1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
molecule keywords Ply protein
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
4RTWA 4Z88A 1BK2A 2AK5A 2DX1A 1MV3A 1ARKA 2FRWA 4RTYA 2LP5A 2KR3A 2D1XA 4J9IA 1K0SA 4E6RA 2G6FX 1UECA 1BBZA 3SEMA 5EC7A 5IXBA 2MOXA 2BZYA 1NEBA 4EIKA 2DILA 3GBQA 4X1VA 1T0JA 4F16A 2KROA 3EG0A 2DLPA 4OMPA 1QWEA 1VYTA 1FYNA 1HJDA 1TUCA 2GBQA 3EG3A 3ULRB 2ABLA 1PRLC 1SSHA 1RUWA 1GFCA 2W0ZA 4AG2C 3VS6A 1QWFA 2KGTA 2DYBA 4JZ3A 4AG1C 1K76A 3RNJA 2KT1A 3LH5A 5FWBA 2EVRA 4CC7A 1X2KA 2RQVA 1UDLA 1V1CA 2F2WA 3KFVA 2F2XA 2JS0A 4OMQA 2DL7A 5FW9A 2OJ2A 1KJWA 1SHGA 1PRMC 1NLOC 1H3HA 2O88A 1WYXA 3H0HA 1PKTA 2AZSA 2EGCA 4Z8AA 1ZLMA 2DBMA 2ENMA 2VKNA 1RLQC 1KIKA 2H8HA 4JPBW 4DEXA 2CUBA 1NEGA 2VVKA 3RBBB 2V1RA 2MIOA 1SEMA 1X43A 2AKLA 2J6FA 4WCIA 1UHFA 1A0NB 2V1QA 3THKA 1GRIA 2ROLA 4AFZC 2L3SA 2VWFA 2JMAA 3JV3A 3CZXA 5IHKA 1B3QA 2CT4A 2ED1A 1JU5C 1OPKA 2X3WD 5ECAA 2KYBA 4KRTA 2LQNA 1FMKA 1NYFA 2FO0A 2O9VA 2PNIA 2YUPA 4DEYA 2GNCA 2EBPA 2LNHB 2EGAA 2RPNA 3QAYA 2KXDA 1TG0A 5I22A 4M6IA 2EYWA 2GTOA 1JWQA 3TSWA 4RN7A 3TVTA 3I35A 5IHIA 2K7AA 1AWXA 2DL3A 3EG2A 1ZUKA 2CH4W 2D8HA 2D8JA 2DVJA 4J9BA 1KSWA 1RLPC 1T3SA 2E5KA 2DM1A 1UHCA 4AFUC 4JJCA 1MUZA 2KXCA 2CDTA 1Y0MA 1H92A 2QDLA 1AEYA 4RTTA 1OPLA 3REBB 2YDLA 2RMOA 4J9GA 1U3OA 2C0IA 2LQWA 4LQ6A 3PE0A 2BZ8A 2JMCA 4HVWA 2FRYA 2GTJA 3M0RA 1S1NA 2JXBA 1AWOA 1QCFA 3VS0A 2J7IA 1K4US 1QKXA 2RN8A 1UUEA 2DMOA 2JW4A 2O2OA 1OEBA 3VS2A 1VYVA 5EMIA 2JM9A 4M6HA 2NWMA 3EHRA 2AKKA 3M0SA 4AFSC 1UJYA 2YSQA 4OMOA 4J9HA 4JJBA 4HVUA 4Y92A 2ODFA 3I9QA 2A36A 2DNUA 2LMJA 2BZXA 1M3AA 1ZUYA 2JTEA 1SHFA 4JJDA 2LCSA 2B86A 2LX7A 1K1ZA 1WA7A 2C0OA 1PNJA 1ZBJA 2JM8A 1M27C 2EKHA 1U5SA 5FWCA 2KRMA 2JS2A 1CKBA 1G83A 2EPDA 2RQWA 2EYXA 2Q7SA 2K9GA 1I0CA 1GBRA 2J06A 1PWTA 1UG1A 2FPDA 1JXMA 2F2VA 1X27A 2EYYA 3UA7A 1W1FA 4J9EA 2MCNA 1UFFA 3QWXX 2IIMA 2SEMA 1SRLA 1KFZA 1MV0B 2CSIA 2DL5A 2A28A 1YNZA 2NUZA 4OMLA 5IHNA 4RTZA 1Z9QA 2SRCA 5GJVB 1Z9ZA 3NE8A 4K11A 1SPKA 4BINA 1J3TA 4HXJA 1N5ZA 1W6XA 2K2MA 4A63B 1E7OA 1PKSA 2A37A 5L23A 1WX6A 2LZ6B 4ORZA 4HVVA 4RTXA 1GCQA 4QT7A 2KRSA 3TSZA 1E6HA 1CSKA 3PVQA 5IH2A 4CC4B 1X6GA 1JXOA 2DL4A 2I0NA 1M3BA 2K6DA 2FG0A 1JO8A 2LJ0A 2FPEA 2CUDA 1AWWA 1OV3A 2DL8A 3R6NA 3EG1A 1CKAA 4LE9A 4RTVA 1PHTA 1Y57A 3EGUA 4Z89A 3EHQA 1M3CA 1JQQA 1NLPC 4D8KA 2LJ1A 1YN8A 2X3XD 4R0KA 2KEAA 4IIMA 1AZEA 1TUDA 2L3QA 4LNPA 3UATA 4LUDA 1I1JA 2DBKA 1U06A 1NYGA 2LJ3A 2YUQA 1YWOA 2CT3A 2KRNA 2D0NA 1H8KA 1K9AA 2EYZA 2EW3A 1T3LA 2J05A 2DJQA 3UA6A 1HD3A 1WLPB 2A08A 2HSPA 2HBWA 1SRMA 2L2PA 4GLMA 2RQUA 1X2QA 4M4ZA 2DRMA 2L3PA 1X69A 4J9DA 1M30A 2C0TA 3U23A 1ABOA 2ESWA 3ZL7C 5HCKA 1ZX6A 1W70A 3VS5A 3NHNA 4GBQA 2KE9A 3C0CA 3CQTA 3H0FA 1X6BA 1EFNA 4M6GA 2JT4A 4JZ4A 1E6GA 1QKWA 1ZUUA 1LCKA 1WXTA 3H0IA 1BU1A 3REAB 2KNBB 3O5ZA 2ED0A 3SHWA 3FJ5A 1UGVA 1AWJA 1UTIA 2KBTA 1RI9A 2O9SA 1YCSB 1HSQA 3QWYA 4OMMA 1M8MA 2CREA 2RQTA 3UF4A 3NMZC 2ROTA 4F17A 1B07A 5IXFA 2O31A 2KT8A 3A98A 3H41A 4IIOA 2J6KA 2K79A 3IQLA 4J9FA 3M0TA 1G2BA 1VA7A 4D8DA 1IO6A 2P4RA 1JEGA 2DRKA 1GFDA 1UJ0A 4LUEA 2PTKA 2OAWA 3VS1A 2OI3A 1AD5A 4FSSA 1GCQC 1AOJA 3PVLA 1AVZC 1WIEA 1ZSGA 1GBQA 3VS3A 1WDXA 2M0YA 2HCKA 2RF0A 1I07A 2HEQA 2PZ1A 1T0HA 1WXBA 2YT6A 1GL5A 1K0XA 2YUNA 4ESRA 2CH4A 3M0PA 1NM7A 4CC3A 1AZGB 1YP5A 2AZVA 2HDAA 4CC2A 1YWPA 5I11A 4LN2A 5GJWB 1WFWA 2GQIA 4J9CA 2L0AA 3VS4A 2W10A 2RQRA 3VS7A 4OMNA 2J6OA 2YUOA 1OOTA 4AFQC 2EGEA 1WI7A 3M0QA 2EQIA 1VYUA 3VRZA 2ECZA 2K3BA 1BB9A 4RUGA 4RTUA 2BTTA 2KYMA 3VRYA 2DE0X 1UE9A 1QLYA 3I5SA 3NGPA 1ABQA 2DA9A 4HCKA 2CSQA 1NG2A 1WXUA 3M0UA 2M51A 3NPFA 1XOVA 4ZNXA 2RNAA 1GCPA 2FEIA 2XMFA 4F14A 2FPFA 3I5RA 2DF6A 2GGRA
chains in the Genus database with same CATH superfamily
1RAAB 2MYSA 4QQGA 2JLMA 4R76A 4Z88A 1KD1U 1ZG8A 4RTYA 2LP5A 4ZN3A 1M44A 2FVGA 1QQ9A 3V8LA 3CCMQ 4E6RA 2QEXA 2ZGWA 1UECA 3GIUA 2BE9B 2M0OA 3SEMA 2HKQB 2VB6A 2MOXA 2BZYA 2OB0A 2CP2A 2DILA 1R43A 4HT8A 4X1VA 2DVEA 2OTJA 1VOMA 2EBJA 3EG0A 4LDXA 4KOSA 1NPPA 2VBQA 1K9MC 3LD2A 2RHZA 1FYNA 3OYKA 5CCAA 3T90A 3SWNB 1PRLC 1GFCA 2E41A 1VQ9A 3CC4T 1K73C 4Y91A 1RI0A 1KQSA 3OYIA 4FCYA 3IWWA 3T8WA 5FWBA 1Q82R 4EVYA 3H6ZA 1UDLA 5D6YA 2RA2A 3PIPA 3FYNA 3RIRA 4M75G 4KSFA 5CPAA 1S72Q 3FXTA 1KJWA 1SHGA 2BL1A 3X26B 5GAMj 1CM0A 3CCLT 3BXMA 2K5IA 3HLPA 1C6VX 4PLIA 3TO7A 2QEXT 2XG8D 3E9FA 2DBMA 5K8NA 2VKNA 5F09A 1V0CA 2EAYA 3CCQA 2EJ9A 4BI3A 1M1GA 2VVKA 4IURA 1JQGA 4NL2A 1SEMA 1VHSA 4HKFA 1I5OB 4CYQA 3GP8A 3D8PA 4WCIA 1UHFA 1QMCA 3C94A 3I3GA 4ZY0A 2XI9A 4FW1A 1U1TA 2ROLA 1XFOA 5DLOA 1QSOA 2QMLA 1ELMP 2VWFA 5LRKA 3CCQQ 2ZEGA 4GY5A 5D7UA 2X3WD 4CYPA 2KYBA 4DA4A 4E7HA 4IK2A 2Z11A 1VQ7Q 2KK4A 1Y9KA 7AT1B 3FDRA 2PVDB 3RMQA 4PJLA 2A4NA 2LT4A 3KQZA 1YGHA 3QAYA 3QJ6A 1VQ6A 1FMWA 1TG0A 5I22A 2E70A 4N4IA 3GY9A 1RADB 2DPSA 3NTIA 4ONUA 1R8OB 4ELZC 2CNTA 3PB4X 3S9NA 3G6ET 3UPUA 4NCZA 4B9WA 2CY2A 4C8QC 4RS2A 1AWXA 5CQXA 2VUBA 2R1IA 6AT1B 4RUHA 2DVJA 1KSWA 2Q4VA 3DKMA 1MMDA 1Y0RA 4AFUC 3OYJA 4YGOA 1OQKA 3EO4A 3PEIA 4E7IA 5DWMA 1Q7YC 1KQ2A 4JRKA 3L2UA 3PB7X 3VKIA 2PVOB 4IKFA 1OU9A 2FT0A 1VQOQ 3CCVQ 4PSXA 1LFWA 2J8MA 1U3OA 2YWWA 1R3NA 1OYXA 3TC8A 1ELLP 4JLIA 3PE0A 4GLKA 2BZ8A 1Z8WA 4HVWA 4PJOG 4CGMA 2FRYA 3M0RA 3OBYA 4RCBA 3MEUA 2XK0A 4J6XA 1AWOA 1QCFA 3WVEB 5GAOm 4R6TA 3RKXA 2RN8A 3ISXA 1UUEA 2DMOA 4MZMA 6CPAA 3M4YA 2F5TX 3VS2A 3PNWC 1VQ8Q 2JM9A 4XK8E 4AFSC 2OU2A 4GXHA 3R9EA 4KVME 4J9HA 1NE9A 3J80E 4PXEA 2E10A 1QVGS 1V29B 1G8XA 2HNIA 1QSNA 4IHMA 2GE3A 4L5GA 4C92G 2HL5C 2NYSA 5HKCA 2VL1A 1WHMA 2LMJA 3JB9J 2CXAA 4A2ZA 1BI2A 3A8HB 3LGLA 4XTWA 3WR7A 1YW6A 3D7GA 3T9YA 4MXUA 4F0YA 2RK1A 2QTVA 2BZXA 2EWNA 4C92A 3TT2A 2HL3A 2HQEA 4XPKA 3TEEA 5H84A 3PRTA 1OX8A 2E3HA 2EQMA 2NUTB 3NTKA 3EFOA 4NGSA 5LJ5j 1Q82U 1ZBJA 1M27C 2JS2A 2F7VA 4PL6A 4KULA 3EGXA 3TX8A 5DWNA 4B6MA 2DKGA 2FPDA 3OS0A 1R0CB 3OYNA 4J9EA 2BE7D 3ME9A 4JJNK 4UC4A 4BE2A 5D8NA 2XHCA 4FSXA 1KFZA 4F0XA 1S7NA 1Q95G 2E3IA 1JRIA 2PJ6A 4X3RA 2A28A 3BFMA 4EFDA 2DO3A 4RTZA 2Q7BA 3JB9I 2QJ8A 1Z9QA 2MI6A 1Z9ZA 1S7KA 2PUOB 4BINA 1J3TA 1XBUA 2ABZA 4OIWA 2R5MA 4A63B 4OVAA 3B7IA 2RH2A 4CRZB 2XDDA 2B3UA 1WX6A 2LZ6B 4DBRA 2I00A 2XEFA 1K8AC 3JCMg 1KC8U 3CC7A 3RAMA 2AFOA 4MJ8A 4BD9A 4P4FA 3CC4Q 1KD1C 1Q86C 1BPMA 4ZY2A 1OU8A 1MNDA 2NLUA 2MAMA 5AG4A 2FZKB 2HZYA 1K8AR 1X6GA 1M3BA 3JCMb 2O01E 2OH1A 4C8QA 1JO8A 3OYEA 2FPEA 2B8AA 3RYOA 1VKCA 2M1HA 3L2NA 1ZSZA 1Z8TA 1TS9A 3VU3C 2Y4YA 3CPWA 1D1BA 3S9LA 3SJXA 4Z89A 1M3CA 1JQQA 4F8ZA 1F1BB 4L59A 8ATCB 4MFLA 1YN8A 3RUXA 3IWGA 2RB6A 2KEAA 3PFEA 4IIMA 3QPHA 4LNPA 5LJ5d 1YJWT 2B4DB 4LUDA 2CS7A 5FLXE 2YHTA 2HD0A 5A28A 4XTZA 2J9AA 2CZ6B 1M1DA 3VATA 4YTLA 3KQXA 5FROA 1YWOA 3EC4A 2L8DA 2CT3A 2XKOC 2D0NA 4C5IA 4MFJA 2ZEOA 2VZZA 4AMCA 4ZYQA 1ZG7A 3SI2A 2FB7A 4MDXA 3VH9A 2DJQA 1IIDA 3UA6A 2A08A 4C5GA 4M78B 2XDBA 2RQUA 2PJ0A 4N4HA 1M30A 2C0TA 3CCSA 3CC4A 2PJ7A 4NEXA 3ZL7C 1UGRB 2XDPA 5GMKh 1ZX6A 4P4IA 2PVVA 3LYIA 3MEAA 4F9VA 3EFSA 4YWYA 3CQTA 4QW2A 1K9MU 1EFNA 4IUUA 5LYDA 3CCJA 3PT9A 4E7KA 3VJPA 4JZ4A 4CYOA 3D4UA 1Z8XA 1QKWA 3DR6A 4MCPA 1ZUUA 4MHNA 3EY5A 1IOFA 3CD6T 4BUGA 3E19A 3REAB 4Y28E 2JTFA 2K57A 4ELYC 1HDQA 2LC4A 3CC7T 3J7AF 3FJ5A 1XE4A 2QI2A 1HYOA 4WF2A 4NL3A 3QJYA 3JCMP 1TKFA 2PQ8A 4CGPA 3KXTA 1JJ2S 3OSSC 3QWYA 3NE7A 1M8MA 2CREA 4XU1A 1BKBA 2IPOB 3ZZIA 2BIVA 2CTCA 3H41A 4Z02A 4TVRA 4RMOA 3G71Q 3OW2A 2PJCA 4JRPA 4EMHA 3W6SA 4A4EA 4CI0C 2FIWA 4Y49B 3KHXA 5CBMA 2YGWA 1IHWA 2AHJB 1RABB 1BIAA 1KHIA 4EMKC 2DRKA 2JJ9A 3FIFA 1UJ0A 2XICA 2P84A 1QVFP 2COYA 4JLGA 3NA6A 4HCBA 4E7LA 1Q7LA 1YQEA 5GANg 3B2YA 1AOJA 1M2VB 2QAZA 3PVLA 4JRQA 1ZSGA 5GANe 2XEJA 1GBQA 3S6GA 4OB1B 1SG5A 3R1KA 2HMAA 4II1A 1IYLA 4M75E 1OI1A 5J8CA 3PFSA 1D3BB 1WXBA 2DD5A 2C1CA 1YW4A 2YT6A 3CCUT 1GL5A 1K0XA 2YUNA 4IAVA 1FY7A 4J7IA 1L0CA 5K8PA 5KTAA 2RI2A 1X75C 3M0PA 3NFZA 1JJ2P 4CC3A 4ZGEB 1LAMA 5A0GA 2ZW6A 1VIXA 5HY6A 3UT1A 4XPDC 2ZEFA 4N0AA 3VWEA 3PTAA 2W10A 2RQRA 3CPWP 2ZPEB 4OMNA 3RERA 3CCLQ 4XAXB 3E9GA 5GMKe 3M0QA 3PP9A 4MY0A 4C8QG 3B3TA 2ECZA 2Q43A 1ZO0A 5IN1A 3VRYA 5IT9E 2CZ0B 8AT1B 1I8FA 4R9MA 2V8DA 4JRIA 3I5SA 2GANA 3FBUA 1ABQA 2Q4YA 2DA9A 5GANj 1R77A 2OZUA 4ZY1A 1M8VA 2CSQA 2VV5A 4B10A 2L89A 4C8QD 4C0DC 1VQKA 2Z0WA 2RNAA 1NSAA 1VQPA 3A1PA 3G4SA 4F14A 2O4HA 1FXXA 3MRUA 1MMNA 2GGRA 2G0BA 2ZAEA 3O8VA 2DXQA 4CGOA 3J81E 2FRWA 5I2SA 1X12A 2KR3A 2POKA 4RG8A 4C0FA 1YJNT 3CBOA 2ZEPA 5E96A 2D1XA 4IUSA 4Q7AA 1ZQ1A 3K9TA 3P2HA 4M7AB 1FMVA 1MGQA 2DEQA 3F0AA 5LJ5h 2PRBA 5GANd 5CK9A 4EIKA 3QZ5B 1H641 3DR8A 3P2FA 2VXFA 4UIBA 2YXYA 4F04B 4BDYA 4ZTJA 3E1SA 4F16A 2YNEA 3G3SA 2DLPA 4OMPA 4C92C 5AYFA 1QWEA 4Q5WA 3OA6A 1AHJB 4C7IA 2BKDN 2PR1A 1TUCA 2GBQA 3EG3A 4KUBA 5JQ4A 2CYZB 3RO0A 5KYWA 4PQAA 4AG2C 4TNUA 2KGTA 4AG1C 1TF9A 3OYYA 5GANf 3DDDA 3W6XA 5GMKm 1VQ6Q 3KGQA 2QDYB 1YMEA 1Z5RA 4CC7A 3DGVA 2RQVA 1V1CA 2F2WA 2EJFA 3QDFA 3D7DA 1YHQQ 1ARLA 1YJ9T 2DL7A 1N9RA 1TUGB 5FW9A 2E4HA 2OJ2A 4JS5A 5IB0A 3MKDA 1KQ1A 4OB3B 1MJBA 1NLOC 2BCOA 1H3HA 4X2TA 4JD6A 3QDRB 2RHUA 1U6MA 2M16A 1TF8A 1RO5A 2VZYA 3BHXA 3LWIA 2EGCA 3X28B 5G20A 1ZLMA 1K4JA 3FEEA 4DEXA 4A4GA 1RAHB 3G6EQ 2V1RA 1VQLA 4LX9A 2VYTA 3SI0A 5GAOr 2X4JA 1A0NB 4OLLA 1D1AA 2V1QA 1GRIA 4IUVA 4M78A 5A0DA 2Q51A 4HKEA 1QVFS 2XEIA 3C12A 4M78F 4KBMB 3MP1A 1AYEA 3EFOB 1VQKT 2AFMA 3CZXA 4KUIA 1OPKA 1B34B 3DB3A 3I55A 1I12A 4E2AA 1K73U 1FMKA 1NYFA 1VQ8A 2RJEA 3CCRA 5GAMf 3KASA 2PNIA 4DEYA 3CCST 4E2FB 2Y4XA 3EAEA 3JB9D 2G3AA 2GNCA 4J83A 5LJ5g 4JDSA 2EGAA 3SJGA 2QEXQ 4M77C 2DJZA 3LGFA 5GMKl 4M7DE 3OS2A 2KXDA 2WUUA 1WQ7A 1JWQA 3G4ST 2VQYA 4UEEA 4V2SA 4X34A 4EPCA 1MK4A 1WHHA 3I35A 5IHIA 3TVTA 5GAN3 3CMEQ 4M7AE 5GCNA 1OX9A 1N27A 2K7AA 5LL6S 3IU1A 2DL3A 4YRHA 3EG2A 4R57A 1ZUKA 3OB9A 3K9UA 3GKRA 4MFPA 3URGA 1RLPC 1Y96A 5M9OA 3WVDB 3D2PA 1UHCA 3CCUA 3P8BB 1WJRA 2CDTA 1Y0MA 2H3JA 4M77F 1YJ9Q 2Z10A 1H92A 5A2QE 1OPLA 4FW2A 3REBB 2PC1A 2YDLA 2OTLQ 4MY3A 3SD4A 2GFAA 2EQUA 2RO0A 5I21A 2JZ2A 3JCMd 4DJLA 2RJDA 2D9TA 4P4DA 2K2VA 3ZEHA 1IB1E 4XNHB 1BCOA 3CCEA 4OC3A 4M7DG 2GQVA 2DTIA 3PMTA 4QVCA 1IZ6A 3JCMh 1EE3P 3NTHA 1YIJA 2C6PA 3BI1A 3UY5A 4C2YA 3TREA 1S1NA 1TWBA 2DERA 4GS4A 1QSRA 3VS0A 2PQWA 2LCCA 1CJWA 3DLJA 1K4US 4OP4A 4M7DA 4C8QF 3V7CA 2O2OA 1OEBA 5EMIA 1VYVA 4KGVB 1C0MA 1QSTA 3IIBA 2AKKA 3M0SA 1UJYA 4FD6A 4KH0B 4KZTA 3I56A 3BJ7A 4JJBA 2RK2A 3M4GA 4HNWB 1OZ2A 4MBUA 4Y92A 2M9UA 3I9QA 3FRNA 3M55A 2OZGA 2YLCA 2OZHA 2A36A 2DNUA 3JTKA 2ZEHA 1ZSZC 4PFZA 2RM4A 4QBJA 1P4NA 2WSFE 4FYWB 4PXBA 2DPPB 3NFCA 3T9NA 1LANA 1JJ2A 2QGGA 5GAOp 4M7AC 2JTEA 4C0ZA 4JJDA 1X10A 2YNDA 1WA7A 2C0OA 3RKYA 4MMOA 1G3YA 1PNJA 3OW2S 4QC6A 2JUFA 3CC2T 3CDXA 1VQ5Q 1MJAA 5FWCA 1U5SA 2CIJA 2KRMA 5IV0A 1G83A 2DTOA 4M75C 1PD1A 2REFA 2CP7A 4MHPA 4OIDA 4KLVA 1GBRA 4KVXA 4NFRA 2O4XB 2R8VA 1UG1A 4ZTFA 5GMKi 2F2VA 2EYYA 1W1FA 4YU9A 2MCNA 3CPAA 1UFFA 3QWXX 2Q44A 2ZENA 4DNCA 2ZPBB 5F46A 1SRLA 5CKDA 1MV0B 2ZCFB 2DL5A 3LLRA 3G7ZA 4OMLA 5KYYA 5IHNA 2DXBA 1NMTA 2SRCA 5GJVB 2RFHA 3QXEB 4B14A 3FEOA 2NMTA 1H8LA 2AT1B 3NE8A 1SPKA 3OYBA 4PXDA 3FH4A 1M90U 1PKSA 2A37A 3RDVA 5L23A 4BACA 2AFWA 5FRMA 4IF5A 1H3ZA 3QBYA 4R3LA 1GCQA 2LQ8A 5EC4A 3IWEA 2P6FA 4UFWA 4MZPA 2RD1A 4JUVA 3LMSA 5KYYB 2K3XA 1RXTA 3PVQA 3EH1A 3CCLA 2I0NA 1JXOA 3ZFJA 5C6SA 4FBEA 2OTJT 2CUDA 1TU0B 2FL4A 2VXKA 5LYIA 2F5KA 3HSBA 1IY7A 1CKAA 1PSFA 4LE9A 4RTVA 2KSSA 2PR8A 1PSEA 3H8ZA 3FB9A 3EGUA 9ATCB 3S6KA 2DAQA 3I55Q 2E5QA 5DM7R 3BI0A 4CGLA 1NLPC 4QVDA 3CC2Q 1NE8A 3PB8X 4LD6A 3HRUA 5AT1B 1KQSS 3BLNA 2RC4A 4KOYA 4R0KA 2EQJA 1ZA1B 5BWAB 1YLOA 1ZLHA 1I1JA 1U06A 2KAFA 2BEIA 1VGYA 3D7SB 4O6JA 2YUQA 3JCMc 1Y9WA 2FL7A 3V7ZA 3JCMJ 1TSFA 4AB7A 3FX6A 1IB8A 4O5VA 4C8QB 2EW3A 1M4IA 2WSCE 2J05A 3MHXA 1VQ4Q 1S7FA 4GM5A 3GPLA 3R6OA 2EKOA 1IHVA 1WLPB 2HSPA 4HNXB 4E0AA 4GLMA 2E12A 4MHDA 5G1ZA 1AT1B 3JCMQ 5AG6A 4A30A 1JB0E 3WC7A 1SKUB 3RBUA 2ZPAA 3CT9A 5GAMg 4BY6C 2VI7A 4N0AC 3SJFA 3OWCA 1YFNA 1W70A 1XQHA 4LQGA 1P0HA 3G8WA 4OC4A 2HV2A 3NHNA 4GBQA 3H0FA 2K5FA 1VQMA 1ON0A 1B6BA 2JT4A 3OY9A 2QQAA 2FVUA 4NGQA 5GAN4 3B3SA 3GF5A 2AFSA 2G3TA 3BJ8A 4FT2A 4M7DD 2DF5A 3OMGA 1PCXA 1RAEB 2A3LA 2HQYA 4UFXA 3O5ZA 5LYLA 1UGQB 2C06A 1X6OA 2F5IA 1UTIA 4KUDK 2QA4Q 2O9SA 1YCSB 1HSQA 1QSMA 2DTHA 1D0XA 1MMAA 3ISZA 1ARMA 2PUKB 1WGSA 2RQTA 4P4JA 1WJQA 2YLBA 3L2ZA 2KY9A 2KT8A 3A98A 3ER0A 4A32A 4IIOA 1VQ7T 2JEWA 3MO8A 3QYGB 4J9FA 4M7DC 2Q0YA 2PJ9A 3NH8A 1G2BA 2JDCA 3WXMB 2MPXC 3MEWA 1BCMA 4D8DA 5HK0A 2C6CA 3EGDA 5K8OA 1JEGA 2EJGA 1QVFA 2V8GA 5EG2A 3VS1A 3N7ZA 4AVBA 4LDVA 3C26A 4BMHA 2EFIA 1K8AU 3CCMT 1MNEA 2DD4A 4L89A 2ATCB 2LRQA 3JB9F 4A39A 4A53A 1I07A 2KMTA 2HEQA 4NJQA 4F6AA 4A94A 4UEFA 1T0HA 2A7YA 1N71A 3HL8A 4UCNA 5I0CA 2PVGB 2DXCA 1D0ZA 2CH4A 4X9DA 4H6ZA 1AZGB 1YP5A 2AZVA 1XTDA 3LH0A 1UFHA 4KORA 4Q38A 3IO1A 1YWPA 4M78D 4BE1A 3JCMW 3WC5A 1YJ9A 4J9CA 4O23A 1W4SA 1YI2Q 3VS4A 3X25B 3VS7A 1SQHA 2RJCA 2YUOA 2AE6A 4AFQC 2EGEA 3LACA 1WI7A 4P4EA 3ZJ0A 5GAN7 4NS5A 2OX7A 4UF4A 2RHIA 4B5PB 1VYUA 3IEHA 3B8GA 4C7HA 4RUGA 2PIYA 2QQSA 4RTUA 5LJ3h 4ANJA 1ZG9A 4CAEA 4KGXB 2PJAA 2PVWA 1QLYA 4BE0A 4A31A 4HCKA 1D09B 2XU8A 4C5HA 2QXFA 3TTHA 1WXUA 3OQ5A 5HVFA 4F7UE 3M0UA 2M51A 2F69A 4ZNXA 3A8GB 4PJJA 5GAOl 2Z3KA 2ZEMA 4FUUA 4ORFA 1GCPA 3FJPA 3FC3A 2FEIA 4A38A 2XMFA 5CKEA 2PJ3A 4NGRA 3MP6A 2E6ZA 4U9YA 1J4JA 3I5RA 2DF6A 3OYDA 4RTWA 1S72T 5JPHA 1UGSB 4NOYA 2ZZDA 5KYWB 1MV3A 2WACA 1S72A 1ARKA 1XMTA 3H8FA 2LDMA 4XTYA 3DNSA 3X24B 3SXNA 2G6FX 2VGNA 1BBZA 1LOJA 1YK3A 5THWA 3FLGA 5EC7A 1VQPT 3KR5A 3F70A 3TOBA 3CXCA 3EXNA 4M7AA 4DBHA 4MCQA 4JZ0A 4FYXB 5HVHA 3QKJA 4F7UG 3ULRB 2ABLA 2X9HA 1SSHA 2B4BA 1ZHIA 4CYNA 3JCMf 1RUWA 3OW2P 3GUXA 4EDUA 1UEBA 1QWFA 2FS5A 2I79A 1DJ7B 1K76A 4FD4A 5HH1A 2QG9B 1D0YA 4C5EA 2KT1A 4F7UA 2FHDA 2LVMA 4B12A 4B13A 2O28A 1X2KA 4U5YA 1CP7A 2KI7A 1NSLA 2ZELA 2AIRB 4LDWA 3I55T 2JS0A 4OMQA 3M58A 2M02A 1YJNQ 1PRMC 4DOWA 2DYIA 4P4BA 5C0MA 2ZPHB 2JBJA 3IFEA 1VQNQ 4UA3A 3H0HA 4CPAA 2QGFB 1WNLA 1VQOT 4ZX9A 4A95A 2ENMA 1RLQC 1KIKA 4JPBW 1MHNA 5GAN5 2QVPA 1Y96B 2CUBA 3HFOA 1IRXA 5FRNA 3M9QA 1NEGA 1KWMA 1VHEA 1Q81C 1WWZA 5GAMe 4P45A 1VQ5T 2AKLA 3CPXA 1VQ8T 1TH7A 2YNCC 3THKA 3S3NA 3QO3A 1PM3A 2PE3A 5JGFA 4OKOA 1N8RU 2L3SA 3D7HA 2V8JA 2JMAA 3JV3A 3KUFA 1B7TA 4MZTA 4CRIA 2LQKA 1CPXA 2CT4A 4CS0B 1JU5C 4EMEA 3S6FA 5GANh 1EIFA 4KRTA 4E7JA 2OTLT 4ZI6A 1YVOA 4AXVA 2FO0A 2O9VA 2BOAA 3KL9A 3JCMV 4XQ3A 2ANPA 2DEAA 2O4XA 1QVPA 3GNGA 3HFNA 1KC8C 4NGMA 2X51A 2NYQA 5LJ3d 2VEZA 4KOUA 2LNHB 1F2PA 1B34A 3EGDB 4FD5A 2RPNA 1KUVA 3R9FA 5KCHA 2EUIA 4M6IA 2EYWA 1LJOA 2GTOA 1A2ZA 3E2UA 1MMGA 1XF8A 3TSWA 4RN7A 5G22A 1RACB 2JDDA 5CIUA 2AFZA 3I9SA 4M77G 4DBQA 3PB6X 2P6EA 3CBPA 2YNCA 2CH4W 2D8HA 1WHGA 2D8JA 4ZGYB 5LYFA 2ZPFB 2ZOGA 3IC1A 4WJBA 3D68A 1I81A 4NGPA 2E5KA 2DM1A 1MUZA 2DK3A 4PJOD 2YRDA 5I2MA 4L8AA 2XEGA 2CF4A 3CPFA 1NJIC 1TTHB 2RMOA 2E1HA 5GAOq 3LW5E 2C0IA 4M7DF 2JEVA 4LQ6A 1QP2A 3A8MB 2OR4A 4H6UA 2JMCA 2PCUA 1YITA 3V8IA 3TQ7P 2GTJA 1K73R 7CPAA 4HT9A 2X4XA 4M7AF 3QHSA 5EBVA 1GYTA 1QKXA 5CO7A 5F48A 2VGMA 1AUGA 3EH2A 4A4KA 4M6HA 2NWMA 3EHRA 5KCOA 3S6HA 4A33A 4QVTA 4OC1A 2X4YA 2YSQA 4OMOA 5LJ5f 1VQMQ 4WWVA 4H89A 4JJXA 1CP6A 1IGUA 4HVUA 5J39A 2ODFA 5LJ5e 2R5AA 1BLLE 4MFKA 2FZCB 4PJOB 1QMUA 2P6GA 1PCAA 2PDOA 1CX8A 2X35A 1EX4A 4ZN1A 1M4GA 1KHCA 1NPRA 1SF9A 4OC5A 1M3AA 4IUQA 1ZUYA 2XIDA 3H8EA 2FYKA 2HQXA 5LJ3f 1SHFA 2B86A 4OB0B 1K1ZA 3MP8A 4BD3A 4K30A 2PU9B 1IYKA 1CG2A 3I1UA 4R8FA 3GIBA 1Z4EA 2EPDA 3R9GA 2DZ9A 4MMLA 2K9GA 1VQLT 1I0CA 4QVZA 3D2MA 4UWIA 2MWOA 2J06A 3PB9X 1GXIE 2HBPA 3CCMA 4DUKA 2QIRA 2Z3OA 3CBMA 3TCVA 2IIMA 4VUBA 1N9SA 4LXCA 2X7BA 3META 4C92E 5GAMh 1YX0A 3HRSA 4ZX8A 2DXUA 3CCSQ 1YNZA 2NUZA 4LDYA 5CAIA 1M1KR 2JN0A 4EMGA 2WPWA 2FZGB 4NF1A 1FT7A 4K11A 2XD0A 4U9ZA 5GMKj 5HK3A 3BY7A 1N5ZA 1HDUA 2AFUA 2V8KA 3VYGA 1K9MR 2R58A 3UDCA 1E7OA 5D6WA 2G9DA 4BBHA 5C82A 4OB2B 1W2BP 3OMCA 4ORZA 4HVVA 4M75F 4RTXA 4B9XA 2KRSA 4B5OA 4I49A 4JXRA 4KSAA 3MCAB 2MMPA 1XEBA 2QK0A 1CSKA 1VQLQ 1BYMA 5IH2A 2K6DA 1KQSP 2QA4A 1S60A 1FWZA 1Y7EA 4PNOA 4C8QE 1AWWA 1OV3A 4R56A 2RI5A 3H9NA 2DL8A 3INZA 3EG1A 1Q2YA 3FIXA 5HVGA 4XTUA 3SI1A 1N8RR 1WPYA 2BUEA 1M2VA 1CBXA 4OADA 1Y57A 1YREA 3EGXB 2CP0A 3EHQA 4D6WA 3PGGA 3CCQT 1YHQT 3HRTA 4M77A 2DFUA 2LJ1A 4MDWA 2IL4A 1TUDA 2REEA 2E64A 4M77B 2V77A 2GCXA 1QCOA 2P0KA 2DBKA 4P44A 3WABA 3TO6A 3CC7Q 4PFPA 3V38A 2EO8A 4L6V5 5FVJA 2C27A 1H8KA 1ZA2B 4HCZA 3OYHA 1QVGP 1ZLIA 1K9AA 4MFQA 3I56Q 2B5GA 1M5Q1 1WHLA 4PJOF 3CXPA 5DS0A 4OMFB 4M77D 3Q1JA 1VUBA 4XPDB 4M4ZA 4ZGDB 2DRMA 1X69A 2VXEA 4OAEA 3FEDA 3B3WA 2ESWA 3X20B 1YSJA 2BSWA 3JCMe 4PJNA 4J5YA 2NUPB 2PJ1A 3VS5A 4N4GA 1KZFA 3KI9A 4HPSA 4EMKA 3S9MA 2KE9A 2P0PA 4J6YA 3L42A 1X6BA 3QSUA 1E6GA 3OYCA 1LCKA 2QTXA 5G21A 3RNZA 1G3SA 3CXSA 2GREA 3QG1A 4H2KA 3FNCA 4Y49C 3EG9A 4E7ZA 4C0DB 2X4WA 2KNBB 1YIJQ 3CCRQ 4BY6B 2ED0A 3GLXA 2BUDA 3OS1A 4M7AG 1UGVA 4R55A 2ZW5A 1BIBA 1RI9A 4OMMA 1F57A 2F8HA 2CP3A 3R96A 5GAN8 2EYQA 4XTXA 2ROTA 4F17A 4AG9A 1Q81U 2O31A 2OTLA 2FCKA 4B6ZA 1YI2T 1IXDA 2J6KA 1FX7A 2R57A 4E7SA 3M0TA 3CCVT 2B58A 4C92D 5IB9A 1IO6A 3G6EA 3LODA 1D3BA 2P4RA 3DSBA 1GFDA 3H4QA 2PTKA 2OAWA 3CCET 2Z0ZA 2OI3A 3PGPA 2MK5A 4PSWA 4FSSA 4MMKA 2AFXA 1P92A 1OULA 3DLMA 2E65A 2HSEB 1AVZC 1WIEA 4KSIA 4PKCC 3OYAA 2HCKA 2RF0A 3A8OB 4M75A 1S3ZA 3VUBA 2V26A 3KBGA 3JB9H 2PZ1A 2LTOA 2D6FA 4UIAA 2JNGA 1I21A 3IU2A 1Z9UA 1D1CA 3RESA 4C0GA 2CNMA 2GLJA 3VARA 1NZ9A 3PFOA 1XIXA 3MN8A 3RZAA 3EFRA 1O9SA 4CC2A 1Z4RA 2JOYA 5I11A 5GJWB 2I3CA 1BAVA 1Q81R 1WFWA 2CZ7B 5CKBA 5FU6B 2IMOA 3JB9G 3QAHA 3JCMX 1Y0YA 4M78C 2GQIA 3WT4A 3P8HA 2L0AA 3OBWA 5D6XA 1VQ6T 4EMKB 3B3VA 1VQ5A 1TOVA 3OS5A 3N5BB 2R98A 1YVKA 4KOWA 1G3WA 4PV6A 4PFOA 1BB9A 1YLEA 3SJEA 2A0FB 3BDLA 3DLLA 3SDZA 3CD6A 3S3OA 1M4LA 2DXTA 3AHUA 2EIFA 2CNSA 5GAMd 1WJSA 2RI3A 3NPFA 3HTRA 2Q4ZA 1RAFB 1YJWA 4JXQA 4P10A 5IAYA 1NJIU 4PJOE 4DYOA 1JBMA 4P5NA 1BK2A 2AK5A 1YHQA 1M4DA 2DX1A 4HCCA 1LVKA 5J8FA 4FD7A 4JS4A 4AG7A 4J9IA 5H86A 2PJBA 4UFVA 1K0SA 1F2OA 4MRIA 1Z2LA 1FNOA 1HEEA 2WSEE 5IXBA 5KE2A 4XTVA 1NEBA 4KT0E 1OZPA 3GBQA 3W91A 1T0JA 3K2KA 4IUPA 4XU3A 2KROA 2B4DA 5CNPA 1VIEA 3CPWS 3LWUA 3QNVA 2K3YA 2HAXA 1VYTA 1PU9A 1HJDA 2PSWA 1IOIA 4F7UF 2HC9A 3CCUQ 1Q2DA 2FE7A 3KHZA 4OC0A 3D3SA 4OGEA 4IUTA 5K8MA 4P6YA 2GLFA 2W0ZA 3VS6A 2ZW7A 2LCLA 3AT1B 1RAIB 2Q04A 3OYFA 2DYBA 4JZ3A 4FM4B 4LDUA 1ACMB 1IGQA 4FIBA 3RNJA 3LH5A 3SXOA 4WTOB 1QW1A 2EVRA 2Y90A 2V8HA 3N5FA 1KUYA 3M53A 1IICA 2OAUA 2PJ5A 2Y0MA 3KFVA 2F2XA 4A54A 1QQJA 3EG9B 3PIOA 4AVAA 2YRCA 4CAWA 4CAXA 2O88A 1DTDA 1RTQA 5AGEA 1WYXA 2V8IA 4PXCA 1VQPQ 2V8VA 4PK3A 5HMNA 4JWPA 4OMEA 1G5VA 1NJIR 1PKTA 5LRJA 2AZSA 4Z8AA 1WHKA 1YJNA 2EQKA 2H8HA 4KGZB 3SWNC 3HP9A 3PBEA 3V8KA 2PJ8A 3RBBB 1Z8LA 2EK8A 3E0KA 1Y71A 4CGNA 3CMEA 2MIOA 1CPSA 3FECA 4F7UB 2LNVA 1X43A 4HA8A 2J6FA 1IU8A 3HPWA 4XU0A 2EVNA 4FAIA 4KOTA 4UEZA 4AFZC 2B5GB 2CP6A 5IHKA 1B3QA 2ED1A 5ECAA 2HUZA 5ISVA 2I2LA 2LQNA 1U1SA 3KKWA 2HKNA 4J7FA 5LJ3j 2DPTA 1RAGB 5D29A 2YUPA 3FRMA 3FJUA 1M1KC 4BB7A 1EZZB 2EBPA 3QUIA 4R3KA 1YITQ 2CP5A 1LRZA 4XNHC 3VV0A 2L5QA 3M57A 5AG7A 1PD0A 1LNXA 3A5ZB 3JSCA 2NUTA 3P8DA 2GFQA 1Y7RA 2WYRA 2IQ6A 5ELYA 1UGPB 3G71A 3L2QA 3GNFB 3S6WA 4DOVA 4C92B 3TOAA 1W2BS 2PJ2A 1Q82C 1PG5B 1OBRA 4C92F 4JLYA 4ONWA 1B87A 1YCYA 2CGHA 3JRUA 5KYUA 1VQMT 4RI1A 5F49A 1KD1R 4J9BA 4OF1A 3VWDA 1T3SA 1I5LA 2CTBA 4KOVA 4LUAA 1TXRA 4JJCA 5IX3A 4A4FA 2KXCA 5LJ3e 2K4YA 4NGNA 4KUAA 2YRVA 1PUAA 4KS9A 2QDLA 3V8JA 1AEYA 3WC6A 1V76A 4RTTA 5JH9A 5FU7B 5KE3A 3CXCP 4PJOC 1VIFA 2COWA 1QCNA 2QASA 3B35A 4R87A 4J9GA 3D66A 3FB3A 2LQWA 4K3NA 2EK9A 4KVOE 4CAFA 4KOXA 2Z3PA 3CXQA 2KDSA 2JXBA 1M90C 2ZW4A 4ZGJB 2J8NA 3TCJA 2J7IA 5A0LA 2O53A 2RJFA 2JW4A 1WK4A 3CEYA 3CMET 2Z3NA 4YFJA 1M90R 5J3BA 2DETA 2QECA 5L8RE 3HKSA 4FWUA 3TFYA 4F9UA 4M75B 2FXFA 2GFUA 3CMAQ 2H3EB 1X01A 2RHYA 3HUVA 5KH6A 1BPNA 2ARHA 5J26A 1Q86U 4QB9A 3KR4A 1QP3A 5DY9A 2Z3LA 3M56A 5DLQE 3CMAA 4R7MA 1R0BG 2LCSA 1YI2A 1I4K1 2LX7A 2R7HA 3IGRA 2PJ4A 1S5KA 4CAVA 2JM8A 4FYYB 2EKHA 2OOTA 2RQWA 1CKBA 4X5KA 3G4SQ 2EYXA 3SB2A 2Q7SA 3QYHB 3OYMA 4JYWA 1BI3A 4OGCA 1M9SA 2MF2A 4C2XA 4MCSA 4BDZA 4II9A 1ZSZB 4PJOA 2BO9A 1PWTA 2L3RA 3I56T 1JXMA 3TE4A 1X27A 3TU4K 3UA7A 3PMIA 2QQBA 1YR0A 2SEMA 1VQ4T 2B3VA 1WZOA 4DQ2A 5KTCA 2D0QB 3OSVA 4M78E 4FL6A 2CSIA 4PPZA 4M85A 3MJXA 3NH5A 1TKHA 5CKHA 2VC8A 2LX9A 3CCJT 2KVQG 4UCPA 1GHEA 1PYTB 1TKJA 3NH4A 4ME7A 5I4MA 1VQ7A 3H8GA 4ATOA 4Z65A 2J8RA 1Y7XA 4HXJA 5GAN6 2NSMA 3F8KA 5KYXB 1W6XA 2ZEDA 2NUPA 2K2MA 3L2WA 4BI4A 4M3SA 3FVLA 3BW1A 2QYVA 4NXYA 3CD6Q 5KYXA 2DIQA 2FIAA 4J3GA 4NSQA 4QT7A 1TXQA 3CCEQ 3M54A 3CCRT 3TSZA 3RKWA 5KTDA 2RHXA 1IREB 1E6HA 3EFAA 2MWPA 4X9CA 2KCWA 1BI1A 4CC4B 2DL4A 2H5MA 5LRGA 1LOKA 2DZCA 2FG0A 1BO4A 5A27A 3CMAT 2LJ0A 2DEUA 1Q7YR 2QA4T 4RKUE 3CXCS 3BE3A 2JTMA 3R6NA 2P0WA 3FF3A 2CZ1B 1O75A 2QQ9A 4C68A 1KUXA 2ATRA 1PHTA 5C88A 1LPLA 3L2VA 1Y07A 3OYLA 3JRZA 3QZ9B 1XJWB 4RG2A 3SWNA 1LAPA 3KZWA 2HQHA 4D8KA 2AJ6A 2X3XD 3M59A 1M1FA 3V7SA 2PRQA 4B11A 1AZEA 1S7LA 4HNYB 2L3QA 3UATA 3V7RA 4MFZA 3CC2A 2CKKA 1G3TA 1SSFA 3ASKA 4CRYB 2QQRA 4PLLA 1NYGA 3H5ZA 2LJ3A 2HB6A 2LT1A 4MHYA 3D67A 2COZA 2KRNA 3CCVA 3TO9A 1YITT 1XRYA 1VQ9Q 2EYZA 1T3LA 3GYAA 5FU7C 1KG1A 4E8OA 1PC0A 1Q7YU 1HD3A 1HK9A 4TWEA 4XU2A 4MCRA 1M4ZA 2HBWA 3SFMA 1SRMA 3M5AA 2L2PA 5CQYA 4AT1B 1NBEB 5CVIA 4M75D 1X2QA 2L3PA 2P4TA 4J9DA 2OTJQ 3U23A 3JAME 4OC2A 2P0QA 3CCJQ 1ABOA 1C1AA 3MGDA 4ZBGA 3DB4A 4PK2A 3VYHB 3F5BA 1OZ3A 5HCKA 1VQNT 1IGBA 1WQWA 3RMSA 4FYVB 4EWTA 2GU2A 2QYZA 5JM6A 3ZBDA 3C0CA 4C2ZA 4M6GA 3B3CA 4Q36A 2ZPGB 1N6AA 5GAN2 3RR6A 3S3MA 4NGTA 4QUSA 4AVCA 8CPAA 2PIZA 1WXTA 1QVGA 5GAOn 3H0IA 4PK4A 2F1LA 1BU1A 5CR2A 3IJ3A 1R57A 4UCMA 4QQ6A 4RCCA 3C95A 3GLJA 3SHWA 4QKUA 3L1AA 1AWJA 1XJOA 3PZJA 4PJMA 4M77E 1ZBXA 2KBTA 4QQDA 3BDUA 2E6NA 3HHTB 1VQOA 2IVWA 3UF4A 3MEVA 3NMZC 4KH1B 1XNIA 4J8OA 5KYUB 2D4OA 1B07A 2VASA 4OP0A 5IXFA 3GB0A 1U8RA 2WPXA 2K79A 2K5TA 3IQLA 5HXDA 3A9LA 1HXDA 1VA7A 4KLWA 4G1PA 4BI8B 2ZXVA 2K5LA 2JVVA 3QB8A 3GOXA 5J1QA 4LUEA 4MI4A 4W9YA 1AD5A 2DIGA 3G1JA 1Q86R 1GCQC 1UWYA 1YJWQ 1MJ9A 3UWNA 4MHZA 3VS3A 1WDXA 2JBKA 5CKFA 2M0YA 2D4PA 4UBRA 1M2OA 3LX7A 4UWJA 2G3RA 1VQ9T 1KC8R 4FU6A 1N8RC 2GF7A 1VHOA 4ESRA 2ZEEA 1XMBA 1TIQA 4E47A 1Q2CA 1NM7A 4FT4A 2WZNA 5AG5A 3QIIA 2HDAA 3LWHA 1LCPA 4LN2A 2ZPIB 3JVNA 2WSAA 4M7DB 3MPUB 4A4HA 4XPLA 3SHPA 2EWBA 3G71T 3FMCA 1YBYA 1M1KU 1RL2A 2KQWA 3VUZA 2IG0A 1VQ4A 4DBFA 1W2BA 2J6OA 1BI0A 1OOTA 5F47A 1KK7A 4A37A 2IJZA 1VQKQ 2EQIA 3C4SA 3R95A 4M78G 3VRZA 2RB7A 2K3BA 2Z3MA 2BTTA 2KYMA 4NJRA 3OYGA 3L2RA 2FSRA 4LD9K 2ZOFA 2DE0X 3PBBA 4B5PA 2C6GA 1UE9A 1WHJA 3NGPA 5FU6C 3A8LB 4J6WA 5LJ3g 1I1DA 3JUWA 1NG2A 1YIJT 1AMPA 1BOBA 2GIVA 1XOVA 3D7FA 1DE4C 4M7AD 4X8IA 1VQNA 2FPFA 1UB4A 5KYNA
chains in the Genus database with same CATH topology
4QQGA 4Z88A 1KD1U 4RTYA 2LP5A 4ZN3A 3V8LA 4E6RA 2QEXA 2ZGWA 1UECA 2M0OA 3SEMA 2MOXA 2BZYA 2DILA 4HT8A 4X1VA 2DVEA 2OTJA 3EG0A 4LDXA 1NPPA 1K9MC 2RHZA 1FYNA 3OYKA 5CCAA 3SWNB 1PRLC 1GFCA 2E41A 1VQ9A 3CC4T 1K73C 4Y91A 1RI0A 1KQSA 3OYIA 5FWBA 3H6ZA 1UDLA 5D6YA 2RA2A 3PIPA 3RIRA 4M75G 1KJWA 1SHGA 3X26B 5GAMj 3CCLT 2K5IA 4PLIA 2QEXT 2XG8D 3E9FA 2DBMA 2VKNA 2EAYA 3CCQA 2EJ9A 4BI3A 2VVKA 1M1GA 4IURA 4NL2A 1SEMA 3GP8A 4WCIA 1UHFA 3C94A 2XI9A 1U1TA 2ROLA 5DLOA 2VWFA 4GY5A 2X3WD 2KYBA 4DA4A 4E7HA 2KK4A 3FDRA 2PVDB 3RMQA 2LT4A 3QAYA 3QJ6A 1VQ6A 1TG0A 5I22A 2E70A 4N4IA 3NTIA 1R8OB 4ELZC 3G6ET 3UPUA 4B9WA 4C8QC 1AWXA 5CQXA 2VUBA 2DVJA 1KSWA 3DKMA 4AFUC 3OYJA 4E7IA 1Q7YC 1KQ2A 4JRKA 3L2UA 3VKIA 2PVOB 4IKFA 1U3OA 1OYXA 4JLIA 3PE0A 4GLKA 2BZ8A 4HVWA 4PJOG 2FRYA 3M0RA 3OBYA 4RCBA 3MEUA 2XK0A 4J6XA 1AWOA 1QCFA 3WVEB 5GAOm 3RKXA 2RN8A 1UUEA 2DMOA 4MZMA 3VS2A 2F5TX 3M4YA 3PNWC 2JM9A 4XK8E 4AFSC 4J9HA 3J80E 2E10A 1QVGS 1V29B 2HNIA 4L5GA 4C92G 5HKCA 2LMJA 3JB9J 1BI2A 3A8HB 3LGLA 4XTWA 2RK1A 2BZXA 2EWNA 4C92A 2HQEA 3TEEA 2EQMA 3NTKA 5LJ5j 1Q82U 1ZBJA 1M27C 2JS2A 4PL6A 4KULA 2DKGA 2FPDA 3OS0A 3OYNA 4J9EA 3ME9A 4JJNK 4UC4A 4BE2A 2XHCA 4FSXA 1KFZA 1JRIA 2A28A 3BFMA 4EFDA 2DO3A 4RTZA 3JB9I 1Z9QA 2MI6A 1Z9ZA 2PUOB 4BINA 1J3TA 2R5MA 4A63B 4OVAA 2RH2A 2XDDA 1WX6A 2LZ6B 1K8AC 3JCMg 1KC8U 3CC7A 1KD1C 1Q86C 2NLUA 2MAMA 1X6GA 1M3BA 3JCMb 2O01E 4C8QA 1JO8A 3OYEA 2FPEA 2B8AA 2M1HA 3VU3C 2Y4YA 3CPWA 4Z89A 1M3CA 1JQQA 4L59A 1YN8A 3RUXA 2RB6A 2KEAA 4IIMA 3QPHA 4LNPA 5LJ5d 1YJWT 5FLXE 4LUDA 2CS7A 2YHTA 2HD0A 4XTZA 2CZ6B 4YTLA 5FROA 1YWOA 2L8DA 2CT3A 2XKOC 2D0NA 4C5IA 2FB7A 4MDXA 2DJQA 3UA6A 2A08A 4C5GA 4M78B 2XDBA 2RQUA 4N4HA 1M30A 2C0TA 3CCSA 3CC4A 3ZL7C 1UGRB 2XDPA 5GMKh 1ZX6A 3LYIA 3MEAA 3EFSA 3CQTA 4QW2A 1K9MU 1EFNA 4IUUA 3CCJA 3PT9A 4E7KA 3VJPA 4JZ4A 1QKWA 1ZUUA 3CD6T 4BUGA 3REAB 3E19A 4Y28E 2JTFA 2K57A 4ELYC 2LC4A 3CC7T 3J7AF 3FJ5A 2QI2A 3JCMP 4WF2A 4NL3A 3QJYA 3KXTA 1JJ2S 3OSSC 3QWYA 1M8MA 2CREA 4XU1A 1BKBA 2BIVA 3H41A 4Z02A 4TVRA 4RMOA 3OW2A 4JRPA 4EMHA 4A4EA 4CI0C 2AHJB 4EMKC 1BIAA 1KHIA 2DRKA 3FIFA 1UJ0A 2XICA 4JLGA 4HCBA 4E7LA 5GANg 1AOJA 3PVLA 4JRQA 1ZSGA 5GANe 1GBQA 4OB1B 4II1A 4M75E 1OI1A 3PFSA 1D3BB 1WXBA 2DD5A 2YT6A 1GL5A 1K0XA 3CCUT 2YUNA 4J7IA 2RI2A 1X75C 3M0PA 4CC3A 4ZGEB 5A0GA 5HY6A 3UT1A 4N0AA 3PTAA 2W10A 2RQRA 2ZPEB 4OMNA 3RERA 4XAXB 3E9GA 5GMKe 3M0QA 4C8QG 2ECZA 5IN1A 3VRYA 5IT9E 2CZ0B 1I8FA 4JRIA 3I5SA 1ABQA 2DA9A 5GANj 1M8VA 2CSQA 2VV5A 2L89A 4C8QD 4C0DC 1VQKA 2RNAA 1VQPA 3G4SA 4F14A 1FXXA 2GGRA 3O8VA 3J81E 2FRWA 5I2SA 2KR3A 4RG8A 4C0FA 1YJNT 3CBOA 2D1XA 1ZQ1A 4M7AB 1MGQA 2DEQA 5LJ5h 5GANd 5CK9A 4EIKA 3QZ5B 1H641 2VXFA 4BDYA 4ZTJA 3E1SA 4F16A 2DLPA 4OMPA 4C92C 5AYFA 1QWEA 4Q5WA 3OA6A 1AHJB 2BKDN 1TUCA 2GBQA 3EG3A 2CYZB 4AG2C 2KGTA 4AG1C 3OYYA 5GANf 5GMKm 2QDYB 4CC7A 2RQVA 1V1CA 2F2WA 2EJFA 1YJ9T 2DL7A 1N9RA 5FW9A 4JS5A 2OJ2A 1KQ1A 4OB3B 1NLOC 1H3HA 3QDRB 2RHUA 2M16A 3LWIA 2EGCA 3X28B 1ZLMA 4DEXA 4A4GA 2V1RA 1VQLA 2VYTA 5GAOr 2X4JA 1A0NB 2V1QA 4IUVA 1GRIA 4M78A 5A0DA 4HKEA 1QVFS 3C12A 4M78F 4KBMB 3MP1A 1VQKT 3CZXA 4KUIA 1OPKA 1B34B 3DB3A 3I55A 1K73U 1FMKA 1NYFA 1VQ8A 2RJEA 3CCRA 5GAMf 2PNIA 4DEYA 3CCST 2Y4XA 3EAEA 3JB9D 2GNCA 4J83A 5LJ5g 4JDSA 2EGAA 4M77C 2DJZA 3LGFA 5GMKl 4M7DE 3OS2A 2KXDA 1WQ7A 1JWQA 3G4ST 4V2SA 4X34A 4EPCA 3TVTA 3I35A 5IHIA 5GAN3 4M7AE 2K7AA 1N27A 5LL6S 2DL3A 3EG2A 1ZUKA 3OB9A 3URGA 1RLPC 1Y96A 5M9OA 3WVDB 1UHCA 3CCUA 3P8BB 1WJRA 2CDTA 1Y0MA 2H3JA 4M77F 1H92A 5A2QE 1OPLA 3REBB 2YDLA 3SD4A 2GFAA 2EQUA 2RO0A 5I21A 2JZ2A 3JCMd 2RJDA 2D9TA 2K2VA 3ZEHA 3CCEA 4M7DG 2GQVA 2DTIA 3PMTA 4QVCA 1IZ6A 3JCMh 3NTHA 1YIJA 3TREA 1S1NA 3VS0A 2PQWA 2LCCA 1K4US 4M7DA 4C8QF 3V7CA 2O2OA 1OEBA 5EMIA 1VYVA 2AKKA 3M0SA 1UJYA 3I56A 4JJBA 2RK2A 3M4GA 1OZ2A 4Y92A 2M9UA 3I9QA 3FRNA 3M55A 2YLCA 2A36A 2DNUA 2RM4A 2WSFE 2DPPB 3NFCA 3T9NA 1JJ2A 5GAOp 4M7AC 2JTEA 4C0ZA 4JJDA 1WA7A 2C0OA 3RKYA 1PNJA 1G3YA 3OW2S 2JUFA 3CC2T 5FWCA 1U5SA 2KRMA 1G83A 2DTOA 4M75C 1GBRA 2O4XB 1UG1A 4ZTFA 5GMKi 2F2VA 2EYYA 1W1FA 2MCNA 1UFFA 3QWXX 2ZPBB 1SRLA 5CKDA 1MV0B 2ZCFB 2DL5A 3LLRA 3G7ZA 4OMLA 5IHNA 2DXBA 2SRCA 5GJVB 3QXEB 3FEOA 3NE8A 1SPKA 3OYBA 1M90U 1PKSA 2A37A 5L23A 4BACA 5FRMA 1H3ZA 3QBYA 1GCQA 2LQ8A 4MZPA 2RD1A 4JUVA 2K3XA 3PVQA 3CCLA 2I0NA 1JXOA 3ZFJA 5C6SA 2OTJT 2CUDA 2F5KA 3HSBA 1CKAA 1PSFA 4LE9A 4RTVA 2KSSA 1PSEA 3H8ZA 3FB9A 3EGUA 2DAQA 2E5QA 5DM7R 1NLPC 4QVDA 1NE8A 4LD6A 3HRUA 1KQSS 4R0KA 2EQJA 1I1JA 1U06A 2KAFA 4O6JA 2YUQA 3JCMc 2FL7A 3JCMJ 4O5VA 4C8QB 2EW3A 2WSCE 2J05A 3MHXA 3GPLA 3R6OA 2EKOA 1WLPB 2HSPA 4GLMA 2E12A 3JCMQ 1JB0E 5GAMg 4BY6C 4N0AC 1W70A 1XQHA 3NHNA 4GBQA 3H0FA 2K5FA 1VQMA 2JT4A 3OY9A 2QQAA 2FVUA 5GAN4 3GF5A 4FT2A 4M7DD 3OMGA 2A3LA 3O5ZA 1UGQB 2C06A 1X6OA 1UTIA 4KUDK 2O9SA 1YCSB 1HSQA 2DTHA 2PUKB 2RQTA 1WGSA 1WJQA 2YLBA 3L2ZA 2KY9A 2KT8A 3A98A 3ER0A 4IIOA 1VQ7T 3MO8A 4J9FA 3QYGB 4M7DC 1G2BA 3WXMB 4D8DA 3MEWA 5HK0A 1JEGA 2EJGA 1QVFA 5EG2A 3VS1A 4LDVA 2EFIA 1K8AU 3CCMT 2DD4A 2LRQA 3JB9F 4A53A 1I07A 2KMTA 2HEQA 1T0HA 2A7YA 3HL8A 2PVGB 2DXCA 2CH4A 4X9DA 1AZGB 1YP5A 2AZVA 1XTDA 3LH0A 1YWPA 4M78D 4BE1A 3JCMW 1YJ9A 4J9CA 1W4SA 3VS4A 3X25B 3VS7A 2RJCA 2YUOA 4AFQC 2EGEA 1WI7A 5GAN7 4NS5A 2RHIA 1VYUA 4RUGA 2QQSA 4RTUA 5LJ3h 1QLYA 4BE0A 4HCKA 2XU8A 4C5HA 2QXFA 1WXUA 3OQ5A 4F7UE 3M0UA 2M51A 2F69A 4ZNXA 3A8GB 5GAOl 1GCPA 3FJPA 3FC3A 2FEIA 2XMFA 5CKEA 3MP6A 2E6ZA 3I5RA 2DF6A 3OYDA 4RTWA 1S72T 1UGSB 4NOYA 2ZZDA 1MV3A 1ARKA 2WACA 1S72A 2LDMA 4XTYA 3X24B 2G6FX 2VGNA 1BBZA 1LOJA 5EC7A 3FLGA 1VQPT 3F70A 3CXCA 4M7AA 3QKJA 4F7UG 3ULRB 2ABLA 1SSHA 1ZHIA 3JCMf 1RUWA 4EDUA 1UEBA 1QWFA 1DJ7B 1K76A 4C5EA 2KT1A 4F7UA 2FHDA 2LVMA 1X2KA 4LDWA 3I55T 2JS0A 4OMQA 3M58A 1PRMC 4DOWA 5C0MA 2ZPHB 3H0HA 1WNLA 1VQOT 2ENMA 1RLQC 1KIKA 4JPBW 1MHNA 5GAN5 2CUBA 1Y96B 3HFOA 5FRNA 3M9QA 1NEGA 1Q81C 5GAMe 1VQ5T 2AKLA 1VQ8T 1TH7A 3THKA 3S3NA 3QO3A 1N8RU 2L3SA 2V8JA 2JMAA 3JV3A 3KUFA 4MZTA 4CRIA 2LQKA 2CT4A 1JU5C 5GANh 1EIFA 4KRTA 4E7JA 2OTLT 2FO0A 2O9VA 3JCMV 4XQ3A 2O4XA 1QVPA 3GNGA 3HFNA 1KC8C 5LJ3d 2LNHB 1B34A 2RPNA 5KCHA 4M6IA 2EYWA 1LJOA 2GTOA 3TSWA 4RN7A 5CIUA 4M77G 3CBPA 2CH4W 2D8HA 2D8JA 2ZPFB 1I81A 2E5KA 2DM1A 1MUZA 2DK3A 4PJOD 5I2MA 3CPFA 1NJIC 2RMOA 5GAOq 2E1HA 3LW5E 2C0IA 4M7DF 4LQ6A 1QP2A 3A8MB 2JMCA 1YITA 2GTJA 4HT9A 2X4XA 4M7AF 3QHSA 1QKXA 5CO7A 2VGMA 4A4KA 4M6HA 2NWMA 3EHRA 5KCOA 2YSQA 2X4YA 4OMOA 5LJ5f 4HVUA 5J39A 2ODFA 5LJ5e 2R5AA 4PJOB 2X35A 4ZN1A 1KHCA 1NPRA 1M3AA 4IUQA 1ZUYA 2XIDA 2FYKA 2HQXA 5LJ3f 1SHFA 2B86A 4OB0B 1K1ZA 3MP8A 4BD3A 2PU9B 3GIBA 2EPDA 2DZ9A 4MMLA 2K9GA 1VQLT 1I0CA 4QVZA 2MWOA 2J06A 1GXIE 2HBPA 3CCMA 3CBMA 2IIMA 4VUBA 1N9SA 3META 4C92E 5GAMh 3HRSA 2DXUA 1YNZA 2NUZA 5CAIA 4LDYA 2JN0A 4EMGA 4K11A 2XD0A 5GMKj 5HK3A 3BY7A 1N5ZA 2V8KA 3VYGA 2R58A 3UDCA 1E7OA 5D6WA 4OB2B 3OMCA 4ORZA 4HVVA 4M75F 4RTXA 4B9XA 2KRSA 3MCAB 2MMPA 1CSKA 1BYMA 5IH2A 2K6DA 2QA4A 1FWZA 4PNOA 4C8QE 1AWWA 1OV3A 4R56A 2RI5A 2DL8A 3INZA 3EG1A 4XTUA 1WPYA 1Y57A 4D6WA 3EHQA 3PGGA 3CCQT 1YHQT 3HRTA 4M77A 2LJ1A 4MDWA 1TUDA 2E64A 4M77B 2GCXA 2P0KA 2DBKA 4L6V5 1H8KA 4HCZA 3OYHA 1K9AA 1M5Q1 4PJOF 4OMFB 4M77D 3Q1JA 1VUBA 4ZGDB 4M4ZA 2DRMA 1X69A 2VXEA 2ESWA 3X20B 3JCMe 4J5YA 3VS5A 4N4GA 4EMKA 2KE9A 2P0PA 4J6YA 3L42A 1X6BA 3QSUA 1E6GA 3OYCA 1LCKA 2QTXA 1G3SA 3QG1A 4C0DB 2X4WA 2KNBB 4BY6B 2ED0A 3GLXA 2BUDA 3OS1A 4M7AG 1UGVA 4R55A 1BIBA 1RI9A 4OMMA 5GAN8 2EYQA 4XTXA 2ROTA 4F17A 1Q81U 2O31A 2OTLA 1YI2T 2J6KA 1FX7A 2R57A 3M0TA 3CCVT 4C92D 1IO6A 3G6EA 2P4RA 1D3BA 1GFDA 2PTKA 2OAWA 3CCET 2OI3A 4FSSA 4MMKA 1P92A 3DLMA 2E65A 1AVZC 1WIEA 4PKCC 3OYAA 2HCKA 2RF0A 3A8OB 4M75A 3VUBA 3KBGA 3JB9H 2PZ1A 2LTOA 2D6FA 2JNGA 4C0GA 3RESA 1NZ9A 3EFRA 1O9SA 4CC2A 2JOYA 5I11A 5GJWB 1WFWA 2CZ7B 5CKBA 5FU6B 3JB9G 3JCMX 4M78C 2GQIA 3P8HA 2L0AA 3OBWA 5D6XA 1VQ6T 4EMKB 1VQ5A 3OS5A 3N5BB 1G3WA 1BB9A 3BDLA 3DLLA 3SDZA 3CD6A 3S3OA 2DXTA 3AHUA 2EIFA 5GAMd 1WJSA 2RI3A 3NPFA 1YJWA 5IAYA 1NJIU 4PJOE 1JBMA 4P5NA 1BK2A 2AK5A 1YHQA 2DX1A 4HCCA 4JS4A 4J9IA 1K0SA 2WSEE 5IXBA 5KE2A 4XTVA 1NEBA 4KT0E 3GBQA 1T0JA 4IUPA 4XU3A 2KROA 1VIEA 3CPWS 2K3YA 2HAXA 1VYTA 1HJDA 4F7UF 2HC9A 4OGEA 4IUTA 2W0ZA 3VS6A 2LCLA 3OYFA 2DYBA 4JZ3A 4FM4B 4LDUA 3RNJA 4FIBA 3LH5A 2EVRA 1QW1A 2Y90A 3M53A 2OAUA 3KFVA 2F2XA 4A54A 3PIOA 2O88A 1WYXA 2V8IA 1G5VA 1PKTA 2AZSA 4Z8AA 1YJNA 2EQKA 2H8HA 3SWNC 3HP9A 3V8KA 3RBBB 1Y71A 3CMEA 2MIOA 4F7UB 2LNVA 1X43A 4HA8A 2J6FA 3HPWA 4XU0A 4AFZC 5IHKA 1B3QA 2ED1A 5ECAA 2I2LA 2LQNA 1U1SA 5LJ3j 4J7FA 2YUPA 1M1KC 4BB7A 2EBPA 3QUIA 3VV0A 2L5QA 3M57A 3A5ZB 1LNXA 3JSCA 3P8DA 1UGPB 3G71A 3L2QA 3GNFB 3S6WA 4DOVA 4C92B 1W2BS 1Q82C 4C92F 1YCYA 2CGHA 1VQMT 4J9BA 4OF1A 1T3SA 1I5LA 4JJCA 4A4FA 2KXCA 5LJ3e 2K4YA 2YRVA 2QDLA 3V8JA 1AEYA 4RTTA 5FU7B 5KE3A 4PJOC 1VIFA 4J9GA 2LQWA 2KDSA 2JXBA 1M90C 4ZGJB 3TCJA 2J7IA 5A0LA 2RJFA 2JW4A 3CEYA 3CMET 5J3BA 5L8RE 3HKSA 4M75B 2GFUA 1X01A 2RHYA 5KH6A 5J26A 1Q86U 1QP3A 5DY9A 3M56A 5DLQE 3CMAA 2LCSA 1YI2A 2LX7A 1I4K1 2JM8A 2EKHA 2RQWA 1CKBA 2EYXA 3SB2A 2Q7SA 3QYHB 3OYMA 1BI3A 4OGCA 1M9SA 2MF2A 4BDZA 4PJOA 1PWTA 2L3RA 3I56T 1JXMA 1X27A 3TU4K 3UA7A 3PMIA 2QQBA 2SEMA 1VQ4T 4DQ2A 2D0QB 3OSVA 4M78E 4FL6A 2CSIA 5CKHA 2VC8A 2LX9A 3CCJT 2KVQG 4ME7A 1VQ7A 4ATOA 1Y7XA 4HXJA 5GAN6 1W6XA 2K2MA 3L2WA 4BI4A 3BW1A 2DIQA 4QT7A 3M54A 3CCRT 3TSZA 3RKWA 2RHXA 1IREB 1E6HA 2MWPA 4X9CA 4CC4B 1BI1A 2DL4A 2DZCA 2FG0A 3CMAT 2LJ0A 2QA4T 4RKUE 3CXCS 2JTMA 3R6NA 2CZ1B 1O75A 2QQ9A 1PHTA 3L2VA 1Y07A 3OYLA 3JRZA 3QZ9B 4RG2A 3SWNA 4D8KA 2X3XD 3M59A 1M1FA 3V7SA 1AZEA 3V7RA 2L3QA 3UATA 3CC2A 2CKKA 1G3TA 1SSFA 3ASKA 2QQRA 4PLLA 1NYGA 2LJ3A 2HB6A 2LT1A 2KRNA 3CCVA 1YITT 2EYZA 1T3LA 5FU7C 1KG1A 1Q7YU 1HD3A 1HK9A 4XU2A 1M4ZA 2HBWA 3SFMA 1SRMA 3M5AA 2L2PA 5CQYA 1X2QA 5CVIA 2P4TA 4M75D 2L3PA 4J9DA 3U23A 3JAME 2P0QA 1ABOA 3DB4A 3VYHB 1OZ3A 5HCKA 1VQNT 1WQWA 3RMSA 3ZBDA 3C0CA 4M6GA 2ZPGB 1N6AA 5GAN2 3S3MA 1WXTA 1QVGA 5GAOn 3H0IA 1BU1A 5CR2A 4QQ6A 4RCCA 3C95A 3SHWA 3L1AA 1AWJA 4M77E 1ZBXA 2KBTA 4QQDA 3BDUA 2E6NA 3HHTB 1VQOA 3UF4A 2IVWA 3MEVA 3NMZC 1XNIA 4J8OA 1B07A 4OP0A 5IXFA 1U8RA 2K79A 3IQLA 1VA7A 1HXDA 4BI8B 2K5LA 2JVVA 3GOXA 4LUEA 1AD5A 2DIGA 1GCQC 3UWNA 3VS3A 1WDXA 5CKFA 2M0YA 3LX7A 2G3RA 1VQ9T 4FU6A 1N8RC 2GF7A 4ESRA 4E47A 1NM7A 4FT4A 3QIIA 2HDAA 3LWHA 4LN2A 2ZPIB 4M7DB 4A4HA 3G71T 1YBYA 1M1KU 1RL2A 2KQWA 3VUZA 2IG0A 1VQ4A 1W2BA 2J6OA 1BI0A 1OOTA 2EQIA 3C4SA 4M78G 3VRZA 2K3BA 2BTTA 2KYMA 3OYGA 3L2RA 4LD9K 2DE0X 1UE9A 3NGPA 5FU6C 3A8LB 4J6WA 5LJ3g 1NG2A 1YIJT 1XOVA 4M7AD 1VQNA 2FPFA 1UB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTW A;  4Z88 A;  1BK2 A;  2AK5 A;  2DX1 A;  1MV3 A;  1ARK A;  2FRW A;  4RTY A;  2LP5 A;  2KR3 A;  2D1X A;  4J9I A;  1K0S A;  4E6R A;  2G6F X;  1UEC A;  1BBZ A;  3SEM A;  5EC7 A;  5IXB A;  2MOX A;  2BZY A;  1NEB A;  4EIK A;  2DIL A;  3GBQ A;  4X1V A;  1T0J A;  4F16 A;  2KRO A;  3EG0 A;  2DLP A;  4OMP A;  1QWE A;  1VYT A;  1FYN A;  1HJD A;  1TUC A;  2GBQ A;  3EG3 A;  3ULR B;  2ABL A;  1PRL C;  1SSH A;  1RUW A;  1GFC A;  2W0Z A;  4AG2 C;  3VS6 A;  1QWF A;  2KGT A;  2DYB A;  4JZ3 A;  4AG1 C;  1K76 A;  3RNJ A;  2KT1 A;  3LH5 A;  5FWB A;  2EVR A;  4CC7 A;  1X2K A;  2RQV A;  1UDL A;  1V1C A;  2F2W A;  3KFV A;  2F2X A;  2JS0 A;  4OMQ A;  2DL7 A;  5FW9 A;  2OJ2 A;  1KJW A;  1SHG A;  1PRM C;  1NLO C;  1H3H A;  2O88 A;  1WYX A;  3H0H A;  1PKT A;  2AZS A;  2EGC A;  4Z8A A;  1ZLM A;  2DBM A;  2ENM A;  2VKN A;  1RLQ C;  1KIK A;  2H8H A;  4JPB W;  4DEX A;  2CUB A;  1NEG A;  2VVK A;  3RBB B;  2V1R A;  2MIO A;  1SEM A;  1X43 A;  2AKL A;  2J6F A;  4WCI A;  1UHF A;  1A0N B;  2V1Q A;  3THK A;  1GRI A;  2ROL A;  4AFZ C;  2L3S A;  2VWF A;  2JMA A;  3JV3 A;  3CZX A;  5IHK A;  1B3Q A;  2CT4 A;  2ED1 A;  1JU5 C;  1OPK A;  2X3W D;  5ECA A;  2KYB A;  4KRT A;  2LQN A;  1FMK A;  1NYF A;  2FO0 A;  2O9V A;  2PNI A;  2YUP A;  4DEY A;  2GNC A;  2EBP A;  2LNH B;  2EGA A;  2RPN A;  3QAY A;  2KXD A;  1TG0 A;  5I22 A;  4M6I A;  2EYW A;  2GTO A;  1JWQ A;  3TSW A;  4RN7 A;  3TVT A;  3I35 A;  5IHI A;  2K7A A;  1AWX A;  2DL3 A;  3EG2 A;  1ZUK A;  2CH4 W;  2D8H A;  2D8J A;  2DVJ A;  4J9B A;  1KSW A;  1RLP C;  1T3S A;  2E5K A;  2DM1 A;  1UHC A;  4AFU C;  4JJC A;  1MUZ A;  2KXC A;  2CDT A;  1Y0M A;  1H92 A;  2QDL A;  1AEY A;  4RTT A;  1OPL A;  3REB B;  2YDL A;  2RMO A;  4J9G A;  1U3O A;  2C0I A;  2LQW A;  4LQ6 A;  3PE0 A;  2BZ8 A;  2JMC A;  4HVW A;  2FRY A;  2GTJ A;  3M0R A;  1S1N A;  2JXB A;  1AWO A;  1QCF A;  3VS0 A;  2J7I A;  1K4U S;  1QKX A;  2RN8 A;  1UUE A;  2DMO A;  2JW4 A;  2O2O A;  1OEB A;  3VS2 A;  1VYV A;  5EMI A;  2JM9 A;  4M6H A;  2NWM A;  3EHR A;  2AKK A;  3M0S A;  4AFS C;  1UJY A;  2YSQ A;  4OMO A;  4J9H A;  4JJB A;  4HVU A;  4Y92 A;  2ODF A;  3I9Q A;  2A36 A;  2DNU A;  2LMJ A;  2BZX A;  1M3A A;  1ZUY A;  2JTE A;  1SHF A;  4JJD A;  2LCS A;  2B86 A;  2LX7 A;  1K1Z A;  1WA7 A;  2C0O A;  1PNJ A;  1ZBJ A;  2JM8 A;  1M27 C;  2EKH A;  1U5S A;  5FWC A;  2KRM A;  2JS2 A;  1CKB A;  1G83 A;  2EPD A;  2RQW A;  2EYX A;  2Q7S A;  2K9G A;  1I0C A;  1GBR A;  2J06 A;  1PWT A;  1UG1 A;  2FPD A;  1JXM A;  2F2V A;  1X27 A;  2EYY A;  3UA7 A;  1W1F A;  4J9E A;  2MCN A;  1UFF A;  3QWX X;  2IIM A;  2SEM A;  1SRL A;  1KFZ A;  1MV0 B;  2CSI A;  2DL5 A;  2A28 A;  1YNZ A;  2NUZ A;  4OML A;  5IHN A;  4RTZ A;  1Z9Q A;  2SRC A;  5GJV B;  1Z9Z A;  3NE8 A;  4K11 A;  1SPK A;  4BIN A;  1J3T A;  4HXJ A;  1N5Z A;  1W6X A;  2K2M A;  4A63 B;  1E7O A;  1PKS A;  2A37 A;  5L23 A;  1WX6 A;  2LZ6 B;  4ORZ A;  4HVV A;  4RTX A;  1GCQ A;  4QT7 A;  2KRS A;  3TSZ A;  1E6H A;  1CSK A;  3PVQ A;  5IH2 A;  4CC4 B;  1X6G A;  1JXO A;  2DL4 A;  2I0N A;  1M3B A;  2K6D A;  2FG0 A;  1JO8 A;  2LJ0 A;  2FPE A;  2CUD A;  1AWW A;  1OV3 A;  2DL8 A;  3R6N A;  3EG1 A;  1CKA A;  4LE9 A;  4RTV A;  1PHT A;  1Y57 A;  3EGU A;  4Z89 A;  3EHQ A;  1M3C A;  1JQQ A;  1NLP C;  4D8K A;  2LJ1 A;  1YN8 A;  2X3X D;  4R0K A;  2KEA A;  4IIM A;  1AZE A;  1TUD A;  2L3Q A;  4LNP A;  3UAT A;  4LUD A;  1I1J A;  2DBK A;  1U06 A;  1NYG A;  2LJ3 A;  2YUQ A;  1YWO A;  2CT3 A;  2KRN A;  2D0N A;  1H8K A;  1K9A A;  2EYZ A;  2EW3 A;  1T3L A;  2J05 A;  2DJQ A;  3UA6 A;  1HD3 A;  1WLP B;  2A08 A;  2HSP A;  2HBW A;  1SRM A;  2L2P A;  4GLM A;  2RQU A;  1X2Q A;  4M4Z A;  2DRM A;  2L3P A;  1X69 A;  4J9D A;  1M30 A;  2C0T A;  3U23 A;  1ABO A;  2ESW A;  3ZL7 C;  5HCK A;  1ZX6 A;  1W70 A;  3VS5 A;  3NHN A;  4GBQ A;  2KE9 A;  3C0C A;  3CQT A;  3H0F A;  1X6B A;  1EFN A;  4M6G A;  2JT4 A;  4JZ4 A;  1E6G A;  1QKW A;  1ZUU A;  1LCK A;  1WXT A;  3H0I A;  1BU1 A;  3REA B;  2KNB B;  3O5Z A;  2ED0 A;  3SHW A;  3FJ5 A;  1UGV A;  1AWJ A;  1UTI A;  2KBT A;  1RI9 A;  2O9S A;  1YCS B;  1HSQ A;  3QWY A;  4OMM A;  1M8M A;  2CRE A;  2RQT A;  3UF4 A;  3NMZ C;  2ROT A;  4F17 A;  1B07 A;  5IXF A;  2O31 A;  2KT8 A;  3A98 A;  3H41 A;  4IIO A;  2J6K A;  2K79 A;  3IQL A;  4J9F A;  3M0T A;  1G2B A;  1VA7 A;  4D8D A;  1IO6 A;  2P4R A;  1JEG A;  2DRK A;  1GFD A;  1UJ0 A;  4LUE A;  2PTK A;  2OAW A;  3VS1 A;  2OI3 A;  1AD5 A;  4FSS A;  1GCQ C;  1AOJ A;  3PVL A;  1AVZ C;  1WIE A;  1ZSG A;  1GBQ A;  3VS3 A;  1WDX A;  2M0Y A;  2HCK A;  2RF0 A;  1I07 A;  2HEQ A;  2PZ1 A;  1T0H A;  1WXB A;  2YT6 A;  1GL5 A;  1K0X A;  2YUN A;  4ESR A;  2CH4 A;  3M0P A;  1NM7 A;  4CC3 A;  1AZG B;  1YP5 A;  2AZV A;  2HDA A;  4CC2 A;  1YWP A;  5I11 A;  4LN2 A;  5GJW B;  1WFW A;  2GQI A;  4J9C A;  2L0A A;  3VS4 A;  2W10 A;  2RQR A;  3VS7 A;  4OMN A;  2J6O A;  2YUO A;  1OOT A;  4AFQ C;  2EGE A;  1WI7 A;  3M0Q A;  2EQI A;  1VYU A;  3VRZ A;  2ECZ A;  2K3B A;  1BB9 A;  4RUG A;  4RTU A;  2BTT A;  2KYM A;  3VRY A;  2DE0 X;  1UE9 A;  1QLY A;  3I5S A;  3NGP A;  1ABQ A;  2DA9 A;  4HCK A;  2CSQ A;  1NG2 A;  1WXU A;  3M0U A;  2M51 A;  3NPF A;  1XOV A;  4ZNX A;  2RNA A;  1GCP A;  2FEI A;  2XMF A;  4F14 A;  2FPF A;  3I5R A;  2DF6 A;  2GGR A; 
#chains in the Genus database with same CATH topology
 1RAA B;  2MYS A;  4QQG A;  2JLM A;  4R76 A;  4Z88 A;  1KD1 U;  1ZG8 A;  4RTY A;  2LP5 A;  4ZN3 A;  1M44 A;  2FVG A;  1QQ9 A;  3V8L A;  3CCM Q;  4E6R A;  2QEX A;  2ZGW A;  1UEC A;  3GIU A;  2BE9 B;  2M0O A;  3SEM A;  2HKQ B;  2VB6 A;  2MOX A;  2BZY A;  2OB0 A;  2CP2 A;  2DIL A;  1R43 A;  4HT8 A;  4X1V A;  2DVE A;  2OTJ A;  1VOM A;  2EBJ A;  3EG0 A;  4LDX A;  4KOS A;  1NPP A;  2VBQ A;  1K9M C;  3LD2 A;  2RHZ A;  1FYN A;  3OYK A;  5CCA A;  3T90 A;  3SWN B;  1PRL C;  1GFC A;  2E41 A;  1VQ9 A;  3CC4 T;  1K73 C;  4Y91 A;  1RI0 A;  1KQS A;  3OYI A;  4FCY A;  3IWW A;  3T8W A;  5FWB A;  1Q82 R;  4EVY A;  3H6Z A;  1UDL A;  5D6Y A;  2RA2 A;  3PIP A;  3FYN A;  3RIR A;  4M75 G;  4KSF A;  5CPA A;  1S72 Q;  3FXT A;  1KJW A;  1SHG A;  2BL1 A;  3X26 B;  5GAM j;  1CM0 A;  3CCL T;  3BXM A;  2K5I A;  3HLP A;  1C6V X;  4PLI A;  3TO7 A;  2QEX T;  2XG8 D;  3E9F A;  2DBM A;  5K8N A;  2VKN A;  5F09 A;  1V0C A;  2EAY A;  3CCQ A;  2EJ9 A;  4BI3 A;  1M1G A;  2VVK A;  4IUR A;  1JQG A;  4NL2 A;  1SEM A;  1VHS A;  4HKF A;  1I5O B;  4CYQ A;  3GP8 A;  3D8P A;  4WCI A;  1UHF A;  1QMC A;  3C94 A;  3I3G A;  4ZY0 A;  2XI9 A;  4FW1 A;  1U1T A;  2ROL A;  1XFO A;  5DLO A;  1QSO A;  2QML A;  1ELM P;  2VWF A;  5LRK A;  3CCQ Q;  2ZEG A;  4GY5 A;  5D7U A;  2X3W D;  4CYP A;  2KYB A;  4DA4 A;  4E7H A;  4IK2 A;  2Z11 A;  1VQ7 Q;  2KK4 A;  1Y9K A;  7AT1 B;  3FDR A;  2PVD B;  3RMQ A;  4PJL A;  2A4N A;  2LT4 A;  3KQZ A;  1YGH A;  3QAY A;  3QJ6 A;  1VQ6 A;  1FMW A;  1TG0 A;  5I22 A;  2E70 A;  4N4I A;  3GY9 A;  1RAD B;  2DPS A;  3NTI A;  4ONU A;  1R8O B;  4ELZ C;  2CNT A;  3PB4 X;  3S9N A;  3G6E T;  3UPU A;  4NCZ A;  4B9W A;  2CY2 A;  4C8Q C;  4RS2 A;  1AWX A;  5CQX A;  2VUB A;  2R1I A;  6AT1 B;  4RUH A;  2DVJ A;  1KSW A;  2Q4V A;  3DKM A;  1MMD A;  1Y0R A;  4AFU C;  3OYJ A;  4YGO A;  1OQK A;  3EO4 A;  3PEI A;  4E7I A;  5DWM A;  1Q7Y C;  1KQ2 A;  4JRK A;  3L2U A;  3PB7 X;  3VKI A;  2PVO B;  4IKF A;  1OU9 A;  2FT0 A;  1VQO Q;  3CCV Q;  4PSX A;  1LFW A;  2J8M A;  1U3O A;  2YWW A;  1R3N A;  1OYX A;  3TC8 A;  1ELL P;  4JLI A;  3PE0 A;  4GLK A;  2BZ8 A;  1Z8W A;  4HVW A;  4PJO G;  4CGM A;  2FRY A;  3M0R A;  3OBY A;  4RCB A;  3MEU A;  2XK0 A;  4J6X A;  1AWO A;  1QCF A;  3WVE B;  5GAO m;  4R6T A;  3RKX A;  2RN8 A;  3ISX A;  1UUE A;  2DMO A;  4MZM A;  6CPA A;  3M4Y A;  2F5T X;  3VS2 A;  3PNW C;  1VQ8 Q;  2JM9 A;  4XK8 E;  4AFS C;  2OU2 A;  4GXH A;  3R9E A;  4KVM E;  4J9H A;  1NE9 A;  3J80 E;  4PXE A;  2E10 A;  1QVG S;  1V29 B;  1G8X A;  2HNI A;  1QSN A;  4IHM A;  2GE3 A;  4L5G A;  4C92 G;  2HL5 C;  2NYS A;  5HKC A;  2VL1 A;  1WHM A;  2LMJ A;  3JB9 J;  2CXA A;  4A2Z A;  1BI2 A;  3A8H B;  3LGL A;  4XTW A;  3WR7 A;  1YW6 A;  3D7G A;  3T9Y A;  4MXU A;  4F0Y A;  2RK1 A;  2QTV A;  2BZX A;  2EWN A;  4C92 A;  3TT2 A;  2HL3 A;  2HQE A;  4XPK A;  3TEE A;  5H84 A;  3PRT A;  1OX8 A;  2E3H A;  2EQM A;  2NUT B;  3NTK A;  3EFO A;  4NGS A;  5LJ5 j;  1Q82 U;  1ZBJ A;  1M27 C;  2JS2 A;  2F7V A;  4PL6 A;  4KUL A;  3EGX A;  3TX8 A;  5DWN A;  4B6M A;  2DKG A;  2FPD A;  3OS0 A;  1R0C B;  3OYN A;  4J9E A;  2BE7 D;  3ME9 A;  4JJN K;  4UC4 A;  4BE2 A;  5D8N A;  2XHC A;  4FSX A;  1KFZ A;  4F0X A;  1S7N A;  1Q95 G;  2E3I A;  1JRI A;  2PJ6 A;  4X3R A;  2A28 A;  3BFM A;  4EFD A;  2DO3 A;  4RTZ A;  2Q7B A;  3JB9 I;  2QJ8 A;  1Z9Q A;  2MI6 A;  1Z9Z A;  1S7K A;  2PUO B;  4BIN A;  1J3T A;  1XBU A;  2ABZ A;  4OIW A;  2R5M A;  4A63 B;  4OVA A;  3B7I A;  2RH2 A;  4CRZ B;  2XDD A;  2B3U A;  1WX6 A;  2LZ6 B;  4DBR A;  2I00 A;  2XEF A;  1K8A C;  3JCM g;  1KC8 U;  3CC7 A;  3RAM A;  2AFO A;  4MJ8 A;  4BD9 A;  4P4F A;  3CC4 Q;  1KD1 C;  1Q86 C;  1BPM A;  4ZY2 A;  1OU8 A;  1MND A;  2NLU A;  2MAM A;  5AG4 A;  2FZK B;  2HZY A;  1K8A R;  1X6G A;  1M3B A;  3JCM b;  2O01 E;  2OH1 A;  4C8Q A;  1JO8 A;  3OYE A;  2FPE A;  2B8A A;  3RYO A;  1VKC A;  2M1H A;  3L2N A;  1ZSZ A;  1Z8T A;  1TS9 A;  3VU3 C;  2Y4Y A;  3CPW A;  1D1B A;  3S9L A;  3SJX A;  4Z89 A;  1M3C A;  1JQQ A;  4F8Z A;  1F1B B;  4L59 A;  8ATC B;  4MFL A;  1YN8 A;  3RUX A;  3IWG A;  2RB6 A;  2KEA A;  3PFE A;  4IIM A;  3QPH A;  4LNP A;  5LJ5 d;  1YJW T;  2B4D B;  4LUD A;  2CS7 A;  5FLX E;  2YHT A;  2HD0 A;  5A28 A;  4XTZ A;  2J9A A;  2CZ6 B;  1M1D A;  3VAT A;  4YTL A;  3KQX A;  5FRO A;  1YWO A;  3EC4 A;  2L8D A;  2CT3 A;  2XKO C;  2D0N A;  4C5I A;  4MFJ A;  2ZEO A;  2VZZ A;  4AMC A;  4ZYQ A;  1ZG7 A;  3SI2 A;  2FB7 A;  4MDX A;  3VH9 A;  2DJQ A;  1IID A;  3UA6 A;  2A08 A;  4C5G A;  4M78 B;  2XDB A;  2RQU A;  2PJ0 A;  4N4H A;  1M30 A;  2C0T A;  3CCS A;  3CC4 A;  2PJ7 A;  4NEX A;  3ZL7 C;  1UGR B;  2XDP A;  5GMK h;  1ZX6 A;  4P4I A;  2PVV A;  3LYI A;  3MEA A;  4F9V A;  3EFS A;  4YWY A;  3CQT A;  4QW2 A;  1K9M U;  1EFN A;  4IUU A;  5LYD A;  3CCJ A;  3PT9 A;  4E7K A;  3VJP A;  4JZ4 A;  4CYO A;  3D4U A;  1Z8X A;  1QKW A;  3DR6 A;  4MCP A;  1ZUU A;  4MHN A;  3EY5 A;  1IOF A;  3CD6 T;  4BUG A;  3E19 A;  3REA B;  4Y28 E;  2JTF A;  2K57 A;  4ELY C;  1HDQ A;  2LC4 A;  3CC7 T;  3J7A F;  3FJ5 A;  1XE4 A;  2QI2 A;  1HYO A;  4WF2 A;  4NL3 A;  3QJY A;  3JCM P;  1TKF A;  2PQ8 A;  4CGP A;  3KXT A;  1JJ2 S;  3OSS C;  3QWY A;  3NE7 A;  1M8M A;  2CRE A;  4XU1 A;  1BKB A;  2IPO B;  3ZZI A;  2BIV A;  2CTC A;  3H41 A;  4Z02 A;  4TVR A;  4RMO A;  3G71 Q;  3OW2 A;  2PJC A;  4JRP A;  4EMH A;  3W6S A;  4A4E A;  4CI0 C;  2FIW A;  4Y49 B;  3KHX A;  5CBM A;  2YGW A;  1IHW A;  2AHJ B;  1RAB B;  1BIA A;  1KHI A;  4EMK C;  2DRK A;  2JJ9 A;  3FIF A;  1UJ0 A;  2XIC A;  2P84 A;  1QVF P;  2COY A;  4JLG A;  3NA6 A;  4HCB A;  4E7L A;  1Q7L A;  1YQE A;  5GAN g;  3B2Y A;  1AOJ A;  1M2V B;  2QAZ A;  3PVL A;  4JRQ A;  1ZSG A;  5GAN e;  2XEJ A;  1GBQ A;  3S6G A;  4OB1 B;  1SG5 A;  3R1K A;  2HMA A;  4II1 A;  1IYL A;  4M75 E;  1OI1 A;  5J8C A;  3PFS A;  1D3B B;  1WXB A;  2DD5 A;  2C1C A;  1YW4 A;  2YT6 A;  3CCU T;  1GL5 A;  1K0X A;  2YUN A;  4IAV A;  1FY7 A;  4J7I A;  1L0C A;  5K8P A;  5KTA A;  2RI2 A;  1X75 C;  3M0P A;  3NFZ A;  1JJ2 P;  4CC3 A;  4ZGE B;  1LAM A;  5A0G A;  2ZW6 A;  1VIX A;  5HY6 A;  3UT1 A;  4XPD C;  2ZEF A;  4N0A A;  3VWE A;  3PTA A;  2W10 A;  2RQR A;  3CPW P;  2ZPE B;  4OMN A;  3RER A;  3CCL Q;  4XAX B;  3E9G A;  5GMK e;  3M0Q A;  3PP9 A;  4MY0 A;  4C8Q G;  3B3T A;  2ECZ A;  2Q43 A;  1ZO0 A;  5IN1 A;  3VRY A;  5IT9 E;  2CZ0 B;  8AT1 B;  1I8F A;  4R9M A;  2V8D A;  4JRI A;  3I5S A;  2GAN A;  3FBU A;  1ABQ A;  2Q4Y A;  2DA9 A;  5GAN j;  1R77 A;  2OZU A;  4ZY1 A;  1M8V A;  2CSQ A;  2VV5 A;  4B10 A;  2L89 A;  4C8Q D;  4C0D C;  1VQK A;  2Z0W A;  2RNA A;  1NSA A;  1VQP A;  3A1P A;  3G4S A;  4F14 A;  2O4H A;  1FXX A;  3MRU A;  1MMN A;  2GGR A;  2G0B A;  2ZAE A;  3O8V A;  2DXQ A;  4CGO A;  3J81 E;  2FRW A;  5I2S A;  1X12 A;  2KR3 A;  2POK A;  4RG8 A;  4C0F A;  1YJN T;  3CBO A;  2ZEP A;  5E96 A;  2D1X A;  4IUS A;  4Q7A A;  1ZQ1 A;  3K9T A;  3P2H A;  4M7A B;  1FMV A;  1MGQ A;  2DEQ A;  3F0A A;  5LJ5 h;  2PRB A;  5GAN d;  5CK9 A;  4EIK A;  3QZ5 B;  1H64 1;  3DR8 A;  3P2F A;  2VXF A;  4UIB A;  2YXY A;  4F04 B;  4BDY A;  4ZTJ A;  3E1S A;  4F16 A;  2YNE A;  3G3S A;  2DLP A;  4OMP A;  4C92 C;  5AYF A;  1QWE A;  4Q5W A;  3OA6 A;  1AHJ B;  4C7I A;  2BKD N;  2PR1 A;  1TUC A;  2GBQ A;  3EG3 A;  4KUB A;  5JQ4 A;  2CYZ B;  3RO0 A;  5KYW A;  4PQA A;  4AG2 C;  4TNU A;  2KGT A;  4AG1 C;  1TF9 A;  3OYY A;  5GAN f;  3DDD A;  3W6X A;  5GMK m;  1VQ6 Q;  3KGQ A;  2QDY B;  1YME A;  1Z5R A;  4CC7 A;  3DGV A;  2RQV A;  1V1C A;  2F2W A;  2EJF A;  3QDF A;  3D7D A;  1YHQ Q;  1ARL A;  1YJ9 T;  2DL7 A;  1N9R A;  1TUG B;  5FW9 A;  2E4H A;  2OJ2 A;  4JS5 A;  5IB0 A;  3MKD A;  1KQ1 A;  4OB3 B;  1MJB A;  1NLO C;  2BCO A;  1H3H A;  4X2T A;  4JD6 A;  3QDR B;  2RHU A;  1U6M A;  2M16 A;  1TF8 A;  1RO5 A;  2VZY A;  3BHX A;  3LWI A;  2EGC A;  3X28 B;  5G20 A;  1ZLM A;  1K4J A;  3FEE A;  4DEX A;  4A4G A;  1RAH B;  3G6E Q;  2V1R A;  1VQL A;  4LX9 A;  2VYT A;  3SI0 A;  5GAO r;  2X4J A;  1A0N B;  4OLL A;  1D1A A;  2V1Q A;  1GRI A;  4IUV A;  4M78 A;  5A0D A;  2Q51 A;  4HKE A;  1QVF S;  2XEI A;  3C12 A;  4M78 F;  4KBM B;  3MP1 A;  1AYE A;  3EFO B;  1VQK T;  2AFM A;  3CZX A;  4KUI A;  1OPK A;  1B34 B;  3DB3 A;  3I55 A;  1I12 A;  4E2A A;  1K73 U;  1FMK A;  1NYF A;  1VQ8 A;  2RJE A;  3CCR A;  5GAM f;  3KAS A;  2PNI A;  4DEY A;  3CCS T;  4E2F B;  2Y4X A;  3EAE A;  3JB9 D;  2G3A A;  2GNC A;  4J83 A;  5LJ5 g;  4JDS A;  2EGA A;  3SJG A;  2QEX Q;  4M77 C;  2DJZ A;  3LGF A;  5GMK l;  4M7D E;  3OS2 A;  2KXD A;  2WUU A;  1WQ7 A;  1JWQ A;  3G4S T;  2VQY A;  4UEE A;  4V2S A;  4X34 A;  4EPC A;  1MK4 A;  1WHH A;  3I35 A;  5IHI A;  3TVT A;  5GAN 3;  3CME Q;  4M7A E;  5GCN A;  1OX9 A;  1N27 A;  2K7A A;  5LL6 S;  3IU1 A;  2DL3 A;  4YRH A;  3EG2 A;  4R57 A;  1ZUK A;  3OB9 A;  3K9U A;  3GKR A;  4MFP A;  3URG A;  1RLP C;  1Y96 A;  5M9O A;  3WVD B;  3D2P A;  1UHC A;  3CCU A;  3P8B B;  1WJR A;  2CDT A;  1Y0M A;  2H3J A;  4M77 F;  1YJ9 Q;  2Z10 A;  1H92 A;  5A2Q E;  1OPL A;  4FW2 A;  3REB B;  2PC1 A;  2YDL A;  2OTL Q;  4MY3 A;  3SD4 A;  2GFA A;  2EQU A;  2RO0 A;  5I21 A;  2JZ2 A;  3JCM d;  4DJL A;  2RJD A;  2D9T A;  4P4D A;  2K2V A;  3ZEH A;  1IB1 E;  4XNH B;  1BCO A;  3CCE A;  4OC3 A;  4M7D G;  2GQV A;  2DTI A;  3PMT A;  4QVC A;  1IZ6 A;  3JCM h;  1EE3 P;  3NTH A;  1YIJ A;  2C6P A;  3BI1 A;  3UY5 A;  4C2Y A;  3TRE A;  1S1N A;  1TWB A;  2DER A;  4GS4 A;  1QSR A;  3VS0 A;  2PQW A;  2LCC A;  1CJW A;  3DLJ A;  1K4U S;  4OP4 A;  4M7D A;  4C8Q F;  3V7C A;  2O2O A;  1OEB A;  5EMI A;  1VYV A;  4KGV B;  1C0M A;  1QST A;  3IIB A;  2AKK A;  3M0S A;  1UJY A;  4FD6 A;  4KH0 B;  4KZT A;  3I56 A;  3BJ7 A;  4JJB A;  2RK2 A;  3M4G A;  4HNW B;  1OZ2 A;  4MBU A;  4Y92 A;  2M9U A;  3I9Q A;  3FRN A;  3M55 A;  2OZG A;  2YLC A;  2OZH A;  2A36 A;  2DNU A;  3JTK A;  2ZEH A;  1ZSZ C;  4PFZ A;  2RM4 A;  4QBJ A;  1P4N A;  2WSF E;  4FYW B;  4PXB A;  2DPP B;  3NFC A;  3T9N A;  1LAN A;  1JJ2 A;  2QGG A;  5GAO p;  4M7A C;  2JTE A;  4C0Z A;  4JJD A;  1X10 A;  2YND A;  1WA7 A;  2C0O A;  3RKY A;  4MMO A;  1G3Y A;  1PNJ A;  3OW2 S;  4QC6 A;  2JUF A;  3CC2 T;  3CDX A;  1VQ5 Q;  1MJA A;  5FWC A;  1U5S A;  2CIJ A;  2KRM A;  5IV0 A;  1G83 A;  2DTO A;  4M75 C;  1PD1 A;  2REF A;  2CP7 A;  4MHP A;  4OID A;  4KLV A;  1GBR A;  4KVX A;  4NFR A;  2O4X B;  2R8V A;  1UG1 A;  4ZTF A;  5GMK i;  2F2V A;  2EYY A;  1W1F A;  4YU9 A;  2MCN A;  3CPA A;  1UFF A;  3QWX X;  2Q44 A;  2ZEN A;  4DNC A;  2ZPB B;  5F46 A;  1SRL A;  5CKD A;  1MV0 B;  2ZCF B;  2DL5 A;  3LLR A;  3G7Z A;  4OML A;  5KYY A;  5IHN A;  2DXB A;  1NMT A;  2SRC A;  5GJV B;  2RFH A;  3QXE B;  4B14 A;  3FEO A;  2NMT A;  1H8L A;  2AT1 B;  3NE8 A;  1SPK A;  3OYB A;  4PXD A;  3FH4 A;  1M90 U;  1PKS A;  2A37 A;  3RDV A;  5L23 A;  4BAC A;  2AFW A;  5FRM A;  4IF5 A;  1H3Z A;  3QBY A;  4R3L A;  1GCQ A;  2LQ8 A;  5EC4 A;  3IWE A;  2P6F A;  4UFW A;  4MZP A;  2RD1 A;  4JUV A;  3LMS A;  5KYY B;  2K3X A;  1RXT A;  3PVQ A;  3EH1 A;  3CCL A;  2I0N A;  1JXO A;  3ZFJ A;  5C6S A;  4FBE A;  2OTJ T;  2CUD A;  1TU0 B;  2FL4 A;  2VXK A;  5LYI A;  2F5K A;  3HSB A;  1IY7 A;  1CKA A;  1PSF A;  4LE9 A;  4RTV A;  2KSS A;  2PR8 A;  1PSE A;  3H8Z A;  3FB9 A;  3EGU A;  9ATC B;  3S6K A;  2DAQ A;  3I55 Q;  2E5Q A;  5DM7 R;  3BI0 A;  4CGL A;  1NLP C;  4QVD A;  3CC2 Q;  1NE8 A;  3PB8 X;  4LD6 A;  3HRU A;  5AT1 B;  1KQS S;  3BLN A;  2RC4 A;  4KOY A;  4R0K A;  2EQJ A;  1ZA1 B;  5BWA B;  1YLO A;  1ZLH A;  1I1J A;  1U06 A;  2KAF A;  2BEI A;  1VGY A;  3D7S B;  4O6J A;  2YUQ A;  3JCM c;  1Y9W A;  2FL7 A;  3V7Z A;  3JCM J;  1TSF A;  4AB7 A;  3FX6 A;  1IB8 A;  4O5V A;  4C8Q B;  2EW3 A;  1M4I A;  2WSC E;  2J05 A;  3MHX A;  1VQ4 Q;  1S7F A;  4GM5 A;  3GPL A;  3R6O A;  2EKO A;  1IHV A;  1WLP B;  2HSP A;  4HNX B;  4E0A A;  4GLM A;  2E12 A;  4MHD A;  5G1Z A;  1AT1 B;  3JCM Q;  5AG6 A;  4A30 A;  1JB0 E;  3WC7 A;  1SKU B;  3RBU A;  2ZPA A;  3CT9 A;  5GAM g;  4BY6 C;  2VI7 A;  4N0A C;  3SJF A;  3OWC A;  1YFN A;  1W70 A;  1XQH A;  4LQG A;  1P0H A;  3G8W A;  4OC4 A;  2HV2 A;  3NHN A;  4GBQ A;  3H0F A;  2K5F A;  1VQM A;  1ON0 A;  1B6B A;  2JT4 A;  3OY9 A;  2QQA A;  2FVU A;  4NGQ A;  5GAN 4;  3B3S A;  3GF5 A;  2AFS A;  2G3T A;  3BJ8 A;  4FT2 A;  4M7D D;  2DF5 A;  3OMG A;  1PCX A;  1RAE B;  2A3L A;  2HQY A;  4UFX A;  3O5Z A;  5LYL A;  1UGQ B;  2C06 A;  1X6O A;  2F5I A;  1UTI A;  4KUD K;  2QA4 Q;  2O9S A;  1YCS B;  1HSQ A;  1QSM A;  2DTH A;  1D0X A;  1MMA A;  3ISZ A;  1ARM A;  2PUK B;  1WGS A;  2RQT A;  4P4J A;  1WJQ A;  2YLB A;  3L2Z A;  2KY9 A;  2KT8 A;  3A98 A;  3ER0 A;  4A32 A;  4IIO A;  1VQ7 T;  2JEW A;  3MO8 A;  3QYG B;  4J9F A;  4M7D C;  2Q0Y A;  2PJ9 A;  3NH8 A;  1G2B A;  2JDC A;  3WXM B;  2MPX C;  3MEW A;  1BCM A;  4D8D A;  5HK0 A;  2C6C A;  3EGD A;  5K8O A;  1JEG A;  2EJG A;  1QVF A;  2V8G A;  5EG2 A;  3VS1 A;  3N7Z A;  4AVB A;  4LDV A;  3C26 A;  4BMH A;  2EFI A;  1K8A U;  3CCM T;  1MNE A;  2DD4 A;  4L89 A;  2ATC B;  2LRQ A;  3JB9 F;  4A39 A;  4A53 A;  1I07 A;  2KMT A;  2HEQ A;  4NJQ A;  4F6A A;  4A94 A;  4UEF A;  1T0H A;  2A7Y A;  1N71 A;  3HL8 A;  4UCN A;  5I0C A;  2PVG B;  2DXC A;  1D0Z A;  2CH4 A;  4X9D A;  4H6Z A;  1AZG B;  1YP5 A;  2AZV A;  1XTD A;  3LH0 A;  1UFH A;  4KOR A;  4Q38 A;  3IO1 A;  1YWP A;  4M78 D;  4BE1 A;  3JCM W;  3WC5 A;  1YJ9 A;  4J9C A;  4O23 A;  1W4S A;  1YI2 Q;  3VS4 A;  3X25 B;  3VS7 A;  1SQH A;  2RJC A;  2YUO A;  2AE6 A;  4AFQ C;  2EGE A;  3LAC A;  1WI7 A;  4P4E A;  3ZJ0 A;  5GAN 7;  4NS5 A;  2OX7 A;  4UF4 A;  2RHI A;  4B5P B;  1VYU A;  3IEH A;  3B8G A;  4C7H A;  4RUG A;  2PIY A;  2QQS A;  4RTU A;  5LJ3 h;  4ANJ A;  1ZG9 A;  4CAE A;  4KGX B;  2PJA A;  2PVW A;  1QLY A;  4BE0 A;  4A31 A;  4HCK A;  1D09 B;  2XU8 A;  4C5H A;  2QXF A;  3TTH A;  1WXU A;  3OQ5 A;  5HVF A;  4F7U E;  3M0U A;  2M51 A;  2F69 A;  4ZNX A;  3A8G B;  4PJJ A;  5GAO l;  2Z3K A;  2ZEM A;  4FUU A;  4ORF A;  1GCP A;  3FJP A;  3FC3 A;  2FEI A;  4A38 A;  2XMF A;  5CKE A;  2PJ3 A;  4NGR A;  3MP6 A;  2E6Z A;  4U9Y A;  1J4J A;  3I5R A;  2DF6 A;  3OYD A;  4RTW A;  1S72 T;  5JPH A;  1UGS B;  4NOY A;  2ZZD A;  5KYW B;  1MV3 A;  2WAC A;  1S72 A;  1ARK A;  1XMT A;  3H8F A;  2LDM A;  4XTY A;  3DNS A;  3X24 B;  3SXN A;  2G6F X;  2VGN A;  1BBZ A;  1LOJ A;  1YK3 A;  5THW A;  3FLG A;  5EC7 A;  1VQP T;  3KR5 A;  3F70 A;  3TOB A;  3CXC A;  3EXN A;  4M7A A;  4DBH A;  4MCQ A;  4JZ0 A;  4FYX B;  5HVH A;  3QKJ A;  4F7U G;  3ULR B;  2ABL A;  2X9H A;  1SSH A;  2B4B A;  1ZHI A;  4CYN A;  3JCM f;  1RUW A;  3OW2 P;  3GUX A;  4EDU A;  1UEB A;  1QWF A;  2FS5 A;  2I79 A;  1DJ7 B;  1K76 A;  4FD4 A;  5HH1 A;  2QG9 B;  1D0Y A;  4C5E A;  2KT1 A;  4F7U A;  2FHD A;  2LVM A;  4B12 A;  4B13 A;  2O28 A;  1X2K A;  4U5Y A;  1CP7 A;  2KI7 A;  1NSL A;  2ZEL A;  2AIR B;  4LDW A;  3I55 T;  2JS0 A;  4OMQ A;  3M58 A;  2M02 A;  1YJN Q;  1PRM C;  4DOW A;  2DYI A;  4P4B A;  5C0M A;  2ZPH B;  2JBJ A;  3IFE A;  1VQN Q;  4UA3 A;  3H0H A;  4CPA A;  2QGF B;  1WNL A;  1VQO T;  4ZX9 A;  4A95 A;  2ENM A;  1RLQ C;  1KIK A;  4JPB W;  1MHN A;  5GAN 5;  2QVP A;  1Y96 B;  2CUB A;  3HFO A;  1IRX A;  5FRN A;  3M9Q A;  1NEG A;  1KWM A;  1VHE A;  1Q81 C;  1WWZ A;  5GAM e;  4P45 A;  1VQ5 T;  2AKL A;  3CPX A;  1VQ8 T;  1TH7 A;  2YNC C;  3THK A;  3S3N A;  3QO3 A;  1PM3 A;  2PE3 A;  5JGF A;  4OKO A;  1N8R U;  2L3S A;  3D7H A;  2V8J A;  2JMA A;  3JV3 A;  3KUF A;  1B7T A;  4MZT A;  4CRI A;  2LQK A;  1CPX A;  2CT4 A;  4CS0 B;  1JU5 C;  4EME A;  3S6F A;  5GAN h;  1EIF A;  4KRT A;  4E7J A;  2OTL T;  4ZI6 A;  1YVO A;  4AXV A;  2FO0 A;  2O9V A;  2BOA A;  3KL9 A;  3JCM V;  4XQ3 A;  2ANP A;  2DEA A;  2O4X A;  1QVP A;  3GNG A;  3HFN A;  1KC8 C;  4NGM A;  2X51 A;  2NYQ A;  5LJ3 d;  2VEZ A;  4KOU A;  2LNH B;  1F2P A;  1B34 A;  3EGD B;  4FD5 A;  2RPN A;  1KUV A;  3R9F A;  5KCH A;  2EUI A;  4M6I A;  2EYW A;  1LJO A;  2GTO A;  1A2Z A;  3E2U A;  1MMG A;  1XF8 A;  3TSW A;  4RN7 A;  5G22 A;  1RAC B;  2JDD A;  5CIU A;  2AFZ A;  3I9S A;  4M77 G;  4DBQ A;  3PB6 X;  2P6E A;  3CBP A;  2YNC A;  2CH4 W;  2D8H A;  1WHG A;  2D8J A;  4ZGY B;  5LYF A;  2ZPF B;  2ZOG A;  3IC1 A;  4WJB A;  3D68 A;  1I81 A;  4NGP A;  2E5K A;  2DM1 A;  1MUZ A;  2DK3 A;  4PJO D;  2YRD A;  5I2M A;  4L8A A;  2XEG A;  2CF4 A;  3CPF A;  1NJI C;  1TTH B;  2RMO A;  2E1H A;  5GAO q;  3LW5 E;  2C0I A;  4M7D F;  2JEV A;  4LQ6 A;  1QP2 A;  3A8M B;  2OR4 A;  4H6U A;  2JMC A;  2PCU A;  1YIT A;  3V8I A;  3TQ7 P;  2GTJ A;  1K73 R;  7CPA A;  4HT9 A;  2X4X A;  4M7A F;  3QHS A;  5EBV A;  1GYT A;  1QKX A;  5CO7 A;  5F48 A;  2VGM A;  1AUG A;  3EH2 A;  4A4K A;  4M6H A;  2NWM A;  3EHR A;  5KCO A;  3S6H A;  4A33 A;  4QVT A;  4OC1 A;  2X4Y A;  2YSQ A;  4OMO A;  5LJ5 f;  1VQM Q;  4WWV A;  4H89 A;  4JJX A;  1CP6 A;  1IGU A;  4HVU A;  5J39 A;  2ODF A;  5LJ5 e;  2R5A A;  1BLL E;  4MFK A;  2FZC B;  4PJO B;  1QMU A;  2P6G A;  1PCA A;  2PDO A;  1CX8 A;  2X35 A;  1EX4 A;  4ZN1 A;  1M4G A;  1KHC A;  1NPR A;  1SF9 A;  4OC5 A;  1M3A A;  4IUQ A;  1ZUY A;  2XID A;  3H8E A;  2FYK A;  2HQX A;  5LJ3 f;  1SHF A;  2B86 A;  4OB0 B;  1K1Z A;  3MP8 A;  4BD3 A;  4K30 A;  2PU9 B;  1IYK A;  1CG2 A;  3I1U A;  4R8F A;  3GIB A;  1Z4E A;  2EPD A;  3R9G A;  2DZ9 A;  4MML A;  2K9G A;  1VQL T;  1I0C A;  4QVZ A;  3D2M A;  4UWI A;  2MWO A;  2J06 A;  3PB9 X;  1GXI E;  2HBP A;  3CCM A;  4DUK A;  2QIR A;  2Z3O A;  3CBM A;  3TCV A;  2IIM A;  4VUB A;  1N9S A;  4LXC A;  2X7B A;  3MET A;  4C92 E;  5GAM h;  1YX0 A;  3HRS A;  4ZX8 A;  2DXU A;  3CCS Q;  1YNZ A;  2NUZ A;  4LDY A;  5CAI A;  1M1K R;  2JN0 A;  4EMG A;  2WPW A;  2FZG B;  4NF1 A;  1FT7 A;  4K11 A;  2XD0 A;  4U9Z A;  5GMK j;  5HK3 A;  3BY7 A;  1N5Z A;  1HDU A;  2AFU A;  2V8K A;  3VYG A;  1K9M R;  2R58 A;  3UDC A;  1E7O A;  5D6W A;  2G9D A;  4BBH A;  5C82 A;  4OB2 B;  1W2B P;  3OMC A;  4ORZ A;  4HVV A;  4M75 F;  4RTX A;  4B9X A;  2KRS A;  4B5O A;  4I49 A;  4JXR A;  4KSA A;  3MCA B;  2MMP A;  1XEB A;  2QK0 A;  1CSK A;  1VQL Q;  1BYM A;  5IH2 A;  2K6D A;  1KQS P;  2QA4 A;  1S60 A;  1FWZ A;  1Y7E A;  4PNO A;  4C8Q E;  1AWW A;  1OV3 A;  4R56 A;  2RI5 A;  3H9N A;  2DL8 A;  3INZ A;  3EG1 A;  1Q2Y A;  3FIX A;  5HVG A;  4XTU A;  3SI1 A;  1N8R R;  1WPY A;  2BUE A;  1M2V A;  1CBX A;  4OAD A;  1Y57 A;  1YRE A;  3EGX B;  2CP0 A;  3EHQ A;  4D6W A;  3PGG A;  3CCQ T;  1YHQ T;  3HRT A;  4M77 A;  2DFU A;  2LJ1 A;  4MDW A;  2IL4 A;  1TUD A;  2REE A;  2E64 A;  4M77 B;  2V77 A;  2GCX A;  1QCO A;  2P0K A;  2DBK A;  4P44 A;  3WAB A;  3TO6 A;  3CC7 Q;  4PFP A;  3V38 A;  2EO8 A;  4L6V 5;  5FVJ A;  2C27 A;  1H8K A;  1ZA2 B;  4HCZ A;  3OYH A;  1QVG P;  1ZLI A;  1K9A A;  4MFQ A;  3I56 Q;  2B5G A;  1M5Q 1;  1WHL A;  4PJO F;  3CXP A;  5DS0 A;  4OMF B;  4M77 D;  3Q1J A;  1VUB A;  4XPD B;  4M4Z A;  4ZGD B;  2DRM A;  1X69 A;  2VXE A;  4OAE A;  3FED A;  3B3W A;  2ESW A;  3X20 B;  1YSJ A;  2BSW A;  3JCM e;  4PJN A;  4J5Y A;  2NUP B;  2PJ1 A;  3VS5 A;  4N4G A;  1KZF A;  3KI9 A;  4HPS A;  4EMK A;  3S9M A;  2KE9 A;  2P0P A;  4J6Y A;  3L42 A;  1X6B A;  3QSU A;  1E6G A;  3OYC A;  1LCK A;  2QTX A;  5G21 A;  3RNZ A;  1G3S A;  3CXS A;  2GRE A;  3QG1 A;  4H2K A;  3FNC A;  4Y49 C;  3EG9 A;  4E7Z A;  4C0D B;  2X4W A;  2KNB B;  1YIJ Q;  3CCR Q;  4BY6 B;  2ED0 A;  3GLX A;  2BUD A;  3OS1 A;  4M7A G;  1UGV A;  4R55 A;  2ZW5 A;  1BIB A;  1RI9 A;  4OMM A;  1F57 A;  2F8H A;  2CP3 A;  3R96 A;  5GAN 8;  2EYQ A;  4XTX A;  2ROT A;  4F17 A;  4AG9 A;  1Q81 U;  2O31 A;  2OTL A;  2FCK A;  4B6Z A;  1YI2 T;  1IXD A;  2J6K A;  1FX7 A;  2R57 A;  4E7S A;  3M0T A;  3CCV T;  2B58 A;  4C92 D;  5IB9 A;  1IO6 A;  3G6E A;  3LOD A;  1D3B A;  2P4R A;  3DSB A;  1GFD A;  3H4Q A;  2PTK A;  2OAW A;  3CCE T;  2Z0Z A;  2OI3 A;  3PGP A;  2MK5 A;  4PSW A;  4FSS A;  4MMK A;  2AFX A;  1P92 A;  1OUL A;  3DLM A;  2E65 A;  2HSE B;  1AVZ C;  1WIE A;  4KSI A;  4PKC C;  3OYA A;  2HCK A;  2RF0 A;  3A8O B;  4M75 A;  1S3Z A;  3VUB A;  2V26 A;  3KBG A;  3JB9 H;  2PZ1 A;  2LTO A;  2D6F A;  4UIA A;  2JNG A;  1I21 A;  3IU2 A;  1Z9U A;  1D1C A;  3RES A;  4C0G A;  2CNM A;  2GLJ A;  3VAR A;  1NZ9 A;  3PFO A;  1XIX A;  3MN8 A;  3RZA A;  3EFR A;  1O9S A;  4CC2 A;  1Z4R A;  2JOY A;  5I11 A;  5GJW B;  2I3C A;  1BAV A;  1Q81 R;  1WFW A;  2CZ7 B;  5CKB A;  5FU6 B;  2IMO A;  3JB9 G;  3QAH A;  3JCM X;  1Y0Y A;  4M78 C;  2GQI A;  3WT4 A;  3P8H A;  2L0A A;  3OBW A;  5D6X A;  1VQ6 T;  4EMK B;  3B3V A;  1VQ5 A;  1TOV A;  3OS5 A;  3N5B B;  2R98 A;  1YVK A;  4KOW A;  1G3W A;  4PV6 A;  4PFO A;  1BB9 A;  1YLE A;  3SJE A;  2A0F B;  3BDL A;  3DLL A;  3SDZ A;  3CD6 A;  3S3O A;  1M4L A;  2DXT A;  3AHU A;  2EIF A;  2CNS A;  5GAM d;  1WJS A;  2RI3 A;  3NPF A;  3HTR A;  2Q4Z A;  1RAF B;  1YJW A;  4JXQ A;  4P10 A;  5IAY A;  1NJI U;  4PJO E;  4DYO A;  1JBM A;  4P5N A;  1BK2 A;  2AK5 A;  1YHQ A;  1M4D A;  2DX1 A;  4HCC A;  1LVK A;  5J8F A;  4FD7 A;  4JS4 A;  4AG7 A;  4J9I A;  5H86 A;  2PJB A;  4UFV A;  1K0S A;  1F2O A;  4MRI A;  1Z2L A;  1FNO A;  1HEE A;  2WSE E;  5IXB A;  5KE2 A;  4XTV A;  1NEB A;  4KT0 E;  1OZP A;  3GBQ A;  3W91 A;  1T0J A;  3K2K A;  4IUP A;  4XU3 A;  2KRO A;  2B4D A;  5CNP A;  1VIE A;  3CPW S;  3LWU A;  3QNV A;  2K3Y A;  2HAX A;  1VYT A;  1PU9 A;  1HJD A;  2PSW A;  1IOI A;  4F7U F;  2HC9 A;  3CCU Q;  1Q2D A;  2FE7 A;  3KHZ A;  4OC0 A;  3D3S A;  4OGE A;  4IUT A;  5K8M A;  4P6Y A;  2GLF A;  2W0Z A;  3VS6 A;  2ZW7 A;  2LCL A;  3AT1 B;  1RAI B;  2Q04 A;  3OYF A;  2DYB A;  4JZ3 A;  4FM4 B;  4LDU A;  1ACM B;  1IGQ A;  4FIB A;  3RNJ A;  3LH5 A;  3SXO A;  4WTO B;  1QW1 A;  2EVR A;  2Y90 A;  2V8H A;  3N5F A;  1KUY A;  3M53 A;  1IIC A;  2OAU A;  2PJ5 A;  2Y0M A;  3KFV A;  2F2X A;  4A54 A;  1QQJ A;  3EG9 B;  3PIO A;  4AVA A;  2YRC A;  4CAW A;  4CAX A;  2O88 A;  1DTD A;  1RTQ A;  5AGE A;  1WYX A;  2V8I A;  4PXC A;  1VQP Q;  2V8V A;  4PK3 A;  5HMN A;  4JWP A;  4OME A;  1G5V A;  1NJI R;  1PKT A;  5LRJ A;  2AZS A;  4Z8A A;  1WHK A;  1YJN A;  2EQK A;  2H8H A;  4KGZ B;  3SWN C;  3HP9 A;  3PBE A;  3V8K A;  2PJ8 A;  3RBB B;  1Z8L A;  2EK8 A;  3E0K A;  1Y71 A;  4CGN A;  3CME A;  2MIO A;  1CPS A;  3FEC A;  4F7U B;  2LNV A;  1X43 A;  4HA8 A;  2J6F A;  1IU8 A;  3HPW A;  4XU0 A;  2EVN A;  4FAI A;  4KOT A;  4UEZ A;  4AFZ C;  2B5G B;  2CP6 A;  5IHK A;  1B3Q A;  2ED1 A;  5ECA A;  2HUZ A;  5ISV A;  2I2L A;  2LQN A;  1U1S A;  3KKW A;  2HKN A;  4J7F A;  5LJ3 j;  2DPT A;  1RAG B;  5D29 A;  2YUP A;  3FRM A;  3FJU A;  1M1K C;  4BB7 A;  1EZZ B;  2EBP A;  3QUI A;  4R3K A;  1YIT Q;  2CP5 A;  1LRZ A;  4XNH C;  3VV0 A;  2L5Q A;  3M57 A;  5AG7 A;  1PD0 A;  1LNX A;  3A5Z B;  3JSC A;  2NUT A;  3P8D A;  2GFQ A;  1Y7R A;  2WYR A;  2IQ6 A;  5ELY A;  1UGP B;  3G71 A;  3L2Q A;  3GNF B;  3S6W A;  4DOV A;  4C92 B;  3TOA A;  1W2B S;  2PJ2 A;  1Q82 C;  1PG5 B;  1OBR A;  4C92 F;  4JLY A;  4ONW A;  1B87 A;  1YCY A;  2CGH A;  3JRU A;  5KYU A;  1VQM T;  4RI1 A;  5F49 A;  1KD1 R;  4J9B A;  4OF1 A;  3VWD A;  1T3S A;  1I5L A;  2CTB A;  4KOV A;  4LUA A;  1TXR A;  4JJC A;  5IX3 A;  4A4F A;  2KXC A;  5LJ3 e;  2K4Y A;  4NGN A;  4KUA A;  2YRV A;  1PUA A;  4KS9 A;  2QDL A;  3V8J A;  1AEY A;  3WC6 A;  1V76 A;  4RTT A;  5JH9 A;  5FU7 B;  5KE3 A;  3CXC P;  4PJO C;  1VIF A;  2COW A;  1QCN A;  2QAS A;  3B35 A;  4R87 A;  4J9G A;  3D66 A;  3FB3 A;  2LQW A;  4K3N A;  2EK9 A;  4KVO E;  4CAF A;  4KOX A;  2Z3P A;  3CXQ A;  2KDS A;  2JXB A;  1M90 C;  2ZW4 A;  4ZGJ B;  2J8N A;  3TCJ A;  2J7I A;  5A0L A;  2O53 A;  2RJF A;  2JW4 A;  1WK4 A;  3CEY A;  3CME T;  2Z3N A;  4YFJ A;  1M90 R;  5J3B A;  2DET A;  2QEC A;  5L8R E;  3HKS A;  4FWU A;  3TFY A;  4F9U A;  4M75 B;  2FXF A;  2GFU A;  3CMA Q;  2H3E B;  1X01 A;  2RHY A;  3HUV A;  5KH6 A;  1BPN A;  2ARH A;  5J26 A;  1Q86 U;  4QB9 A;  3KR4 A;  1QP3 A;  5DY9 A;  2Z3L A;  3M56 A;  5DLQ E;  3CMA A;  4R7M A;  1R0B G;  2LCS A;  1YI2 A;  1I4K 1;  2LX7 A;  2R7H A;  3IGR A;  2PJ4 A;  1S5K A;  4CAV A;  2JM8 A;  4FYY B;  2EKH A;  2OOT A;  2RQW A;  1CKB A;  4X5K A;  3G4S Q;  2EYX A;  3SB2 A;  2Q7S A;  3QYH B;  3OYM A;  4JYW A;  1BI3 A;  4OGC A;  1M9S A;  2MF2 A;  4C2X A;  4MCS A;  4BDZ A;  4II9 A;  1ZSZ B;  4PJO A;  2BO9 A;  1PWT A;  2L3R A;  3I56 T;  1JXM A;  3TE4 A;  1X27 A;  3TU4 K;  3UA7 A;  3PMI A;  2QQB A;  1YR0 A;  2SEM A;  1VQ4 T;  2B3V A;  1WZO A;  4DQ2 A;  5KTC A;  2D0Q B;  3OSV A;  4M78 E;  4FL6 A;  2CSI A;  4PPZ A;  4M85 A;  3MJX A;  3NH5 A;  1TKH A;  5CKH A;  2VC8 A;  2LX9 A;  3CCJ T;  2KVQ G;  4UCP A;  1GHE A;  1PYT B;  1TKJ A;  3NH4 A;  4ME7 A;  5I4M A;  1VQ7 A;  3H8G A;  4ATO A;  4Z65 A;  2J8R A;  1Y7X A;  4HXJ A;  5GAN 6;  2NSM A;  3F8K A;  5KYX B;  1W6X A;  2ZED A;  2NUP A;  2K2M A;  3L2W A;  4BI4 A;  4M3S A;  3FVL A;  3BW1 A;  2QYV A;  4NXY A;  3CD6 Q;  5KYX A;  2DIQ A;  2FIA A;  4J3G A;  4NSQ A;  4QT7 A;  1TXQ A;  3CCE Q;  3M54 A;  3CCR T;  3TSZ A;  3RKW A;  5KTD A;  2RHX A;  1IRE B;  1E6H A;  3EFA A;  2MWP A;  4X9C A;  2KCW A;  1BI1 A;  4CC4 B;  2DL4 A;  2H5M A;  5LRG A;  1LOK A;  2DZC A;  2FG0 A;  1BO4 A;  5A27 A;  3CMA T;  2LJ0 A;  2DEU A;  1Q7Y R;  2QA4 T;  4RKU E;  3CXC S;  3BE3 A;  2JTM A;  3R6N A;  2P0W A;  3FF3 A;  2CZ1 B;  1O75 A;  2QQ9 A;  4C68 A;  1KUX A;  2ATR A;  1PHT A;  5C88 A;  1LPL A;  3L2V A;  1Y07 A;  3OYL A;  3JRZ A;  3QZ9 B;  1XJW B;  4RG2 A;  3SWN A;  1LAP A;  3KZW A;  2HQH A;  4D8K A;  2AJ6 A;  2X3X D;  3M59 A;  1M1F A;  3V7S A;  2PRQ A;  4B11 A;  1AZE A;  1S7L A;  4HNY B;  2L3Q A;  3UAT A;  3V7R A;  4MFZ A;  3CC2 A;  2CKK A;  1G3T A;  1SSF A;  3ASK A;  4CRY B;  2QQR A;  4PLL A;  1NYG A;  3H5Z A;  2LJ3 A;  2HB6 A;  2LT1 A;  4MHY A;  3D67 A;  2COZ A;  2KRN A;  3CCV A;  3TO9 A;  1YIT T;  1XRY A;  1VQ9 Q;  2EYZ A;  1T3L A;  3GYA A;  5FU7 C;  1KG1 A;  4E8O A;  1PC0 A;  1Q7Y U;  1HD3 A;  1HK9 A;  4TWE A;  4XU2 A;  4MCR A;  1M4Z A;  2HBW A;  3SFM A;  1SRM A;  3M5A A;  2L2P A;  5CQY A;  4AT1 B;  1NBE B;  5CVI A;  4M75 D;  1X2Q A;  2L3P A;  2P4T A;  4J9D A;  2OTJ Q;  3U23 A;  3JAM E;  4OC2 A;  2P0Q A;  3CCJ Q;  1ABO A;  1C1A A;  3MGD A;  4ZBG A;  3DB4 A;  4PK2 A;  3VYH B;  3F5B A;  1OZ3 A;  5HCK A;  1VQN T;  1IGB A;  1WQW A;  3RMS A;  4FYV B;  4EWT A;  2GU2 A;  2QYZ A;  5JM6 A;  3ZBD A;  3C0C A;  4C2Z A;  4M6G A;  3B3C A;  4Q36 A;  2ZPG B;  1N6A A;  5GAN 2;  3RR6 A;  3S3M A;  4NGT A;  4QUS A;  4AVC A;  8CPA A;  2PIZ A;  1WXT A;  1QVG A;  5GAO n;  3H0I A;  4PK4 A;  2F1L A;  1BU1 A;  5CR2 A;  3IJ3 A;  1R57 A;  4UCM A;  4QQ6 A;  4RCC A;  3C95 A;  3GLJ A;  3SHW A;  4QKU A;  3L1A A;  1AWJ A;  1XJO A;  3PZJ A;  4PJM A;  4M77 E;  1ZBX A;  2KBT A;  4QQD A;  3BDU A;  2E6N A;  3HHT B;  1VQO A;  2IVW A;  3UF4 A;  3MEV A;  3NMZ C;  4KH1 B;  1XNI A;  4J8O A;  5KYU B;  2D4O A;  1B07 A;  2VAS A;  4OP0 A;  5IXF A;  3GB0 A;  1U8R A;  2WPX A;  2K79 A;  2K5T A;  3IQL A;  5HXD A;  3A9L A;  1HXD A;  1VA7 A;  4KLW A;  4G1P A;  4BI8 B;  2ZXV A;  2K5L A;  2JVV A;  3QB8 A;  3GOX A;  5J1Q A;  4LUE A;  4MI4 A;  4W9Y A;  1AD5 A;  2DIG A;  3G1J A;  1Q86 R;  1GCQ C;  1UWY A;  1YJW Q;  1MJ9 A;  3UWN A;  4MHZ A;  3VS3 A;  1WDX A;  2JBK A;  5CKF A;  2M0Y A;  2D4P A;  4UBR A;  1M2O A;  3LX7 A;  4UWJ A;  2G3R A;  1VQ9 T;  1KC8 R;  4FU6 A;  1N8R C;  2GF7 A;  1VHO A;  4ESR A;  2ZEE A;  1XMB A;  1TIQ A;  4E47 A;  1Q2C A;  1NM7 A;  4FT4 A;  2WZN A;  5AG5 A;  3QII A;  2HDA A;  3LWH A;  1LCP A;  4LN2 A;  2ZPI B;  3JVN A;  2WSA A;  4M7D B;  3MPU B;  4A4H A;  4XPL A;  3SHP A;  2EWB A;  3G71 T;  3FMC A;  1YBY A;  1M1K U;  1RL2 A;  2KQW A;  3VUZ A;  2IG0 A;  1VQ4 A;  4DBF A;  1W2B A;  2J6O A;  1BI0 A;  1OOT A;  5F47 A;  1KK7 A;  4A37 A;  2IJZ A;  1VQK Q;  2EQI A;  3C4S A;  3R95 A;  4M78 G;  3VRZ A;  2RB7 A;  2K3B A;  2Z3M A;  2BTT A;  2KYM A;  4NJR A;  3OYG A;  3L2R A;  2FSR A;  4LD9 K;  2ZOF A;  2DE0 X;  3PBB A;  4B5P A;  2C6G A;  1UE9 A;  1WHJ A;  3NGP A;  5FU6 C;  3A8L B;  4J6W A;  5LJ3 g;  1I1D A;  3JUW A;  1NG2 A;  1YIJ T;  1AMP A;  1BOB A;  2GIV A;  1XOV A;  3D7F A;  1DE4 C;  4M7A D;  4X8I A;  1VQN A;  2FPF A;  1UB4 A;  5KYN A; 
#chains in the Genus database with same CATH homology
 4QQG A;  4Z88 A;  1KD1 U;  4RTY A;  2LP5 A;  4ZN3 A;  3V8L A;  4E6R A;  2QEX A;  2ZGW A;  1UEC A;  2M0O A;  3SEM A;  2MOX A;  2BZY A;  2DIL A;  4HT8 A;  4X1V A;  2DVE A;  2OTJ A;  3EG0 A;  4LDX A;  1NPP A;  1K9M C;  2RHZ A;  1FYN A;  3OYK A;  5CCA A;  3SWN B;  1PRL C;  1GFC A;  2E41 A;  1VQ9 A;  3CC4 T;  1K73 C;  4Y91 A;  1RI0 A;  1KQS A;  3OYI A;  5FWB A;  3H6Z A;  1UDL A;  5D6Y A;  2RA2 A;  3PIP A;  3RIR A;  4M75 G;  1KJW A;  1SHG A;  3X26 B;  5GAM j;  3CCL T;  2K5I A;  4PLI A;  2QEX T;  2XG8 D;  3E9F A;  2DBM A;  2VKN A;  2EAY A;  3CCQ A;  2EJ9 A;  4BI3 A;  2VVK A;  1M1G A;  4IUR A;  4NL2 A;  1SEM A;  3GP8 A;  4WCI A;  1UHF A;  3C94 A;  2XI9 A;  1U1T A;  2ROL A;  5DLO A;  2VWF A;  4GY5 A;  2X3W D;  2KYB A;  4DA4 A;  4E7H A;  2KK4 A;  3FDR A;  2PVD B;  3RMQ A;  2LT4 A;  3QAY A;  3QJ6 A;  1VQ6 A;  1TG0 A;  5I22 A;  2E70 A;  4N4I A;  3NTI A;  1R8O B;  4ELZ C;  3G6E T;  3UPU A;  4B9W A;  4C8Q C;  1AWX A;  5CQX A;  2VUB A;  2DVJ A;  1KSW A;  3DKM A;  4AFU C;  3OYJ A;  4E7I A;  1Q7Y C;  1KQ2 A;  4JRK A;  3L2U A;  3VKI A;  2PVO B;  4IKF A;  1U3O A;  1OYX A;  4JLI A;  3PE0 A;  4GLK A;  2BZ8 A;  4HVW A;  4PJO G;  2FRY A;  3M0R A;  3OBY A;  4RCB A;  3MEU A;  2XK0 A;  4J6X A;  1AWO A;  1QCF A;  3WVE B;  5GAO m;  3RKX A;  2RN8 A;  1UUE A;  2DMO A;  4MZM A;  3VS2 A;  2F5T X;  3M4Y A;  3PNW C;  2JM9 A;  4XK8 E;  4AFS C;  4J9H A;  3J80 E;  2E10 A;  1QVG S;  1V29 B;  2HNI A;  4L5G A;  4C92 G;  5HKC A;  2LMJ A;  3JB9 J;  1BI2 A;  3A8H B;  3LGL A;  4XTW A;  2RK1 A;  2BZX A;  2EWN A;  4C92 A;  2HQE A;  3TEE A;  2EQM A;  3NTK A;  5LJ5 j;  1Q82 U;  1ZBJ A;  1M27 C;  2JS2 A;  4PL6 A;  4KUL A;  2DKG A;  2FPD A;  3OS0 A;  3OYN A;  4J9E A;  3ME9 A;  4JJN K;  4UC4 A;  4BE2 A;  2XHC A;  4FSX A;  1KFZ A;  1JRI A;  2A28 A;  3BFM A;  4EFD A;  2DO3 A;  4RTZ A;  3JB9 I;  1Z9Q A;  2MI6 A;  1Z9Z A;  2PUO B;  4BIN A;  1J3T A;  2R5M A;  4A63 B;  4OVA A;  2RH2 A;  2XDD A;  1WX6 A;  2LZ6 B;  1K8A C;  3JCM g;  1KC8 U;  3CC7 A;  1KD1 C;  1Q86 C;  2NLU A;  2MAM A;  1X6G A;  1M3B A;  3JCM b;  2O01 E;  4C8Q A;  1JO8 A;  3OYE A;  2FPE A;  2B8A A;  2M1H A;  3VU3 C;  2Y4Y A;  3CPW A;  4Z89 A;  1M3C A;  1JQQ A;  4L59 A;  1YN8 A;  3RUX A;  2RB6 A;  2KEA A;  4IIM A;  3QPH A;  4LNP A;  5LJ5 d;  1YJW T;  5FLX E;  4LUD A;  2CS7 A;  2YHT A;  2HD0 A;  4XTZ A;  2CZ6 B;  4YTL A;  5FRO A;  1YWO A;  2L8D A;  2CT3 A;  2XKO C;  2D0N A;  4C5I A;  2FB7 A;  4MDX A;  2DJQ A;  3UA6 A;  2A08 A;  4C5G A;  4M78 B;  2XDB A;  2RQU A;  4N4H A;  1M30 A;  2C0T A;  3CCS A;  3CC4 A;  3ZL7 C;  1UGR B;  2XDP A;  5GMK h;  1ZX6 A;  3LYI A;  3MEA A;  3EFS A;  3CQT A;  4QW2 A;  1K9M U;  1EFN A;  4IUU A;  3CCJ A;  3PT9 A;  4E7K A;  3VJP A;  4JZ4 A;  1QKW A;  1ZUU A;  3CD6 T;  4BUG A;  3REA B;  3E19 A;  4Y28 E;  2JTF A;  2K57 A;  4ELY C;  2LC4 A;  3CC7 T;  3J7A F;  3FJ5 A;  2QI2 A;  3JCM P;  4WF2 A;  4NL3 A;  3QJY A;  3KXT A;  1JJ2 S;  3OSS C;  3QWY A;  1M8M A;  2CRE A;  4XU1 A;  1BKB A;  2BIV A;  3H41 A;  4Z02 A;  4TVR A;  4RMO A;  3OW2 A;  4JRP A;  4EMH A;  4A4E A;  4CI0 C;  2AHJ B;  4EMK C;  1BIA A;  1KHI A;  2DRK A;  3FIF A;  1UJ0 A;  2XIC A;  4JLG A;  4HCB A;  4E7L A;  5GAN g;  1AOJ A;  3PVL A;  4JRQ A;  1ZSG A;  5GAN e;  1GBQ A;  4OB1 B;  4II1 A;  4M75 E;  1OI1 A;  3PFS A;  1D3B B;  1WXB A;  2DD5 A;  2YT6 A;  1GL5 A;  1K0X A;  3CCU T;  2YUN A;  4J7I A;  2RI2 A;  1X75 C;  3M0P A;  4CC3 A;  4ZGE B;  5A0G A;  5HY6 A;  3UT1 A;  4N0A A;  3PTA A;  2W10 A;  2RQR A;  2ZPE B;  4OMN A;  3RER A;  4XAX B;  3E9G A;  5GMK e;  3M0Q A;  4C8Q G;  2ECZ A;  5IN1 A;  3VRY A;  5IT9 E;  2CZ0 B;  1I8F A;  4JRI A;  3I5S A;  1ABQ A;  2DA9 A;  5GAN j;  1M8V A;  2CSQ A;  2VV5 A;  2L89 A;  4C8Q D;  4C0D C;  1VQK A;  2RNA A;  1VQP A;  3G4S A;  4F14 A;  1FXX A;  2GGR A;  3O8V A;  3J81 E;  2FRW A;  5I2S A;  2KR3 A;  4RG8 A;  4C0F A;  1YJN T;  3CBO A;  2D1X A;  1ZQ1 A;  4M7A B;  1MGQ A;  2DEQ A;  5LJ5 h;  5GAN d;  5CK9 A;  4EIK A;  3QZ5 B;  1H64 1;  2VXF A;  4BDY A;  4ZTJ A;  3E1S A;  4F16 A;  2DLP A;  4OMP A;  4C92 C;  5AYF A;  1QWE A;  4Q5W A;  3OA6 A;  1AHJ B;  2BKD N;  1TUC A;  2GBQ A;  3EG3 A;  2CYZ B;  4AG2 C;  2KGT A;  4AG1 C;  3OYY A;  5GAN f;  5GMK m;  2QDY B;  4CC7 A;  2RQV A;  1V1C A;  2F2W A;  2EJF A;  1YJ9 T;  2DL7 A;  1N9R A;  5FW9 A;  4JS5 A;  2OJ2 A;  1KQ1 A;  4OB3 B;  1NLO C;  1H3H A;  3QDR B;  2RHU A;  2M16 A;  3LWI A;  2EGC A;  3X28 B;  1ZLM A;  4DEX A;  4A4G A;  2V1R A;  1VQL A;  2VYT A;  5GAO r;  2X4J A;  1A0N B;  2V1Q A;  4IUV A;  1GRI A;  4M78 A;  5A0D A;  4HKE A;  1QVF S;  3C12 A;  4M78 F;  4KBM B;  3MP1 A;  1VQK T;  3CZX A;  4KUI A;  1OPK A;  1B34 B;  3DB3 A;  3I55 A;  1K73 U;  1FMK A;  1NYF A;  1VQ8 A;  2RJE A;  3CCR A;  5GAM f;  2PNI A;  4DEY A;  3CCS T;  2Y4X A;  3EAE A;  3JB9 D;  2GNC A;  4J83 A;  5LJ5 g;  4JDS A;  2EGA A;  4M77 C;  2DJZ A;  3LGF A;  5GMK l;  4M7D E;  3OS2 A;  2KXD A;  1WQ7 A;  1JWQ A;  3G4S T;  4V2S A;  4X34 A;  4EPC A;  3TVT A;  3I35 A;  5IHI A;  5GAN 3;  4M7A E;  2K7A A;  1N27 A;  5LL6 S;  2DL3 A;  3EG2 A;  1ZUK A;  3OB9 A;  3URG A;  1RLP C;  1Y96 A;  5M9O A;  3WVD B;  1UHC A;  3CCU A;  3P8B B;  1WJR A;  2CDT A;  1Y0M A;  2H3J A;  4M77 F;  1H92 A;  5A2Q E;  1OPL A;  3REB B;  2YDL A;  3SD4 A;  2GFA A;  2EQU A;  2RO0 A;  5I21 A;  2JZ2 A;  3JCM d;  2RJD A;  2D9T A;  2K2V A;  3ZEH A;  3CCE A;  4M7D G;  2GQV A;  2DTI A;  3PMT A;  4QVC A;  1IZ6 A;  3JCM h;  3NTH A;  1YIJ A;  3TRE A;  1S1N A;  3VS0 A;  2PQW A;  2LCC A;  1K4U S;  4M7D A;  4C8Q F;  3V7C A;  2O2O A;  1OEB A;  5EMI A;  1VYV A;  2AKK A;  3M0S A;  1UJY A;  3I56 A;  4JJB A;  2RK2 A;  3M4G A;  1OZ2 A;  4Y92 A;  2M9U A;  3I9Q A;  3FRN A;  3M55 A;  2YLC A;  2A36 A;  2DNU A;  2RM4 A;  2WSF E;  2DPP B;  3NFC A;  3T9N A;  1JJ2 A;  5GAO p;  4M7A C;  2JTE A;  4C0Z A;  4JJD A;  1WA7 A;  2C0O A;  3RKY A;  1PNJ A;  1G3Y A;  3OW2 S;  2JUF A;  3CC2 T;  5FWC A;  1U5S A;  2KRM A;  1G83 A;  2DTO A;  4M75 C;  1GBR A;  2O4X B;  1UG1 A;  4ZTF A;  5GMK i;  2F2V A;  2EYY A;  1W1F A;  2MCN A;  1UFF A;  3QWX X;  2ZPB B;  1SRL A;  5CKD A;  1MV0 B;  2ZCF B;  2DL5 A;  3LLR A;  3G7Z A;  4OML A;  5IHN A;  2DXB A;  2SRC A;  5GJV B;  3QXE B;  3FEO A;  3NE8 A;  1SPK A;  3OYB A;  1M90 U;  1PKS A;  2A37 A;  5L23 A;  4BAC A;  5FRM A;  1H3Z A;  3QBY A;  1GCQ A;  2LQ8 A;  4MZP A;  2RD1 A;  4JUV A;  2K3X A;  3PVQ A;  3CCL A;  2I0N A;  1JXO A;  3ZFJ A;  5C6S A;  2OTJ T;  2CUD A;  2F5K A;  3HSB A;  1CKA A;  1PSF A;  4LE9 A;  4RTV A;  2KSS A;  1PSE A;  3H8Z A;  3FB9 A;  3EGU A;  2DAQ A;  2E5Q A;  5DM7 R;  1NLP C;  4QVD A;  1NE8 A;  4LD6 A;  3HRU A;  1KQS S;  4R0K A;  2EQJ A;  1I1J A;  1U06 A;  2KAF A;  4O6J A;  2YUQ A;  3JCM c;  2FL7 A;  3JCM J;  4O5V A;  4C8Q B;  2EW3 A;  2WSC E;  2J05 A;  3MHX A;  3GPL A;  3R6O A;  2EKO A;  1WLP B;  2HSP A;  4GLM A;  2E12 A;  3JCM Q;  1JB0 E;  5GAM g;  4BY6 C;  4N0A C;  1W70 A;  1XQH A;  3NHN A;  4GBQ A;  3H0F A;  2K5F A;  1VQM A;  2JT4 A;  3OY9 A;  2QQA A;  2FVU A;  5GAN 4;  3GF5 A;  4FT2 A;  4M7D D;  3OMG A;  2A3L A;  3O5Z A;  1UGQ B;  2C06 A;  1X6O A;  1UTI A;  4KUD K;  2O9S A;  1YCS B;  1HSQ A;  2DTH A;  2PUK B;  2RQT A;  1WGS A;  1WJQ A;  2YLB A;  3L2Z A;  2KY9 A;  2KT8 A;  3A98 A;  3ER0 A;  4IIO A;  1VQ7 T;  3MO8 A;  4J9F A;  3QYG B;  4M7D C;  1G2B A;  3WXM B;  4D8D A;  3MEW A;  5HK0 A;  1JEG A;  2EJG A;  1QVF A;  5EG2 A;  3VS1 A;  4LDV A;  2EFI A;  1K8A U;  3CCM T;  2DD4 A;  2LRQ A;  3JB9 F;  4A53 A;  1I07 A;  2KMT A;  2HEQ A;  1T0H A;  2A7Y A;  3HL8 A;  2PVG B;  2DXC A;  2CH4 A;  4X9D A;  1AZG B;  1YP5 A;  2AZV A;  1XTD A;  3LH0 A;  1YWP A;  4M78 D;  4BE1 A;  3JCM W;  1YJ9 A;  4J9C A;  1W4S A;  3VS4 A;  3X25 B;  3VS7 A;  2RJC A;  2YUO A;  4AFQ C;  2EGE A;  1WI7 A;  5GAN 7;  4NS5 A;  2RHI A;  1VYU A;  4RUG A;  2QQS A;  4RTU A;  5LJ3 h;  1QLY A;  4BE0 A;  4HCK A;  2XU8 A;  4C5H A;  2QXF A;  1WXU A;  3OQ5 A;  4F7U E;  3M0U A;  2M51 A;  2F69 A;  4ZNX A;  3A8G B;  5GAO l;  1GCP A;  3FJP A;  3FC3 A;  2FEI A;  2XMF A;  5CKE A;  3MP6 A;  2E6Z A;  3I5R A;  2DF6 A;  3OYD A;  4RTW A;  1S72 T;  1UGS B;  4NOY A;  2ZZD A;  1MV3 A;  1ARK A;  2WAC A;  1S72 A;  2LDM A;  4XTY A;  3X24 B;  2G6F X;  2VGN A;  1BBZ A;  1LOJ A;  5EC7 A;  3FLG A;  1VQP T;  3F70 A;  3CXC A;  4M7A A;  3QKJ A;  4F7U G;  3ULR B;  2ABL A;  1SSH A;  1ZHI A;  3JCM f;  1RUW A;  4EDU A;  1UEB A;  1QWF A;  1DJ7 B;  1K76 A;  4C5E A;  2KT1 A;  4F7U A;  2FHD A;  2LVM A;  1X2K A;  4LDW A;  3I55 T;  2JS0 A;  4OMQ A;  3M58 A;  1PRM C;  4DOW A;  5C0M A;  2ZPH B;  3H0H A;  1WNL A;  1VQO T;  2ENM A;  1RLQ C;  1KIK A;  4JPB W;  1MHN A;  5GAN 5;  2CUB A;  1Y96 B;  3HFO A;  5FRN A;  3M9Q A;  1NEG A;  1Q81 C;  5GAM e;  1VQ5 T;  2AKL A;  1VQ8 T;  1TH7 A;  3THK A;  3S3N A;  3QO3 A;  1N8R U;  2L3S A;  2V8J A;  2JMA A;  3JV3 A;  3KUF A;  4MZT A;  4CRI A;  2LQK A;  2CT4 A;  1JU5 C;  5GAN h;  1EIF A;  4KRT A;  4E7J A;  2OTL T;  2FO0 A;  2O9V A;  3JCM V;  4XQ3 A;  2O4X A;  1QVP A;  3GNG A;  3HFN A;  1KC8 C;  5LJ3 d;  2LNH B;  1B34 A;  2RPN A;  5KCH A;  4M6I A;  2EYW A;  1LJO A;  2GTO A;  3TSW A;  4RN7 A;  5CIU A;  4M77 G;  3CBP A;  2CH4 W;  2D8H A;  2D8J A;  2ZPF B;  1I81 A;  2E5K A;  2DM1 A;  1MUZ A;  2DK3 A;  4PJO D;  5I2M A;  3CPF A;  1NJI C;  2RMO A;  5GAO q;  2E1H A;  3LW5 E;  2C0I A;  4M7D F;  4LQ6 A;  1QP2 A;  3A8M B;  2JMC A;  1YIT A;  2GTJ A;  4HT9 A;  2X4X A;  4M7A F;  3QHS A;  1QKX A;  5CO7 A;  2VGM A;  4A4K A;  4M6H A;  2NWM A;  3EHR A;  5KCO A;  2YSQ A;  2X4Y A;  4OMO A;  5LJ5 f;  4HVU A;  5J39 A;  2ODF A;  5LJ5 e;  2R5A A;  4PJO B;  2X35 A;  4ZN1 A;  1KHC A;  1NPR A;  1M3A A;  4IUQ A;  1ZUY A;  2XID A;  2FYK A;  2HQX A;  5LJ3 f;  1SHF A;  2B86 A;  4OB0 B;  1K1Z A;  3MP8 A;  4BD3 A;  2PU9 B;  3GIB A;  2EPD A;  2DZ9 A;  4MML A;  2K9G A;  1VQL T;  1I0C A;  4QVZ A;  2MWO A;  2J06 A;  1GXI E;  2HBP A;  3CCM A;  3CBM A;  2IIM A;  4VUB A;  1N9S A;  3MET A;  4C92 E;  5GAM h;  3HRS A;  2DXU A;  1YNZ A;  2NUZ A;  5CAI A;  4LDY A;  2JN0 A;  4EMG A;  4K11 A;  2XD0 A;  5GMK j;  5HK3 A;  3BY7 A;  1N5Z A;  2V8K A;  3VYG A;  2R58 A;  3UDC A;  1E7O A;  5D6W A;  4OB2 B;  3OMC A;  4ORZ A;  4HVV A;  4M75 F;  4RTX A;  4B9X A;  2KRS A;  3MCA B;  2MMP A;  1CSK A;  1BYM A;  5IH2 A;  2K6D A;  2QA4 A;  1FWZ A;  4PNO A;  4C8Q E;  1AWW A;  1OV3 A;  4R56 A;  2RI5 A;  2DL8 A;  3INZ A;  3EG1 A;  4XTU A;  1WPY A;  1Y57 A;  4D6W A;  3EHQ A;  3PGG A;  3CCQ T;  1YHQ T;  3HRT A;  4M77 A;  2LJ1 A;  4MDW A;  1TUD A;  2E64 A;  4M77 B;  2GCX A;  2P0K A;  2DBK A;  4L6V 5;  1H8K A;  4HCZ A;  3OYH A;  1K9A A;  1M5Q 1;  4PJO F;  4OMF B;  4M77 D;  3Q1J A;  1VUB A;  4ZGD B;  4M4Z A;  2DRM A;  1X69 A;  2VXE A;  2ESW A;  3X20 B;  3JCM e;  4J5Y A;  3VS5 A;  4N4G A;  4EMK A;  2KE9 A;  2P0P A;  4J6Y A;  3L42 A;  1X6B A;  3QSU A;  1E6G A;  3OYC A;  1LCK A;  2QTX A;  1G3S A;  3QG1 A;  4C0D B;  2X4W A;  2KNB B;  4BY6 B;  2ED0 A;  3GLX A;  2BUD A;  3OS1 A;  4M7A G;  1UGV A;  4R55 A;  1BIB A;  1RI9 A;  4OMM A;  5GAN 8;  2EYQ A;  4XTX A;  2ROT A;  4F17 A;  1Q81 U;  2O31 A;  2OTL A;  1YI2 T;  2J6K A;  1FX7 A;  2R57 A;  3M0T A;  3CCV T;  4C92 D;  1IO6 A;  3G6E A;  2P4R A;  1D3B A;  1GFD A;  2PTK A;  2OAW A;  3CCE T;  2OI3 A;  4FSS A;  4MMK A;  1P92 A;  3DLM A;  2E65 A;  1AVZ C;  1WIE A;  4PKC C;  3OYA A;  2HCK A;  2RF0 A;  3A8O B;  4M75 A;  3VUB A;  3KBG A;  3JB9 H;  2PZ1 A;  2LTO A;  2D6F A;  2JNG A;  4C0G A;  3RES A;  1NZ9 A;  3EFR A;  1O9S A;  4CC2 A;  2JOY A;  5I11 A;  5GJW B;  1WFW A;  2CZ7 B;  5CKB A;  5FU6 B;  3JB9 G;  3JCM X;  4M78 C;  2GQI A;  3P8H A;  2L0A A;  3OBW A;  5D6X A;  1VQ6 T;  4EMK B;  1VQ5 A;  3OS5 A;  3N5B B;  1G3W A;  1BB9 A;  3BDL A;  3DLL A;  3SDZ A;  3CD6 A;  3S3O A;  2DXT A;  3AHU A;  2EIF A;  5GAM d;  1WJS A;  2RI3 A;  3NPF A;  1YJW A;  5IAY A;  1NJI U;  4PJO E;  1JBM A;  4P5N A;  1BK2 A;  2AK5 A;  1YHQ A;  2DX1 A;  4HCC A;  4JS4 A;  4J9I A;  1K0S A;  2WSE E;  5IXB A;  5KE2 A;  4XTV A;  1NEB A;  4KT0 E;  3GBQ A;  1T0J A;  4IUP A;  4XU3 A;  2KRO A;  1VIE A;  3CPW S;  2K3Y A;  2HAX A;  1VYT A;  1HJD A;  4F7U F;  2HC9 A;  4OGE A;  4IUT A;  2W0Z A;  3VS6 A;  2LCL A;  3OYF A;  2DYB A;  4JZ3 A;  4FM4 B;  4LDU A;  3RNJ A;  4FIB A;  3LH5 A;  2EVR A;  1QW1 A;  2Y90 A;  3M53 A;  2OAU A;  3KFV A;  2F2X A;  4A54 A;  3PIO A;  2O88 A;  1WYX A;  2V8I A;  1G5V A;  1PKT A;  2AZS A;  4Z8A A;  1YJN A;  2EQK A;  2H8H A;  3SWN C;  3HP9 A;  3V8K A;  3RBB B;  1Y71 A;  3CME A;  2MIO A;  4F7U B;  2LNV A;  1X43 A;  4HA8 A;  2J6F A;  3HPW A;  4XU0 A;  4AFZ C;  5IHK A;  1B3Q A;  2ED1 A;  5ECA A;  2I2L A;  2LQN A;  1U1S A;  5LJ3 j;  4J7F A;  2YUP A;  1M1K C;  4BB7 A;  2EBP A;  3QUI A;  3VV0 A;  2L5Q A;  3M57 A;  3A5Z B;  1LNX A;  3JSC A;  3P8D A;  1UGP B;  3G71 A;  3L2Q A;  3GNF B;  3S6W A;  4DOV A;  4C92 B;  1W2B S;  1Q82 C;  4C92 F;  1YCY A;  2CGH A;  1VQM T;  4J9B A;  4OF1 A;  1T3S A;  1I5L A;  4JJC A;  4A4F A;  2KXC A;  5LJ3 e;  2K4Y A;  2YRV A;  2QDL A;  3V8J A;  1AEY A;  4RTT A;  5FU7 B;  5KE3 A;  4PJO C;  1VIF A;  4J9G A;  2LQW A;  2KDS A;  2JXB A;  1M90 C;  4ZGJ B;  3TCJ A;  2J7I A;  5A0L A;  2RJF A;  2JW4 A;  3CEY A;  3CME T;  5J3B A;  5L8R E;  3HKS A;  4M75 B;  2GFU A;  1X01 A;  2RHY A;  5KH6 A;  5J26 A;  1Q86 U;  1QP3 A;  5DY9 A;  3M56 A;  5DLQ E;  3CMA A;  2LCS A;  1YI2 A;  2LX7 A;  1I4K 1;  2JM8 A;  2EKH A;  2RQW A;  1CKB A;  2EYX A;  3SB2 A;  2Q7S A;  3QYH B;  3OYM A;  1BI3 A;  4OGC A;  1M9S A;  2MF2 A;  4BDZ A;  4PJO A;  1PWT A;  2L3R A;  3I56 T;  1JXM A;  1X27 A;  3TU4 K;  3UA7 A;  3PMI A;  2QQB A;  2SEM A;  1VQ4 T;  4DQ2 A;  2D0Q B;  3OSV A;  4M78 E;  4FL6 A;  2CSI A;  5CKH A;  2VC8 A;  2LX9 A;  3CCJ T;  2KVQ G;  4ME7 A;  1VQ7 A;  4ATO A;  1Y7X A;  4HXJ A;  5GAN 6;  1W6X A;  2K2M A;  3L2W A;  4BI4 A;  3BW1 A;  2DIQ A;  4QT7 A;  3M54 A;  3CCR T;  3TSZ A;  3RKW A;  2RHX A;  1IRE B;  1E6H A;  2MWP A;  4X9C A;  4CC4 B;  1BI1 A;  2DL4 A;  2DZC A;  2FG0 A;  3CMA T;  2LJ0 A;  2QA4 T;  4RKU E;  3CXC S;  2JTM A;  3R6N A;  2CZ1 B;  1O75 A;  2QQ9 A;  1PHT A;  3L2V A;  1Y07 A;  3OYL A;  3JRZ A;  3QZ9 B;  4RG2 A;  3SWN A;  4D8K A;  2X3X D;  3M59 A;  1M1F A;  3V7S A;  1AZE A;  3V7R A;  2L3Q A;  3UAT A;  3CC2 A;  2CKK A;  1G3T A;  1SSF A;  3ASK A;  2QQR A;  4PLL A;  1NYG A;  2LJ3 A;  2HB6 A;  2LT1 A;  2KRN A;  3CCV A;  1YIT T;  2EYZ A;  1T3L A;  5FU7 C;  1KG1 A;  1Q7Y U;  1HD3 A;  1HK9 A;  4XU2 A;  1M4Z A;  2HBW A;  3SFM A;  1SRM A;  3M5A A;  2L2P A;  5CQY A;  1X2Q A;  5CVI A;  2P4T A;  4M75 D;  2L3P A;  4J9D A;  3U23 A;  3JAM E;  2P0Q A;  1ABO A;  3DB4 A;  3VYH B;  1OZ3 A;  5HCK A;  1VQN T;  1WQW A;  3RMS A;  3ZBD A;  3C0C A;  4M6G A;  2ZPG B;  1N6A A;  5GAN 2;  3S3M A;  1WXT A;  1QVG A;  5GAO n;  3H0I A;  1BU1 A;  5CR2 A;  4QQ6 A;  4RCC A;  3C95 A;  3SHW A;  3L1A A;  1AWJ A;  4M77 E;  1ZBX A;  2KBT A;  4QQD A;  3BDU A;  2E6N A;  3HHT B;  1VQO A;  3UF4 A;  2IVW A;  3MEV A;  3NMZ C;  1XNI A;  4J8O A;  1B07 A;  4OP0 A;  5IXF A;  1U8R A;  2K79 A;  3IQL A;  1VA7 A;  1HXD A;  4BI8 B;  2K5L A;  2JVV A;  3GOX A;  4LUE A;  1AD5 A;  2DIG A;  1GCQ C;  3UWN A;  3VS3 A;  1WDX A;  5CKF A;  2M0Y A;  3LX7 A;  2G3R A;  1VQ9 T;  4FU6 A;  1N8R C;  2GF7 A;  4ESR A;  4E47 A;  1NM7 A;  4FT4 A;  3QII A;  2HDA A;  3LWH A;  4LN2 A;  2ZPI B;  4M7D B;  4A4H A;  3G71 T;  1YBY A;  1M1K U;  1RL2 A;  2KQW A;  3VUZ A;  2IG0 A;  1VQ4 A;  1W2B A;  2J6O A;  1BI0 A;  1OOT A;  2EQI A;  3C4S A;  4M78 G;  3VRZ A;  2K3B A;  2BTT A;  2KYM A;  3OYG A;  3L2R A;  4LD9 K;  2DE0 X;  1UE9 A;  3NGP A;  5FU6 C;  3A8L B;  4J6W A;  5LJ3 g;  1NG2 A;  1YIJ T;  1XOV A;  4M7A D;  1VQN A;  2FPF A;  1UB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...