YNZ A;  4M77 A;  4LDW A;  4EIK A;  1ZHI A;  4N4G A;  4J7I A;  2PNI A;  4OB1 B;  2MF2 A;  2PVD B;  3G4S A;  1YIJ T;  1CKB A;  3UPU A;  3MP1 A;  4BB7 A;  3QXE B;  3CCQ T;  1PNJ A;  3HHT B;  5GAO n;  2DF6 A;  1NJI U;  2QQB A;  3VKI A;  3L2V A;  2E5Q A;  3H8Z A;  3G7Z A;  2FB7 A;  4DQ2 A;  4A4K A;  5GAN e;  1M9S A;  2L89 A;  1LNX A;  1XOV A;  3FDR A;  3QJY A;  5GAM j;  2ODF A;  1M3B A;  1U06 A;  1KD1 U;  1W2B S;  2RM4 A;  5FU7 C;  4AFQ C;  1VYV A;  5FLX E;  5GAN g;  3LH5 A;  2RHX A;  1WX6 A;  3M56 A;  2DXT A;  2DXU A;  1KQS A;  1NJI C;  1N6A A;  3LGL A;  5CKE A;  2KRS A;  2DX1 A;  4ESR A;  1I4K 1;  3OSV A;  2DTH A;  4J9H A;  4IIM A;  1G3W A;  4C8Q F;  2O9V A;  2MAM A;  1K73 U;  4C8Q B;  1SHF A;  4XTZ A;  3QAY A;  1W70 A;  3MEW A;  1WFW A;  3MET A;  1GCP A;  3PGG A;  3GF5 A;  2K79 A;  2RD1 A;  1N8R U;  3M53 A;  3CQT A;  5CK9 A;  2H3J A;  3V8L A;  2QEX A;  4FT2 A;  4C8Q A;  3HRU A;  2GNC A;  3A8L B;  1VQK T;  1YJ9 T;  1KJW A;  4JLG A;  4M7A E;  2HEQ A;  2LP5 A;  4FSS A;  3JV3 A;  1X2K A;  3OYL A;  1K73 C;  4GY5 A;  5GAN 2;  1BYM A;  2V8K A;  4ZTF A;  4HVU A;  3PIP A;  4IKF A;  2D6F A;  2LQK A;  2KT1 A;  4OGE A;  5A0G A;  3VU3 C;  3GP8 A;  2A3L A;  1U1S A;  4C8Q G;  2FPF A;  5GMK j;  2Q7S A;  2VUB A;  2DRK A;  4N4H A;  4R55 A;  3GOX A;  5A0L A;  3JCM Q;  3HPW A;  2K9G A;  1N27 A;  1UUE A;  3CC4 T;  2EVR A;  3J80 E;  2CZ0 B;  4HT9 A;  4J7F A;  2EYQ A;  3M54 A;  1YP5 A;  2KXC A;  3OYD A;  1VQL T;  3SB2 A;  2ECZ A;  2RHU A;  1EFN A;  4F16 A;  4HCZ A;  5LJ3 h;  4K11 A;  4C92 E;  3CME A;  2KYB A;  1AZE A;  3GIB A;  2J6K A;  5D6W A;  2JM8 A;  1S72 T;  2XD0 A;  2PTK A;  1JRI A;  4BD3 A;  2D8J A;  2C0T A;  2CKK A;  2DJZ A;  4AFU C;  1PHT A;  2EQK A;  3JCM J;  1K0X A;  5HY6 A;  4IIO A;  2EQM A;  3CBM A;  2EGC A;  4CC3 A;  2JN0 A;  4QW2 A;  3JCM b;  1WPY A;  2J7I A;  4TVR A;  4JS4 A;  4M7D B;  3V7S A;  2AHJ B;  4JPB W;  2M51 A;  3H6Z A;  4YTL A;  2I0N A;  1UGV A;  4F14 A;  3SDZ A;  1X6G A;  4JDS A;  2RHY A;  3EFR A;  1GBQ A;  2D1X A;  3QSU A;  4A63 B;  2KQW A;  2L3P A;  3F70 A;  4JRQ A;  3G6E T;  3RES A;  5I21 A;  1B34 B;  3GPL A;  2EJ9 A;  2VGM A;  4HCK A;  2MWP A;  1Z9Z A;  2LJ1 A;  4FU6 A;  1YIJ A;  2L8D A;  3VUZ A;  4LD6 A;  4Z89 A;  1RI0 A;  4M7D G;  2BIV A;  1X6O A;  4EMK C;  2DK3 A;  3BFM A;  3A8O B;  1QVG A;  1JB0 E;  3INZ A;  2M16 A;  2Y4Y A;  4M7D D;  1YWO A;  1VQ7 T;  2FVU A;  2DNU A;  1TH7 A;  4QT7 A;  5C6S A;  2J05 A;  4M77 C;  3JCM W;  4QQD A;  1X6B A;  3VRZ A;  1OOT A;  2LDM A;  3E19 A;  1V1C A;  3I55 T;  1QVF S;  4EMG A;  2M0Y A;  1WXT A;  3CC7 T;  3ME9 A;  1Y96 B;  3JB9 F;  2LQ8 A;  2ZPH B;  4QVD A;  1U5S A;  4OVA A;  4E7K A;  2EWN A;  2G6F X;  1M3A A;  2ED1 A;  4PKC C;  2K3X A;  5LJ5 d;  1Y96 A;  5GAM d;  5FRN A;  2GFA A;  3QYH B;  1FX7 A;  2K3B A;  4OGC A;  2PU9 B;  2X4Y A;  1YCS B;  3CBO A;  4Z8A A;  1OYX A;  2IG0 A;  2DM1 A;  2XK0 A;  2GTJ A;  3C94 A;  1YJN A;  1XTD A;  2QQS A;  2AK5 A;  1HJD A;  1VQK A;  3EFS A;  5FWB A;  2LQW A;  1JJ2 A;  2CH4 W;  3JCM V;  2RPN A;  4J83 A;  3CMA A;  1JBM A;  3C0C A;  2C06 A;  3OYM A;  1K8A U;  2KAF A;  2KYM A;  2RI5 A;  3JB9 G;  3CPF A;  2JVV A;  4J9B A;  1U1T A;  4ME7 A;  2KY9 A;  2K2M A;  1SSF A;  3OYY A;  3TCJ A;  3QHS A;  3L2U A;  4PLL A;  2HCK A;  2V1R A;  1QCF A;  2GQV A;  1X43 A;  3CCU A;  3JB9 D;  1Z9Q A;  3ZEH A;  2QQR A;  1FXX A;  3FJP A;  2FL7 A;  5A0D A;  4XK8 E;  4C8Q C;  5KE3 A;  4JRP A;  3C12 A;  2YHT A;  2JXB A;  2LT1 A;  4OMF B;  5GAN f;  4QVC A;  1PSF A;  3JAM E;  3ASK A;  2GQI A;  2LX7 A;  2LC4 A;  1K8A C;  1VQ8 A;  4DA4 A;  2AZS A;  4ELZ C;  2LJ3 A;  3ULR B;  3M0R A;  2RI3 A;  1Q82 U;  1QLY A;  4OMQ A;  3U23 A;  5FWC A;  1WJR A;  2KR3 A;  2P4T A;  5GAO l;  3M55 A;  3LGF A;  2QEX T;  2DBK A;  3A98 A;  2DTI A;  3CCM A;  3NHN A;  1EIF A;  4QQ6 A;  2E6Z A;  4LE9 A;  3CCS A;  3RBB B;  4BE0 A;  2RHI A;  3M5A A;  1KFZ A;  2HDA A;  2FEI A;  2HAX A;  3M0P A;  3Q1J A;  2M1H A;  4JRI A;  1Q82 C;  3L2R A;  1X69 A;  3X24 B;  3MP6 A;  1I07 A;  2QDL A;  2CT3 A;  4OML A;  3QPH A;  4J6W A;  5GJV B;  4J9F A;  3CCV A;  2VKN A;  2R57 A;  1ZX6 A;  3MO8 A;  2DIG A;  2PVO B;  1D3B B;  2HQE A;  3OSS C;  1CSK A;  3VS2 A;  1KSW A;  4JJB A;  4VUB A;  2K57 A;  4XAX B;  4Q5W A;  1KIK A;  3KXT A;  2DL7 A;  2EPD A;  2FG0 A;  5LJ5 h;  2DD4 A;  5CQY A;  5GAM h;  2CSI A;  4C92 F;  3OYN A;  3MEV A;  3V7C A;  2LNV A;  4FL6 A;  1D3B A;  2X35 A;  3OYA A;  3CME T;  1VQ6 A;  3CPW A;  2GF7 A;  4XTX A;  3UF4 A;  2JTM A;  2KRO A;  3PMI A;  1AWO A;  4M78 E;  1X75 C;  2K6D A;  4XTU A;  4L59 A;  2V8I A;  3A5Z B;  2QI2 A;  3VS3 A;  4C92 A;  2EQI A;  3PVQ A;  2HBP A;  2XDP A;  4HVV A;  3CXC A;  1H8K A;  3A8M B;  2EYZ A;  2BZX A;  4DEY A;  5CAI A;  3CBP A;  2MIO A;  2A7Y A;  5IXF A;  3JCM e;  3CCR T;  1M90 U;  2DE0 X;  3LYI A;  1K9M C;  4E6R A;  1I0C A;  4WCI A;  3P8B B;  5GAN 8;  2XDD A;  5EC7 A;  4N4I A;  3FRN A;  1B3Q A;  5CKF A;  1U8R A;  1SHG A;  2KE9 A;  1X01 A;  3CC2 A;  2XHC A;  1B07 A;  4AG2 C;  4ATO A;  1J3T A;  3X26 B;  4LNP A;  2KVQ G;  1AHJ B;  3VUB A;  3BDL A;  2K4Y A;  2RK1 A;  4HKE A;  3T9N A;  1RL2 A;  1M90 C;  3M9Q A;  1FYN A;  1VA7 A;  2ZPI B;  1GBR A;  5GAN j;  5GMK h;  5LJ3 d;  3OW2 A;  1UEB A;  2M0O A;  4M77 G;  2YRV A;  5IHN A;  3PE0 A;  2P4R A;  3WVE B;  3M0S A;  4IUQ A;  3OYK A;  4ZGE B;  5L23 A;  2L0A A;  2QQ9 A;  4M77 D;  3R6O A;  3J7A F;  1QP3 A;  2DRM A;  2JMC A;  4JS5 A;  3UA6 A;  5A2Q E;  3M57 A;  5EMI A;  1M5Q 1;  3GLX A;  1BI1 A;  1UGS B;  4RTW A;  3OS1 A;  1M1F A;  1Y71 A;  3L42 A;  1QKW A;  1YBY A;  1CKA A;  1K0S A;  3C4S A;  2DO3 A;  4BE2 A;  2OTL A;  2DTO A;  4ZTJ A;  3H41 A;  5GAN 7;  4BDZ A;  4HT8 A;  2V1Q A;  5LJ5 e;  2O31 A;  3EG0 A;  2DL4 A;  1KD1 C;  3RNJ A;  2SEM A;  2F2V A;  1G3T A;  4J9C A;  3RUX A;  1ABQ A;  4JUV A;  3REA B;  1UB4 A;  3LX7 A;  5LJ5 g;  5HKC A;  5GAM g;  1JWQ A;  1YIT A;  4BE1 A;  3RMS A;  1BK2 A;  2MWO A;  2XI9 A;  4L6V 5;  2D0N A;  2LNH B;  1M8V A;  4J9E A;  1Q86 U;  1YJN T;  4X9C A;  3I35 A;  5HK3 A;  2K2V A;  3HFN A;  4J6X A;  1NLP C;  2RK2 A;  3TU4 K;  2J6F A;  4O5V A;  3VS7 A;  3X28 B;  3CMA T;  2J06 A;  1YJW A;  4CC4 B;  4IUP A;  2RB6 A;  2X3X D;  4C5G A;  1OZ2 A;  4EDU A;  4ELY C;  3DLL A;  2K5F A;  1N8R C;  3QJ6 A;  3EG3 A;  2R5M A;  3E9G A;  4M75 E;  4B9X A;  1GCQ A;  3CCU T;  2L5Q A;  5KCO A;  1Q86 C;  5EG2 A;  4BIN A;  4RTY A;  2DL8 A;  2OJ2 A;  4C8Q D;  1NLO C;  1JU5 C;  5M9O A;  1IZ6 A;  2EIF A;  5L8R E;  4LDV A;  1KQ1 A;  5D6X A;  3E1S A;  2YUN A;  3AHU A;  1HXD A;  1VQ8 T;  1BI2 A;  1OZ3 A;  4RTX A;  3URG A;  4N0A A;  3HRT A;  1FMK A;  2EGA A;  1Y0M A;  3OS5 A;  3HP9 A;  1GL5 A;  3LH0 A;  1AVZ C;  2DL3 A;  3SD4 A;  4HXJ A;  3JSC A;  2RJF A;  3CCM T;  1NPP A;  1PRL C;  2LQN A;  3ER0 A;  3CCS T;  4FIB A;  2A28 A;  3V8J A;  3QDR B;  5IH2 A;  4E7L A;  2AKK A;  4LUD A;  1M27 C;  1M3C A;  3OA6 A;  2E12 A;  2RNA A;  2XG8 D;  4WF2 A;  3G71 A;  4BI8 B;  1Q7Y U;  3OS0 A;  1VYT A;  2XMF A;  1VQO A;  2EW3 A;  3CCV T;  1UDL A;  3RIR A;  4F17 A;  4X34 A;  1BKB A;  3QZ5 B;  3CCR A;  1W2B A;  2O9S A;  2PQW A;  2HD0 A;  2FYK A;  2KBT A;  4PJO F;  1KC8 U;  2CRE A;  4Z88 A;  3J81 E;  4JZ3 A;  3S3N A;  1HK9 A;  4PJO B;  1M4Z A;  2ZGW A;  4C92 C;  1Q7Y C;  4XTV A;  5GMK m;  4RG2 A;  4GLK A;  2ABL A;  3P8D A;  3OQ5 A;  1MHN A;  2DLP A;  2CGH A;  4M78 F;  2XID A;  1VQ6 T;  2J6O A;  4L5G A;  4AFS C;  3UDC A;  3VS1 A;  2KDS A;  4PJO A;  4M78 B;  2CSQ A;  1AWX A;  1R8O B;  3CCE A;  4C5E A;  3HL8 A;  1V29 B;  2JMA A;  2EYY A;  1GFC A;  1KC8 C;  4QQG A;  5IHI A;  3OY9 A;  3VS4 A;  1NEG A;  1S1N A;  4M78 A;  4JLI A;  2B8A A;  1UGP B;  4NL2 A;  2YLC A;  4MZP A;  4F7U E;  4M6H A;  4X1V A;  3M0U A;  3SWN A;  1WYX A;  3DKM A;  2NWM A;  4PJO G;  2A37 A;  4RTV A;  2JTF A;  2P0K A;  1SSH A;  3JCM P;  4DOW A;  4PJO D;  2CYZ B;  2E6N A;  1SRL A;  5GAO m;  5I2S A;  3JB9 J;  3CD6 A;  4M78 G;  1W1F A;  1SEM A;  2DD5 A;  3M0T A;  3CC2 T;  3QII A;  1X2Q A;  5CKD A;  4A4F A;  1PWT A;  3THK A;  4KUI A;  1YHQ A;  2AZV A;  3HRS A;  4RN7 A;  2M9U A;  5LJ3 e;  3PTA A;  4EFD A;  3OS2 A;  3FEO A;  4LDY A;  3SFM A;  4JJD A;  3VS0 A;  3TRE A;  5DM7 R;  2SRC A;  3MEA A;  2YUP A;  4CC7 A;  3JCM f;  3NTH A;  3I56 A;  4J8O A;  1H3H A;  5LJ3 g;  2K7A A;  2O2O A;  1G83 A;  3X20 B;  3QYG B;  2EKH A;  2VXF A;  2RI2 A;  3L2Z A;  3BDU A;  5GMK l;  2LZ6 B;  4R0K A;  3L2W A;  1ZUK A;  4E7J A;  2RQV A;  3CXC S;  5GAO r;  1NE8 A;  2DA9 A;  1WI7 A;  3L2Q A;  2RJC A;  2RO0 A;  4MZT A;  2LTO A;  1ZQ1 A;  3KBG A;  1WA7 A;  2L3Q A;  1GRI A;  2PUK B;  5GAN 5;  1E7O A;  3FB9 A;  3GNG A;  3MHX A;  2OTL T;  1MGQ A;  4NOY A;  2O4X B;  1VQ9 A;  2F2X A;  1BI3 A;  2R58 A;  2W0Z A;  1H64 1;  2JS2 A;  3KFV A;  2GBQ A;  4A54 A;  1KHC A;  2O4X A;  2K5L A;  1YIT T;  2C0O A;  3OYE A;  3A8G B;  2EQU A;  2QDY B;  1VQM A;  3O5Z A;  1UJY A;  1M30 A;  3OYB A;  2VVK A;  3NTI A;  1YCY A;  4M7A F;  1GFD A;  1TUC A;  4HCC A;  5ECA A;  3PIO A;  3CCL A;  1GCQ C;  2RQT A;  4D8K A;  3LLR A;  4M7A B;  2QXF A;  2DEQ A;  2WSC E;  4RTZ A;  2XU8 A;  3I5S A;  3M0Q A;  3JB9 I;  1YJW T;  3FJ5 A;  4AFZ C;  4DEX A;  2EJF A;  2QA4 A;  4A4H A;  4M75 F;  1YI2 T;  1HSQ A;  4EMH A;  4M7A A;  2D9T A;  1UG1 A;  1JEG A;  4CI0 C;  2DXC A;  1LCK A;  2HNI A;  1VQ5 T;  2JTE A;  4N0A C;  1ZUU A;  5FRM A;  4J5Y A;  5I2M A;  3OYJ A;  4EPC A;  2YDL A;  1KQS S;  3RER A;  1LOJ A;  4MZM A;  1GXI E;  3I5R A;  5GAN h;  3L1A A;  5IAY A;  1VQ4 A;  4M75 A;  3MP8 A;  5IHK A;  4M7A G;  5DY9 A;  3FLG A;  4C0F A;  2E65 A;  4M7D E;  5AYF A;  5HK0 A;  4FM4 B;  4M7A D;  1MUZ A;  2ZZD A;  3UT1 A;  1HD3 A;  4OMP A;  2E64 A;  4JRK A;  4C92 B;  2RQR A;  2Y4X A;  3OB9 A;  1W4S A;  1A0N B;  5GAN 3;  1SRM A;  5IT9 E;  1ZLM A;  4DOV A;  2DZ9 A;  5J39 A;  5HCK A;  3EAE A;  1BB9 A;  4NS5 A;  1AZG B;  4C0G A;  3BY7 A;  1UGR B;  4O6J A;  2FRY A;  3G71 T;  2EAY A;  1BIB A;  2IIM A;  2LCC A;  1VQO T;  1KHI A;  3N5B B;  1RI9 A;  4BUG A;  2DIQ A;  3C95 A;  1NPR A;  3DB4 A;  3HSB A;  4J6Y A;  2ZPF B;  2PVG B;  4E7I A;  1RLP C;  2PZ1 A;  2ROL A;  3ZL7 C;  5CCA A;  1ZBX A;  4C92 G;  1JXO A;  4PJO C;  1Y57 A;  3M4Y A;  1OEB A;  2CUD A;  4BY6 B;  2Y90 A;  1PKS A;  2AKL A;  4C92 D;  2O88 A;  5KE2 A;  3NE8 A;  3VRY A;  2P0P A;  3EG1 A;  1ZUY A;  4M78 C;  5GAN 6;  2XIC A;  4ZN1 A;  3OYF A;  1W6X A;  4J9I A;  3QO3 A;  3SWN C;  3CCE T;  1I8F A;  4ZGJ B;  3OBW A;  1E6G A;  1M1K U;  3QBY A;  3WVD B;  2DIL A;  1Y07 A;  5GAN 4;  1WGS A;  4BI4 A;  1QWF A;  3UA7 A;  1WIE A;  1N5Z A;  4A4G A;  4F7U F;  3REB B;  4C0Z A;  3QWX X;  2KNB B;  4F7U B;  3EHR A;  1O75 A;  2JUF A;  3VS5 A;  3GBQ A;  1WLP B;  2FHD A;  2HBW A;  1U3O A;  3TSW A;  4M6G A;  4KT0 E;  2W10 A;  1M1K C;  2DYB A;  2PUO B;  2RH2 A;  1K76 A;  2L3R A;  5J26 A;  4F7U A;  3CZX A;  2OTJ A;  5LJ5 j;  5LL6 S;  4B9W A;  2JM9 A;  2HSP A;  4LUE A;  3CD6 T;  1LJO A;  1WNL A;  1WQ7 A;  2JT4 A;  1IO6 A;  5GAM e;  2X4J A;  1IRE B;  1G2B A;  4RTU A;  3EGU A;  1YHQ T;  3OBY A;  3EHQ A;  3H0H A;  1X27 A;  4F7U G;  3HKS A;  2E10 A;  4JJC A;  1QWE A;  4D6W A;  1I81 A;  2MMP A;  2YUO A;  5CQX A;  4Z02 A;  3I56 T;  2QQA A;  2V8J A;  2LVM A;  2DVE A;  5DLO A;  3OYH A;  3JRZ A;  5FU6 B;  2DL5 A;  2DJQ A;  1QVG S;  4E7H A;  5CO7 A;  2KMT A;  2ED0 A;  2CT4 A;  5LJ3 f;  1YI2 A;  3H0I A;  2CUB A;  1VQN A;  2DPP B;  1VQ5 A;  2VGN A;  3RKX A;  4OB0 B;  5FRO A;  1VIF A;  3NPF A;  2GFU A;  1VQ9 T;  2L2P A;  2VXE A;  4J9D A;  1VIE A;  3UWN A;  2K5I A;  2P0Q A;  2MCN A;  2HB6 A;  4A53 A;  3JCM X;  1UJ0 A;  1T0J A;  1WDX A;  4HVW A;  1NYG A;  1UFF A;  3OYG A;  1VYU A;  1WJQ A;  2MOX A;  4IUR A;  4OB3 B;  1VQM T;  1UHF A;  1KQ2 A;  2VYT A;  3FC3 A;  3NGP A;  5GMK i;  5GMK e;  4M7A C;  3CCJ A;  2F2W A;  5GAO p;  4HCB A;  3V8K A;  3CCL T;  3BW1 A;  2XKO C;  2WSE E;  1JQQ A;  2E1H A;  2QTX A;  2CS7 A;  2FPD A;  4BDY A;  2QA4 T;  3PFS A;  2EFI A;  4M75 C;  1T0H A;  1JJ2 S;  1QVP A;  4Y92 A;  1Q81 U;  4V2S A;  2EKO A;  3LWH A;  2NUZ A;  1UE9 A;  2C0I A;  4C0D B;  5DLQ E;  3LW5 E;  2JZ2 A;  1VQP A;  1YWP A;  4IUU A;  2KK4 A;  4KBM B;  1RLQ C;  2YLB A;  2JW4 A;  1VQ4 T;  2CZ6 B;  2EGE A;  2FO0 A;  1MV3 A;  1ZBJ A;  4M7D F;  1ZSG A;  2OAW A;  2I2L A;  1XNI A;  3ZBD A;  4ZN3 A;  1Q81 C;  4FSX A;  1I1J A;  2FPE A;  4CC2 A;  2CDT A;  1FWZ A;  3M4G A;  1OPL A;  4XTW A;  3WXM B;  4M77 E;  2ZPE B;  1T3L A;  1AOJ A;  1UEC A;  2E5K A;  5IN1 A;  3S6W A;  2LRQ A;  1H92 A;  2EBP A;  2H8H A;  1TUD A;  1BBZ A;  3SHW A;  4M7D A;  3JCM d;  4P5N A;  2F69 A;  3HFO A;  2HQX A;  3SWN B;  2YT6 A;  4IUT A;  4RG8 A;  5D6Y A;  4Y28 E;  2VV5 A;  2EQJ A;  4HA8 A;  4C5I A;  2O01 E;  4RCC A;  3DLM A;  2BTT A;  2G3R A;  3S3O A;  2DMO A;  3NMZ C;  1WJS A;  4M4Z A;  2D8H A;  4LDX A;  3CCQ A;  1B34 A;  1T3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...