1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ply protein
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
2KXDA 5IH2A 4RTTA 1E6GA 1KFZA 3VS3A 1JQQA 2VWFA 1M27C 1T3SA 4OMNA 5FWCA 3NPFA 1RLQC 1UJYA 2D1XA 4OMLA 1H8KA 1AWJA 2YDLA 4M4ZA 3VS2A 2CUBA 2J05A 2EYYA 2DILA 4JPBW 4IIMA 2DJQA 4QT7A 3EG3A 3VRYA 1ABQA 1M3BA 2JM8A 3UATA 2CREA 2EYXA 4EIKA 2GBQA 2V1QA 2C0TA 2Q7SA 2DBKA 5IXFA 2DX1A 1SSHA 1LCKA 2C0IA 3CQTA 2CT3A 1JO8A 1I07A 4J9FA 1UUEA 1ARKA 4F16A 2DF6A 2PTKA 2M0YA 2SEMA 2EBPA 3QAYA 2KEAA 2O9SA 3NMZC 2LMJA 3FJ5A 4LQ6A 3GBQA 1ABOA 1WDXA 2SRCA 2F2WA 2YUQA 3TSZA 1HD3A 1SEMA 4GLMA 4RTUA 1UHFA 3VS5A 1GFCA 2JTEA 1G83A 2RQUA 1T0HA 4OMOA 1UFFA 4LUDA 3M0TA 4D8KA 1W1FA 2H8HA 1CKBA 2OAWA 1S1NA 1QCFA 1RI9A 2BZXA 2J6OA 2RQRA 2KXCA 1QWEA 2KROA 2CDTA 2F2VA 2J6FA 2KBTA 1B3QA 1QKWA 2L3SA 2EVRA 1X6GA 1PWTA 5I11A 2O31A 2HSPA 2EGAA 2OJ2A 4F14A 1I0CA 1BB9A 1Y57A 1GFDA 2IIMA 4Z89A 4WCIA 5IXBA 3U23A 2DRMA 1G2BA 3ZL7C 4J9DA 1PRLC 2CSIA 2AKLA 1MUZA 1N5ZA 5EC7A 3R6NA 1CKAA 4CC2A 1A0NB 4OMQA 2JT4A 5GJWB 3UA6A 1VYUA 2I0NA 2DYBA 3VRZA 1HJDA 1X27A 1U06A 1U3OA 3M0RA 4OMMA 1E7OA 2LQWA 1SHGA 1UG1A 2FRYA 2L3QA 3NGPA 1OV3A 2ODFA 1WIEA 1FYNA 1NLPC 4OMPA 3VS0A 3JV3A 4Z88A 2B86A 2RMOA 2HCKA 4F17A 2LZ6B 4FSSA 4JJCA 4KRTA 2ED1A 1KSWA 1GL5A 1OPKA 1UHCA 2GTOA 2EW3A 1WYXA 1WA7A 1T3LA 2D8JA 4HVWA 2DL5A 1BU1A 2KRSA 3SHWA 2RQVA 2DA9A 4CC4B 1ZLMA 1Z9ZA 1JEGA 4J9CA 2YUPA 3PVQA 2LX7A 1ZUYA 2RQWA 1PRMC 3QWXX 2DM1A 1AWOA 2JW4A 1E6HA 1PKTA 3A98A 1UE9A 2MIOA 4LNPA 4HCKA 1BK2A 2ESWA 2BZ8A 3VS6A 1CSKA 2A37A 2JMAA 1UJ0A 2RNAA 4AFZC 2MCNA 2GQIA 2AKKA 1PKSA 4AG2C 1AWWA 1NEGA 3UA7A 2YSQA 2J6KA 1YNZA 2K2MA 2KYMA 2W0ZA 1VYVA 2ED0A 2L3PA 3H0HA 1BBZA 3SEMA 3M0PA 3EGUA 1YN8A 2EGEA 2DL3A 5L23A 2W10A 3PE0A 2RF0A 1NYFA 2CT4A 2KRNA 1XOVA 1SRMA 2V1RA 4J9EA 4RUGA 1M30A 2HEQA 1TG0A 2P4RA 4RTYA 2DNUA 1QWFA 1UECA 2O9VA 2LJ1A 1PNJA 1YWPA 1Z9QA 4JJDA 1AVZC 5GJVB 4GBQA 2EYZA 2CSQA 3VS4A 1JWQA 2A36A 1WLPB 1GCPA 1X6BA 2O2OA 3M0SA 3UF4A 2DLPA 1WFWA 2O88A 4ORZA 3LH5A 4DEYA 2RPNA 2FG0A 1OOTA 5IHKA 1GBQA 1WXBA 2A08A 2JS0A 1RUWA 4HVVA 4CC7A 2OI3A 1K0SA 2KNBB 2FRWA 3H0IA 1GCQA 2VVKA 1K9AA 2VKNA 1VYTA 2LNHB 1IO6A 1GBRA 2X3WD 2ABLA 1U5SA 2KE9A 4A63B 1ZUUA 1MV0B 4BINA 4JJBA 2K6DA 1Y0MA 1H3HA 2F2XA 3KFVA 2JS2A 2CH4A 1EFNA 5IHIA 3RBBB 2DBMA 2LP5A 1AZEA 1NYGA 1HSQA 1QLYA 2DL7A 1UDLA 5EMIA 5FWBA 2D0NA 1OPLA 2K3BA 3O5ZA 1K4US 4M6HA 3REBB 3TVTA 3QWYA 1QKXA 2DL4A 2KR3A 2LQNA 2ROTA 4RTZA 2E5KA 2FPDA 4LUEA 2DRKA 2PZ1A 1KIKA 4RTXA 2K79A 1X69A 2RN8A 3NHNA 2L2PA 2XMFA 3EHQA 3EHRA 2MOXA 2JMCA 1WI7A 2C0OA 3I5RA 5HCKA 3M0UA 4ESRA 3EG1A 2YUOA 2YUNA 4ZNXA 2A28A 1NEBA 1WXUA 1WX6A 4AFQC 2K7AA 3VS1A 1TUCA 1M8MA 3EG2A 2KGTA 1K0XA 1W70A 1GRIA 2X3XD 1B07A 1RLPC 2J7IA 4M6GA 2RQTA 4AG1C 2EPDA 2EQIA 3ULRB 1T0JA 2D8HA 1W6XA 4D8DA 2FPFA 4LE9A 3CZXA 2G6FX 2FPEA 4J9IA 3M0QA 1AZGB 3RNJA 2DMOA 1ZSGA 5I22A 1SPKA 2ENMA 2KRMA 3EG0A 4HVUA 2GGRA 2FO0A 2JXBA 1MV3A 3I5SA 3IQLA 2J06A 3REAB 4AFSC 3TSWA 1AWXA 2JM9A 2LJ3A 3I35A 4Z8AA 2K9GA 2PNIA 1AEYA 1V1CA 1K76A 1K1ZA 4E6RA 4M6IA 2L0AA 4IIOA 4Y92A 1J3TA 1SRLA 1NM7A 2BTTA 2DL8A 2DE0X 1I1JA 4RTVA 4HXJA 2BZYA 4JZ3A 1NLOC 1ZUKA 1KJWA 2LJ0A 4AFUC 1TUDA 1JXOA 1JXMA 2EYWA 2AZSA 2CUDA 2HDAA 1X2KA 2EKHA 2YT6A 1OEBA 3PVLA 2ECZA 2KYBA 3H0FA 2LCSA 4LN2A 2KT1A 3VS7A 4RN7A 1UGVA 1GCQC 3THKA 2DVJA 4CC3A 4J9HA 1AD5A 1FMKA 1X43A 5FW9A 2M51A 3C0CA 2GTJA 2KT8A 4RTWA 1M3CA 3I9QA 5ECAA 1X2QA 4J9GA 1M3AA 1ZBJA 2EGCA 3NE8A 2FEIA 2CH4W 2ROLA 1ZX6A 4J9BA 2NWMA 1AOJA 5IHNA 2GNCA 2AZVA 4K11A 4DEXA 2HBWA 1H92A 1NG2A 1YWOA 2AK5A 2NUZA 1UTIA 2QDLA 1VA7A 1WXTA 1YCSB 3H41A 4X1VA 4JZ4A 4R0KA 1YP5A 1PHTA 1JU5C 1SHFA
chains in the Genus database with same CATH superfamily
2HBPA 2B5GB 4B14A 3GLJA 4PSWA 2ZEMA 2YNCA 2QK0A 4FSXA 4OC2A 1RLQC 4H89A 5C6SA 2D1XA 2Q4YA 5HH1A 2WYRA 3AHUA 1ACMB 2YDLA 2VGNA 4M4ZA 2GLJA 2CYZB 3T9YA 4KVME 4YU9A 3S9NA 2YHTA 4PJOF 1Q7YR 1HDUA 1U1SA 3MJXA 3KQXA 1M3BA 2ZPIB 1WJRA 4J7FA 4XU3A 1NSLA 4IHMA 3UATA 5C0MA 2CREA 2Z3MA 2V1QA 4ATOA 2NMTA 2NYQA 1IOIA 2Q7SA 2ZELA 2DX1A 4KGXB 5LJ3f 3N5BB 2I2LA 1JO8A 1Y7XA 2ZOGA 4ZN1A 4HT8A 4J9FA 2XDPA 5GANh 2VZZA 3CMEQ 2H5MA 4F16A 3V8IA 3CCSA 1KD1C 2DF6A 3CPWS 1Y7EA 1VHSA 3OWCA 2D9TA 4MMLA 1M4DA 2O9SA 3GBQA 2OTLA 1WHLA 4IUPA 1AUGA 3VUZA 1GYTA 4JLIA 4C8QE 1WDXA 2YUQA 3G6EA 1S3ZA 1VQLQ 4GLMA 1M4IA 2ZEGA 1MMNA 3OSVA 4OC0A 4JXQA 1VQPQ 4RMOA 1WWZA 4II1A 5GANg 4LUDA 5DM7R 2P0PA 2NUTA 1S5KA 3IGRA 2LT1A 4N4HA 1RL2A 1Q82U 1VQNQ 3OB9A 2EBJA 1RI9A 5F48A 3NH4A 2LTOA 1QWEA 2KROA 2CDTA 3QZ9B 3X28B 4XK8E 4R56A 4W9YA 1B3QA 1Y96A 4QVTA 3E2UA 1QKWA 2EIFA 2L3SA 4JDSA 4EMKA 5IT9E 3FDRA 2O31A 2V77A 4C8QA 2JUFA 5LJ5e 1YK3A 1I0CA 2R7HA 3MKDA 1XJOA 3CMAT 3KASA 4IK2A 4A33A 5KH6A 4KSIA 1VQMA 5L8RE 4WCIA 5IXBA 3U23A 3CPWA 1YITQ 2X4XA 4M3SA 4P45A 2AKLA 3TO7A 3R95A 2ARHA 3JVNA 4OB3B 2PQWA 5GAN4 2FE7A 2LC4A 3L1AA 4OMQA 2ZXVA 3R96A 3CCQT 4MI4A 1Q81C 2DYBA 3HRTA 1VIFA 2P84A 2QYZA 2G3TA 2K5FA 3RNZA 2PJBA 3EGXB 1U06A 2IVWA 1YW6A 4ZBGA 2RM4A 4M78E 2QDYB 3G4SA 1BAVA 3TEEA 4PJLA 4TVRA 3D2PA 1M2VB 3CPAA 4J6YA 2NUPA 2BUEA 1B6BA 1QVGS 2ODFA 4E2AA 1WIEA 1XEBA 1NE9A 2RHUA 1PG5B 4DBQA 4OMPA 4A4FA 4N0AC 2RMOA 3F70A 4F17A 3V7RA 2LZ6B 4FSSA 1YIJA 3S6GA 2XHCA 1HXDA 4JJCA 2PJ9A 3NH8A 3PTAA 2JDCA 3G7ZA 4J5YA 3CCLA 2DXCA 4C2YA 4OKOA 4C92D 4M78A 4KOTA 2KRSA 1MMDA 1OZPA 2DA9A 4AT1B 2G9DA 1Z9ZA 4FD6A 1VQ5T 1JEGA 4ZY2A 1WPYA 5GMKh 2B4DA 2PVDB 1MNEA 2RD1A 3SJXA 2ZPFB 1ZBXA 1YJ9A 2CKKA 1TOVA 3KZWA 1I81A 4UEFA 4JRIA 1M1KU 1RO5A 5AG7A 2EWBA 2AFWA 4KS9A 1PD0A 4WTOB 4YRHA 1NSAA 2JLMA 2LQKA 1OU8A 3S6FA 3PIOA 4A39A 3CC2T 1PKTA 4Y49B 2E70A 4OIWA 3EG9A 4A94A 1UE9A 2MIOA 2ESWA 1QVGA 1UB4A 2HNIA 4CPAA 4K3NA 1D09B 2J8NA 2Q51A 3CCMT 4P4BA 4ZGJB 1NEGA 2V8KA 4OADA 1K9MC 4KGZB 2HD0A 1YNZA 2L8DA 1VQ4A 2ZOFA 4G1PA 2LNVA 2KMTA 2EWNA 4GS4A 3H0HA 4OP0A 2VXEA 3EGUA 3RR6A 5LJ5f 1YN8A 4PK3A 2PRQA 4C5GA 2GF7A 4DUKA 4NCZA 2RHIA 2RF0A 4M75C 1VIXA 1Z8WA 2CT4A 5A27A 2ABZA 1SRMA 1N8RU 1F2OA 1TF8A 5FU6C 2ZGWA 2P0KA 4A31A 4UWJA 3PIPA 3DLLA 1YLOA 2OZUA 2P4RA 3PB9X 3L2UA 1D1BA 3G1JA 1OZ3A 1UECA 2F5KA 1YJNT 1KUVA 3W91A 3RKWA 2FZKB 1QP2A 2LJ1A 3TX8A 1SKUB 1OYXA 3I56A 2BOAA 2YLCA 3OS5A 4PFOA 3QDRB 3VS4A 4KLVA 3SJEA 4ZTFA 1VQKA 1VQ6T 5LJ3j 4E7JA 2QA4T 1NE8A 2FZCB 2ZPGB 3UT1A 4BY6C 3CCVT 1Z4EA 2V8IA 2YGWA 2CGHA 2PC1A 4IF5A 2AFZA 4ANJA 1X6BA 4CAVA 2NUTB 2CP3A 3CCQQ 1M8VA 2EYQA 1IB1E 4KOUA 1WFWA 3LH5A 5CVIA 3BJ7A 2RPNA 2FG0A 4DOVA 2L3RA 4M75G 3JCMJ 1WXBA 4CRZB 3BJ8A 3OMCA 1YI2Q 2PRBA 2QQSA 4E7LA 4MCPA 4HVVA 2NYSA 2OI3A 5IV0A 1Y96B 4PJOG 2K2VA 3A1PA 1IREB 4NSQA 4EMKB 4RI1A 2ZW7A 3VYHB 2PJ5A 4C8QB 1VYTA 2LNHB 2PR1A 1IO6A 2PU9B 2DPPB 2PJ1A 3G71T 5FROA 4BINA 2IL4A 2GQVA 2K6DA 1Y0MA 4LXCA 1RXTA 4CGNA 2XI9A 2WACA 1EFNA 1LAPA 3RBBB 3C26A 3FLGA 2G0BA 3OYCA 1A2ZA 5AT1B 3WXMB 1XQHA 1HK9A 4A38A 4R3KA 2LDMA 1YFNA 1KC8U 4E7KA 4CRYB 4M6HA 3REBB 1CJWA 3TVTA 3QWYA 2PCUA 4II9A 1QKXA 2KR3A 4FYXB 1VQ5Q 3BXMA 4RTZA 4KOYA 5LYLA 2YRVA 4C92E 3ZJ0A 2HKQB 2PZ1A 2EVNA 1RAHB 4RTXA 3FYNA 1X69A 4TWEA 4NL2A 4CGLA 1QVPA 2XMFA 2NUPB 2R98A 2MOXA 1WI7A 2C0OA 2JMCA 2DERA 4DA4A 3WR7A 3CC2Q 1ZLHA 5CKBA 2YUNA 2Z3LA 4IAVA 4FL6A 2QXFA 3ER0A 4X9DA 1WXUA 4M7DD 1WX6A 3L2NA 1PU9A 1TUCA 1HDQA 1YJWA 1M8MA 3EG2A 3CCMQ 5CKEA 1GRIA 2X3XD 1RLPC 2J7IA 3LGFA 4UEEA 4CYNA 4M6GA 1OQKA 2RQTA 4C92A 4M78B 2OB0A 2EPDA 3M4YA 2DYIA 2O4XA 2ATRA 2KVQG 4FCYA 4PKCC 1O75A 2FVUA 1W2BP 1QSOA 2B4DB 5AGEA 3P2FA 3MCAB 3L2WA 2DFUA 4DOWA 4XTXA 2VB6A 4J9IA 3LX7A 1AZGB 2QTVA 1K8AU 4M7AC 1G3YA 2DMOA 2Q0YA 1M1DA 2D4PA 2M16A 2ZPHB 4M77D 4R3LA 3EG9B 4HNYB 4HVUA 1KUXA 2CP6A 3LGLA 2CNTA 2PJCA 1VQOA 3I5SA 5D8NA 3VARA 3SB2A 1YJNQ 5CNPA 1PCXA 2QASA 1YSJA 3GLXA 1LOKA 1K1ZA 3X20B 4E6RA 2E5QA 2L0AA 4IIOA 5CKFA 4FT4A 1SRLA 3IU1A 1NM7A 1RADB 5GCNA 3B8GA 2QA4Q 3CXQA 3CCVQ 4HXJA 2BZYA 1CBXA 1MHNA 3P8DA 2K3XA 1RACB 4ZYQA 2PJAA 3CPXA 4MFJA 3FIFA 2QECA 3TU4K 2O53A 2R5AA 4OC3A 3B2YA 4H6UA 5G21A 1JXMA 2EYWA 3EFOA 3PRTA 2HDAA 1VKCA 4B5OA 1Q7YU 4FWUA 1OEBA 3PVLA 4JS4A 3FRNA 3D3SA 1XFOA 1ARMA 3RKXA 2YXYA 1L0CA 4LDWA 2FVGA 2V8VA 3THKA 3X24B 4BI4A 1I12A 1FMKA 3C0CA 2FYKA 4AVAA 3QG1A 2GTJA 1QQJA 3RZAA 2KT8A 2COWA 4JJNK 1M3CA 1R0CB 2HQHA 3H8EA 3NE8A 3D7SB 2DVEA 3OYNA 1RABB 5ELYA 4J9BA 2QEXT 2GNCA 2E12A 3NE7A 2RJEA 1O9SA 4DEXA 2C1CA 2HBWA 1BYMA 2V8JA 3QHSA 1H92A 1MK4A 1NG2A 1YVKA 1SSFA 2EKOA 3JB9F 1IOFA 4RG8A 1YP5A 5I21A 3NPFA 2JTMA 3MHXA 4KUIA 2MI6A 1JU5C 3RO0A 2A0FB 1E6GA 1KFZA 4EDUA 1K73U 1JQQA 4B6ZA 1LJOA 1M27C 3MP1A 3H8GA 1KHCA 4A2ZA 1TTHB 5D7UA 4NXYA 2MPXC 1QW1A 1UJYA 3PBBA 3R9FA 1H8KA 3FRMA 4JLGA 3QKJA 5CIUA 1RAFB 5GMKm 4L89A 1S60A 4DJLA 3HL8A 4IUUA 1Q2CA 2J05A 2DILA 4M7DE 2JEVA 3VH9A 1M1KC 2DJQA 4Z02A 2EJ9A 1ABQA 2WPXA 2XG8D 3EFSA 3WC7A 2JM8A 4E7SA 2LCCA 2Z11A 3FB9A 4EIKA 3CC4T 2QGGA 4LQGA 4NFRA 4BMHA 2DBKA 1BKBA 1M90R 2QVPA 1WK4A 3D7FA 3CQTA 3LWIA 1I07A 2Y4XA 5A0GA 1IGUA 4ZGYB 5LJ3h 2PTKA 2VEZA 1I5OB 2SEMA 4QKUA 1X12A 5DWNA 2VUBA 3FJ5A 4M7DA 3S6KA 2WSCE 3TQ7P 3QPHA 3CMEA 7CPAA 5D6XA 3TSZA 3TREA 1TXQA 1WHGA 2F2WA 3DB4A 4LDVA 4PJMA 4JRQA 1B34A 1UHFA 3VS5A 1GFCA 4UFWA 1G83A 4M77C 2PQ8A 3CXPA 4OMOA 7AT1B 1UFFA 1W2BS 2Q7BA 4D8KA 1TSFA 3LODA 1W1FA 2H8HA 5LJ3g 1N8RC 2F5IA 4PK2A 1VQLA 4D6WA 4E8OA 3CCEA 1CKBA 4F8ZA 2Z0ZA 2EQMA 1NZ9A 1VQPA 2J6OA 3OYYA 1ON0A 2KXCA 4R76A 1FMWA 3LWUA 2F2VA 1M1FA 2J6FA 5CQYA 1VQNA 1XBUA 3JCMb 1X6GA 2COZA 5KYYA 1YHQQ 1PWTA 1MMGA 1UGPB 4AG9A 1VQ7Q 2EGAA 4MMKA 2AFOA 4QBJA 2OJ2A 4F14A 2MWOA 4NGRA 3QYHB 4M78F 4ELYC 5AG6A 2IIMA 5I0CA 4FU6A 3EXNA 3OSSC 2FT0A 1ARLA 2OTJT 1SQHA 1YR0A 2CSIA 1N5ZA 2F7VA 4UIBA 1CKAA 4LDXA 4PK4A 3DB3A 2C06A 2F8HA 5CK9A 1A0NB 5K8MA 4X3RA 3JB9J 3MEAA 5GJWB 4DQ2A 2I00A 1YITA 3RBUA 2AFUA 4P4JA 2YWWA 3V7CA 3VRZA 4KSAA 4A32A 5IB0A 4AB7A 1X27A 4KSFA 4CYPA 1W2BA 5JH9A 5AG4A 2RHYA 2QEXQ 3CCUT 4OMMA 1E7OA 1S7FA 2FL7A 3B3WA 3IWEA 3R6OA 2XEFA 3QBYA 1SHGA 3EC4A 2FRYA 4RKUE 2MF2A 1OV3A 4UWIA 1NLPC 2KDSA 4Y49C 3VS0A 2P6GA 3QB8A 4XPDB 1KQSP 1KUYA 4FT2A 4BACA 3FEOA 4E47A 2MYSA 2DZCA 1GL5A 4DBHA 3META 1ZO0A 2E10A 2GTOA 1WYXA 2D8JA 2MK5A 2XKOC 2DL5A 3QJ6A 5GAMd 4BDYA 3SHWA 3OBYA 3SJGA 3H6ZA 1PM3A 2K57A 4MDWA 4EMGA 3K2KA 4C68A 4XTZA 3RAMA 3OYJA 3PFEA 1ZUYA 1R57A 2QMLA 3CC4Q 4OB0B 4L8AA 3RKYA 3PB7X 1NBEB 1AWOA 1P0HA 5K8NA 3O8VA 3C4SA 2I79A 3A98A 5GAOl 1UGRB 5DY9A 4LDYA 2J8MA 4JS5A 4HCKA 3W6SA 1CSKA 3HLPA 1Q81R 4AFZC 2KQWA 2MCNA 3A8LB 3DSBA 1FNOA 4AG2C 1AWWA 1F2PA 4KOSA 4XTVA 4EWTA 4LD6A 4OB1B 1RAIB 2O01E 1F1BB 1TUGB 1DE4C 1Z5RA 3TO6A 2P0QA 1V29B 3JUWA 2ED0A 4M75D 5HVFA 1YW4A 4XPLA 1QVFP 3SEMA 2V8HA 2OOTA 1UEBA 3FXTA 2M02A 2AIRB 4PJOD 3PB6X 3EFRA 2M1HA 5L23A 3PE0A 1IU8A 3R1KA 4OMEA 4B9WA 3G6ET 1Y0RA 3M57A 3ME9A 4XU1A 2DIGA 2KRNA 5LJ5h 2R1IA 2XEIA 3IU2A 3OW2P 4O23A 3KL9A 2HEQA 3KR5A 4R9MA 3BI1A 2HAXA 3JCMV 1QSRA 4EMKC 4N4IA 2O9VA 2Q4VA 4M85A 4C8QC 1S72A 4CGMA 1YWPA 1Z9QA 4JJDA 5GJVB 4JUVA 3GUXA 1TWBA 4GM5A 2EYZA 2CSQA 2DTOA 2QQRA 4CAEA 2OTJQ 2CZ6B 1Q86U 2D6FA 1B34B 4KLWA 3JB9G 1X10A 1IZ6A 1R8OB 2A36A 3D7DA 3H8FA 1WLPB 5LJ5g 2XEJA 3CMAA 4CYQA 5J26A 1HEEA 1NJIC 4PXCA 1TH7A 2O2OA 3D4UA 4X5KA 3M0SA 3EO4A 4FAIA 3I55T 4XU0A 4MY3A 2O88A 1M4LA 4ORZA 4DEYA 4AVBA 1CG2A 5IHKA 3CCRQ 1CPSA 4PPZA 5FRMA 3ISXA 2HB6A 2BKDN 2A08A 3CCUQ 2POKA 3CCQA 1YI2T 4FYYB 3KXTA 3WC6A 4U9ZA 2LQ8A 2FRWA 2PVWA 3B3SA 4C2ZA 5KYYB 5GAN8 3VUBA 1K9MR 1GCQA 2VVKA 2ZPEB 5I2SA 1TKHA 1ZA1B 3IEHA 4OIDA 3OYMA 4BD3A 1GBRA 4C92F 2X3WD 3MEUA 3V8LA 2ABLA 1U5SA 4C8QG 5BWAB 4EMHA 1EZZB 5LYDA 1VQ8A 3D7GA 4GXHA 4MFPA 3BDLA 1WZOA 1M44A 1FY7A 2RJFA 2P6FA 2LP5A 4HCCA 1PYTB 5KE3A 1U1TA 4HNWB 4F0XA 1HSQA 3FB3A 4OMFB 5FWBA 3JSCA 2BL1A 3JRUA 4XPKA 2QJ8A 2HSEB 1YIJT 2LQNA 3SI1A 1NPRA 1YREA 2E3HA 5FRNA 3CXCS 3HTRA 3QSUA 2E5KA 3KHZA 1K73C 3JCMd 4N0AA 3KBGA 4MHDA 2DJZA 2RN8A 3M5AA 3JAME 3CCLT 5GAN6 4C2XA 2COYA 3EHQA 1KHIA 3EHRA 3RDVA 1GHEA 2X35A 1VQ5A 3H9NA 5HK0A 3G3SA 2MAMA 3IC1A 3I5RA 1KQSS 3HP9A 4Q38A 3SWNB 1YX0A 3EG1A 1Z4RA 1G3SA 2J8RA 2YNDA 2YUOA 4ZNXA 2A28A 2CTCA 2K5TA 2NSMA 4C7IA 5GAMe 5ISVA 5LRJA 3VS1A 4ZGEB 3PFSA 4BBHA 4KULA 2KGTA 4UF4A 3BDUA 3CC2A 5J8CA 2X9HA 4QVCA 3PFOA 2LX9A 3A8HB 4MMOA 1V0CA 4UBRA 4M7AD 4X34A 4M78G 3CCSQ 2EQIA 3ULRB 3CCMA 3PEIA 3LH0A 2D8HA 5A2QE 2DPTA 3HFNA 2FPFA 4NGMA 4LE9A 2GE3A 3CZXA 4M75E 1VHEA 3V7SA 4F7UE 2EK8A 1H641 3M0QA 1BO4A 3BHXA 4C0ZA 3CXCA 3G6EQ 4HKFA 1IGBA 5CQXA 2HQEA 5KYNA 1ZSGA 3JCMX 2VQYA 1AHJB 1KG1A 2RI3A 2DD4A 4RUHA 2JXBA 4DBFA 4ZI6A 5J1QA 4PJOC 1MV3A 3GKRA 2RH2A 3TSWA 1KQSA 4MCSA 1JBMA 4JLYA 5GAOq 3VYGA 2PNIA 2RHZA 1XNIA 1AEYA 5KCHA 4RCBA 5THWA 1WJSA 1LFWA 2QAZA 4BUGA 3BW1A 1QVFS 1YJNA 4MRIA 1I8FA 2BTTA 5H84A 4M75A 4F7UA 3PBEA 2DL8A 4FYVB 1I1JA 4RTVA 1ZUKA 1Z8XA 2R57A 1IYLA 3MRUA 1ZSZC 3IO1A 1K4JA 3OYBA 3I55Q 1VQ6A 3I56T 5DLOA 1YMEA 2Z3PA 2QA4A 1UWYA 2QQAA 3CCVA 2AZSA 1OULA 3FH4A 3PGPA 2G3AA 2RC4A 2YT6A 1G5VA 2RK1A 2E4HA 2ECZA 4MFZA 3CCJT 2Q04A 2LCSA 2AJ6A 3E0KA 5G22A 2KT1A 3ASKA 2K5IA 3NTKA 3A9LA 2ZEHA 4CC3A 4PNOA 1M90U 2AFMA 1ZG9A 3PZJA 2M51A 3I1UA 1YCYA 2A3LA 2KSSA 5M9OA 1FMVA 1G3TA 4PFPA 1OX9A 5IAYA 4OGCA 3BI0A 3E9GA 4OC5A 2OAUA 1BI2A 4J9GA 1X2QA 1MJ9A 1M3AA 2LRQA 1Q2DA 3CPFA 3G71A 5I4MA 2QIRA 1ZX6A 2PUKB 3X26B 1QVFA 3T90A 4KUAA 2VYTA 4QW2A 1LCPA 4UFXA 5J8FA 5CKDA 3SI2A 5CBMA 5F46A 2PJ7A 1YIJQ 2B8AA 2PR8A 5GAMf 4M7DF 2NUZA 1YWOA 1R43A 2FXFA 1VA7A 1WXTA 3EH2A 2XICA 4JZ4A 4MZPA 3UPUA 1CPXA 4H6ZA 1PHTA 3OYGA 4QT7A 2AT1B 1SHFA 3J81E 3CCLQ 1KQ2A 1Q82R 3SI0A 3RYOA 3VS3A 4I49A 2VWFA 1T3SA 4OMNA 2D0QB 2GREA 1WHJA 3GP8A 1FT7A 3JB9I 2XDBA 2E41A 2K3YA 3JCMh 1XE4A 4OMLA 4XTYA 1RI0A 4QUSA 9ATCB 3I3GA 1VQ9T 5K8OA 2EYYA 3OYIA 2HUZA 4JPBW 4YTLA 2R5MA 3VRYA 4MJ8A 3QJYA 3JCMe 2WSAA 1IRXA 1G3WA 4E7HA 4MCRA 5IXFA 1N9RA 1LCKA 2QI2A 4OB2B 4M7AE 5I2MA 3ZFJA 4JZ0A 3JRZA 4CAFA 1YGHA 2K5LA 3CEYA 2B3UA 4C5HA 1QSTA 4ZY0A 2OZGA 3FNCA 1D0XA 4MHPA 2RI5A 5J39A 2EBPA 2ZPBB 2C6GA 3QAYA 4CS0B 2KEAA 4F04B 4JRPA 1KD1U 3NMZC 1F57A 1ABOA 5DLQE 1Z8LA 2SRCA 4P4DA 4FM4B 4RCCA 4J83A 4RTUA 1ZG7A 2ZEOA 2JTEA 4RG2A 2J9AA 2RQUA 1M2OA 4PXBA 3TFYA 4PLLA 5KE2A 2ZENA 3A8OB 1Q82C 1Q7LA 3B7IA 3M0TA 5GMKi 2ZW5A 4M7AA 3GPLA 2PJ3A 5FLXE 1Q2YA 2PJ8A 2HC9A 2OAWA 2VXFA 4B10A 1QCFA 2BZXA 3F0AA 2PSWA 3MEVA 1IXDA 4MFQA 4MFKA 3I56Q 5HKCA 3FJPA 3GNFB 3TE4A 2PJ2A 2EVRA 4E7ZA 3IIBA 4IKFA 1YBYA 2OZHA 2ZZDA 1VUBA 2QQ9A 2PIYA 1YHQT 1Z9UA 3CCJQ 2JNGA 1Q86C 3QDFA 1VQ7T 5KCOA 5GANj 1M1KR 3GF5A 1GFDA 3SDZA 5GAOp 4L5GA 4PV6A 3ZZIA 5AYFA 4J9DA 1MUZA 5EC7A 3FVLA 3M9QA 3R6NA 2FCKA 4H2KA 3QUIA 2JT4A 1ZG8A 2PE3A 8CPAA 5D29A 4F7UB 1VYUA 5FU7B 2I0NA 3L42A 4MCQA 4FIBA 1HJDA 3VV0A 3H8ZA 1C0MA 5FU6B 2C6CA 2X4WA 1Z2LA 2E3IA 1BIBA 4UCPA 3GY9A 1U3OA 3R9EA 4MXUA 4OC1A 1WNLA 1TKFA 1FWZA 1XF8A 2V26A 1V76A 3MEWA 5C82A 2Q43A 2OH1A 1Y7RA 3OBWA 3NGPA 3RMSA 2DF5A 4PSXA 1FYNA 4NL3A 3M56A 1N71A 3JV3A 3JCMf 3CC7T 2P6EA 4UC4A 3RERA 3HPWA 2DXQA 4KRTA 1YVOA 4R87A 1N8RR 2P4TA 3V8JA 1KSWA 1OPKA 1X01A 2VGMA 3M55A 4P4IA 3HUVA 2M9UA 1G8XA 2EW3A 4HVWA 3JCMc 1VHOA 4J6XA 2RI2A 1MJBA 1VQ9Q 3UY5A 2VV5A 1BU1A 1DJ7B 2YLBA 3D7HA 2RQVA 3C12A 3FX6A 2GANA 2PUOB 2LX7A 3DR6A 5DS0A 1ELMP 4B11A 3IFEA 2RQWA 1QMUA 1M5Q1 3QWXX 2YNEA 5KTCA 4JXRA 2PVGB 4EPCA 1WHHA 2VC8A 4B5PA 4C0DB 4OF1A 2X4YA 3CC4A 4OP4A 4FW1A 2EQUA 4LNPA 2B4BA 2RFHA 2JMAA 4E0AA 1D0ZA 1UJ0A 2RNAA 3GB0A 3D2MA 2RO0A 2AKKA 1LANA 2DAQA 5GAMj 3HHTB 2J6KA 3JCMQ 1LRZA 4M77E 5GANd 2O4HA 3QAHA 1VYVA 1K9MU 4C7HA 2L3PA 4E2FB 1BI0A 4J7IA 3NFZA 4PLIA 4NGTA 5LYFA 3M0PA 2CS7A 3A5ZB 2MMPA 2YRCA 2EGEA 4C92B 5DWMA 1XTDA 1VQOQ 4C5IA 4BB7A 2CNMA 4CAXA 2O4XB 1NYFA 4MDXA 2CXAA 3BLNA 5FVJA 2HQYA 4L6V5 2H3EB 4C8QD 1XOVA 4RUGA 2BO9A 1M30A 4NGQA 2HL5C 4Y91A 1TG0A 2BIVA 2Q44A 3B3TA 3TT2A 2FB7A 4QQGA 1PC0A 4EFDA 5JPHA 4RS2A 4M77A 1C1AA 1ELLP 1PNJA 2RK2A 4R6TA 1Z8TA 3V7ZA 1AVZC 1Y71A 2Y4YA 3V8KA 3H5ZA 4GBQA 1RAEB 2CY2A 3E9FA 5HK3A 2VL1A 4A4HA 4LUAA 4HNXB 1EIFA 1ZLIA 1N6AA 1M1GA 2DXBA 3EGXA 1R0BG 3TC8A 4ZY1A 2DEAA 4M7AB 2B58A 2PJ6A 3UF4A 1Q95G 2OTJA 2PJ4A 3LLRA 4HPSA 4CAWA 4F6AA 2DLPA 4MFLA 1WJQA 5GAN7 1TKJA 1W4SA 2HMAA 3OYLA 1OOTA 3CXSA 2JVVA 2GFAA 3CCRT 2JS0A 4F9VA 1QQ9A 1K0SA 4PQAA 2AFSA 3BE3A 3FIXA 2C27A 3EFOB 3BY7A 2VKNA 2ZW6A 3NFCA 2IJZA 2E6NA 3CCUA 5A0LA 3A8MB 4U5YA 1ZUUA 3IWGA 3PMTA 3H4QA 3SWNC 4FD4A 3CC7Q 1HYOA 3JTKA 1WGSA 1H3HA 1UFHA 2F2XA 3KFVA 3QIIA 4J6WA 2VBQA 4KVOE 3QO3A 2JOYA 1H3ZA 2DBMA 4M78D 3QZ5B 1AZEA 2QYVA 3CD6T 4EMEA 1KC8C 4UCMA 2YNCC 1QLYA 2DL7A 1UDLA 5EMIA 2V8GA 2ZW4A 2E64A 3EGDA 3PNWC 2LT4A 2LCLA 1OPLA 4FYWB 3O5ZA 3Q1JA 1K4US 2HV2A 4QC6A 3WVEB 1MJAA 2DL4A 1TS9A 3AT1B 4AXVA 1D0YA 3B35A 2FPDA 2DO3A 2DRKA 4HCZA 1KIKA 3D68A 2CF4A 2K79A 1S7KA 2ZEDA 3PB4X 4NF1A 2L2PA 5HMNA 3SXNA 5F09A 1MGQA 4KH1B 1NMTA 5HCKA 3M0UA 4M75F 4F7UF 2CZ0B 2BCOA 5E96A 5LRGA 4ZN3A 1OU9A 1NJIR 2K7AA 2XK0A 3VWDA 3EFAA 3NH5A 4KVXA 4XU2A 3OQ5A 1WHKA 1B07A 8AT1B 3WT4A 1IYKA 3A8GB 2D4OA 3NTHA 4IUSA 1OX8A 5CCAA 1T0JA 2JEWA 3CCST 1W6XA 5A0DA 1Y9WA 1ZA2B 5HY6A 1K8AC 4JWPA 5KYXA 2CNSA 3CBPA 2OTLT 2HZYA 3JCMW 3RNJA 4KORA 4PL6A 4KOXA 4ZGDB 2ENMA 4B5PB 3RIRA 4R57A 2JJ9A 4BD9A 4NS5A 2GGRA 5GAN3 4NJRA 5KYWA 4FD5A 3REAB 5GANe 3T9NA 1MMAA 4A54A 4AFSC 4LD9K 1AWXA 3OYKA 3TOAA 2FL4A 3CCEQ 1DTDA 3CT9A 1V1CA 4HKEA 4M7DB 4M6IA 2ZEFA 4Y92A 1J3TA 1K73R 2O28A 4NOYA 1XRYA 2ZEPA 4KUBA 3RESA 5K8PA 4Q5WA 2X7BA 2DE0X 5IB9A 3DLMA 3FJUA 4J3GA 3OS0A 4A95A 1N27A 3GYAA 1S72T 5EC4A 4UFVA 2LJ0A 4AFUC 2REFA 4Z65A 1Q7YC 3K9UA 5F49A 2DXTA 1TUDA 1JXOA 1VQMT 3FEEA 4UA3A 2A7YA 2FS5A 2CUDA 1X2KA 3ZEHA 1EE3P 3L2ZA 3DNSA 4BE2A 2IG0A 3GIUA 2REEA 4YFJA 3I55A 1BI3A 2HKNA 4RN7A 4XNHB 3S3NA 3PB8X 4KOVA 2DPSA 3F5BA 4ME7A 1GCQC 4M77B 2DVJA 4OGEA 4J9HA 3HKSA 1AD5A 1MNDA 1YI2A 5C88A 4Y28E 1BPNA 1M4GA 1BPMA 3PMIA 1TU0B 4KUDK 5G20A 2BUDA 3G4ST 4RTWA 1XMTA 4A37A 1LPLA 3I9QA 2CZ7B 3CD6Q 2FEIA 3KGQA 4HT9A 2CH4W 4B9XA 1PSFA 2FSRA 4CI0C 3JCMP 2NWMA 3R9GA 2WSFE 3X25B 4DBRA 4KT0E 2AZVA 1VQ8T 2JDDA 1OBRA 4QQDA 4M78C 2CP5A 2FIAA 4X1VA 1UTIA 1D1CA 1YCSB 4ORFA 1KK7A 4R0KA 2ROLA 5GAMh 2KXDA 5IH2A 4RTTA 4PJJA 3L2QA 1TIQA 1IB8A 4Q7AA 1C6VX 5FWCA 3VJPA 4J8OA 2Z0WA 4M7AF 5G1ZA 2CP2A 4TNUA 2OU2A 2B3VA 4FW2A 1AWJA 1Y07A 2F69A 3OS1A 5H86A 2IPOB 1KZFA 1YJ9T 3EH1A 4WWVA 3VS2A 2CUBA 3VKIA 2EQKA 2DTHA 4IIMA 3LACA 3EG3A 3EGDB 4IUTA 2IQ6A 3CBMA 4IUVA 5GAMg 3IWWA 3WABA 3S3MA 4OLLA 3UWNA 4KOWA 4MHNA 2EYXA 2GU2A 3RUXA 2JBJA 2GBQA 2WUUA 2C0TA 4MHZA 4DYOA 3MP8A 5GANf 1I1DA 1SSHA 2C0IA 5GMKe 2CT3A 4NEXA 5GMKl 4JYWA 3LMSA 1B87A 1UUEA 2OTLQ 1ARKA 5HXDA 4X9CA 1VQ4T 4PJOE 3OYHA 2M0YA 1S7LA 4UIAA 1ZQ1A 5CR2A 2LMJA 2X51A 4LQ6A 2JBKA 4HA8A 1IIDA 3L2RA 1HD3A 1SEMA 3SD4A 4QVDA 3E19A 1T0HA 3DGVA 4B6MA 1U8RA 3HRUA 1Y9KA 3OYDA 3TCVA 1YLEA 4P10A 4HCBA 4LX9A 3TTHA 3SHPA 2PDOA 1SG5A 5FU7C 1AMPA 1WQWA 4OVAA 1S1NA 5LRKA 2RQRA 2ZAEA 1S72Q 2P0WA 4LDUA 5KYXB 2K4YA 2DTIA 4PJOA 2GFQA 4R7MA 5CPAA 5GAN2 5GAOr 1LOJA 2KBTA 5KTDA 1VQMQ 4XTUA 2AE6A 3OW2S 3RMQA 6CPAA 1VQKT 5I11A 4IUQA 2DEQA 2HSPA 3CMAQ 4MBUA 3J7AF 5KYWB 1BB9A 1Y57A 1CP6A 4PFZA 1I5LA 4MHYA 4Z89A 1FXXA 4ZTJA 4KBMB 3EY5A 1QCNA 4XQ3A 2DRMA 1G2BA 3ZL7C 5D6WA 3GNGA 3VU3C 4A30A 1PRLC 2VASA 2E1HA 3KI9A 5JGFA 4CC2A 3CCJA 1ZSZA 3JB9H 3P8HA 2ZCFB 3FF3A 3UDCA 2ATCB 3G4SQ 3UA6A 1CP7A 1UGSB 1QMCA 5JQ4A 1PD1A 4K30A 4R8FA 4ELZC 4F7UG 4MZTA 3MO8A 1ZHIA 3CDXA 1FX7A 2EQJA 4FUUA 2X4JA 3M0RA 2JTFA 4BE1A 3E1SA 1RTQA 3P2HA 3L2VA 4UEZA 3HFOA 1VQ8Q 3S9MA 1CX8A 3DKMA 2LQWA 1TF9A 1UG1A 1LNXA 4JD6A 3SXOA 2L3QA 2I3CA 3PP9A 3OW2A 4Z88A 4C0DC 1QCOA 2B86A 2HCKA 3PT9A 3K9TA 4ZX9A 4F9UA 2KAFA 2CTBA 3OYAA 1BI1A 2ED1A 4KZTA 4IURA 4L59A 1Y0YA 1UHCA 5CO7A 1WA7A 1T3LA 1YJ9Q 3M59A 3KQZA 5GAOm 3FMCA 3D66A 2RB6A 5A28A 5LYIA 2KK4A 4CC4B 1ZLMA 2IMOA 4C5EA 2R58A 1RAAB 3OY9A 4J9CA 3PVQA 4C0FA 3DDDA 4P5NA 4CYOA 2OR4A 1Q86R 1PRMC 4M77F 4N4GA 2DM1A 4R55A 1VQ9A 1LAMA 5IN1A 4C92C 1M4ZA 3M53A 3WVDB 1X6OA 4EVYA 2JW4A 3JCMg 1YJWT 6AT1B 1E6HA 2EJFA 2F1LA 2GCXA 1PUAA 2HL3A 5EBVA 1BK2A 2BZ8A 3VS6A 1VQ4Q 1BCMA 2A37A 5CKHA 4ONWA 3GIBA 2GQIA 3IJ3A 1PKSA 1LVKA 2JN0A 3FC3A 3T8WA 3UA7A 2PVOB 2YSQA 3MN8A 3M4GA 4F0YA 2Z3NA 4BI3A 2VI7A 2K2MA 2KYMA 4AMCA 4O6JA 1IHVA 2W0ZA 3OYEA 4U9YA 4CRIA 4A4KA 4ZX8A 5LJ3d 2ZEEA 4NJQA 1BBZA 1JJ2P 3N5FA 2EAYA 4OC4A 2DL3A 4NGSA 2W10A 2DEUA 4C92G 2PVVA 1VQOT 1R3NA 2WZNA 2XD0A 2PIZA 2KY9A 1H8LA 4CGPA 2V1RA 4J9EA 4FBEA 3B3VA 2Y0MA 3D8PA 4RTYA 3KHXA 2DNUA 1QWFA 1VQKQ 3S6WA 3V38A 2KI7A 3I9SA 4QVZA 1JB0E 1N9SA 1YQEA 3KKWA 1EX4A 2DKGA 4VUBA 3VATA 1KWMA 3QXEB 4PXEA 5EG2A 4Q36A 1VQ6Q 1JWQA 2Z3OA 4MY0A 4NGPA 4XPDC 1YHQA 3N7ZA 2OX7A 1VQ7A 4CGOA 1VOMA 2R8VA 4YGOA 1GCPA 3MGDA 3FEDA 2XDDA 5KYUA 2E6ZA 4FD7A 2WSEE 4M75B 1NJIU 4M7AG 3LD2A 4A4EA 4KH0B 3D67A 1GBQA 2DIQA 1D3BA 5HVGA 4E7IA 4PJOB 2Z3KA 2L5QA 1Q81U 1TXRA 1RUWA 2AHJB 4CC7A 2XIDA 3MP6A 3SFMA 2G3RA 2KNBB 4QQ6A 3LWHA 3TO9A 2B5GA 3H0IA 1K9AA 5LJ5j 4WJBA 2EO8A 3G71Q 4BDZA 4A63B 2KE9A 2CP0A 2QEXA 1MV0B 4JJBA 2BSWA 1M9SA 3FECA 3OS2A 3ZBDA 2JS2A 2CH4A 3OMGA 4P4EA 5IHIA 4BY6B 1ZSZB 2FIWA 4X8IA 2QQBA 1NYGA 3TCJA 1J4JA 2Q4ZA 4BE0A 3HRSA 4JRKA 3CC7A 2DXUA 2RHXA 2D0NA 5JM6A 2VZYA 2K3BA 5J3BA 3FBUA 2EFIA 1BOBA 1P92A 4WF2A 1PCAA 2XEGA 2ROTA 4A53A 1B7TA 1IICA 2EK9A 3C95A 4LUEA 5GAN5 4MZMA 4NGNA 2GIVA 3MPUB 3NHNA 3NTIA 3S9LA 3LW5E 1BIAA 2RJCA 3QYGB 4A4GA 1YJWQ 5CAIA 3VWEA 2E65A 2L89A 3C94A 4ESRA 1XMBA 1IHWA 4P4FA 1NEBA 3TOBA 2FZGB 3CPWP 3B3CA 4AFQC 3HSBA 2Y90A 2BE9B 8ATCB 1SF9A 2ANPA 3JB9D 1K0XA 1W70A 3OA6A 4P44A 3DLJA 1PSEA 4XAXB 4C8QF 2GFUA 1UGQB 4M7DC 4AG1C 2BE7D 2XU8A 5LL6S 2QG9B 4V2SA 2H3JA 4C0GA 1OZ2A 1IY7A 1U6MA 3BFMA 4D8DA 1RAGB 3INZA 3G8WA 2ZPAA 2G6FX 2FPEA 2HQXA 1NPPA 1I21A 2AFXA 3CMET 2M0OA 2QGFB 5I22A 5GMKj 1XIXA 1SPKA 4JJXA 2KRMA 3EG0A 4PJNA 4BI8B 2V8DA 1KC8R 2FO0A 2Z10A 4B12A 1WQ7A 3URGA 3OYFA 3M54A 1CM0A 3IQLA 3WC5A 2J06A 1R77A 3P8BB 2PJ0A 4B13A 2JM9A 4XNHC 4KGVB 2LJ3A 3I35A 5LJ3e 4Z8AA 3NA6A 1JQGA 2K9GA 2F5TX 1VQLT 2YRDA 3SJFA 1D1AA 2MWPA 3CCET 3W6XA 1K76A 2EUIA 5LJ5d 2JZ2A 1VQPT 1VIEA 4AVCA 4M7DG 1JJ2S 1BCOA 1XJWB 4X2TA 1JRIA 3EAEA 4JZ3A 1VQNT 1NLOC 4OAEA 1KJWA 5F47A 2GLFA 2DZ9A 1VGYA 5GAOn 2RB7A 3S6HA 1X75C 3PGGA 4O5VA 2LVMA 1BLLE 4ONUA 3DR8A 3GOXA 1QSNA 3S3OA 2EKHA 2FHDA 1P4NA 4P6YA 1M2VA 2CP7A 2KCWA 2A4NA 2KYBA 2BEIA 2C6PA 3H0FA 5KTAA 4UCNA 4LN2A 1AT1B 3VS7A 1M90C 1QVGP 3ISZA 2CIJA 1IGQA 2RJDA 1UGVA 1YITT 4DNCA 3CCRA 2NLUA 1X43A 4M77G 5FW9A 3KR4A 4AG7A 5IX3A 4GLKA 3QNVA 5AG5A 1K8AR 2VXKA 3CBOA 4XTWA 2DK3A 5ECAA 1S7NA 5HVHA 2EGCA 1ZBJA 1KD1R 2DD5A 4QB9A 1I4K1 5KYUB 1GXIE 1QP3A 1AYEA 1AOJA 3J80E 3LYIA 5IHNA 1JJ2A 2DETA 4GY5A 4K11A 1OI1A 5D6YA 3CXCP 1QSMA 1KQ1A 2WPWA 3M58A 2QTXA 3CD6A 1D3BB 3F8KA 2RA2A 2AK5A 2CZ1B 2QDLA 3H41A 4YWYA 3SWNA 4PXDA 2EJGA 1WHMA 2YUPA 3KUFA
chains in the Genus database with same CATH topology
2HBPA 4FSXA 1RLQC 5C6SA 2D1XA 3AHUA 2YDLA 4M4ZA 2VGNA 2CYZB 2YHTA 4PJOF 1U1SA 1M3BA 2ZPIB 1WJRA 4J7FA 4XU3A 3UATA 5C0MA 2CREA 2V1QA 4ATOA 2Q7SA 2DX1A 5LJ3f 3N5BB 2I2LA 1JO8A 1Y7XA 4ZN1A 4HT8A 4J9FA 2XDPA 5GANh 4F16A 3CCSA 1KD1C 2DF6A 3CPWS 2D9TA 4MMLA 2O9SA 3GBQA 2OTLA 4IUPA 3VUZA 4JLIA 4C8QE 1WDXA 2YUQA 3G6EA 4GLMA 3OSVA 4RMOA 4II1A 5GANg 4LUDA 5DM7R 2P0PA 2LT1A 4N4HA 1RL2A 1Q82U 3OB9A 1RI9A 2LTOA 1QWEA 2KROA 2CDTA 3QZ9B 3X28B 4XK8E 4R56A 1B3QA 1Y96A 1QKWA 2L3SA 2EIFA 4JDSA 4EMKA 5IT9E 3FDRA 2O31A 4C8QA 2JUFA 5LJ5e 1I0CA 3CMAT 5KH6A 1VQMA 5L8RE 4WCIA 5IXBA 3U23A 3CPWA 2X4XA 2AKLA 4OB3B 2PQWA 5GAN4 4OMQA 2LC4A 3L1AA 3CCQT 1Q81C 2DYBA 3HRTA 1VIFA 2K5FA 1U06A 2IVWA 2RM4A 4M78E 2QDYB 3G4SA 3TEEA 4TVRA 4J6YA 1QVGS 2ODFA 1WIEA 2RHUA 4OMPA 4A4FA 4N0AC 2RMOA 3F70A 4F17A 3V7RA 2LZ6B 4FSSA 1YIJA 4JJCA 1HXDA 2XHCA 3PTAA 3G7ZA 4J5YA 3CCLA 2DXCA 4C92D 4M78A 2KRSA 2DA9A 1Z9ZA 1VQ5T 1JEGA 1WPYA 5GMKh 2PVDB 2RD1A 2ZPFB 1ZBXA 1YJ9A 2CKKA 1I81A 4JRIA 1M1KU 2LQKA 3PIOA 3CC2T 1PKTA 2E70A 1UE9A 2MIOA 2ESWA 1QVGA 1UB4A 2HNIA 3CCMT 4ZGJB 1NEGA 2V8KA 1K9MC 2HD0A 1YNZA 2L8DA 1VQ4A 2LNVA 2KMTA 2EWNA 3H0HA 4OP0A 3EGUA 2VXEA 5LJ5f 1YN8A 4C5GA 2GF7A 2RHIA 2RF0A 4M75C 2CT4A 1SRMA 1N8RU 5FU6C 2ZGWA 2P0KA 3PIPA 3DLLA 2P4RA 3L2UA 1OZ3A 1UECA 2F5KA 1YJNT 3RKWA 1QP2A 2LJ1A 1OYXA 3I56A 2YLCA 3OS5A 3VS4A 3QDRB 4ZTFA 1VQKA 1VQ6T 5LJ3j 4E7JA 2QA4T 1NE8A 2ZPGB 3UT1A 4BY6C 3CCVT 2V8IA 2CGHA 1X6BA 1M8VA 2EYQA 1WFWA 3LH5A 5CVIA 2RPNA 2FG0A 4DOVA 2L3RA 4M75G 3JCMJ 1WXBA 3OMCA 2QQSA 4E7LA 4HVVA 2OI3A 1Y96B 4PJOG 2K2VA 1IREB 4EMKB 3VYHB 4C8QB 1VYTA 2LNHB 1IO6A 2PU9B 2DPPB 3G71T 5FROA 4BINA 2K6DA 2GQVA 1Y0MA 2XI9A 2WACA 1EFNA 3RBBB 3FLGA 3OYCA 3WXMB 1XQHA 1HK9A 2LDMA 1KC8U 4E7KA 4M6HA 3REBB 3TVTA 3QWYA 1QKXA 2KR3A 4RTZA 2YRVA 4C92E 2PZ1A 4RTXA 1X69A 4NL2A 2XMFA 1QVPA 2MOXA 2JMCA 1WI7A 2C0OA 4DA4A 5CKBA 2YUNA 4FL6A 2QXFA 3ER0A 4X9DA 1WXUA 4M7DD 1WX6A 1TUCA 1YJWA 1M8MA 3EG2A 5CKEA 1GRIA 2X3XD 1RLPC 2J7IA 3LGFA 4M6GA 2RQTA 4C92A 4M78B 2EPDA 3M4YA 2O4XA 2KVQG 4PKCC 1O75A 2FVUA 3MCAB 3L2WA 4DOWA 4XTXA 4J9IA 3LX7A 1AZGB 1K8AU 4M7AC 1G3YA 2DMOA 2M16A 2ZPHB 4M77D 4HVUA 3LGLA 1VQOA 3I5SA 3SB2A 3GLXA 1K1ZA 3X20B 4E6RA 2E5QA 2L0AA 4IIOA 5CKFA 4FT4A 1SRLA 1NM7A 4HXJA 2BZYA 1MHNA 3P8DA 2K3XA 3FIFA 3TU4K 2R5AA 1JXMA 2EYWA 2HDAA 1Q7YU 1OEBA 3PVLA 4JS4A 3FRNA 3RKXA 4LDWA 3THKA 3X24B 4BI4A 1FMKA 3C0CA 2FYKA 3QG1A 2GTJA 2KT8A 4JJNK 1M3CA 3NE8A 2DVEA 3OYNA 4J9BA 2QEXT 2GNCA 2E12A 2RJEA 1O9SA 4DEXA 2HBWA 1BYMA 2V8JA 3QHSA 1H92A 1NG2A 1SSFA 2EKOA 3JB9F 4RG8A 1YP5A 5I21A 3NPFA 2JTMA 3MHXA 4KUIA 2MI6A 1JU5C 1E6GA 1KFZA 4EDUA 1K73U 1JQQA 1M27C 1LJOA 3MP1A 1KHCA 1UJYA 1QW1A 1H8KA 4JLGA 3QKJA 5CIUA 5GMKm 3HL8A 4IUUA 2J05A 2DILA 4M7DE 1M1KC 2DJQA 4Z02A 2EJ9A 1ABQA 2XG8D 3EFSA 2JM8A 2LCCA 3FB9A 4EIKA 3CC4T 2DBKA 1BKBA 3CQTA 3LWIA 1I07A 2Y4XA 5A0GA 5LJ3h 2PTKA 2SEMA 2VUBA 3FJ5A 4M7DA 2WSCE 3QPHA 3CMEA 5D6XA 3TSZA 3TREA 2F2WA 4LDVA 3DB4A 4JRQA 1UHFA 3VS5A 1B34A 1GFCA 1G83A 4M77C 4OMOA 1UFFA 1W2BS 4D8KA 1W1FA 2H8HA 5LJ3g 1N8RC 1VQLA 4D6WA 3CCEA 1CKBA 2EQMA 1NZ9A 1VQPA 2J6OA 3OYYA 2KXCA 2F2VA 2J6FA 1M1FA 5CQYA 1VQNA 3JCMb 1X6GA 1PWTA 1UGPB 2EGAA 4MMKA 2OJ2A 4F14A 2MWOA 3QYHB 4M78F 4ELYC 2IIMA 4FU6A 3OSSC 2OTJT 2CSIA 1N5ZA 1CKAA 4LDXA 3DB3A 2C06A 1A0NB 5CK9A 3JB9J 3MEAA 5GJWB 4DQ2A 1YITA 3V7CA 3VRZA 1X27A 1W2BA 2RHYA 3CCUT 4OMMA 1E7OA 2FL7A 3R6OA 3QBYA 1SHGA 2FRYA 4RKUE 2MF2A 1OV3A 1NLPC 2KDSA 3VS0A 4FT2A 4BACA 3FEOA 4E47A 2DZCA 1GL5A 3META 2E10A 2GTOA 1WYXA 2D8JA 2XKOC 2DL5A 3QJ6A 5GAMd 4BDYA 3SHWA 3OBYA 3H6ZA 2K57A 4MDWA 4EMGA 4XTZA 3OYJA 1ZUYA 4OB0B 3RKYA 1AWOA 3O8VA 3C4SA 3A98A 5GAOl 1UGRB 5DY9A 4LDYA 4JS5A 4HCKA 1CSKA 4AFZC 2MCNA 2KQWA 3A8LB 4AG2C 1AWWA 4XTVA 4LD6A 4OB1B 2O01E 2P0QA 1V29B 2ED0A 4M75D 3SEMA 1UEBA 4PJOD 3EFRA 2M1HA 5L23A 3PE0A 4B9WA 3G6ET 3M57A 3ME9A 4XU1A 2DIGA 2KRNA 5LJ5h 2HEQA 2HAXA 3JCMV 4EMKC 4N4IA 2O9VA 4C8QC 1S72A 1YWPA 1Z9QA 4JJDA 5GJVB 4JUVA 2EYZA 2CSQA 2DTOA 2QQRA 2CZ6B 1Q86U 2D6FA 1B34B 3JB9G 1IZ6A 2A36A 1R8OB 1WLPB 5LJ5g 3CMAA 5J26A 1NJIC 1TH7A 2O2OA 3M0SA 3I55T 4XU0A 2O88A 4ORZA 4DEYA 5IHKA 5FRMA 2HB6A 2BKDN 2A08A 3CCQA 1YI2T 3KXTA 2LQ8A 2FRWA 5GAN8 3VUBA 1GCQA 2VVKA 2ZPEB 5I2SA 3OYMA 4BD3A 1GBRA 4C92F 2X3WD 3MEUA 3V8LA 2ABLA 1U5SA 4C8QG 4EMHA 1VQ8A 3BDLA 2RJFA 2LP5A 4HCCA 5KE3A 1U1TA 1HSQA 5FWBA 4OMFB 3JSCA 1YIJT 2LQNA 1NPRA 5FRNA 3CXCS 3QSUA 2E5KA 1K73C 3JCMd 4N0AA 3KBGA 2DJZA 2RN8A 3M5AA 3JAME 3CCLT 5GAN6 3EHQA 1KHIA 3EHRA 2X35A 1VQ5A 5HK0A 2MAMA 3I5RA 1KQSS 3HP9A 3SWNB 3EG1A 1G3SA 2YUOA 4ZNXA 2A28A 5GAMe 3VS1A 4ZGEB 3PFSA 4KULA 2KGTA 3BDUA 3CC2A 4QVCA 2LX9A 3A8HB 4M7AD 4X34A 4M78G 2EQIA 3ULRB 3CCMA 3LH0A 2D8HA 5A2QE 3HFNA 2FPFA 4LE9A 3CZXA 4M75E 3V7SA 4F7UE 1H641 3M0QA 4C0ZA 3CXCA 5CQXA 2HQEA 1ZSGA 3JCMX 1AHJB 1KG1A 2RI3A 2DD4A 2JXBA 4PJOC 1MV3A 2RH2A 3TSWA 1KQSA 1JBMA 5GAOq 3VYGA 2PNIA 1AEYA 1XNIA 2RHZA 5KCHA 4RCBA 1WJSA 4BUGA 3BW1A 1QVFS 1YJNA 1I8FA 2BTTA 4M75A 4F7UA 2DL8A 1I1JA 4RTVA 1ZUKA 2R57A 3OYBA 1VQ6A 3I56T 5DLOA 2QA4A 2QQAA 3CCVA 2AZSA 2YT6A 1G5VA 2RK1A 2ECZA 3CCJT 2LCSA 2KT1A 3ASKA 2K5IA 3NTKA 4CC3A 4PNOA 1M90U 2M51A 1YCYA 2A3LA 2KSSA 5M9OA 1G3TA 5IAYA 4OGCA 3E9GA 2OAUA 1BI2A 1X2QA 4J9GA 1M3AA 2LRQA 3CPFA 3G71A 1ZX6A 2PUKB 3X26B 1QVFA 2VYTA 4QW2A 5CKDA 2B8AA 5GAMf 4M7DF 2NUZA 1YWOA 1VA7A 1WXTA 2XICA 4JZ4A 4MZPA 3UPUA 1PHTA 3OYGA 4QT7A 1SHFA 3J81E 1KQ2A 3VS3A 2VWFA 1T3SA 4OMNA 2D0QB 3GP8A 3JB9I 2XDBA 2E41A 2K3YA 3JCMh 4OMLA 4XTYA 1RI0A 1VQ9T 2EYYA 3OYIA 4JPBW 4YTLA 2R5MA 3VRYA 3QJYA 3JCMe 1G3WA 4E7HA 5IXFA 1N9RA 1LCKA 2QI2A 4OB2B 4M7AE 5I2MA 3ZFJA 3JRZA 2K5LA 3CEYA 4C5HA 2RI5A 5J39A 2EBPA 2ZPBB 3QAYA 2KEAA 4JRPA 1KD1U 3NMZC 1ABOA 5DLQE 2SRCA 4FM4B 4RCCA 4RTUA 4J83A 2JTEA 4RG2A 2RQUA 4PLLA 5KE2A 3A8OB 1Q82C 3M0TA 5GMKi 4M7AA 3GPLA 5FLXE 2HC9A 2OAWA 2VXFA 1QCFA 2BZXA 3MEVA 5HKCA 3FJPA 3GNFB 2EVRA 4IKFA 1YBYA 2ZZDA 1VUBA 2QQ9A 1YHQT 2JNGA 1Q86C 1VQ7T 5KCOA 5GANj 1GFDA 3GF5A 3SDZA 5GAOp 4L5GA 5AYFA 4J9DA 1MUZA 5EC7A 3M9QA 3R6NA 3QUIA 2JT4A 4F7UB 1VYUA 5FU7B 2I0NA 3L42A 4FIBA 1HJDA 3VV0A 3H8ZA 5FU6B 2X4WA 1BIBA 1U3OA 1WNLA 1FWZA 3MEWA 3OBWA 3NGPA 3RMSA 1FYNA 4NL3A 3M56A 3JV3A 3JCMf 3CC7T 4UC4A 3RERA 3HPWA 4KRTA 2P4TA 3V8JA 1KSWA 1OPKA 1X01A 2VGMA 3M55A 2M9UA 2EW3A 4HVWA 3JCMc 4J6XA 2RI2A 2VV5A 1BU1A 1DJ7B 2YLBA 2RQVA 3C12A 2PUOB 2LX7A 2RQWA 1M5Q1 3QWXX 2PVGB 4EPCA 2VC8A 4C0DB 4OF1A 2X4YA 3CC4A 2EQUA 4LNPA 2JMAA 1UJ0A 2RNAA 2RO0A 2AKKA 2DAQA 5GAMj 3HHTB 2J6KA 3JCMQ 4M77E 5GANd 1VYVA 1K9MU 2L3PA 1BI0A 4J7IA 4PLIA 3M0PA 2CS7A 3A5ZB 2MMPA 2EGEA 4C92B 1XTDA 4C5IA 4BB7A 2O4XB 1NYFA 4MDXA 4L6V5 4C8QD 1XOVA 4RUGA 1M30A 4Y91A 1TG0A 2BIVA 2FB7A 4QQGA 4EFDA 4M77A 1PNJA 2RK2A 1AVZC 1Y71A 2Y4YA 3V8KA 4GBQA 3E9FA 5HK3A 4A4HA 1EIFA 1N6AA 1M1GA 2DXBA 4M7AB 3UF4A 2OTJA 3LLRA 2DLPA 1WJQA 5GAN7 1W4SA 3OYLA 1OOTA 2JVVA 2GFAA 3CCRT 2JS0A 1K0SA 3BY7A 2VKNA 3NFCA 2E6NA 3CCUA 5A0LA 3A8MB 1ZUUA 3PMTA 3SWNC 1H3HA 1WGSA 2F2XA 3KFVA 3QIIA 4J6WA 3QO3A 2JOYA 1H3ZA 2DBMA 4M78D 1AZEA 3QZ5B 3CD6T 1KC8C 1QLYA 2DL7A 1UDLA 5EMIA 2E64A 3PNWC 2LT4A 2LCLA 1OPLA 3O5ZA 1K4US 3Q1JA 3WVEB 2DL4A 2FPDA 2DO3A 2DRKA 1KIKA 4HCZA 2K79A 2L2PA 1MGQA 5HCKA 3M0UA 4M75F 4F7UF 2CZ0B 4ZN3A 2K7AA 2XK0A 4XU2A 3OQ5A 1B07A 3A8GB 3NTHA 5CCAA 1T0JA 3CCST 1W6XA 5A0DA 5HY6A 1K8AC 3CBPA 2OTLT 3JCMW 3RNJA 4PL6A 4ZGDB 2ENMA 3RIRA 4NS5A 2GGRA 5GAN3 3REAB 5GANe 3T9NA 4A54A 4AFSC 4LD9K 1AWXA 3OYKA 1V1CA 4HKEA 4M7DB 4M6IA 4Y92A 1J3TA 4NOYA 3RESA 4Q5WA 2DE0X 3DLMA 3OS0A 1N27A 1S72T 2LJ0A 4AFUC 1Q7YC 2DXTA 1TUDA 1JXOA 1VQMT 2A7YA 2CUDA 1X2KA 3ZEHA 3L2ZA 4BE2A 2IG0A 3I55A 1BI3A 4RN7A 3S3NA 4ME7A 1GCQC 4M77B 2DVJA 4OGEA 4J9HA 3HKSA 1AD5A 1YI2A 4Y28E 3PMIA 4KUDK 2BUDA 3G4ST 4RTWA 3I9QA 2CZ7B 2FEIA 4HT9A 2CH4W 4B9XA 1PSFA 4CI0C 3JCMP 2NWMA 2WSFE 3X25B 4KT0E 2AZVA 1VQ8T 4QQDA 4M78C 4X1VA 1UTIA 1YCSB 4R0KA 2ROLA 5GAMh 2KXDA 5IH2A 4RTTA 3L2QA 3VJPA 5FWCA 4J8OA 4M7AF 1AWJA 1Y07A 2F69A 3OS1A 1YJ9T 3VS2A 2CUBA 3VKIA 2EQKA 4IIMA 2DTHA 3EG3A 4IUTA 3CBMA 4IUVA 5GAMg 3S3MA 3UWNA 2EYXA 3RUXA 2GBQA 2C0TA 3MP8A 5GANf 1SSHA 2C0IA 5GMKe 2CT3A 5GMKl 1UUEA 1ARKA 4X9CA 1VQ4T 4PJOE 3OYHA 2M0YA 1ZQ1A 5CR2A 2LMJA 4LQ6A 4HA8A 3L2RA 1HD3A 1SEMA 3SD4A 4QVDA 3E19A 1T0HA 1U8RA 3HRUA 3OYDA 4HCBA 5FU7C 1WQWA 4OVAA 1S1NA 2RQRA 4LDUA 2K4YA 2DTIA 4PJOA 5GAN2 5GAOr 1LOJA 2KBTA 4XTUA 3OW2S 3RMQA 1VQKT 5I11A 4IUQA 2HSPA 2DEQA 3J7AF 1BB9A 1Y57A 1I5LA 4Z89A 1FXXA 4ZTJA 4KBMB 4XQ3A 2DRMA 1G2BA 3ZL7C 5D6WA 3GNGA 3VU3C 1PRLC 2E1HA 4CC2A 3CCJA 3JB9H 3P8HA 2ZCFB 3UDCA 3UA6A 1UGSB 4ELZC 4F7UG 4MZTA 3MO8A 1ZHIA 1FX7A 2EQJA 3M0RA 2X4JA 2JTFA 4BE1A 3E1SA 3L2VA 3HFOA 3DKMA 2LQWA 1UG1A 1LNXA 2L3QA 3OW2A 4Z88A 4C0DC 2B86A 2HCKA 3PT9A 2KAFA 3OYAA 1BI1A 2ED1A 4IURA 4L59A 1UHCA 5CO7A 1WA7A 1T3LA 3M59A 5GAOm 2RB6A 2KK4A 4CC4B 1ZLMA 4C5EA 2R58A 3OY9A 4J9CA 3PVQA 4C0FA 4P5NA 1PRMC 4M77F 4N4GA 2DM1A 4R55A 1VQ9A 5IN1A 4C92C 1M4ZA 3M53A 3WVDB 1X6OA 2JW4A 3JCMg 1YJWT 1E6HA 2EJFA 2GCXA 1BK2A 2BZ8A 3VS6A 2A37A 5CKHA 3GIBA 2GQIA 1PKSA 2JN0A 3FC3A 3UA7A 2PVOB 2YSQA 3M4GA 4BI3A 2K2MA 2KYMA 4O6JA 2W0ZA 3OYEA 4CRIA 4A4KA 5LJ3d 1BBZA 2EAYA 2DL3A 2W10A 4C92G 1VQOT 2XD0A 2KY9A 2V1RA 4J9EA 4RTYA 2DNUA 1QWFA 3S6WA 4QVZA 1JB0E 1N9SA 2DKGA 4VUBA 3QXEB 5EG2A 1JWQA 1YHQA 1VQ7A 1GCPA 2XDDA 2E6ZA 2WSEE 4M75B 1NJIU 4M7AG 4A4EA 1GBQA 2DIQA 1D3BA 4E7IA 4PJOB 2L5QA 1Q81U 1RUWA 2AHJB 4CC7A 2XIDA 3MP6A 3SFMA 2KNBB 2G3RA 4QQ6A 3LWHA 3H0IA 1K9AA 5LJ5j 4BDZA 4A63B 2KE9A 2QEXA 1MV0B 4JJBA 1M9SA 3OS2A 3ZBDA 2JS2A 2CH4A 3OMGA 5IHIA 4BY6B 2QQBA 1NYGA 3TCJA 4BE0A 3HRSA 4JRKA 3CC7A 2DXUA 2RHXA 2D0NA 2K3BA 5J3BA 2EFIA 1P92A 4WF2A 2ROTA 4A53A 3C95A 4LUEA 5GAN5 4MZMA 3NHNA 3NTIA 3LW5E 1BIAA 2RJCA 3QYGB 4A4GA 5CAIA 2E65A 2L89A 3C94A 4ESRA 1NEBA 4AFQC 3HSBA 2Y90A 3JB9D 1K0XA 1W70A 3OA6A 1PSEA 4XAXB 4C8QF 2GFUA 1UGQB 4M7DC 4AG1C 2XU8A 5LL6S 4V2SA 2H3JA 4C0GA 1OZ2A 3BFMA 4D8DA 3INZA 2G6FX 2FPEA 2HQXA 1NPPA 3CMET 2M0OA 5I22A 5GMKj 1SPKA 2KRMA 3EG0A 4BI8B 2FO0A 1WQ7A 3URGA 3OYFA 3M54A 3IQLA 2J06A 3P8BB 2JM9A 2LJ3A 3I35A 5LJ3e 4Z8AA 2K9GA 2F5TX 1VQLT 2MWPA 3CCET 1K76A 5LJ5d 2JZ2A 1VQPT 1VIEA 4M7DG 1JJ2S 1JRIA 3EAEA 4JZ3A 1VQNT 1NLOC 1KJWA 2DZ9A 5GAOn 1X75C 3PGGA 4O5VA 2LVMA 3GOXA 3S3OA 2EKHA 2FHDA 2KYBA 3H0FA 4LN2A 3VS7A 1M90C 2RJDA 1UGVA 1YITT 3CCRA 2NLUA 1X43A 5FW9A 4M77G 4GLKA 3CBOA 4XTWA 2DK3A 5ECAA 2EGCA 1ZBJA 2DD5A 1I4K1 1GXIE 1QP3A 1AOJA 3J80E 5IHNA 3LYIA 1JJ2A 4K11A 4GY5A 1OI1A 5D6YA 1KQ1A 3M58A 2QTXA 3CD6A 1D3BB 2RA2A 2AK5A 2CZ1B 2QDLA 3H41A 3SWNA 2EJGA 2YUPA 3KUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXD A;  5IH2 A;  4RTT A;  1E6G A;  1KFZ A;  3VS3 A;  1JQQ A;  2VWF A;  1M27 C;  1T3S A;  4OMN A;  5FWC A;  3NPF A;  1RLQ C;  1UJY A;  2D1X A;  4OML A;  1H8K A;  1AWJ A;  2YDL A;  4M4Z A;  3VS2 A;  2CUB A;  2J05 A;  2EYY A;  2DIL A;  4JPB W;  4IIM A;  2DJQ A;  4QT7 A;  3EG3 A;  3VRY A;  1ABQ A;  1M3B A;  2JM8 A;  3UAT A;  2CRE A;  2EYX A;  4EIK A;  2GBQ A;  2V1Q A;  2C0T A;  2Q7S A;  2DBK A;  5IXF A;  2DX1 A;  1SSH A;  1LCK A;  2C0I A;  3CQT A;  2CT3 A;  1JO8 A;  1I07 A;  4J9F A;  1UUE A;  1ARK A;  4F16 A;  2DF6 A;  2PTK A;  2M0Y A;  2SEM A;  2EBP A;  3QAY A;  2KEA A;  2O9S A;  3NMZ C;  2LMJ A;  3FJ5 A;  4LQ6 A;  3GBQ A;  1ABO A;  1WDX A;  2SRC A;  2F2W A;  2YUQ A;  3TSZ A;  1HD3 A;  1SEM A;  4GLM A;  4RTU A;  1UHF A;  3VS5 A;  1GFC A;  2JTE A;  1G83 A;  2RQU A;  1T0H A;  4OMO A;  1UFF A;  4LUD A;  3M0T A;  4D8K A;  1W1F A;  2H8H A;  1CKB A;  2OAW A;  1S1N A;  1QCF A;  1RI9 A;  2BZX A;  2J6O A;  2RQR A;  2KXC A;  1QWE A;  2KRO A;  2CDT A;  2F2V A;  2J6F A;  2KBT A;  1B3Q A;  1QKW A;  2L3S A;  2EVR A;  1X6G A;  1PWT A;  5I11 A;  2O31 A;  2HSP A;  2EGA A;  2OJ2 A;  4F14 A;  1I0C A;  1BB9 A;  1Y57 A;  1GFD A;  2IIM A;  4Z89 A;  4WCI A;  5IXB A;  3U23 A;  2DRM A;  1G2B A;  3ZL7 C;  4J9D A;  1PRL C;  2CSI A;  2AKL A;  1MUZ A;  1N5Z A;  5EC7 A;  3R6N A;  1CKA A;  4CC2 A;  1A0N B;  4OMQ A;  2JT4 A;  5GJW B;  3UA6 A;  1VYU A;  2I0N A;  2DYB A;  3VRZ A;  1HJD A;  1X27 A;  1U06 A;  1U3O A;  3M0R A;  4OMM A;  1E7O A;  2LQW A;  1SHG A;  1UG1 A;  2FRY A;  2L3Q A;  3NGP A;  1OV3 A;  2ODF A;  1WIE A;  1FYN A;  1NLP C;  4OMP A;  3VS0 A;  3JV3 A;  4Z88 A;  2B86 A;  2RMO A;  2HCK A;  4F17 A;  2LZ6 B;  4FSS A;  4JJC A;  4KRT A;  2ED1 A;  1KSW A;  1GL5 A;  1OPK A;  1UHC A;  2GTO A;  2EW3 A;  1WYX A;  1WA7 A;  1T3L A;  2D8J A;  4HVW A;  2DL5 A;  1BU1 A;  2KRS A;  3SHW A;  2RQV A;  2DA9 A;  4CC4 B;  1ZLM A;  1Z9Z A;  1JEG A;  4J9C A;  2YUP A;  3PVQ A;  2LX7 A;  1ZUY A;  2RQW A;  1PRM C;  3QWX X;  2DM1 A;  1AWO A;  2JW4 A;  1E6H A;  1PKT A;  3A98 A;  1UE9 A;  2MIO A;  4LNP A;  4HCK A;  1BK2 A;  2ESW A;  2BZ8 A;  3VS6 A;  1CSK A;  2A37 A;  2JMA A;  1UJ0 A;  2RNA A;  4AFZ C;  2MCN A;  2GQI A;  2AKK A;  1PKS A;  4AG2 C;  1AWW A;  1NEG A;  3UA7 A;  2YSQ A;  2J6K A;  1YNZ A;  2K2M A;  2KYM A;  2W0Z A;  1VYV A;  2ED0 A;  2L3P A;  3H0H A;  1BBZ A;  3SEM A;  3M0P A;  3EGU A;  1YN8 A;  2EGE A;  2DL3 A;  5L23 A;  2W10 A;  3PE0 A;  2RF0 A;  1NYF A;  2CT4 A;  2KRN A;  1XOV A;  1SRM A;  2V1R A;  4J9E A;  4RUG A;  1M30 A;  2HEQ A;  1TG0 A;  2P4R A;  4RTY A;  2DNU A;  1QWF A;  1UEC A;  2O9V A;  2LJ1 A;  1PNJ A;  1YWP A;  1Z9Q A;  4JJD A;  1AVZ C;  5GJV B;  4GBQ A;  2EYZ A;  2CSQ A;  3VS4 A;  1JWQ A;  2A36 A;  1WLP B;  1GCP A;  1X6B A;  2O2O A;  3M0S A;  3UF4 A;  2DLP A;  1WFW A;  2O88 A;  4ORZ A;  3LH5 A;  4DEY A;  2RPN A;  2FG0 A;  1OOT A;  5IHK A;  1GBQ A;  1WXB A;  2A08 A;  2JS0 A;  1RUW A;  4HVV A;  4CC7 A;  2OI3 A;  1K0S A;  2KNB B;  2FRW A;  3H0I A;  1GCQ A;  2VVK A;  1K9A A;  2VKN A;  1VYT A;  2LNH B;  1IO6 A;  1GBR A;  2X3W D;  2ABL A;  1U5S A;  2KE9 A;  4A63 B;  1ZUU A;  1MV0 B;  4BIN A;  4JJB A;  2K6D A;  1Y0M A;  1H3H A;  2F2X A;  3KFV A;  2JS2 A;  2CH4 A;  1EFN A;  5IHI A;  3RBB B;  2DBM A;  2LP5 A;  1AZE A;  1NYG A;  1HSQ A;  1QLY A;  2DL7 A;  1UDL A;  5EMI A;  5FWB A;  2D0N A;  1OPL A;  2K3B A;  3O5Z A;  1K4U S;  4M6H A;  3REB B;  3TVT A;  3QWY A;  1QKX A;  2DL4 A;  2KR3 A;  2LQN A;  2ROT A;  4RTZ A;  2E5K A;  2FPD A;  4LUE A;  2DRK A;  2PZ1 A;  1KIK A;  4RTX A;  2K79 A;  1X69 A;  2RN8 A;  3NHN A;  2L2P A;  2XMF A;  3EHQ A;  3EHR A;  2MOX A;  2JMC A;  1WI7 A;  2C0O A;  3I5R A;  5HCK A;  3M0U A;  4ESR A;  3EG1 A;  2YUO A;  2YUN A;  4ZNX A;  2A28 A;  1NEB A;  1WXU A;  1WX6 A;  4AFQ C;  2K7A A;  3VS1 A;  1TUC A;  1M8M A;  3EG2 A;  2KGT A;  1K0X A;  1W70 A;  1GRI A;  2X3X D;  1B07 A;  1RLP C;  2J7I A;  4M6G A;  2RQT A;  4AG1 C;  2EPD A;  2EQI A;  3ULR B;  1T0J A;  2D8H A;  1W6X A;  4D8D A;  2FPF A;  4LE9 A;  3CZX A;  2G6F X;  2FPE A;  4J9I A;  3M0Q A;  1AZG B;  3RNJ A;  2DMO A;  1ZSG A;  5I22 A;  1SPK A;  2ENM A;  2KRM A;  3EG0 A;  4HVU A;  2GGR A;  2FO0 A;  2JXB A;  1MV3 A;  3I5S A;  3IQL A;  2J06 A;  3REA B;  4AFS C;  3TSW A;  1AWX A;  2JM9 A;  2LJ3 A;  3I35 A;  4Z8A A;  2K9G A;  2PNI A;  1AEY A;  1V1C A;  1K76 A;  1K1Z A;  4E6R A;  4M6I A;  2L0A A;  4IIO A;  4Y92 A;  1J3T A;  1SRL A;  1NM7 A;  2BTT A;  2DL8 A;  2DE0 X;  1I1J A;  4RTV A;  4HXJ A;  2BZY A;  4JZ3 A;  1NLO C;  1ZUK A;  1KJW A;  2LJ0 A;  4AFU C;  1TUD A;  1JXO A;  1JXM A;  2EYW A;  2AZS A;  2CUD A;  2HDA A;  1X2K A;  2EKH A;  2YT6 A;  1OEB A;  3PVL A;  2ECZ A;  2KYB A;  3H0F A;  2LCS A;  4LN2 A;  2KT1 A;  3VS7 A;  4RN7 A;  1UGV A;  1GCQ C;  3THK A;  2DVJ A;  4CC3 A;  4J9H A;  1AD5 A;  1FMK A;  1X43 A;  5FW9 A;  2M51 A;  3C0C A;  2GTJ A;  2KT8 A;  4RTW A;  1M3C A;  3I9Q A;  5ECA A;  1X2Q A;  4J9G A;  1M3A A;  1ZBJ A;  2EGC A;  3NE8 A;  2FEI A;  2CH4 W;  2ROL A;  1ZX6 A;  4J9B A;  2NWM A;  1AOJ A;  5IHN A;  2GNC A;  2AZV A;  4K11 A;  4DEX A;  2HBW A;  1H92 A;  1NG2 A;  1YWO A;  2AK5 A;  2NUZ A;  1UTI A;  2QDL A;  1VA7 A;  1WXT A;  1YCS B;  3H41 A;  4X1V A;  4JZ4 A;  4R0K A;  1YP5 A;  1PHT A;  1JU5 C;  1SHF A; 
#chains in the Genus database with same CATH topology
 2HBP A;  2B5G B;  4B14 A;  3GLJ A;  4PSW A;  2ZEM A;  2YNC A;  2QK0 A;  4FSX A;  4OC2 A;  1RLQ C;  4H89 A;  5C6S A;  2D1X A;  2Q4Y A;  5HH1 A;  2WYR A;  3AHU A;  1ACM B;  2YDL A;  2VGN A;  4M4Z A;  2GLJ A;  2CYZ B;  3T9Y A;  4KVM E;  4YU9 A;  3S9N A;  2YHT A;  4PJO F;  1Q7Y R;  1HDU A;  1U1S A;  3MJX A;  3KQX A;  1M3B A;  2ZPI B;  1WJR A;  4J7F A;  4XU3 A;  1NSL A;  4IHM A;  3UAT A;  5C0M A;  2CRE A;  2Z3M A;  2V1Q A;  4ATO A;  2NMT A;  2NYQ A;  1IOI A;  2Q7S A;  2ZEL A;  2DX1 A;  4KGX B;  5LJ3 f;  3N5B B;  2I2L A;  1JO8 A;  1Y7X A;  2ZOG A;  4ZN1 A;  4HT8 A;  4J9F A;  2XDP A;  5GAN h;  2VZZ A;  3CME Q;  2H5M A;  4F16 A;  3V8I A;  3CCS A;  1KD1 C;  2DF6 A;  3CPW S;  1Y7E A;  1VHS A;  3OWC A;  2D9T A;  4MML A;  1M4D A;  2O9S A;  3GBQ A;  2OTL A;  1WHL A;  4IUP A;  1AUG A;  3VUZ A;  1GYT A;  4JLI A;  4C8Q E;  1WDX A;  2YUQ A;  3G6E A;  1S3Z A;  1VQL Q;  4GLM A;  1M4I A;  2ZEG A;  1MMN A;  3OSV A;  4OC0 A;  4JXQ A;  1VQP Q;  4RMO A;  1WWZ A;  4II1 A;  5GAN g;  4LUD A;  5DM7 R;  2P0P A;  2NUT A;  1S5K A;  3IGR A;  2LT1 A;  4N4H A;  1RL2 A;  1Q82 U;  1VQN Q;  3OB9 A;  2EBJ A;  1RI9 A;  5F48 A;  3NH4 A;  2LTO A;  1QWE A;  2KRO A;  2CDT A;  3QZ9 B;  3X28 B;  4XK8 E;  4R56 A;  4W9Y A;  1B3Q A;  1Y96 A;  4QVT A;  3E2U A;  1QKW A;  2EIF A;  2L3S A;  4JDS A;  4EMK A;  5IT9 E;  3FDR A;  2O31 A;  2V77 A;  4C8Q A;  2JUF A;  5LJ5 e;  1YK3 A;  1I0C A;  2R7H A;  3MKD A;  1XJO A;  3CMA T;  3KAS A;  4IK2 A;  4A33 A;  5KH6 A;  4KSI A;  1VQM A;  5L8R E;  4WCI A;  5IXB A;  3U23 A;  3CPW A;  1YIT Q;  2X4X A;  4M3S A;  4P45 A;  2AKL A;  3TO7 A;  3R95 A;  2ARH A;  3JVN A;  4OB3 B;  2PQW A;  5GAN 4;  2FE7 A;  2LC4 A;  3L1A A;  4OMQ A;  2ZXV A;  3R96 A;  3CCQ T;  4MI4 A;  1Q81 C;  2DYB A;  3HRT A;  1VIF A;  2P84 A;  2QYZ A;  2G3T A;  2K5F A;  3RNZ A;  2PJB A;  3EGX B;  1U06 A;  2IVW A;  1YW6 A;  4ZBG A;  2RM4 A;  4M78 E;  2QDY B;  3G4S A;  1BAV A;  3TEE A;  4PJL A;  4TVR A;  3D2P A;  1M2V B;  3CPA A;  4J6Y A;  2NUP A;  2BUE A;  1B6B A;  1QVG S;  2ODF A;  4E2A A;  1WIE A;  1XEB A;  1NE9 A;  2RHU A;  1PG5 B;  4DBQ A;  4OMP A;  4A4F A;  4N0A C;  2RMO A;  3F70 A;  4F17 A;  3V7R A;  2LZ6 B;  4FSS A;  1YIJ A;  3S6G A;  2XHC A;  1HXD A;  4JJC A;  2PJ9 A;  3NH8 A;  3PTA A;  2JDC A;  3G7Z A;  4J5Y A;  3CCL A;  2DXC A;  4C2Y A;  4OKO A;  4C92 D;  4M78 A;  4KOT A;  2KRS A;  1MMD A;  1OZP A;  2DA9 A;  4AT1 B;  2G9D A;  1Z9Z A;  4FD6 A;  1VQ5 T;  1JEG A;  4ZY2 A;  1WPY A;  5GMK h;  2B4D A;  2PVD B;  1MNE A;  2RD1 A;  3SJX A;  2ZPF B;  1ZBX A;  1YJ9 A;  2CKK A;  1TOV A;  3KZW A;  1I81 A;  4UEF A;  4JRI A;  1M1K U;  1RO5 A;  5AG7 A;  2EWB A;  2AFW A;  4KS9 A;  1PD0 A;  4WTO B;  4YRH A;  1NSA A;  2JLM A;  2LQK A;  1OU8 A;  3S6F A;  3PIO A;  4A39 A;  3CC2 T;  1PKT A;  4Y49 B;  2E70 A;  4OIW A;  3EG9 A;  4A94 A;  1UE9 A;  2MIO A;  2ESW A;  1QVG A;  1UB4 A;  2HNI A;  4CPA A;  4K3N A;  1D09 B;  2J8N A;  2Q51 A;  3CCM T;  4P4B A;  4ZGJ B;  1NEG A;  2V8K A;  4OAD A;  1K9M C;  4KGZ B;  2HD0 A;  1YNZ A;  2L8D A;  1VQ4 A;  2ZOF A;  4G1P A;  2LNV A;  2KMT A;  2EWN A;  4GS4 A;  3H0H A;  4OP0 A;  2VXE A;  3EGU A;  3RR6 A;  5LJ5 f;  1YN8 A;  4PK3 A;  2PRQ A;  4C5G A;  2GF7 A;  4DUK A;  4NCZ A;  2RHI A;  2RF0 A;  4M75 C;  1VIX A;  1Z8W A;  2CT4 A;  5A27 A;  2ABZ A;  1SRM A;  1N8R U;  1F2O A;  1TF8 A;  5FU6 C;  2ZGW A;  2P0K A;  4A31 A;  4UWJ A;  3PIP A;  3DLL A;  1YLO A;  2OZU A;  2P4R A;  3PB9 X;  3L2U A;  1D1B A;  3G1J A;  1OZ3 A;  1UEC A;  2F5K A;  1YJN T;  1KUV A;  3W91 A;  3RKW A;  2FZK B;  1QP2 A;  2LJ1 A;  3TX8 A;  1SKU B;  1OYX A;  3I56 A;  2BOA A;  2YLC A;  3OS5 A;  4PFO A;  3QDR B;  3VS4 A;  4KLV A;  3SJE A;  4ZTF A;  1VQK A;  1VQ6 T;  5LJ3 j;  4E7J A;  2QA4 T;  1NE8 A;  2FZC B;  2ZPG B;  3UT1 A;  4BY6 C;  3CCV T;  1Z4E A;  2V8I A;  2YGW A;  2CGH A;  2PC1 A;  4IF5 A;  2AFZ A;  4ANJ A;  1X6B A;  4CAV A;  2NUT B;  2CP3 A;  3CCQ Q;  1M8V A;  2EYQ A;  1IB1 E;  4KOU A;  1WFW A;  3LH5 A;  5CVI A;  3BJ7 A;  2RPN A;  2FG0 A;  4DOV A;  2L3R A;  4M75 G;  3JCM J;  1WXB A;  4CRZ B;  3BJ8 A;  3OMC A;  1YI2 Q;  2PRB A;  2QQS A;  4E7L A;  4MCP A;  4HVV A;  2NYS A;  2OI3 A;  5IV0 A;  1Y96 B;  4PJO G;  2K2V A;  3A1P A;  1IRE B;  4NSQ A;  4EMK B;  4RI1 A;  2ZW7 A;  3VYH B;  2PJ5 A;  4C8Q B;  1VYT A;  2LNH B;  2PR1 A;  1IO6 A;  2PU9 B;  2DPP B;  2PJ1 A;  3G71 T;  5FRO A;  4BIN A;  2IL4 A;  2GQV A;  2K6D A;  1Y0M A;  4LXC A;  1RXT A;  4CGN A;  2XI9 A;  2WAC A;  1EFN A;  1LAP A;  3RBB B;  3C26 A;  3FLG A;  2G0B A;  3OYC A;  1A2Z A;  5AT1 B;  3WXM B;  1XQH A;  1HK9 A;  4A38 A;  4R3K A;  2LDM A;  1YFN A;  1KC8 U;  4E7K A;  4CRY B;  4M6H A;  3REB B;  1CJW A;  3TVT A;  3QWY A;  2PCU A;  4II9 A;  1QKX A;  2KR3 A;  4FYX B;  1VQ5 Q;  3BXM A;  4RTZ A;  4KOY A;  5LYL A;  2YRV A;  4C92 E;  3ZJ0 A;  2HKQ B;  2PZ1 A;  2EVN A;  1RAH B;  4RTX A;  3FYN A;  1X69 A;  4TWE A;  4NL2 A;  4CGL A;  1QVP A;  2XMF A;  2NUP B;  2R98 A;  2MOX A;  1WI7 A;  2C0O A;  2JMC A;  2DER A;  4DA4 A;  3WR7 A;  3CC2 Q;  1ZLH A;  5CKB A;  2YUN A;  2Z3L A;  4IAV A;  4FL6 A;  2QXF A;  3ER0 A;  4X9D A;  1WXU A;  4M7D D;  1WX6 A;  3L2N A;  1PU9 A;  1TUC A;  1HDQ A;  1YJW A;  1M8M A;  3EG2 A;  3CCM Q;  5CKE A;  1GRI A;  2X3X D;  1RLP C;  2J7I A;  3LGF A;  4UEE A;  4CYN A;  4M6G A;  1OQK A;  2RQT A;  4C92 A;  4M78 B;  2OB0 A;  2EPD A;  3M4Y A;  2DYI A;  2O4X A;  2ATR A;  2KVQ G;  4FCY A;  4PKC C;  1O75 A;  2FVU A;  1W2B P;  1QSO A;  2B4D B;  5AGE A;  3P2F A;  3MCA B;  3L2W A;  2DFU A;  4DOW A;  4XTX A;  2VB6 A;  4J9I A;  3LX7 A;  1AZG B;  2QTV A;  1K8A U;  4M7A C;  1G3Y A;  2DMO A;  2Q0Y A;  1M1D A;  2D4P A;  2M16 A;  2ZPH B;  4M77 D;  4R3L A;  3EG9 B;  4HNY B;  4HVU A;  1KUX A;  2CP6 A;  3LGL A;  2CNT A;  2PJC A;  1VQO A;  3I5S A;  5D8N A;  3VAR A;  3SB2 A;  1YJN Q;  5CNP A;  1PCX A;  2QAS A;  1YSJ A;  3GLX A;  1LOK A;  1K1Z A;  3X20 B;  4E6R A;  2E5Q A;  2L0A A;  4IIO A;  5CKF A;  4FT4 A;  1SRL A;  3IU1 A;  1NM7 A;  1RAD B;  5GCN A;  3B8G A;  2QA4 Q;  3CXQ A;  3CCV Q;  4HXJ A;  2BZY A;  1CBX A;  1MHN A;  3P8D A;  2K3X A;  1RAC B;  4ZYQ A;  2PJA A;  3CPX A;  4MFJ A;  3FIF A;  2QEC A;  3TU4 K;  2O53 A;  2R5A A;  4OC3 A;  3B2Y A;  4H6U A;  5G21 A;  1JXM A;  2EYW A;  3EFO A;  3PRT A;  2HDA A;  1VKC A;  4B5O A;  1Q7Y U;  4FWU A;  1OEB A;  3PVL A;  4JS4 A;  3FRN A;  3D3S A;  1XFO A;  1ARM A;  3RKX A;  2YXY A;  1L0C A;  4LDW A;  2FVG A;  2V8V A;  3THK A;  3X24 B;  4BI4 A;  1I12 A;  1FMK A;  3C0C A;  2FYK A;  4AVA A;  3QG1 A;  2GTJ A;  1QQJ A;  3RZA A;  2KT8 A;  2COW A;  4JJN K;  1M3C A;  1R0C B;  2HQH A;  3H8E A;  3NE8 A;  3D7S B;  2DVE A;  3OYN A;  1RAB B;  5ELY A;  4J9B A;  2QEX T;  2GNC A;  2E12 A;  3NE7 A;  2RJE A;  1O9S A;  4DEX A;  2C1C A;  2HBW A;  1BYM A;  2V8J A;  3QHS A;  1H92 A;  1MK4 A;  1NG2 A;  1YVK A;  1SSF A;  2EKO A;  3JB9 F;  1IOF A;  4RG8 A;  1YP5 A;  5I21 A;  3NPF A;  2JTM A;  3MHX A;  4KUI A;  2MI6 A;  1JU5 C;  3RO0 A;  2A0F B;  1E6G A;  1KFZ A;  4EDU A;  1K73 U;  1JQQ A;  4B6Z A;  1LJO A;  1M27 C;  3MP1 A;  3H8G A;  1KHC A;  4A2Z A;  1TTH B;  5D7U A;  4NXY A;  2MPX C;  1QW1 A;  1UJY A;  3PBB A;  3R9F A;  1H8K A;  3FRM A;  4JLG A;  3QKJ A;  5CIU A;  1RAF B;  5GMK m;  4L89 A;  1S60 A;  4DJL A;  3HL8 A;  4IUU A;  1Q2C A;  2J05 A;  2DIL A;  4M7D E;  2JEV A;  3VH9 A;  1M1K C;  2DJQ A;  4Z02 A;  2EJ9 A;  1ABQ A;  2WPX A;  2XG8 D;  3EFS A;  3WC7 A;  2JM8 A;  4E7S A;  2LCC A;  2Z11 A;  3FB9 A;  4EIK A;  3CC4 T;  2QGG A;  4LQG A;  4NFR A;  4BMH A;  2DBK A;  1BKB A;  1M90 R;  2QVP A;  1WK4 A;  3D7F A;  3CQT A;  3LWI A;  1I07 A;  2Y4X A;  5A0G A;  1IGU A;  4ZGY B;  5LJ3 h;  2PTK A;  2VEZ A;  1I5O B;  2SEM A;  4QKU A;  1X12 A;  5DWN A;  2VUB A;  3FJ5 A;  4M7D A;  3S6K A;  2WSC E;  3TQ7 P;  3QPH A;  3CME A;  7CPA A;  5D6X A;  3TSZ A;  3TRE A;  1TXQ A;  1WHG A;  2F2W A;  3DB4 A;  4LDV A;  4PJM A;  4JRQ A;  1B34 A;  1UHF A;  3VS5 A;  1GFC A;  4UFW A;  1G83 A;  4M77 C;  2PQ8 A;  3CXP A;  4OMO A;  7AT1 B;  1UFF A;  1W2B S;  2Q7B A;  4D8K A;  1TSF A;  3LOD A;  1W1F A;  2H8H A;  5LJ3 g;  1N8R C;  2F5I A;  4PK2 A;  1VQL A;  4D6W A;  4E8O A;  3CCE A;  1CKB A;  4F8Z A;  2Z0Z A;  2EQM A;  1NZ9 A;  1VQP A;  2J6O A;  3OYY A;  1ON0 A;  2KXC A;  4R76 A;  1FMW A;  3LWU A;  2F2V A;  1M1F A;  2J6F A;  5CQY A;  1VQN A;  1XBU A;  3JCM b;  1X6G A;  2COZ A;  5KYY A;  1YHQ Q;  1PWT A;  1MMG A;  1UGP B;  4AG9 A;  1VQ7 Q;  2EGA A;  4MMK A;  2AFO A;  4QBJ A;  2OJ2 A;  4F14 A;  2MWO A;  4NGR A;  3QYH B;  4M78 F;  4ELY C;  5AG6 A;  2IIM A;  5I0C A;  4FU6 A;  3EXN A;  3OSS C;  2FT0 A;  1ARL A;  2OTJ T;  1SQH A;  1YR0 A;  2CSI A;  1N5Z A;  2F7V A;  4UIB A;  1CKA A;  4LDX A;  4PK4 A;  3DB3 A;  2C06 A;  2F8H A;  5CK9 A;  1A0N B;  5K8M A;  4X3R A;  3JB9 J;  3MEA A;  5GJW B;  4DQ2 A;  2I00 A;  1YIT A;  3RBU A;  2AFU A;  4P4J A;  2YWW A;  3V7C A;  3VRZ A;  4KSA A;  4A32 A;  5IB0 A;  4AB7 A;  1X27 A;  4KSF A;  4CYP A;  1W2B A;  5JH9 A;  5AG4 A;  2RHY A;  2QEX Q;  3CCU T;  4OMM A;  1E7O A;  1S7F A;  2FL7 A;  3B3W A;  3IWE A;  3R6O A;  2XEF A;  3QBY A;  1SHG A;  3EC4 A;  2FRY A;  4RKU E;  2MF2 A;  1OV3 A;  4UWI A;  1NLP C;  2KDS A;  4Y49 C;  3VS0 A;  2P6G A;  3QB8 A;  4XPD B;  1KQS P;  1KUY A;  4FT2 A;  4BAC A;  3FEO A;  4E47 A;  2MYS A;  2DZC A;  1GL5 A;  4DBH A;  3MET A;  1ZO0 A;  2E10 A;  2GTO A;  1WYX A;  2D8J A;  2MK5 A;  2XKO C;  2DL5 A;  3QJ6 A;  5GAM d;  4BDY A;  3SHW A;  3OBY A;  3SJG A;  3H6Z A;  1PM3 A;  2K57 A;  4MDW A;  4EMG A;  3K2K A;  4C68 A;  4XTZ A;  3RAM A;  3OYJ A;  3PFE A;  1ZUY A;  1R57 A;  2QML A;  3CC4 Q;  4OB0 B;  4L8A A;  3RKY A;  3PB7 X;  1NBE B;  1AWO A;  1P0H A;  5K8N A;  3O8V A;  3C4S A;  2I79 A;  3A98 A;  5GAO l;  1UGR B;  5DY9 A;  4LDY A;  2J8M A;  4JS5 A;  4HCK A;  3W6S A;  1CSK A;  3HLP A;  1Q81 R;  4AFZ C;  2KQW A;  2MCN A;  3A8L B;  3DSB A;  1FNO A;  4AG2 C;  1AWW A;  1F2P A;  4KOS A;  4XTV A;  4EWT A;  4LD6 A;  4OB1 B;  1RAI B;  2O01 E;  1F1B B;  1TUG B;  1DE4 C;  1Z5R A;  3TO6 A;  2P0Q A;  1V29 B;  3JUW A;  2ED0 A;  4M75 D;  5HVF A;  1YW4 A;  4XPL A;  1QVF P;  3SEM A;  2V8H A;  2OOT A;  1UEB A;  3FXT A;  2M02 A;  2AIR B;  4PJO D;  3PB6 X;  3EFR A;  2M1H A;  5L23 A;  3PE0 A;  1IU8 A;  3R1K A;  4OME A;  4B9W A;  3G6E T;  1Y0R A;  3M57 A;  3ME9 A;  4XU1 A;  2DIG A;  2KRN A;  5LJ5 h;  2R1I A;  2XEI A;  3IU2 A;  3OW2 P;  4O23 A;  3KL9 A;  2HEQ A;  3KR5 A;  4R9M A;  3BI1 A;  2HAX A;  3JCM V;  1QSR A;  4EMK C;  4N4I A;  2O9V A;  2Q4V A;  4M85 A;  4C8Q C;  1S72 A;  4CGM A;  1YWP A;  1Z9Q A;  4JJD A;  5GJV B;  4JUV A;  3GUX A;  1TWB A;  4GM5 A;  2EYZ A;  2CSQ A;  2DTO A;  2QQR A;  4CAE A;  2OTJ Q;  2CZ6 B;  1Q86 U;  2D6F A;  1B34 B;  4KLW A;  3JB9 G;  1X10 A;  1IZ6 A;  1R8O B;  2A36 A;  3D7D A;  3H8F A;  1WLP B;  5LJ5 g;  2XEJ A;  3CMA A;  4CYQ A;  5J26 A;  1HEE A;  1NJI C;  4PXC A;  1TH7 A;  2O2O A;  3D4U A;  4X5K A;  3M0S A;  3EO4 A;  4FAI A;  3I55 T;  4XU0 A;  4MY3 A;  2O88 A;  1M4L A;  4ORZ A;  4DEY A;  4AVB A;  1CG2 A;  5IHK A;  3CCR Q;  1CPS A;  4PPZ A;  5FRM A;  3ISX A;  2HB6 A;  2BKD N;  2A08 A;  3CCU Q;  2POK A;  3CCQ A;  1YI2 T;  4FYY B;  3KXT A;  3WC6 A;  4U9Z A;  2LQ8 A;  2FRW A;  2PVW A;  3B3S A;  4C2Z A;  5KYY B;  5GAN 8;  3VUB A;  1K9M R;  1GCQ A;  2VVK A;  2ZPE B;  5I2S A;  1TKH A;  1ZA1 B;  3IEH A;  4OID A;  3OYM A;  4BD3 A;  1GBR A;  4C92 F;  2X3W D;  3MEU A;  3V8L A;  2ABL A;  1U5S A;  4C8Q G;  5BWA B;  4EMH A;  1EZZ B;  5LYD A;  1VQ8 A;  3D7G A;  4GXH A;  4MFP A;  3BDL A;  1WZO A;  1M44 A;  1FY7 A;  2RJF A;  2P6F A;  2LP5 A;  4HCC A;  1PYT B;  5KE3 A;  1U1T A;  4HNW B;  4F0X A;  1HSQ A;  3FB3 A;  4OMF B;  5FWB A;  3JSC A;  2BL1 A;  3JRU A;  4XPK A;  2QJ8 A;  2HSE B;  1YIJ T;  2LQN A;  3SI1 A;  1NPR A;  1YRE A;  2E3H A;  5FRN A;  3CXC S;  3HTR A;  3QSU A;  2E5K A;  3KHZ A;  1K73 C;  3JCM d;  4N0A A;  3KBG A;  4MHD A;  2DJZ A;  2RN8 A;  3M5A A;  3JAM E;  3CCL T;  5GAN 6;  4C2X A;  2COY A;  3EHQ A;  1KHI A;  3EHR A;  3RDV A;  1GHE A;  2X35 A;  1VQ5 A;  3H9N A;  5HK0 A;  3G3S A;  2MAM A;  3IC1 A;  3I5R A;  1KQS S;  3HP9 A;  4Q38 A;  3SWN B;  1YX0 A;  3EG1 A;  1Z4R A;  1G3S A;  2J8R A;  2YND A;  2YUO A;  4ZNX A;  2A28 A;  2CTC A;  2K5T A;  2NSM A;  4C7I A;  5GAM e;  5ISV A;  5LRJ A;  3VS1 A;  4ZGE B;  3PFS A;  4BBH A;  4KUL A;  2KGT A;  4UF4 A;  3BDU A;  3CC2 A;  5J8C A;  2X9H A;  4QVC A;  3PFO A;  2LX9 A;  3A8H B;  4MMO A;  1V0C A;  4UBR A;  4M7A D;  4X34 A;  4M78 G;  3CCS Q;  2EQI A;  3ULR B;  3CCM A;  3PEI A;  3LH0 A;  2D8H A;  5A2Q E;  2DPT A;  3HFN A;  2FPF A;  4NGM A;  4LE9 A;  2GE3 A;  3CZX A;  4M75 E;  1VHE A;  3V7S A;  4F7U E;  2EK8 A;  1H64 1;  3M0Q A;  1BO4 A;  3BHX A;  4C0Z A;  3CXC A;  3G6E Q;  4HKF A;  1IGB A;  5CQX A;  2HQE A;  5KYN A;  1ZSG A;  3JCM X;  2VQY A;  1AHJ B;  1KG1 A;  2RI3 A;  2DD4 A;  4RUH A;  2JXB A;  4DBF A;  4ZI6 A;  5J1Q A;  4PJO C;  1MV3 A;  3GKR A;  2RH2 A;  3TSW A;  1KQS A;  4MCS A;  1JBM A;  4JLY A;  5GAO q;  3VYG A;  2PNI A;  2RHZ A;  1XNI A;  1AEY A;  5KCH A;  4RCB A;  5THW A;  1WJS A;  1LFW A;  2QAZ A;  4BUG A;  3BW1 A;  1QVF S;  1YJN A;  4MRI A;  1I8F A;  2BTT A;  5H84 A;  4M75 A;  4F7U A;  3PBE A;  2DL8 A;  4FYV B;  1I1J A;  4RTV A;  1ZUK A;  1Z8X A;  2R57 A;  1IYL A;  3MRU A;  1ZSZ C;  3IO1 A;  1K4J A;  3OYB A;  3I55 Q;  1VQ6 A;  3I56 T;  5DLO A;  1YME A;  2Z3P A;  2QA4 A;  1UWY A;  2QQA A;  3CCV A;  2AZS A;  1OUL A;  3FH4 A;  3PGP A;  2G3A A;  2RC4 A;  2YT6 A;  1G5V A;  2RK1 A;  2E4H A;  2ECZ A;  4MFZ A;  3CCJ T;  2Q04 A;  2LCS A;  2AJ6 A;  3E0K A;  5G22 A;  2KT1 A;  3ASK A;  2K5I A;  3NTK A;  3A9L A;  2ZEH A;  4CC3 A;  4PNO A;  1M90 U;  2AFM A;  1ZG9 A;  3PZJ A;  2M51 A;  3I1U A;  1YCY A;  2A3L A;  2KSS A;  5M9O A;  1FMV A;  1G3T A;  4PFP A;  1OX9 A;  5IAY A;  4OGC A;  3BI0 A;  3E9G A;  4OC5 A;  2OAU A;  1BI2 A;  4J9G A;  1X2Q A;  1MJ9 A;  1M3A A;  2LRQ A;  1Q2D A;  3CPF A;  3G71 A;  5I4M A;  2QIR A;  1ZX6 A;  2PUK B;  3X26 B;  1QVF A;  3T90 A;  4KUA A;  2VYT A;  4QW2 A;  1LCP A;  4UFX A;  5J8F A;  5CKD A;  3SI2 A;  5CBM A;  5F46 A;  2PJ7 A;  1YIJ Q;  2B8A A;  2PR8 A;  5GAM f;  4M7D F;  2NUZ A;  1YWO A;  1R43 A;  2FXF A;  1VA7 A;  1WXT A;  3EH2 A;  2XIC A;  4JZ4 A;  4MZP A;  3UPU A;  1CPX A;  4H6Z A;  1PHT A;  3OYG A;  4QT7 A;  2AT1 B;  1SHF A;  3J81 E;  3CCL Q;  1KQ2 A;  1Q82 R;  3SI0 A;  3RYO A;  3VS3 A;  4I49 A;  2VWF A;  1T3S A;  4OMN A;  2D0Q B;  2GRE A;  1WHJ A;  3GP8 A;  1FT7 A;  3JB9 I;  2XDB A;  2E41 A;  2K3Y A;  3JCM h;  1XE4 A;  4OML A;  4XTY A;  1RI0 A;  4QUS A;  9ATC B;  3I3G A;  1VQ9 T;  5K8O A;  2EYY A;  3OYI A;  2HUZ A;  4JPB W;  4YTL A;  2R5M A;  3VRY A;  4MJ8 A;  3QJY A;  3JCM e;  2WSA A;  1IRX A;  1G3W A;  4E7H A;  4MCR A;  5IXF A;  1N9R A;  1LCK A;  2QI2 A;  4OB2 B;  4M7A E;  5I2M A;  3ZFJ A;  4JZ0 A;  3JRZ A;  4CAF A;  1YGH A;  2K5L A;  3CEY A;  2B3U A;  4C5H A;  1QST A;  4ZY0 A;  2OZG A;  3FNC A;  1D0X A;  4MHP A;  2RI5 A;  5J39 A;  2EBP A;  2ZPB B;  2C6G A;  3QAY A;  4CS0 B;  2KEA A;  4F04 B;  4JRP A;  1KD1 U;  3NMZ C;  1F57 A;  1ABO A;  5DLQ E;  1Z8L A;  2SRC A;  4P4D A;  4FM4 B;  4RCC A;  4J83 A;  4RTU A;  1ZG7 A;  2ZEO A;  2JTE A;  4RG2 A;  2J9A A;  2RQU A;  1M2O A;  4PXB A;  3TFY A;  4PLL A;  5KE2 A;  2ZEN A;  3A8O B;  1Q82 C;  1Q7L A;  3B7I A;  3M0T A;  5GMK i;  2ZW5 A;  4M7A A;  3GPL A;  2PJ3 A;  5FLX E;  1Q2Y A;  2PJ8 A;  2HC9 A;  2OAW A;  2VXF A;  4B10 A;  1QCF A;  2BZX A;  3F0A A;  2PSW A;  3MEV A;  1IXD A;  4MFQ A;  4MFK A;  3I56 Q;  5HKC A;  3FJP A;  3GNF B;  3TE4 A;  2PJ2 A;  2EVR A;  4E7Z A;  3IIB A;  4IKF A;  1YBY A;  2OZH A;  2ZZD A;  1VUB A;  2QQ9 A;  2PIY A;  1YHQ T;  1Z9U A;  3CCJ Q;  2JNG A;  1Q86 C;  3QDF A;  1VQ7 T;  5KCO A;  5GAN j;  1M1K R;  3GF5 A;  1GFD A;  3SDZ A;  5GAO p;  4L5G A;  4PV6 A;  3ZZI A;  5AYF A;  4J9D A;  1MUZ A;  5EC7 A;  3FVL A;  3M9Q A;  3R6N A;  2FCK A;  4H2K A;  3QUI A;  2JT4 A;  1ZG8 A;  2PE3 A;  8CPA A;  5D29 A;  4F7U B;  1VYU A;  5FU7 B;  2I0N A;  3L42 A;  4MCQ A;  4FIB A;  1HJD A;  3VV0 A;  3H8Z A;  1C0M A;  5FU6 B;  2C6C A;  2X4W A;  1Z2L A;  2E3I A;  1BIB A;  4UCP A;  3GY9 A;  1U3O A;  3R9E A;  4MXU A;  4OC1 A;  1WNL A;  1TKF A;  1FWZ A;  1XF8 A;  2V26 A;  1V76 A;  3MEW A;  5C82 A;  2Q43 A;  2OH1 A;  1Y7R A;  3OBW A;  3NGP A;  3RMS A;  2DF5 A;  4PSX A;  1FYN A;  4NL3 A;  3M56 A;  1N71 A;  3JV3 A;  3JCM f;  3CC7 T;  2P6E A;  4UC4 A;  3RER A;  3HPW A;  2DXQ A;  4KRT A;  1YVO A;  4R87 A;  1N8R R;  2P4T A;  3V8J A;  1KSW A;  1OPK A;  1X01 A;  2VGM A;  3M55 A;  4P4I A;  3HUV A;  2M9U A;  1G8X A;  2EW3 A;  4HVW A;  3JCM c;  1VHO A;  4J6X A;  2RI2 A;  1MJB A;  1VQ9 Q;  3UY5 A;  2VV5 A;  1BU1 A;  1DJ7 B;  2YLB A;  3D7H A;  2RQV A;  3C12 A;  3FX6 A;  2GAN A;  2PUO B;  2LX7 A;  3DR6 A;  5DS0 A;  1ELM P;  4B11 A;  3IFE A;  2RQW A;  1QMU A;  1M5Q 1;  3QWX X;  2YNE A;  5KTC A;  4JXR A;  2PVG B;  4EPC A;  1WHH A;  2VC8 A;  4B5P A;  4C0D B;  4OF1 A;  2X4Y A;  3CC4 A;  4OP4 A;  4FW1 A;  2EQU A;  4LNP A;  2B4B A;  2RFH A;  2JMA A;  4E0A A;  1D0Z A;  1UJ0 A;  2RNA A;  3GB0 A;  3D2M A;  2RO0 A;  2AKK A;  1LAN A;  2DAQ A;  5GAM j;  3HHT B;  2J6K A;  3JCM Q;  1LRZ A;  4M77 E;  5GAN d;  2O4H A;  3QAH A;  1VYV A;  1K9M U;  4C7H A;  2L3P A;  4E2F B;  1BI0 A;  4J7I A;  3NFZ A;  4PLI A;  4NGT A;  5LYF A;  3M0P A;  2CS7 A;  3A5Z B;  2MMP A;  2YRC A;  2EGE A;  4C92 B;  5DWM A;  1XTD A;  1VQO Q;  4C5I A;  4BB7 A;  2CNM A;  4CAX A;  2O4X B;  1NYF A;  4MDX A;  2CXA A;  3BLN A;  5FVJ A;  2HQY A;  4L6V 5;  2H3E B;  4C8Q D;  1XOV A;  4RUG A;  2BO9 A;  1M30 A;  4NGQ A;  2HL5 C;  4Y91 A;  1TG0 A;  2BIV A;  2Q44 A;  3B3T A;  3TT2 A;  2FB7 A;  4QQG A;  1PC0 A;  4EFD A;  5JPH A;  4RS2 A;  4M77 A;  1C1A A;  1ELL P;  1PNJ A;  2RK2 A;  4R6T A;  1Z8T A;  3V7Z A;  1AVZ C;  1Y71 A;  2Y4Y A;  3V8K A;  3H5Z A;  4GBQ A;  1RAE B;  2CY2 A;  3E9F A;  5HK3 A;  2VL1 A;  4A4H A;  4LUA A;  4HNX B;  1EIF A;  1ZLI A;  1N6A A;  1M1G A;  2DXB A;  3EGX A;  1R0B G;  3TC8 A;  4ZY1 A;  2DEA A;  4M7A B;  2B58 A;  2PJ6 A;  3UF4 A;  1Q95 G;  2OTJ A;  2PJ4 A;  3LLR A;  4HPS A;  4CAW A;  4F6A A;  2DLP A;  4MFL A;  1WJQ A;  5GAN 7;  1TKJ A;  1W4S A;  2HMA A;  3OYL A;  1OOT A;  3CXS A;  2JVV A;  2GFA A;  3CCR T;  2JS0 A;  4F9V A;  1QQ9 A;  1K0S A;  4PQA A;  2AFS A;  3BE3 A;  3FIX A;  2C27 A;  3EFO B;  3BY7 A;  2VKN A;  2ZW6 A;  3NFC A;  2IJZ A;  2E6N A;  3CCU A;  5A0L A;  3A8M B;  4U5Y A;  1ZUU A;  3IWG A;  3PMT A;  3H4Q A;  3SWN C;  4FD4 A;  3CC7 Q;  1HYO A;  3JTK A;  1WGS A;  1H3H A;  1UFH A;  2F2X A;  3KFV A;  3QII A;  4J6W A;  2VBQ A;  4KVO E;  3QO3 A;  2JOY A;  1H3Z A;  2DBM A;  4M78 D;  3QZ5 B;  1AZE A;  2QYV A;  3CD6 T;  4EME A;  1KC8 C;  4UCM A;  2YNC C;  1QLY A;  2DL7 A;  1UDL A;  5EMI A;  2V8G A;  2ZW4 A;  2E64 A;  3EGD A;  3PNW C;  2LT4 A;  2LCL A;  1OPL A;  4FYW B;  3O5Z A;  3Q1J A;  1K4U S;  2HV2 A;  4QC6 A;  3WVE B;  1MJA A;  2DL4 A;  1TS9 A;  3AT1 B;  4AXV A;  1D0Y A;  3B35 A;  2FPD A;  2DO3 A;  2DRK A;  4HCZ A;  1KIK A;  3D68 A;  2CF4 A;  2K79 A;  1S7K A;  2ZED A;  3PB4 X;  4NF1 A;  2L2P A;  5HMN A;  3SXN A;  5F09 A;  1MGQ A;  4KH1 B;  1NMT A;  5HCK A;  3M0U A;  4M75 F;  4F7U F;  2CZ0 B;  2BCO A;  5E96 A;  5LRG A;  4ZN3 A;  1OU9 A;  1NJI R;  2K7A A;  2XK0 A;  3VWD A;  3EFA A;  3NH5 A;  4KVX A;  4XU2 A;  3OQ5 A;  1WHK A;  1B07 A;  8AT1 B;  3WT4 A;  1IYK A;  3A8G B;  2D4O A;  3NTH A;  4IUS A;  1OX8 A;  5CCA A;  1T0J A;  2JEW A;  3CCS T;  1W6X A;  5A0D A;  1Y9W A;  1ZA2 B;  5HY6 A;  1K8A C;  4JWP A;  5KYX A;  2CNS A;  3CBP A;  2OTL T;  2HZY A;  3JCM W;  3RNJ A;  4KOR A;  4PL6 A;  4KOX A;  4ZGD B;  2ENM A;  4B5P B;  3RIR A;  4R57 A;  2JJ9 A;  4BD9 A;  4NS5 A;  2GGR A;  5GAN 3;  4NJR A;  5KYW A;  4FD5 A;  3REA B;  5GAN e;  3T9N A;  1MMA A;  4A54 A;  4AFS C;  4LD9 K;  1AWX A;  3OYK A;  3TOA A;  2FL4 A;  3CCE Q;  1DTD A;  3CT9 A;  1V1C A;  4HKE A;  4M7D B;  4M6I A;  2ZEF A;  4Y92 A;  1J3T A;  1K73 R;  2O28 A;  4NOY A;  1XRY A;  2ZEP A;  4KUB A;  3RES A;  5K8P A;  4Q5W A;  2X7B A;  2DE0 X;  5IB9 A;  3DLM A;  3FJU A;  4J3G A;  3OS0 A;  4A95 A;  1N27 A;  3GYA A;  1S72 T;  5EC4 A;  4UFV A;  2LJ0 A;  4AFU C;  2REF A;  4Z65 A;  1Q7Y C;  3K9U A;  5F49 A;  2DXT A;  1TUD A;  1JXO A;  1VQM T;  3FEE A;  4UA3 A;  2A7Y A;  2FS5 A;  2CUD A;  1X2K A;  3ZEH A;  1EE3 P;  3L2Z A;  3DNS A;  4BE2 A;  2IG0 A;  3GIU A;  2REE A;  4YFJ A;  3I55 A;  1BI3 A;  2HKN A;  4RN7 A;  4XNH B;  3S3N A;  3PB8 X;  4KOV A;  2DPS A;  3F5B A;  4ME7 A;  1GCQ C;  4M77 B;  2DVJ A;  4OGE A;  4J9H A;  3HKS A;  1AD5 A;  1MND A;  1YI2 A;  5C88 A;  4Y28 E;  1BPN A;  1M4G A;  1BPM A;  3PMI A;  1TU0 B;  4KUD K;  5G20 A;  2BUD A;  3G4S T;  4RTW A;  1XMT A;  4A37 A;  1LPL A;  3I9Q A;  2CZ7 B;  3CD6 Q;  2FEI A;  3KGQ A;  4HT9 A;  2CH4 W;  4B9X A;  1PSF A;  2FSR A;  4CI0 C;  3JCM P;  2NWM A;  3R9G A;  2WSF E;  3X25 B;  4DBR A;  4KT0 E;  2AZV A;  1VQ8 T;  2JDD A;  1OBR A;  4QQD A;  4M78 C;  2CP5 A;  2FIA A;  4X1V A;  1UTI A;  1D1C A;  1YCS B;  4ORF A;  1KK7 A;  4R0K A;  2ROL A;  5GAM h;  2KXD A;  5IH2 A;  4RTT A;  4PJJ A;  3L2Q A;  1TIQ A;  1IB8 A;  4Q7A A;  1C6V X;  5FWC A;  3VJP A;  4J8O A;  2Z0W A;  4M7A F;  5G1Z A;  2CP2 A;  4TNU A;  2OU2 A;  2B3V A;  4FW2 A;  1AWJ A;  1Y07 A;  2F69 A;  3OS1 A;  5H86 A;  2IPO B;  1KZF A;  1YJ9 T;  3EH1 A;  4WWV A;  3VS2 A;  2CUB A;  3VKI A;  2EQK A;  2DTH A;  4IIM A;  3LAC A;  3EG3 A;  3EGD B;  4IUT A;  2IQ6 A;  3CBM A;  4IUV A;  5GAM g;  3IWW A;  3WAB A;  3S3M A;  4OLL A;  3UWN A;  4KOW A;  4MHN A;  2EYX A;  2GU2 A;  3RUX A;  2JBJ A;  2GBQ A;  2WUU A;  2C0T A;  4MHZ A;  4DYO A;  3MP8 A;  5GAN f;  1I1D A;  1SSH A;  2C0I A;  5GMK e;  2CT3 A;  4NEX A;  5GMK l;  4JYW A;  3LMS A;  1B87 A;  1UUE A;  2OTL Q;  1ARK A;  5HXD A;  4X9C A;  1VQ4 T;  4PJO E;  3OYH A;  2M0Y A;  1S7L A;  4UIA A;  1ZQ1 A;  5CR2 A;  2LMJ A;  2X51 A;  4LQ6 A;  2JBK A;  4HA8 A;  1IID A;  3L2R A;  1HD3 A;  1SEM A;  3SD4 A;  4QVD A;  3E19 A;  1T0H A;  3DGV A;  4B6M A;  1U8R A;  3HRU A;  1Y9K A;  3OYD A;  3TCV A;  1YLE A;  4P10 A;  4HCB A;  4LX9 A;  3TTH A;  3SHP A;  2PDO A;  1SG5 A;  5FU7 C;  1AMP A;  1WQW A;  4OVA A;  1S1N A;  5LRK A;  2RQR A;  2ZAE A;  1S72 Q;  2P0W A;  4LDU A;  5KYX B;  2K4Y A;  2DTI A;  4PJO A;  2GFQ A;  4R7M A;  5CPA A;  5GAN 2;  5GAO r;  1LOJ A;  2KBT A;  5KTD A;  1VQM Q;  4XTU A;  2AE6 A;  3OW2 S;  3RMQ A;  6CPA A;  1VQK T;  5I11 A;  4IUQ A;  2DEQ A;  2HSP A;  3CMA Q;  4MBU A;  3J7A F;  5KYW B;  1BB9 A;  1Y57 A;  1CP6 A;  4PFZ A;  1I5L A;  4MHY A;  4Z89 A;  1FXX A;  4ZTJ A;  4KBM B;  3EY5 A;  1QCN A;  4XQ3 A;  2DRM A;  1G2B A;  3ZL7 C;  5D6W A;  3GNG A;  3VU3 C;  4A30 A;  1PRL C;  2VAS A;  2E1H A;  3KI9 A;  5JGF A;  4CC2 A;  3CCJ A;  1ZSZ A;  3JB9 H;  3P8H A;  2ZCF B;  3FF3 A;  3UDC A;  2ATC B;  3G4S Q;  3UA6 A;  1CP7 A;  1UGS B;  1QMC A;  5JQ4 A;  1PD1 A;  4K30 A;  4R8F A;  4ELZ C;  4F7U G;  4MZT A;  3MO8 A;  1ZHI A;  3CDX A;  1FX7 A;  2EQJ A;  4FUU A;  2X4J A;  3M0R A;  2JTF A;  4BE1 A;  3E1S A;  1RTQ A;  3P2H A;  3L2V A;  4UEZ A;  3HFO A;  1VQ8 Q;  3S9M A;  1CX8 A;  3DKM A;  2LQW A;  1TF9 A;  1UG1 A;  1LNX A;  4JD6 A;  3SXO A;  2L3Q A;  2I3C A;  3PP9 A;  3OW2 A;  4Z88 A;  4C0D C;  1QCO A;  2B86 A;  2HCK A;  3PT9 A;  3K9T A;  4ZX9 A;  4F9U A;  2KAF A;  2CTB A;  3OYA A;  1BI1 A;  2ED1 A;  4KZT A;  4IUR A;  4L59 A;  1Y0Y A;  1UHC A;  5CO7 A;  1WA7 A;  1T3L A;  1YJ9 Q;  3M59 A;  3KQZ A;  5GAO m;  3FMC A;  3D66 A;  2RB6 A;  5A28 A;  5LYI A;  2KK4 A;  4CC4 B;  1ZLM A;  2IMO A;  4C5E A;  2R58 A;  1RAA B;  3OY9 A;  4J9C A;  3PVQ A;  4C0F A;  3DDD A;  4P5N A;  4CYO A;  2OR4 A;  1Q86 R;  1PRM C;  4M77 F;  4N4G A;  2DM1 A;  4R55 A;  1VQ9 A;  1LAM A;  5IN1 A;  4C92 C;  1M4Z A;  3M53 A;  3WVD B;  1X6O A;  4EVY A;  2JW4 A;  3JCM g;  1YJW T;  6AT1 B;  1E6H A;  2EJF A;  2F1L A;  2GCX A;  1PUA A;  2HL3 A;  5EBV A;  1BK2 A;  2BZ8 A;  3VS6 A;  1VQ4 Q;  1BCM A;  2A37 A;  5CKH A;  4ONW A;  3GIB A;  2GQI A;  3IJ3 A;  1PKS A;  1LVK A;  2JN0 A;  3FC3 A;  3T8W A;  3UA7 A;  2PVO B;  2YSQ A;  3MN8 A;  3M4G A;  4F0Y A;  2Z3N A;  4BI3 A;  2VI7 A;  2K2M A;  2KYM A;  4AMC A;  4O6J A;  1IHV A;  2W0Z A;  3OYE A;  4U9Y A;  4CRI A;  4A4K A;  4ZX8 A;  5LJ3 d;  2ZEE A;  4NJQ A;  1BBZ A;  1JJ2 P;  3N5F A;  2EAY A;  4OC4 A;  2DL3 A;  4NGS A;  2W10 A;  2DEU A;  4C92 G;  2PVV A;  1VQO T;  1R3N A;  2WZN A;  2XD0 A;  2PIZ A;  2KY9 A;  1H8L A;  4CGP A;  2V1R A;  4J9E A;  4FBE A;  3B3V A;  2Y0M A;  3D8P A;  4RTY A;  3KHX A;  2DNU A;  1QWF A;  1VQK Q;  3S6W A;  3V38 A;  2KI7 A;  3I9S A;  4QVZ A;  1JB0 E;  1N9S A;  1YQE A;  3KKW A;  1EX4 A;  2DKG A;  4VUB A;  3VAT A;  1KWM A;  3QXE B;  4PXE A;  5EG2 A;  4Q36 A;  1VQ6 Q;  1JWQ A;  2Z3O A;  4MY0 A;  4NGP A;  4XPD C;  1YHQ A;  3N7Z A;  2OX7 A;  1VQ7 A;  4CGO A;  1VOM A;  2R8V A;  4YGO A;  1GCP A;  3MGD A;  3FED A;  2XDD A;  5KYU A;  2E6Z A;  4FD7 A;  2WSE E;  4M75 B;  1NJI U;  4M7A G;  3LD2 A;  4A4E A;  4KH0 B;  3D67 A;  1GBQ A;  2DIQ A;  1D3B A;  5HVG A;  4E7I A;  4PJO B;  2Z3K A;  2L5Q A;  1Q81 U;  1TXR A;  1RUW A;  2AHJ B;  4CC7 A;  2XID A;  3MP6 A;  3SFM A;  2G3R A;  2KNB B;  4QQ6 A;  3LWH A;  3TO9 A;  2B5G A;  3H0I A;  1K9A A;  5LJ5 j;  4WJB A;  2EO8 A;  3G71 Q;  4BDZ A;  4A63 B;  2KE9 A;  2CP0 A;  2QEX A;  1MV0 B;  4JJB A;  2BSW A;  1M9S A;  3FEC A;  3OS2 A;  3ZBD A;  2JS2 A;  2CH4 A;  3OMG A;  4P4E A;  5IHI A;  4BY6 B;  1ZSZ B;  2FIW A;  4X8I A;  2QQB A;  1NYG A;  3TCJ A;  1J4J A;  2Q4Z A;  4BE0 A;  3HRS A;  4JRK A;  3CC7 A;  2DXU A;  2RHX A;  2D0N A;  5JM6 A;  2VZY A;  2K3B A;  5J3B A;  3FBU A;  2EFI A;  1BOB A;  1P92 A;  4WF2 A;  1PCA A;  2XEG A;  2ROT A;  4A53 A;  1B7T A;  1IIC A;  2EK9 A;  3C95 A;  4LUE A;  5GAN 5;  4MZM A;  4NGN A;  2GIV A;  3MPU B;  3NHN A;  3NTI A;  3S9L A;  3LW5 E;  1BIA A;  2RJC A;  3QYG B;  4A4G A;  1YJW Q;  5CAI A;  3VWE A;  2E65 A;  2L89 A;  3C94 A;  4ESR A;  1XMB A;  1IHW A;  4P4F A;  1NEB A;  3TOB A;  2FZG B;  3CPW P;  3B3C A;  4AFQ C;  3HSB A;  2Y90 A;  2BE9 B;  8ATC B;  1SF9 A;  2ANP A;  3JB9 D;  1K0X A;  1W70 A;  3OA6 A;  4P44 A;  3DLJ A;  1PSE A;  4XAX B;  4C8Q F;  2GFU A;  1UGQ B;  4M7D C;  4AG1 C;  2BE7 D;  2XU8 A;  5LL6 S;  2QG9 B;  4V2S A;  2H3J A;  4C0G A;  1OZ2 A;  1IY7 A;  1U6M A;  3BFM A;  4D8D A;  1RAG B;  3INZ A;  3G8W A;  2ZPA A;  2G6F X;  2FPE A;  2HQX A;  1NPP A;  1I21 A;  2AFX A;  3CME T;  2M0O A;  2QGF B;  5I22 A;  5GMK j;  1XIX A;  1SPK A;  4JJX A;  2KRM A;  3EG0 A;  4PJN A;  4BI8 B;  2V8D A;  1KC8 R;  2FO0 A;  2Z10 A;  4B12 A;  1WQ7 A;  3URG A;  3OYF A;  3M54 A;  1CM0 A;  3IQL A;  3WC5 A;  2J06 A;  1R77 A;  3P8B B;  2PJ0 A;  4B13 A;  2JM9 A;  4XNH C;  4KGV B;  2LJ3 A;  3I35 A;  5LJ3 e;  4Z8A A;  3NA6 A;  1JQG A;  2K9G A;  2F5T X;  1VQL T;  2YRD A;  3SJF A;  1D1A A;  2MWP A;  3CCE T;  3W6X A;  1K76 A;  2EUI A;  5LJ5 d;  2JZ2 A;  1VQP T;  1VIE A;  4AVC A;  4M7D G;  1JJ2 S;  1BCO A;  1XJW B;  4X2T A;  1JRI A;  3EAE A;  4JZ3 A;  1VQN T;  1NLO C;  4OAE A;  1KJW A;  5F47 A;  2GLF A;  2DZ9 A;  1VGY A;  5GAO n;  2RB7 A;  3S6H A;  1X75 C;  3PGG A;  4O5V A;  2LVM A;  1BLL E;  4ONU A;  3DR8 A;  3GOX A;  1QSN A;  3S3O A;  2EKH A;  2FHD A;  1P4N A;  4P6Y A;  1M2V A;  2CP7 A;  2KCW A;  2A4N A;  2KYB A;  2BEI A;  2C6P A;  3H0F A;  5KTA A;  4UCN A;  4LN2 A;  1AT1 B;  3VS7 A;  1M90 C;  1QVG P;  3ISZ A;  2CIJ A;  1IGQ A;  2RJD A;  1UGV A;  1YIT T;  4DNC A;  3CCR A;  2NLU A;  1X43 A;  4M77 G;  5FW9 A;  3KR4 A;  4AG7 A;  5IX3 A;  4GLK A;  3QNV A;  5AG5 A;  1K8A R;  2VXK A;  3CBO A;  4XTW A;  2DK3 A;  5ECA A;  1S7N A;  5HVH A;  2EGC A;  1ZBJ A;  1KD1 R;  2DD5 A;  4QB9 A;  1I4K 1;  5KYU B;  1GXI E;  1QP3 A;  1AYE A;  1AOJ A;  3J80 E;  3LYI A;  5IHN A;  1JJ2 A;  2DET A;  4GY5 A;  4K11 A;  1OI1 A;  5D6Y A;  3CXC P;  1QSM A;  1KQ1 A;  2WPW A;  3M58 A;  2QTX A;  3CD6 A;  1D3B B;  3F8K A;  2RA2 A;  2AK5 A;  2CZ1 B;  2QDL A;  3H41 A;  4YWY A;  3SWN A;  4PXD A;  2EJG A;  1WHM A;  2YUP A;  3KUF A; 
#chains in the Genus database with same CATH homology
 2HBP A;  4FSX A;  1RLQ C;  5C6S A;  2D1X A;  3AHU A;  2YDL A;  4M4Z A;  2VGN A;  2CYZ B;  2YHT A;  4PJO F;  1U1S A;  1M3B A;  2ZPI B;  1WJR A;  4J7F A;  4XU3 A;  3UAT A;  5C0M A;  2CRE A;  2V1Q A;  4ATO A;  2Q7S A;  2DX1 A;  5LJ3 f;  3N5B B;  2I2L A;  1JO8 A;  1Y7X A;  4ZN1 A;  4HT8 A;  4J9F A;  2XDP A;  5GAN h;  4F16 A;  3CCS A;  1KD1 C;  2DF6 A;  3CPW S;  2D9T A;  4MML A;  2O9S A;  3GBQ A;  2OTL A;  4IUP A;  3VUZ A;  4JLI A;  4C8Q E;  1WDX A;  2YUQ A;  3G6E A;  4GLM A;  3OSV A;  4RMO A;  4II1 A;  5GAN g;  4LUD A;  5DM7 R;  2P0P A;  2LT1 A;  4N4H A;  1RL2 A;  1Q82 U;  3OB9 A;  1RI9 A;  2LTO A;  1QWE A;  2KRO A;  2CDT A;  3QZ9 B;  3X28 B;  4XK8 E;  4R56 A;  1B3Q A;  1Y96 A;  1QKW A;  2L3S A;  2EIF A;  4JDS A;  4EMK A;  5IT9 E;  3FDR A;  2O31 A;  4C8Q A;  2JUF A;  5LJ5 e;  1I0C A;  3CMA T;  5KH6 A;  1VQM A;  5L8R E;  4WCI A;  5IXB A;  3U23 A;  3CPW A;  2X4X A;  2AKL A;  4OB3 B;  2PQW A;  5GAN 4;  4OMQ A;  2LC4 A;  3L1A A;  3CCQ T;  1Q81 C;  2DYB A;  3HRT A;  1VIF A;  2K5F A;  1U06 A;  2IVW A;  2RM4 A;  4M78 E;  2QDY B;  3G4S A;  3TEE A;  4TVR A;  4J6Y A;  1QVG S;  2ODF A;  1WIE A;  2RHU A;  4OMP A;  4A4F A;  4N0A C;  2RMO A;  3F70 A;  4F17 A;  3V7R A;  2LZ6 B;  4FSS A;  1YIJ A;  4JJC A;  1HXD A;  2XHC A;  3PTA A;  3G7Z A;  4J5Y A;  3CCL A;  2DXC A;  4C92 D;  4M78 A;  2KRS A;  2DA9 A;  1Z9Z A;  1VQ5 T;  1JEG A;  1WPY A;  5GMK h;  2PVD B;  2RD1 A;  2ZPF B;  1ZBX A;  1YJ9 A;  2CKK A;  1I81 A;  4JRI A;  1M1K U;  2LQK A;  3PIO A;  3CC2 T;  1PKT A;  2E70 A;  1UE9 A;  2MIO A;  2ESW A;  1QVG A;  1UB4 A;  2HNI A;  3CCM T;  4ZGJ B;  1NEG A;  2V8K A;  1K9M C;  2HD0 A;  1YNZ A;  2L8D A;  1VQ4 A;  2LNV A;  2KMT A;  2EWN A;  3H0H A;  4OP0 A;  3EGU A;  2VXE A;  5LJ5 f;  1YN8 A;  4C5G A;  2GF7 A;  2RHI A;  2RF0 A;  4M75 C;  2CT4 A;  1SRM A;  1N8R U;  5FU6 C;  2ZGW A;  2P0K A;  3PIP A;  3DLL A;  2P4R A;  3L2U A;  1OZ3 A;  1UEC A;  2F5K A;  1YJN T;  3RKW A;  1QP2 A;  2LJ1 A;  1OYX A;  3I56 A;  2YLC A;  3OS5 A;  3VS4 A;  3QDR B;  4ZTF A;  1VQK A;  1VQ6 T;  5LJ3 j;  4E7J A;  2QA4 T;  1NE8 A;  2ZPG B;  3UT1 A;  4BY6 C;  3CCV T;  2V8I A;  2CGH A;  1X6B A;  1M8V A;  2EYQ A;  1WFW A;  3LH5 A;  5CVI A;  2RPN A;  2FG0 A;  4DOV A;  2L3R A;  4M75 G;  3JCM J;  1WXB A;  3OMC A;  2QQS A;  4E7L A;  4HVV A;  2OI3 A;  1Y96 B;  4PJO G;  2K2V A;  1IRE B;  4EMK B;  3VYH B;  4C8Q B;  1VYT A;  2LNH B;  1IO6 A;  2PU9 B;  2DPP B;  3G71 T;  5FRO A;  4BIN A;  2K6D A;  2GQV A;  1Y0M A;  2XI9 A;  2WAC A;  1EFN A;  3RBB B;  3FLG A;  3OYC A;  3WXM B;  1XQH A;  1HK9 A;  2LDM A;  1KC8 U;  4E7K A;  4M6H A;  3REB B;  3TVT A;  3QWY A;  1QKX A;  2KR3 A;  4RTZ A;  2YRV A;  4C92 E;  2PZ1 A;  4RTX A;  1X69 A;  4NL2 A;  2XMF A;  1QVP A;  2MOX A;  2JMC A;  1WI7 A;  2C0O A;  4DA4 A;  5CKB A;  2YUN A;  4FL6 A;  2QXF A;  3ER0 A;  4X9D A;  1WXU A;  4M7D D;  1WX6 A;  1TUC A;  1YJW A;  1M8M A;  3EG2 A;  5CKE A;  1GRI A;  2X3X D;  1RLP C;  2J7I A;  3LGF A;  4M6G A;  2RQT A;  4C92 A;  4M78 B;  2EPD A;  3M4Y A;  2O4X A;  2KVQ G;  4PKC C;  1O75 A;  2FVU A;  3MCA B;  3L2W A;  4DOW A;  4XTX A;  4J9I A;  3LX7 A;  1AZG B;  1K8A U;  4M7A C;  1G3Y A;  2DMO A;  2M16 A;  2ZPH B;  4M77 D;  4HVU A;  3LGL A;  1VQO A;  3I5S A;  3SB2 A;  3GLX A;  1K1Z A;  3X20 B;  4E6R A;  2E5Q A;  2L0A A;  4IIO A;  5CKF A;  4FT4 A;  1SRL A;  1NM7 A;  4HXJ A;  2BZY A;  1MHN A;  3P8D A;  2K3X A;  3FIF A;  3TU4 K;  2R5A A;  1JXM A;  2EYW A;  2HDA A;  1Q7Y U;  1OEB A;  3PVL A;  4JS4 A;  3FRN A;  3RKX A;  4LDW A;  3THK A;  3X24 B;  4BI4 A;  1FMK A;  3C0C A;  2FYK A;  3QG1 A;  2GTJ A;  2KT8 A;  4JJN K;  1M3C A;  3NE8 A;  2DVE A;  3OYN A;  4J9B A;  2QEX T;  2GNC A;  2E12 A;  2RJE A;  1O9S A;  4DEX A;  2HBW A;  1BYM A;  2V8J A;  3QHS A;  1H92 A;  1NG2 A;  1SSF A;  2EKO A;  3JB9 F;  4RG8 A;  1YP5 A;  5I21 A;  3NPF A;  2JTM A;  3MHX A;  4KUI A;  2MI6 A;  1JU5 C;  1E6G A;  1KFZ A;  4EDU A;  1K73 U;  1JQQ A;  1M27 C;  1LJO A;  3MP1 A;  1KHC A;  1UJY A;  1QW1 A;  1H8K A;  4JLG A;  3QKJ A;  5CIU A;  5GMK m;  3HL8 A;  4IUU A;  2J05 A;  2DIL A;  4M7D E;  1M1K C;  2DJQ A;  4Z02 A;  2EJ9 A;  1ABQ A;  2XG8 D;  3EFS A;  2JM8 A;  2LCC A;  3FB9 A;  4EIK A;  3CC4 T;  2DBK A;  1BKB A;  3CQT A;  3LWI A;  1I07 A;  2Y4X A;  5A0G A;  5LJ3 h;  2PTK A;  2SEM A;  2VUB A;  3FJ5 A;  4M7D A;  2WSC E;  3QPH A;  3CME A;  5D6X A;  3TSZ A;  3TRE A;  2F2W A;  4LDV A;  3DB4 A;  4JRQ A;  1UHF A;  3VS5 A;  1B34 A;  1GFC A;  1G83 A;  4M77 C;  4OMO A;  1UFF A;  1W2B S;  4D8K A;  1W1F A;  2H8H A;  5LJ3 g;  1N8R C;  1VQL A;  4D6W A;  3CCE A;  1CKB A;  2EQM A;  1NZ9 A;  1VQP A;  2J6O A;  3OYY A;  2KXC A;  2F2V A;  2J6F A;  1M1F A;  5CQY A;  1VQN A;  3JCM b;  1X6G A;  1PWT A;  1UGP B;  2EGA A;  4MMK A;  2OJ2 A;  4F14 A;  2MWO A;  3QYH B;  4M78 F;  4ELY C;  2IIM A;  4FU6 A;  3OSS C;  2OTJ T;  2CSI A;  1N5Z A;  1CKA A;  4LDX A;  3DB3 A;  2C06 A;  1A0N B;  5CK9 A;  3JB9 J;  3MEA A;  5GJW B;  4DQ2 A;  1YIT A;  3V7C A;  3VRZ A;  1X27 A;  1W2B A;  2RHY A;  3CCU T;  4OMM A;  1E7O A;  2FL7 A;  3R6O A;  3QBY A;  1SHG A;  2FRY A;  4RKU E;  2MF2 A;  1OV3 A;  1NLP C;  2KDS A;  3VS0 A;  4FT2 A;  4BAC A;  3FEO A;  4E47 A;  2DZC A;  1GL5 A;  3MET A;  2E10 A;  2GTO A;  1WYX A;  2D8J A;  2XKO C;  2DL5 A;  3QJ6 A;  5GAM d;  4BDY A;  3SHW A;  3OBY A;  3H6Z A;  2K57 A;  4MDW A;  4EMG A;  4XTZ A;  3OYJ A;  1ZUY A;  4OB0 B;  3RKY A;  1AWO A;  3O8V A;  3C4S A;  3A98 A;  5GAO l;  1UGR B;  5DY9 A;  4LDY A;  4JS5 A;  4HCK A;  1CSK A;  4AFZ C;  2MCN A;  2KQW A;  3A8L B;  4AG2 C;  1AWW A;  4XTV A;  4LD6 A;  4OB1 B;  2O01 E;  2P0Q A;  1V29 B;  2ED0 A;  4M75 D;  3SEM A;  1UEB A;  4PJO D;  3EFR A;  2M1H A;  5L23 A;  3PE0 A;  4B9W A;  3G6E T;  3M57 A;  3ME9 A;  4XU1 A;  2DIG A;  2KRN A;  5LJ5 h;  2HEQ A;  2HAX A;  3JCM V;  4EMK C;  4N4I A;  2O9V A;  4C8Q C;  1S72 A;  1YWP A;  1Z9Q A;  4JJD A;  5GJV B;  4JUV A;  2EYZ A;  2CSQ A;  2DTO A;  2QQR A;  2CZ6 B;  1Q86 U;  2D6F A;  1B34 B;  3JB9 G;  1IZ6 A;  2A36 A;  1R8O B;  1WLP B;  5LJ5 g;  3CMA A;  5J26 A;  1NJI C;  1TH7 A;  2O2O A;  3M0S A;  3I55 T;  4XU0 A;  2O88 A;  4ORZ A;  4DEY A;  5IHK A;  5FRM A;  2HB6 A;  2BKD N;  2A08 A;  3CCQ A;  1YI2 T;  3KXT A;  2LQ8 A;  2FRW A;  5GAN 8;  3VUB A;  1GCQ A;  2VVK A;  2ZPE B;  5I2S A;  3OYM A;  4BD3 A;  1GBR A;  4C92 F;  2X3W D;  3MEU A;  3V8L A;  2ABL A;  1U5S A;  4C8Q G;  4EMH A;  1VQ8 A;  3BDL A;  2RJF A;  2LP5 A;  4HCC A;  5KE3 A;  1U1T A;  1HSQ A;  5FWB A;  4OMF B;  3JSC A;  1YIJ T;  2LQN A;  1NPR A;  5FRN A;  3CXC S;  3QSU A;  2E5K A;  1K73 C;  3JCM d;  4N0A A;  3KBG A;  2DJZ A;  2RN8 A;  3M5A A;  3JAM E;  3CCL T;  5GAN 6;  3EHQ A;  1KHI A;  3EHR A;  2X35 A;  1VQ5 A;  5HK0 A;  2MAM A;  3I5R A;  1KQS S;  3HP9 A;  3SWN B;  3EG1 A;  1G3S A;  2YUO A;  4ZNX A;  2A28 A;  5GAM e;  3VS1 A;  4ZGE B;  3PFS A;  4KUL A;  2KGT A;  3BDU A;  3CC2 A;  4QVC A;  2LX9 A;  3A8H B;  4M7A D;  4X34 A;  4M78 G;  2EQI A;  3ULR B;  3CCM A;  3LH0 A;  2D8H A;  5A2Q E;  3HFN A;  2FPF A;  4LE9 A;  3CZX A;  4M75 E;  3V7S A;  4F7U E;  1H64 1;  3M0Q A;  4C0Z A;  3CXC A;  5CQX A;  2HQE A;  1ZSG A;  3JCM X;  1AHJ B;  1KG1 A;  2RI3 A;  2DD4 A;  2JXB A;  4PJO C;  1MV3 A;  2RH2 A;  3TSW A;  1KQS A;  1JBM A;  5GAO q;  3VYG A;  2PNI A;  1AEY A;  1XNI A;  2RHZ A;  5KCH A;  4RCB A;  1WJS A;  4BUG A;  3BW1 A;  1QVF S;  1YJN A;  1I8F A;  2BTT A;  4M75 A;  4F7U A;  2DL8 A;  1I1J A;  4RTV A;  1ZUK A;  2R57 A;  3OYB A;  1VQ6 A;  3I56 T;  5DLO A;  2QA4 A;  2QQA A;  3CCV A;  2AZS A;  2YT6 A;  1G5V A;  2RK1 A;  2ECZ A;  3CCJ T;  2LCS A;  2KT1 A;  3ASK A;  2K5I A;  3NTK A;  4CC3 A;  4PNO A;  1M90 U;  2M51 A;  1YCY A;  2A3L A;  2KSS A;  5M9O A;  1G3T A;  5IAY A;  4OGC A;  3E9G A;  2OAU A;  1BI2 A;  1X2Q A;  4J9G A;  1M3A A;  2LRQ A;  3CPF A;  3G71 A;  1ZX6 A;  2PUK B;  3X26 B;  1QVF A;  2VYT A;  4QW2 A;  5CKD A;  2B8A A;  5GAM f;  4M7D F;  2NUZ A;  1YWO A;  1VA7 A;  1WXT A;  2XIC A;  4JZ4 A;  4MZP A;  3UPU A;  1PHT A;  3OYG A;  4QT7 A;  1SHF A;  3J81 E;  1KQ2 A;  3VS3 A;  2VWF A;  1T3S A;  4OMN A;  2D0Q B;  3GP8 A;  3JB9 I;  2XDB A;  2E41 A;  2K3Y A;  3JCM h;  4OML A;  4XTY A;  1RI0 A;  1VQ9 T;  2EYY A;  3OYI A;  4JPB W;  4YTL A;  2R5M A;  3VRY A;  3QJY A;  3JCM e;  1G3W A;  4E7H A;  5IXF A;  1N9R A;  1LCK A;  2QI2 A;  4OB2 B;  4M7A E;  5I2M A;  3ZFJ A;  3JRZ A;  2K5L A;  3CEY A;  4C5H A;  2RI5 A;  5J39 A;  2EBP A;  2ZPB B;  3QAY A;  2KEA A;  4JRP A;  1KD1 U;  3NMZ C;  1ABO A;  5DLQ E;  2SRC A;  4FM4 B;  4RCC A;  4RTU A;  4J83 A;  2JTE A;  4RG2 A;  2RQU A;  4PLL A;  5KE2 A;  3A8O B;  1Q82 C;  3M0T A;  5GMK i;  4M7A A;  3GPL A;  5FLX E;  2HC9 A;  2OAW A;  2VXF A;  1QCF A;  2BZX A;  3MEV A;  5HKC A;  3FJP A;  3GNF B;  2EVR A;  4IKF A;  1YBY A;  2ZZD A;  1VUB A;  2QQ9 A;  1YHQ T;  2JNG A;  1Q86 C;  1VQ7 T;  5KCO A;  5GAN j;  1GFD A;  3GF5 A;  3SDZ A;  5GAO p;  4L5G A;  5AYF A;  4J9D A;  1MUZ A;  5EC7 A;  3M9Q A;  3R6N A;  3QUI A;  2JT4 A;  4F7U B;  1VYU A;  5FU7 B;  2I0N A;  3L42 A;  4FIB A;  1HJD A;  3VV0 A;  3H8Z A;  5FU6 B;  2X4W A;  1BIB A;  1U3O A;  1WNL A;  1FWZ A;  3MEW A;  3OBW A;  3NGP A;  3RMS A;  1FYN A;  4NL3 A;  3M56 A;  3JV3 A;  3JCM f;  3CC7 T;  4UC4 A;  3RER A;  3HPW A;  4KRT A;  2P4T A;  3V8J A;  1KSW A;  1OPK A;  1X01 A;  2VGM A;  3M55 A;  2M9U A;  2EW3 A;  4HVW A;  3JCM c;  4J6X A;  2RI2 A;  2VV5 A;  1BU1 A;  1DJ7 B;  2YLB A;  2RQV A;  3C12 A;  2PUO B;  2LX7 A;  2RQW A;  1M5Q 1;  3QWX X;  2PVG B;  4EPC A;  2VC8 A;  4C0D B;  4OF1 A;  2X4Y A;  3CC4 A;  2EQU A;  4LNP A;  2JMA A;  1UJ0 A;  2RNA A;  2RO0 A;  2AKK A;  2DAQ A;  5GAM j;  3HHT B;  2J6K A;  3JCM Q;  4M77 E;  5GAN d;  1VYV A;  1K9M U;  2L3P A;  1BI0 A;  4J7I A;  4PLI A;  3M0P A;  2CS7 A;  3A5Z B;  2MMP A;  2EGE A;  4C92 B;  1XTD A;  4C5I A;  4BB7 A;  2O4X B;  1NYF A;  4MDX A;  4L6V 5;  4C8Q D;  1XOV A;  4RUG A;  1M30 A;  4Y91 A;  1TG0 A;  2BIV A;  2FB7 A;  4QQG A;  4EFD A;  4M77 A;  1PNJ A;  2RK2 A;  1AVZ C;  1Y71 A;  2Y4Y A;  3V8K A;  4GBQ A;  3E9F A;  5HK3 A;  4A4H A;  1EIF A;  1N6A A;  1M1G A;  2DXB A;  4M7A B;  3UF4 A;  2OTJ A;  3LLR A;  2DLP A;  1WJQ A;  5GAN 7;  1W4S A;  3OYL A;  1OOT A;  2JVV A;  2GFA A;  3CCR T;  2JS0 A;  1K0S A;  3BY7 A;  2VKN A;  3NFC A;  2E6N A;  3CCU A;  5A0L A;  3A8M B;  1ZUU A;  3PMT A;  3SWN C;  1H3H A;  1WGS A;  2F2X A;  3KFV A;  3QII A;  4J6W A;  3QO3 A;  2JOY A;  1H3Z A;  2DBM A;  4M78 D;  1AZE A;  3QZ5 B;  3CD6 T;  1KC8 C;  1QLY A;  2DL7 A;  1UDL A;  5EMI A;  2E64 A;  3PNW C;  2LT4 A;  2LCL A;  1OPL A;  3O5Z A;  1K4U S;  3Q1J A;  3WVE B;  2DL4 A;  2FPD A;  2DO3 A;  2DRK A;  1KIK A;  4HCZ A;  2K79 A;  2L2P A;  1MGQ A;  5HCK A;  3M0U A;  4M75 F;  4F7U F;  2CZ0 B;  4ZN3 A;  2K7A A;  2XK0 A;  4XU2 A;  3OQ5 A;  1B07 A;  3A8G B;  3NTH A;  5CCA A;  1T0J A;  3CCS T;  1W6X A;  5A0D A;  5HY6 A;  1K8A C;  3CBP A;  2OTL T;  3JCM W;  3RNJ A;  4PL6 A;  4ZGD B;  2ENM A;  3RIR A;  4NS5 A;  2GGR A;  5GAN 3;  3REA B;  5GAN e;  3T9N A;  4A54 A;  4AFS C;  4LD9 K;  1AWX A;  3OYK A;  1V1C A;  4HKE A;  4M7D B;  4M6I A;  4Y92 A;  1J3T A;  4NOY A;  3RES A;  4Q5W A;  2DE0 X;  3DLM A;  3OS0 A;  1N27 A;  1S72 T;  2LJ0 A;  4AFU C;  1Q7Y C;  2DXT A;  1TUD A;  1JXO A;  1VQM T;  2A7Y A;  2CUD A;  1X2K A;  3ZEH A;  3L2Z A;  4BE2 A;  2IG0 A;  3I55 A;  1BI3 A;  4RN7 A;  3S3N A;  4ME7 A;  1GCQ C;  4M77 B;  2DVJ A;  4OGE A;  4J9H A;  3HKS A;  1AD5 A;  1YI2 A;  4Y28 E;  3PMI A;  4KUD K;  2BUD A;  3G4S T;  4RTW A;  3I9Q A;  2CZ7 B;  2FEI A;  4HT9 A;  2CH4 W;  4B9X A;  1PSF A;  4CI0 C;  3JCM P;  2NWM A;  2WSF E;  3X25 B;  4KT0 E;  2AZV A;  1VQ8 T;  4QQD A;  4M78 C;  4X1V A;  1UTI A;  1YCS B;  4R0K A;  2ROL A;  5GAM h;  2KXD A;  5IH2 A;  4RTT A;  3L2Q A;  3VJP A;  5FWC A;  4J8O A;  4M7A F;  1AWJ A;  1Y07 A;  2F69 A;  3OS1 A;  1YJ9 T;  3VS2 A;  2CUB A;  3VKI A;  2EQK A;  4IIM A;  2DTH A;  3EG3 A;  4IUT A;  3CBM A;  4IUV A;  5GAM g;  3S3M A;  3UWN A;  2EYX A;  3RUX A;  2GBQ A;  2C0T A;  3MP8 A;  5GAN f;  1SSH A;  2C0I A;  5GMK e;  2CT3 A;  5GMK l;  1UUE A;  1ARK A;  4X9C A;  1VQ4 T;  4PJO E;  3OYH A;  2M0Y A;  1ZQ1 A;  5CR2 A;  2LMJ A;  4LQ6 A;  4HA8 A;  3L2R A;  1HD3 A;  1SEM A;  3SD4 A;  4QVD A;  3E19 A;  1T0H A;  1U8R A;  3HRU A;  3OYD A;  4HCB A;  5FU7 C;  1WQW A;  4OVA A;  1S1N A;  2RQR A;  4LDU A;  2K4Y A;  2DTI A;  4PJO A;  5GAN 2;  5GAO r;  1LOJ A;  2KBT A;  4XTU A;  3OW2 S;  3RMQ A;  1VQK T;  5I11 A;  4IUQ A;  2HSP A;  2DEQ A;  3J7A F;  1BB9 A;  1Y57 A;  1I5L A;  4Z89 A;  1FXX A;  4ZTJ A;  4KBM B;  4XQ3 A;  2DRM A;  1G2B A;  3ZL7 C;  5D6W A;  3GNG A;  3VU3 C;  1PRL C;  2E1H A;  4CC2 A;  3CCJ A;  3JB9 H;  3P8H A;  2ZCF B;  3UDC A;  3UA6 A;  1UGS B;  4ELZ C;  4F7U G;  4MZT A;  3MO8 A;  1ZHI A;  1FX7 A;  2EQJ A;  3M0R A;  2X4J A;  2JTF A;  4BE1 A;  3E1S A;  3L2V A;  3HFO A;  3DKM A;  2LQW A;  1UG1 A;  1LNX A;  2L3Q A;  3OW2 A;  4Z88 A;  4C0D C;  2B86 A;  2HCK A;  3PT9 A;  2KAF A;  3OYA A;  1BI1 A;  2ED1 A;  4IUR A;  4L59 A;  1UHC A;  5CO7 A;  1WA7 A;  1T3L A;  3M59 A;  5GAO m;  2RB6 A;  2KK4 A;  4CC4 B;  1ZLM A;  4C5E A;  2R58 A;  3OY9 A;  4J9C A;  3PVQ A;  4C0F A;  4P5N A;  1PRM C;  4M77 F;  4N4G A;  2DM1 A;  4R55 A;  1VQ9 A;  5IN1 A;  4C92 C;  1M4Z A;  3M53 A;  3WVD B;  1X6O A;  2JW4 A;  3JCM g;  1YJW T;  1E6H A;  2EJF A;  2GCX A;  1BK2 A;  2BZ8 A;  3VS6 A;  2A37 A;  5CKH A;  3GIB A;  2GQI A;  1PKS A;  2JN0 A;  3FC3 A;  3UA7 A;  2PVO B;  2YSQ A;  3M4G A;  4BI3 A;  2K2M A;  2KYM A;  4O6J A;  2W0Z A;  3OYE A;  4CRI A;  4A4K A;  5LJ3 d;  1BBZ A;  2EAY A;  2DL3 A;  2W10 A;  4C92 G;  1VQO T;  2XD0 A;  2KY9 A;  2V1R A;  4J9E A;  4RTY A;  2DNU A;  1QWF A;  3S6W A;  4QVZ A;  1JB0 E;  1N9S A;  2DKG A;  4VUB A;  3QXE B;  5EG2 A;  1JWQ A;  1YHQ A;  1VQ7 A;  1GCP A;  2XDD A;  2E6Z A;  2WSE E;  4M75 B;  1NJI U;  4M7A G;  4A4E A;  1GBQ A;  2DIQ A;  1D3B A;  4E7I A;  4PJO B;  2L5Q A;  1Q81 U;  1RUW A;  2AHJ B;  4CC7 A;  2XID A;  3MP6 A;  3SFM A;  2KNB B;  2G3R A;  4QQ6 A;  3LWH A;  3H0I A;  1K9A A;  5LJ5 j;  4BDZ A;  4A63 B;  2KE9 A;  2QEX A;  1MV0 B;  4JJB A;  1M9S A;  3OS2 A;  3ZBD A;  2JS2 A;  2CH4 A;  3OMG A;  5IHI A;  4BY6 B;  2QQB A;  1NYG A;  3TCJ A;  4BE0 A;  3HRS A;  4JRK A;  3CC7 A;  2DXU A;  2RHX A;  2D0N A;  2K3B A;  5J3B A;  2EFI A;  1P92 A;  4WF2 A;  2ROT A;  4A53 A;  3C95 A;  4LUE A;  5GAN 5;  4MZM A;  3NHN A;  3NTI A;  3LW5 E;  1BIA A;  2RJC A;  3QYG B;  4A4G A;  5CAI A;  2E65 A;  2L89 A;  3C94 A;  4ESR A;  1NEB A;  4AFQ C;  3HSB A;  2Y90 A;  3JB9 D;  1K0X A;  1W70 A;  3OA6 A;  1PSE A;  4XAX B;  4C8Q F;  2GFU A;  1UGQ B;  4M7D C;  4AG1 C;  2XU8 A;  5LL6 S;  4V2S A;  2H3J A;  4C0G A;  1OZ2 A;  3BFM A;  4D8D A;  3INZ A;  2G6F X;  2FPE A;  2HQX A;  1NPP A;  3CME T;  2M0O A;  5I22 A;  5GMK j;  1SPK A;  2KRM A;  3EG0 A;  4BI8 B;  2FO0 A;  1WQ7 A;  3URG A;  3OYF A;  3M54 A;  3IQL A;  2J06 A;  3P8B B;  2JM9 A;  2LJ3 A;  3I35 A;  5LJ3 e;  4Z8A A;  2K9G A;  2F5T X;  1VQL T;  2MWP A;  3CCE T;  1K76 A;  5LJ5 d;  2JZ2 A;  1VQP T;  1VIE A;  4M7D G;  1JJ2 S;  1JRI A;  3EAE A;  4JZ3 A;  1VQN T;  1NLO C;  1KJW A;  2DZ9 A;  5GAO n;  1X75 C;  3PGG A;  4O5V A;  2LVM A;  3GOX A;  3S3O A;  2EKH A;  2FHD A;  2KYB A;  3H0F A;  4LN2 A;  3VS7 A;  1M90 C;  2RJD A;  1UGV A;  1YIT T;  3CCR A;  2NLU A;  1X43 A;  5FW9 A;  4M77 G;  4GLK A;  3CBO A;  4XTW A;  2DK3 A;  5ECA A;  2EGC A;  1ZBJ A;  2DD5 A;  1I4K 1;  1GXI E;  1QP3 A;  1AOJ A;  3J80 E;  5IHN A;  3LYI A;  1JJ2 A;  4K11 A;  4GY5 A;  1OI1 A;  5D6Y A;  1KQ1 A;  3M58 A;  2QTX A;  3CD6 A;  1D3B B;  2RA2 A;  2AK5 A;  2CZ1 B;  2QDL A;  3H41 A;  3SWN A;  2EJG A;  2YUP A;  3KUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...