1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
b'AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ply protein
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
1M30A 2LJ3A 4OMLA 2EVRA 1UHFA 2M0YA 2CSIA 2W10A 3TSZA 2B86A 2A36A 4D8KA 2V1QA 2EYZA 4FSSA 2GBQA 1G2BA 1QKWA 1SEMA 1SHFA 4J9FA 1GFCA 3M0PA 2JW4A 3RBBB 2RPNA 2FG0A 1AZGB 4IIMA 4JPBW 1GBQA 1VYTA 1UECA 2DRMA 1GCQC 2FEIA 4BINA 1Z9QA 4RUGA 3NE8A 2MIOA 4OMQA 5ECAA 2ABLA 4AG1C 4J9EA 2PTKA 1CKBA 2EW3A 3PE0A 2J06A 1AZEA 4WCIA 4LUDA 1NEBA 1SPKA 2DL3A 3ZL7C 1HJDA 2BZYA 1SHGA 2IIMA 4QT7A 2C0TA 2L3SA 4F16A 1CKAA 2JXBA 2EPDA 1X43A 3THKA 3TSWA 2GQIA 2K9GA 1MUZA 4X1VA 1WDXA 3U23A 2JMCA 4OMMA 5IH2A 2A08A 1M3AA 1RI9A 1K0XA 2D1XA 1KSWA 1YN8A 2KGTA 2ESWA 2YUNA 4JJBA 1GL5A 2Q7SA 1UJ0A 2VWFA 4Z89A 2DRKA 4M6HA 1B3QA 2BTTA 2F2XA 2KYBA 2RF0A 2QDLA 3PVLA 1H92A 3CZXA 3VS5A 4OMPA 1ZUYA 1QCFA 1U5SA 1YP5A 4ORZA 2L3QA 2YDLA 3I5SA 1K4US 3UATA 1K9AA 3M0RA 4M6IA 3I9QA 2YT6A 2F2VA 1QWFA 2X3XD 1JEGA 3EHRA 4J9HA 2KRMA 5IHIA 5HCKA 2LJ1A 2D0NA 3R6NA 2AZVA 1HSQA 3M0QA 1SSHA 4LUEA 2AKLA 3QWYA 1W6XA 1M3CA 2O88A 1WLPB 4F14A 1J3TA 1BBZA 2H8HA 2RN8A 3NMZC 2EGEA 4HVUA 3UF4A 1RLPC 3KFVA 2HCKA 3JV3A 4GLMA 1NLOC 4DEXA 2AK5A 1AD5A 2KE9A 1NEGA 4IIOA 2OJ2A 2EQIA 2PZ1A 3QWXX 2C0IA 2M51A 2C0OA 5I22A 1W1FA 4A63B 2LP5A 1X2KA 4RTYA 1YWOA 2KROA 2X3WD 1I0CA 2EBPA 5GJWB 2K2MA 4RTVA 2FO0A 2L3PA 4AFQC 2JMAA 2KT8A 1WXUA 2YUOA 5EC7A 2DJQA 2KR3A 2KXDA 4JZ3A 1QLYA 2EYWA 1GFDA 4AG2C 2DL4A 1T0JA 2EKHA 3SHWA 4Z8AA 1H8KA 2FRWA 1FYNA 1M27C 2O9SA 1QWEA 2PNIA 3EGUA 2G6FX 1T3SA 2VVKA 1BB9A 1ZLMA 1GRIA 2KRNA 3VS3A 3M0TA 4M4ZA 2HSPA 1UG1A 1Y0MA 3M0UA 4HVVA 4ZNXA 2K3BA 2KRSA 4AFUC 5I11A 2P4RA 2J05A 2E5KA 1PKTA 1AWWA 4RTWA 1M3BA 4Z88A 5IHNA 1OEBA 2AZSA 3EHQA 2MCNA 2I0NA 4J9CA 4LNPA 4J9IA 1VYVA 4RTZA 4EIKA 3VRYA 4OMNA 2DBKA 1NLPC 1ZX6A 1TG0A 2SRCA 3PVQA 2CSQA 2NUZA 1UE9A 1AWXA 2RNAA 4D8DA 1B07A 2DNUA 3I35A 1PWTA 3VS4A 3EG3A 4J9DA 4JJCA 2ED0A 2BZ8A 3H0IA 2YUPA 1SRMA 3SEMA 1JQQA 2KBTA 2LNHB 1H3HA 2ODFA 2EGAA 1TUDA 2KT1A 1AEYA 1X6BA 4HCKA 1AVZC 3NGPA 2VKNA 2LMJA 3EG1A 2RQRA 1WIEA 2BZXA 2CH4W 4GBQA 2DL5A 2HBWA 3I5RA 5IXFA 3VS2A 4J9BA 1JO8A 2ED1A 3H0HA 1QKXA 2K6DA 1TUCA 3LH5A 1T3LA 1JWQA 2KXCA 2CDTA 3REAB 1ABQA 4AFZC 2GNCA 1G83A 3M0SA 2A28A 2DVJA 2JM8A 2ENMA 2J7IA 1MV3A 3IQLA 1HD3A 1WYXA 3UA6A 2RQWA 1WFWA 2O31A 1JU5C 5FWBA 1W70A 2L0AA 2LX7A 1E7OA 1EFNA 2AKKA 2OAWA 1WI7A 2DF6A 1PNJA 2DX1A 5FW9A 2DA9A 2LJ0A 2MOXA 1V1CA 1RUWA 1CSKA 2GGRA 1UJYA 1X6GA 3VRZA 3VS7A 3TVTA 2CUDA 1YCSB 1PRMC 1X27A 5FWCA 1S1NA 1WA7A 2L2PA 2LQWA 4M6GA 4RN7A 2A37A 2O9VA 4AFSC 3EG2A 4CC7A 2LCSA 3UA7A 2FRYA 1BU1A 2LQNA 2GTOA 2ROTA 1PRLC 4LQ6A 1VYUA 1AWOA 2RQVA 2KNBB 1UTIA 1VA7A 1WXTA 4HXJA 4RTTA 4E6RA 1E6GA 2HEQA 2CREA 3GBQA 3FJ5A 1OPLA 1T0HA 1U3OA 2DILA 2KEAA 2J6KA 1UFFA 1Y57A 1NM7A 2O2OA 1FMKA 1Z9ZA 3VS1A 2CT4A 3NPFA 1UDLA 1XOVA 1SRLA 1PHTA 2FPEA 3NHNA 2JT4A 1KIKA 4RTXA 3A98A 2J6FA 4HVWA 1YNZA 1UUEA 3VS6A 3EG0A 3ULRB 1WX6A 2EYXA 1NYGA 2ECZA 2NWMA 1AWJA 2FPFA 1K76A 1AOJA 1GCQA 1JXMA 1E6HA 4F17A 1IO6A 2YSQA 3H0FA 2RQTA 2HDAA 2DLPA 1KJWA 4K11A 1ZSGA 2FPDA 4DEYA 1GBRA 2D8HA 2GTJA 4R0KA 4RTUA 1LCKA 5IHKA 1ARKA 1I1JA 1ZUUA 1X69A 2J6OA 4KRTA 1OV3A 1PKSA 4OMOA 2CT3A 2JS2A 1OPKA 5EMIA 2EGCA 2JTEA 3QAYA 4LE9A 1NYFA 2JS0A 5L23A 2CUBA 1ABOA 2DMOA 2DYBA 1I07A 2DM1A 2KYMA 1U06A 5GJVB 3REBB 2CH4A 3C0CA 1K1ZA 1M8MA 1ZUKA 2F2WA 1ZBJA 2EYYA 3O5ZA 2DL7A 2JM9A 4CC2A 2W0ZA 2DE0X 2K7AA 2K79A 4J9GA 1KFZA 1WXBA 4CC4B 4LN2A 2XMFA 4Y92A 1JXOA 1UGVA 2OI3A 1A0NB 2SEMA 1NG2A 1X2QA 4JJDA 3RNJA 2YUQA 1RLQC 1UHCA 1K0SA 4JZ4A 2RQUA 3CQTA 2DBMA 4CC3A 1N5ZA 2DL8A 1GCPA 3VS0A 4ESRA 1YWPA 2V1RA 1OOTA 2LZ6B 2RMOA 2ROLA 2D8JA 1MV0B 5IXBA 3H41A 1BK2A
chains in the Genus database with same CATH superfamily
2LCCA 3GP8A 2JUFA 3TOBA 2YNCA 3B3VA 1M30A 5CKEA 2RK2A 3G3SA 2W10A 2ZW7A 3KQZA 1NBEB 3TSZA 1RI0A 2B86A 4ANJA 5FU7B 3R9GA 2ZAEA 4YGOA 2A36A 1KUVA 2QA4Q 4A31A 1FMVA 1QKWA 1Y7XA 5IB0A 2R98A 5GAOr 4R6TA 3CC2Q 1NPPA 1YI2Q 1Y7RA 4QVDA 4C92F 2PIYA 4AXVA 2MWPA 4RG2A 3CC4Q 1GBQA 4BE1A 3OW2A 3NE8A 4C92E 1SKUB 7CPAA 2OH1A 3LGFA 4YTLA 4MY0A 2HL3A 4JRKA 1O75A 5ECAA 4M7DG 2NUTB 2J9AA 3NH5A 4C7HA 2ABLA 4CYNA 1M90C 3V8JA 1RACB 1VQPQ 1MMDA 1CKBA 3LWIA 4PJOF 1IOIA 3DDDA 1I21A 4ORFA 3FJUA 1LOKA 1XQHA 3ZZIA 2WUUA 2K3XA 3IU1A 4C2XA 1Y96B 2DO3A 4RCBA 3UDCA 4PJOE 2IIMA 1WHMA 3PGGA 3MP1A 4FL6A 2QVPA 4IK2A 2EJGA 1B34A 1WK4A 1O9SA 1K8AU 2QYVA 2ZEGA 1TS9A 1HYOA 1IIDA 4BB7A 1X43A 3N7ZA 3QDFA 3THKA 4C5IA 4BD9A 1K73R 2GQIA 2K5LA 4X1VA 4KSAA 4CGLA 2IPOB 2JMCA 4C8QG 1D1CA 4RMOA 4XTVA 4KGVB 2F1LA 3OYMA 1Y7EA 3T9YA 4CAEA 4XTXA 4J6XA 2ESWA 5GAOq 2PVWA 3JUWA 2CP0A 4HKEA 3CMAQ 4JJNK 2F2XA 4ZX8A 2KYBA 3PT9A 4NXYA 3A8MB 1IHVA 1ZG9A 3HFOA 3VS5A 2NUPB 2Q4VA 4OMPA 4NEXA 1QCFA 1M4LA 3SFMA 4OB3B 2P0WA 2QASA 4F9VA 2CZ1B 3R6OA 3UATA 3I9QA 2YT6A 1QWFA 2X3XD 4K3NA 2KRMA 4M77A 2LJ1A 3R6NA 3A9LA 2CZ0B 2EQKA 2VXFA 4LQGA 3QXEB 2XEGA 2AKLA 2CP5A 4IUSA 1J3TA 1IYLA 4KVME 1YX0A 3X24B 4CGOA 3AT1B 1CG2A 2GIVA 2D4PA 3KFVA 2HCKA 3CCRQ 1KUXA 2DTHA 1OI1A 3M5AA 5I0CA 2CXAA 2ZW5A 2Q51A 1NEGA 1XIXA 3E9FA 1U1SA 3WT4A 3A1PA 1A2ZA 2K2VA 3P8BB 3M4YA 2G3TA 4PXEA 3EG9A 1S7NA 2ZCFB 3HKSA 5GAN2 3CXPA 2FT0A 2M51A 3QUIA 5CR2A 3HRSA 3TC8A 5J26A 4ME7A 3QJ6A 1TF9A 4NOYA 4BE0A 3M59A 4FW2A 1YJ9Q 1BKBA 1YIJT 3QJYA 2P84A 2EKOA 1BLLE 3QBYA 4F8ZA 4NGSA 3UWNA 4AFQC 1PSFA 2JMAA 1WXUA 2CTBA 3CCET 4A33A 2DJQA 2KXDA 2CZ6B 1KQSA 4UIAA 3R9EA 3QDRB 3PB7X 4BY6B 2IG0A 1H8KA 3PIPA 2BCOA 1FYNA 1PG5B 5GANe 1JB0E 3A8LB 5LJ5j 2HQHA 2V8GA 2ZW4A 4FD5A 1QWEA 4CRIA 2HL5C 3EGUA 4Y91A 1Y9KA 3D4UA 1BB9A 2HV2A 4F7UG 4M75A 4ZGDB 3JAME 5LYIA 4ZGJB 2R57A 2ZPHB 3ZFJA 3M54A 3DNSA 2Z0ZA 1F57A 2P4RA 2QG9B 1C0MA 1M90U 3FNCA 2V26A 3KZWA 4M7AA 3VU3C 2PCUA 2JTFA 3F0AA 5IHNA 1OEBA 2AZSA 4NGRA 3CC7T 2LCLA 4OGEA 1H3ZA 4J9IA 2Z0WA 6CPAA 1QCNA 3VRYA 1BI0A 1B7TA 1PYTB 3D68A 3MP6A 3FLGA 3G4ST 4EMHA 3OYLA 1Z8TA 1TG0A 5GAN5 3LLRA 4M85A 3IO1A 3CXQA 1UE9A 2GANA 2I3CA 3CEYA 1B07A 2QQ9A 3EH2A 2QXFA 2B5GA 4UWIA 3OYAA 1C1AA 1V29B 1QVFS 2ED0A 2M16A 4XPDB 4NL2A 1SRMA 3G1JA 3PBBA 2YRCA 3MCAB 1N8RC 1M2VB 1NZ9A 3P2HA 4QVTA 4X2TA 1H3HA 2ODFA 3IC1A 2KT1A 1BIBA 4FW1A 2DXUA 2YNDA 2VKNA 2LMJA 5DWNA 4F9UA 4KOUA 2RQRA 2JJ9A 3SWNB 1WIEA 1S5KA 4A4FA 2AE6A 5D6YA 2BE7D 5IXFA 4ZI6A 1VIFA 3BDUA 3VS2A 3M4GA 3OYHA 2VGMA 2ZPBB 5CCAA 1ELLP 4QB9A 3NTHA 2BEIA 3KKWA 2FVUA 1D3BB 3BLNA 3KBGA 1VQNQ 1YIJA 5AGEA 4FBEA 5CAIA 4DNCA 2LDMA 1G83A 2CP7A 1I12A 4KH0B 5FROA 2DVJA 2BO9A 2ENMA 3CCEA 4OAEA 1MJAA 4OP4A 3IQLA 3CXCS 4RKUE 1RXTA 2REFA 3ZJ0A 1PCAA 2RQWA 4JRIA 2P0QA 4JXRA 5CBMA 3CBMA 2L0AA 4FD4A 1Z4EA 3LWHA 1YMEA 3K9TA 3P2FA 2QAZA 4VUBA 1D0YA 2DA9A 2X4XA 4JWPA 1RABB 2O28A 1CSKA 2GGRA 3FJPA 4MHPA 1M44A 4OIDA 4A95A 1UJYA 1N8RR 1V76A 1BI2A 3N5BB 2CUDA 1YCSB 4PK4A 4NGQA 4NJRA 2LT4A 1X27A 2E65A 1Q81C 4AB7A 2QTXA 1VQMT 3PB8X 4AMCA 1WA7A 4OC0A 2O4XB 2L2PA 4KOXA 1CP6A 2P0KA 3PMTA 3CCUT 5E96A 3RZAA 3CC7A 1Z8XA 2RHIA 2WYRA 3MP8A 2PJ1A 3KUFA 1BU1A 3DLMA 4E7SA 2Q44A 2NLUA 3TT2A 4ZGYB 2GTOA 3G4SA 2VC8A 3RIRA 1M4IA 4LQ6A 3CCVT 4A94A 3I3GA 2RQVA 4ZY1A 2WSFE 3CCJQ 1WXTA 4NJQA 1IYKA 5IV0A 3OY9A 3CPAA 3META 3V7RA 1MNEA 4J3GA 1NJIC 2R1IA 2HEQA 1LVKA 2YWWA 3FJ5A 5CKDA 1OPLA 1N9RA 2DILA 2BUDA 3H8EA 4KLWA 5DLOA 3FYNA 2J6KA 1OBRA 2J8NA 4XU1A 1FMKA 1Z9ZA 2OAUA 2GCXA 4M78E 3RMQA 2X4JA 5KYUA 2ZEOA 1XOVA 1SRLA 4C0GA 4HT8A 2E12A 1PHTA 4PJLA 3DB3A 3PEIA 2LQKA 4EMKB 4RTXA 3UPUA 2ATCB 1XEBA 4HVWA 4KH1B 5KYYA 2PVDB 1KC8R 2D6FA 2AFXA 2J8MA 4OKOA 4ONWA 1G3YA 1Q81R 1H641 3I9SA 1TTHB 5GMKh 2VEZA 1AOJA 3ME9A 5GAN7 2V8DA 2EK8A 1YHQT 3H0FA 2RJCA 3H6ZA 3FDRA 2JLMA 4DOVA 1Q82C 2HQXA 3RO0A 2B4DA 2E10A 2E5QA 2GTJA 5LJ3j 1N8RU 1ZSZB 5LJ3f 4MFLA 1LCKA 5IHKA 2E64A 1NSLA 2J6OA 1Q2YA 2A0FB 2VI7A 4CS0B 2K5FA 2LTOA 1OPKA 1TUGB 5HK3A 4WF2A 5CKFA 4BI4A 1VQOQ 4AVBA 3I56T 3IU2A 2EK9A 1Y71A 4QQ6A 1F1BB 3FXTA 1YLEA 2DMOA 1MNDA 2DYBA 3RUXA 4MHDA 1WHGA 2KYMA 2CH4A 5AT1B 3BE3A 2FS5A 2GLFA 4H89A 1K1ZA 4KULA 2FL7A 4MBUA 3O5ZA 3M53A 1VQMA 2DYIA 3JCMf 4X9DA 2HKNA 4MMKA 2K7AA 2K79A 1PU9A 3L2UA 4MFKA 1XNIA 2VZZA 1WQWA 3CCUA 4IURA 2XMFA 4IUTA 1JXOA 2HQYA 4BI8B 4BY6C 4E0AA 2SEMA 1AMPA 2PUKB 3PIOA 1X2QA 1WQ7A 4LDXA 1UHCA 1K0SA 2Z3MA 3ISZA 3SI0A 2RQUA 2VQYA 2ZPIB 3D7GA 4M78D 1LRZA 4M7DB 3CCVA 1Q2DA 2DL8A 4GS4A 4O6JA 1YWPA 1Q82R 2FB7A 3B7IA 2XD0A 2PJ6A 2ZPAA 1VHOA 3V8LA 4LE9A 2AT1B 2C06A 3FX6A 1HXDA 4E2FB 2F5IA 2EVRA 1Q81U 2CSIA 3C12A 1X10A 1I8FA 5J1QA 4HKFA 2CZ7B 4D8KA 2P6GA 2V1QA 2EYZA 3GPLA 4FSSA 2GBQA 4X8IA 2MPXC 1VQKT 4JS5A 1I4K1 1RAIB 1VQ8T 4B10A 5FU6B 1UWYA 3TO7A 4I49A 5D7UA 4C8QB 3RBBB 4AVCA 4Z02A 4OC4A 1AZGB 4IIMA 3PFOA 1K9MR 1VYTA 1YW6A 3FMCA 4H2KA 2KI7A 1R8OB 4C0DC 2Y4YA 4MXUA 4C2YA 4UIBA 4OB0B 2MIOA 2EO8A 1NJIU 4PV6A 1YHQA 2AFMA 3H8FA 1RAAB 2LVMA 3OQ5A 3JVNA 2CYZB 2PTKA 1NE8A 2BIVA 2OTJQ 4XPDC 1XMTA 2VGNA 1QSOA 2J06A 4FYXB 2PRBA 3X25B 5KYXB 4WCIA 1CX8A 5KYWA 4IUQA 1SPKA 3ZL7C 2PJ3A 1KK7A 2BZYA 1HJDA 3B8GA 3CPXA 3S3NA 5CO7A 3I56A 1NPRA 4LDUA 1EE3P 3OYBA 4UA3A 4MDWA 4YRHA 2K5IA 3M55A 3BJ8A 4YU9A 1YIJQ 4A37A 4A4GA 1OU9A 2RD1A 1QSTA 3TSWA 3OS0A 2MAMA 4ZX9A 5GAN4 3G6EQ 1MUZA 1OZPA 1WDXA 3U23A 2A08A 4UC4A 2ZXVA 1Q82U 4OF1A 2PJAA 3LW5E 1K0XA 2D1XA 1KSWA 1YN8A 4P4IA 4Q5WA 1UJ0A 2Q7SA 4M6HA 2DD4A 2F69A 1S72T 1JJ2S 2RF0A 4LXCA 1H92A 1N71A 3NE7A 3V38A 1U5SA 2EQJA 1K4US 2HB6A 4OMFB 3M0RA 2ZPFB 2XDBA 3B35A 2PUOB 2GREA 4A30A 2F2VA 2F8HA 1D0ZA 1VUBA 3JSCA 4J9HA 4PFPA 4M78G 3HLPA 1YITT 4UF4A 4NGMA 4CAVA 3M0QA 5GANh 2Y4XA 2VL1A 3I1UA 3JB9F 3DB4A 3GLXA 1BPMA 3QYGB 2RHZA 5GMKe 2B3UA 1OZ2A 1WHKA 4FU6A 2EGEA 3OWCA 2VV5A 4HVUA 3O8VA 4F7UB 4B5PB 1VQKA 3V7SA 1AYEA 1RLPC 3JV3A 1RAGB 1VQ8A 2NMTA 1VQ6T 4NCZA 3LD2A 1WNLA 4DEXA 2AK5A 3RKWA 3MEUA 2BKDN 2ZEFA 2OJ2A 4CYOA 4KUIA 4UFWA 3QWXX 3V7ZA 2C0IA 2PJ2A 2MMPA 1F2OA 5I2SA 5I22A 2KCWA 4A63B 1UB4A 5DWMA 1X2KA 2FZCB 4RTYA 3JB9I 3HUVA 4KLVA 1YWOA 2AFOA 1K73C 2EBPA 3RERA 2ZEPA 4MHNA 4FAIA 4RTVA 1AT1B 3GNGA 4IAVA 3OYJA 3PGPA 2ZPGB 2FO0A 5CQYA 2BOAA 1NMTA 2KMTA 5EC7A 1Z5RA 3RESA 2ZEHA 1ZG8A 1QLYA 4AG9A 3MO8A 3S6WA 1GFDA 4AG2C 2DL4A 3SHWA 4A2ZA 1LFWA 4DQ2A 3EGDB 4KSIA 2FRWA 4ZN1A 2HMAA 3OYYA 4EMKC 1M27C 4HNXB 2QTVA 3TQ7P 5C6SA 2VXEA 2DJZA 1LPLA 2XU8A 1IGBA 5KTDA 1XTDA 2KRNA 3M0TA 4M4ZA 2PC1A 5GANg 3EO4A 4A38A 3L2RA 2HSPA 1Y0MA 3M0UA 2EBJA 4HVVA 1ZO0A 1S7FA 4C5GA 2K3BA 2FXFA 2KRSA 1PSEA 2HD0A 4KGXB 2YGWA 2E5KA 2KAFA 1BIAA 2NUTA 4C92B 1M3BA 4RI1A 3GY9A 1ZSZC 1S72A 4OC1A 2CP2A 1Y0RA 3EHQA 2X7BA 2VASA 4KOSA 3D67A 1VYVA 1Y96A 3OW2S 3TU4K 4EIKA 5AG6A 3QYHB 4OMNA 5IB9A 3VARA 4DOWA 3JB9D 2AFUA 5FVJA 4PJOB 1NLPC 2R5MA 1ZX6A 2CSQA 1YITA 2NUZA 1AWXA 3S9MA 5M9OA 3NFCA 4O5VA 1TSFA 3TO6A 2EQMA 3CCMQ 4L8AA 1VQMQ 2Z10A 2BZ8A 5JM6A 4A4HA 2XEJA 2OTLT 1EIFA 3SEMA 1JQQA 2KBTA 4M77F 5GMKm 3CCUQ 1JQGA 4XNHB 5D29A 5G20A 3X26B 4J83A 2EGAA 2X4WA 1VQ6A 1TUDA 4MHYA 3CCSQ 5HVFA 1AEYA 1ZHIA 1X6BA 2CP6A 3FB9A 4M77E 5GAOl 3SJGA 4QBJA 5A28A 3NGPA 3OMCA 3A8HB 3QNVA 1YLOA 5H86A 2NUPA 3CCVQ 2EWNA 2LT1A 2CS7A 3A8GB 2BL1A 4M7DC 4B14A 3FRMA 2HAXA 2CH4W 3CCLT 2DL5A 4H6ZA 3LX7A 8ATCB 2NYSA 5D8NA 2PJ5A 4ZY2A 3SJFA 3GKRA 1QKXA 4P6YA 2YNEA 1TUCA 1Q7LA 1JWQA 2KXCA 4XAXB 4BE2A 2B3VA 3C95A 4AFZC 1WWZA 2GNCA 4UFVA 4C92D 2ATRA 2DPTA 2B8AA 2IMOA 3JCMd 4UCPA 2RHXA 1YVOA 3KHZA 2J7IA 5HMNA 2EVNA 1BOBA 4HCCA 1TF8A 1HD3A 1KHIA 1WYXA 4MDXA 4MMOA 4C5EA 4A4EA 4K30A 4WTOB 1WFWA 3N5FA 2O31A 4MRIA 5FWBA 2O01E 5FU6C 4PJOD 2DIQA 4C8QC 4DUKA 5KTCA 1YJWQ 3QG1A 4BD3A 3GNFB 2DF6A 1MGQA 4HPSA 2LJ0A 3L2ZA 3RMSA 3QPHA 3KR4A 1X6GA 4OB2B 5KCHA 3OYCA 2RJFA 2DZCA 1LAMA 3TVTA 2DD5A 1K73U 2EIFA 1LAPA 3K9UA 3KXTA 4U9ZA 4M75F 4BI3A 4RG8A 4MJ8A 4NGNA 2EQUA 1L0CA 5J8CA 4XU3A 3S6HA 2DPPB 3BXMA 1UFHA 2CF4A 4M6GA 4M75E 2R5AA 3ZEHA 2QMLA 2B58A 4U9YA 5LJ5f 4AFSC 4CC7A 3UA7A 1M4ZA 4AVAA 1NE9A 1IGQA 3I56Q 4M7AF 4AG7A 1YJNT 1VYUA 4R87A 3TOAA 1M1FA 4XQ3A 3GIUA 4E6RA 4M7AE 1CPSA 2P6EA 4ELZC 2Y0MA 2PDOA 1E6GA 2CREA 3GBQA 4JJXA 1T0HA 2KEAA 4Y28E 2PE3A 1IOFA 1KQSS 2L89A 1GXIE 5F47A 4KBMB 3VKIA 4P4EA 2OTLA 4E8OA 1NM7A 3IFEA 4MFPA 3QZ9B 2BE9B 1JBMA 1UDLA 2LX9A 2NYQA 4LDYA 2RC4A 3NA6A 5K8OA 5ELYA 3QAHA 2F5KA 1DE4C 3NHNA 4ZBGA 1I81A 1KIKA 3T8WA 1QVFA 1M1KR 1UGSB 4C0DB 1KG1A 1ZLIA 1YGHA 9ATCB 4WJBA 4MMLA 3CCLA 1UUEA 3VS6A 5EC4A 3NFZA 1XJOA 4KOTA 2NWMA 5DLQE 3FF3A 3L42A 1E6HA 3G71T 4C0FA 4A54A 4F17A 3TFYA 5G21A 3S9NA 2G0BA 1XRYA 3F8KA 2AFSA 1RAFB 1ZSGA 2G9DA 1DTDA 1YFNA 4F6AA 4N4GA 1GBRA 2V8JA 2X51A 3OS2A 1D1AA 2G3RA 4RTUA 4C92G 2DXCA 1ZUUA 1M2VA 3JRZA 4P45A 1VQ8Q 1RAEB 2XKOC 4R76A 4UEZA 3TTHA 4OMOA 1XJWB 3DLLA 5LYDA 2C6CA 3OYIA 4HT9A 4EMEA 2EGCA 1FXXA 2JTEA 2QA4T 1VQLQ 1NYFA 2JS0A 3LYIA 2CUBA 4M75D 5L23A 3KASA 3IWWA 3SWNA 4PLIA 2PSWA 4NGPA 4RCCA 3CC2T 1YI2T 3FEDA 4PJOG 5A27A 5GJVB 2E6ZA 5A0DA 1D3BA 3OA6A 5JGFA 4NL3A 2JM9A 2W0ZA 1VQ5T 1OYXA 2ZOGA 4A53A 2JEVA 2DIGA 4R55A 4KVXA 5HK0A 1G3SA 4Q36A 4M7AD 1ZA2B 1KFZA 5GAMj 2HBPA 3PZJA 4Y92A 4CGPA 5GAMf 4P4JA 1UGVA 1VQPT 2OI3A 2EFIA 2HSEB 3EFOB 1A0NB 1PD1A 2CNSA 3CCQT 3EGXB 2DTIA 4UEEA 3RNJA 5LYLA 1YJNA 1IY7A 2WACA 4MI4A 4PXCA 5DS0A 3M56A 4L6V5 2JEWA 4KOYA 1GCPA 4ESRA 2LNVA 1KC8C 1H8LA 1XE4A 3EH1A 3S3OA 2LZ6B 1IU8A 2WPWA 5AG5A 3G8WA 3RNZA 3VWEA 1FT7A 2GFQA 5JH9A 4OIWA 5LRKA 1ACMB 1U1TA 2LC4A 2Z3NA 4B11A 2M0YA 2QI2A 2X9HA 4C92C 2COYA 3BHXA 1S72Q 1Z4RA 1KD1C 2O4XA 1V0CA 3EFAA 1G2BA 4EVYA 5C82A 2A3LA 1SEMA 1SHFA 3V7CA 4PFZA 2LRQA 4EMGA 4B12A 3M0PA 2M9UA 1D1BA 4OGCA 2J8RA 3GF5A 4PJOC 4KZTA 2DRMA 1VQ9T 2PJ9A 4CGNA 1YITQ 3HL8A 4KGZB 1Z9QA 2QGFB 3G7ZA 3MEAA 4RUGA 3G71A 1Q86C 1GHEA 1VIXA 2C6GA 1X6OA 1M2OA 2DK3A 1CM0A 3PMIA 3ZBDA 3UT1A 2EW3A 1Y07A 3PE0A 5GMKi 4XNHC 2RB6A 2I00A 1TXQA 4LUDA 5F46A 2D9TA 1YVKA 3IWGA 3KQXA 4UEFA 5I2MA 3FRNA 1VQ6Q 4OMEA 1MHNA 1WJQA 2DL3A 2FL4A 4LUAA 4TWEA 2POKA 5A2QE 4FSXA 4M78B 4QT7A 5K8NA 2C0TA 5HXDA 4F16A 1TIQA 4EMKA 2QA4A 2JXBA 4JRQA 1I1DA 2HQEA 1BPNA 3P8DA 3CBPA 5J39A 5J3BA 4E7ZA 3L2WA 1Z8LA 2VYTA 4KT0E 3J81E 3CC2A 2V8KA 1YI2A 3PB6X 5CK9A 2KK4A 2CY2A 3OSSC 4FIBA 3H4QA 5LRJA 2K9GA 8AT1B 1PCXA 5IH2A 1VQ5A 1KD1R 3OSVA 1ON0A 1M3AA 2XDPA 4PSWA 5CQXA 1UGQB 1YJ9T 4II1A 2XEIA 2KGTA 2H3JA 1AUGA 4P4DA 5BWAB 2DRKA 5D6XA 4J8OA 2IQ6A 1VQPA 3M58A 4FT2A 1ZSZA 2IVWA 4FYWB 2QDLA 3CCQA 1FMWA 2DXTA 1YR0A 1WHLA 5LRGA 2RI2A 2PVGB 2REEA 3WVEB 3MJXA 5GAN8 1Q86R 3R1KA 3R9FA 2YDLA 3I5SA 1BYMA 2DEUA 3S6GA 4L59A 5IX3A 3CD6T 2XIDA 3L1AA 1HDUA 1ZA1B 2P4TA 3Q1JA 4UBRA 3OMGA 3EHRA 5IHIA 1G3WA 1K9MC 5HCKA 3OBWA 2D0NA 5L8RE 2FSRA 2O4HA 4Y49B 2AZVA 1PC0A 5IT9E 2RH2A 3CDXA 1WJSA 1SSFA 4LUEA 3QWYA 1M3CA 1VIEA 1RO5A 1W4SA 4HA8A 4F14A 2H8HA 2PJBA 2RN8A 4PNOA 1XFOA 1Z9UA 4M7DF 5CVIA 3B3WA 2GQVA 1VOMA 4GLMA 1TKHA 3F5BA 3DKMA 4W9YA 2R7HA 1AD5A 2KE9A 4JS4A 1ZQ1A 1IGUA 4X3RA 3DSBA 2EQIA 2ARHA 3H5ZA 2EAYA 4YWYA 1Y0YA 2DEQA 1VQ9A 4M7DA 5GMKj 1KC8U 2C0OA 2JDDA 1W1FA 1KHCA 5GAN3 3ISXA 2VZYA 4KSFA 4MZPA 4NGTA 1LNXA 1I0CA 5GJWB 4OVAA 2ABZA 3C94A 3GYAA 4IF5A 3SI2A 2GLJA 5FRNA 4ELYC 2L3PA 3BJ7A 1QMCA 4J6WA 2YUOA 1IB8A 4C8QF 2ZPEB 5K8MA 5LJ5d 1KD1U 1T0JA 2EKHA 3B3SA 3CT9A 3PB9X 3GLJA 2FE7A 3SI1A 2O9SA 4RS2A 1YREA 2PNIA 4J7IA 3FEEA 2VVKA 3WC5A 3URGA 4DBFA 4C8QA 4MCPA 3VS3A 2QECA 2RA2A 2X4YA 2HC9A 1Q86U 1UG1A 1P92A 2GF7A 1QVGS 1HEEA 1VHSA 5F48A 5I11A 1PKTA 1AWWA 1YJ9A 1VQNT 3RR6A 2CKKA 2OOTA 2Z3KA 3D7SB 2EUIA 4FCYA 5KYXA 2MCNA 4MY3A 4LNPA 1WPYA 3JCMJ 2ZOFA 3FEOA 3TEEA 2E3IA 3E9GA 3CD6A 4PK3A 1IRXA 4DBRA 5A0GA 2DAQA 3J7AF 4O23A 2SRCA 4F04B 2GU2A 5LJ3e 4XTZA 4TNUA 2RNAA 4D8DA 2RI5A 3CCEQ 3WVDB 2DNUA 3I35A 1PWTA 1R77A 3CPWS 3WR7A 5C88A 3EG3A 1KWMA 2PQ8A 2YUPA 1PUAA 2XDDA 4P44A 3NTIA 3X20B 2AFZA 5I4MA 2CIJA 4C0ZA 4XPLA 2G3AA 1LANA 2LNHB 2EJFA 3MPUB 2PQWA 3RKXA 4HCKA 3BI0A 2MWOA 4IUPA 1ZBXA 1AVZC 2IL4A 3EG1A 1FNOA 5F09A 2I2LA 2E1HA 2FZKB 4XTWA 3JCMe 3I5RA 4P5NA 1QCOA 4J9BA 4OP0A 5EG2A 4CAWA 4R57A 1OU8A 4MCSA 1IZ6A 1K9MU 3VATA 3S9LA 3EXNA 2M02A 4NF1A 3REAB 1ABQA 3CCJT 4F7UF 3T9NA 1LCPA 4CYQA 4BBHA 1B87A 2A28A 4M3SA 3CC7Q 3PFEA 3MEWA 1W2BS 1EZZB 3TREA 2WSAA 1PM3A 1U6MA 5GAMd 4G1PA 3L2NA 5HKCA 4JDSA 2M0OA 2EJ9A 3UA6A 3G4SQ 2NSMA 3D7FA 1ARMA 3VJPA 4UFXA 4F7UA 4B5PA 4II9A 1W70A 3LODA 2LX7A 4XK8E 1Y9WA 1EFNA 1G8XA 1MJBA 1BCOA 3JB9H 1WI7A 2DX1A 1PNJA 1NSAA 3JTKA 3PNWC 2MOXA 1V1CA 2QGGA 2F7VA 3G71Q 1RL2A 3MEVA 2XEFA 3QZ5B 3VS7A 4B5OA 4IHMA 1YQEA 1PRMC 3JCMW 1RTQA 5GMKl 1VQNA 5FWCA 3OS1A 4DBQA 1PD0A 4JLYA 8CPAA 2LQWA 4QVCA 2OZGA 4MZTA 4JUVA 1XBUA 2DTOA 2ZGWA 3EG2A 3HRUA 4BACA 4MFZA 2I79A 4XU2A 1QVFP 3NH8A 4M78C 3RBUA 1BAVA 4HNWB 3EGDA 1PRLC 2PR1A 1RAHB 3D2MA 3KL9A 2KNBB 1VA7A 4JD6A 5GAOp 4HXJA 2JBKA 3R96A 4MCRA 3KHXA 5GANj 3K2KA 2COZA 1VQOT 3SJEA 5GANf 1VQ5Q 3MGDA 3E2UA 3VYHB 4TVRA 1M1GA 5GAN6 3DR8A 2Q4YA 4FD7A 4C7IA 4EWTA 4NFRA 2E4HA 2QQRA 2O2OA 2XI9A 5EBVA 2CT4A 2VB6A 4C92A 1EX4A 1S60A 4MFQA 1WJRA 3CCQQ 1N9SA 4PL6A 2FPEA 5D6WA 2PJ7A 1B34B 2ZZDA 3LWUA 2P0PA 2H3EB 2EWBA 3A98A 3CMET 3LH0A 3WXMB 1CP7A 1CPXA 2E70A 3EG0A 3CXCP 2DFUA 3ULRB 2EYXA 1NYGA 2DF5A 2ECZA 3FIFA 4PJOA 4DYOA 2L5QA 2FPFA 3JCMX 1K76A 1Q95G 2QEXT 1JXMA 4Y49C 1IO6A 3CCJA 3HTRA 2FYKA 2YLCA 2QJ8A 2HDAA 2DLPA 1KJWA 5LJ3d 2HNIA 2RK1A 4K11A 2R58A 3H8ZA 1B6BA 1IREB 3SXOA 2D8HA 4HCZA 4R0KA 1ARKA 2COWA 3L2QA 4CYPA 5A0LA 1VQ7T 2XK0A 2JOYA 4C2ZA 5LL6S 1N6AA 3FECA 3QAYA 4B13A 5LJ5h 3OYKA 1VQ9Q 3EC4A 4M77B 2ZEMA 4GXHA 2RFHA 5F49A 4E7KA 2HZYA 5KTAA 2DM1A 1U06A 5ISVA 3REBB 5IAYA 2Z3LA 1M8MA 1M90R 2F2WA 2VXKA 1ZBJA 2EYYA 4KOVA 1QW1A 2Z11A 2Z3OA 2F5TX 4J9GA 1VKCA 5GCNA 2Q7BA 3JCMP 4QW2A 2FIAA 1MJ9A 5J8FA 4MCQA 2DPSA 5CPAA 1GYTA 3I55T 3QIIA 5CIUA 4QQDA 2DXQA 2OTJT 1NG2A 2YUQA 1RLQC 1QQ9A 1TXRA 4JZ4A 3CQTA 3EG9B 4FM4B 3W6XA 2DBMA 4CC3A 1N5ZA 2JN0A 1M1KC 1OX9A 2C27A 2LQ8A 1YHQQ 4OC5A 2KVQG 2MF2A 2V1RA 1M9SA 4GM5A 3IGRA 4XTYA 1OOTA 1QSNA 3PP9A 3V8KA 4ZY0A 1VQOA 3BDLA 4PK2A 5IXBA 3H41A 1BK2A 2ZENA 3H8GA 3FB3A 3JCMV 2Z3PA 4QVZA 3RAMA 2LJ3A 3LGLA 4OMLA 1I5LA 1UHFA 4R8FA 2K57A 2R8VA 2ZW6A 1VQ4T 2CTCA 3JCMc 3G6ET 2ANPA 2Q43A 3AHUA 3FC3A 1IXDA 1MMGA 2HUZA 3GB0A 3SDZA 4R56A 4XTUA 3CPFA 5LJ5g 1QSRA 4LD6A 4J9FA 3CMEA 1GFCA 4PJNA 3KI9A 3CD6Q 2K3YA 2JW4A 2CNTA 4M75B 3BI1A 4KS9A 4M77D 4N0AC 2RPNA 2QQAA 2V77A 2FG0A 3HP9A 2KQWA 4JPBW 3JB9G 2VBQA 1UECA 1R43A 1GCQC 2QEXA 5GAOm 2FEIA 1KZFA 4BINA 2V8IA 3MHXA 4OMQA 2A4NA 2RJEA 2CP3A 3JB9J 4AG1C 4J9EA 1QSMA 4M7AB 4DA4A 4C68A 3WC6A 1AZEA 5G22A 2PIZA 1VQ7A 1NEBA 4CRYB 3EY5A 4P10A 1SHGA 4LDWA 3PFSA 3RYOA 2L3SA 1CKAA 5GAMh 2YHTA 1QVPA 3ASKA 3QB8A 1VHEA 4MZMA 4GLKA 4P4FA 4X9CA 3KR5A 3DLJA 3LACA 2EPDA 2L8DA 3X28B 2B5GB 1YW4A 4LDVA 1TH7A 2DVEA 4OMMA 4PFOA 4OC2A 3M9QA 1UGRB 1VQKQ 3VV0A 1RI9A 4QUSA 4CAFA 2B4BA 2YUNA 4JJBA 1GL5A 3EFRA 2VWFA 1OX8A 4Z89A 4KORA 5IN1A 3I55A 4JXQA 1B3QA 3BW1A 2BTTA 2OX7A 4MFJA 4PSXA 2OTJA 3PVLA 3C26A 4DJLA 3D7HA 3CZXA 1ZUYA 2YLBA 1YP5A 4ORZA 3CXCA 2L3QA 4JRPA 3TE4A 3D66A 1K9AA 5HVHA 4M6IA 1MMNA 2FCKA 2L3RA 4FYVB 1TOVA 3INZA 3CC4T 3HHTB 1JEGA 2EYQA 2ZEEA 3QO3A 5KYNA 1D0XA 3OYNA 5HH1A 4CRZB 2MI6A 2YNCC 1HSQA 4U5YA 3D7DA 1SSHA 3EFSA 1IHWA 1FWZA 1VQ4A 4L5GA 1W6XA 4E47A 3G6EA 2O88A 4UCNA 1WLPB 1QP2A 1BBZA 1SG5A 4L89A 3NMZC 4WWVA 2JVVA 3UF4A 1XF8A 2CNMA 4J7FA 3UY5A 1BO4A 5DY9A 5GAMg 1NLOC 5FU7C 4R7MA 3EFOA 4IIOA 1QVGP 3EGXA 2P6FA 4JLGA 4E7JA 3IJ3A 3D8PA 1M1KU 2PZ1A 3ER0A 3E1SA 3IIBA 1M1DA 2WSEE 4R3LA 2M1HA 2H5MA 5C0MA 2LP5A 4M77G 5KCOA 1QMUA 5LJ5e 2KROA 2X3WD 2K2MA 4OADA 4KUDK 4AT1B 3OS5A 2HKQB 4QKUA 1HK9A 4EDUA 2FVGA 2GE3A 5CNPA 4B6ZA 1S7KA 1J4JA 2KT8A 1BCMA 4JZ3A 2KR3A 1ZLHA 3CCMT 2JTMA 2K4YA 4IKFA 2JBJA 3E0KA 2EYWA 5LJ3h 3D3SA 3OYFA 3CMAT 2XG8D 4Z8AA 5HY6A 4CPAA 4XU0A 3MN8A 1S3ZA 2G6FX 1T3SA 3CPWP 5JPHA 2DZ9A 3PRTA 1ZLMA 4E7IA 4EFDA 3CCST 1JJ2P 4HCBA 2ZELA 1GRIA 2QQSA 4N4IA 4UCMA 1Q7YC 4D6WA 1TWBA 2PJ4A 5GANd 2AFWA 4QQGA 4ZNXA 2RO0A 3OBYA 4AFUC 2IJZA 4PQAA 2J05A 1M4GA 4F0XA 2ZEDA 4RTWA 3VH9A 2KSSA 1KUYA 3JCMh 5G1ZA 5JQ4A 4Z88A 5KYUB 4M78F 3FIXA 1KQ2A 3JRUA 2I0NA 4J9CA 2V8VA 4CI0C 3CCRT 2PJ0A 5KYYB 2OZHA 4RTZA 1S7LA 3C4SA 2C1CA 3TX8A 3S6FA 1IICA 1G3TA 2QYZA 4M78A 3QKJA 4P4BA 3VWDA 4OC3A 2DBKA 3OYDA 4NSQA 3CC4A 2OU2A 4M77C 1ZG7A 4QC6A 4M75G 3SXNA 3PVQA 1W2BP 2OR4A 1I5OB 3HFNA 3GUXA 4KUBA 3P8HA 1BI1A 1YJWT 1M5Q1 4UWJA 2YRVA 4ZN3A 2B4DB 3VS4A 4J9DA 3IEHA 4JJCA 3H0IA 4PJJA 5LJ3g 4J5YA 4M7AG 3GOXA 1IB1E 4PLLA 4A39A 4XPKA 1CJWA 3V8IA 3VUZA 3JCMb 2AJ6A 5FLXE 4PPZA 1Q7YR 1OQKA 4PXBA 3QHSA 2E3HA 2VUBA 3EAEA 4CAXA 2FIWA 4YFJA 2BZXA 4GBQA 1N27A 2HBWA 1JO8A 3HPWA 1G5VA 1NJIR 1YSJA 2ED1A 3WABA 3NTKA 3CXSA 3H0HA 1WZOA 5GAMe 2K6DA 2DERA 3GIBA 3RKYA 4C5HA 3LH5A 1T3LA 2AIRB 4ZGEB 4E7HA 2XICA 4HNYB 2CDTA 1D09B 3JCMg 1SQHA 2E41A 2DEAA 4F0YA 3H9NA 2AHJB 3IWEA 1C6VX 3M0SA 2JM8A 4CGMA 2QK0A 2YXYA 1QQJA 3HSBA 1MV3A 2C6PA 5KE2A 4GY5A 2RJDA 1Z8WA 2RHUA 1TKFA 3CCMA 4A4KA 2Q04A 3OYEA 2RM4A 3CMAA 4M7DE 3D2PA 1JU5C 3CMEQ 1YBYA 4ZYQA 4M75C 4NS5A 1E7OA 2D0QB 2RI3A 3CCSA 1TKJA 1QP3A 2AKKA 4PKCC 2OAWA 2GFAA 2JZ2A 5FW9A 2QEXQ 4KVOE 1UGPB 1MK4A 3QSUA 1RUWA 2WPXA 3DGVA 2FZGB 4FT4A 2KY9A 2OTLQ 2OB0A 3OW2P 3VRZA 2WSCE 4BMHA 3W6SA 1HDQA 3FVLA 4ZTJA 4M7AC 3J80E 1S1NA 2BUEA 1X75C 4KUAA 4FUUA 2PU9B 1FY7A 4FYYB 5KH6A 2PVVA 2WZNA 4C8QE 4RN7A 2QIRA 4V2SA 1VQ7Q 2A37A 3B3CA 3CCLQ 2O9VA 3CCRA 1QVGA 4MHZA 1M4DA 2LCSA 1CBXA 3MRUA 1R0BG 3SJXA 2FRYA 2LQNA 3KGQA 2ROTA 4BDYA 3A5ZB 5I21A 1WHHA 1TU0B 1AWOA 4JLIA 4LD9K 5CKBA 1UTIA 3FH4A 1LOJA 1P4NA 3TCVA 1SF9A 4RTTA 3E19A 2V8HA 4Q38A 1Q7YU 4ONUA 1YJWA 1U3OA 2QDYB 1VQLT 2PJCA 3M57A 1JRIA 3WC7A 4J6YA 1FX7A 3VYGA 3T90A 1UFFA 1Y57A 3FBUA 4E2AA 3VS1A 5AG4A 3NPFA 5FRMA 4LX9A 5KYWB 1BI3A 3MKDA 3OB9A 4B9WA 2GFUA 3I55Q 1R57A 3NH4A 4FD6A 4FWUA 5AG7A 4A32A 1YCYA 4DBHA 3A8OB 2DKGA 4E7LA 2YRDA 2JT4A 3CPWA 5DM7R 2Q4ZA 4N4HA 1KQ1A 4IUVA 1K8AC 1X01A 2J6FA 1JJ2A 4ATOA 5THWA 2DETA 2XHCA 1OULA 1P0HA 2D4OA 4PXDA 1YNZA 4Q7AA 4R9MA 4JYWA 2JNGA 4M7DD 4N0AA 4Z65A 1WX6A 2MYSA 3HRTA 4OLLA 4H6UA 1AHJB 1AWJA 1F2PA 1GCQA 3SWNC 3B3TA 5HVGA 5K8PA 1Z2LA 2MK5A 1DJ7B 2YSQA 1UEBA 2RQTA 4ZTFA 4EPCA 4OB1B 3TCJA 1VQ4Q 1M8VA 2RHYA 2O53A 3R95A 2OZUA 2FPDA 4DEYA 2FHDA 2RB7A 3SHPA 4BDZA 4B9XA 1YJNQ 7AT1B 5H84A 1I1JA 2PRQA 1X69A 3BFMA 3B2YA 4KRTA 4R3KA 1OV3A 1PKSA 2CT3A 2JS2A 2KDSA 1YK3A 5EMIA 3TO9A 3RDVA 3DR6A 4B6MA 3SB2A 1W2BA 3PB4X 4C8QD 2PR8A 4PJMA 1ARLA 3LMSA 4IUUA 1ABOA 3VUBA 1I07A 1R0CB 1WHJA 5LYFA 3PBEA 3C0CA 4KOWA 2X35A 1ELMP 1R3NA 3SD4A 3BY7A 1ZUKA 2A7YA 1VGYA 1X12A 2DL7A 3F70A 4X34A 4CC2A 4F7UE 3JCMQ 2CGHA 2DE0X 2PVOB 1OZ3A 5GAOn 3L2VA 4JZ0A 2JDCA 1MMAA 1WXBA 4CC4B 1U8RA 2Q0YA 1K8AR 1XMBA 4RUHA 4LN2A 1K4JA 4BUGA 1LJOA 5KE3A 1RADB 1KQSP 3W91A 4JJDA 3S6KA 2Y90A 3PTAA 2BSWA 3S3MA 5CKHA 1Q2CA 2K5TA 3OYGA 3VS0A 1WGSA 2QQBA 2E6NA 5AYFA 6AT1B 3CBOA 2RMOA 2ROLA 2DXBA 2D8JA 1MV0B 1VQLA 4X5KA 2PJ8A
chains in the Genus database with same CATH topology
2LCCA 3GP8A 2JUFA 1M30A 5CKEA 2RK2A 2W10A 3TSZA 2B86A 1RI0A 5FU7B 2A36A 1QKWA 1Y7XA 5GAOr 1NPPA 4QVDA 4C92F 2MWPA 4RG2A 1GBQA 4BE1A 3OW2A 3NE8A 4C92E 3LGFA 4YTLA 5ECAA 1O75A 4JRKA 4M7DG 2ABLA 1M90C 3V8JA 1CKBA 3LWIA 4PJOF 1XQHA 2K3XA 1Y96B 2DO3A 3UDCA 4RCBA 4PJOE 2IIMA 3PGGA 3MP1A 4FL6A 2EJGA 1B34A 1O9SA 1K8AU 4BB7A 1X43A 3THKA 4C5IA 2GQIA 2K5LA 4X1VA 2JMCA 4C8QG 4RMOA 4XTVA 3OYMA 4XTXA 4J6XA 2ESWA 5GAOq 4HKEA 4JJNK 2F2XA 2KYBA 3PT9A 3A8MB 3HFOA 3VS5A 4OMPA 1QCFA 3SFMA 4OB3B 2CZ1B 3R6OA 3UATA 3I9QA 2YT6A 1QWFA 2X3XD 2KRMA 4M77A 2LJ1A 3R6NA 2CZ0B 2EQKA 2VXFA 3QXEB 2AKLA 1J3TA 3X24B 3KFVA 2HCKA 2DTHA 1OI1A 3M5AA 1NEGA 3E9FA 1U1SA 2K2VA 3P8BB 3M4YA 2ZCFB 3HKSA 5GAN2 2M51A 3QUIA 5CR2A 3HRSA 5J26A 4ME7A 3QJ6A 4NOYA 4BE0A 3M59A 1BKBA 1YIJT 3QJYA 2EKOA 3QBYA 4AFQC 3UWNA 2JMAA 1PSFA 1WXUA 3CCET 2DJQA 2KXDA 2CZ6B 1KQSA 3QDRB 4BY6B 2IG0A 1H8KA 3PIPA 1FYNA 5GANe 1JB0E 3A8LB 5LJ5j 1QWEA 4CRIA 3EGUA 4Y91A 1BB9A 4F7UG 4M75A 4ZGDB 3JAME 4ZGJB 2R57A 2ZPHB 3ZFJA 3M54A 2P4RA 1M90U 4M7AA 3VU3C 2JTFA 5IHNA 1OEBA 2AZSA 3CC7T 2LCLA 4OGEA 1H3ZA 4J9IA 3VRYA 1BI0A 3MP6A 3FLGA 3G4ST 4EMHA 3OYLA 1TG0A 5GAN5 3LLRA 1UE9A 3CEYA 1B07A 2QQ9A 2QXFA 3OYAA 1V29B 1QVFS 2ED0A 2M16A 4NL2A 1SRMA 3MCAB 1N8RC 1NZ9A 1H3HA 2ODFA 2KT1A 1BIBA 2DXUA 2VKNA 2LMJA 2RQRA 3SWNB 1WIEA 4A4FA 5D6YA 5IXFA 3VS2A 1VIFA 3BDUA 3M4GA 3OYHA 2VGMA 2ZPBB 5CCAA 3NTHA 2FVUA 1D3BB 3KBGA 1YIJA 5CAIA 2LDMA 1G83A 5FROA 2DVJA 2ENMA 3CCEA 3IQLA 3CXCS 4RKUE 2RQWA 4JRIA 2P0QA 3CBMA 2L0AA 3LWHA 4VUBA 2DA9A 2X4XA 1CSKA 2GGRA 3FJPA 1UJYA 1BI2A 3N5BB 2CUDA 1YCSB 2LT4A 1X27A 2E65A 1Q81C 2QTXA 1VQMT 1WA7A 2O4XB 2L2PA 2P0KA 3PMTA 3CCUT 3CC7A 2RHIA 3MP8A 3KUFA 1BU1A 3DLMA 2NLUA 2GTOA 3G4SA 2VC8A 3RIRA 4LQ6A 3CCVT 2RQVA 2WSFE 1WXTA 3OY9A 3META 3V7RA 1NJIC 2HEQA 5CKDA 3FJ5A 1OPLA 2DILA 1N9RA 2BUDA 5DLOA 2J6KA 4XU1A 1FMKA 1Z9ZA 2OAUA 2GCXA 4M78E 3RMQA 2X4JA 1XOVA 1SRLA 4C0GA 4HT8A 2E12A 1PHTA 3DB3A 2LQKA 4EMKB 4RTXA 3UPUA 4HVWA 2PVDB 2D6FA 1G3YA 1H641 5GMKh 1AOJA 3ME9A 5GAN7 1YHQT 3H0FA 2RJCA 3H6ZA 3FDRA 4DOVA 1Q82C 2HQXA 2E10A 2E5QA 2GTJA 5LJ3j 1N8RU 5LJ3f 1LCKA 5IHKA 2E64A 2J6OA 2K5FA 2LTOA 1OPKA 5HK3A 4WF2A 5CKFA 4BI4A 3I56T 1Y71A 4QQ6A 2DMOA 2DYBA 3RUXA 2KYMA 2CH4A 1K1ZA 4KULA 2FL7A 3O5ZA 3M53A 1VQMA 3JCMf 4X9DA 4MMKA 2K7AA 2K79A 3L2UA 1XNIA 1WQWA 3CCUA 4IURA 2XMFA 4IUTA 1JXOA 4BI8B 4BY6C 2SEMA 2PUKB 3PIOA 1X2QA 1WQ7A 4LDXA 1UHCA 1K0SA 2RQUA 2ZPIB 4M78D 4M7DB 3CCVA 2DL8A 4O6JA 1YWPA 2FB7A 2XD0A 3V8LA 4LE9A 2C06A 1HXDA 2EVRA 1Q81U 2CSIA 3C12A 1I8FA 2CZ7B 4D8KA 2V1QA 2EYZA 3GPLA 4FSSA 2GBQA 1VQKT 4JS5A 1I4K1 1VQ8T 5FU6B 4C8QB 3RBBB 4Z02A 1AZGB 4IIMA 1VYTA 1R8OB 4C0DC 2Y4YA 4OB0B 2MIOA 1NJIU 1YHQA 2LVMA 3OQ5A 2PTKA 2CYZB 1NE8A 2BIVA 2VGNA 2J06A 3X25B 4WCIA 4IUQA 1SPKA 3ZL7C 1HJDA 2BZYA 3S3NA 5CO7A 3I56A 1NPRA 4LDUA 3OYBA 4MDWA 2K5IA 3M55A 4A4GA 2RD1A 3TSWA 3OS0A 2MAMA 5GAN4 1MUZA 1WDXA 3U23A 2A08A 4UC4A 1Q82U 4OF1A 3LW5E 1K0XA 2D1XA 1KSWA 1YN8A 4Q5WA 1UJ0A 2Q7SA 4M6HA 2DD4A 2F69A 1S72T 1JJ2S 2RF0A 1H92A 1U5SA 2EQJA 1K4US 2HB6A 4OMFB 3M0RA 2ZPFB 2XDBA 2PUOB 2F2VA 1VUBA 4J9HA 3JSCA 4M78G 1YITT 3M0QA 5GANh 2Y4XA 3JB9F 3DB4A 3GLXA 3QYGB 2RHZA 5GMKe 1OZ2A 4FU6A 2EGEA 2VV5A 4HVUA 3O8VA 4F7UB 1VQKA 3V7SA 1RLPC 3JV3A 1VQ8A 1VQ6T 1WNLA 4DEXA 2AK5A 3RKWA 3MEUA 2BKDN 2OJ2A 4KUIA 3QWXX 2C0IA 2MMPA 5I2SA 5I22A 4A63B 1UB4A 1X2KA 3JB9I 4RTYA 1YWOA 1K73C 2EBPA 3RERA 4RTVA 3GNGA 3OYJA 2ZPGB 2FO0A 5CQYA 2KMTA 5EC7A 3RESA 1QLYA 3MO8A 3S6WA 1GFDA 4AG2C 2DL4A 3SHWA 4DQ2A 2FRWA 4ZN1A 3OYYA 4EMKC 1M27C 5C6SA 2VXEA 2DJZA 2XU8A 1XTDA 2KRNA 3M0TA 4M4ZA 5GANg 3L2RA 2HSPA 1Y0MA 3M0UA 4HVVA 4C5GA 2K3BA 2KRSA 1PSEA 2HD0A 2E5KA 2KAFA 1BIAA 4C92B 1M3BA 1S72A 3EHQA 1VYVA 1Y96A 3OW2S 3TU4K 4EIKA 3QYHB 4OMNA 4DOWA 3JB9D 4PJOB 1NLPC 2R5MA 1ZX6A 2CSQA 1YITA 2NUZA 1AWXA 5M9OA 3NFCA 4O5VA 2EQMA 2BZ8A 4A4HA 2OTLT 1EIFA 3SEMA 1JQQA 2KBTA 4M77F 5GMKm 3X26B 4J83A 2EGAA 2X4WA 1VQ6A 1TUDA 1AEYA 1ZHIA 1X6BA 3FB9A 4M77E 5GAOl 3NGPA 3OMCA 3A8HB 2EWNA 2LT1A 2CS7A 3A8GB 4M7DC 2HAXA 2CH4W 3CCLT 2DL5A 3LX7A 1QKXA 1TUCA 1JWQA 2KXCA 4XAXB 4BE2A 4AFZC 3C95A 2GNCA 4C92D 2B8AA 3JCMd 2RHXA 2J7IA 4HCCA 1HD3A 1KHIA 1WYXA 4MDXA 4C5EA 4A4EA 1WFWA 2O31A 5FWBA 2O01E 5FU6C 4PJOD 2DIQA 4C8QC 3QG1A 4BD3A 3GNFB 2DF6A 1MGQA 2LJ0A 3L2ZA 3RMSA 3QPHA 1X6GA 4OB2B 5KCHA 3OYCA 2RJFA 2DZCA 3TVTA 2DD5A 1K73U 2EIFA 3KXTA 4M75F 4BI3A 4RG8A 2EQUA 4XU3A 2DPPB 4M6GA 4M75E 2R5AA 3ZEHA 5LJ5f 4AFSC 4CC7A 3UA7A 1M4ZA 4M7AF 1YJNT 1VYUA 1M1FA 4XQ3A 4E6RA 4M7AE 4ELZC 1E6GA 2CREA 3GBQA 1T0HA 2KEAA 4Y28E 1KQSS 2L89A 1GXIE 4KBMB 3VKIA 2OTLA 1NM7A 3QZ9B 1JBMA 1UDLA 2LX9A 4LDYA 2F5KA 3NHNA 1KIKA 1I81A 1QVFA 1UGSB 4C0DB 1KG1A 4MMLA 3CCLA 1UUEA 3VS6A 2NWMA 5DLQE 3L42A 1E6HA 3G71T 4C0FA 4F17A 4A54A 1ZSGA 4N4GA 1GBRA 2V8JA 3OS2A 2G3RA 4RTUA 4C92G 2DXCA 1ZUUA 3JRZA 2XKOC 4OMOA 3DLLA 3OYIA 4HT9A 2EGCA 1FXXA 2JTEA 2QA4T 1NYFA 2JS0A 5L23A 2CUBA 3LYIA 4M75D 3SWNA 4PLIA 4RCCA 3CC2T 1YI2T 4PJOG 5GJVB 2E6ZA 5A0DA 1D3BA 3OA6A 4NL3A 2JM9A 2W0ZA 1VQ5T 1OYXA 4A53A 2DIGA 4R55A 5HK0A 1G3SA 4M7AD 1KFZA 5GAMj 2HBPA 4Y92A 5GAMf 1UGVA 1VQPT 2OI3A 1A0NB 2EFIA 3CCQT 2DTIA 3RNJA 1YJNA 2WACA 3M56A 4L6V5 1GCPA 4ESRA 2LNVA 1KC8C 3S3OA 2LZ6B 1U1TA 2LC4A 2M0YA 2QI2A 4C92C 1KD1C 2O4XA 1G2BA 2A3LA 1SEMA 1SHFA 3V7CA 2LRQA 4EMGA 3M0PA 2M9UA 4OGCA 3GF5A 4PJOC 2DRMA 1VQ9T 3HL8A 1Z9QA 4RUGA 3G7ZA 3MEAA 3G71A 1Q86C 1X6OA 2DK3A 3PMIA 3ZBDA 3UT1A 2EW3A 3PE0A 1Y07A 5GMKi 2RB6A 4LUDA 2D9TA 5I2MA 3FRNA 2DL3A 1MHNA 1WJQA 5A2QE 4FSXA 4M78B 4QT7A 2C0TA 4F16A 4EMKA 2QA4A 2JXBA 4JRQA 2HQEA 3P8DA 3CBPA 5J39A 5J3BA 3L2WA 2VYTA 4KT0E 3J81E 3CC2A 2V8KA 1YI2A 5CK9A 2KK4A 3OSSC 4FIBA 2K9GA 5IH2A 1VQ5A 3OSVA 1M3AA 2XDPA 5CQXA 1UGQB 1YJ9T 4II1A 2KGTA 2H3JA 2DRKA 5D6XA 4J8OA 1VQPA 3M58A 4FT2A 2IVWA 2QDLA 3CCQA 2DXTA 2RI2A 2PVGB 3WVEB 5GAN8 2YDLA 3I5SA 1BYMA 4L59A 3CD6T 2XIDA 3L1AA 2P4TA 3Q1JA 3OMGA 3EHRA 5IHIA 1G3WA 1K9MC 5HCKA 3OBWA 2D0NA 5L8RE 2AZVA 5IT9E 2RH2A 1WJSA 1SSFA 4LUEA 3QWYA 1M3CA 1VIEA 4F14A 1W4SA 4HA8A 2H8HA 2RN8A 4PNOA 4M7DF 5CVIA 2GQVA 4GLMA 3DKMA 1AD5A 2KE9A 4JS4A 1ZQ1A 2EQIA 2EAYA 2DEQA 1VQ9A 4M7DA 5GMKj 1KC8U 2C0OA 1W1FA 1KHCA 5GAN3 4MZPA 1LNXA 1I0CA 5GJWB 4OVAA 3C94A 5FRNA 4ELYC 2L3PA 4J6WA 2YUOA 4C8QF 2ZPEB 5LJ5d 1KD1U 1T0JA 2EKHA 2O9SA 2PNIA 4J7IA 2VVKA 3URGA 4C8QA 3VS3A 2RA2A 2X4YA 2HC9A 1Q86U 1UG1A 1P92A 2GF7A 1QVGS 5I11A 1PKTA 1AWWA 1YJ9A 1VQNT 2CKKA 2MCNA 4LNPA 1WPYA 3JCMJ 3FEOA 3TEEA 3E9GA 3CD6A 5A0GA 2DAQA 3J7AF 2SRCA 5LJ3e 4XTZA 2RNAA 4D8DA 2RI5A 3WVDB 2DNUA 3I35A 1PWTA 3CPWS 3EG3A 2YUPA 2XDDA 3NTIA 3X20B 4C0ZA 2LNHB 2EJFA 2PQWA 3RKXA 4HCKA 2MWOA 4IUPA 1ZBXA 1AVZC 3EG1A 2I2LA 2E1HA 4XTWA 3JCMe 3I5RA 4P5NA 4J9BA 4OP0A 5EG2A 1IZ6A 1K9MU 3REAB 1ABQA 3CCJT 4F7UF 3T9NA 2A28A 3MEWA 1W2BS 3TREA 5GAMd 5HKCA 4JDSA 3UA6A 2EJ9A 2M0OA 3VJPA 4F7UA 1W70A 2LX7A 4XK8E 1EFNA 3JB9H 1WI7A 2DX1A 1PNJA 3PNWC 2MOXA 1V1CA 1RL2A 3MEVA 3QZ5B 3VS7A 1PRMC 3JCMW 5GMKl 1VQNA 5FWCA 3OS1A 2LQWA 4QVCA 4MZTA 4JUVA 3EG2A 2DTOA 2ZGWA 3HRUA 4BACA 4XU2A 4M78C 1PRLC 2KNBB 1VA7A 5GAOp 4HXJA 5GANj 1VQOT 5GANf 3VYHB 4TVRA 1M1GA 5GAN6 2QQRA 2O2OA 2XI9A 2CT4A 4C92A 1WJRA 1N9SA 4PL6A 2FPEA 5D6WA 1B34B 2ZZDA 2P0PA 3A98A 3CMET 3LH0A 3WXMB 2E70A 3EG0A 3ULRB 2EYXA 1NYGA 2ECZA 3FIFA 4PJOA 2L5QA 2FPFA 3JCMX 1K76A 2QEXT 1JXMA 1IO6A 3CCJA 2FYKA 2YLCA 2HDAA 2DLPA 1KJWA 5LJ3d 4K11A 2HNIA 2RK1A 2R58A 3H8ZA 1IREB 2D8HA 4HCZA 4R0KA 1ARKA 3L2QA 5A0LA 1VQ7T 2XK0A 2JOYA 5LL6S 1N6AA 3QAYA 5LJ5h 3OYKA 4M77B 4E7KA 2DM1A 1U06A 3REBB 5IAYA 1M8MA 2F2WA 1ZBJA 2EYYA 1QW1A 2F5TX 4J9GA 3JCMP 4QW2A 3I55T 3QIIA 5CIUA 4QQDA 2OTJT 1NG2A 2YUQA 1RLQC 4JZ4A 3CQTA 4FM4B 2DBMA 4CC3A 1N5ZA 2JN0A 1M1KC 2LQ8A 2KVQG 2MF2A 2V1RA 1M9SA 4XTYA 1OOTA 3V8KA 1VQOA 3BDLA 5IXBA 3H41A 1BK2A 3JCMV 4QVZA 2LJ3A 3LGLA 4OMLA 1I5LA 1UHFA 2K57A 1VQ4T 3JCMc 3G6ET 3AHUA 3FC3A 3SDZA 4R56A 4XTUA 3CPFA 5LJ5g 4LD6A 4J9FA 3CMEA 1GFCA 2K3YA 2JW4A 4M75B 4M77D 4N0AC 2RPNA 2QQAA 2FG0A 3HP9A 4JPBW 2KQWA 3JB9G 1UECA 1GCQC 2QEXA 5GAOm 2FEIA 4BINA 2V8IA 3MHXA 4OMQA 2RJEA 3JB9J 4AG1C 4J9EA 4M7AB 4DA4A 1AZEA 1VQ7A 1NEBA 1SHGA 4LDWA 3PFSA 2L3SA 1CKAA 5GAMh 2YHTA 1QVPA 3ASKA 4MZMA 4GLKA 4X9CA 2EPDA 2L8DA 3X28B 4LDVA 1TH7A 2DVEA 4OMMA 3M9QA 1UGRB 3VV0A 1RI9A 2YUNA 4JJBA 1GL5A 3EFRA 2VWFA 4Z89A 5IN1A 3I55A 1B3QA 3BW1A 2BTTA 2OTJA 3PVLA 3CZXA 1ZUYA 2YLBA 1YP5A 4ORZA 3CXCA 2L3QA 4JRPA 1K9AA 4M6IA 2L3RA 3INZA 1JEGA 3HHTB 3CC4T 2EYQA 3QO3A 3OYNA 2MI6A 1HSQA 1SSHA 3EFSA 1FWZA 1VQ4A 4L5GA 1W6XA 2O88A 4E47A 3G6EA 1WLPB 1QP2A 1BBZA 3NMZC 2JVVA 3UF4A 4J7FA 5DY9A 5GAMg 1NLOC 5FU7C 4IIOA 4JLGA 4E7JA 1M1KU 2PZ1A 3ER0A 3E1SA 2WSEE 2M1HA 5C0MA 2LP5A 4M77G 5KCOA 5LJ5e 2KROA 2X3WD 2K2MA 4KUDK 3OS5A 4EDUA 1HK9A 2KT8A 2KR3A 4JZ3A 3CCMT 2JTMA 2K4YA 4IKFA 2EYWA 5LJ3h 3OYFA 3CMAT 2XG8D 4Z8AA 5HY6A 4XU0A 2G6FX 1T3SA 2DZ9A 1ZLMA 4E7IA 4EFDA 3CCST 4HCBA 1GRIA 2QQSA 4N4IA 1Q7YC 4D6WA 5GANd 4QQGA 4ZNXA 2RO0A 4AFUC 3OBYA 2J05A 4RTWA 2KSSA 3JCMh 4Z88A 4M78F 1KQ2A 2I0NA 4J9CA 4CI0C 3CCRT 4RTZA 3C4SA 1G3TA 4M78A 3QKJA 2DBKA 3OYDA 3CC4A 4M77C 4M75G 3PVQA 3HFNA 3P8HA 1BI1A 1YJWT 1M5Q1 2YRVA 4ZN3A 3VS4A 4J9DA 4JJCA 3H0IA 5LJ3g 4J5YA 4M7AG 3GOXA 4PLLA 3VUZA 3JCMb 5FLXE 3QHSA 2VUBA 3EAEA 2BZXA 4GBQA 1N27A 2HBWA 1JO8A 3HPWA 1G5VA 2ED1A 3NTKA 3H0HA 5GAMe 2K6DA 3GIBA 3RKYA 4C5HA 3LH5A 1T3LA 4ZGEB 4E7HA 2XICA 2CDTA 3JCMg 2E41A 2AHJB 3M0SA 2JM8A 3HSBA 1MV3A 5KE2A 4GY5A 2RJDA 2RHUA 3CCMA 4A4KA 3OYEA 2RM4A 3CMAA 4M7DE 1JU5C 1YBYA 4M75C 4NS5A 1E7OA 2D0QB 2RI3A 3CCSA 1QP3A 2AKKA 4PKCC 2OAWA 2GFAA 5FW9A 2JZ2A 1UGPB 3QSUA 1RUWA 4FT4A 2KY9A 3VRZA 2WSCE 4ZTJA 4M7AC 3J80E 1S1NA 1X75C 2PU9B 5KH6A 4C8QE 4RN7A 4V2SA 2A37A 1QVGA 2O9VA 3CCRA 2LCSA 2FRYA 2LQNA 2ROTA 4BDYA 3A5ZB 5I21A 1AWOA 4JLIA 4LD9K 5CKBA 1UTIA 1LOJA 4RTTA 3E19A 1Q7YU 1YJWA 1U3OA 2QDYB 1VQLT 3M57A 1JRIA 4J6YA 1FX7A 3VYGA 1UFFA 1Y57A 3VS1A 3NPFA 5FRMA 1BI3A 3OB9A 4B9WA 2GFUA 1YCYA 3A8OB 2DKGA 4E7LA 2JT4A 3CPWA 5DM7R 4N4HA 1KQ1A 4IUVA 1K8AC 2J6FA 1X01A 1JJ2A 4ATOA 2XHCA 1YNZA 2JNGA 4M7DD 4N0AA 1WX6A 3HRTA 1AHJB 1AWJA 1GCQA 3SWNC 1DJ7B 2YSQA 1UEBA 2RQTA 4ZTFA 4EPCA 4OB1B 3TCJA 1M8VA 2RHYA 2FPDA 4DEYA 2FHDA 4BDZA 4B9XA 1I1JA 1X69A 3BFMA 4KRTA 1OV3A 1PKSA 2CT3A 2JS2A 2KDSA 5EMIA 3SB2A 1W2BA 4C8QD 4IUUA 1ABOA 3VUBA 1I07A 3C0CA 2X35A 3SD4A 3BY7A 1ZUKA 2A7YA 2DL7A 4X34A 4CC2A 3F70A 4F7UE 3JCMQ 2CGHA 2DE0X 2PVOB 1OZ3A 5GAOn 3L2VA 1WXBA 4CC4B 1U8RA 4LN2A 4BUGA 1LJOA 5KE3A 4JJDA 2Y90A 3PTAA 3S3MA 5CKHA 3OYGA 3VS0A 1WGSA 2QQBA 2E6NA 5AYFA 3CBOA 2RMOA 2ROLA 2DXBA 2D8JA 1MV0B 1VQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M30 A;  2LJ3 A;  4OML A;  2EVR A;  1UHF A;  2M0Y A;  2CSI A;  2W10 A;  3TSZ A;  2B86 A;  2A36 A;  4D8K A;  2V1Q A;  2EYZ A;  4FSS A;  2GBQ A;  1G2B A;  1QKW A;  1SEM A;  1SHF A;  4J9F A;  1GFC A;  3M0P A;  2JW4 A;  3RBB B;  2RPN A;  2FG0 A;  1AZG B;  4IIM A;  4JPB W;  1GBQ A;  1VYT A;  1UEC A;  2DRM A;  1GCQ C;  2FEI A;  4BIN A;  1Z9Q A;  4RUG A;  3NE8 A;  2MIO A;  4OMQ A;  5ECA A;  2ABL A;  4AG1 C;  4J9E A;  2PTK A;  1CKB A;  2EW3 A;  3PE0 A;  2J06 A;  1AZE A;  4WCI A;  4LUD A;  1NEB A;  1SPK A;  2DL3 A;  3ZL7 C;  1HJD A;  2BZY A;  1SHG A;  2IIM A;  4QT7 A;  2C0T A;  2L3S A;  4F16 A;  1CKA A;  2JXB A;  2EPD A;  1X43 A;  3THK A;  3TSW A;  2GQI A;  2K9G A;  1MUZ A;  4X1V A;  1WDX A;  3U23 A;  2JMC A;  4OMM A;  5IH2 A;  2A08 A;  1M3A A;  1RI9 A;  1K0X A;  2D1X A;  1KSW A;  1YN8 A;  2KGT A;  2ESW A;  2YUN A;  4JJB A;  1GL5 A;  2Q7S A;  1UJ0 A;  2VWF A;  4Z89 A;  2DRK A;  4M6H A;  1B3Q A;  2BTT A;  2F2X A;  2KYB A;  2RF0 A;  2QDL A;  3PVL A;  1H92 A;  3CZX A;  3VS5 A;  4OMP A;  1ZUY A;  1QCF A;  1U5S A;  1YP5 A;  4ORZ A;  2L3Q A;  2YDL A;  3I5S A;  1K4U S;  3UAT A;  1K9A A;  3M0R A;  4M6I A;  3I9Q A;  2YT6 A;  2F2V A;  1QWF A;  2X3X D;  1JEG A;  3EHR A;  4J9H A;  2KRM A;  5IHI A;  5HCK A;  2LJ1 A;  2D0N A;  3R6N A;  2AZV A;  1HSQ A;  3M0Q A;  1SSH A;  4LUE A;  2AKL A;  3QWY A;  1W6X A;  1M3C A;  2O88 A;  1WLP B;  4F14 A;  1J3T A;  1BBZ A;  2H8H A;  2RN8 A;  3NMZ C;  2EGE A;  4HVU A;  3UF4 A;  1RLP C;  3KFV A;  2HCK A;  3JV3 A;  4GLM A;  1NLO C;  4DEX A;  2AK5 A;  1AD5 A;  2KE9 A;  1NEG A;  4IIO A;  2OJ2 A;  2EQI A;  2PZ1 A;  3QWX X;  2C0I A;  2M51 A;  2C0O A;  5I22 A;  1W1F A;  4A63 B;  2LP5 A;  1X2K A;  4RTY A;  1YWO A;  2KRO A;  2X3W D;  1I0C A;  2EBP A;  5GJW B;  2K2M A;  4RTV A;  2FO0 A;  2L3P A;  4AFQ C;  2JMA A;  2KT8 A;  1WXU A;  2YUO A;  5EC7 A;  2DJQ A;  2KR3 A;  2KXD A;  4JZ3 A;  1QLY A;  2EYW A;  1GFD A;  4AG2 C;  2DL4 A;  1T0J A;  2EKH A;  3SHW A;  4Z8A A;  1H8K A;  2FRW A;  1FYN A;  1M27 C;  2O9S A;  1QWE A;  2PNI A;  3EGU A;  2G6F X;  1T3S A;  2VVK A;  1BB9 A;  1ZLM A;  1GRI A;  2KRN A;  3VS3 A;  3M0T A;  4M4Z A;  2HSP A;  1UG1 A;  1Y0M A;  3M0U A;  4HVV A;  4ZNX A;  2K3B A;  2KRS A;  4AFU C;  5I11 A;  2P4R A;  2J05 A;  2E5K A;  1PKT A;  1AWW A;  4RTW A;  1M3B A;  4Z88 A;  5IHN A;  1OEB A;  2AZS A;  3EHQ A;  2MCN A;  2I0N A;  4J9C A;  4LNP A;  4J9I A;  1VYV A;  4RTZ A;  4EIK A;  3VRY A;  4OMN A;  2DBK A;  1NLP C;  1ZX6 A;  1TG0 A;  2SRC A;  3PVQ A;  2CSQ A;  2NUZ A;  1UE9 A;  1AWX A;  2RNA A;  4D8D A;  1B07 A;  2DNU A;  3I35 A;  1PWT A;  3VS4 A;  3EG3 A;  4J9D A;  4JJC A;  2ED0 A;  2BZ8 A;  3H0I A;  2YUP A;  1SRM A;  3SEM A;  1JQQ A;  2KBT A;  2LNH B;  1H3H A;  2ODF A;  2EGA A;  1TUD A;  2KT1 A;  1AEY A;  1X6B A;  4HCK A;  1AVZ C;  3NGP A;  2VKN A;  2LMJ A;  3EG1 A;  2RQR A;  1WIE A;  2BZX A;  2CH4 W;  4GBQ A;  2DL5 A;  2HBW A;  3I5R A;  5IXF A;  3VS2 A;  4J9B A;  1JO8 A;  2ED1 A;  3H0H A;  1QKX A;  2K6D A;  1TUC A;  3LH5 A;  1T3L A;  1JWQ A;  2KXC A;  2CDT A;  3REA B;  1ABQ A;  4AFZ C;  2GNC A;  1G83 A;  3M0S A;  2A28 A;  2DVJ A;  2JM8 A;  2ENM A;  2J7I A;  1MV3 A;  3IQL A;  1HD3 A;  1WYX A;  3UA6 A;  2RQW A;  1WFW A;  2O31 A;  1JU5 C;  5FWB A;  1W70 A;  2L0A A;  2LX7 A;  1E7O A;  1EFN A;  2AKK A;  2OAW A;  1WI7 A;  2DF6 A;  1PNJ A;  2DX1 A;  5FW9 A;  2DA9 A;  2LJ0 A;  2MOX A;  1V1C A;  1RUW A;  1CSK A;  2GGR A;  1UJY A;  1X6G A;  3VRZ A;  3VS7 A;  3TVT A;  2CUD A;  1YCS B;  1PRM C;  1X27 A;  5FWC A;  1S1N A;  1WA7 A;  2L2P A;  2LQW A;  4M6G A;  4RN7 A;  2A37 A;  2O9V A;  4AFS C;  3EG2 A;  4CC7 A;  2LCS A;  3UA7 A;  2FRY A;  1BU1 A;  2LQN A;  2GTO A;  2ROT A;  1PRL C;  4LQ6 A;  1VYU A;  1AWO A;  2RQV A;  2KNB B;  1UTI A;  1VA7 A;  1WXT A;  4HXJ A;  4RTT A;  4E6R A;  1E6G A;  2HEQ A;  2CRE A;  3GBQ A;  3FJ5 A;  1OPL A;  1T0H A;  1U3O A;  2DIL A;  2KEA A;  2J6K A;  1UFF A;  1Y57 A;  1NM7 A;  2O2O A;  1FMK A;  1Z9Z A;  3VS1 A;  2CT4 A;  3NPF A;  1UDL A;  1XOV A;  1SRL A;  1PHT A;  2FPE A;  3NHN A;  2JT4 A;  1KIK A;  4RTX A;  3A98 A;  2J6F A;  4HVW A;  1YNZ A;  1UUE A;  3VS6 A;  3EG0 A;  3ULR B;  1WX6 A;  2EYX A;  1NYG A;  2ECZ A;  2NWM A;  1AWJ A;  2FPF A;  1K76 A;  1AOJ A;  1GCQ A;  1JXM A;  1E6H A;  4F17 A;  1IO6 A;  2YSQ A;  3H0F A;  2RQT A;  2HDA A;  2DLP A;  1KJW A;  4K11 A;  1ZSG A;  2FPD A;  4DEY A;  1GBR A;  2D8H A;  2GTJ A;  4R0K A;  4RTU A;  1LCK A;  5IHK A;  1ARK A;  1I1J A;  1ZUU A;  1X69 A;  2J6O A;  4KRT A;  1OV3 A;  1PKS A;  4OMO A;  2CT3 A;  2JS2 A;  1OPK A;  5EMI A;  2EGC A;  2JTE A;  3QAY A;  4LE9 A;  1NYF A;  2JS0 A;  5L23 A;  2CUB A;  1ABO A;  2DMO A;  2DYB A;  1I07 A;  2DM1 A;  2KYM A;  1U06 A;  5GJV B;  3REB B;  2CH4 A;  3C0C A;  1K1Z A;  1M8M A;  1ZUK A;  2F2W A;  1ZBJ A;  2EYY A;  3O5Z A;  2DL7 A;  2JM9 A;  4CC2 A;  2W0Z A;  2DE0 X;  2K7A A;  2K79 A;  4J9G A;  1KFZ A;  1WXB A;  4CC4 B;  4LN2 A;  2XMF A;  4Y92 A;  1JXO A;  1UGV A;  2OI3 A;  1A0N B;  2SEM A;  1NG2 A;  1X2Q A;  4JJD A;  3RNJ A;  2YUQ A;  1RLQ C;  1UHC A;  1K0S A;  4JZ4 A;  2RQU A;  3CQT A;  2DBM A;  4CC3 A;  1N5Z A;  2DL8 A;  1GCP A;  3VS0 A;  4ESR A;  1YWP A;  2V1R A;  1OOT A;  2LZ6 B;  2RMO A;  2ROL A;  2D8J A;  1MV0 B;  5IXB A;  3H41 A;  1BK2 A; 
#chains in the Genus database with same CATH topology
 2LCC A;  3GP8 A;  2JUF A;  3TOB A;  2YNC A;  3B3V A;  1M30 A;  5CKE A;  2RK2 A;  3G3S A;  2W10 A;  2ZW7 A;  3KQZ A;  1NBE B;  3TSZ A;  1RI0 A;  2B86 A;  4ANJ A;  5FU7 B;  3R9G A;  2ZAE A;  4YGO A;  2A36 A;  1KUV A;  2QA4 Q;  4A31 A;  1FMV A;  1QKW A;  1Y7X A;  5IB0 A;  2R98 A;  5GAO r;  4R6T A;  3CC2 Q;  1NPP A;  1YI2 Q;  1Y7R A;  4QVD A;  4C92 F;  2PIY A;  4AXV A;  2MWP A;  4RG2 A;  3CC4 Q;  1GBQ A;  4BE1 A;  3OW2 A;  3NE8 A;  4C92 E;  1SKU B;  7CPA A;  2OH1 A;  3LGF A;  4YTL A;  4MY0 A;  2HL3 A;  4JRK A;  1O75 A;  5ECA A;  4M7D G;  2NUT B;  2J9A A;  3NH5 A;  4C7H A;  2ABL A;  4CYN A;  1M90 C;  3V8J A;  1RAC B;  1VQP Q;  1MMD A;  1CKB A;  3LWI A;  4PJO F;  1IOI A;  3DDD A;  1I21 A;  4ORF A;  3FJU A;  1LOK A;  1XQH A;  3ZZI A;  2WUU A;  2K3X A;  3IU1 A;  4C2X A;  1Y96 B;  2DO3 A;  4RCB A;  3UDC A;  4PJO E;  2IIM A;  1WHM A;  3PGG A;  3MP1 A;  4FL6 A;  2QVP A;  4IK2 A;  2EJG A;  1B34 A;  1WK4 A;  1O9S A;  1K8A U;  2QYV A;  2ZEG A;  1TS9 A;  1HYO A;  1IID A;  4BB7 A;  1X43 A;  3N7Z A;  3QDF A;  3THK A;  4C5I A;  4BD9 A;  1K73 R;  2GQI A;  2K5L A;  4X1V A;  4KSA A;  4CGL A;  2IPO B;  2JMC A;  4C8Q G;  1D1C A;  4RMO A;  4XTV A;  4KGV B;  2F1L A;  3OYM A;  1Y7E A;  3T9Y A;  4CAE A;  4XTX A;  4J6X A;  2ESW A;  5GAO q;  2PVW A;  3JUW A;  2CP0 A;  4HKE A;  3CMA Q;  4JJN K;  2F2X A;  4ZX8 A;  2KYB A;  3PT9 A;  4NXY A;  3A8M B;  1IHV A;  1ZG9 A;  3HFO A;  3VS5 A;  2NUP B;  2Q4V A;  4OMP A;  4NEX A;  1QCF A;  1M4L A;  3SFM A;  4OB3 B;  2P0W A;  2QAS A;  4F9V A;  2CZ1 B;  3R6O A;  3UAT A;  3I9Q A;  2YT6 A;  1QWF A;  2X3X D;  4K3N A;  2KRM A;  4M77 A;  2LJ1 A;  3R6N A;  3A9L A;  2CZ0 B;  2EQK A;  2VXF A;  4LQG A;  3QXE B;  2XEG A;  2AKL A;  2CP5 A;  4IUS A;  1J3T A;  1IYL A;  4KVM E;  1YX0 A;  3X24 B;  4CGO A;  3AT1 B;  1CG2 A;  2GIV A;  2D4P A;  3KFV A;  2HCK A;  3CCR Q;  1KUX A;  2DTH A;  1OI1 A;  3M5A A;  5I0C A;  2CXA A;  2ZW5 A;  2Q51 A;  1NEG A;  1XIX A;  3E9F A;  1U1S A;  3WT4 A;  3A1P A;  1A2Z A;  2K2V A;  3P8B B;  3M4Y A;  2G3T A;  4PXE A;  3EG9 A;  1S7N A;  2ZCF B;  3HKS A;  5GAN 2;  3CXP A;  2FT0 A;  2M51 A;  3QUI A;  5CR2 A;  3HRS A;  3TC8 A;  5J26 A;  4ME7 A;  3QJ6 A;  1TF9 A;  4NOY A;  4BE0 A;  3M59 A;  4FW2 A;  1YJ9 Q;  1BKB A;  1YIJ T;  3QJY A;  2P84 A;  2EKO A;  1BLL E;  3QBY A;  4F8Z A;  4NGS A;  3UWN A;  4AFQ C;  1PSF A;  2JMA A;  1WXU A;  2CTB A;  3CCE T;  4A33 A;  2DJQ A;  2KXD A;  2CZ6 B;  1KQS A;  4UIA A;  3R9E A;  3QDR B;  3PB7 X;  4BY6 B;  2IG0 A;  1H8K A;  3PIP A;  2BCO A;  1FYN A;  1PG5 B;  5GAN e;  1JB0 E;  3A8L B;  5LJ5 j;  2HQH A;  2V8G A;  2ZW4 A;  4FD5 A;  1QWE A;  4CRI A;  2HL5 C;  3EGU A;  4Y91 A;  1Y9K A;  3D4U A;  1BB9 A;  2HV2 A;  4F7U G;  4M75 A;  4ZGD B;  3JAM E;  5LYI A;  4ZGJ B;  2R57 A;  2ZPH B;  3ZFJ A;  3M54 A;  3DNS A;  2Z0Z A;  1F57 A;  2P4R A;  2QG9 B;  1C0M A;  1M90 U;  3FNC A;  2V26 A;  3KZW A;  4M7A A;  3VU3 C;  2PCU A;  2JTF A;  3F0A A;  5IHN A;  1OEB A;  2AZS A;  4NGR A;  3CC7 T;  2LCL A;  4OGE A;  1H3Z A;  4J9I A;  2Z0W A;  6CPA A;  1QCN A;  3VRY A;  1BI0 A;  1B7T A;  1PYT B;  3D68 A;  3MP6 A;  3FLG A;  3G4S T;  4EMH A;  3OYL A;  1Z8T A;  1TG0 A;  5GAN 5;  3LLR A;  4M85 A;  3IO1 A;  3CXQ A;  1UE9 A;  2GAN A;  2I3C A;  3CEY A;  1B07 A;  2QQ9 A;  3EH2 A;  2QXF A;  2B5G A;  4UWI A;  3OYA A;  1C1A A;  1V29 B;  1QVF S;  2ED0 A;  2M16 A;  4XPD B;  4NL2 A;  1SRM A;  3G1J A;  3PBB A;  2YRC A;  3MCA B;  1N8R C;  1M2V B;  1NZ9 A;  3P2H A;  4QVT A;  4X2T A;  1H3H A;  2ODF A;  3IC1 A;  2KT1 A;  1BIB A;  4FW1 A;  2DXU A;  2YND A;  2VKN A;  2LMJ A;  5DWN A;  4F9U A;  4KOU A;  2RQR A;  2JJ9 A;  3SWN B;  1WIE A;  1S5K A;  4A4F A;  2AE6 A;  5D6Y A;  2BE7 D;  5IXF A;  4ZI6 A;  1VIF A;  3BDU A;  3VS2 A;  3M4G A;  3OYH A;  2VGM A;  2ZPB B;  5CCA A;  1ELL P;  4QB9 A;  3NTH A;  2BEI A;  3KKW A;  2FVU A;  1D3B B;  3BLN A;  3KBG A;  1VQN Q;  1YIJ A;  5AGE A;  4FBE A;  5CAI A;  4DNC A;  2LDM A;  1G83 A;  2CP7 A;  1I12 A;  4KH0 B;  5FRO A;  2DVJ A;  2BO9 A;  2ENM A;  3CCE A;  4OAE A;  1MJA A;  4OP4 A;  3IQL A;  3CXC S;  4RKU E;  1RXT A;  2REF A;  3ZJ0 A;  1PCA A;  2RQW A;  4JRI A;  2P0Q A;  4JXR A;  5CBM A;  3CBM A;  2L0A A;  4FD4 A;  1Z4E A;  3LWH A;  1YME A;  3K9T A;  3P2F A;  2QAZ A;  4VUB A;  1D0Y A;  2DA9 A;  2X4X A;  4JWP A;  1RAB B;  2O28 A;  1CSK A;  2GGR A;  3FJP A;  4MHP A;  1M44 A;  4OID A;  4A95 A;  1UJY A;  1N8R R;  1V76 A;  1BI2 A;  3N5B B;  2CUD A;  1YCS B;  4PK4 A;  4NGQ A;  4NJR A;  2LT4 A;  1X27 A;  2E65 A;  1Q81 C;  4AB7 A;  2QTX A;  1VQM T;  3PB8 X;  4AMC A;  1WA7 A;  4OC0 A;  2O4X B;  2L2P A;  4KOX A;  1CP6 A;  2P0K A;  3PMT A;  3CCU T;  5E96 A;  3RZA A;  3CC7 A;  1Z8X A;  2RHI A;  2WYR A;  3MP8 A;  2PJ1 A;  3KUF A;  1BU1 A;  3DLM A;  4E7S A;  2Q44 A;  2NLU A;  3TT2 A;  4ZGY B;  2GTO A;  3G4S A;  2VC8 A;  3RIR A;  1M4I A;  4LQ6 A;  3CCV T;  4A94 A;  3I3G A;  2RQV A;  4ZY1 A;  2WSF E;  3CCJ Q;  1WXT A;  4NJQ A;  1IYK A;  5IV0 A;  3OY9 A;  3CPA A;  3MET A;  3V7R A;  1MNE A;  4J3G A;  1NJI C;  2R1I A;  2HEQ A;  1LVK A;  2YWW A;  3FJ5 A;  5CKD A;  1OPL A;  1N9R A;  2DIL A;  2BUD A;  3H8E A;  4KLW A;  5DLO A;  3FYN A;  2J6K A;  1OBR A;  2J8N A;  4XU1 A;  1FMK A;  1Z9Z A;  2OAU A;  2GCX A;  4M78 E;  3RMQ A;  2X4J A;  5KYU A;  2ZEO A;  1XOV A;  1SRL A;  4C0G A;  4HT8 A;  2E12 A;  1PHT A;  4PJL A;  3DB3 A;  3PEI A;  2LQK A;  4EMK B;  4RTX A;  3UPU A;  2ATC B;  1XEB A;  4HVW A;  4KH1 B;  5KYY A;  2PVD B;  1KC8 R;  2D6F A;  2AFX A;  2J8M A;  4OKO A;  4ONW A;  1G3Y A;  1Q81 R;  1H64 1;  3I9S A;  1TTH B;  5GMK h;  2VEZ A;  1AOJ A;  3ME9 A;  5GAN 7;  2V8D A;  2EK8 A;  1YHQ T;  3H0F A;  2RJC A;  3H6Z A;  3FDR A;  2JLM A;  4DOV A;  1Q82 C;  2HQX A;  3RO0 A;  2B4D A;  2E10 A;  2E5Q A;  2GTJ A;  5LJ3 j;  1N8R U;  1ZSZ B;  5LJ3 f;  4MFL A;  1LCK A;  5IHK A;  2E64 A;  1NSL A;  2J6O A;  1Q2Y A;  2A0F B;  2VI7 A;  4CS0 B;  2K5F A;  2LTO A;  1OPK A;  1TUG B;  5HK3 A;  4WF2 A;  5CKF A;  4BI4 A;  1VQO Q;  4AVB A;  3I56 T;  3IU2 A;  2EK9 A;  1Y71 A;  4QQ6 A;  1F1B B;  3FXT A;  1YLE A;  2DMO A;  1MND A;  2DYB A;  3RUX A;  4MHD A;  1WHG A;  2KYM A;  2CH4 A;  5AT1 B;  3BE3 A;  2FS5 A;  2GLF A;  4H89 A;  1K1Z A;  4KUL A;  2FL7 A;  4MBU A;  3O5Z A;  3M53 A;  1VQM A;  2DYI A;  3JCM f;  4X9D A;  2HKN A;  4MMK A;  2K7A A;  2K79 A;  1PU9 A;  3L2U A;  4MFK A;  1XNI A;  2VZZ A;  1WQW A;  3CCU A;  4IUR A;  2XMF A;  4IUT A;  1JXO A;  2HQY A;  4BI8 B;  4BY6 C;  4E0A A;  2SEM A;  1AMP A;  2PUK B;  3PIO A;  1X2Q A;  1WQ7 A;  4LDX A;  1UHC A;  1K0S A;  2Z3M A;  3ISZ A;  3SI0 A;  2RQU A;  2VQY A;  2ZPI B;  3D7G A;  4M78 D;  1LRZ A;  4M7D B;  3CCV A;  1Q2D A;  2DL8 A;  4GS4 A;  4O6J A;  1YWP A;  1Q82 R;  2FB7 A;  3B7I A;  2XD0 A;  2PJ6 A;  2ZPA A;  1VHO A;  3V8L A;  4LE9 A;  2AT1 B;  2C06 A;  3FX6 A;  1HXD A;  4E2F B;  2F5I A;  2EVR A;  1Q81 U;  2CSI A;  3C12 A;  1X10 A;  1I8F A;  5J1Q A;  4HKF A;  2CZ7 B;  4D8K A;  2P6G A;  2V1Q A;  2EYZ A;  3GPL A;  4FSS A;  2GBQ A;  4X8I A;  2MPX C;  1VQK T;  4JS5 A;  1I4K 1;  1RAI B;  1VQ8 T;  4B10 A;  5FU6 B;  1UWY A;  3TO7 A;  4I49 A;  5D7U A;  4C8Q B;  3RBB B;  4AVC A;  4Z02 A;  4OC4 A;  1AZG B;  4IIM A;  3PFO A;  1K9M R;  1VYT A;  1YW6 A;  3FMC A;  4H2K A;  2KI7 A;  1R8O B;  4C0D C;  2Y4Y A;  4MXU A;  4C2Y A;  4UIB A;  4OB0 B;  2MIO A;  2EO8 A;  1NJI U;  4PV6 A;  1YHQ A;  2AFM A;  3H8F A;  1RAA B;  2LVM A;  3OQ5 A;  3JVN A;  2CYZ B;  2PTK A;  1NE8 A;  2BIV A;  2OTJ Q;  4XPD C;  1XMT A;  2VGN A;  1QSO A;  2J06 A;  4FYX B;  2PRB A;  3X25 B;  5KYX B;  4WCI A;  1CX8 A;  5KYW A;  4IUQ A;  1SPK A;  3ZL7 C;  2PJ3 A;  1KK7 A;  2BZY A;  1HJD A;  3B8G A;  3CPX A;  3S3N A;  5CO7 A;  3I56 A;  1NPR A;  4LDU A;  1EE3 P;  3OYB A;  4UA3 A;  4MDW A;  4YRH A;  2K5I A;  3M55 A;  3BJ8 A;  4YU9 A;  1YIJ Q;  4A37 A;  4A4G A;  1OU9 A;  2RD1 A;  1QST A;  3TSW A;  3OS0 A;  2MAM A;  4ZX9 A;  5GAN 4;  3G6E Q;  1MUZ A;  1OZP A;  1WDX A;  3U23 A;  2A08 A;  4UC4 A;  2ZXV A;  1Q82 U;  4OF1 A;  2PJA A;  3LW5 E;  1K0X A;  2D1X A;  1KSW A;  1YN8 A;  4P4I A;  4Q5W A;  1UJ0 A;  2Q7S A;  4M6H A;  2DD4 A;  2F69 A;  1S72 T;  1JJ2 S;  2RF0 A;  4LXC A;  1H92 A;  1N71 A;  3NE7 A;  3V38 A;  1U5S A;  2EQJ A;  1K4U S;  2HB6 A;  4OMF B;  3M0R A;  2ZPF B;  2XDB A;  3B35 A;  2PUO B;  2GRE A;  4A30 A;  2F2V A;  2F8H A;  1D0Z A;  1VUB A;  3JSC A;  4J9H A;  4PFP A;  4M78 G;  3HLP A;  1YIT T;  4UF4 A;  4NGM A;  4CAV A;  3M0Q A;  5GAN h;  2Y4X A;  2VL1 A;  3I1U A;  3JB9 F;  3DB4 A;  3GLX A;  1BPM A;  3QYG B;  2RHZ A;  5GMK e;  2B3U A;  1OZ2 A;  1WHK A;  4FU6 A;  2EGE A;  3OWC A;  2VV5 A;  4HVU A;  3O8V A;  4F7U B;  4B5P B;  1VQK A;  3V7S A;  1AYE A;  1RLP C;  3JV3 A;  1RAG B;  1VQ8 A;  2NMT A;  1VQ6 T;  4NCZ A;  3LD2 A;  1WNL A;  4DEX A;  2AK5 A;  3RKW A;  3MEU A;  2BKD N;  2ZEF A;  2OJ2 A;  4CYO A;  4KUI A;  4UFW A;  3QWX X;  3V7Z A;  2C0I A;  2PJ2 A;  2MMP A;  1F2O A;  5I2S A;  5I22 A;  2KCW A;  4A63 B;  1UB4 A;  5DWM A;  1X2K A;  2FZC B;  4RTY A;  3JB9 I;  3HUV A;  4KLV A;  1YWO A;  2AFO A;  1K73 C;  2EBP A;  3RER A;  2ZEP A;  4MHN A;  4FAI A;  4RTV A;  1AT1 B;  3GNG A;  4IAV A;  3OYJ A;  3PGP A;  2ZPG B;  2FO0 A;  5CQY A;  2BOA A;  1NMT A;  2KMT A;  5EC7 A;  1Z5R A;  3RES A;  2ZEH A;  1ZG8 A;  1QLY A;  4AG9 A;  3MO8 A;  3S6W A;  1GFD A;  4AG2 C;  2DL4 A;  3SHW A;  4A2Z A;  1LFW A;  4DQ2 A;  3EGD B;  4KSI A;  2FRW A;  4ZN1 A;  2HMA A;  3OYY A;  4EMK C;  1M27 C;  4HNX B;  2QTV A;  3TQ7 P;  5C6S A;  2VXE A;  2DJZ A;  1LPL A;  2XU8 A;  1IGB A;  5KTD A;  1XTD A;  2KRN A;  3M0T A;  4M4Z A;  2PC1 A;  5GAN g;  3EO4 A;  4A38 A;  3L2R A;  2HSP A;  1Y0M A;  3M0U A;  2EBJ A;  4HVV A;  1ZO0 A;  1S7F A;  4C5G A;  2K3B A;  2FXF A;  2KRS A;  1PSE A;  2HD0 A;  4KGX B;  2YGW A;  2E5K A;  2KAF A;  1BIA A;  2NUT A;  4C92 B;  1M3B A;  4RI1 A;  3GY9 A;  1ZSZ C;  1S72 A;  4OC1 A;  2CP2 A;  1Y0R A;  3EHQ A;  2X7B A;  2VAS A;  4KOS A;  3D67 A;  1VYV A;  1Y96 A;  3OW2 S;  3TU4 K;  4EIK A;  5AG6 A;  3QYH B;  4OMN A;  5IB9 A;  3VAR A;  4DOW A;  3JB9 D;  2AFU A;  5FVJ A;  4PJO B;  1NLP C;  2R5M A;  1ZX6 A;  2CSQ A;  1YIT A;  2NUZ A;  1AWX A;  3S9M A;  5M9O A;  3NFC A;  4O5V A;  1TSF A;  3TO6 A;  2EQM A;  3CCM Q;  4L8A A;  1VQM Q;  2Z10 A;  2BZ8 A;  5JM6 A;  4A4H A;  2XEJ A;  2OTL T;  1EIF A;  3SEM A;  1JQQ A;  2KBT A;  4M77 F;  5GMK m;  3CCU Q;  1JQG A;  4XNH B;  5D29 A;  5G20 A;  3X26 B;  4J83 A;  2EGA A;  2X4W A;  1VQ6 A;  1TUD A;  4MHY A;  3CCS Q;  5HVF A;  1AEY A;  1ZHI A;  1X6B A;  2CP6 A;  3FB9 A;  4M77 E;  5GAO l;  3SJG A;  4QBJ A;  5A28 A;  3NGP A;  3OMC A;  3A8H B;  3QNV A;  1YLO A;  5H86 A;  2NUP A;  3CCV Q;  2EWN A;  2LT1 A;  2CS7 A;  3A8G B;  2BL1 A;  4M7D C;  4B14 A;  3FRM A;  2HAX A;  2CH4 W;  3CCL T;  2DL5 A;  4H6Z A;  3LX7 A;  8ATC B;  2NYS A;  5D8N A;  2PJ5 A;  4ZY2 A;  3SJF A;  3GKR A;  1QKX A;  4P6Y A;  2YNE A;  1TUC A;  1Q7L A;  1JWQ A;  2KXC A;  4XAX B;  4BE2 A;  2B3V A;  3C95 A;  4AFZ C;  1WWZ A;  2GNC A;  4UFV A;  4C92 D;  2ATR A;  2DPT A;  2B8A A;  2IMO A;  3JCM d;  4UCP A;  2RHX A;  1YVO A;  3KHZ A;  2J7I A;  5HMN A;  2EVN A;  1BOB A;  4HCC A;  1TF8 A;  1HD3 A;  1KHI A;  1WYX A;  4MDX A;  4MMO A;  4C5E A;  4A4E A;  4K30 A;  4WTO B;  1WFW A;  3N5F A;  2O31 A;  4MRI A;  5FWB A;  2O01 E;  5FU6 C;  4PJO D;  2DIQ A;  4C8Q C;  4DUK A;  5KTC A;  1YJW Q;  3QG1 A;  4BD3 A;  3GNF B;  2DF6 A;  1MGQ A;  4HPS A;  2LJ0 A;  3L2Z A;  3RMS A;  3QPH A;  3KR4 A;  1X6G A;  4OB2 B;  5KCH A;  3OYC A;  2RJF A;  2DZC A;  1LAM A;  3TVT A;  2DD5 A;  1K73 U;  2EIF A;  1LAP A;  3K9U A;  3KXT A;  4U9Z A;  4M75 F;  4BI3 A;  4RG8 A;  4MJ8 A;  4NGN A;  2EQU A;  1L0C A;  5J8C A;  4XU3 A;  3S6H A;  2DPP B;  3BXM A;  1UFH A;  2CF4 A;  4M6G A;  4M75 E;  2R5A A;  3ZEH A;  2QML A;  2B58 A;  4U9Y A;  5LJ5 f;  4AFS C;  4CC7 A;  3UA7 A;  1M4Z A;  4AVA A;  1NE9 A;  1IGQ A;  3I56 Q;  4M7A F;  4AG7 A;  1YJN T;  1VYU A;  4R87 A;  3TOA A;  1M1F A;  4XQ3 A;  3GIU A;  4E6R A;  4M7A E;  1CPS A;  2P6E A;  4ELZ C;  2Y0M A;  2PDO A;  1E6G A;  2CRE A;  3GBQ A;  4JJX A;  1T0H A;  2KEA A;  4Y28 E;  2PE3 A;  1IOF A;  1KQS S;  2L89 A;  1GXI E;  5F47 A;  4KBM B;  3VKI A;  4P4E A;  2OTL A;  4E8O A;  1NM7 A;  3IFE A;  4MFP A;  3QZ9 B;  2BE9 B;  1JBM A;  1UDL A;  2LX9 A;  2NYQ A;  4LDY A;  2RC4 A;  3NA6 A;  5K8O A;  5ELY A;  3QAH A;  2F5K A;  1DE4 C;  3NHN A;  4ZBG A;  1I81 A;  1KIK A;  3T8W A;  1QVF A;  1M1K R;  1UGS B;  4C0D B;  1KG1 A;  1ZLI A;  1YGH A;  9ATC B;  4WJB A;  4MML A;  3CCL A;  1UUE A;  3VS6 A;  5EC4 A;  3NFZ A;  1XJO A;  4KOT A;  2NWM A;  5DLQ E;  3FF3 A;  3L42 A;  1E6H A;  3G71 T;  4C0F A;  4A54 A;  4F17 A;  3TFY A;  5G21 A;  3S9N A;  2G0B A;  1XRY A;  3F8K A;  2AFS A;  1RAF B;  1ZSG A;  2G9D A;  1DTD A;  1YFN A;  4F6A A;  4N4G A;  1GBR A;  2V8J A;  2X51 A;  3OS2 A;  1D1A A;  2G3R A;  4RTU A;  4C92 G;  2DXC A;  1ZUU A;  1M2V A;  3JRZ A;  4P45 A;  1VQ8 Q;  1RAE B;  2XKO C;  4R76 A;  4UEZ A;  3TTH A;  4OMO A;  1XJW B;  3DLL A;  5LYD A;  2C6C A;  3OYI A;  4HT9 A;  4EME A;  2EGC A;  1FXX A;  2JTE A;  2QA4 T;  1VQL Q;  1NYF A;  2JS0 A;  3LYI A;  2CUB A;  4M75 D;  5L23 A;  3KAS A;  3IWW A;  3SWN A;  4PLI A;  2PSW A;  4NGP A;  4RCC A;  3CC2 T;  1YI2 T;  3FED A;  4PJO G;  5A27 A;  5GJV B;  2E6Z A;  5A0D A;  1D3B A;  3OA6 A;  5JGF A;  4NL3 A;  2JM9 A;  2W0Z A;  1VQ5 T;  1OYX A;  2ZOG A;  4A53 A;  2JEV A;  2DIG A;  4R55 A;  4KVX A;  5HK0 A;  1G3S A;  4Q36 A;  4M7A D;  1ZA2 B;  1KFZ A;  5GAM j;  2HBP A;  3PZJ A;  4Y92 A;  4CGP A;  5GAM f;  4P4J A;  1UGV A;  1VQP T;  2OI3 A;  2EFI A;  2HSE B;  3EFO B;  1A0N B;  1PD1 A;  2CNS A;  3CCQ T;  3EGX B;  2DTI A;  4UEE A;  3RNJ A;  5LYL A;  1YJN A;  1IY7 A;  2WAC A;  4MI4 A;  4PXC A;  5DS0 A;  3M56 A;  4L6V 5;  2JEW A;  4KOY A;  1GCP A;  4ESR A;  2LNV A;  1KC8 C;  1H8L A;  1XE4 A;  3EH1 A;  3S3O A;  2LZ6 B;  1IU8 A;  2WPW A;  5AG5 A;  3G8W A;  3RNZ A;  3VWE A;  1FT7 A;  2GFQ A;  5JH9 A;  4OIW A;  5LRK A;  1ACM B;  1U1T A;  2LC4 A;  2Z3N A;  4B11 A;  2M0Y A;  2QI2 A;  2X9H A;  4C92 C;  2COY A;  3BHX A;  1S72 Q;  1Z4R A;  1KD1 C;  2O4X A;  1V0C A;  3EFA A;  1G2B A;  4EVY A;  5C82 A;  2A3L A;  1SEM A;  1SHF A;  3V7C A;  4PFZ A;  2LRQ A;  4EMG A;  4B12 A;  3M0P A;  2M9U A;  1D1B A;  4OGC A;  2J8R A;  3GF5 A;  4PJO C;  4KZT A;  2DRM A;  1VQ9 T;  2PJ9 A;  4CGN A;  1YIT Q;  3HL8 A;  4KGZ B;  1Z9Q A;  2QGF B;  3G7Z A;  3MEA A;  4RUG A;  3G71 A;  1Q86 C;  1GHE A;  1VIX A;  2C6G A;  1X6O A;  1M2O A;  2DK3 A;  1CM0 A;  3PMI A;  3ZBD A;  3UT1 A;  2EW3 A;  1Y07 A;  3PE0 A;  5GMK i;  4XNH C;  2RB6 A;  2I00 A;  1TXQ A;  4LUD A;  5F46 A;  2D9T A;  1YVK A;  3IWG A;  3KQX A;  4UEF A;  5I2M A;  3FRN A;  1VQ6 Q;  4OME A;  1MHN A;  1WJQ A;  2DL3 A;  2FL4 A;  4LUA A;  4TWE A;  2POK A;  5A2Q E;  4FSX A;  4M78 B;  4QT7 A;  5K8N A;  2C0T A;  5HXD A;  4F16 A;  1TIQ A;  4EMK A;  2QA4 A;  2JXB A;  4JRQ A;  1I1D A;  2HQE A;  1BPN A;  3P8D A;  3CBP A;  5J39 A;  5J3B A;  4E7Z A;  3L2W A;  1Z8L A;  2VYT A;  4KT0 E;  3J81 E;  3CC2 A;  2V8K A;  1YI2 A;  3PB6 X;  5CK9 A;  2KK4 A;  2CY2 A;  3OSS C;  4FIB A;  3H4Q A;  5LRJ A;  2K9G A;  8AT1 B;  1PCX A;  5IH2 A;  1VQ5 A;  1KD1 R;  3OSV A;  1ON0 A;  1M3A A;  2XDP A;  4PSW A;  5CQX A;  1UGQ B;  1YJ9 T;  4II1 A;  2XEI A;  2KGT A;  2H3J A;  1AUG A;  4P4D A;  5BWA B;  2DRK A;  5D6X A;  4J8O A;  2IQ6 A;  1VQP A;  3M58 A;  4FT2 A;  1ZSZ A;  2IVW A;  4FYW B;  2QDL A;  3CCQ A;  1FMW A;  2DXT A;  1YR0 A;  1WHL A;  5LRG A;  2RI2 A;  2PVG B;  2REE A;  3WVE B;  3MJX A;  5GAN 8;  1Q86 R;  3R1K A;  3R9F A;  2YDL A;  3I5S A;  1BYM A;  2DEU A;  3S6G A;  4L59 A;  5IX3 A;  3CD6 T;  2XID A;  3L1A A;  1HDU A;  1ZA1 B;  2P4T A;  3Q1J A;  4UBR A;  3OMG A;  3EHR A;  5IHI A;  1G3W A;  1K9M C;  5HCK A;  3OBW A;  2D0N A;  5L8R E;  2FSR A;  2O4H A;  4Y49 B;  2AZV A;  1PC0 A;  5IT9 E;  2RH2 A;  3CDX A;  1WJS A;  1SSF A;  4LUE A;  3QWY A;  1M3C A;  1VIE A;  1RO5 A;  1W4S A;  4HA8 A;  4F14 A;  2H8H A;  2PJB A;  2RN8 A;  4PNO A;  1XFO A;  1Z9U A;  4M7D F;  5CVI A;  3B3W A;  2GQV A;  1VOM A;  4GLM A;  1TKH A;  3F5B A;  3DKM A;  4W9Y A;  2R7H A;  1AD5 A;  2KE9 A;  4JS4 A;  1ZQ1 A;  1IGU A;  4X3R A;  3DSB A;  2EQI A;  2ARH A;  3H5Z A;  2EAY A;  4YWY A;  1Y0Y A;  2DEQ A;  1VQ9 A;  4M7D A;  5GMK j;  1KC8 U;  2C0O A;  2JDD A;  1W1F A;  1KHC A;  5GAN 3;  3ISX A;  2VZY A;  4KSF A;  4MZP A;  4NGT A;  1LNX A;  1I0C A;  5GJW B;  4OVA A;  2ABZ A;  3C94 A;  3GYA A;  4IF5 A;  3SI2 A;  2GLJ A;  5FRN A;  4ELY C;  2L3P A;  3BJ7 A;  1QMC A;  4J6W A;  2YUO A;  1IB8 A;  4C8Q F;  2ZPE B;  5K8M A;  5LJ5 d;  1KD1 U;  1T0J A;  2EKH A;  3B3S A;  3CT9 A;  3PB9 X;  3GLJ A;  2FE7 A;  3SI1 A;  2O9S A;  4RS2 A;  1YRE A;  2PNI A;  4J7I A;  3FEE A;  2VVK A;  3WC5 A;  3URG A;  4DBF A;  4C8Q A;  4MCP A;  3VS3 A;  2QEC A;  2RA2 A;  2X4Y A;  2HC9 A;  1Q86 U;  1UG1 A;  1P92 A;  2GF7 A;  1QVG S;  1HEE A;  1VHS A;  5F48 A;  5I11 A;  1PKT A;  1AWW A;  1YJ9 A;  1VQN T;  3RR6 A;  2CKK A;  2OOT A;  2Z3K A;  3D7S B;  2EUI A;  4FCY A;  5KYX A;  2MCN A;  4MY3 A;  4LNP A;  1WPY A;  3JCM J;  2ZOF A;  3FEO A;  3TEE A;  2E3I A;  3E9G A;  3CD6 A;  4PK3 A;  1IRX A;  4DBR A;  5A0G A;  2DAQ A;  3J7A F;  4O23 A;  2SRC A;  4F04 B;  2GU2 A;  5LJ3 e;  4XTZ A;  4TNU A;  2RNA A;  4D8D A;  2RI5 A;  3CCE Q;  3WVD B;  2DNU A;  3I35 A;  1PWT A;  1R77 A;  3CPW S;  3WR7 A;  5C88 A;  3EG3 A;  1KWM A;  2PQ8 A;  2YUP A;  1PUA A;  2XDD A;  4P44 A;  3NTI A;  3X20 B;  2AFZ A;  5I4M A;  2CIJ A;  4C0Z A;  4XPL A;  2G3A A;  1LAN A;  2LNH B;  2EJF A;  3MPU B;  2PQW A;  3RKX A;  4HCK A;  3BI0 A;  2MWO A;  4IUP A;  1ZBX A;  1AVZ C;  2IL4 A;  3EG1 A;  1FNO A;  5F09 A;  2I2L A;  2E1H A;  2FZK B;  4XTW A;  3JCM e;  3I5R A;  4P5N A;  1QCO A;  4J9B A;  4OP0 A;  5EG2 A;  4CAW A;  4R57 A;  1OU8 A;  4MCS A;  1IZ6 A;  1K9M U;  3VAT A;  3S9L A;  3EXN A;  2M02 A;  4NF1 A;  3REA B;  1ABQ A;  3CCJ T;  4F7U F;  3T9N A;  1LCP A;  4CYQ A;  4BBH A;  1B87 A;  2A28 A;  4M3S A;  3CC7 Q;  3PFE A;  3MEW A;  1W2B S;  1EZZ B;  3TRE A;  2WSA A;  1PM3 A;  1U6M A;  5GAM d;  4G1P A;  3L2N A;  5HKC A;  4JDS A;  2M0O A;  2EJ9 A;  3UA6 A;  3G4S Q;  2NSM A;  3D7F A;  1ARM A;  3VJP A;  4UFX A;  4F7U A;  4B5P A;  4II9 A;  1W70 A;  3LOD A;  2LX7 A;  4XK8 E;  1Y9W A;  1EFN A;  1G8X A;  1MJB A;  1BCO A;  3JB9 H;  1WI7 A;  2DX1 A;  1PNJ A;  1NSA A;  3JTK A;  3PNW C;  2MOX A;  1V1C A;  2QGG A;  2F7V A;  3G71 Q;  1RL2 A;  3MEV A;  2XEF A;  3QZ5 B;  3VS7 A;  4B5O A;  4IHM A;  1YQE A;  1PRM C;  3JCM W;  1RTQ A;  5GMK l;  1VQN A;  5FWC A;  3OS1 A;  4DBQ A;  1PD0 A;  4JLY A;  8CPA A;  2LQW A;  4QVC A;  2OZG A;  4MZT A;  4JUV A;  1XBU A;  2DTO A;  2ZGW A;  3EG2 A;  3HRU A;  4BAC A;  4MFZ A;  2I79 A;  4XU2 A;  1QVF P;  3NH8 A;  4M78 C;  3RBU A;  1BAV A;  4HNW B;  3EGD A;  1PRL C;  2PR1 A;  1RAH B;  3D2M A;  3KL9 A;  2KNB B;  1VA7 A;  4JD6 A;  5GAO p;  4HXJ A;  2JBK A;  3R96 A;  4MCR A;  3KHX A;  5GAN j;  3K2K A;  2COZ A;  1VQO T;  3SJE A;  5GAN f;  1VQ5 Q;  3MGD A;  3E2U A;  3VYH B;  4TVR A;  1M1G A;  5GAN 6;  3DR8 A;  2Q4Y A;  4FD7 A;  4C7I A;  4EWT A;  4NFR A;  2E4H A;  2QQR A;  2O2O A;  2XI9 A;  5EBV A;  2CT4 A;  2VB6 A;  4C92 A;  1EX4 A;  1S60 A;  4MFQ A;  1WJR A;  3CCQ Q;  1N9S A;  4PL6 A;  2FPE A;  5D6W A;  2PJ7 A;  1B34 B;  2ZZD A;  3LWU A;  2P0P A;  2H3E B;  2EWB A;  3A98 A;  3CME T;  3LH0 A;  3WXM B;  1CP7 A;  1CPX A;  2E70 A;  3EG0 A;  3CXC P;  2DFU A;  3ULR B;  2EYX A;  1NYG A;  2DF5 A;  2ECZ A;  3FIF A;  4PJO A;  4DYO A;  2L5Q A;  2FPF A;  3JCM X;  1K76 A;  1Q95 G;  2QEX T;  1JXM A;  4Y49 C;  1IO6 A;  3CCJ A;  3HTR A;  2FYK A;  2YLC A;  2QJ8 A;  2HDA A;  2DLP A;  1KJW A;  5LJ3 d;  2HNI A;  2RK1 A;  4K11 A;  2R58 A;  3H8Z A;  1B6B A;  1IRE B;  3SXO A;  2D8H A;  4HCZ A;  4R0K A;  1ARK A;  2COW A;  3L2Q A;  4CYP A;  5A0L A;  1VQ7 T;  2XK0 A;  2JOY A;  4C2Z A;  5LL6 S;  1N6A A;  3FEC A;  3QAY A;  4B13 A;  5LJ5 h;  3OYK A;  1VQ9 Q;  3EC4 A;  4M77 B;  2ZEM A;  4GXH A;  2RFH A;  5F49 A;  4E7K A;  2HZY A;  5KTA A;  2DM1 A;  1U06 A;  5ISV A;  3REB B;  5IAY A;  2Z3L A;  1M8M A;  1M90 R;  2F2W A;  2VXK A;  1ZBJ A;  2EYY A;  4KOV A;  1QW1 A;  2Z11 A;  2Z3O A;  2F5T X;  4J9G A;  1VKC A;  5GCN A;  2Q7B A;  3JCM P;  4QW2 A;  2FIA A;  1MJ9 A;  5J8F A;  4MCQ A;  2DPS A;  5CPA A;  1GYT A;  3I55 T;  3QII A;  5CIU A;  4QQD A;  2DXQ A;  2OTJ T;  1NG2 A;  2YUQ A;  1RLQ C;  1QQ9 A;  1TXR A;  4JZ4 A;  3CQT A;  3EG9 B;  4FM4 B;  3W6X A;  2DBM A;  4CC3 A;  1N5Z A;  2JN0 A;  1M1K C;  1OX9 A;  2C27 A;  2LQ8 A;  1YHQ Q;  4OC5 A;  2KVQ G;  2MF2 A;  2V1R A;  1M9S A;  4GM5 A;  3IGR A;  4XTY A;  1OOT A;  1QSN A;  3PP9 A;  3V8K A;  4ZY0 A;  1VQO A;  3BDL A;  4PK2 A;  5IXB A;  3H41 A;  1BK2 A;  2ZEN A;  3H8G A;  3FB3 A;  3JCM V;  2Z3P A;  4QVZ A;  3RAM A;  2LJ3 A;  3LGL A;  4OML A;  1I5L A;  1UHF A;  4R8F A;  2K57 A;  2R8V A;  2ZW6 A;  1VQ4 T;  2CTC A;  3JCM c;  3G6E T;  2ANP A;  2Q43 A;  3AHU A;  3FC3 A;  1IXD A;  1MMG A;  2HUZ A;  3GB0 A;  3SDZ A;  4R56 A;  4XTU A;  3CPF A;  5LJ5 g;  1QSR A;  4LD6 A;  4J9F A;  3CME A;  1GFC A;  4PJN A;  3KI9 A;  3CD6 Q;  2K3Y A;  2JW4 A;  2CNT A;  4M75 B;  3BI1 A;  4KS9 A;  4M77 D;  4N0A C;  2RPN A;  2QQA A;  2V77 A;  2FG0 A;  3HP9 A;  2KQW A;  4JPB W;  3JB9 G;  2VBQ A;  1UEC A;  1R43 A;  1GCQ C;  2QEX A;  5GAO m;  2FEI A;  1KZF A;  4BIN A;  2V8I A;  3MHX A;  4OMQ A;  2A4N A;  2RJE A;  2CP3 A;  3JB9 J;  4AG1 C;  4J9E A;  1QSM A;  4M7A B;  4DA4 A;  4C68 A;  3WC6 A;  1AZE A;  5G22 A;  2PIZ A;  1VQ7 A;  1NEB A;  4CRY B;  3EY5 A;  4P10 A;  1SHG A;  4LDW A;  3PFS A;  3RYO A;  2L3S A;  1CKA A;  5GAM h;  2YHT A;  1QVP A;  3ASK A;  3QB8 A;  1VHE A;  4MZM A;  4GLK A;  4P4F A;  4X9C A;  3KR5 A;  3DLJ A;  3LAC A;  2EPD A;  2L8D A;  3X28 B;  2B5G B;  1YW4 A;  4LDV A;  1TH7 A;  2DVE A;  4OMM A;  4PFO A;  4OC2 A;  3M9Q A;  1UGR B;  1VQK Q;  3VV0 A;  1RI9 A;  4QUS A;  4CAF A;  2B4B A;  2YUN A;  4JJB A;  1GL5 A;  3EFR A;  2VWF A;  1OX8 A;  4Z89 A;  4KOR A;  5IN1 A;  3I55 A;  4JXQ A;  1B3Q A;  3BW1 A;  2BTT A;  2OX7 A;  4MFJ A;  4PSX A;  2OTJ A;  3PVL A;  3C26 A;  4DJL A;  3D7H A;  3CZX A;  1ZUY A;  2YLB A;  1YP5 A;  4ORZ A;  3CXC A;  2L3Q A;  4JRP A;  3TE4 A;  3D66 A;  1K9A A;  5HVH A;  4M6I A;  1MMN A;  2FCK A;  2L3R A;  4FYV B;  1TOV A;  3INZ A;  3CC4 T;  3HHT B;  1JEG A;  2EYQ A;  2ZEE A;  3QO3 A;  5KYN A;  1D0X A;  3OYN A;  5HH1 A;  4CRZ B;  2MI6 A;  2YNC C;  1HSQ A;  4U5Y A;  3D7D A;  1SSH A;  3EFS A;  1IHW A;  1FWZ A;  1VQ4 A;  4L5G A;  1W6X A;  4E47 A;  3G6E A;  2O88 A;  4UCN A;  1WLP B;  1QP2 A;  1BBZ A;  1SG5 A;  4L89 A;  3NMZ C;  4WWV A;  2JVV A;  3UF4 A;  1XF8 A;  2CNM A;  4J7F A;  3UY5 A;  1BO4 A;  5DY9 A;  5GAM g;  1NLO C;  5FU7 C;  4R7M A;  3EFO A;  4IIO A;  1QVG P;  3EGX A;  2P6F A;  4JLG A;  4E7J A;  3IJ3 A;  3D8P A;  1M1K U;  2PZ1 A;  3ER0 A;  3E1S A;  3IIB A;  1M1D A;  2WSE E;  4R3L A;  2M1H A;  2H5M A;  5C0M A;  2LP5 A;  4M77 G;  5KCO A;  1QMU A;  5LJ5 e;  2KRO A;  2X3W D;  2K2M A;  4OAD A;  4KUD K;  4AT1 B;  3OS5 A;  2HKQ B;  4QKU A;  1HK9 A;  4EDU A;  2FVG A;  2GE3 A;  5CNP A;  4B6Z A;  1S7K A;  1J4J A;  2KT8 A;  1BCM A;  4JZ3 A;  2KR3 A;  1ZLH A;  3CCM T;  2JTM A;  2K4Y A;  4IKF A;  2JBJ A;  3E0K A;  2EYW A;  5LJ3 h;  3D3S A;  3OYF A;  3CMA T;  2XG8 D;  4Z8A A;  5HY6 A;  4CPA A;  4XU0 A;  3MN8 A;  1S3Z A;  2G6F X;  1T3S A;  3CPW P;  5JPH A;  2DZ9 A;  3PRT A;  1ZLM A;  4E7I A;  4EFD A;  3CCS T;  1JJ2 P;  4HCB A;  2ZEL A;  1GRI A;  2QQS A;  4N4I A;  4UCM A;  1Q7Y C;  4D6W A;  1TWB A;  2PJ4 A;  5GAN d;  2AFW A;  4QQG A;  4ZNX A;  2RO0 A;  3OBY A;  4AFU C;  2IJZ A;  4PQA A;  2J05 A;  1M4G A;  4F0X A;  2ZED A;  4RTW A;  3VH9 A;  2KSS A;  1KUY A;  3JCM h;  5G1Z A;  5JQ4 A;  4Z88 A;  5KYU B;  4M78 F;  3FIX A;  1KQ2 A;  3JRU A;  2I0N A;  4J9C A;  2V8V A;  4CI0 C;  3CCR T;  2PJ0 A;  5KYY B;  2OZH A;  4RTZ A;  1S7L A;  3C4S A;  2C1C A;  3TX8 A;  3S6F A;  1IIC A;  1G3T A;  2QYZ A;  4M78 A;  3QKJ A;  4P4B A;  3VWD A;  4OC3 A;  2DBK A;  3OYD A;  4NSQ A;  3CC4 A;  2OU2 A;  4M77 C;  1ZG7 A;  4QC6 A;  4M75 G;  3SXN A;  3PVQ A;  1W2B P;  2OR4 A;  1I5O B;  3HFN A;  3GUX A;  4KUB A;  3P8H A;  1BI1 A;  1YJW T;  1M5Q 1;  4UWJ A;  2YRV A;  4ZN3 A;  2B4D B;  3VS4 A;  4J9D A;  3IEH A;  4JJC A;  3H0I A;  4PJJ A;  5LJ3 g;  4J5Y A;  4M7A G;  3GOX A;  1IB1 E;  4PLL A;  4A39 A;  4XPK A;  1CJW A;  3V8I A;  3VUZ A;  3JCM b;  2AJ6 A;  5FLX E;  4PPZ A;  1Q7Y R;  1OQK A;  4PXB A;  3QHS A;  2E3H A;  2VUB A;  3EAE A;  4CAX A;  2FIW A;  4YFJ A;  2BZX A;  4GBQ A;  1N27 A;  2HBW A;  1JO8 A;  3HPW A;  1G5V A;  1NJI R;  1YSJ A;  2ED1 A;  3WAB A;  3NTK A;  3CXS A;  3H0H A;  1WZO A;  5GAM e;  2K6D A;  2DER A;  3GIB A;  3RKY A;  4C5H A;  3LH5 A;  1T3L A;  2AIR B;  4ZGE B;  4E7H A;  2XIC A;  4HNY B;  2CDT A;  1D09 B;  3JCM g;  1SQH A;  2E41 A;  2DEA A;  4F0Y A;  3H9N A;  2AHJ B;  3IWE A;  1C6V X;  3M0S A;  2JM8 A;  4CGM A;  2QK0 A;  2YXY A;  1QQJ A;  3HSB A;  1MV3 A;  2C6P A;  5KE2 A;  4GY5 A;  2RJD A;  1Z8W A;  2RHU A;  1TKF A;  3CCM A;  4A4K A;  2Q04 A;  3OYE A;  2RM4 A;  3CMA A;  4M7D E;  3D2P A;  1JU5 C;  3CME Q;  1YBY A;  4ZYQ A;  4M75 C;  4NS5 A;  1E7O A;  2D0Q B;  2RI3 A;  3CCS A;  1TKJ A;  1QP3 A;  2AKK A;  4PKC C;  2OAW A;  2GFA A;  2JZ2 A;  5FW9 A;  2QEX Q;  4KVO E;  1UGP B;  1MK4 A;  3QSU A;  1RUW A;  2WPX A;  3DGV A;  2FZG B;  4FT4 A;  2KY9 A;  2OTL Q;  2OB0 A;  3OW2 P;  3VRZ A;  2WSC E;  4BMH A;  3W6S A;  1HDQ A;  3FVL A;  4ZTJ A;  4M7A C;  3J80 E;  1S1N A;  2BUE A;  1X75 C;  4KUA A;  4FUU A;  2PU9 B;  1FY7 A;  4FYY B;  5KH6 A;  2PVV A;  2WZN A;  4C8Q E;  4RN7 A;  2QIR A;  4V2S A;  1VQ7 Q;  2A37 A;  3B3C A;  3CCL Q;  2O9V A;  3CCR A;  1QVG A;  4MHZ A;  1M4D A;  2LCS A;  1CBX A;  3MRU A;  1R0B G;  3SJX A;  2FRY A;  2LQN A;  3KGQ A;  2ROT A;  4BDY A;  3A5Z B;  5I21 A;  1WHH A;  1TU0 B;  1AWO A;  4JLI A;  4LD9 K;  5CKB A;  1UTI A;  3FH4 A;  1LOJ A;  1P4N A;  3TCV A;  1SF9 A;  4RTT A;  3E19 A;  2V8H A;  4Q38 A;  1Q7Y U;  4ONU A;  1YJW A;  1U3O A;  2QDY B;  1VQL T;  2PJC A;  3M57 A;  1JRI A;  3WC7 A;  4J6Y A;  1FX7 A;  3VYG A;  3T90 A;  1UFF A;  1Y57 A;  3FBU A;  4E2A A;  3VS1 A;  5AG4 A;  3NPF A;  5FRM A;  4LX9 A;  5KYW B;  1BI3 A;  3MKD A;  3OB9 A;  4B9W A;  2GFU A;  3I55 Q;  1R57 A;  3NH4 A;  4FD6 A;  4FWU A;  5AG7 A;  4A32 A;  1YCY A;  4DBH A;  3A8O B;  2DKG A;  4E7L A;  2YRD A;  2JT4 A;  3CPW A;  5DM7 R;  2Q4Z A;  4N4H A;  1KQ1 A;  4IUV A;  1K8A C;  1X01 A;  2J6F A;  1JJ2 A;  4ATO A;  5THW A;  2DET A;  2XHC A;  1OUL A;  1P0H A;  2D4O A;  4PXD A;  1YNZ A;  4Q7A A;  4R9M A;  4JYW A;  2JNG A;  4M7D D;  4N0A A;  4Z65 A;  1WX6 A;  2MYS A;  3HRT A;  4OLL A;  4H6U A;  1AHJ B;  1AWJ A;  1F2P A;  1GCQ A;  3SWN C;  3B3T A;  5HVG A;  5K8P A;  1Z2L A;  2MK5 A;  1DJ7 B;  2YSQ A;  1UEB A;  2RQT A;  4ZTF A;  4EPC A;  4OB1 B;  3TCJ A;  1VQ4 Q;  1M8V A;  2RHY A;  2O53 A;  3R95 A;  2OZU A;  2FPD A;  4DEY A;  2FHD A;  2RB7 A;  3SHP A;  4BDZ A;  4B9X A;  1YJN Q;  7AT1 B;  5H84 A;  1I1J A;  2PRQ A;  1X69 A;  3BFM A;  3B2Y A;  4KRT A;  4R3K A;  1OV3 A;  1PKS A;  2CT3 A;  2JS2 A;  2KDS A;  1YK3 A;  5EMI A;  3TO9 A;  3RDV A;  3DR6 A;  4B6M A;  3SB2 A;  1W2B A;  3PB4 X;  4C8Q D;  2PR8 A;  4PJM A;  1ARL A;  3LMS A;  4IUU A;  1ABO A;  3VUB A;  1I07 A;  1R0C B;  1WHJ A;  5LYF A;  3PBE A;  3C0C A;  4KOW A;  2X35 A;  1ELM P;  1R3N A;  3SD4 A;  3BY7 A;  1ZUK A;  2A7Y A;  1VGY A;  1X12 A;  2DL7 A;  3F70 A;  4X34 A;  4CC2 A;  4F7U E;  3JCM Q;  2CGH A;  2DE0 X;  2PVO B;  1OZ3 A;  5GAO n;  3L2V A;  4JZ0 A;  2JDC A;  1MMA A;  1WXB A;  4CC4 B;  1U8R A;  2Q0Y A;  1K8A R;  1XMB A;  4RUH A;  4LN2 A;  1K4J A;  4BUG A;  1LJO A;  5KE3 A;  1RAD B;  1KQS P;  3W91 A;  4JJD A;  3S6K A;  2Y90 A;  3PTA A;  2BSW A;  3S3M A;  5CKH A;  1Q2C A;  2K5T A;  3OYG A;  3VS0 A;  1WGS A;  2QQB A;  2E6N A;  5AYF A;  6AT1 B;  3CBO A;  2RMO A;  2ROL A;  2DXB A;  2D8J A;  1MV0 B;  1VQL A;  4X5K A;  2PJ8 A; 
#chains in the Genus database with same CATH homology
 2LCC A;  3GP8 A;  2JUF A;  1M30 A;  5CKE A;  2RK2 A;  2W10 A;  3TSZ A;  2B86 A;  1RI0 A;  5FU7 B;  2A36 A;  1QKW A;  1Y7X A;  5GAO r;  1NPP A;  4QVD A;  4C92 F;  2MWP A;  4RG2 A;  1GBQ A;  4BE1 A;  3OW2 A;  3NE8 A;  4C92 E;  3LGF A;  4YTL A;  5ECA A;  1O75 A;  4JRK A;  4M7D G;  2ABL A;  1M90 C;  3V8J A;  1CKB A;  3LWI A;  4PJO F;  1XQH A;  2K3X A;  1Y96 B;  2DO3 A;  3UDC A;  4RCB A;  4PJO E;  2IIM A;  3PGG A;  3MP1 A;  4FL6 A;  2EJG A;  1B34 A;  1O9S A;  1K8A U;  4BB7 A;  1X43 A;  3THK A;  4C5I A;  2GQI A;  2K5L A;  4X1V A;  2JMC A;  4C8Q G;  4RMO A;  4XTV A;  3OYM A;  4XTX A;  4J6X A;  2ESW A;  5GAO q;  4HKE A;  4JJN K;  2F2X A;  2KYB A;  3PT9 A;  3A8M B;  3HFO A;  3VS5 A;  4OMP A;  1QCF A;  3SFM A;  4OB3 B;  2CZ1 B;  3R6O A;  3UAT A;  3I9Q A;  2YT6 A;  1QWF A;  2X3X D;  2KRM A;  4M77 A;  2LJ1 A;  3R6N A;  2CZ0 B;  2EQK A;  2VXF A;  3QXE B;  2AKL A;  1J3T A;  3X24 B;  3KFV A;  2HCK A;  2DTH A;  1OI1 A;  3M5A A;  1NEG A;  3E9F A;  1U1S A;  2K2V A;  3P8B B;  3M4Y A;  2ZCF B;  3HKS A;  5GAN 2;  2M51 A;  3QUI A;  5CR2 A;  3HRS A;  5J26 A;  4ME7 A;  3QJ6 A;  4NOY A;  4BE0 A;  3M59 A;  1BKB A;  1YIJ T;  3QJY A;  2EKO A;  3QBY A;  4AFQ C;  3UWN A;  2JMA A;  1PSF A;  1WXU A;  3CCE T;  2DJQ A;  2KXD A;  2CZ6 B;  1KQS A;  3QDR B;  4BY6 B;  2IG0 A;  1H8K A;  3PIP A;  1FYN A;  5GAN e;  1JB0 E;  3A8L B;  5LJ5 j;  1QWE A;  4CRI A;  3EGU A;  4Y91 A;  1BB9 A;  4F7U G;  4M75 A;  4ZGD B;  3JAM E;  4ZGJ B;  2R57 A;  2ZPH B;  3ZFJ A;  3M54 A;  2P4R A;  1M90 U;  4M7A A;  3VU3 C;  2JTF A;  5IHN A;  1OEB A;  2AZS A;  3CC7 T;  2LCL A;  4OGE A;  1H3Z A;  4J9I A;  3VRY A;  1BI0 A;  3MP6 A;  3FLG A;  3G4S T;  4EMH A;  3OYL A;  1TG0 A;  5GAN 5;  3LLR A;  1UE9 A;  3CEY A;  1B07 A;  2QQ9 A;  2QXF A;  3OYA A;  1V29 B;  1QVF S;  2ED0 A;  2M16 A;  4NL2 A;  1SRM A;  3MCA B;  1N8R C;  1NZ9 A;  1H3H A;  2ODF A;  2KT1 A;  1BIB A;  2DXU A;  2VKN A;  2LMJ A;  2RQR A;  3SWN B;  1WIE A;  4A4F A;  5D6Y A;  5IXF A;  3VS2 A;  1VIF A;  3BDU A;  3M4G A;  3OYH A;  2VGM A;  2ZPB B;  5CCA A;  3NTH A;  2FVU A;  1D3B B;  3KBG A;  1YIJ A;  5CAI A;  2LDM A;  1G83 A;  5FRO A;  2DVJ A;  2ENM A;  3CCE A;  3IQL A;  3CXC S;  4RKU E;  2RQW A;  4JRI A;  2P0Q A;  3CBM A;  2L0A A;  3LWH A;  4VUB A;  2DA9 A;  2X4X A;  1CSK A;  2GGR A;  3FJP A;  1UJY A;  1BI2 A;  3N5B B;  2CUD A;  1YCS B;  2LT4 A;  1X27 A;  2E65 A;  1Q81 C;  2QTX A;  1VQM T;  1WA7 A;  2O4X B;  2L2P A;  2P0K A;  3PMT A;  3CCU T;  3CC7 A;  2RHI A;  3MP8 A;  3KUF A;  1BU1 A;  3DLM A;  2NLU A;  2GTO A;  3G4S A;  2VC8 A;  3RIR A;  4LQ6 A;  3CCV T;  2RQV A;  2WSF E;  1WXT A;  3OY9 A;  3MET A;  3V7R A;  1NJI C;  2HEQ A;  5CKD A;  3FJ5 A;  1OPL A;  2DIL A;  1N9R A;  2BUD A;  5DLO A;  2J6K A;  4XU1 A;  1FMK A;  1Z9Z A;  2OAU A;  2GCX A;  4M78 E;  3RMQ A;  2X4J A;  1XOV A;  1SRL A;  4C0G A;  4HT8 A;  2E12 A;  1PHT A;  3DB3 A;  2LQK A;  4EMK B;  4RTX A;  3UPU A;  4HVW A;  2PVD B;  2D6F A;  1G3Y A;  1H64 1;  5GMK h;  1AOJ A;  3ME9 A;  5GAN 7;  1YHQ T;  3H0F A;  2RJC A;  3H6Z A;  3FDR A;  4DOV A;  1Q82 C;  2HQX A;  2E10 A;  2E5Q A;  2GTJ A;  5LJ3 j;  1N8R U;  5LJ3 f;  1LCK A;  5IHK A;  2E64 A;  2J6O A;  2K5F A;  2LTO A;  1OPK A;  5HK3 A;  4WF2 A;  5CKF A;  4BI4 A;  3I56 T;  1Y71 A;  4QQ6 A;  2DMO A;  2DYB A;  3RUX A;  2KYM A;  2CH4 A;  1K1Z A;  4KUL A;  2FL7 A;  3O5Z A;  3M53 A;  1VQM A;  3JCM f;  4X9D A;  4MMK A;  2K7A A;  2K79 A;  3L2U A;  1XNI A;  1WQW A;  3CCU A;  4IUR A;  2XMF A;  4IUT A;  1JXO A;  4BI8 B;  4BY6 C;  2SEM A;  2PUK B;  3PIO A;  1X2Q A;  1WQ7 A;  4LDX A;  1UHC A;  1K0S A;  2RQU A;  2ZPI B;  4M78 D;  4M7D B;  3CCV A;  2DL8 A;  4O6J A;  1YWP A;  2FB7 A;  2XD0 A;  3V8L A;  4LE9 A;  2C06 A;  1HXD A;  2EVR A;  1Q81 U;  2CSI A;  3C12 A;  1I8F A;  2CZ7 B;  4D8K A;  2V1Q A;  2EYZ A;  3GPL A;  4FSS A;  2GBQ A;  1VQK T;  4JS5 A;  1I4K 1;  1VQ8 T;  5FU6 B;  4C8Q B;  3RBB B;  4Z02 A;  1AZG B;  4IIM A;  1VYT A;  1R8O B;  4C0D C;  2Y4Y A;  4OB0 B;  2MIO A;  1NJI U;  1YHQ A;  2LVM A;  3OQ5 A;  2PTK A;  2CYZ B;  1NE8 A;  2BIV A;  2VGN A;  2J06 A;  3X25 B;  4WCI A;  4IUQ A;  1SPK A;  3ZL7 C;  1HJD A;  2BZY A;  3S3N A;  5CO7 A;  3I56 A;  1NPR A;  4LDU A;  3OYB A;  4MDW A;  2K5I A;  3M55 A;  4A4G A;  2RD1 A;  3TSW A;  3OS0 A;  2MAM A;  5GAN 4;  1MUZ A;  1WDX A;  3U23 A;  2A08 A;  4UC4 A;  1Q82 U;  4OF1 A;  3LW5 E;  1K0X A;  2D1X A;  1KSW A;  1YN8 A;  4Q5W A;  1UJ0 A;  2Q7S A;  4M6H A;  2DD4 A;  2F69 A;  1S72 T;  1JJ2 S;  2RF0 A;  1H92 A;  1U5S A;  2EQJ A;  1K4U S;  2HB6 A;  4OMF B;  3M0R A;  2ZPF B;  2XDB A;  2PUO B;  2F2V A;  1VUB A;  4J9H A;  3JSC A;  4M78 G;  1YIT T;  3M0Q A;  5GAN h;  2Y4X A;  3JB9 F;  3DB4 A;  3GLX A;  3QYG B;  2RHZ A;  5GMK e;  1OZ2 A;  4FU6 A;  2EGE A;  2VV5 A;  4HVU A;  3O8V A;  4F7U B;  1VQK A;  3V7S A;  1RLP C;  3JV3 A;  1VQ8 A;  1VQ6 T;  1WNL A;  4DEX A;  2AK5 A;  3RKW A;  3MEU A;  2BKD N;  2OJ2 A;  4KUI A;  3QWX X;  2C0I A;  2MMP A;  5I2S A;  5I22 A;  4A63 B;  1UB4 A;  1X2K A;  3JB9 I;  4RTY A;  1YWO A;  1K73 C;  2EBP A;  3RER A;  4RTV A;  3GNG A;  3OYJ A;  2ZPG B;  2FO0 A;  5CQY A;  2KMT A;  5EC7 A;  3RES A;  1QLY A;  3MO8 A;  3S6W A;  1GFD A;  4AG2 C;  2DL4 A;  3SHW A;  4DQ2 A;  2FRW A;  4ZN1 A;  3OYY A;  4EMK C;  1M27 C;  5C6S A;  2VXE A;  2DJZ A;  2XU8 A;  1XTD A;  2KRN A;  3M0T A;  4M4Z A;  5GAN g;  3L2R A;  2HSP A;  1Y0M A;  3M0U A;  4HVV A;  4C5G A;  2K3B A;  2KRS A;  1PSE A;  2HD0 A;  2E5K A;  2KAF A;  1BIA A;  4C92 B;  1M3B A;  1S72 A;  3EHQ A;  1VYV A;  1Y96 A;  3OW2 S;  3TU4 K;  4EIK A;  3QYH B;  4OMN A;  4DOW A;  3JB9 D;  4PJO B;  1NLP C;  2R5M A;  1ZX6 A;  2CSQ A;  1YIT A;  2NUZ A;  1AWX A;  5M9O A;  3NFC A;  4O5V A;  2EQM A;  2BZ8 A;  4A4H A;  2OTL T;  1EIF A;  3SEM A;  1JQQ A;  2KBT A;  4M77 F;  5GMK m;  3X26 B;  4J83 A;  2EGA A;  2X4W A;  1VQ6 A;  1TUD A;  1AEY A;  1ZHI A;  1X6B A;  3FB9 A;  4M77 E;  5GAO l;  3NGP A;  3OMC A;  3A8H B;  2EWN A;  2LT1 A;  2CS7 A;  3A8G B;  4M7D C;  2HAX A;  2CH4 W;  3CCL T;  2DL5 A;  3LX7 A;  1QKX A;  1TUC A;  1JWQ A;  2KXC A;  4XAX B;  4BE2 A;  4AFZ C;  3C95 A;  2GNC A;  4C92 D;  2B8A A;  3JCM d;  2RHX A;  2J7I A;  4HCC A;  1HD3 A;  1KHI A;  1WYX A;  4MDX A;  4C5E A;  4A4E A;  1WFW A;  2O31 A;  5FWB A;  2O01 E;  5FU6 C;  4PJO D;  2DIQ A;  4C8Q C;  3QG1 A;  4BD3 A;  3GNF B;  2DF6 A;  1MGQ A;  2LJ0 A;  3L2Z A;  3RMS A;  3QPH A;  1X6G A;  4OB2 B;  5KCH A;  3OYC A;  2RJF A;  2DZC A;  3TVT A;  2DD5 A;  1K73 U;  2EIF A;  3KXT A;  4M75 F;  4BI3 A;  4RG8 A;  2EQU A;  4XU3 A;  2DPP B;  4M6G A;  4M75 E;  2R5A A;  3ZEH A;  5LJ5 f;  4AFS C;  4CC7 A;  3UA7 A;  1M4Z A;  4M7A F;  1YJN T;  1VYU A;  1M1F A;  4XQ3 A;  4E6R A;  4M7A E;  4ELZ C;  1E6G A;  2CRE A;  3GBQ A;  1T0H A;  2KEA A;  4Y28 E;  1KQS S;  2L89 A;  1GXI E;  4KBM B;  3VKI A;  2OTL A;  1NM7 A;  3QZ9 B;  1JBM A;  1UDL A;  2LX9 A;  4LDY A;  2F5K A;  3NHN A;  1KIK A;  1I81 A;  1QVF A;  1UGS B;  4C0D B;  1KG1 A;  4MML A;  3CCL A;  1UUE A;  3VS6 A;  2NWM A;  5DLQ E;  3L42 A;  1E6H A;  3G71 T;  4C0F A;  4F17 A;  4A54 A;  1ZSG A;  4N4G A;  1GBR A;  2V8J A;  3OS2 A;  2G3R A;  4RTU A;  4C92 G;  2DXC A;  1ZUU A;  3JRZ A;  2XKO C;  4OMO A;  3DLL A;  3OYI A;  4HT9 A;  2EGC A;  1FXX A;  2JTE A;  2QA4 T;  1NYF A;  2JS0 A;  5L23 A;  2CUB A;  3LYI A;  4M75 D;  3SWN A;  4PLI A;  4RCC A;  3CC2 T;  1YI2 T;  4PJO G;  5GJV B;  2E6Z A;  5A0D A;  1D3B A;  3OA6 A;  4NL3 A;  2JM9 A;  2W0Z A;  1VQ5 T;  1OYX A;  4A53 A;  2DIG A;  4R55 A;  5HK0 A;  1G3S A;  4M7A D;  1KFZ A;  5GAM j;  2HBP A;  4Y92 A;  5GAM f;  1UGV A;  1VQP T;  2OI3 A;  1A0N B;  2EFI A;  3CCQ T;  2DTI A;  3RNJ A;  1YJN A;  2WAC A;  3M56 A;  4L6V 5;  1GCP A;  4ESR A;  2LNV A;  1KC8 C;  3S3O A;  2LZ6 B;  1U1T A;  2LC4 A;  2M0Y A;  2QI2 A;  4C92 C;  1KD1 C;  2O4X A;  1G2B A;  2A3L A;  1SEM A;  1SHF A;  3V7C A;  2LRQ A;  4EMG A;  3M0P A;  2M9U A;  4OGC A;  3GF5 A;  4PJO C;  2DRM A;  1VQ9 T;  3HL8 A;  1Z9Q A;  4RUG A;  3G7Z A;  3MEA A;  3G71 A;  1Q86 C;  1X6O A;  2DK3 A;  3PMI A;  3ZBD A;  3UT1 A;  2EW3 A;  3PE0 A;  1Y07 A;  5GMK i;  2RB6 A;  4LUD A;  2D9T A;  5I2M A;  3FRN A;  2DL3 A;  1MHN A;  1WJQ A;  5A2Q E;  4FSX A;  4M78 B;  4QT7 A;  2C0T A;  4F16 A;  4EMK A;  2QA4 A;  2JXB A;  4JRQ A;  2HQE A;  3P8D A;  3CBP A;  5J39 A;  5J3B A;  3L2W A;  2VYT A;  4KT0 E;  3J81 E;  3CC2 A;  2V8K A;  1YI2 A;  5CK9 A;  2KK4 A;  3OSS C;  4FIB A;  2K9G A;  5IH2 A;  1VQ5 A;  3OSV A;  1M3A A;  2XDP A;  5CQX A;  1UGQ B;  1YJ9 T;  4II1 A;  2KGT A;  2H3J A;  2DRK A;  5D6X A;  4J8O A;  1VQP A;  3M58 A;  4FT2 A;  2IVW A;  2QDL A;  3CCQ A;  2DXT A;  2RI2 A;  2PVG B;  3WVE B;  5GAN 8;  2YDL A;  3I5S A;  1BYM A;  4L59 A;  3CD6 T;  2XID A;  3L1A A;  2P4T A;  3Q1J A;  3OMG A;  3EHR A;  5IHI A;  1G3W A;  1K9M C;  5HCK A;  3OBW A;  2D0N A;  5L8R E;  2AZV A;  5IT9 E;  2RH2 A;  1WJS A;  1SSF A;  4LUE A;  3QWY A;  1M3C A;  1VIE A;  4F14 A;  1W4S A;  4HA8 A;  2H8H A;  2RN8 A;  4PNO A;  4M7D F;  5CVI A;  2GQV A;  4GLM A;  3DKM A;  1AD5 A;  2KE9 A;  4JS4 A;  1ZQ1 A;  2EQI A;  2EAY A;  2DEQ A;  1VQ9 A;  4M7D A;  5GMK j;  1KC8 U;  2C0O A;  1W1F A;  1KHC A;  5GAN 3;  4MZP A;  1LNX A;  1I0C A;  5GJW B;  4OVA A;  3C94 A;  5FRN A;  4ELY C;  2L3P A;  4J6W A;  2YUO A;  4C8Q F;  2ZPE B;  5LJ5 d;  1KD1 U;  1T0J A;  2EKH A;  2O9S A;  2PNI A;  4J7I A;  2VVK A;  3URG A;  4C8Q A;  3VS3 A;  2RA2 A;  2X4Y A;  2HC9 A;  1Q86 U;  1UG1 A;  1P92 A;  2GF7 A;  1QVG S;  5I11 A;  1PKT A;  1AWW A;  1YJ9 A;  1VQN T;  2CKK A;  2MCN A;  4LNP A;  1WPY A;  3JCM J;  3FEO A;  3TEE A;  3E9G A;  3CD6 A;  5A0G A;  2DAQ A;  3J7A F;  2SRC A;  5LJ3 e;  4XTZ A;  2RNA A;  4D8D A;  2RI5 A;  3WVD B;  2DNU A;  3I35 A;  1PWT A;  3CPW S;  3EG3 A;  2YUP A;  2XDD A;  3NTI A;  3X20 B;  4C0Z A;  2LNH B;  2EJF A;  2PQW A;  3RKX A;  4HCK A;  2MWO A;  4IUP A;  1ZBX A;  1AVZ C;  3EG1 A;  2I2L A;  2E1H A;  4XTW A;  3JCM e;  3I5R A;  4P5N A;  4J9B A;  4OP0 A;  5EG2 A;  1IZ6 A;  1K9M U;  3REA B;  1ABQ A;  3CCJ T;  4F7U F;  3T9N A;  2A28 A;  3MEW A;  1W2B S;  3TRE A;  5GAM d;  5HKC A;  4JDS A;  3UA6 A;  2EJ9 A;  2M0O A;  3VJP A;  4F7U A;  1W70 A;  2LX7 A;  4XK8 E;  1EFN A;  3JB9 H;  1WI7 A;  2DX1 A;  1PNJ A;  3PNW C;  2MOX A;  1V1C A;  1RL2 A;  3MEV A;  3QZ5 B;  3VS7 A;  1PRM C;  3JCM W;  5GMK l;  1VQN A;  5FWC A;  3OS1 A;  2LQW A;  4QVC A;  4MZT A;  4JUV A;  3EG2 A;  2DTO A;  2ZGW A;  3HRU A;  4BAC A;  4XU2 A;  4M78 C;  1PRL C;  2KNB B;  1VA7 A;  5GAO p;  4HXJ A;  5GAN j;  1VQO T;  5GAN f;  3VYH B;  4TVR A;  1M1G A;  5GAN 6;  2QQR A;  2O2O A;  2XI9 A;  2CT4 A;  4C92 A;  1WJR A;  1N9S A;  4PL6 A;  2FPE A;  5D6W A;  1B34 B;  2ZZD A;  2P0P A;  3A98 A;  3CME T;  3LH0 A;  3WXM B;  2E70 A;  3EG0 A;  3ULR B;  2EYX A;  1NYG A;  2ECZ A;  3FIF A;  4PJO A;  2L5Q A;  2FPF A;  3JCM X;  1K76 A;  2QEX T;  1JXM A;  1IO6 A;  3CCJ A;  2FYK A;  2YLC A;  2HDA A;  2DLP A;  1KJW A;  5LJ3 d;  4K11 A;  2HNI A;  2RK1 A;  2R58 A;  3H8Z A;  1IRE B;  2D8H A;  4HCZ A;  4R0K A;  1ARK A;  3L2Q A;  5A0L A;  1VQ7 T;  2XK0 A;  2JOY A;  5LL6 S;  1N6A A;  3QAY A;  5LJ5 h;  3OYK A;  4M77 B;  4E7K A;  2DM1 A;  1U06 A;  3REB B;  5IAY A;  1M8M A;  2F2W A;  1ZBJ A;  2EYY A;  1QW1 A;  2F5T X;  4J9G A;  3JCM P;  4QW2 A;  3I55 T;  3QII A;  5CIU A;  4QQD A;  2OTJ T;  1NG2 A;  2YUQ A;  1RLQ C;  4JZ4 A;  3CQT A;  4FM4 B;  2DBM A;  4CC3 A;  1N5Z A;  2JN0 A;  1M1K C;  2LQ8 A;  2KVQ G;  2MF2 A;  2V1R A;  1M9S A;  4XTY A;  1OOT A;  3V8K A;  1VQO A;  3BDL A;  5IXB A;  3H41 A;  1BK2 A;  3JCM V;  4QVZ A;  2LJ3 A;  3LGL A;  4OML A;  1I5L A;  1UHF A;  2K57 A;  1VQ4 T;  3JCM c;  3G6E T;  3AHU A;  3FC3 A;  3SDZ A;  4R56 A;  4XTU A;  3CPF A;  5LJ5 g;  4LD6 A;  4J9F A;  3CME A;  1GFC A;  2K3Y A;  2JW4 A;  4M75 B;  4M77 D;  4N0A C;  2RPN A;  2QQA A;  2FG0 A;  3HP9 A;  4JPB W;  2KQW A;  3JB9 G;  1UEC A;  1GCQ C;  2QEX A;  5GAO m;  2FEI A;  4BIN A;  2V8I A;  3MHX A;  4OMQ A;  2RJE A;  3JB9 J;  4AG1 C;  4J9E A;  4M7A B;  4DA4 A;  1AZE A;  1VQ7 A;  1NEB A;  1SHG A;  4LDW A;  3PFS A;  2L3S A;  1CKA A;  5GAM h;  2YHT A;  1QVP A;  3ASK A;  4MZM A;  4GLK A;  4X9C A;  2EPD A;  2L8D A;  3X28 B;  4LDV A;  1TH7 A;  2DVE A;  4OMM A;  3M9Q A;  1UGR B;  3VV0 A;  1RI9 A;  2YUN A;  4JJB A;  1GL5 A;  3EFR A;  2VWF A;  4Z89 A;  5IN1 A;  3I55 A;  1B3Q A;  3BW1 A;  2BTT A;  2OTJ A;  3PVL A;  3CZX A;  1ZUY A;  2YLB A;  1YP5 A;  4ORZ A;  3CXC A;  2L3Q A;  4JRP A;  1K9A A;  4M6I A;  2L3R A;  3INZ A;  1JEG A;  3HHT B;  3CC4 T;  2EYQ A;  3QO3 A;  3OYN A;  2MI6 A;  1HSQ A;  1SSH A;  3EFS A;  1FWZ A;  1VQ4 A;  4L5G A;  1W6X A;  2O88 A;  4E47 A;  3G6E A;  1WLP B;  1QP2 A;  1BBZ A;  3NMZ C;  2JVV A;  3UF4 A;  4J7F A;  5DY9 A;  5GAM g;  1NLO C;  5FU7 C;  4IIO A;  4JLG A;  4E7J A;  1M1K U;  2PZ1 A;  3ER0 A;  3E1S A;  2WSE E;  2M1H A;  5C0M A;  2LP5 A;  4M77 G;  5KCO A;  5LJ5 e;  2KRO A;  2X3W D;  2K2M A;  4KUD K;  3OS5 A;  4EDU A;  1HK9 A;  2KT8 A;  2KR3 A;  4JZ3 A;  3CCM T;  2JTM A;  2K4Y A;  4IKF A;  2EYW A;  5LJ3 h;  3OYF A;  3CMA T;  2XG8 D;  4Z8A A;  5HY6 A;  4XU0 A;  2G6F X;  1T3S A;  2DZ9 A;  1ZLM A;  4E7I A;  4EFD A;  3CCS T;  4HCB A;  1GRI A;  2QQS A;  4N4I A;  1Q7Y C;  4D6W A;  5GAN d;  4QQG A;  4ZNX A;  2RO0 A;  4AFU C;  3OBY A;  2J05 A;  4RTW A;  2KSS A;  3JCM h;  4Z88 A;  4M78 F;  1KQ2 A;  2I0N A;  4J9C A;  4CI0 C;  3CCR T;  4RTZ A;  3C4S A;  1G3T A;  4M78 A;  3QKJ A;  2DBK A;  3OYD A;  3CC4 A;  4M77 C;  4M75 G;  3PVQ A;  3HFN A;  3P8H A;  1BI1 A;  1YJW T;  1M5Q 1;  2YRV A;  4ZN3 A;  3VS4 A;  4J9D A;  4JJC A;  3H0I A;  5LJ3 g;  4J5Y A;  4M7A G;  3GOX A;  4PLL A;  3VUZ A;  3JCM b;  5FLX E;  3QHS A;  2VUB A;  3EAE A;  2BZX A;  4GBQ A;  1N27 A;  2HBW A;  1JO8 A;  3HPW A;  1G5V A;  2ED1 A;  3NTK A;  3H0H A;  5GAM e;  2K6D A;  3GIB A;  3RKY A;  4C5H A;  3LH5 A;  1T3L A;  4ZGE B;  4E7H A;  2XIC A;  2CDT A;  3JCM g;  2E41 A;  2AHJ B;  3M0S A;  2JM8 A;  3HSB A;  1MV3 A;  5KE2 A;  4GY5 A;  2RJD A;  2RHU A;  3CCM A;  4A4K A;  3OYE A;  2RM4 A;  3CMA A;  4M7D E;  1JU5 C;  1YBY A;  4M75 C;  4NS5 A;  1E7O A;  2D0Q B;  2RI3 A;  3CCS A;  1QP3 A;  2AKK A;  4PKC C;  2OAW A;  2GFA A;  5FW9 A;  2JZ2 A;  1UGP B;  3QSU A;  1RUW A;  4FT4 A;  2KY9 A;  3VRZ A;  2WSC E;  4ZTJ A;  4M7A C;  3J80 E;  1S1N A;  1X75 C;  2PU9 B;  5KH6 A;  4C8Q E;  4RN7 A;  4V2S A;  2A37 A;  1QVG A;  2O9V A;  3CCR A;  2LCS A;  2FRY A;  2LQN A;  2ROT A;  4BDY A;  3A5Z B;  5I21 A;  1AWO A;  4JLI A;  4LD9 K;  5CKB A;  1UTI A;  1LOJ A;  4RTT A;  3E19 A;  1Q7Y U;  1YJW A;  1U3O A;  2QDY B;  1VQL T;  3M57 A;  1JRI A;  4J6Y A;  1FX7 A;  3VYG A;  1UFF A;  1Y57 A;  3VS1 A;  3NPF A;  5FRM A;  1BI3 A;  3OB9 A;  4B9W A;  2GFU A;  1YCY A;  3A8O B;  2DKG A;  4E7L A;  2JT4 A;  3CPW A;  5DM7 R;  4N4H A;  1KQ1 A;  4IUV A;  1K8A C;  2J6F A;  1X01 A;  1JJ2 A;  4ATO A;  2XHC A;  1YNZ A;  2JNG A;  4M7D D;  4N0A A;  1WX6 A;  3HRT A;  1AHJ B;  1AWJ A;  1GCQ A;  3SWN C;  1DJ7 B;  2YSQ A;  1UEB A;  2RQT A;  4ZTF A;  4EPC A;  4OB1 B;  3TCJ A;  1M8V A;  2RHY A;  2FPD A;  4DEY A;  2FHD A;  4BDZ A;  4B9X A;  1I1J A;  1X69 A;  3BFM A;  4KRT A;  1OV3 A;  1PKS A;  2CT3 A;  2JS2 A;  2KDS A;  5EMI A;  3SB2 A;  1W2B A;  4C8Q D;  4IUU A;  1ABO A;  3VUB A;  1I07 A;  3C0C A;  2X35 A;  3SD4 A;  3BY7 A;  1ZUK A;  2A7Y A;  2DL7 A;  4X34 A;  4CC2 A;  3F70 A;  4F7U E;  3JCM Q;  2CGH A;  2DE0 X;  2PVO B;  1OZ3 A;  5GAO n;  3L2V A;  1WXB A;  4CC4 B;  1U8R A;  4LN2 A;  4BUG A;  1LJO A;  5KE3 A;  4JJD A;  2Y90 A;  3PTA A;  3S3M A;  5CKH A;  3OYG A;  3VS0 A;  1WGS A;  2QQB A;  2E6N A;  5AYF A;  3CBO A;  2RMO A;  2ROL A;  2DXB A;  2D8J A;  1MV0 B;  1VQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...