1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ply protein
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
4GBQA 2O9VA 2DL5A 2K9GA 2KGTA 1CKBA 2VKNA 3M0TA 4AG2C 3LH5A 2OJ2A 2CREA 2LMJA 1PKSA 4LE9A 1K76A 1GFDA 3GBQA 1QWFA 1RLQC 2KRSA 3VS5A 1VYVA 2K3BA 3R6NA 4Z89A 1HJDA 1PWTA 3NMZC 4J9HA 2L2PA 1AWOA 2J6OA 1RLPC 2CH4W 2EQIA 2GGRA 2L0AA 2DL7A 1JXOA 4M6GA 1QCFA 1JQQA 1B07A 2JW4A 1SHFA 2RQTA 2MCNA 4JPBW 1UUEA 1AD5A 2D8JA 1NM7A 1CSKA 5IXBA 3QWYA 4F17A 5IHNA 4HVUA 2A28A 1NYGA 2YUNA 2M51A 3VS0A 1AZEA 4OMQA 4AFQC 1RUWA 2DNUA 1S1NA 5I22A 1NLPC 2EYZA 1HSQA 2BTTA 2O88A 2DX1A 1J3TA 5FW9A 3VS2A 1WXTA 1UECA 2OI3A 1ARKA 1OV3A 2YUOA 3A98A 2ROLA 1E6GA 1Y0MA 3REAB 3VRZA 4J9DA 3I5SA 4JJBA 3PE0A 2CT4A 1PRLC 4AFUC 2CH4A 4AFSC 3U23A 2EPDA 4RTUA 2V1QA 2SEMA 1GBQA 2XMFA 1X2QA 1K1ZA 2SRCA 1PKTA 1YNZA 4DEYA 2W10A 3JV3A 2PZ1A 2JS0A 3M0QA 2EGCA 2FPFA 2D0NA 1GCQA 1UE9A 2DMOA 1M30A 2K6DA 2CUDA 2RQVA 2EYWA 1RI9A 1W1FA 2AKKA 2BZXA 4HXJA 2JMCA 1JU5C 3H0IA 2AZVA 2ROTA 1BB9A 2F2WA 3NPFA 4RTWA 2ESWA 4A63B 1WI7A 4D8DA 1W6XA 1UFFA 2DA9A 1Y57A 4OMOA 4IIOA 4OMLA 5FWBA 1MUZA 3EG2A 1ZLMA 2DLPA 4FSSA 2OAWA 2RQWA 2F2VA 1EFNA 2HSPA 4M6IA 2FPEA 2KROA 4LN2A 1UHFA 2L3QA 5I11A 2B86A 1ZUKA 1T0JA 1M27C 2RQUA 1TUDA 1YWPA 1AEYA 2JMAA 3M0SA 3THKA 4RTVA 4CC3A 3VS1A 2FPDA 2AK5A 2VVKA 3PVQA 2HCKA 4JJDA 3QAYA 1VYUA 2A08A 4ORZA 2GNCA 2V1RA 2LNHB 1YN8A 3EG3A 2RMOA 1A0NB 2YUQA 2YDLA 2W0ZA 2ENMA 2FRYA 2Q7SA 1G83A 2K2MA 2RPNA 5IHKA 1PNJA 2PTKA 3I9QA 1M3AA 4Z88A 1ABQA 1K0XA 1JWQA 4HVVA 5GJVB 2C0OA 5L23A 1AOJA 3FJ5A 3KFVA 2RF0A 2JM8A 2CT3A 4OMNA 1GFCA 2KXCA 3I35A 1ZBJA 1WXUA 4Z8AA 4D8KA 2LQNA 2YUPA 5EMIA 1YCSB 3EGUA 1X69A 2A36A 1YP5A 3EG0A 3NGPA 4LUDA 4LQ6A 1I1JA 2DL8A 1UG1A 2C0IA 1K4US 1QWEA 2DRMA 1WYXA 1AVZC 2D1XA 1ABOA 1MV0B 1PHTA 2KT8A 2KNBB 2KYBA 2EYYA 1MV3A 1X2KA 2GQIA 3RBBB 4JZ4A 1UJ0A 3EHRA 4IIMA 1WDXA 1X6GA 2L3PA 4J9GA 2J6KA 2KRMA 2LJ0A 1UJYA 2O31A 2AZSA 2O2OA 1ZUYA 2NUZA 3H41A 2J05A 2LX7A 2MOXA 1NEGA 1IO6A 2BZYA 4CC4B 1BBZA 4LUEA 4F14A 5EC7A 1AWXA 1B3QA 1FYNA 1QLYA 1AZGB 3EHQA 2CSIA 2AKLA 3H0FA 2I0NA 1KFZA 2DILA 1M8MA 4QT7A 4RN7A 1JXMA 2D8HA 1H92A 1U3OA 2DL4A 1H3HA 2JTEA 1E6HA 2P4RA 2ODFA 3QWXX 2EBPA 4J9FA 4WCIA 1U5SA 1M3BA 1NLOC 1WA7A 4J9IA 2YT6A 3UATA 2JM9A 4HCKA 2HDAA 4E6RA 1U06A 2YSQA 1X27A 2F2XA 2RQRA 1AWJA 2KBTA 2LQWA 1T3SA 1UHCA 2X3WD 1QKXA 2M0YA 3H0HA 2JT4A 3REBB 2ABLA 2EVRA 2A37A 3CZXA 3M0UA 1Z9ZA 1UDLA 2HBWA 1OPLA 1X6BA 2FO0A 3UA7A 1FMKA 1SHGA 1WX6A 1M3CA 2GTJA 4LNPA 4RTZA 1WXBA 2GBQA 2VWFA 1X43A 2FG0A 1KIKA 4JJCA 4J9BA 4ESRA 1OOTA 1T3LA 3TVTA 4Y92A 2DYBA 4AFZC 3CQTA 1GBRA 2QDLA 1UTIA 1Z9QA 4R0KA 1K0SA 1SSHA 2ED0A 3M0RA 5GJWB 1GRIA 1N5ZA 2LJ1A 1GCQC 3IQLA 1WIEA 2ECZA 1BU1A 3RNJA 1H8KA 4J9EA 4RUGA 1TUCA 2DM1A 1YWOA 2DVJA 5HCKA 4DEXA 4OMMA 1T0HA 3TSWA 4M6HA 1OEBA 5IXFA 2KRNA 3PVLA 1XOVA 2PNIA 3UA6A 1WFWA 1GL5A 1I0CA 1SRLA 1NG2A 1QKWA 2DBMA 2HEQA 1AWWA 4CC2A 2K7AA 1W70A 2J7IA 2RNAA 1GCPA 1VYTA 2RN8A 3M0PA 1PRMC 1E7OA 1BK2A 4AG1C 4CC7A 4RTXA 3NE8A 2FRWA 3I5RA 2X3XD 2KYMA 2H8HA 2JS2A 3EG1A 4GLMA 2L3SA 2EKHA 1LCKA 4BINA 1ZUUA 4M4ZA 2E5KA 2J6FA 1NEBA 2CUBA 2LJ3A 2DBKA 1UGVA 1HD3A 1ZX6A 5FWCA 1SEMA 5ECAA 1V1CA 4JZ3A 1KSWA 2ED1A 3ZL7C 3O5ZA 1G2BA 2DE0X 4HVWA 2G6FX 1JEGA 2LP5A 1CKAA 2K79A 1NYFA 1SRMA 1OPKA 3NHNA 3SEMA 1TG0A 3SHWA 1I07A 3C0CA 4EIKA 2LCSA 3VRYA 3VS7A 4F16A 2KEAA 2IIMA 2DL3A 2DF6A 2KE9A 4ZNXA 5IH2A 2FEIA 2EW3A 2LZ6B 4K11A 2DJQA 4RTTA 4KRTA 2EYXA 2DRKA 1VA7A 1ZSGA 2BZ8A 2O9SA 1JO8A 2EGAA 2JXBA 2GTOA 2CSQA 2KXDA 2EGEA 2J06A 1WLPB 2MIOA 3VS4A 3UF4A 3VS3A 3VS6A 1K9AA 2C0TA 5IHIA 1SPKA 2CDTA 4RTYA 4J9CA 4OMPA 1KJWA 2KT1A 3ULRB 2NWMA 2KR3A 3TSZA 4X1VA
chains in the Genus database with same CATH superfamily
2O9VA 4DOWA 5GAN2 4MHPA 2X7BA 5GANg 1BYMA 3SJEA 2K9GA 4M77C 2ZPGB 4M7AG 1U1SA 3I56T 4FW2A 9ATCB 3KKWA 2B4BA 4E0AA 2LCCA 1YIJT 3D7SB 2V8DA 2OJ2A 3FH4A 1NZ9A 1TIQA 2HAXA 4RS2A 4UFWA 4LE9A 1M4DA 1VQOA 2C27A 4LXCA 4PQAA 2CZ1B 1TXRA 3R95A 1RLQC 4YGOA 5GAN3 3GPLA 5F49A 2K3BA 4XTUA 3R6NA 1HJDA 1D1AA 1RADB 1RAEB 4PJOF 2V8GA 1R43A 4I49A 2L2PA 2L0AA 1RLPC 2CH4W 1V29B 1YJ9Q 3OYEA 4XTWA 1NPRA 1UEBA 4ANJA 1PSEA 4OC5A 2QQBA 2Q4YA 3I9SA 3H8FA 4J3GA 2JW4A 5LJ5e 2MCNA 1OX9A 1TKHA 2MWOA 2D8JA 3CPXA 1CSKA 1M8VA 2P0PA 2Z11A 3KQZA 3OS5A 4F17A 3GNGA 3OS2A 1QP3A 1RAHB 5DY9A 1Q7YC 4F7UF 3K2KA 1KUYA 4FD6A 2E64A 4M78E 1AZEA 1WPYA 2QJ8A 1VQ6Q 2OTJQ 1S1NA 4RCCA 2HB6A 2EYZA 3VYHB 5C82A 3QYGB 2DX1A 2LT1A 4TVRA 1OULA 1XTDA 3VS2A 3NFCA 3RERA 1QP2A 1KUXA 4J6WA 2OTLA 2OZGA 4YRHA 3EG9A 4H6UA 2DFUA 3PMIA 3CCMT 4JS4A 4OC1A 5EG2A 5M9OA 4C7IA 3MP6A 6CPAA 3VRZA 4J9DA 3J80E 4NL3A 4AFUC 4P4DA 1OZPA 3A8GB 3BLNA 2FIWA 3U23A 4RTUA 5GAMd 4M7AE 3S6GA 5HVGA 1XNIA 4ZY0A 1G5VA 5KYNA 4P4FA 3WC6A 4L6V5 1NJIC 2MAMA 1K1ZA 2SRCA 5KYYB 3SJFA 5AG4A 4IUUA 2VYTA 2HD0A 2YRVA 4PK4A 3ZEHA 4KVOE 2A0FB 1Q81U 1VQLQ 2JS0A 1HYOA 1KQSS 1LOKA 2LTOA 4II1A 2EGCA 4PK2A 1UE9A 2DMOA 1M30A 2EQJA 1VQ4T 1W1FA 3GY9A 1SKUB 1JU5C 3H0IA 5GAMf 1Z8XA 4PXBA 2ESWA 3GOXA 1V0CA 4CAFA 4K3NA 4A37A 3TFYA 1IIDA 3F70A 3MKDA 4IIOA 3NA6A 4NGQA 4CYQA 1MUZA 3EG2A 2DLPA 3SXNA 4YWYA 3KGQA 3M53A 4G1PA 1M4IA 2FPEA 3VJPA 3MEUA 2L3QA 4A4EA 4UEEA 3L2WA 2Q44A 2PDOA 3L2VA 3OYHA 8CPAA 3VWDA 3JCMW 3RBUA 4JS5A 4JXRA 4BI8B 2VB6A 2LT4A 4E7LA 2CNSA 1AEYA 2D4PA 5CR2A 4FW1A 4CC3A 1UGRB 4C0DB 2PJ9A 3PVQA 4JJDA 4M75D 1OBRA 4ORZA 4GY5A 3TT2A 4AMCA 2V1RA 4EWTA 3FC3A 1YN8A 2CNTA 5I2SA 3CD6A 2RMOA 4MZMA 3JUWA 2YUQA 2YDLA 2W0ZA 3EGDA 2JBJA 3CCEA 2QAZA 2ENMA 1VQ5T 2OZHA 4JJNK 4GLKA 2OB0A 4MFZA 4ORFA 4UWJA 2PTKA 3HHTB 1PCAA 3I9QA 1D09B 4M78D 1VQ7T 4HVVA 2PRBA 5AT1B 4C5GA 5L23A 5KTAA 1WWZA 2P6EA 2WPWA 2XEJA 3CPWS 4IUVA 2VXEA 5J1QA 1YJNT 3TTHA 4QVZA 4CGPA 4D8KA 4KOWA 4NS5A 1N8RR 1RL2A 1MMDA 2RM4A 4QQGA 2QA4T 3TCJA 3TOAA 1QVFS 2KCWA 2JZ2A 4AT1B 1VHEA 4R3LA 2A7YA 2RJFA 3RNZA 1WNLA 5A27A 3QUIA 1YP5A 2F5TX 1Z8LA 4LQ6A 2HKQB 2PJ2A 3PFOA 2HQYA 4A32A 1UG1A 2YRDA 3LGFA 1DJ7B 1M5Q1 4RUHA 4M7AD 2EQUA 2QXFA 2FCKA 2ABZA 1WYXA 1LFWA 1AVZC 4C7HA 2D1XA 2ARHA 4BD3A 5GANj 3DNSA 4XU3A 2NLUA 3OYAA 3PRTA 2P4TA 1MV0B 3D4UA 4BY6B 3CXCA 2LRQA 2KT8A 2KNBB 1Q95G 4F0YA 3IGRA 1UB4A 3QXEB 1MV3A 2XG8D 2RO0A 4C92A 3R6OA 1N8RU 1NSLA 2GANA 5GAOm 4KORA 4U9YA 2WZNA 3KI9A 3H8GA 2PQ8A 2L8DA 1G3SA 3DLLA 4A2ZA 2JUFA 2JVVA 2LJ0A 2O31A 2AZSA 5GAN4 1IU8A 4LQGA 1ZLHA 3D7HA 5GAOr 2F7VA 2PR8A 2J05A 1OX8A 3VARA 1XFOA 1IO6A 2BZYA 1BIAA 5G22A 2PCUA 2Y0MA 3G71Q 3P8DA 1K8AR 2YNCC 1UFHA 4F14A 3CCQA 1AWXA 4M75F 4XPKA 1W2BA 2WUUA 3FLGA 1RI0A 3MCAB 2DETA 4W9YA 1QLYA 3T8WA 3RMSA 2X4YA 3KXTA 2Z10A 1Q86C 2JEVA 2P0WA 3A9LA 1C1AA 1CPXA 3V7ZA 1Y9WA 1WK4A 4KOUA 2HL5C 3H0FA 6AT1B 1R0BG 1VQPQ 1M8MA 3M4YA 4QT7A 2DXCA 2QECA 4A94A 3FEDA 5IV0A 2QQAA 1J4JA 1H92A 3OA6A 1BO4A 4ELZC 3VUBA 4AG9A 5JGFA 1M4ZA 3JCMc 2XICA 3MPUB 4M7DG 4X5KA 2ZW6A 2O4XB 4P4BA 1VGYA 1VQMQ 4XK8E 4WCIA 1U5SA 1M3BA 1WQ7A 1K8AU 1MJ9A 1WA7A 4C5IA 4J9IA 1ZG7A 3G6EQ 1G3WA 1MJAA 3GIBA 2Q4ZA 4HCKA 3A8LB 2QEXQ 4E6RA 3PP9A 2VXFA 2D6FA 1RAGB 2BUEA 2IJZA 1X12A 4EMGA 3FDRA 2AFZA 2HSEB 1BOBA 4C0DC 4EFDA 2LQWA 3CC7T 1TKFA 4B12A 1XE4A 1D1BA 1QKXA 4PSXA 4X9CA 2CP5A 2GU2A 5LJ3f 1AUGA 1S72A 2CF4A 1R77A 1YX0A 2CNMA 4C8QC 4YTLA 2X4XA 1P92A 4M7AF 5A0GA 3CZXA 2DXBA 1XRYA 4UBRA 1H641 2EFIA 1Z9ZA 1UDLA 1TH7A 1FMKA 3KUFA 2K57A 3CCVA 1M3CA 2GTJA 3SI2A 2PUKB 1KQSP 3V8KA 5LJ3h 4BBHA 5GMKl 4B5PA 5G1ZA 3G1JA 4EMKC 1Q82R 2WPXA 4YFJA 1XBUA 3T9YA 1T3LA 2XDPA 4A53A 4KLVA 2QASA 4AFZC 3CEYA 4LD9K 3QJ6A 2J8RA 3FMCA 2DO3A 4AVBA 2QQSA 4XU1A 2RB6A 1GRIA 1N5ZA 3LACA 3OBYA 3L42A 1WIEA 5GANd 5DWMA 4JDSA 4H89A 4JLGA 4DBHA 3C12A 4PJOB 4MFLA 2MF2A 3JB9I 3FXTA 2G3RA 2WSCE 4DEXA 2VZZA 4UF4A 4QW2A 2ZCFB 3TSWA 4M6HA 4EPCA 2P6GA 1OEBA 3IWGA 1XQHA 1GYTA 3CPAA 1ZSZC 1Q82U 5K8MA 1GL5A 1I0CA 3OYNA 3QJYA 4BY6C 2R5MA 4CAXA 3CXSA 1VQ9A 5FRMA 3G4SA 5FU6B 4BDYA 4IUSA 3GP8A 3C4SA 1AWWA 1UGPB 1W70A 1XF8A 3IJ3A 3DGVA 2AHJB 3M0PA 1GCPA 2K5TA 1RABB 4XNHB 1Z4RA 1E7OA 3X28B 3FB9A 4CC7A 2X4JA 3NE8A 2FRWA 4F7UB 2X3XD 4HCCA 3EG1A 2JS2A 4RCBA 1YI2A 1IGBA 2L3SA 1ZG8A 4LDUA 1ZUUA 4Z65A 2WSFE 4PJMA 1D0ZA 2ZXVA 4O6JA 3MEWA 2FZGB 2WSAA 4MMOA 4NFRA 5ECAA 1S7FA 4ONUA 3V8IA 1KSWA 3CPWP 1YJWT 3CCJQ 2DE0X 2GFAA 3LH0A 3P8HA 5LJ3e 5GMKi 1I12A 3QIIA 4BDZA 3FB3A 1NBEB 3LWIA 2R7HA 4XAXB 1QVFP 1NMTA 2JJ9A 3IWEA 3JRUA 4L5GA 3H8EA 3CXPA 2ZEDA 5HK3A 3IU2A 4CRYB 4PSWA 5DWNA 2CTBA 3BFMA 2MPXC 3K9TA 5HXDA 2ZZDA 1PSFA 2RK1A 3M56A 3V7RA 2LCLA 2V8HA 2KEAA 4Y49B 2IIMA 3F8KA 2J9AA 4KH0B 5IH2A 5GAOq 1M1KC 2RH2A 2BE9B 5D6XA 1QVPA 2DJQA 1G3YA 1PC0A 2ZEMA 2Q51A 4NGSA 3FECA 2KQWA 3CC2T 1HDUA 4OLLA 1ZA1B 1I1DA 2EGAA 4BI4A 3B2YA 4CRZB 4FAIA 2DEQA 2EGEA 2J06A 2MIOA 2DTHA 1K9MC 2ZW5A 1K9AA 1Q2DA 3PB8X 1D0YA 5EBVA 4OMPA 3RDVA 1KJWA 4QUSA 3CXQA 2KT1A 1OZ2A 4HNXB 2NWMA 4FD7A 1VKCA 1YHQQ 3HL8A 2C1CA 2DL5A 1P0HA 3B3VA 2KMTA 5KYYA 2E65A 2Y4YA 4ZTFA 2PC1A 2Z0ZA 3H6ZA 4M77G 1YITA 4CGOA 2KVQG 4UFXA 2YNCA 4A38A 1YJ9T 2RJEA 3LLRA 2L5QA 3JB9G 3S3MA 4B9WA 1K76A 4M7DD 1GFDA 3URGA 2PVOB 1BCOA 1X10A 2AFSA 2ZPEB 2KRSA 3VS5A 4FM4B 1VYVA 1S7NA 5THWA 4OF1A 2P0QA 4LDYA 4MCRA 1Y7EA 3PFSA 4J9HA 3L2RA 2CGHA 2COWA 1P4NA 5F47A 3L1AA 4X2TA 2EQIA 1Z4EA 3LODA 2DPPB 4MHZA 1JXOA 3OMCA 5I2MA 1QCFA 2EWNA 5GAN6 2FSRA 2I00A 1FWZA 1SHFA 1VQ6T 2OTJT 3CCSA 1XMBA 1AD5A 1K73C 5A0LA 5E96A 2PJ6A 3ISXA 1I5LA 2K2VA 3B35A 4HVUA 2A28A 2G3AA 1BI3A 2LVMA 3BI1A 4HKFA 2EQKA 2B4DB 3VS0A 1D3BB 3WC7A 4AFQC 4F04B 4ZGDB 3KL9A 5KYXB 2HKNA 4XNHC 3F0AA 4QQ6A 4OP0A 5I22A 1NLPC 1HSQA 2O88A 1M90R 1QCOA 2Q7BA 2ZW7A 3RO0A 4EDUA 2CTCA 2OI3A 1ARKA 2NYSA 2EUIA 3A98A 2NSMA 3CPFA 1E6GA 3JCMQ 4L89A 1Y0MA 2LC4A 2F5KA 1RAAB 5IB9A 3REAB 3I5SA 5LJ3g 4JJBA 3KZWA 3PE0A 5C0MA 1VQLT 3TC8A 5CNPA 2VC8A 4AFSC 4C92E 5LJ5f 1VIFA 2ATCB 5D29A 2D4OA 3S9NA 3FRMA 5A2QE 1ON0A 1GBQA 1YMEA 3ISZA 1WHJA 1KHCA 2K5FA 4B6MA 1CBXA 4P6YA 3NTIA 1IICA 3PEIA 1M90U 1B87A 3S9LA 4R56A 2I79A 3S6FA 4FYYB 1QQJA 5HKCA 4P4JA 5GAMj 2PJ4A 4MZPA 2K6DA 3WVDB 2RQVA 4A54A 2AKKA 2BZXA 2DTIA 4AXVA 2PIYA 2AZVA 3NPFA 4M75B 2EQMA 3ZFJA 2CIJA 4M7DF 4KUDK 4KOYA 2A4NA 1M2VB 4A63B 5CO7A 3HP9A 4NGTA 1W6XA 3OBWA 2FS5A 1I4K1 1TUGB 2DA9A 1CP7A 1N6AA 2EK9A 5IX3A 5F09A 2IPOB 1Q7YU 1X75C 1EFNA 1H3ZA 4TNUA 3D66A 3PB7X 2KROA 2V8VA 4O23A 1ZHIA 3IWWA 1VQ8T 1T0JA 1M27C 2DTOA 4L8AA 4ZY2A 4C92C 1AT1B 1YWPA 3I56A 1AHJB 1YIJA 4Y91A 2JMAA 2VUBA 3OYLA 4RTVA 3BXMA 4X8IA 3CCRT 4OMFB 3VS1A 1AYEA 3AT1B 2VVKA 3QAYA 4ZY1A 2A08A 2OOTA 1BAVA 4MJ8A 4P45A 2OU2A 4KGZB 1TKJA 4EMEA 3V7CA 4DBFA 4FWUA 2Q43A 3QSUA 3S6WA 4RKUE 1N9SA 4E2AA 3FJPA 2NYQA 2C6CA 1G83A 2RPNA 2RHUA 2JN0A 2QGGA 2RI5A 1K0XA 1JWQA 4R3KA 1JJ2S 4AG7A 2R57A 4OIWA 1AOJA 1D0XA 3SDZA 2JM8A 3HKSA 2IMOA 2CT3A 4Q38A 1U8RA 1YR0A 1GFCA 3CMEQ 4U5YA 2K4YA 1B34B 2KXCA 1ZBJA 2O4XA 3PT9A 4NGPA 4UCPA 2OX7A 3FBUA 4E7SA 2XEIA 5EMIA 4QVTA 5ISVA 2QG9B 3CCLQ 3EGUA 2COZA 2DYIA 2PJAA 5G20A 2RJCA 3PBBA 4FD5A 1Z8TA 1QW1A 2HQXA 3O8VA 4OGCA 1M9SA 3KR5A 2V26A 3OY9A 2CP6A 2DL8A 3RESA 4MRIA 5CKEA 1QWEA 4MY0A 4LX9A 3CCMA 4ZX9A 2DRMA 2ZW4A 1JB0E 1QSMA 2QTXA 4M77D 1Q81R 3T90A 2FT0A 5GMKm 1X6OA 2BE7D 4CYPA 1KC8C 3RMQA 4N4IA 1MJBA 5LYIA 3JB9D 4NF1A 1X2KA 2ZEFA 8AT1B 1FY7A 1UJ0A 2QTVA 3M5AA 4NSQA 1Z5RA 1WDXA 4R55A 3PGGA 3GUXA 3G71T 3TO7A 2QDYB 4P44A 2BO9A 4NXYA 1OYXA 5GAOp 4PXCA 1WHHA 3H41A 2IL4A 2H3EB 1MK4A 2MOXA 2GQVA 1BBZA 1VQ4A 2HBPA 1VQPT 3VH9A 5JQ4A 3K9UA 3QBYA 1KWMA 5D6WA 4C0GA 3CCUQ 3EFOB 4BUGA 2YGWA 2CZ0B 5D8NA 4X34A 1AZGB 3OYBA 3EHQA 5GAN5 1KHIA 1UGSB 2PJCA 4PJOA 5LYFA 4KZTA 3DDDA 2WSEE 1VQMT 4ELYC 2I0NA 4KT0E 2QGFB 3WVEB 4N4GA 3G6ET 1JXMA 2M1HA 2D8HA 3VU3C 3SI1A 5CKBA 2QEXT 4FBEA 3MGDA 3H9NA 2J8NA 1CP6A 1PM3A 4GM5A 3JB9H 2K3XA 5GCNA 2K3YA 3E1SA 2YNDA 4MHNA 4OB3B 2YT6A 2WYRA 4OGEA 3UATA 2DAQA 3OQ5A 3P2FA 3W6XA 5LRKA 1YREA 2HDAA 3OYGA 3CBPA 4F7UA 4KVME 1X27A 5LJ3j 5F46A 2AT1B 2Y90A 3IC1A 1T3SA 2YRCA 1UHCA 2GFUA 4FYVB 2M0YA 4C0FA 1VQ8Q 3MP1A 2JT4A 4PNOA 1VUBA 1YSJA 1VQ5A 2A37A 2F1LA 3M0UA 1GXIE 1IREB 4M77F 4C8QG 3CCRQ 2LQKA 1PG5B 1OPLA 1X6BA 1VQ7A 1M44A 1C0MA 1WX6A 1XIXA 3JB9F 4LNPA 4RTZA 4LUAA 3N5FA 2C06A 1YJNA 2VWFA 2FG0A 2CZ6B 1TXQA 5LJ5g 1KIKA 4JJCA 4J9BA 3P2HA 5GAN7 1Q86U 4Y92A 3SB2A 5KYWB 3CC4Q 2R98A 1N9RA 3TOBA 1Y07A 5CVIA 2QDLA 1O9SA 1UTIA 1Z9QA 3G7ZA 2NMTA 1K0SA 4HCZA 3SXOA 4Q5WA 1VQNA 5CQYA 1GCQC 2RHZA 1VHSA 4EVYA 2ECZA 1BU1A 3N7ZA 2R5AA 3V8LA 3DB4A 3A1PA 1S7LA 3MEAA 5HCKA 1BPMA 4C5EA 4A4HA 4OMMA 4MCPA 4P4IA 5IT9E 5IXFA 4J6XA 1XJOA 3PVLA 1XOVA 1VQOQ 1WFWA 2O4HA 1Y0RA 4RG8A 1OI1A 3RYOA 4OMEA 1QKWA 2DBMA 2HEQA 2L3RA 5JH9A 1KQSA 3M55A 2R58A 3V8JA 1R0CB 2K7AA 1N27A 2E5QA 4CS0B 2JTMA 2CP0A 4JZ0A 1PRMC 4U9ZA 1G8XA 3NTHA 2KYMA 4HKEA 3CCJT 2EKHA 1LCKA 4BINA 2PJ1A 5BWAB 2NUTB 3W6SA 1IGUA 3HLPA 1NEBA 1O75A 2GLFA 2VGMA 2LJ3A 2DBKA 1YK3A 1UGVA 5FWCA 2CS7A 3PTAA 3VYGA 1JJ2P 3RKXA 1V1CA 4C8QE 4N0AC 1MMAA 3O5ZA 4KUAA 4PV6A 1G2BA 2JOYA 2AJ6A 3R1KA 2BUDA 3AHUA 3QAHA 1S60A 2G6FX 3I1UA 3PGPA 1JEGA 4IAVA 3Q1JA 2LP5A 5J8FA 2K79A 3JTKA 4NL2A 3VWEA 3QHSA 1NYFA 2OZUA 2OTLQ 1SRMA 2CKKA 2DEAA 3TCVA 1YW4A 3B8GA 4RMOA 4QC6A 2ZPAA 4PK3A 4J7IA 1NSAA 1I07A 3C0CA 4EIKA 4M78F 1JBMA 3E19A 3VRYA 2VI7A 5LJ3d 3BE3A 2GIVA 3GF5A 4R87A 5HMNA 5JM6A 1OU9A 2B4DA 2DF6A 3PB9X 1D1CA 4ZNXA 1D3BA 1Y7XA 5KYXA 2EW3A 3CC7A 2AIRB 2VQYA 3PB6X 2AFOA 4ZN1A 4E2FB 3GKRA 5LL6S 2DRKA 2DD4A 4PFZA 5LRJA 3LW5E 5CK9A 1MNDA 2O9SA 2JXBA 4M7DB 2AFXA 1BIBA 5KCOA 2PVDB 1YHQT 2CSQA 1H8LA 3E0KA 4NJQA 2Z3MA 4P5NA 3X24B 3CPWA 4WWVA 1CG2A 3MEVA 4F9VA 2XEGA 5DLQE 4J9CA 3QKJA 1QVFA 3TSZA 4F8ZA 3OYIA 4OIDA 1CKBA 2F5IA 1IB8A 4HA8A 1N8RC 3GYAA 3M0TA 3B3WA 2EKOA 3A8MB 3HRUA 1G3TA 2Z3OA 2LMJA 2PSWA 1PKSA 3HSBA 2JDCA 2V8KA 1Y0YA 2JEWA 3GBQA 2VV5A 1ZBXA 1QWFA 1F1BB 2X4WA 2ZELA 3IEHA 4UWIA 3OYKA 3VKIA 1I5OB 4C2YA 4Z89A 2DZ9A 2Q4VA 3WC5A 4M75A 1PWTA 2ZPIB 3TO6A 2HUZA 3ZBDA 1M2VA 4XTXA 2XD0A 4OC4A 5D6YA 1VQKA 1AWOA 1GHEA 1IY7A 2GGRA 4FYWB 2DL7A 2FE7A 3QNVA 2FZKB 3PMTA 1Z8WA 5I21A 4ZGYB 3A8HB 3UT1A 4C2ZA 2HQEA 1ELLP 1B07A 3I55A 3CD6Q 3PZJA 1M1KU 3D7GA 1UUEA 4LDXA 1FMWA 4NEXA 4E8OA 2PQWA 3FYNA 4E47A 3CCEQ 5IXBA 3QWYA 1PU9A 2AFWA 3EXNA 2CYZB 2J8MA 4CYNA 2RD1A 4C8QD 2YUNA 4JRQA 3I3GA 4J5YA 3M54A 4FYXB 1RUWA 1WHGA 1K8AC 4R8FA 2BTTA 1EZZB 1OQKA 2JTFA 2C6PA 1DE4C 5EC4A 3WABA 3TEEA 4FSXA 1OV3A 3KQXA 2H3JA 4QVDA 4XU2A 2ROLA 3SD4A 1AMPA 3MO8A 5LJ5j 3PIOA 4KSIA 4F6AA 1SSFA 4C5HA 5J3BA 4FUUA 3WR7A 5KE3A 2PVVA 1PRLC 4A4FA 3D2MA 4FD4A 1WJSA 4XQ3A 2RK2A 3B3TA 4JUVA 3WXMB 2XMFA 2R8VA 4MY3A 1X2QA 3T9NA 1YLEA 4CRIA 1PKTA 1B34A 2KAFA 5D7UA 2QYVA 4CI0C 2K5LA 1YBYA 2PZ1A 1B7TA 3MHXA 3M0QA 2FPFA 4JJXA 1GCQA 3IO1A 3CMAA 2ANPA 1MGQA 2CUDA 2EYWA 5FU7B 2LNVA 5AG6A 4HXJA 3CC2A 4B11A 4MDXA 2ROTA 1BB9A 2F2WA 4HT9A 1HDQA 1U1TA 4RTWA 1HK9A 5KYUB 2QYZA 3ER0A 4E7HA 1U6MA 4D8DA 3B7IA 4BE0A 3DKMA 2B3UA 4B6ZA 1Y57A 4PJOE 4OMOA 1KK7A 2NUPB 5KE2A 1F2OA 4FSSA 5GMKh 4CGNA 2RQWA 2F2VA 4WF2A 2HSPA 1LJOA 3CCQQ 4UIBA 1IOFA 1KD1R 2FIAA 4LN2A 1WHLA 2YLCA 3MJXA 1ZUKA 4PFOA 2IQ6A 1JQGA 4UA3A 1Q82C 1TUDA 3JCMf 2ZEPA 2VGNA 4C92G 3THKA 1IRXA 3M0SA 3JCMP 4K30A 1QVGS 2FPDA 1YJ9A 4PLLA 4C8QF 3EFAA 3OYDA 4F7UE 5C6SA 2GNCA 4L59A 2Q0YA 2LNHB 1CX8A 1FNOA 2X9HA 3RZAA 4BMHA 1DTDA 2FZCB 3L2QA 4N0AA 3EFOA 3JCMh 3IIBA 1A0NB 1KD1U 3JRZA 4LDVA 5FRNA 3UWNA 5K8NA 2QK0A 3CMET 2FRYA 4Z02A 1LRZA 2Q7SA 2K2MA 3CT9A 3D7DA 4OB1B 4M77B 3M58A 4IUTA 1FT7A 1I81A 2JDDA 1M3AA 4Z88A 1ABQA 3TREA 3CCLT 1LAMA 3OW2S 4KULA 2GCXA 1VQ6A 4PJOC 5GJVB 2OTJA 4XPDB 5GANe 3FJ5A 1A2ZA 1VIXA 2ZGWA 2DVEA 1S72Q 1RAFB 1RXTA 3I35A 2ATRA 5GAOl 2REEA 1LVKA 1BCMA 4Z8AA 3QG1A 2XEFA 5J26A 5HH1A 1YCSB 1OZ3A 2FB7A 2PRQA 3KHZA 1XEBA 1RACB 3E9FA 1M1FA 5FU6C 3P8BB 3CCVQ 3X26B 4HNYB 1ZG9A 3EG0A 2K5IA 3NGPA 3HFNA 4LUDA 3OS0A 1BPNA 4KUIA 2X51A 1FXXA 2HV2A 1PD1A 2MI6A 1QSTA 2E41A 5LJ5d 1XMTA 5CKDA 1QMUA 4BB7A 5H84A 5GMKe 3OYFA 4QQDA 1PHTA 1IHWA 4DJLA 4PFPA 1VQLA 4JRKA 3OS1A 2P6FA 4IUQA 5LYLA 2RHYA 1VQKQ 1Q2YA 5AGEA 5K8OA 4IIMA 4H2KA 3ZJ0A 1VHOA 2PJ3A 4A31A 2BL1A 5HK0A 1X6GA 2L3PA 4J9GA 2J6KA 2KRMA 1KG1A 3D2PA 1UJYA 2O28A 3CCUT 2O2OA 1ZUYA 5CKFA 4MCQA 3G8WA 3I55Q 5CKHA 4MMLA 2NUZA 3DR8A 1YCYA 4NOYA 1Q7YR 2M0OA 5KYWA 3QZ5B 2LX7A 1LANA 4J6YA 1RTQA 3S6HA 4CC4B 3JCMe 1VQ9Q 4XTVA 3G4SQ 1BKBA 1ZLIA 1LAPA 1B3QA 2QQRA 1NE9A 4KOXA 3MN8A 4PPZA 5KH6A 1WHMA 5FU7C 4MMKA 4Y49C 4AVCA 1C6VX 2MWPA 2CSIA 1IHVA 2ZPBB 3H5ZA 2V8IA 4B9XA 2QQ9A 1YI2Q 3EH2A 3EFSA 1KFZA 2DILA 2AFUA 2EWBA 4R76A 1SG5A 4RN7A 3UDCA 2DIQA 4PXEA 1U3OA 1H3HA 4ME7A 4GS4A 3JCMX 5ELYA 2ZOFA 2P4RA 2E6NA 2WACA 1YLOA 4B14A 2Y4XA 3SWNB 1NPPA 2C6GA 4CAWA 1Y7RA 1NLOC 3S3OA 1NJIR 4R6TA 2BSWA 2EJ9A 5LYDA 4ZGEB 3QPHA 3V7SA 3BJ8A 1TS9A 4M78B 1FX7A 5C88A 2JM9A 1KC8U 4DBRA 2RFHA 1LOJA 3W91A 2PE3A 1TWBA 3RIRA 4DUKA 1BI1A 2RQRA 1AWJA 4AB7A 1WGSA 5CQXA 2NUTA 2X3WD 3B3CA 3PB4X 3D7FA 3R9FA 3CMAQ 3JB9J 1CPSA 3FF3A 5IB0A 1QSRA 2BKDN 4ONWA 2VASA 4C2XA 5IN1A 1S3ZA 3OSSC 3DLJA 4CGMA 2HBWA 1NJIU 2FO0A 3CC4T 4VUBA 5HY6A 4M7AB 1R8OB 2DKGA 5J8CA 1YFNA 4KH1B 3GLJA 4A33A 1RAIB 2KY9A 2QMLA 4XPDC 1SF9A 5KCHA 4ESRA 1ZQ1A 2MMPA 3TVTA 5CAIA 1EE3P 2DYBA 4ZBGA 4KGXB 2B8AA 3L2UA 4QBJA 2Z3KA 1SSHA 3M0RA 3JVNA 4DA4A 1M90C 2POKA 3C26A 5AYFA 1VQOT 2RC4A 4MFQA 1TUCA 1YWOA 4M75E 4C92D 5GAOn 1YITQ 4HT8A 4M7DA 2AFMA 2PJ0A 4UFVA 3INZA 1RO5A 1UWYA 2EK8A 2I3CA 2KRNA 3UA6A 2PNIA 1SRLA 2LDMA 2GLJA 4MXUA 3G71A 4F0XA 1QVGP 4BE1A 3EGXB 4JLYA 4C68A 2RN8A 3LGLA 1BK2A 4AG1C 2YXYA 1PYTB 4RTXA 3QDRB 3I5RA 1IXDA 3BY7A 3JCMg 2REFA 1VQPA 2E5KA 3CCSQ 3UPUA 4KGVB 3PFEA 4Q36A 2CUBA 1JRIA 5LRGA 1PCXA 2DIGA 1L0CA 1ZX6A 1SEMA 3RR6A 3OW2P 2OTLT 3X20B 4JZ3A 3FJUA 1IZ6A 2MYSA 1VQMA 1EX4A 2ZEHA 2GE3A 4MDWA 4PKCC 1KZFA 1Z2LA 4HVWA 4NGNA 3G6EA 4A4KA 4RG2A 3JCMJ 4M75C 4UEZA 2QEXA 3E2UA 3MP8A 3FX6A 4A39A 2V8JA 3EC4A 1OPKA 2DPSA 4GXHA 3CXCS 1WJRA 3RAMA 1Y9KA 1TG0A 4JRIA 3SHWA 1Y71A 4OKOA 2IVWA 3IU1A 4KVXA 3WT4A 3SWNC 3HRTA 4DYOA 4MZTA 3DB3A 2KE9A 4M78C 3LWUA 2Q04A 4P4EA 2LZ6B 1UGQB 4ZTJA 5AG5A 4KRTA 4OVAA 2PJBA 5FLXE 4ATOA 3EO4A 4NCZA 1VA7A 2BZ8A 1Y96B 3L2NA 1JO8A 2GTOA 1Q86R 1JJ2A 4KSFA 4D6WA 1WLPB 1ZO0A 3VS4A 3UF4A 3VS3A 1W2BS 4C92F 3M9QA 5GAMh 1YQEA 2CP7A 1QQ9A 3CDXA 4B13A 4MCSA 2FXFA 2B5GB 3PNWC 4IK2A 3D3SA 4CYOA 4MBUA 4EMHA 3LYIA 2Z3PA 3GLXA 2DD5A 3H8ZA 4X1VA 4GBQA 1WHKA 4BE2A 3CBMA 4J7FA 3VV0A 3LX7A 4M7AC 2ZEOA 3NFZA 2KGTA 4CAVA 3FRNA 4R9MA 2VKNA 4AG2C 3NH4A 4V2SA 3LH5A 2P0KA 2QA4A 2CREA 4OB2B 4KLWA 1QSNA 1PD0A 4C8QB 2PJ8A 2E4HA 4IUPA 3LMSA 3EFRA 3LD2A 4ZGJB 3C95A 2DJZA 2DXTA 3I56Q 3CD6T 1YIJQ 3NMZC 1Q81C 5KYUA 4E7KA 3PIPA 2OAUA 2J6OA 3CCET 1K4JA 4MHDA 1BLLE 4NJRA 2NUPA 4IURA 4KOVA 4EMKB 4M6GA 1JQQA 2IG0A 2CP3A 2RQTA 3KBGA 4JPBW 2F8HA 1NM7A 4AVAA 2GFQA 4F9UA 3ASKA 2KI7A 5IHNA 1I21A 3ME9A 1BI2A 1VOMA 1NYGA 4P10A 4JRPA 3KR4A 3MRUA 2B58A 2M51A 4JWPA 3SHPA 1WJQA 1VQNT 1V76A 4DOVA 4OMQA 3CCJA 2DNUA 2EJFA 3QYHB 2DERA 1X01A 7CPAA 3HFOA 4FCYA 2RJDA 1J3TA 2A3LA 1M4LA 3IFEA 5FW9A 2PJ7A 1ZSZB 1WXTA 1UECA 2QIRA 5GAMe 4QVCA 2YUOA 3SJXA 4UC4A 3QO3A 3JCMV 2X35A 2Z3NA 3A5ZB 2CT4A 4B10A 2CH4A 1B6BA 4M77A 2OR4A 2EPDA 2V1QA 3CCMQ 2SEMA 4II9A 2JBKA 2PU9B 4MFPA 3BW1A 3OYMA 3FIFA 5GMKj 1YNZA 4J8OA 4DEYA 2DEUA 2W10A 3JV3A 2PR1A 2LX9A 3L2ZA 2D0NA 2E1HA 3EY5A 4KBMB 1RI9A 2ZENA 4X9DA 2PVWA 4YU9A 3NH5A 2JMCA 3CCQT 2XI9A 4ZYQA 1PUAA 2HNIA 1WI7A 3RKYA 2OH1A 3QZ9B 1YHQA 2EYQA 1UFFA 3KHXA 2HC9A 2G9DA 2O53A 4OMLA 5FWBA 3BJ7A 3HUVA 1ZLMA 2OAWA 1VQ4Q 1IGQA 1YGHA 5IAYA 1LNXA 4M6IA 3GIUA 2PVGB 2P84A 4ZX8A 3M57A 1UHFA 4OP4A 5I11A 2FL7A 2Z0WA 2B86A 2FL4A 3D67A 4WJBA 3H4QA 4OAEA 2HL3A 2HMAA 2RQUA 3HTRA 1QSOA 2ZEGA 3F5BA 3RUXA 3R9GA 3C94A 3OYYA 2DXUA 4KOSA 5DS0A 2BIVA 2XHCA 2AK5A 2HCKA 4BD9A 4FT2A 1VYUA 4PL6A 2DF5A 1TSFA 1M1KR 1YW6A 1ARMA 1VIEA 3EG3A 2RI3A 3EG9B 4MFKA 1M4GA 3QB8A 4B5OA 4CAEA 2XKOC 2YHTA 1S72T 3BHXA 2FVGA 3CXCP 3NH8A 4O5VA 4TWEA 2D9TA 3TE4A 2XK0A 1K9MR 2EO8A 5IHKA 1PNJA 4HCBA 2RHXA 1R3NA 4DNCA 2G3TA 2C0OA 2GF7A 3CCVT 5JPHA 3KFVA 2RF0A 3J81E 4MFJA 4Y28E 2DK3A 4PJOG 1M1DA 4OMNA 2BOAA 1IYLA 3M59A 2KDSA 2CZ7B 5KTCA 1VQ5Q 3SWNA 1WXUA 4XU0A 1IYKA 1KUVA 2YNEA 1LPLA 1QMCA 3OYJA 4NGMA 2LQNA 2YUPA 1VQ7Q 3BDLA 4M78A 2ZOGA 3B3SA 1X69A 4OC3A 3HRSA 1MMGA 2ZEEA 2A36A 2M9UA 3QDFA 3N5BB 1I1JA 2ZAEA 1YJNQ 1W2BP 1K9MU 4MHYA 1KQ1A 3OB9A 2C0IA 1K4US 5GAMg 1M1GA 2QA4Q 1VQKT 4M85A 3JAME 3TO9A 3OSVA 3SI0A 2MK5A 4F7UG 2CP2A 4M7DE 3R96A 4PLIA 4PJLA 1ABOA 2EJGA 1IB1E 2KSSA 3I55T 1VQNQ 3R9EA 3TX8A 2EYYA 2KYBA 1YJWA 1R57A 4PXDA 2GQIA 3S6KA 3RBBB 3VUZA 2COYA 4JZ4A 5GANf 3EHRA 4M7AA 4FL6A 4NGRA 1LCPA 1VQ9T 1HEEA 3G4ST 3D68A 1K73R 2QVPA 3HPWA 3FNCA 2XDDA 3TU4K 2YWWA 3G3SA 1NEGA 5GANh 1ARLA 1MMNA 1YI2T 2KK4A 2RB7A 4LUEA 1N71A 2VL1A 2FYKA 5EC7A 4JYWA 2E3IA 5G21A 4QB9A 1FYNA 2HQHA 5I0CA 3EGDB 4RI1A 4OC0A 4Q7AA 1EIFA 1Q7LA 2AKLA 2PUOB 5HVFA 2R1IA 1K73U 3JCMd 3OWCA 2PIZA 2DZCA 2B3VA 4UCMA 2XU8A 3DSBA 4HPSA 2DL4A 2JTEA 4M7DC 1E6HA 1WQWA 4E7JA 2D0QB 3FEOA 5CCAA 3KASA 4OC2A 2Z3LA 4IF5A 2ODFA 3BI0A 1TOVA 3QWXX 2EBPA 4JXQA 4J9FA 3V38A 4R7MA 3EGXA 1CJWA 1HXDA 2VEZA 4A95A 2M02A 2EBJA 3EAEA 2I2LA 2CXAA 4UIAA 4ZI6A 3CMAT 2ZPHB 2E3HA 3X25B 2GREA 2VZYA 4DBQA 3S9MA 4UEFA 2EIFA 1U06A 2YSQA 4KOTA 2F2XA 4LDWA 1WZOA 2KBTA 4OB0B 4KS9A 4MI4A 2PJ5A 4JLIA 2RHIA 1ACMB 3GNFB 1CM0A 4IKFA 3H0HA 2DPTA 2XIDA 2G0BA 3REBB 2LQ8A 2ABLA 3CMEA 2EVRA 3SFMA 4CPAA 1MHNA 2EAYA 3UA7A 4C92B 3TQ7P 1Z9UA 3CC7Q 3CCLA 2BEIA 2RA2A 1SHGA 5I4MA 2F69A 3UY5A 3M4GA 1WXBA 2GBQA 3FVLA 5A0DA 1Q2CA 1X43A 2YLBA 2E12A 2VBQA 4BACA 5J39A 1OOTA 1BI0A 1QCNA 2JNGA 2JLMA 4E7ZA 3E9GA 3J7AF 1YITT 3CQTA 3OMGA 1GBRA 3FIXA 4R0KA 3SJGA 2ED0A 4PJNA 5AG7A 5FROA 1SQHA 1TF9A 5GJWB 2VXKA 2LJ1A 3RKWA 3IQLA 4A30A 5CIUA 5CPAA 3S3NA 4XPLA 3RNJA 1H8KA 5A28A 4J9EA 4RUGA 2DM1A 3NTKA 1Y96A 1KQ2A 2DVJA 4FU6A 1TF8A 3PBEA 1T0HA 4ZN3A 5CBMA 1IOIA 3JCMb 2O01E 1NE8A 4BI3A 5F48A 4M3SA 1NG2A 2B5GA 4HNWB 3CCST 8ATCB 4CC2A 1I8FA 3DLMA 3CCUA 2J7IA 2RNAA 1TU0B 1VYTA 3JSCA 5DLOA 5FVJA 4N4HA 2E10A 3LWHA 1ELMP 2V77A 3VATA 2H8HA 4GLMA 2AE6A 1M2OA 5DM7R 4M4ZA 3ZZIA 2J6FA 1OU8A 4A4GA 4PJOD 4KUBA 4C8QA 5KTDA 3NE7A 1HD3A 3EH1A 4UCNA 1F57A 4XTYA 2HZYA 2ED1A 1F2PA 3ZL7C 3DR6A 3D8PA 3FEEA 1KC8R 2E70A 1TTHB 3A8OB 4QKUA 2H5MA 4EMKA 2FHDA 1XJWB 2QI2A 1KD1C 2XDBA 2BCOA 1CKAA 4M77E 2EVNA 5HVHA 5K8PA 4M75G 4LD6A 1ZA2B 4B5PB 3NHNA 1QVGA 1FMVA 3META 5H86A 3SEMA 2ZPFB 4IHMA 1YJWQ 2DXQA 1S5KA 5LJ5h 1VQ8A 2LCSA 4JD6A 3CBOA 4FIBA 3VS7A 4F16A 1YVKA 2DL3A 4XTZA 2E6ZA 1W4SA 2M16A 4R57A 4E7IA 4OADA 5GAN8 3CCRA 4H6ZA 2FEIA 2L89A 2RI2A 4K11A 4M78G 4RTTA 3GB0A 2EYXA 4WTOB 1ZSGA 2FVUA 1ZSZA 5L8RE 4PJJA 4FT4A 4X3RA 2CY2A 4J83A 4C0ZA 4DQ2A 3OW2A 2KXDA 1S7KA 4CGLA 3BDUA 3VS6A 2C0TA 3OYCA 3CC4A 5IHIA 1SPKA 2CDTA 4RTYA 1MNEA 3CC2Q 4KSAA 3ULRB 1YVOA 2KR3A 7AT1B
chains in the Genus database with same CATH topology
2O9VA 4DOWA 5GAN2 5GANg 1BYMA 2K9GA 4M77C 2ZPGB 4M7AG 1U1SA 3I56T 2LCCA 1YIJT 2OJ2A 1NZ9A 2HAXA 4LE9A 1VQOA 2CZ1B 1RLQC 5GAN3 3GPLA 2K3BA 4XTUA 3R6NA 1HJDA 4PJOF 2L2PA 2L0AA 1RLPC 2CH4W 1V29B 3OYEA 4XTWA 1NPRA 1UEBA 1PSEA 2QQBA 2JW4A 5LJ5e 2MCNA 2MWOA 2D8JA 1CSKA 1M8VA 2P0PA 3OS5A 4F17A 3GNGA 3OS2A 1QP3A 5DY9A 1Q7YC 4F7UF 1AZEA 2E64A 4M78E 1WPYA 1S1NA 4RCCA 2HB6A 2EYZA 3VYHB 3QYGB 2DX1A 2LT1A 4TVRA 1XTDA 3VS2A 3NFCA 3RERA 1QP2A 4J6WA 2OTLA 3CCMT 3PMIA 4JS4A 5EG2A 5M9OA 3MP6A 3VRZA 4J9DA 3J80E 4NL3A 4AFUC 3A8GB 3U23A 4RTUA 5GAMd 4M7AE 1XNIA 1G5VA 4L6V5 1NJIC 2MAMA 1K1ZA 2SRCA 4IUUA 2VYTA 2HD0A 2YRVA 3ZEHA 1Q81U 2JS0A 1KQSS 2LTOA 4II1A 2EGCA 1UE9A 2DMOA 1M30A 2EQJA 1VQ4T 1W1FA 1JU5C 3H0IA 5GAMf 2ESWA 3GOXA 4IIOA 3F70A 1MUZA 3EG2A 2DLPA 3M53A 2FPEA 3VJPA 3MEUA 2L3QA 4A4EA 3L2WA 3L2VA 3OYHA 3JCMW 4JS5A 4BI8B 2LT4A 4E7LA 1AEYA 5CR2A 4CC3A 1UGRB 4C0DB 3PVQA 4JJDA 4M75D 4ORZA 4GY5A 2V1RA 3FC3A 1YN8A 5I2SA 3CD6A 2RMOA 4MZMA 2YUQA 2YDLA 2W0ZA 3CCEA 2ENMA 1VQ5T 4JJNK 4GLKA 2PTKA 3HHTB 3I9QA 4M78D 1VQ7T 4HVVA 4C5GA 5L23A 3CPWS 4IUVA 2VXEA 1YJNT 4QVZA 4D8KA 4NS5A 1RL2A 2RM4A 4QQGA 2QA4T 3TCJA 1QVFS 2JZ2A 2A7YA 2RJFA 1WNLA 3QUIA 1YP5A 2F5TX 4LQ6A 1UG1A 3LGFA 1DJ7B 1M5Q1 4M7AD 2EQUA 2QXFA 1WYXA 1AVZC 2D1XA 4BD3A 5GANj 4XU3A 2NLUA 3OYAA 2P4TA 1MV0B 4BY6B 3CXCA 2LRQA 2KT8A 2KNBB 1UB4A 3QXEB 1MV3A 2XG8D 2RO0A 4C92A 3R6OA 1N8RU 5GAOm 2L8DA 1G3SA 3DLLA 2JUFA 2LJ0A 2JVVA 2O31A 2AZSA 5GAN4 5GAOr 2J05A 1IO6A 2BZYA 1BIAA 3P8DA 4F14A 3CCQA 1AWXA 4M75F 1W2BA 3FLGA 1RI0A 3MCAB 1QLYA 3RMSA 2X4YA 3KXTA 1Q86C 3H0FA 1M8MA 4QT7A 3M4YA 2DXCA 2QQAA 1H92A 3OA6A 4ELZC 3VUBA 1M4ZA 3JCMc 2XICA 4M7DG 2O4XB 4XK8E 4WCIA 1U5SA 1M3BA 1WQ7A 1K8AU 1WA7A 4C5IA 4J9IA 1G3WA 3GIBA 4HCKA 3A8LB 4E6RA 2VXFA 2D6FA 4EMGA 3FDRA 4C0DC 4EFDA 2LQWA 3CC7T 1QKXA 4X9CA 5LJ3f 1S72A 4C8QC 4YTLA 2X4XA 1P92A 4M7AF 5A0GA 3CZXA 2DXBA 1H641 2EFIA 1Z9ZA 1UDLA 1TH7A 1FMKA 3KUFA 2K57A 3CCVA 1M3CA 2GTJA 2PUKB 3V8KA 5LJ3h 5GMKl 4EMKC 1T3LA 2XDPA 4A53A 4AFZC 3CEYA 4LD9K 3QJ6A 2DO3A 2QQSA 4XU1A 2RB6A 1GRIA 1N5ZA 3OBYA 3L42A 1WIEA 5GANd 4JDSA 4JLGA 3C12A 4PJOB 2MF2A 3JB9I 2G3RA 4DEXA 2WSCE 4QW2A 2ZCFB 3TSWA 4M6HA 4EPCA 1OEBA 1XQHA 1Q82U 1GL5A 1I0CA 3OYNA 3QJYA 4BY6C 2R5MA 1VQ9A 5FRMA 3G4SA 5FU6B 4BDYA 3GP8A 3C4SA 1AWWA 1UGPB 1W70A 2AHJB 1GCPA 3M0PA 1E7OA 3X28B 3FB9A 4CC7A 2X4JA 3NE8A 2FRWA 4F7UB 2X3XD 4HCCA 3EG1A 2JS2A 4RCBA 1YI2A 2L3SA 4LDUA 1ZUUA 2WSFE 4O6JA 3MEWA 5ECAA 1KSWA 1YJWT 2DE0X 2GFAA 3LH0A 3P8HA 5LJ3e 5GMKi 3QIIA 4BDZA 3LWIA 4XAXB 4L5GA 5HK3A 3BFMA 2ZZDA 1PSFA 2RK1A 3M56A 3V7RA 2LCLA 2KEAA 2IIMA 5IH2A 5GAOq 1M1KC 2RH2A 5D6XA 1QVPA 2DJQA 1G3YA 2KQWA 3CC2T 2EGAA 4BI4A 2DEQA 2EGEA 2J06A 2MIOA 2DTHA 1K9MC 1K9AA 4OMPA 1KJWA 2KT1A 1OZ2A 2NWMA 3HL8A 2DL5A 2KMTA 2E65A 2Y4YA 4ZTFA 3H6ZA 4M77G 1YITA 2KVQG 1YJ9T 2RJEA 3LLRA 2L5QA 3JB9G 3S3MA 4B9WA 1K76A 4M7DD 1GFDA 3URGA 2PVOB 2ZPEB 2KRSA 3VS5A 4FM4B 1VYVA 4OF1A 2P0QA 4LDYA 3PFSA 4J9HA 3L2RA 2CGHA 3L1AA 2EQIA 2DPPB 1JXOA 3OMCA 5I2MA 1QCFA 2EWNA 5GAN6 1FWZA 1SHFA 1VQ6T 2OTJT 3CCSA 1AD5A 1K73C 5A0LA 1I5LA 2K2VA 4HVUA 2A28A 1BI3A 2LVMA 2EQKA 3VS0A 1D3BB 4AFQC 4ZGDB 4QQ6A 4OP0A 5I22A 1NLPC 1HSQA 2O88A 4EDUA 2OI3A 1ARKA 3A98A 3CPFA 1E6GA 3JCMQ 1Y0MA 2LC4A 2F5KA 3REAB 3I5SA 5LJ3g 4JJBA 3PE0A 5C0MA 1VQLT 4AFSC 2VC8A 4C92E 5LJ5f 1VIFA 5A2QE 1GBQA 1KHCA 2K5FA 3NTIA 1M90U 4R56A 5HKCA 5GAMj 4MZPA 2K6DA 3WVDB 2RQVA 4A54A 2AKKA 2BZXA 2DTIA 2AZVA 3NPFA 4M75B 2EQMA 3ZFJA 4M7DF 4KUDK 4A63B 5CO7A 3HP9A 1W6XA 3OBWA 1I4K1 2DA9A 1N6AA 1Q7YU 1X75C 1EFNA 1H3ZA 2KROA 1ZHIA 1VQ8T 1T0JA 1M27C 2DTOA 4C92C 1YWPA 3I56A 1AHJB 1YIJA 4Y91A 2JMAA 2VUBA 3OYLA 4RTVA 3CCRT 4OMFB 3VS1A 2VVKA 3QAYA 2A08A 3V7CA 3QSUA 3S6WA 4RKUE 1N9SA 3FJPA 1G83A 2RPNA 2RHUA 2JN0A 2RI5A 1K0XA 1JWQA 1JJ2S 2R57A 1AOJA 3SDZA 2JM8A 3HKSA 2CT3A 1U8RA 1GFCA 2K4YA 2KXCA 1B34B 1ZBJA 2O4XA 3PT9A 5EMIA 3EGUA 2RJCA 1QW1A 2HQXA 3O8VA 4OGCA 1M9SA 3OY9A 2DL8A 3RESA 5CKEA 1QWEA 3CCMA 2DRMA 1JB0E 2QTXA 4M77D 5GMKm 1X6OA 1KC8C 3RMQA 4N4IA 3JB9D 1X2KA 1UJ0A 3M5AA 1WDXA 4R55A 3PGGA 3G71T 2QDYB 1OYXA 5GAOp 3H41A 2MOXA 2GQVA 1BBZA 1VQ4A 2HBPA 1VQPT 3QBYA 5D6WA 4C0GA 4BUGA 2CZ0B 4X34A 1AZGB 3OYBA 3EHQA 5GAN5 1KHIA 1UGSB 4PJOA 2WSEE 1VQMT 4ELYC 2I0NA 4KT0E 3WVEB 4N4GA 3G6ET 1JXMA 2M1HA 2D8HA 3VU3C 5CKBA 2QEXT 3JB9H 2K3XA 2K3YA 3E1SA 4OB3B 2YT6A 4OGEA 3UATA 2DAQA 3OQ5A 2HDAA 3OYGA 3CBPA 4F7UA 1X27A 5LJ3j 2Y90A 1T3SA 1UHCA 2GFUA 2M0YA 4C0FA 3MP1A 2JT4A 4PNOA 1VUBA 1VQ5A 2A37A 3M0UA 1GXIE 1IREB 4M77F 4C8QG 2LQKA 1OPLA 1X6BA 1VQ7A 1WX6A 3JB9F 4LNPA 4RTZA 2C06A 1YJNA 2VWFA 2FG0A 2CZ6B 1KIKA 5LJ5g 4JJCA 4J9BA 5GAN7 1Q86U 4Y92A 3SB2A 1N9RA 5CVIA 1Y07A 2QDLA 1UTIA 1Z9QA 1O9SA 3G7ZA 1K0SA 4HCZA 4Q5WA 1VQNA 5CQYA 1GCQC 2RHZA 2ECZA 1BU1A 2R5AA 3V8LA 3DB4A 5HCKA 3MEAA 4C5EA 4A4HA 4OMMA 5IT9E 5IXFA 4J6XA 3PVLA 1XOVA 1WFWA 4RG8A 1OI1A 1QKWA 2DBMA 2HEQA 2L3RA 1KQSA 3M55A 2R58A 3V8JA 2K7AA 1N27A 2E5QA 2JTMA 1PRMC 3NTHA 2KYMA 4HKEA 3CCJT 2EKHA 1LCKA 4BINA 1NEBA 1O75A 2VGMA 2LJ3A 2DBKA 1UGVA 5FWCA 2CS7A 3PTAA 3VYGA 3RKXA 1V1CA 4C8QE 4N0AC 3O5ZA 1G2BA 2JOYA 2BUDA 3AHUA 2G6FX 1JEGA 3Q1JA 2LP5A 2K79A 4NL2A 3QHSA 1NYFA 1SRMA 2CKKA 4RMOA 4J7IA 1I07A 3C0CA 4EIKA 4M78F 1JBMA 3VRYA 3E19A 5LJ3d 3GF5A 2DF6A 4ZNXA 1D3BA 1Y7XA 2EW3A 3CC7A 4ZN1A 5LL6S 2DRKA 2DD4A 3LW5E 5CK9A 2O9SA 2JXBA 4M7DB 1BIBA 5KCOA 2PVDB 1YHQT 2CSQA 4P5NA 3X24B 3CPWA 3MEVA 5DLQE 4J9CA 3QKJA 1QVFA 3TSZA 3OYIA 1CKBA 4HA8A 1N8RC 3M0TA 2EKOA 3A8MB 3HRUA 1G3TA 2LMJA 1PKSA 3HSBA 2V8KA 3GBQA 2VV5A 1ZBXA 1QWFA 2X4WA 3OYKA 3VKIA 4Z89A 2DZ9A 4M75A 1PWTA 2ZPIB 3ZBDA 4XTXA 2XD0A 5D6YA 1AWOA 1VQKA 2GGRA 2DL7A 3PMTA 5I21A 3A8HB 3UT1A 2HQEA 1B07A 3I55A 1M1KU 1UUEA 4LDXA 2PQWA 4E47A 5IXBA 3QWYA 2CYZB 2RD1A 4C8QD 2YUNA 4JRQA 4J5YA 3M54A 1RUWA 1K8AC 2BTTA 2JTFA 3TEEA 4FSXA 1OV3A 2H3JA 4QVDA 4XU2A 2ROLA 3SD4A 3MO8A 5LJ5j 3PIOA 1SSFA 4C5HA 5J3BA 5KE3A 1PRLC 4A4FA 1WJSA 4XQ3A 2RK2A 4JUVA 3WXMB 2XMFA 1X2QA 3T9NA 4CRIA 1PKTA 1B34A 2KAFA 4CI0C 2PZ1A 1YBYA 2K5LA 3MHXA 3M0QA 2FPFA 1GCQA 3CMAA 1MGQA 2CUDA 2EYWA 5FU7B 2LNVA 4HXJA 3CC2A 4MDXA 2ROTA 1BB9A 2F2WA 4HT9A 1U1TA 4RTWA 1HK9A 4E7HA 3ER0A 4D8DA 4BE0A 3DKMA 1Y57A 4PJOE 4OMOA 5KE2A 4FSSA 5GMKh 2RQWA 2F2VA 4WF2A 2HSPA 1LJOA 4LN2A 2YLCA 1ZUKA 1Q82C 1TUDA 3JCMf 2VGNA 4C92G 3THKA 3M0SA 3JCMP 1QVGS 2FPDA 1YJ9A 4PLLA 4C8QF 3OYDA 4F7UE 5C6SA 2GNCA 4L59A 2LNHB 3L2QA 4N0AA 3JCMh 1A0NB 1KD1U 3JRZA 4LDVA 5FRNA 3UWNA 3CMET 2FRYA 4Z02A 2Q7SA 2K2MA 4OB1B 4M77B 3M58A 4IUTA 1I81A 1M3AA 4Z88A 1ABQA 3TREA 3CCLT 3OW2S 4KULA 2GCXA 1VQ6A 4PJOC 5GJVB 2OTJA 5GANe 3FJ5A 2ZGWA 2DVEA 3I35A 5GAOl 4Z8AA 3QG1A 5J26A 1YCSB 1OZ3A 2FB7A 5FU6C 1M1FA 3E9FA 3P8BB 3X26B 3EG0A 3NGPA 2K5IA 3HFNA 4LUDA 3OS0A 4KUIA 1FXXA 2MI6A 2E41A 5LJ5d 5CKDA 4BB7A 5GMKe 3OYFA 4QQDA 1PHTA 1VQLA 4JRKA 3OS1A 4IUQA 2RHYA 4IIMA 5HK0A 1X6GA 2L3PA 4J9GA 2J6KA 2KRMA 1KG1A 1UJYA 3CCUT 2O2OA 1ZUYA 5CKFA 5CKHA 4MMLA 2NUZA 1YCYA 4NOYA 2M0OA 3QZ5B 2LX7A 4J6YA 4CC4B 3JCMe 4XTVA 1BKBA 1B3QA 2QQRA 5KH6A 5FU7C 4MMKA 2MWPA 2CSIA 2ZPBB 2V8IA 4B9XA 2QQ9A 3EFSA 1KFZA 2DILA 4RN7A 3UDCA 2DIQA 1U3OA 1H3HA 4ME7A 3JCMX 2P4RA 2E6NA 2WACA 2Y4XA 3SWNB 1NPPA 1NLOC 3S3OA 2EJ9A 4ZGEB 3QPHA 3V7SA 4M78B 1FX7A 2JM9A 1KC8U 1LOJA 3RIRA 1BI1A 2RQRA 1AWJA 1WGSA 5CQXA 2X3WD 3JB9J 2BKDN 5IN1A 3OSSC 2HBWA 1NJIU 2FO0A 3CC4T 4VUBA 5HY6A 4M7AB 1R8OB 2DKGA 2KY9A 5KCHA 4ESRA 1ZQ1A 2MMPA 3TVTA 5CAIA 2DYBA 2B8AA 3L2UA 1SSHA 3M0RA 4DA4A 1M90C 5AYFA 1VQOT 1TUCA 1YWOA 4M75E 4C92D 5GAOn 4HT8A 4M7DA 3INZA 2KRNA 3UA6A 2PNIA 1SRLA 2LDMA 3G71A 4BE1A 2RN8A 3LGLA 1BK2A 4AG1C 4RTXA 3QDRB 3I5RA 3JCMg 3BY7A 1VQPA 2E5KA 3UPUA 2CUBA 1JRIA 2DIGA 1ZX6A 1SEMA 2OTLT 3X20B 4JZ3A 1IZ6A 1VQMA 4MDWA 4PKCC 4HVWA 3G6EA 4A4KA 4RG2A 3JCMJ 4M75C 2QEXA 3MP8A 2V8JA 1OPKA 3CXCS 1WJRA 1TG0A 3SHWA 4JRIA 1Y71A 2IVWA 3SWNC 3HRTA 4MZTA 3DB3A 2KE9A 4M78C 2LZ6B 1UGQB 4ZTJA 4KRTA 4OVAA 5FLXE 4ATOA 1VA7A 2BZ8A 1Y96B 1JO8A 2GTOA 1JJ2A 4D6WA 1WLPB 3VS4A 3UF4A 3VS3A 1W2BS 4C92F 3M9QA 5GAMh 3PNWC 4EMHA 3LYIA 3GLXA 2DD5A 3H8ZA 4X1VA 4GBQA 4BE2A 3CBMA 4J7FA 3VV0A 3LX7A 4M7AC 2KGTA 3FRNA 2VKNA 4AG2C 4V2SA 3LH5A 2P0KA 2QA4A 2CREA 4OB2B 4C8QB 4IUPA 3EFRA 4ZGJB 3C95A 2DJZA 2DXTA 3CD6T 3NMZC 1Q81C 4E7KA 3PIPA 2OAUA 2J6OA 3CCET 4IURA 4EMKB 4M6GA 1JQQA 2IG0A 2RQTA 3KBGA 4JPBW 1NM7A 3ASKA 5IHNA 3ME9A 1BI2A 1NYGA 4JRPA 2M51A 1WJQA 1VQNT 4DOVA 4OMQA 3CCJA 2DNUA 2EJFA 3QYHB 1X01A 3HFOA 2RJDA 1J3TA 2A3LA 5FW9A 1WXTA 1UECA 5GAMe 4QVCA 2YUOA 4UC4A 3QO3A 3JCMV 2X35A 3A5ZB 2CT4A 2CH4A 4M77A 2EPDA 2V1QA 2SEMA 2PU9B 3BW1A 3OYMA 3FIFA 5GMKj 1YNZA 4J8OA 4DEYA 2W10A 3JV3A 2LX9A 3L2ZA 2D0NA 2E1HA 4KBMB 1RI9A 4X9DA 2JMCA 3CCQT 2XI9A 2HNIA 1WI7A 3RKYA 3QZ9B 1YHQA 2EYQA 1UFFA 2HC9A 4OMLA 5FWBA 1ZLMA 2OAWA 5IAYA 1LNXA 4M6IA 2PVGB 3M57A 1UHFA 5I11A 2FL7A 2B86A 2RQUA 3RUXA 3C94A 3OYYA 2DXUA 2BIVA 2XHCA 2AK5A 2HCKA 4FT2A 1VYUA 4PL6A 1VIEA 3EG3A 2RI3A 2XKOC 2YHTA 1S72T 4O5VA 2D9TA 2XK0A 5IHKA 1PNJA 4HCBA 2RHXA 2C0OA 2GF7A 3CCVT 3KFVA 2RF0A 3J81E 4Y28E 2DK3A 4PJOG 4OMNA 3M59A 2KDSA 2CZ7B 3SWNA 1WXUA 4XU0A 3OYJA 2LQNA 2YUPA 3BDLA 4M78A 1X69A 3HRSA 2A36A 2M9UA 3N5BB 1I1JA 1K9MU 1KQ1A 3OB9A 2C0IA 1K4US 5GAMg 1M1GA 1VQKT 3JAME 3OSVA 4F7UG 4M7DE 4PLIA 1ABOA 2EJGA 2KSSA 3I55T 2KYBA 2EYYA 1YJWA 2GQIA 3RBBB 3VUZA 4JZ4A 5GANf 3EHRA 4M7AA 4FL6A 1VQ9T 3G4ST 3HPWA 2XDDA 3TU4K 1NEGA 5GANh 1YI2T 2KK4A 4LUEA 5EC7A 2FYKA 1FYNA 1EIFA 2AKLA 2PUOB 1K73U 3JCMd 2DZCA 2XU8A 2DL4A 2JTEA 4M7DC 1E6HA 1WQWA 4E7JA 2D0QB 3FEOA 5CCAA 2ODFA 3QWXX 2EBPA 4J9FA 1HXDA 3EAEA 2I2LA 3CMAT 2ZPHB 3X25B 2EIFA 1U06A 2YSQA 2F2XA 4LDWA 2KBTA 4OB0B 4JLIA 2RHIA 3GNFB 4IKFA 3H0HA 2XIDA 3REBB 2LQ8A 2ABLA 3CMEA 2EVRA 3SFMA 1MHNA 2EAYA 3UA7A 4C92B 3CCLA 2RA2A 1SHGA 2F69A 3M4GA 1WXBA 2GBQA 5A0DA 1X43A 2YLBA 2E12A 4BACA 5J39A 1OOTA 1BI0A 2JNGA 3E9GA 3J7AF 1YITT 3CQTA 1GBRA 3OMGA 4R0KA 2ED0A 5FROA 5GJWB 2LJ1A 3RKWA 3IQLA 5CIUA 3S3NA 3RNJA 1H8KA 4J9EA 4RUGA 2DM1A 3NTKA 1Y96A 1KQ2A 2DVJA 4FU6A 1T0HA 4ZN3A 3JCMb 2O01E 1NE8A 4BI3A 1NG2A 3CCST 4CC2A 1I8FA 3DLMA 3CCUA 2J7IA 2RNAA 1VYTA 3JSCA 5DLOA 4N4HA 2E10A 3LWHA 2H8HA 4GLMA 5DM7R 4M4ZA 2J6FA 4PJOD 4A4GA 4C8QA 1HD3A 4XTYA 2ED1A 3ZL7C 2E70A 3A8OB 4EMKA 2FHDA 2QI2A 1KD1C 2XDBA 1CKAA 4M77E 4M75G 4LD6A 3NHNA 1QVGA 3META 3SEMA 2ZPFB 5LJ5h 1VQ8A 2LCSA 3CBOA 4FIBA 3VS7A 4F16A 2DL3A 4XTZA 2E6ZA 1W4SA 2M16A 4E7IA 5GAN8 3CCRA 2FEIA 2L89A 2RI2A 4K11A 4M78G 4RTTA 2EYXA 1ZSGA 2FVUA 5L8RE 4FT4A 4J83A 4C0ZA 4DQ2A 3OW2A 2KXDA 3VS6A 3BDUA 2C0TA 3OYCA 3CC4A 5IHIA 1SPKA 2CDTA 4RTYA 3ULRB 2KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBQ A;  2O9V A;  2DL5 A;  2K9G A;  2KGT A;  1CKB A;  2VKN A;  3M0T A;  4AG2 C;  3LH5 A;  2OJ2 A;  2CRE A;  2LMJ A;  1PKS A;  4LE9 A;  1K76 A;  1GFD A;  3GBQ A;  1QWF A;  1RLQ C;  2KRS A;  3VS5 A;  1VYV A;  2K3B A;  3R6N A;  4Z89 A;  1HJD A;  1PWT A;  3NMZ C;  4J9H A;  2L2P A;  1AWO A;  2J6O A;  1RLP C;  2CH4 W;  2EQI A;  2GGR A;  2L0A A;  2DL7 A;  1JXO A;  4M6G A;  1QCF A;  1JQQ A;  1B07 A;  2JW4 A;  1SHF A;  2RQT A;  2MCN A;  4JPB W;  1UUE A;  1AD5 A;  2D8J A;  1NM7 A;  1CSK A;  5IXB A;  3QWY A;  4F17 A;  5IHN A;  4HVU A;  2A28 A;  1NYG A;  2YUN A;  2M51 A;  3VS0 A;  1AZE A;  4OMQ A;  4AFQ C;  1RUW A;  2DNU A;  1S1N A;  5I22 A;  1NLP C;  2EYZ A;  1HSQ A;  2BTT A;  2O88 A;  2DX1 A;  1J3T A;  5FW9 A;  3VS2 A;  1WXT A;  1UEC A;  2OI3 A;  1ARK A;  1OV3 A;  2YUO A;  3A98 A;  2ROL A;  1E6G A;  1Y0M A;  3REA B;  3VRZ A;  4J9D A;  3I5S A;  4JJB A;  3PE0 A;  2CT4 A;  1PRL C;  4AFU C;  2CH4 A;  4AFS C;  3U23 A;  2EPD A;  4RTU A;  2V1Q A;  2SEM A;  1GBQ A;  2XMF A;  1X2Q A;  1K1Z A;  2SRC A;  1PKT A;  1YNZ A;  4DEY A;  2W10 A;  3JV3 A;  2PZ1 A;  2JS0 A;  3M0Q A;  2EGC A;  2FPF A;  2D0N A;  1GCQ A;  1UE9 A;  2DMO A;  1M30 A;  2K6D A;  2CUD A;  2RQV A;  2EYW A;  1RI9 A;  1W1F A;  2AKK A;  2BZX A;  4HXJ A;  2JMC A;  1JU5 C;  3H0I A;  2AZV A;  2ROT A;  1BB9 A;  2F2W A;  3NPF A;  4RTW A;  2ESW A;  4A63 B;  1WI7 A;  4D8D A;  1W6X A;  1UFF A;  2DA9 A;  1Y57 A;  4OMO A;  4IIO A;  4OML A;  5FWB A;  1MUZ A;  3EG2 A;  1ZLM A;  2DLP A;  4FSS A;  2OAW A;  2RQW A;  2F2V A;  1EFN A;  2HSP A;  4M6I A;  2FPE A;  2KRO A;  4LN2 A;  1UHF A;  2L3Q A;  5I11 A;  2B86 A;  1ZUK A;  1T0J A;  1M27 C;  2RQU A;  1TUD A;  1YWP A;  1AEY A;  2JMA A;  3M0S A;  3THK A;  4RTV A;  4CC3 A;  3VS1 A;  2FPD A;  2AK5 A;  2VVK A;  3PVQ A;  2HCK A;  4JJD A;  3QAY A;  1VYU A;  2A08 A;  4ORZ A;  2GNC A;  2V1R A;  2LNH B;  1YN8 A;  3EG3 A;  2RMO A;  1A0N B;  2YUQ A;  2YDL A;  2W0Z A;  2ENM A;  2FRY A;  2Q7S A;  1G83 A;  2K2M A;  2RPN A;  5IHK A;  1PNJ A;  2PTK A;  3I9Q A;  1M3A A;  4Z88 A;  1ABQ A;  1K0X A;  1JWQ A;  4HVV A;  5GJV B;  2C0O A;  5L23 A;  1AOJ A;  3FJ5 A;  3KFV A;  2RF0 A;  2JM8 A;  2CT3 A;  4OMN A;  1GFC A;  2KXC A;  3I35 A;  1ZBJ A;  1WXU A;  4Z8A A;  4D8K A;  2LQN A;  2YUP A;  5EMI A;  1YCS B;  3EGU A;  1X69 A;  2A36 A;  1YP5 A;  3EG0 A;  3NGP A;  4LUD A;  4LQ6 A;  1I1J A;  2DL8 A;  1UG1 A;  2C0I A;  1K4U S;  1QWE A;  2DRM A;  1WYX A;  1AVZ C;  2D1X A;  1ABO A;  1MV0 B;  1PHT A;  2KT8 A;  2KNB B;  2KYB A;  2EYY A;  1MV3 A;  1X2K A;  2GQI A;  3RBB B;  4JZ4 A;  1UJ0 A;  3EHR A;  4IIM A;  1WDX A;  1X6G A;  2L3P A;  4J9G A;  2J6K A;  2KRM A;  2LJ0 A;  1UJY A;  2O31 A;  2AZS A;  2O2O A;  1ZUY A;  2NUZ A;  3H41 A;  2J05 A;  2LX7 A;  2MOX A;  1NEG A;  1IO6 A;  2BZY A;  4CC4 B;  1BBZ A;  4LUE A;  4F14 A;  5EC7 A;  1AWX A;  1B3Q A;  1FYN A;  1QLY A;  1AZG B;  3EHQ A;  2CSI A;  2AKL A;  3H0F A;  2I0N A;  1KFZ A;  2DIL A;  1M8M A;  4QT7 A;  4RN7 A;  1JXM A;  2D8H A;  1H92 A;  1U3O A;  2DL4 A;  1H3H A;  2JTE A;  1E6H A;  2P4R A;  2ODF A;  3QWX X;  2EBP A;  4J9F A;  4WCI A;  1U5S A;  1M3B A;  1NLO C;  1WA7 A;  4J9I A;  2YT6 A;  3UAT A;  2JM9 A;  4HCK A;  2HDA A;  4E6R A;  1U06 A;  2YSQ A;  1X27 A;  2F2X A;  2RQR A;  1AWJ A;  2KBT A;  2LQW A;  1T3S A;  1UHC A;  2X3W D;  1QKX A;  2M0Y A;  3H0H A;  2JT4 A;  3REB B;  2ABL A;  2EVR A;  2A37 A;  3CZX A;  3M0U A;  1Z9Z A;  1UDL A;  2HBW A;  1OPL A;  1X6B A;  2FO0 A;  3UA7 A;  1FMK A;  1SHG A;  1WX6 A;  1M3C A;  2GTJ A;  4LNP A;  4RTZ A;  1WXB A;  2GBQ A;  2VWF A;  1X43 A;  2FG0 A;  1KIK A;  4JJC A;  4J9B A;  4ESR A;  1OOT A;  1T3L A;  3TVT A;  4Y92 A;  2DYB A;  4AFZ C;  3CQT A;  1GBR A;  2QDL A;  1UTI A;  1Z9Q A;  4R0K A;  1K0S A;  1SSH A;  2ED0 A;  3M0R A;  5GJW B;  1GRI A;  1N5Z A;  2LJ1 A;  1GCQ C;  3IQL A;  1WIE A;  2ECZ A;  1BU1 A;  3RNJ A;  1H8K A;  4J9E A;  4RUG A;  1TUC A;  2DM1 A;  1YWO A;  2DVJ A;  5HCK A;  4DEX A;  4OMM A;  1T0H A;  3TSW A;  4M6H A;  1OEB A;  5IXF A;  2KRN A;  3PVL A;  1XOV A;  2PNI A;  3UA6 A;  1WFW A;  1GL5 A;  1I0C A;  1SRL A;  1NG2 A;  1QKW A;  2DBM A;  2HEQ A;  1AWW A;  4CC2 A;  2K7A A;  1W70 A;  2J7I A;  2RNA A;  1GCP A;  1VYT A;  2RN8 A;  3M0P A;  1PRM C;  1E7O A;  1BK2 A;  4AG1 C;  4CC7 A;  4RTX A;  3NE8 A;  2FRW A;  3I5R A;  2X3X D;  2KYM A;  2H8H A;  2JS2 A;  3EG1 A;  4GLM A;  2L3S A;  2EKH A;  1LCK A;  4BIN A;  1ZUU A;  4M4Z A;  2E5K A;  2J6F A;  1NEB A;  2CUB A;  2LJ3 A;  2DBK A;  1UGV A;  1HD3 A;  1ZX6 A;  5FWC A;  1SEM A;  5ECA A;  1V1C A;  4JZ3 A;  1KSW A;  2ED1 A;  3ZL7 C;  3O5Z A;  1G2B A;  2DE0 X;  4HVW A;  2G6F X;  1JEG A;  2LP5 A;  1CKA A;  2K79 A;  1NYF A;  1SRM A;  1OPK A;  3NHN A;  3SEM A;  1TG0 A;  3SHW A;  1I07 A;  3C0C A;  4EIK A;  2LCS A;  3VRY A;  3VS7 A;  4F16 A;  2KEA A;  2IIM A;  2DL3 A;  2DF6 A;  2KE9 A;  4ZNX A;  5IH2 A;  2FEI A;  2EW3 A;  2LZ6 B;  4K11 A;  2DJQ A;  4RTT A;  4KRT A;  2EYX A;  2DRK A;  1VA7 A;  1ZSG A;  2BZ8 A;  2O9S A;  1JO8 A;  2EGA A;  2JXB A;  2GTO A;  2CSQ A;  2KXD A;  2EGE A;  2J06 A;  1WLP B;  2MIO A;  3VS4 A;  3UF4 A;  3VS3 A;  3VS6 A;  1K9A A;  2C0T A;  5IHI A;  1SPK A;  2CDT A;  4RTY A;  4J9C A;  4OMP A;  1KJW A;  2KT1 A;  3ULR B;  2NWM A;  2KR3 A;  3TSZ A;  4X1V A; 
#chains in the Genus database with same CATH topology
 2O9V A;  4DOW A;  5GAN 2;  4MHP A;  2X7B A;  5GAN g;  1BYM A;  3SJE A;  2K9G A;  4M77 C;  2ZPG B;  4M7A G;  1U1S A;  3I56 T;  4FW2 A;  9ATC B;  3KKW A;  2B4B A;  4E0A A;  2LCC A;  1YIJ T;  3D7S B;  2V8D A;  2OJ2 A;  3FH4 A;  1NZ9 A;  1TIQ A;  2HAX A;  4RS2 A;  4UFW A;  4LE9 A;  1M4D A;  1VQO A;  2C27 A;  4LXC A;  4PQA A;  2CZ1 B;  1TXR A;  3R95 A;  1RLQ C;  4YGO A;  5GAN 3;  3GPL A;  5F49 A;  2K3B A;  4XTU A;  3R6N A;  1HJD A;  1D1A A;  1RAD B;  1RAE B;  4PJO F;  2V8G A;  1R43 A;  4I49 A;  2L2P A;  2L0A A;  1RLP C;  2CH4 W;  1V29 B;  1YJ9 Q;  3OYE A;  4XTW A;  1NPR A;  1UEB A;  4ANJ A;  1PSE A;  4OC5 A;  2QQB A;  2Q4Y A;  3I9S A;  3H8F A;  4J3G A;  2JW4 A;  5LJ5 e;  2MCN A;  1OX9 A;  1TKH A;  2MWO A;  2D8J A;  3CPX A;  1CSK A;  1M8V A;  2P0P A;  2Z11 A;  3KQZ A;  3OS5 A;  4F17 A;  3GNG A;  3OS2 A;  1QP3 A;  1RAH B;  5DY9 A;  1Q7Y C;  4F7U F;  3K2K A;  1KUY A;  4FD6 A;  2E64 A;  4M78 E;  1AZE A;  1WPY A;  2QJ8 A;  1VQ6 Q;  2OTJ Q;  1S1N A;  4RCC A;  2HB6 A;  2EYZ A;  3VYH B;  5C82 A;  3QYG B;  2DX1 A;  2LT1 A;  4TVR A;  1OUL A;  1XTD A;  3VS2 A;  3NFC A;  3RER A;  1QP2 A;  1KUX A;  4J6W A;  2OTL A;  2OZG A;  4YRH A;  3EG9 A;  4H6U A;  2DFU A;  3PMI A;  3CCM T;  4JS4 A;  4OC1 A;  5EG2 A;  5M9O A;  4C7I A;  3MP6 A;  6CPA A;  3VRZ A;  4J9D A;  3J80 E;  4NL3 A;  4AFU C;  4P4D A;  1OZP A;  3A8G B;  3BLN A;  2FIW A;  3U23 A;  4RTU A;  5GAM d;  4M7A E;  3S6G A;  5HVG A;  1XNI A;  4ZY0 A;  1G5V A;  5KYN A;  4P4F A;  3WC6 A;  4L6V 5;  1NJI C;  2MAM A;  1K1Z A;  2SRC A;  5KYY B;  3SJF A;  5AG4 A;  4IUU A;  2VYT A;  2HD0 A;  2YRV A;  4PK4 A;  3ZEH A;  4KVO E;  2A0F B;  1Q81 U;  1VQL Q;  2JS0 A;  1HYO A;  1KQS S;  1LOK A;  2LTO A;  4II1 A;  2EGC A;  4PK2 A;  1UE9 A;  2DMO A;  1M30 A;  2EQJ A;  1VQ4 T;  1W1F A;  3GY9 A;  1SKU B;  1JU5 C;  3H0I A;  5GAM f;  1Z8X A;  4PXB A;  2ESW A;  3GOX A;  1V0C A;  4CAF A;  4K3N A;  4A37 A;  3TFY A;  1IID A;  3F70 A;  3MKD A;  4IIO A;  3NA6 A;  4NGQ A;  4CYQ A;  1MUZ A;  3EG2 A;  2DLP A;  3SXN A;  4YWY A;  3KGQ A;  3M53 A;  4G1P A;  1M4I A;  2FPE A;  3VJP A;  3MEU A;  2L3Q A;  4A4E A;  4UEE A;  3L2W A;  2Q44 A;  2PDO A;  3L2V A;  3OYH A;  8CPA A;  3VWD A;  3JCM W;  3RBU A;  4JS5 A;  4JXR A;  4BI8 B;  2VB6 A;  2LT4 A;  4E7L A;  2CNS A;  1AEY A;  2D4P A;  5CR2 A;  4FW1 A;  4CC3 A;  1UGR B;  4C0D B;  2PJ9 A;  3PVQ A;  4JJD A;  4M75 D;  1OBR A;  4ORZ A;  4GY5 A;  3TT2 A;  4AMC A;  2V1R A;  4EWT A;  3FC3 A;  1YN8 A;  2CNT A;  5I2S A;  3CD6 A;  2RMO A;  4MZM A;  3JUW A;  2YUQ A;  2YDL A;  2W0Z A;  3EGD A;  2JBJ A;  3CCE A;  2QAZ A;  2ENM A;  1VQ5 T;  2OZH A;  4JJN K;  4GLK A;  2OB0 A;  4MFZ A;  4ORF A;  4UWJ A;  2PTK A;  3HHT B;  1PCA A;  3I9Q A;  1D09 B;  4M78 D;  1VQ7 T;  4HVV A;  2PRB A;  5AT1 B;  4C5G A;  5L23 A;  5KTA A;  1WWZ A;  2P6E A;  2WPW A;  2XEJ A;  3CPW S;  4IUV A;  2VXE A;  5J1Q A;  1YJN T;  3TTH A;  4QVZ A;  4CGP A;  4D8K A;  4KOW A;  4NS5 A;  1N8R R;  1RL2 A;  1MMD A;  2RM4 A;  4QQG A;  2QA4 T;  3TCJ A;  3TOA A;  1QVF S;  2KCW A;  2JZ2 A;  4AT1 B;  1VHE A;  4R3L A;  2A7Y A;  2RJF A;  3RNZ A;  1WNL A;  5A27 A;  3QUI A;  1YP5 A;  2F5T X;  1Z8L A;  4LQ6 A;  2HKQ B;  2PJ2 A;  3PFO A;  2HQY A;  4A32 A;  1UG1 A;  2YRD A;  3LGF A;  1DJ7 B;  1M5Q 1;  4RUH A;  4M7A D;  2EQU A;  2QXF A;  2FCK A;  2ABZ A;  1WYX A;  1LFW A;  1AVZ C;  4C7H A;  2D1X A;  2ARH A;  4BD3 A;  5GAN j;  3DNS A;  4XU3 A;  2NLU A;  3OYA A;  3PRT A;  2P4T A;  1MV0 B;  3D4U A;  4BY6 B;  3CXC A;  2LRQ A;  2KT8 A;  2KNB B;  1Q95 G;  4F0Y A;  3IGR A;  1UB4 A;  3QXE B;  1MV3 A;  2XG8 D;  2RO0 A;  4C92 A;  3R6O A;  1N8R U;  1NSL A;  2GAN A;  5GAO m;  4KOR A;  4U9Y A;  2WZN A;  3KI9 A;  3H8G A;  2PQ8 A;  2L8D A;  1G3S A;  3DLL A;  4A2Z A;  2JUF A;  2JVV A;  2LJ0 A;  2O31 A;  2AZS A;  5GAN 4;  1IU8 A;  4LQG A;  1ZLH A;  3D7H A;  5GAO r;  2F7V A;  2PR8 A;  2J05 A;  1OX8 A;  3VAR A;  1XFO A;  1IO6 A;  2BZY A;  1BIA A;  5G22 A;  2PCU A;  2Y0M A;  3G71 Q;  3P8D A;  1K8A R;  2YNC C;  1UFH A;  4F14 A;  3CCQ A;  1AWX A;  4M75 F;  4XPK A;  1W2B A;  2WUU A;  3FLG A;  1RI0 A;  3MCA B;  2DET A;  4W9Y A;  1QLY A;  3T8W A;  3RMS A;  2X4Y A;  3KXT A;  2Z10 A;  1Q86 C;  2JEV A;  2P0W A;  3A9L A;  1C1A A;  1CPX A;  3V7Z A;  1Y9W A;  1WK4 A;  4KOU A;  2HL5 C;  3H0F A;  6AT1 B;  1R0B G;  1VQP Q;  1M8M A;  3M4Y A;  4QT7 A;  2DXC A;  2QEC A;  4A94 A;  3FED A;  5IV0 A;  2QQA A;  1J4J A;  1H92 A;  3OA6 A;  1BO4 A;  4ELZ C;  3VUB A;  4AG9 A;  5JGF A;  1M4Z A;  3JCM c;  2XIC A;  3MPU B;  4M7D G;  4X5K A;  2ZW6 A;  2O4X B;  4P4B A;  1VGY A;  1VQM Q;  4XK8 E;  4WCI A;  1U5S A;  1M3B A;  1WQ7 A;  1K8A U;  1MJ9 A;  1WA7 A;  4C5I A;  4J9I A;  1ZG7 A;  3G6E Q;  1G3W A;  1MJA A;  3GIB A;  2Q4Z A;  4HCK A;  3A8L B;  2QEX Q;  4E6R A;  3PP9 A;  2VXF A;  2D6F A;  1RAG B;  2BUE A;  2IJZ A;  1X12 A;  4EMG A;  3FDR A;  2AFZ A;  2HSE B;  1BOB A;  4C0D C;  4EFD A;  2LQW A;  3CC7 T;  1TKF A;  4B12 A;  1XE4 A;  1D1B A;  1QKX A;  4PSX A;  4X9C A;  2CP5 A;  2GU2 A;  5LJ3 f;  1AUG A;  1S72 A;  2CF4 A;  1R77 A;  1YX0 A;  2CNM A;  4C8Q C;  4YTL A;  2X4X A;  1P92 A;  4M7A F;  5A0G A;  3CZX A;  2DXB A;  1XRY A;  4UBR A;  1H64 1;  2EFI A;  1Z9Z A;  1UDL A;  1TH7 A;  1FMK A;  3KUF A;  2K57 A;  3CCV A;  1M3C A;  2GTJ A;  3SI2 A;  2PUK B;  1KQS P;  3V8K A;  5LJ3 h;  4BBH A;  5GMK l;  4B5P A;  5G1Z A;  3G1J A;  4EMK C;  1Q82 R;  2WPX A;  4YFJ A;  1XBU A;  3T9Y A;  1T3L A;  2XDP A;  4A53 A;  4KLV A;  2QAS A;  4AFZ C;  3CEY A;  4LD9 K;  3QJ6 A;  2J8R A;  3FMC A;  2DO3 A;  4AVB A;  2QQS A;  4XU1 A;  2RB6 A;  1GRI A;  1N5Z A;  3LAC A;  3OBY A;  3L42 A;  1WIE A;  5GAN d;  5DWM A;  4JDS A;  4H89 A;  4JLG A;  4DBH A;  3C12 A;  4PJO B;  4MFL A;  2MF2 A;  3JB9 I;  3FXT A;  2G3R A;  2WSC E;  4DEX A;  2VZZ A;  4UF4 A;  4QW2 A;  2ZCF B;  3TSW A;  4M6H A;  4EPC A;  2P6G A;  1OEB A;  3IWG A;  1XQH A;  1GYT A;  3CPA A;  1ZSZ C;  1Q82 U;  5K8M A;  1GL5 A;  1I0C A;  3OYN A;  3QJY A;  4BY6 C;  2R5M A;  4CAX A;  3CXS A;  1VQ9 A;  5FRM A;  3G4S A;  5FU6 B;  4BDY A;  4IUS A;  3GP8 A;  3C4S A;  1AWW A;  1UGP B;  1W70 A;  1XF8 A;  3IJ3 A;  3DGV A;  2AHJ B;  3M0P A;  1GCP A;  2K5T A;  1RAB B;  4XNH B;  1Z4R A;  1E7O A;  3X28 B;  3FB9 A;  4CC7 A;  2X4J A;  3NE8 A;  2FRW A;  4F7U B;  2X3X D;  4HCC A;  3EG1 A;  2JS2 A;  4RCB A;  1YI2 A;  1IGB A;  2L3S A;  1ZG8 A;  4LDU A;  1ZUU A;  4Z65 A;  2WSF E;  4PJM A;  1D0Z A;  2ZXV A;  4O6J A;  3MEW A;  2FZG B;  2WSA A;  4MMO A;  4NFR A;  5ECA A;  1S7F A;  4ONU A;  3V8I A;  1KSW A;  3CPW P;  1YJW T;  3CCJ Q;  2DE0 X;  2GFA A;  3LH0 A;  3P8H A;  5LJ3 e;  5GMK i;  1I12 A;  3QII A;  4BDZ A;  3FB3 A;  1NBE B;  3LWI A;  2R7H A;  4XAX B;  1QVF P;  1NMT A;  2JJ9 A;  3IWE A;  3JRU A;  4L5G A;  3H8E A;  3CXP A;  2ZED A;  5HK3 A;  3IU2 A;  4CRY B;  4PSW A;  5DWN A;  2CTB A;  3BFM A;  2MPX C;  3K9T A;  5HXD A;  2ZZD A;  1PSF A;  2RK1 A;  3M56 A;  3V7R A;  2LCL A;  2V8H A;  2KEA A;  4Y49 B;  2IIM A;  3F8K A;  2J9A A;  4KH0 B;  5IH2 A;  5GAO q;  1M1K C;  2RH2 A;  2BE9 B;  5D6X A;  1QVP A;  2DJQ A;  1G3Y A;  1PC0 A;  2ZEM A;  2Q51 A;  4NGS A;  3FEC A;  2KQW A;  3CC2 T;  1HDU A;  4OLL A;  1ZA1 B;  1I1D A;  2EGA A;  4BI4 A;  3B2Y A;  4CRZ B;  4FAI A;  2DEQ A;  2EGE A;  2J06 A;  2MIO A;  2DTH A;  1K9M C;  2ZW5 A;  1K9A A;  1Q2D A;  3PB8 X;  1D0Y A;  5EBV A;  4OMP A;  3RDV A;  1KJW A;  4QUS A;  3CXQ A;  2KT1 A;  1OZ2 A;  4HNX B;  2NWM A;  4FD7 A;  1VKC A;  1YHQ Q;  3HL8 A;  2C1C A;  2DL5 A;  1P0H A;  3B3V A;  2KMT A;  5KYY A;  2E65 A;  2Y4Y A;  4ZTF A;  2PC1 A;  2Z0Z A;  3H6Z A;  4M77 G;  1YIT A;  4CGO A;  2KVQ G;  4UFX A;  2YNC A;  4A38 A;  1YJ9 T;  2RJE A;  3LLR A;  2L5Q A;  3JB9 G;  3S3M A;  4B9W A;  1K76 A;  4M7D D;  1GFD A;  3URG A;  2PVO B;  1BCO A;  1X10 A;  2AFS A;  2ZPE B;  2KRS A;  3VS5 A;  4FM4 B;  1VYV A;  1S7N A;  5THW A;  4OF1 A;  2P0Q A;  4LDY A;  4MCR A;  1Y7E A;  3PFS A;  4J9H A;  3L2R A;  2CGH A;  2COW A;  1P4N A;  5F47 A;  3L1A A;  4X2T A;  2EQI A;  1Z4E A;  3LOD A;  2DPP B;  4MHZ A;  1JXO A;  3OMC A;  5I2M A;  1QCF A;  2EWN A;  5GAN 6;  2FSR A;  2I00 A;  1FWZ A;  1SHF A;  1VQ6 T;  2OTJ T;  3CCS A;  1XMB A;  1AD5 A;  1K73 C;  5A0L A;  5E96 A;  2PJ6 A;  3ISX A;  1I5L A;  2K2V A;  3B35 A;  4HVU A;  2A28 A;  2G3A A;  1BI3 A;  2LVM A;  3BI1 A;  4HKF A;  2EQK A;  2B4D B;  3VS0 A;  1D3B B;  3WC7 A;  4AFQ C;  4F04 B;  4ZGD B;  3KL9 A;  5KYX B;  2HKN A;  4XNH C;  3F0A A;  4QQ6 A;  4OP0 A;  5I22 A;  1NLP C;  1HSQ A;  2O88 A;  1M90 R;  1QCO A;  2Q7B A;  2ZW7 A;  3RO0 A;  4EDU A;  2CTC A;  2OI3 A;  1ARK A;  2NYS A;  2EUI A;  3A98 A;  2NSM A;  3CPF A;  1E6G A;  3JCM Q;  4L89 A;  1Y0M A;  2LC4 A;  2F5K A;  1RAA B;  5IB9 A;  3REA B;  3I5S A;  5LJ3 g;  4JJB A;  3KZW A;  3PE0 A;  5C0M A;  1VQL T;  3TC8 A;  5CNP A;  2VC8 A;  4AFS C;  4C92 E;  5LJ5 f;  1VIF A;  2ATC B;  5D29 A;  2D4O A;  3S9N A;  3FRM A;  5A2Q E;  1ON0 A;  1GBQ A;  1YME A;  3ISZ A;  1WHJ A;  1KHC A;  2K5F A;  4B6M A;  1CBX A;  4P6Y A;  3NTI A;  1IIC A;  3PEI A;  1M90 U;  1B87 A;  3S9L A;  4R56 A;  2I79 A;  3S6F A;  4FYY B;  1QQJ A;  5HKC A;  4P4J A;  5GAM j;  2PJ4 A;  4MZP A;  2K6D A;  3WVD B;  2RQV A;  4A54 A;  2AKK A;  2BZX A;  2DTI A;  4AXV A;  2PIY A;  2AZV A;  3NPF A;  4M75 B;  2EQM A;  3ZFJ A;  2CIJ A;  4M7D F;  4KUD K;  4KOY A;  2A4N A;  1M2V B;  4A63 B;  5CO7 A;  3HP9 A;  4NGT A;  1W6X A;  3OBW A;  2FS5 A;  1I4K 1;  1TUG B;  2DA9 A;  1CP7 A;  1N6A A;  2EK9 A;  5IX3 A;  5F09 A;  2IPO B;  1Q7Y U;  1X75 C;  1EFN A;  1H3Z A;  4TNU A;  3D66 A;  3PB7 X;  2KRO A;  2V8V A;  4O23 A;  1ZHI A;  3IWW A;  1VQ8 T;  1T0J A;  1M27 C;  2DTO A;  4L8A A;  4ZY2 A;  4C92 C;  1AT1 B;  1YWP A;  3I56 A;  1AHJ B;  1YIJ A;  4Y91 A;  2JMA A;  2VUB A;  3OYL A;  4RTV A;  3BXM A;  4X8I A;  3CCR T;  4OMF B;  3VS1 A;  1AYE A;  3AT1 B;  2VVK A;  3QAY A;  4ZY1 A;  2A08 A;  2OOT A;  1BAV A;  4MJ8 A;  4P45 A;  2OU2 A;  4KGZ B;  1TKJ A;  4EME A;  3V7C A;  4DBF A;  4FWU A;  2Q43 A;  3QSU A;  3S6W A;  4RKU E;  1N9S A;  4E2A A;  3FJP A;  2NYQ A;  2C6C A;  1G83 A;  2RPN A;  2RHU A;  2JN0 A;  2QGG A;  2RI5 A;  1K0X A;  1JWQ A;  4R3K A;  1JJ2 S;  4AG7 A;  2R57 A;  4OIW A;  1AOJ A;  1D0X A;  3SDZ A;  2JM8 A;  3HKS A;  2IMO A;  2CT3 A;  4Q38 A;  1U8R A;  1YR0 A;  1GFC A;  3CME Q;  4U5Y A;  2K4Y A;  1B34 B;  2KXC A;  1ZBJ A;  2O4X A;  3PT9 A;  4NGP A;  4UCP A;  2OX7 A;  3FBU A;  4E7S A;  2XEI A;  5EMI A;  4QVT A;  5ISV A;  2QG9 B;  3CCL Q;  3EGU A;  2COZ A;  2DYI A;  2PJA A;  5G20 A;  2RJC A;  3PBB A;  4FD5 A;  1Z8T A;  1QW1 A;  2HQX A;  3O8V A;  4OGC A;  1M9S A;  3KR5 A;  2V26 A;  3OY9 A;  2CP6 A;  2DL8 A;  3RES A;  4MRI A;  5CKE A;  1QWE A;  4MY0 A;  4LX9 A;  3CCM A;  4ZX9 A;  2DRM A;  2ZW4 A;  1JB0 E;  1QSM A;  2QTX A;  4M77 D;  1Q81 R;  3T90 A;  2FT0 A;  5GMK m;  1X6O A;  2BE7 D;  4CYP A;  1KC8 C;  3RMQ A;  4N4I A;  1MJB A;  5LYI A;  3JB9 D;  4NF1 A;  1X2K A;  2ZEF A;  8AT1 B;  1FY7 A;  1UJ0 A;  2QTV A;  3M5A A;  4NSQ A;  1Z5R A;  1WDX A;  4R55 A;  3PGG A;  3GUX A;  3G71 T;  3TO7 A;  2QDY B;  4P44 A;  2BO9 A;  4NXY A;  1OYX A;  5GAO p;  4PXC A;  1WHH A;  3H41 A;  2IL4 A;  2H3E B;  1MK4 A;  2MOX A;  2GQV A;  1BBZ A;  1VQ4 A;  2HBP A;  1VQP T;  3VH9 A;  5JQ4 A;  3K9U A;  3QBY A;  1KWM A;  5D6W A;  4C0G A;  3CCU Q;  3EFO B;  4BUG A;  2YGW A;  2CZ0 B;  5D8N A;  4X34 A;  1AZG B;  3OYB A;  3EHQ A;  5GAN 5;  1KHI A;  1UGS B;  2PJC A;  4PJO A;  5LYF A;  4KZT A;  3DDD A;  2WSE E;  1VQM T;  4ELY C;  2I0N A;  4KT0 E;  2QGF B;  3WVE B;  4N4G A;  3G6E T;  1JXM A;  2M1H A;  2D8H A;  3VU3 C;  3SI1 A;  5CKB A;  2QEX T;  4FBE A;  3MGD A;  3H9N A;  2J8N A;  1CP6 A;  1PM3 A;  4GM5 A;  3JB9 H;  2K3X A;  5GCN A;  2K3Y A;  3E1S A;  2YND A;  4MHN A;  4OB3 B;  2YT6 A;  2WYR A;  4OGE A;  3UAT A;  2DAQ A;  3OQ5 A;  3P2F A;  3W6X A;  5LRK A;  1YRE A;  2HDA A;  3OYG A;  3CBP A;  4F7U A;  4KVM E;  1X27 A;  5LJ3 j;  5F46 A;  2AT1 B;  2Y90 A;  3IC1 A;  1T3S A;  2YRC A;  1UHC A;  2GFU A;  4FYV B;  2M0Y A;  4C0F A;  1VQ8 Q;  3MP1 A;  2JT4 A;  4PNO A;  1VUB A;  1YSJ A;  1VQ5 A;  2A37 A;  2F1L A;  3M0U A;  1GXI E;  1IRE B;  4M77 F;  4C8Q G;  3CCR Q;  2LQK A;  1PG5 B;  1OPL A;  1X6B A;  1VQ7 A;  1M44 A;  1C0M A;  1WX6 A;  1XIX A;  3JB9 F;  4LNP A;  4RTZ A;  4LUA A;  3N5F A;  2C06 A;  1YJN A;  2VWF A;  2FG0 A;  2CZ6 B;  1TXQ A;  5LJ5 g;  1KIK A;  4JJC A;  4J9B A;  3P2H A;  5GAN 7;  1Q86 U;  4Y92 A;  3SB2 A;  5KYW B;  3CC4 Q;  2R98 A;  1N9R A;  3TOB A;  1Y07 A;  5CVI A;  2QDL A;  1O9S A;  1UTI A;  1Z9Q A;  3G7Z A;  2NMT A;  1K0S A;  4HCZ A;  3SXO A;  4Q5W A;  1VQN A;  5CQY A;  1GCQ C;  2RHZ A;  1VHS A;  4EVY A;  2ECZ A;  1BU1 A;  3N7Z A;  2R5A A;  3V8L A;  3DB4 A;  3A1P A;  1S7L A;  3MEA A;  5HCK A;  1BPM A;  4C5E A;  4A4H A;  4OMM A;  4MCP A;  4P4I A;  5IT9 E;  5IXF A;  4J6X A;  1XJO A;  3PVL A;  1XOV A;  1VQO Q;  1WFW A;  2O4H A;  1Y0R A;  4RG8 A;  1OI1 A;  3RYO A;  4OME A;  1QKW A;  2DBM A;  2HEQ A;  2L3R A;  5JH9 A;  1KQS A;  3M55 A;  2R58 A;  3V8J A;  1R0C B;  2K7A A;  1N27 A;  2E5Q A;  4CS0 B;  2JTM A;  2CP0 A;  4JZ0 A;  1PRM C;  4U9Z A;  1G8X A;  3NTH A;  2KYM A;  4HKE A;  3CCJ T;  2EKH A;  1LCK A;  4BIN A;  2PJ1 A;  5BWA B;  2NUT B;  3W6S A;  1IGU A;  3HLP A;  1NEB A;  1O75 A;  2GLF A;  2VGM A;  2LJ3 A;  2DBK A;  1YK3 A;  1UGV A;  5FWC A;  2CS7 A;  3PTA A;  3VYG A;  1JJ2 P;  3RKX A;  1V1C A;  4C8Q E;  4N0A C;  1MMA A;  3O5Z A;  4KUA A;  4PV6 A;  1G2B A;  2JOY A;  2AJ6 A;  3R1K A;  2BUD A;  3AHU A;  3QAH A;  1S60 A;  2G6F X;  3I1U A;  3PGP A;  1JEG A;  4IAV A;  3Q1J A;  2LP5 A;  5J8F A;  2K79 A;  3JTK A;  4NL2 A;  3VWE A;  3QHS A;  1NYF A;  2OZU A;  2OTL Q;  1SRM A;  2CKK A;  2DEA A;  3TCV A;  1YW4 A;  3B8G A;  4RMO A;  4QC6 A;  2ZPA A;  4PK3 A;  4J7I A;  1NSA A;  1I07 A;  3C0C A;  4EIK A;  4M78 F;  1JBM A;  3E19 A;  3VRY A;  2VI7 A;  5LJ3 d;  3BE3 A;  2GIV A;  3GF5 A;  4R87 A;  5HMN A;  5JM6 A;  1OU9 A;  2B4D A;  2DF6 A;  3PB9 X;  1D1C A;  4ZNX A;  1D3B A;  1Y7X A;  5KYX A;  2EW3 A;  3CC7 A;  2AIR B;  2VQY A;  3PB6 X;  2AFO A;  4ZN1 A;  4E2F B;  3GKR A;  5LL6 S;  2DRK A;  2DD4 A;  4PFZ A;  5LRJ A;  3LW5 E;  5CK9 A;  1MND A;  2O9S A;  2JXB A;  4M7D B;  2AFX A;  1BIB A;  5KCO A;  2PVD B;  1YHQ T;  2CSQ A;  1H8L A;  3E0K A;  4NJQ A;  2Z3M A;  4P5N A;  3X24 B;  3CPW A;  4WWV A;  1CG2 A;  3MEV A;  4F9V A;  2XEG A;  5DLQ E;  4J9C A;  3QKJ A;  1QVF A;  3TSZ A;  4F8Z A;  3OYI A;  4OID A;  1CKB A;  2F5I A;  1IB8 A;  4HA8 A;  1N8R C;  3GYA A;  3M0T A;  3B3W A;  2EKO A;  3A8M B;  3HRU A;  1G3T A;  2Z3O A;  2LMJ A;  2PSW A;  1PKS A;  3HSB A;  2JDC A;  2V8K A;  1Y0Y A;  2JEW A;  3GBQ A;  2VV5 A;  1ZBX A;  1QWF A;  1F1B B;  2X4W A;  2ZEL A;  3IEH A;  4UWI A;  3OYK A;  3VKI A;  1I5O B;  4C2Y A;  4Z89 A;  2DZ9 A;  2Q4V A;  3WC5 A;  4M75 A;  1PWT A;  2ZPI B;  3TO6 A;  2HUZ A;  3ZBD A;  1M2V A;  4XTX A;  2XD0 A;  4OC4 A;  5D6Y A;  1VQK A;  1AWO A;  1GHE A;  1IY7 A;  2GGR A;  4FYW B;  2DL7 A;  2FE7 A;  3QNV A;  2FZK B;  3PMT A;  1Z8W A;  5I21 A;  4ZGY B;  3A8H B;  3UT1 A;  4C2Z A;  2HQE A;  1ELL P;  1B07 A;  3I55 A;  3CD6 Q;  3PZJ A;  1M1K U;  3D7G A;  1UUE A;  4LDX A;  1FMW A;  4NEX A;  4E8O A;  2PQW A;  3FYN A;  4E47 A;  3CCE Q;  5IXB A;  3QWY A;  1PU9 A;  2AFW A;  3EXN A;  2CYZ B;  2J8M A;  4CYN A;  2RD1 A;  4C8Q D;  2YUN A;  4JRQ A;  3I3G A;  4J5Y A;  3M54 A;  4FYX B;  1RUW A;  1WHG A;  1K8A C;  4R8F A;  2BTT A;  1EZZ B;  1OQK A;  2JTF A;  2C6P A;  1DE4 C;  5EC4 A;  3WAB A;  3TEE A;  4FSX A;  1OV3 A;  3KQX A;  2H3J A;  4QVD A;  4XU2 A;  2ROL A;  3SD4 A;  1AMP A;  3MO8 A;  5LJ5 j;  3PIO A;  4KSI A;  4F6A A;  1SSF A;  4C5H A;  5J3B A;  4FUU A;  3WR7 A;  5KE3 A;  2PVV A;  1PRL C;  4A4F A;  3D2M A;  4FD4 A;  1WJS A;  4XQ3 A;  2RK2 A;  3B3T A;  4JUV A;  3WXM B;  2XMF A;  2R8V A;  4MY3 A;  1X2Q A;  3T9N A;  1YLE A;  4CRI A;  1PKT A;  1B34 A;  2KAF A;  5D7U A;  2QYV A;  4CI0 C;  2K5L A;  1YBY A;  2PZ1 A;  1B7T A;  3MHX A;  3M0Q A;  2FPF A;  4JJX A;  1GCQ A;  3IO1 A;  3CMA A;  2ANP A;  1MGQ A;  2CUD A;  2EYW A;  5FU7 B;  2LNV A;  5AG6 A;  4HXJ A;  3CC2 A;  4B11 A;  4MDX A;  2ROT A;  1BB9 A;  2F2W A;  4HT9 A;  1HDQ A;  1U1T A;  4RTW A;  1HK9 A;  5KYU B;  2QYZ A;  3ER0 A;  4E7H A;  1U6M A;  4D8D A;  3B7I A;  4BE0 A;  3DKM A;  2B3U A;  4B6Z A;  1Y57 A;  4PJO E;  4OMO A;  1KK7 A;  2NUP B;  5KE2 A;  1F2O A;  4FSS A;  5GMK h;  4CGN A;  2RQW A;  2F2V A;  4WF2 A;  2HSP A;  1LJO A;  3CCQ Q;  4UIB A;  1IOF A;  1KD1 R;  2FIA A;  4LN2 A;  1WHL A;  2YLC A;  3MJX A;  1ZUK A;  4PFO A;  2IQ6 A;  1JQG A;  4UA3 A;  1Q82 C;  1TUD A;  3JCM f;  2ZEP A;  2VGN A;  4C92 G;  3THK A;  1IRX A;  3M0S A;  3JCM P;  4K30 A;  1QVG S;  2FPD A;  1YJ9 A;  4PLL A;  4C8Q F;  3EFA A;  3OYD A;  4F7U E;  5C6S A;  2GNC A;  4L59 A;  2Q0Y A;  2LNH B;  1CX8 A;  1FNO A;  2X9H A;  3RZA A;  4BMH A;  1DTD A;  2FZC B;  3L2Q A;  4N0A A;  3EFO A;  3JCM h;  3IIB A;  1A0N B;  1KD1 U;  3JRZ A;  4LDV A;  5FRN A;  3UWN A;  5K8N A;  2QK0 A;  3CME T;  2FRY A;  4Z02 A;  1LRZ A;  2Q7S A;  2K2M A;  3CT9 A;  3D7D A;  4OB1 B;  4M77 B;  3M58 A;  4IUT A;  1FT7 A;  1I81 A;  2JDD A;  1M3A A;  4Z88 A;  1ABQ A;  3TRE A;  3CCL T;  1LAM A;  3OW2 S;  4KUL A;  2GCX A;  1VQ6 A;  4PJO C;  5GJV B;  2OTJ A;  4XPD B;  5GAN e;  3FJ5 A;  1A2Z A;  1VIX A;  2ZGW A;  2DVE A;  1S72 Q;  1RAF B;  1RXT A;  3I35 A;  2ATR A;  5GAO l;  2REE A;  1LVK A;  1BCM A;  4Z8A A;  3QG1 A;  2XEF A;  5J26 A;  5HH1 A;  1YCS B;  1OZ3 A;  2FB7 A;  2PRQ A;  3KHZ A;  1XEB A;  1RAC B;  3E9F A;  1M1F A;  5FU6 C;  3P8B B;  3CCV Q;  3X26 B;  4HNY B;  1ZG9 A;  3EG0 A;  2K5I A;  3NGP A;  3HFN A;  4LUD A;  3OS0 A;  1BPN A;  4KUI A;  2X51 A;  1FXX A;  2HV2 A;  1PD1 A;  2MI6 A;  1QST A;  2E41 A;  5LJ5 d;  1XMT A;  5CKD A;  1QMU A;  4BB7 A;  5H84 A;  5GMK e;  3OYF A;  4QQD A;  1PHT A;  1IHW A;  4DJL A;  4PFP A;  1VQL A;  4JRK A;  3OS1 A;  2P6F A;  4IUQ A;  5LYL A;  2RHY A;  1VQK Q;  1Q2Y A;  5AGE A;  5K8O A;  4IIM A;  4H2K A;  3ZJ0 A;  1VHO A;  2PJ3 A;  4A31 A;  2BL1 A;  5HK0 A;  1X6G A;  2L3P A;  4J9G A;  2J6K A;  2KRM A;  1KG1 A;  3D2P A;  1UJY A;  2O28 A;  3CCU T;  2O2O A;  1ZUY A;  5CKF A;  4MCQ A;  3G8W A;  3I55 Q;  5CKH A;  4MML A;  2NUZ A;  3DR8 A;  1YCY A;  4NOY A;  1Q7Y R;  2M0O A;  5KYW A;  3QZ5 B;  2LX7 A;  1LAN A;  4J6Y A;  1RTQ A;  3S6H A;  4CC4 B;  3JCM e;  1VQ9 Q;  4XTV A;  3G4S Q;  1BKB A;  1ZLI A;  1LAP A;  1B3Q A;  2QQR A;  1NE9 A;  4KOX A;  3MN8 A;  4PPZ A;  5KH6 A;  1WHM A;  5FU7 C;  4MMK A;  4Y49 C;  4AVC A;  1C6V X;  2MWP A;  2CSI A;  1IHV A;  2ZPB B;  3H5Z A;  2V8I A;  4B9X A;  2QQ9 A;  1YI2 Q;  3EH2 A;  3EFS A;  1KFZ A;  2DIL A;  2AFU A;  2EWB A;  4R76 A;  1SG5 A;  4RN7 A;  3UDC A;  2DIQ A;  4PXE A;  1U3O A;  1H3H A;  4ME7 A;  4GS4 A;  3JCM X;  5ELY A;  2ZOF A;  2P4R A;  2E6N A;  2WAC A;  1YLO A;  4B14 A;  2Y4X A;  3SWN B;  1NPP A;  2C6G A;  4CAW A;  1Y7R A;  1NLO C;  3S3O A;  1NJI R;  4R6T A;  2BSW A;  2EJ9 A;  5LYD A;  4ZGE B;  3QPH A;  3V7S A;  3BJ8 A;  1TS9 A;  4M78 B;  1FX7 A;  5C88 A;  2JM9 A;  1KC8 U;  4DBR A;  2RFH A;  1LOJ A;  3W91 A;  2PE3 A;  1TWB A;  3RIR A;  4DUK A;  1BI1 A;  2RQR A;  1AWJ A;  4AB7 A;  1WGS A;  5CQX A;  2NUT A;  2X3W D;  3B3C A;  3PB4 X;  3D7F A;  3R9F A;  3CMA Q;  3JB9 J;  1CPS A;  3FF3 A;  5IB0 A;  1QSR A;  2BKD N;  4ONW A;  2VAS A;  4C2X A;  5IN1 A;  1S3Z A;  3OSS C;  3DLJ A;  4CGM A;  2HBW A;  1NJI U;  2FO0 A;  3CC4 T;  4VUB A;  5HY6 A;  4M7A B;  1R8O B;  2DKG A;  5J8C A;  1YFN A;  4KH1 B;  3GLJ A;  4A33 A;  1RAI B;  2KY9 A;  2QML A;  4XPD C;  1SF9 A;  5KCH A;  4ESR A;  1ZQ1 A;  2MMP A;  3TVT A;  5CAI A;  1EE3 P;  2DYB A;  4ZBG A;  4KGX B;  2B8A A;  3L2U A;  4QBJ A;  2Z3K A;  1SSH A;  3M0R A;  3JVN A;  4DA4 A;  1M90 C;  2POK A;  3C26 A;  5AYF A;  1VQO T;  2RC4 A;  4MFQ A;  1TUC A;  1YWO A;  4M75 E;  4C92 D;  5GAO n;  1YIT Q;  4HT8 A;  4M7D A;  2AFM A;  2PJ0 A;  4UFV A;  3INZ A;  1RO5 A;  1UWY A;  2EK8 A;  2I3C A;  2KRN A;  3UA6 A;  2PNI A;  1SRL A;  2LDM A;  2GLJ A;  4MXU A;  3G71 A;  4F0X A;  1QVG P;  4BE1 A;  3EGX B;  4JLY A;  4C68 A;  2RN8 A;  3LGL A;  1BK2 A;  4AG1 C;  2YXY A;  1PYT B;  4RTX A;  3QDR B;  3I5R A;  1IXD A;  3BY7 A;  3JCM g;  2REF A;  1VQP A;  2E5K A;  3CCS Q;  3UPU A;  4KGV B;  3PFE A;  4Q36 A;  2CUB A;  1JRI A;  5LRG A;  1PCX A;  2DIG A;  1L0C A;  1ZX6 A;  1SEM A;  3RR6 A;  3OW2 P;  2OTL T;  3X20 B;  4JZ3 A;  3FJU A;  1IZ6 A;  2MYS A;  1VQM A;  1EX4 A;  2ZEH A;  2GE3 A;  4MDW A;  4PKC C;  1KZF A;  1Z2L A;  4HVW A;  4NGN A;  3G6E A;  4A4K A;  4RG2 A;  3JCM J;  4M75 C;  4UEZ A;  2QEX A;  3E2U A;  3MP8 A;  3FX6 A;  4A39 A;  2V8J A;  3EC4 A;  1OPK A;  2DPS A;  4GXH A;  3CXC S;  1WJR A;  3RAM A;  1Y9K A;  1TG0 A;  4JRI A;  3SHW A;  1Y71 A;  4OKO A;  2IVW A;  3IU1 A;  4KVX A;  3WT4 A;  3SWN C;  3HRT A;  4DYO A;  4MZT A;  3DB3 A;  2KE9 A;  4M78 C;  3LWU A;  2Q04 A;  4P4E A;  2LZ6 B;  1UGQ B;  4ZTJ A;  5AG5 A;  4KRT A;  4OVA A;  2PJB A;  5FLX E;  4ATO A;  3EO4 A;  4NCZ A;  1VA7 A;  2BZ8 A;  1Y96 B;  3L2N A;  1JO8 A;  2GTO A;  1Q86 R;  1JJ2 A;  4KSF A;  4D6W A;  1WLP B;  1ZO0 A;  3VS4 A;  3UF4 A;  3VS3 A;  1W2B S;  4C92 F;  3M9Q A;  5GAM h;  1YQE A;  2CP7 A;  1QQ9 A;  3CDX A;  4B13 A;  4MCS A;  2FXF A;  2B5G B;  3PNW C;  4IK2 A;  3D3S A;  4CYO A;  4MBU A;  4EMH A;  3LYI A;  2Z3P A;  3GLX A;  2DD5 A;  3H8Z A;  4X1V A;  4GBQ A;  1WHK A;  4BE2 A;  3CBM A;  4J7F A;  3VV0 A;  3LX7 A;  4M7A C;  2ZEO A;  3NFZ A;  2KGT A;  4CAV A;  3FRN A;  4R9M A;  2VKN A;  4AG2 C;  3NH4 A;  4V2S A;  3LH5 A;  2P0K A;  2QA4 A;  2CRE A;  4OB2 B;  4KLW A;  1QSN A;  1PD0 A;  4C8Q B;  2PJ8 A;  2E4H A;  4IUP A;  3LMS A;  3EFR A;  3LD2 A;  4ZGJ B;  3C95 A;  2DJZ A;  2DXT A;  3I56 Q;  3CD6 T;  1YIJ Q;  3NMZ C;  1Q81 C;  5KYU A;  4E7K A;  3PIP A;  2OAU A;  2J6O A;  3CCE T;  1K4J A;  4MHD A;  1BLL E;  4NJR A;  2NUP A;  4IUR A;  4KOV A;  4EMK B;  4M6G A;  1JQQ A;  2IG0 A;  2CP3 A;  2RQT A;  3KBG A;  4JPB W;  2F8H A;  1NM7 A;  4AVA A;  2GFQ A;  4F9U A;  3ASK A;  2KI7 A;  5IHN A;  1I21 A;  3ME9 A;  1BI2 A;  1VOM A;  1NYG A;  4P10 A;  4JRP A;  3KR4 A;  3MRU A;  2B58 A;  2M51 A;  4JWP A;  3SHP A;  1WJQ A;  1VQN T;  1V76 A;  4DOV A;  4OMQ A;  3CCJ A;  2DNU A;  2EJF A;  3QYH B;  2DER A;  1X01 A;  7CPA A;  3HFO A;  4FCY A;  2RJD A;  1J3T A;  2A3L A;  1M4L A;  3IFE A;  5FW9 A;  2PJ7 A;  1ZSZ B;  1WXT A;  1UEC A;  2QIR A;  5GAM e;  4QVC A;  2YUO A;  3SJX A;  4UC4 A;  3QO3 A;  3JCM V;  2X35 A;  2Z3N A;  3A5Z B;  2CT4 A;  4B10 A;  2CH4 A;  1B6B A;  4M77 A;  2OR4 A;  2EPD A;  2V1Q A;  3CCM Q;  2SEM A;  4II9 A;  2JBK A;  2PU9 B;  4MFP A;  3BW1 A;  3OYM A;  3FIF A;  5GMK j;  1YNZ A;  4J8O A;  4DEY A;  2DEU A;  2W10 A;  3JV3 A;  2PR1 A;  2LX9 A;  3L2Z A;  2D0N A;  2E1H A;  3EY5 A;  4KBM B;  1RI9 A;  2ZEN A;  4X9D A;  2PVW A;  4YU9 A;  3NH5 A;  2JMC A;  3CCQ T;  2XI9 A;  4ZYQ A;  1PUA A;  2HNI A;  1WI7 A;  3RKY A;  2OH1 A;  3QZ9 B;  1YHQ A;  2EYQ A;  1UFF A;  3KHX A;  2HC9 A;  2G9D A;  2O53 A;  4OML A;  5FWB A;  3BJ7 A;  3HUV A;  1ZLM A;  2OAW A;  1VQ4 Q;  1IGQ A;  1YGH A;  5IAY A;  1LNX A;  4M6I A;  3GIU A;  2PVG B;  2P84 A;  4ZX8 A;  3M57 A;  1UHF A;  4OP4 A;  5I11 A;  2FL7 A;  2Z0W A;  2B86 A;  2FL4 A;  3D67 A;  4WJB A;  3H4Q A;  4OAE A;  2HL3 A;  2HMA A;  2RQU A;  3HTR A;  1QSO A;  2ZEG A;  3F5B A;  3RUX A;  3R9G A;  3C94 A;  3OYY A;  2DXU A;  4KOS A;  5DS0 A;  2BIV A;  2XHC A;  2AK5 A;  2HCK A;  4BD9 A;  4FT2 A;  1VYU A;  4PL6 A;  2DF5 A;  1TSF A;  1M1K R;  1YW6 A;  1ARM A;  1VIE A;  3EG3 A;  2RI3 A;  3EG9 B;  4MFK A;  1M4G A;  3QB8 A;  4B5O A;  4CAE A;  2XKO C;  2YHT A;  1S72 T;  3BHX A;  2FVG A;  3CXC P;  3NH8 A;  4O5V A;  4TWE A;  2D9T A;  3TE4 A;  2XK0 A;  1K9M R;  2EO8 A;  5IHK A;  1PNJ A;  4HCB A;  2RHX A;  1R3N A;  4DNC A;  2G3T A;  2C0O A;  2GF7 A;  3CCV T;  5JPH A;  3KFV A;  2RF0 A;  3J81 E;  4MFJ A;  4Y28 E;  2DK3 A;  4PJO G;  1M1D A;  4OMN A;  2BOA A;  1IYL A;  3M59 A;  2KDS A;  2CZ7 B;  5KTC A;  1VQ5 Q;  3SWN A;  1WXU A;  4XU0 A;  1IYK A;  1KUV A;  2YNE A;  1LPL A;  1QMC A;  3OYJ A;  4NGM A;  2LQN A;  2YUP A;  1VQ7 Q;  3BDL A;  4M78 A;  2ZOG A;  3B3S A;  1X69 A;  4OC3 A;  3HRS A;  1MMG A;  2ZEE A;  2A36 A;  2M9U A;  3QDF A;  3N5B B;  1I1J A;  2ZAE A;  1YJN Q;  1W2B P;  1K9M U;  4MHY A;  1KQ1 A;  3OB9 A;  2C0I A;  1K4U S;  5GAM g;  1M1G A;  2QA4 Q;  1VQK T;  4M85 A;  3JAM E;  3TO9 A;  3OSV A;  3SI0 A;  2MK5 A;  4F7U G;  2CP2 A;  4M7D E;  3R96 A;  4PLI A;  4PJL A;  1ABO A;  2EJG A;  1IB1 E;  2KSS A;  3I55 T;  1VQN Q;  3R9E A;  3TX8 A;  2EYY A;  2KYB A;  1YJW A;  1R57 A;  4PXD A;  2GQI A;  3S6K A;  3RBB B;  3VUZ A;  2COY A;  4JZ4 A;  5GAN f;  3EHR A;  4M7A A;  4FL6 A;  4NGR A;  1LCP A;  1VQ9 T;  1HEE A;  3G4S T;  3D68 A;  1K73 R;  2QVP A;  3HPW A;  3FNC A;  2XDD A;  3TU4 K;  2YWW A;  3G3S A;  1NEG A;  5GAN h;  1ARL A;  1MMN A;  1YI2 T;  2KK4 A;  2RB7 A;  4LUE A;  1N71 A;  2VL1 A;  2FYK A;  5EC7 A;  4JYW A;  2E3I A;  5G21 A;  4QB9 A;  1FYN A;  2HQH A;  5I0C A;  3EGD B;  4RI1 A;  4OC0 A;  4Q7A A;  1EIF A;  1Q7L A;  2AKL A;  2PUO B;  5HVF A;  2R1I A;  1K73 U;  3JCM d;  3OWC A;  2PIZ A;  2DZC A;  2B3V A;  4UCM A;  2XU8 A;  3DSB A;  4HPS A;  2DL4 A;  2JTE A;  4M7D C;  1E6H A;  1WQW A;  4E7J A;  2D0Q B;  3FEO A;  5CCA A;  3KAS A;  4OC2 A;  2Z3L A;  4IF5 A;  2ODF A;  3BI0 A;  1TOV A;  3QWX X;  2EBP A;  4JXQ A;  4J9F A;  3V38 A;  4R7M A;  3EGX A;  1CJW A;  1HXD A;  2VEZ A;  4A95 A;  2M02 A;  2EBJ A;  3EAE A;  2I2L A;  2CXA A;  4UIA A;  4ZI6 A;  3CMA T;  2ZPH B;  2E3H A;  3X25 B;  2GRE A;  2VZY A;  4DBQ A;  3S9M A;  4UEF A;  2EIF A;  1U06 A;  2YSQ A;  4KOT A;  2F2X A;  4LDW A;  1WZO A;  2KBT A;  4OB0 B;  4KS9 A;  4MI4 A;  2PJ5 A;  4JLI A;  2RHI A;  1ACM B;  3GNF B;  1CM0 A;  4IKF A;  3H0H A;  2DPT A;  2XID A;  2G0B A;  3REB B;  2LQ8 A;  2ABL A;  3CME A;  2EVR A;  3SFM A;  4CPA A;  1MHN A;  2EAY A;  3UA7 A;  4C92 B;  3TQ7 P;  1Z9U A;  3CC7 Q;  3CCL A;  2BEI A;  2RA2 A;  1SHG A;  5I4M A;  2F69 A;  3UY5 A;  3M4G A;  1WXB A;  2GBQ A;  3FVL A;  5A0D A;  1Q2C A;  1X43 A;  2YLB A;  2E12 A;  2VBQ A;  4BAC A;  5J39 A;  1OOT A;  1BI0 A;  1QCN A;  2JNG A;  2JLM A;  4E7Z A;  3E9G A;  3J7A F;  1YIT T;  3CQT A;  3OMG A;  1GBR A;  3FIX A;  4R0K A;  3SJG A;  2ED0 A;  4PJN A;  5AG7 A;  5FRO A;  1SQH A;  1TF9 A;  5GJW B;  2VXK A;  2LJ1 A;  3RKW A;  3IQL A;  4A30 A;  5CIU A;  5CPA A;  3S3N A;  4XPL A;  3RNJ A;  1H8K A;  5A28 A;  4J9E A;  4RUG A;  2DM1 A;  3NTK A;  1Y96 A;  1KQ2 A;  2DVJ A;  4FU6 A;  1TF8 A;  3PBE A;  1T0H A;  4ZN3 A;  5CBM A;  1IOI A;  3JCM b;  2O01 E;  1NE8 A;  4BI3 A;  5F48 A;  4M3S A;  1NG2 A;  2B5G A;  4HNW B;  3CCS T;  8ATC B;  4CC2 A;  1I8F A;  3DLM A;  3CCU A;  2J7I A;  2RNA A;  1TU0 B;  1VYT A;  3JSC A;  5DLO A;  5FVJ A;  4N4H A;  2E10 A;  3LWH A;  1ELM P;  2V77 A;  3VAT A;  2H8H A;  4GLM A;  2AE6 A;  1M2O A;  5DM7 R;  4M4Z A;  3ZZI A;  2J6F A;  1OU8 A;  4A4G A;  4PJO D;  4KUB A;  4C8Q A;  5KTD A;  3NE7 A;  1HD3 A;  3EH1 A;  4UCN A;  1F57 A;  4XTY A;  2HZY A;  2ED1 A;  1F2P A;  3ZL7 C;  3DR6 A;  3D8P A;  3FEE A;  1KC8 R;  2E70 A;  1TTH B;  3A8O B;  4QKU A;  2H5M A;  4EMK A;  2FHD A;  1XJW B;  2QI2 A;  1KD1 C;  2XDB A;  2BCO A;  1CKA A;  4M77 E;  2EVN A;  5HVH A;  5K8P A;  4M75 G;  4LD6 A;  1ZA2 B;  4B5P B;  3NHN A;  1QVG A;  1FMV A;  3MET A;  5H86 A;  3SEM A;  2ZPF B;  4IHM A;  1YJW Q;  2DXQ A;  1S5K A;  5LJ5 h;  1VQ8 A;  2LCS A;  4JD6 A;  3CBO A;  4FIB A;  3VS7 A;  4F16 A;  1YVK A;  2DL3 A;  4XTZ A;  2E6Z A;  1W4S A;  2M16 A;  4R57 A;  4E7I A;  4OAD A;  5GAN 8;  3CCR A;  4H6Z A;  2FEI A;  2L89 A;  2RI2 A;  4K11 A;  4M78 G;  4RTT A;  3GB0 A;  2EYX A;  4WTO B;  1ZSG A;  2FVU A;  1ZSZ A;  5L8R E;  4PJJ A;  4FT4 A;  4X3R A;  2CY2 A;  4J83 A;  4C0Z A;  4DQ2 A;  3OW2 A;  2KXD A;  1S7K A;  4CGL A;  3BDU A;  3VS6 A;  2C0T A;  3OYC A;  3CC4 A;  5IHI A;  1SPK A;  2CDT A;  4RTY A;  1MNE A;  3CC2 Q;  4KSA A;  3ULR B;  1YVO A;  2KR3 A;  7AT1 B; 
#chains in the Genus database with same CATH homology
 2O9V A;  4DOW A;  5GAN 2;  5GAN g;  1BYM A;  2K9G A;  4M77 C;  2ZPG B;  4M7A G;  1U1S A;  3I56 T;  2LCC A;  1YIJ T;  2OJ2 A;  1NZ9 A;  2HAX A;  4LE9 A;  1VQO A;  2CZ1 B;  1RLQ C;  5GAN 3;  3GPL A;  2K3B A;  4XTU A;  3R6N A;  1HJD A;  4PJO F;  2L2P A;  2L0A A;  1RLP C;  2CH4 W;  1V29 B;  3OYE A;  4XTW A;  1NPR A;  1UEB A;  1PSE A;  2QQB A;  2JW4 A;  5LJ5 e;  2MCN A;  2MWO A;  2D8J A;  1CSK A;  1M8V A;  2P0P A;  3OS5 A;  4F17 A;  3GNG A;  3OS2 A;  1QP3 A;  5DY9 A;  1Q7Y C;  4F7U F;  1AZE A;  2E64 A;  4M78 E;  1WPY A;  1S1N A;  4RCC A;  2HB6 A;  2EYZ A;  3VYH B;  3QYG B;  2DX1 A;  2LT1 A;  4TVR A;  1XTD A;  3VS2 A;  3NFC A;  3RER A;  1QP2 A;  4J6W A;  2OTL A;  3CCM T;  3PMI A;  4JS4 A;  5EG2 A;  5M9O A;  3MP6 A;  3VRZ A;  4J9D A;  3J80 E;  4NL3 A;  4AFU C;  3A8G B;  3U23 A;  4RTU A;  5GAM d;  4M7A E;  1XNI A;  1G5V A;  4L6V 5;  1NJI C;  2MAM A;  1K1Z A;  2SRC A;  4IUU A;  2VYT A;  2HD0 A;  2YRV A;  3ZEH A;  1Q81 U;  2JS0 A;  1KQS S;  2LTO A;  4II1 A;  2EGC A;  1UE9 A;  2DMO A;  1M30 A;  2EQJ A;  1VQ4 T;  1W1F A;  1JU5 C;  3H0I A;  5GAM f;  2ESW A;  3GOX A;  4IIO A;  3F70 A;  1MUZ A;  3EG2 A;  2DLP A;  3M53 A;  2FPE A;  3VJP A;  3MEU A;  2L3Q A;  4A4E A;  3L2W A;  3L2V A;  3OYH A;  3JCM W;  4JS5 A;  4BI8 B;  2LT4 A;  4E7L A;  1AEY A;  5CR2 A;  4CC3 A;  1UGR B;  4C0D B;  3PVQ A;  4JJD A;  4M75 D;  4ORZ A;  4GY5 A;  2V1R A;  3FC3 A;  1YN8 A;  5I2S A;  3CD6 A;  2RMO A;  4MZM A;  2YUQ A;  2YDL A;  2W0Z A;  3CCE A;  2ENM A;  1VQ5 T;  4JJN K;  4GLK A;  2PTK A;  3HHT B;  3I9Q A;  4M78 D;  1VQ7 T;  4HVV A;  4C5G A;  5L23 A;  3CPW S;  4IUV A;  2VXE A;  1YJN T;  4QVZ A;  4D8K A;  4NS5 A;  1RL2 A;  2RM4 A;  4QQG A;  2QA4 T;  3TCJ A;  1QVF S;  2JZ2 A;  2A7Y A;  2RJF A;  1WNL A;  3QUI A;  1YP5 A;  2F5T X;  4LQ6 A;  1UG1 A;  3LGF A;  1DJ7 B;  1M5Q 1;  4M7A D;  2EQU A;  2QXF A;  1WYX A;  1AVZ C;  2D1X A;  4BD3 A;  5GAN j;  4XU3 A;  2NLU A;  3OYA A;  2P4T A;  1MV0 B;  4BY6 B;  3CXC A;  2LRQ A;  2KT8 A;  2KNB B;  1UB4 A;  3QXE B;  1MV3 A;  2XG8 D;  2RO0 A;  4C92 A;  3R6O A;  1N8R U;  5GAO m;  2L8D A;  1G3S A;  3DLL A;  2JUF A;  2LJ0 A;  2JVV A;  2O31 A;  2AZS A;  5GAN 4;  5GAO r;  2J05 A;  1IO6 A;  2BZY A;  1BIA A;  3P8D A;  4F14 A;  3CCQ A;  1AWX A;  4M75 F;  1W2B A;  3FLG A;  1RI0 A;  3MCA B;  1QLY A;  3RMS A;  2X4Y A;  3KXT A;  1Q86 C;  3H0F A;  1M8M A;  4QT7 A;  3M4Y A;  2DXC A;  2QQA A;  1H92 A;  3OA6 A;  4ELZ C;  3VUB A;  1M4Z A;  3JCM c;  2XIC A;  4M7D G;  2O4X B;  4XK8 E;  4WCI A;  1U5S A;  1M3B A;  1WQ7 A;  1K8A U;  1WA7 A;  4C5I A;  4J9I A;  1G3W A;  3GIB A;  4HCK A;  3A8L B;  4E6R A;  2VXF A;  2D6F A;  4EMG A;  3FDR A;  4C0D C;  4EFD A;  2LQW A;  3CC7 T;  1QKX A;  4X9C A;  5LJ3 f;  1S72 A;  4C8Q C;  4YTL A;  2X4X A;  1P92 A;  4M7A F;  5A0G A;  3CZX A;  2DXB A;  1H64 1;  2EFI A;  1Z9Z A;  1UDL A;  1TH7 A;  1FMK A;  3KUF A;  2K57 A;  3CCV A;  1M3C A;  2GTJ A;  2PUK B;  3V8K A;  5LJ3 h;  5GMK l;  4EMK C;  1T3L A;  2XDP A;  4A53 A;  4AFZ C;  3CEY A;  4LD9 K;  3QJ6 A;  2DO3 A;  2QQS A;  4XU1 A;  2RB6 A;  1GRI A;  1N5Z A;  3OBY A;  3L42 A;  1WIE A;  5GAN d;  4JDS A;  4JLG A;  3C12 A;  4PJO B;  2MF2 A;  3JB9 I;  2G3R A;  4DEX A;  2WSC E;  4QW2 A;  2ZCF B;  3TSW A;  4M6H A;  4EPC A;  1OEB A;  1XQH A;  1Q82 U;  1GL5 A;  1I0C A;  3OYN A;  3QJY A;  4BY6 C;  2R5M A;  1VQ9 A;  5FRM A;  3G4S A;  5FU6 B;  4BDY A;  3GP8 A;  3C4S A;  1AWW A;  1UGP B;  1W70 A;  2AHJ B;  1GCP A;  3M0P A;  1E7O A;  3X28 B;  3FB9 A;  4CC7 A;  2X4J A;  3NE8 A;  2FRW A;  4F7U B;  2X3X D;  4HCC A;  3EG1 A;  2JS2 A;  4RCB A;  1YI2 A;  2L3S A;  4LDU A;  1ZUU A;  2WSF E;  4O6J A;  3MEW A;  5ECA A;  1KSW A;  1YJW T;  2DE0 X;  2GFA A;  3LH0 A;  3P8H A;  5LJ3 e;  5GMK i;  3QII A;  4BDZ A;  3LWI A;  4XAX B;  4L5G A;  5HK3 A;  3BFM A;  2ZZD A;  1PSF A;  2RK1 A;  3M56 A;  3V7R A;  2LCL A;  2KEA A;  2IIM A;  5IH2 A;  5GAO q;  1M1K C;  2RH2 A;  5D6X A;  1QVP A;  2DJQ A;  1G3Y A;  2KQW A;  3CC2 T;  2EGA A;  4BI4 A;  2DEQ A;  2EGE A;  2J06 A;  2MIO A;  2DTH A;  1K9M C;  1K9A A;  4OMP A;  1KJW A;  2KT1 A;  1OZ2 A;  2NWM A;  3HL8 A;  2DL5 A;  2KMT A;  2E65 A;  2Y4Y A;  4ZTF A;  3H6Z A;  4M77 G;  1YIT A;  2KVQ G;  1YJ9 T;  2RJE A;  3LLR A;  2L5Q A;  3JB9 G;  3S3M A;  4B9W A;  1K76 A;  4M7D D;  1GFD A;  3URG A;  2PVO B;  2ZPE B;  2KRS A;  3VS5 A;  4FM4 B;  1VYV A;  4OF1 A;  2P0Q A;  4LDY A;  3PFS A;  4J9H A;  3L2R A;  2CGH A;  3L1A A;  2EQI A;  2DPP B;  1JXO A;  3OMC A;  5I2M A;  1QCF A;  2EWN A;  5GAN 6;  1FWZ A;  1SHF A;  1VQ6 T;  2OTJ T;  3CCS A;  1AD5 A;  1K73 C;  5A0L A;  1I5L A;  2K2V A;  4HVU A;  2A28 A;  1BI3 A;  2LVM A;  2EQK A;  3VS0 A;  1D3B B;  4AFQ C;  4ZGD B;  4QQ6 A;  4OP0 A;  5I22 A;  1NLP C;  1HSQ A;  2O88 A;  4EDU A;  2OI3 A;  1ARK A;  3A98 A;  3CPF A;  1E6G A;  3JCM Q;  1Y0M A;  2LC4 A;  2F5K A;  3REA B;  3I5S A;  5LJ3 g;  4JJB A;  3PE0 A;  5C0M A;  1VQL T;  4AFS C;  2VC8 A;  4C92 E;  5LJ5 f;  1VIF A;  5A2Q E;  1GBQ A;  1KHC A;  2K5F A;  3NTI A;  1M90 U;  4R56 A;  5HKC A;  5GAM j;  4MZP A;  2K6D A;  3WVD B;  2RQV A;  4A54 A;  2AKK A;  2BZX A;  2DTI A;  2AZV A;  3NPF A;  4M75 B;  2EQM A;  3ZFJ A;  4M7D F;  4KUD K;  4A63 B;  5CO7 A;  3HP9 A;  1W6X A;  3OBW A;  1I4K 1;  2DA9 A;  1N6A A;  1Q7Y U;  1X75 C;  1EFN A;  1H3Z A;  2KRO A;  1ZHI A;  1VQ8 T;  1T0J A;  1M27 C;  2DTO A;  4C92 C;  1YWP A;  3I56 A;  1AHJ B;  1YIJ A;  4Y91 A;  2JMA A;  2VUB A;  3OYL A;  4RTV A;  3CCR T;  4OMF B;  3VS1 A;  2VVK A;  3QAY A;  2A08 A;  3V7C A;  3QSU A;  3S6W A;  4RKU E;  1N9S A;  3FJP A;  1G83 A;  2RPN A;  2RHU A;  2JN0 A;  2RI5 A;  1K0X A;  1JWQ A;  1JJ2 S;  2R57 A;  1AOJ A;  3SDZ A;  2JM8 A;  3HKS A;  2CT3 A;  1U8R A;  1GFC A;  2K4Y A;  2KXC A;  1B34 B;  1ZBJ A;  2O4X A;  3PT9 A;  5EMI A;  3EGU A;  2RJC A;  1QW1 A;  2HQX A;  3O8V A;  4OGC A;  1M9S A;  3OY9 A;  2DL8 A;  3RES A;  5CKE A;  1QWE A;  3CCM A;  2DRM A;  1JB0 E;  2QTX A;  4M77 D;  5GMK m;  1X6O A;  1KC8 C;  3RMQ A;  4N4I A;  3JB9 D;  1X2K A;  1UJ0 A;  3M5A A;  1WDX A;  4R55 A;  3PGG A;  3G71 T;  2QDY B;  1OYX A;  5GAO p;  3H41 A;  2MOX A;  2GQV A;  1BBZ A;  1VQ4 A;  2HBP A;  1VQP T;  3QBY A;  5D6W A;  4C0G A;  4BUG A;  2CZ0 B;  4X34 A;  1AZG B;  3OYB A;  3EHQ A;  5GAN 5;  1KHI A;  1UGS B;  4PJO A;  2WSE E;  1VQM T;  4ELY C;  2I0N A;  4KT0 E;  3WVE B;  4N4G A;  3G6E T;  1JXM A;  2M1H A;  2D8H A;  3VU3 C;  5CKB A;  2QEX T;  3JB9 H;  2K3X A;  2K3Y A;  3E1S A;  4OB3 B;  2YT6 A;  4OGE A;  3UAT A;  2DAQ A;  3OQ5 A;  2HDA A;  3OYG A;  3CBP A;  4F7U A;  1X27 A;  5LJ3 j;  2Y90 A;  1T3S A;  1UHC A;  2GFU A;  2M0Y A;  4C0F A;  3MP1 A;  2JT4 A;  4PNO A;  1VUB A;  1VQ5 A;  2A37 A;  3M0U A;  1GXI E;  1IRE B;  4M77 F;  4C8Q G;  2LQK A;  1OPL A;  1X6B A;  1VQ7 A;  1WX6 A;  3JB9 F;  4LNP A;  4RTZ A;  2C06 A;  1YJN A;  2VWF A;  2FG0 A;  2CZ6 B;  1KIK A;  5LJ5 g;  4JJC A;  4J9B A;  5GAN 7;  1Q86 U;  4Y92 A;  3SB2 A;  1N9R A;  5CVI A;  1Y07 A;  2QDL A;  1UTI A;  1Z9Q A;  1O9S A;  3G7Z A;  1K0S A;  4HCZ A;  4Q5W A;  1VQN A;  5CQY A;  1GCQ C;  2RHZ A;  2ECZ A;  1BU1 A;  2R5A A;  3V8L A;  3DB4 A;  5HCK A;  3MEA A;  4C5E A;  4A4H A;  4OMM A;  5IT9 E;  5IXF A;  4J6X A;  3PVL A;  1XOV A;  1WFW A;  4RG8 A;  1OI1 A;  1QKW A;  2DBM A;  2HEQ A;  2L3R A;  1KQS A;  3M55 A;  2R58 A;  3V8J A;  2K7A A;  1N27 A;  2E5Q A;  2JTM A;  1PRM C;  3NTH A;  2KYM A;  4HKE A;  3CCJ T;  2EKH A;  1LCK A;  4BIN A;  1NEB A;  1O75 A;  2VGM A;  2LJ3 A;  2DBK A;  1UGV A;  5FWC A;  2CS7 A;  3PTA A;  3VYG A;  3RKX A;  1V1C A;  4C8Q E;  4N0A C;  3O5Z A;  1G2B A;  2JOY A;  2BUD A;  3AHU A;  2G6F X;  1JEG A;  3Q1J A;  2LP5 A;  2K79 A;  4NL2 A;  3QHS A;  1NYF A;  1SRM A;  2CKK A;  4RMO A;  4J7I A;  1I07 A;  3C0C A;  4EIK A;  4M78 F;  1JBM A;  3VRY A;  3E19 A;  5LJ3 d;  3GF5 A;  2DF6 A;  4ZNX A;  1D3B A;  1Y7X A;  2EW3 A;  3CC7 A;  4ZN1 A;  5LL6 S;  2DRK A;  2DD4 A;  3LW5 E;  5CK9 A;  2O9S A;  2JXB A;  4M7D B;  1BIB A;  5KCO A;  2PVD B;  1YHQ T;  2CSQ A;  4P5N A;  3X24 B;  3CPW A;  3MEV A;  5DLQ E;  4J9C A;  3QKJ A;  1QVF A;  3TSZ A;  3OYI A;  1CKB A;  4HA8 A;  1N8R C;  3M0T A;  2EKO A;  3A8M B;  3HRU A;  1G3T A;  2LMJ A;  1PKS A;  3HSB A;  2V8K A;  3GBQ A;  2VV5 A;  1ZBX A;  1QWF A;  2X4W A;  3OYK A;  3VKI A;  4Z89 A;  2DZ9 A;  4M75 A;  1PWT A;  2ZPI B;  3ZBD A;  4XTX A;  2XD0 A;  5D6Y A;  1AWO A;  1VQK A;  2GGR A;  2DL7 A;  3PMT A;  5I21 A;  3A8H B;  3UT1 A;  2HQE A;  1B07 A;  3I55 A;  1M1K U;  1UUE A;  4LDX A;  2PQW A;  4E47 A;  5IXB A;  3QWY A;  2CYZ B;  2RD1 A;  4C8Q D;  2YUN A;  4JRQ A;  4J5Y A;  3M54 A;  1RUW A;  1K8A C;  2BTT A;  2JTF A;  3TEE A;  4FSX A;  1OV3 A;  2H3J A;  4QVD A;  4XU2 A;  2ROL A;  3SD4 A;  3MO8 A;  5LJ5 j;  3PIO A;  1SSF A;  4C5H A;  5J3B A;  5KE3 A;  1PRL C;  4A4F A;  1WJS A;  4XQ3 A;  2RK2 A;  4JUV A;  3WXM B;  2XMF A;  1X2Q A;  3T9N A;  4CRI A;  1PKT A;  1B34 A;  2KAF A;  4CI0 C;  2PZ1 A;  1YBY A;  2K5L A;  3MHX A;  3M0Q A;  2FPF A;  1GCQ A;  3CMA A;  1MGQ A;  2CUD A;  2EYW A;  5FU7 B;  2LNV A;  4HXJ A;  3CC2 A;  4MDX A;  2ROT A;  1BB9 A;  2F2W A;  4HT9 A;  1U1T A;  4RTW A;  1HK9 A;  4E7H A;  3ER0 A;  4D8D A;  4BE0 A;  3DKM A;  1Y57 A;  4PJO E;  4OMO A;  5KE2 A;  4FSS A;  5GMK h;  2RQW A;  2F2V A;  4WF2 A;  2HSP A;  1LJO A;  4LN2 A;  2YLC A;  1ZUK A;  1Q82 C;  1TUD A;  3JCM f;  2VGN A;  4C92 G;  3THK A;  3M0S A;  3JCM P;  1QVG S;  2FPD A;  1YJ9 A;  4PLL A;  4C8Q F;  3OYD A;  4F7U E;  5C6S A;  2GNC A;  4L59 A;  2LNH B;  3L2Q A;  4N0A A;  3JCM h;  1A0N B;  1KD1 U;  3JRZ A;  4LDV A;  5FRN A;  3UWN A;  3CME T;  2FRY A;  4Z02 A;  2Q7S A;  2K2M A;  4OB1 B;  4M77 B;  3M58 A;  4IUT A;  1I81 A;  1M3A A;  4Z88 A;  1ABQ A;  3TRE A;  3CCL T;  3OW2 S;  4KUL A;  2GCX A;  1VQ6 A;  4PJO C;  5GJV B;  2OTJ A;  5GAN e;  3FJ5 A;  2ZGW A;  2DVE A;  3I35 A;  5GAO l;  4Z8A A;  3QG1 A;  5J26 A;  1YCS B;  1OZ3 A;  2FB7 A;  5FU6 C;  1M1F A;  3E9F A;  3P8B B;  3X26 B;  3EG0 A;  3NGP A;  2K5I A;  3HFN A;  4LUD A;  3OS0 A;  4KUI A;  1FXX A;  2MI6 A;  2E41 A;  5LJ5 d;  5CKD A;  4BB7 A;  5GMK e;  3OYF A;  4QQD A;  1PHT A;  1VQL A;  4JRK A;  3OS1 A;  4IUQ A;  2RHY A;  4IIM A;  5HK0 A;  1X6G A;  2L3P A;  4J9G A;  2J6K A;  2KRM A;  1KG1 A;  1UJY A;  3CCU T;  2O2O A;  1ZUY A;  5CKF A;  5CKH A;  4MML A;  2NUZ A;  1YCY A;  4NOY A;  2M0O A;  3QZ5 B;  2LX7 A;  4J6Y A;  4CC4 B;  3JCM e;  4XTV A;  1BKB A;  1B3Q A;  2QQR A;  5KH6 A;  5FU7 C;  4MMK A;  2MWP A;  2CSI A;  2ZPB B;  2V8I A;  4B9X A;  2QQ9 A;  3EFS A;  1KFZ A;  2DIL A;  4RN7 A;  3UDC A;  2DIQ A;  1U3O A;  1H3H A;  4ME7 A;  3JCM X;  2P4R A;  2E6N A;  2WAC A;  2Y4X A;  3SWN B;  1NPP A;  1NLO C;  3S3O A;  2EJ9 A;  4ZGE B;  3QPH A;  3V7S A;  4M78 B;  1FX7 A;  2JM9 A;  1KC8 U;  1LOJ A;  3RIR A;  1BI1 A;  2RQR A;  1AWJ A;  1WGS A;  5CQX A;  2X3W D;  3JB9 J;  2BKD N;  5IN1 A;  3OSS C;  2HBW A;  1NJI U;  2FO0 A;  3CC4 T;  4VUB A;  5HY6 A;  4M7A B;  1R8O B;  2DKG A;  2KY9 A;  5KCH A;  4ESR A;  1ZQ1 A;  2MMP A;  3TVT A;  5CAI A;  2DYB A;  2B8A A;  3L2U A;  1SSH A;  3M0R A;  4DA4 A;  1M90 C;  5AYF A;  1VQO T;  1TUC A;  1YWO A;  4M75 E;  4C92 D;  5GAO n;  4HT8 A;  4M7D A;  3INZ A;  2KRN A;  3UA6 A;  2PNI A;  1SRL A;  2LDM A;  3G71 A;  4BE1 A;  2RN8 A;  3LGL A;  1BK2 A;  4AG1 C;  4RTX A;  3QDR B;  3I5R A;  3JCM g;  3BY7 A;  1VQP A;  2E5K A;  3UPU A;  2CUB A;  1JRI A;  2DIG A;  1ZX6 A;  1SEM A;  2OTL T;  3X20 B;  4JZ3 A;  1IZ6 A;  1VQM A;  4MDW A;  4PKC C;  4HVW A;  3G6E A;  4A4K A;  4RG2 A;  3JCM J;  4M75 C;  2QEX A;  3MP8 A;  2V8J A;  1OPK A;  3CXC S;  1WJR A;  1TG0 A;  3SHW A;  4JRI A;  1Y71 A;  2IVW A;  3SWN C;  3HRT A;  4MZT A;  3DB3 A;  2KE9 A;  4M78 C;  2LZ6 B;  1UGQ B;  4ZTJ A;  4KRT A;  4OVA A;  5FLX E;  4ATO A;  1VA7 A;  2BZ8 A;  1Y96 B;  1JO8 A;  2GTO A;  1JJ2 A;  4D6W A;  1WLP B;  3VS4 A;  3UF4 A;  3VS3 A;  1W2B S;  4C92 F;  3M9Q A;  5GAM h;  3PNW C;  4EMH A;  3LYI A;  3GLX A;  2DD5 A;  3H8Z A;  4X1V A;  4GBQ A;  4BE2 A;  3CBM A;  4J7F A;  3VV0 A;  3LX7 A;  4M7A C;  2KGT A;  3FRN A;  2VKN A;  4AG2 C;  4V2S A;  3LH5 A;  2P0K A;  2QA4 A;  2CRE A;  4OB2 B;  4C8Q B;  4IUP A;  3EFR A;  4ZGJ B;  3C95 A;  2DJZ A;  2DXT A;  3CD6 T;  3NMZ C;  1Q81 C;  4E7K A;  3PIP A;  2OAU A;  2J6O A;  3CCE T;  4IUR A;  4EMK B;  4M6G A;  1JQQ A;  2IG0 A;  2RQT A;  3KBG A;  4JPB W;  1NM7 A;  3ASK A;  5IHN A;  3ME9 A;  1BI2 A;  1NYG A;  4JRP A;  2M51 A;  1WJQ A;  1VQN T;  4DOV A;  4OMQ A;  3CCJ A;  2DNU A;  2EJF A;  3QYH B;  1X01 A;  3HFO A;  2RJD A;  1J3T A;  2A3L A;  5FW9 A;  1WXT A;  1UEC A;  5GAM e;  4QVC A;  2YUO A;  4UC4 A;  3QO3 A;  3JCM V;  2X35 A;  3A5Z B;  2CT4 A;  2CH4 A;  4M77 A;  2EPD A;  2V1Q A;  2SEM A;  2PU9 B;  3BW1 A;  3OYM A;  3FIF A;  5GMK j;  1YNZ A;  4J8O A;  4DEY A;  2W10 A;  3JV3 A;  2LX9 A;  3L2Z A;  2D0N A;  2E1H A;  4KBM B;  1RI9 A;  4X9D A;  2JMC A;  3CCQ T;  2XI9 A;  2HNI A;  1WI7 A;  3RKY A;  3QZ9 B;  1YHQ A;  2EYQ A;  1UFF A;  2HC9 A;  4OML A;  5FWB A;  1ZLM A;  2OAW A;  5IAY A;  1LNX A;  4M6I A;  2PVG B;  3M57 A;  1UHF A;  5I11 A;  2FL7 A;  2B86 A;  2RQU A;  3RUX A;  3C94 A;  3OYY A;  2DXU A;  2BIV A;  2XHC A;  2AK5 A;  2HCK A;  4FT2 A;  1VYU A;  4PL6 A;  1VIE A;  3EG3 A;  2RI3 A;  2XKO C;  2YHT A;  1S72 T;  4O5V A;  2D9T A;  2XK0 A;  5IHK A;  1PNJ A;  4HCB A;  2RHX A;  2C0O A;  2GF7 A;  3CCV T;  3KFV A;  2RF0 A;  3J81 E;  4Y28 E;  2DK3 A;  4PJO G;  4OMN A;  3M59 A;  2KDS A;  2CZ7 B;  3SWN A;  1WXU A;  4XU0 A;  3OYJ A;  2LQN A;  2YUP A;  3BDL A;  4M78 A;  1X69 A;  3HRS A;  2A36 A;  2M9U A;  3N5B B;  1I1J A;  1K9M U;  1KQ1 A;  3OB9 A;  2C0I A;  1K4U S;  5GAM g;  1M1G A;  1VQK T;  3JAM E;  3OSV A;  4F7U G;  4M7D E;  4PLI A;  1ABO A;  2EJG A;  2KSS A;  3I55 T;  2KYB A;  2EYY A;  1YJW A;  2GQI A;  3RBB B;  3VUZ A;  4JZ4 A;  5GAN f;  3EHR A;  4M7A A;  4FL6 A;  1VQ9 T;  3G4S T;  3HPW A;  2XDD A;  3TU4 K;  1NEG A;  5GAN h;  1YI2 T;  2KK4 A;  4LUE A;  5EC7 A;  2FYK A;  1FYN A;  1EIF A;  2AKL A;  2PUO B;  1K73 U;  3JCM d;  2DZC A;  2XU8 A;  2DL4 A;  2JTE A;  4M7D C;  1E6H A;  1WQW A;  4E7J A;  2D0Q B;  3FEO A;  5CCA A;  2ODF A;  3QWX X;  2EBP A;  4J9F A;  1HXD A;  3EAE A;  2I2L A;  3CMA T;  2ZPH B;  3X25 B;  2EIF A;  1U06 A;  2YSQ A;  2F2X A;  4LDW A;  2KBT A;  4OB0 B;  4JLI A;  2RHI A;  3GNF B;  4IKF A;  3H0H A;  2XID A;  3REB B;  2LQ8 A;  2ABL A;  3CME A;  2EVR A;  3SFM A;  1MHN A;  2EAY A;  3UA7 A;  4C92 B;  3CCL A;  2RA2 A;  1SHG A;  2F69 A;  3M4G A;  1WXB A;  2GBQ A;  5A0D A;  1X43 A;  2YLB A;  2E12 A;  4BAC A;  5J39 A;  1OOT A;  1BI0 A;  2JNG A;  3E9G A;  3J7A F;  1YIT T;  3CQT A;  1GBR A;  3OMG A;  4R0K A;  2ED0 A;  5FRO A;  5GJW B;  2LJ1 A;  3RKW A;  3IQL A;  5CIU A;  3S3N A;  3RNJ A;  1H8K A;  4J9E A;  4RUG A;  2DM1 A;  3NTK A;  1Y96 A;  1KQ2 A;  2DVJ A;  4FU6 A;  1T0H A;  4ZN3 A;  3JCM b;  2O01 E;  1NE8 A;  4BI3 A;  1NG2 A;  3CCS T;  4CC2 A;  1I8F A;  3DLM A;  3CCU A;  2J7I A;  2RNA A;  1VYT A;  3JSC A;  5DLO A;  4N4H A;  2E10 A;  3LWH A;  2H8H A;  4GLM A;  5DM7 R;  4M4Z A;  2J6F A;  4PJO D;  4A4G A;  4C8Q A;  1HD3 A;  4XTY A;  2ED1 A;  3ZL7 C;  2E70 A;  3A8O B;  4EMK A;  2FHD A;  2QI2 A;  1KD1 C;  2XDB A;  1CKA A;  4M77 E;  4M75 G;  4LD6 A;  3NHN A;  1QVG A;  3MET A;  3SEM A;  2ZPF B;  5LJ5 h;  1VQ8 A;  2LCS A;  3CBO A;  4FIB A;  3VS7 A;  4F16 A;  2DL3 A;  4XTZ A;  2E6Z A;  1W4S A;  2M16 A;  4E7I A;  5GAN 8;  3CCR A;  2FEI A;  2L89 A;  2RI2 A;  4K11 A;  4M78 G;  4RTT A;  2EYX A;  1ZSG A;  2FVU A;  5L8R E;  4FT4 A;  4J83 A;  4C0Z A;  4DQ2 A;  3OW2 A;  2KXD A;  3VS6 A;  3BDU A;  2C0T A;  3OYC A;  3CC4 A;  5IHI A;  1SPK A;  2CDT A;  4RTY A;  3ULR B;  2KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...