1XOVA

The crystal structure of the listeria monocytogenes bacteriophage psa endolysin plypsa
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
315
structure length
315
Chain Sequence
AMSNYSMSRGHSDKCVGAEDILSEIKEAEKVLNAASDELKREGHNVKTFIDRTSTTQSANLNKIVNWHNANPADVHISVHLNAGKGTGVEVWYYAGDEKGRKLAVEISAKMAKALGLPNRGAKATKDLRFLNSTKGTAVLLEVCFVDRKEDANAIHKSGMYDKLGIAIAEGLTGKTVAAKNPNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the bacteriophage PSA endolysin reveals a unique fold responsible for specific recognition of Listeria cell walls
pubmed doi rcsb
source organism Listeria phage psa
molecule tags Hydrolase
molecule keywords Ply protein
total genus 101
structure length 315
sequence length 315
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF18341 PSA_CBD PSA endolysin C-terminal cell wall binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1xovA02
2.30.30.500 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1xovA03
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 1xovA01
1AZGB 1BBZA 2DILA 4HVWA 2DMOA 2RMOA 4Z8AA 4RTTA 1UFFA 4E6RA 1M30A 2KYMA 1RI9A 3EGUA 2RQUA 4A63B 2K2MA 3M0QA 4CC2A 4HCKA 4J9HA 1HD3A 2G6FX 4JJDA 2JM9A 3UA7A 2JXBA 3REAB 2KXDA 2KEAA 1XOVA 2LJ0A 2CUDA 5IHIA 4Z89A 1I1JA 2K3BA 1GFDA 3I9QA 2O88A 2DNUA 1VA7A 2LQWA 5FW9A 4J9FA 2LQNA 2AK5A 3CZXA 2DX1A 1B3QA 1QKXA 4ZNXA 2YUNA 1ARKA 4LUDA 1BU1A 2X3WD 3QWXX 2KBTA 2EGCA 2KGTA 2O9VA 3H41A 4EIKA 4JPBW 1FYNA 2DL5A 2DLPA 2M51A 4J9IA 1ZUYA 2DJQA 4AG1C 1RUWA 1E7OA 1WI7A 3O5ZA 3UATA 4X1VA 3VS7A 1QWEA 4HVUA 2FEIA 2J6OA 3EG3A 2O31A 2VWFA 2YUOA 1JQQA 4RN7A 2CT3A 1X2QA 3VS1A 1AWOA 1NG2A 2EYXA 1GCQC 2DYBA 1ZSGA 1ZUUA 2AKKA 2LNHB 1UHFA 2KT8A 3U23A 1NEGA 2SEMA 2KROA 1OEBA 2BZYA 2KXCA 4J9GA 1UE9A 2LMJA 3M0TA 2JMCA 1AZEA 2KRMA 2YUQA 3I5RA 2V1RA 2DL7A 1YP5A 3ULRB 1KIKA 2JMAA 1TUCA 1HSQA 1VYTA 2FO0A 2CH4W 4JZ4A 1W70A 4F16A 2LJ1A 2EPDA 1WA7A 3PVLA 4LUEA 2CT4A 1NLOC 2K6DA 2J7IA 1X2KA 4ORZA 1YNZA 1ZX6A 1WYXA 4FSSA 1ZLMA 2Q7SA 1PRMC 2ROTA 4CC3A 1JWQA 2BZXA 2SRCA 2L3SA 4IIMA 1GFCA 1NYFA 2FRWA 2GTOA 2LJ3A 4LN2A 4GBQA 5IXFA 4M4ZA 2DL3A 1GRIA 1K76A 1SEMA 2XMFA 3EG1A 3KFVA 2RQVA 2VVKA 1JXOA 4OMOA 3VS6A 4WCIA 1MV3A 1Y0MA 4LNPA 5IH2A 2RPNA 1W6XA 4Y92A 1YCSB 3NHNA 2V1QA 1UJ0A 4RUGA 2JTEA 2DL4A 1BK2A 2GGRA 1WLPB 3FJ5A 4OMMA 1SPKA 1A0NB 3JV3A 1UJYA 1CKAA 1GCQA 2EBPA 3QWYA 4K11A 4AG2C 2KRNA 5I22A 4OMLA 3M0UA 3I35A 3SHWA 2DL8A 2PTKA 2F2VA 1SHGA 1OV3A 2GQIA 2RQWA 1LCKA 1H92A 3VS5A 2YT6A 3VS4A 3IQLA 3I5SA 4M6HA 2J6KA 1CSKA 2HBWA 1T0JA 1W1FA 3LH5A 1JXMA 3H0HA 1T3SA 2KNBB 5HCKA 1YWOA 3UA6A 4HVVA 4RTWA 2JT4A 2RF0A 2ABLA 1QKWA 2I0NA 1NM7A 2L0AA 2FRYA 4DEYA 2DE0X 2FPDA 3EHRA 1K0XA 3RBBB 1WX6A 1KFZA 3PVQA 2MIOA 3M0SA 2OJ2A 3VS3A 2HEQA 2DA9A 3REBB 1T0HA 1E6GA 4D8KA 1M8MA 1UHCA 5EC7A 2ESWA 2X3XD 1WDXA 4OMNA 3VS2A 1GL5A 4QT7A 2ODFA 2OI3A 4IIOA 2A36A 1UGVA 2AZVA 2ECZA 2DRMA 2JS0A 1M27C 2DF6A 5ECAA 5GJWB 4M6IA 3THKA 2RQRA 4F14A 2A28A 2L2PA 1QWFA 1GBQA 2A37A 4OMQA 1OPLA 1UECA 2FG0A 4D8DA 1NYGA 1WFWA 4Z88A 2D1XA 1KSWA 2E5KA 2W10A 1SRLA 2DBKA 2EKHA 5GJVB 2PZ1A 1AD5A 1VYUA 1G83A 2ED1A 2W0ZA 1K0SA 5L23A 1BB9A 1X43A 2K79A 1PKTA 4RTZA 5FWCA 1WXUA 1AEYA 1PHTA 4R0KA 1ZUKA 2EGEA 3H0IA 4JJBA 2B86A 2D0NA 4J9EA 2YDLA 3PE0A 1RLQC 1YWPA 2DBMA 1I07A 3M0RA 3M0PA 3VRYA 2P4RA 3VS0A 5IHNA 1UG1A 4CC4B 2FPEA 2JW4A 2ENMA 2NUZA 2J05A 2KE9A 1TUDA 2LCSA 3A98A 1H8KA 1MV0B 1RLPC 2EW3A 3NPFA 5EMIA 2DM1A 2BTTA 1M3CA 2EYWA 1SHFA 2K7AA 1JO8A 2D8JA 2LZ6B 2RQTA 1PRLC 1AWXA 1YN8A 2EVRA 2CH4A 3EG0A 3TVTA 3TSWA 1EFNA 1E6HA 2OAWA 2RNAA 2EGAA 1X6BA 2GBQA 1WIEA 1J3TA 4RTUA 1UUEA 3VRZA 4BINA 1AVZC 1PNJA 1X6GA 2KRSA 3GBQA 4OMPA 2EQIA 3R6NA 3RNJA 4LQ6A 1QCFA 2PNIA 4CC7A 2AKLA 2JS2A 4JZ3A 5FWBA 4KRTA 1MUZA 4AFSC 1FMKA 1OPKA 1AWWA 2KR3A 4AFZC 1H3HA 1U3OA 2VKNA 2H8HA 3EG2A 1IO6A 1U06A 1JEGA 1AWJA 1X69A 4JJCA 4J9BA 2C0OA 1HJDA 1B07A 1GBRA 1T3LA 1GCPA 1ZBJA 4J9CA 1SRMA 4DEXA 2DVJA 2LX7A 1K9AA 2C0IA 4AFUC 2LP5A 4M6GA 2F2XA 2J06A 2ROLA 1VYVA 2HCKA 4LE9A 1WXTA 2FPFA 2AZSA 1CKBA 1UTIA 1JU5C 2K9GA 2L3PA 1Y57A 2JM8A 4J9DA 1G2BA 1KJWA 2GTJA 2YSQA 1I0CA 4ESRA 2D8HA 3UF4A 2CSQA 2EYYA 1N5ZA 2IIMA 2BZ8A 5IHKA 1SSHA 2C0TA 2O2OA 2A08A 1NEBA 4F17A 1ABOA 2CSIA 1Z9ZA 2RN8A 2NWMA 4AFQC 1PKSA 2L3QA 1QLYA 1UDLA 2HDAA 2MOXA 2CREA 1M3AA 3TSZA 1U5SA 3C0CA 1TG0A 1Z9QA 1NLPC 3EHQA 3ZL7C 5I11A 2GNCA 2M0YA 1X27A 3CQTA 1ABQA 4RTYA 1OOTA 2MCNA 1WXBA 2QDLA 4RTXA 2KYBA 4HXJA 3SEMA 2J6FA 3QAYA 4GLMA 3NGPA 3NE8A 3H0FA 1K4US 4RTVA 1M3BA 1S1NA 2EYZA 1PWTA 2ED0A 2KT1A 2DRKA 2O9SA 2HSPA 2YUPA 2F2WA 5IXBA 2CUBA 1K1ZA 2CDTA 3NMZC 1AOJA 1V1CA
chains in the Genus database with same CATH superfamily
3GPLA 3M9QA 2DTIA 3X28B 2RI2A 2B8AA 4L8AA 4C8QB 1M4DA 1YHQQ 4R55A 3L2VA 3ZFJA 3L2WA 2DYIA 1XE4A 2KAFA 5HY6A 4PKCC 1M4LA 1S7KA 1HDQA 1UFFA 2ZW5A 1B7TA 3QKJA 5C0MA 4QC6A 1PC0A 4CGNA 1M2VA 2K2MA 2D0QB 5CPAA 3G6ET 3UDCA 2E70A 2E10A 1UEBA 4KVOE 1M5Q1 1TF9A 3N5BB 2GFUA 4KOUA 4JJDA 3E9FA 2E5QA 1BCMA 4C92C 4OIWA 1HXDA 2CTCA 2WUUA 2ZPBB 5LJ5g 2WSEE 5CIUA 2RHXA 2CUDA 3MO8A 1X10A 5CBMA 4ZI6A 4JRPA 5A2QE 4XU2A 1GFDA 4F7UF 5I2SA 1KQSP 5GAMh 5G22A 4LD9K 2R1IA 2AK5A 2ZEPA 7CPAA 4M7AC 3DB4A 1KQ1A 4ZNXA 3CXCP 4E2AA 2XG8D 1ARKA 3F70A 4AMCA 1A2ZA 4LUDA 3FEDA 4N4HA 1OQKA 2VXFA 1M44A 2X3WD 3QWXX 1ZLIA 3OQ5A 3JRUA 1SF9A 5FLXE 5FU6B 4JPBW 5A0GA 3QB8A 3CCRT 1RACB 3BXMA 2JTFA 1RUWA 2ARHA 2OU2A 4AG9A 2CNMA 4PJJA 1M2VB 3D7SB 8CPAA 2J6OA 1W2BA 1QCOA 3FLGA 2YUOA 2PCUA 3OB9A 2EIFA 4FD7A 5I0CA 1X6OA 3KR4A 2CT3A 1D0XA 3G7ZA 3KQXA 1K8AR 1VQ7T 4QQGA 1F2PA 1TOVA 1V76A 1SSFA 4UFVA 2DYBA 2OZHA 5CKEA 3OBYA 3X26B 4YRHA 1TUGB 4ZTJA 2DIGA 2ZPFB 4RS2A 4KGXB 2X4JA 2KROA 4J5YA 2KXCA 5IAYA 1I8FA 2I2LA 2LVMA 3G71Q 2Q4YA 3S9MA 4JS4A 1VQKT 1OU8A 2DK3A 4A39A 2JMAA 2AFSA 1TUCA 5LJ3g 1NE9A 3QNVA 5JH9A 4OB2B 3BI1A 3OWCA 2CTBA 1WA7A 3PVLA 3PB9X 2CT4A 3EC4A 4KORA 2PJBA 3RBUA 5HVFA 1ZX6A 1YQEA 4FSSA 1PRMC 4CAVA 4OP0A 1JWQA 3GB0A 2BZXA 2L3SA 2ZEHA 3OS5A 5LRGA 4LXCA 2QECA 1U1TA 2E65A 1PYTB 4GBQA 3NH5A 1KC8C 3LX7A 2REEA 2CS7A 5J8FA 4XPKA 4EFDA 1JXOA 4OMOA 3OYMA 2COWA 1I4K1 2R5AA 1MV3A 2X4YA 4ME7A 5IH2A 5GAOp 1Y7RA 5ELYA 3WXMB 2VXEA 2EJ9A 3CCUA 4AVCA 4Y28E 2EK8A 3NHNA 2CZ6B 2V1QA 4FAIA 4AB7A 2JTEA 4TVRA 3CCLT 2QTVA 1VQMT 4C7IA 1M8VA 5K8MA 1N8RR 3F8KA 1K8AC 1VIFA 3FJ5A 4OMMA 1SPKA 3JTKA 2DPPB 5GANf 2XDDA 4OMFB 1WJQA 4CAWA 1GCQA 4C92E 4AG2C 2RK2A 4OMLA 3NH4A 2ZOFA 3M0UA 4KUBA 3CMEA 1QVPA 4XU3A 2RB7A 3PZJA 5CKFA 2Y90A 3H4QA 2DL8A 2PTKA 4ONWA 3TOAA 1SHGA 1OV3A 2RQWA 4I49A 2YT6A 3RKWA 3GY9A 3IQLA 3I5SA 4F9VA 2J6KA 1CSKA 1MHNA 1YLOA 5G1ZA 2GE3A 2D6FA 3A8GB 3DR6A 2XEFA 2ZPGB 5HCKA 2PJ9A 2COYA 4E2FB 3GP8A 1VQKQ 3L1AA 4QKUA 5GAOr 4ORFA 4KLVA 3OW2A 3FH4A 2AFMA 2K3YA 2MI6A 1N6AA 3JB9G 4HPSA 2RF0A 1IICA 2YHTA 4N0AA 3RESA 3V7RA 3OA6A 1NM7A 2J8RA 4YU9A 2FRYA 2CGHA 1RAFB 5E96A 1X01A 1W2BP 1XQHA 1KQ2A 1QW1A 2R58A 2R8VA 3PB7X 5LRJA 4Y91A 3M0SA 3VS3A 1Q81C 4FYXB 2HEQA 5GANe 3UT1A 3CXQA 5KCOA 3E1SA 1M8MA 5KCHA 5C82A 3L2QA 3B3WA 4M7AE 3BJ7A 1TF8A 3K9UA 2ESWA 2RHYA 5GAMe 1K8AU 4B13A 1WDXA 3VS2A 1VQ9Q 3EGDB 4VUBA 1QQJA 4EMHA 4MY3A 3IU1A 4PXEA 4GM5A 2A36A 2EJFA 5GAN7 1LFWA 3TU4K 2MAMA 2ECZA 5CKBA 4R8FA 2RK1A 3JCMg 2ATCB 2RA2A 2DPSA 2BCOA 2KSSA 4B6MA 2A28A 3KGQA 1CM0A 1MMGA 5H86A 1YJWT 2J8NA 3I56A 2FXFA 3EH1A 3OYEA 3W6XA 3S6GA 4MCQA 3FRNA 2E3IA 4OMQA 4H6ZA 4QQDA 4X5KA 2EWBA 1M1KR 4PJOC 3DGVA 1NYGA 1LRZA 3PBEA 4FD4A 4R9MA 3CCSA 2P0WA 3V8IA 2E5KA 1DE4C 2EQJA 4OC4A 3RYOA 2Y0MA 1SRLA 3CC2T 3QDFA 2LQKA 2MK5A 1G83A 3CD6T 3W91A 2QA4T 3QXEB 2HB6A 2FT0A 4ZX8A 1X43A 2HC9A 5EG2A 2FVGA 4R0KA 4MI4A 4PNOA 3DLMA 3H5ZA 3BFMA 5GAN2 4M75E 4J9EA 4FT2A 2RB6A 1RLQC 1YWPA 1U8RA 2QEXT 3MEVA 3FEEA 2LNVA 2WSAA 3O8VA 3C94A 4PFOA 5DWMA 3VS0A 1YJ9T 3GYAA 1YJ9A 4CC4B 1UG1A 1PM3A 2OX7A 2J05A 3CCQA 2LT1A 3A98A 3SWNA 3V38A 2EW3A 4XTXA 4M7DD 2EBJA 2DM1A 2GIVA 1SHFA 1JO8A 2D8JA 1YJNA 3JCMX 1I5LA 2AFXA 3OW2S 1YN8A 1S7NA 1HDUA 3I55Q 3G6EQ 1VQ5A 1EE3P 4JS5A 3RIRA 4RTUA 2XEJA 1FMWA 1KWMA 1G3YA 2E6NA 4PJOF 1X6GA 4WTOB 4PSXA 4LQ6A 3LH0A 5GAN5 1QCFA 5D8NA 3ZJ0A 2DXQA 3OS0A 1G3SA 2JS2A 1J4JA 2JDDA 2PUKB 4IUPA 3VKIA 3IWWA 5HMNA 4KRTA 2FB7A 4MZTA 1D1AA 4M75D 1FMKA 1AWWA 3R9EA 2KR3A 1XF8A 4AFZC 1H3HA 3CCQQ 3JCMJ 4N4IA 4M7DB 1YITA 3SWNB 2Z3OA 1S3ZA 4HCZA 2B5GA 1YIJQ 3JCMW 5A27A 4AVAA 2C0OA 5GMKj 3IJ3A 1VQ9A 4N4GA 1ZBJA 1VHEA 4P5NA 2C6PA 2ZPAA 3PB8X 1TKFA 4R3KA 2DZCA 2ATRA 4P44A 3G3SA 2QASA 3UY5A 1NPRA 3PIOA 4OMEA 2J06A 4M77G 1VQOQ 1VQLT 4D6WA 1ZA1B 2FPFA 5GAMf 4PV6A 2QEXQ 3PRTA 1JU5C 5J1QA 2VBQA 1NE8A 5FVJA 4LD6A 2PVOB 4DJLA 1VQNQ 2L3PA 4K3NA 2CZ7B 1VIEA 2GTJA 1JB0E 1I0CA 3NTKA 2DD4A 1V29B 2NSMA 2ZW7A 5IV0A 1WNLA 4XTUA 2QVPA 1EX4A 3IWGA 3DLLA 1IB1E 1IHVA 5IHKA 1SSHA 4ZGYB 1S5KA 2B5GB 2O2OA 5EC4A 2BSWA 2RI3A 1XMBA 1KQSA 4LX9A 3HKSA 4C68A 5FU7B 1ZG9A 1PKSA 2L3QA 4L59A 4A53A 5KH6A 4ZX9A 1QLYA 1IB8A 2MOXA 1K73U 2X9HA 3TSZA 1U5SA 1S72A 1YITT 4MBUA 1X12A 2P0PA 3JCMP 5GAOq 1KUXA 1M90C 2EQKA 5JQ4A 3CBOA 1M2OA 4TWEA 2GNCA 2M0YA 1X27A 6AT1B 4MFQA 4P4EA 3PTAA 4HXJA 3QYGB 5A0LA 1I21A 3FX6A 4GLMA 2ABZA 3NGPA 3CCEA 3IFEA 4JLIA 1N9SA 2G0BA 4A54A 2QI2A 2BEIA 4F04B 1OU9A 1M3BA 3ISZA 3K9TA 3JRZA 1WWZA 4PK3A 2KT1A 3VYGA 5LJ5e 1Y07A 2O9SA 1Q86R 4JRKA 4L6V5 2H3EB 2CUBA 4LDYA 1Y0YA 3FF3A 1PSFA 2NUPA 2CDTA 2B58A 1XTDA 2C6GA 3GNFB 4KOTA 4EMKA 1Q81R 1KZFA 2KK4A 4HVWA 4FSXA 2JEWA 4E0AA 2RMOA 4FYVB 4YWYA 1OZPA 2K4YA 5GMKh 2EUIA 4JZ0A 3S6KA 5J8CA 2LDMA 2E1HA 3DR8A 5DWNA 5GAMg 2A7YA 1AYEA 1M30A 2FCKA 2Z10A 3EGUA 4IUSA 3SI0A 4A63B 1VQNT 4PK2A 1F57A 4AVBA 4RI1A 4XTWA 3G1JA 3M0QA 3VYHB 1NMTA 3CCJQ 4A4FA 2G6FX 3EY5A 5J39A 4A38A 2ZAEA 3SFMA 1VQ8A 3REAB 2PJCA 1Q7YR 2LJ0A 3I55A 4E7HA 1YVOA 4M3SA 4UBRA 3CDXA 5IHIA 4M7AG 1I1JA 1YIJT 1ARMA 4KUAA 1VA7A 2LQWA 2Z3NA 1Y7EA 2Y4YA 3DDDA 3C26A 1YJWA 3EFAA 3CZXA 2DX1A 4FL6A 1QKXA 3NTHA 2YUNA 4EPCA 4OC2A 3P8BB 5H84A 2NUTA 3L2UA 1BU1A 4EMGA 2KBTA 2HL5C 5FU7C 3BDLA 1W2BS 2V8JA 3RR6A 3NFCA 3TO9A 3MP6A 2AE6A 2FL4A 1FYNA 2JZ2A 2DEUA 1BKBA 1WHGA 4J9IA 4C0FA 4AG1C 2RHIA 4A31A 4YFJA 3O5ZA 3UATA 4X1VA 1Z8LA 3MEWA 3CC7A 1KUYA 3VS7A 4NSQA 5GANg 1RAIB 3OYBA 2PVDB 4XU0A 2OTLA 1IOIA 2KDSA 2O31A 3INZA 2PUOB 2FIWA 1JQQA 3RKYA 1X75C 3CCQT 3MGDA 3PFOA 3OSVA 4HCBA 1PU9A 3OW2P 3BY7A 3SHPA 1ZSZB 3M56A 3CBMA 1XFOA 3WVDB 1M9SA 3BLNA 1KC8R 4BI3A 1O75A 1SG5A 3U23A 5GANh 4ZTFA 3CCLA 3BI0A 1NEGA 4NFRA 4WJBA 2SEMA 2LTOA 1RL2A 3NA6A 1OEBA 2XIDA 3JCMe 2G3AA 2ANPA 3S6WA 1UE9A 3M0TA 3CPWA 3CCRA 2XEGA 1CBXA 4CS0B 3W6SA 2K57A 1OZ2A 1PSEA 4UF4A 3ULRB 2ZPEB 3SWNC 3D7DA 5FU6C 5GCNA 1I5OB 4M77F 2CH4W 3PT9A 4ZGJB 1VQPT 1BPMA 4F16A 3LYIA 1VQ6Q 1TXRA 2ZGWA 1NLOC 2K6DA 3CCEQ 4ANJA 4ORZA 4MHPA 2DPTA 2O4XB 3TQ7P 5GAMd 2ROTA 5LJ3f 2R5MA 2CNSA 1MMNA 1WPYA 3MEAA 3L42A 4IIMA 1NYFA 3QO3A 2GTOA 5GAN4 1LOKA 4LN2A 1QQ9A 4DOWA 1GRIA 2GU2A 2HL3A 2DFUA 2XMFA 2Y4XA 3EG1A 4NOYA 2VVKA 1PD0A 3VS6A 3TCVA 2IL4A 3LMSA 3B3TA 5IT9E 3CD6Q 3JCMd 2K5LA 2RPNA 3MKDA 1MK4A 1OBRA 2KCWA 1W6XA 1UFHA 2JJ9A 1YCSB 5D6XA 1H641 1R43A 1Q86U 5LYIA 4C7HA 4GXHA 3JCMf 4C8QC 2EK9A 2GGRA 3FDRA 4UIBA 4PJOA 1MMAA 5DLQE 2YNEA 4JD6A 1A0NB 3JV3A 4UA3A 2RM4A 3H6ZA 1WHHA 3OY9A 1BYMA 1KK7A 3B3VA 1PCXA 2ZPIB 4HKEA 4HT9A 3P2HA 5I22A 1PUAA 4FIBA 1NJIR 2WPWA 3R9GA 2DJZA 5KTAA 3EG9A 5HVGA 1LCKA 1WK4A 3HSBA 2DF5A 3RDVA 4BI8B 4M6HA 4U5YA 1T0JA 1NJIU 3D2PA 1W1FA 3LH5A 1JXMA 1YREA 3H0HA 1VQ9T 1T3SA 2KNBB 2L89A 3JSCA 2EWNA 4A4KA 5GANj 1BOBA 4HVVA 3A8LB 4CRIA 4R6TA 4DUKA 2JT4A 1TU0B 2VYTA 4M85A 4ZN1A 1QVFA 4IUVA 2HQYA 5LYLA 4B9WA 1B34B 1WQ7A 3CCMT 4DEYA 2PJ6A 3I9SA 1KHCA 4KUIA 4WWVA 4X34A 1K0XA 1WHJA 1TH7A 4EVYA 4NEXA 2FS5A 2RHUA 4NGQA 3SJGA 2OJ2A 4P4DA 5LYFA 2ZEFA 1LAMA 1CG2A 3OS1A 2RO0A 1MNDA 3VJPA 3WC7A 3QIIA 1BI0A 3GLXA 4B5PB 4R57A 2PJ1A 4P10A 2P84A 4XPLA 1K9MC 1ELMP 3CC4Q 1RTQA 1Q7YC 1OI1A 2AZVA 5GAMj 2FL7A 5HK0A 2DRMA 3LLRA 1M27C 5ECAA 2QG9B 3AT1B 2L5QA 3THKA 3UPUA 3PB6X 4F14A 2KMTA 4LDWA 5CR2A 3D4UA 3MCAB 3FJPA 1Y0RA 2BIVA 3QDRB 1TS9A 1QWFA 1GBQA 2HZYA 4C2XA 2DXBA 4M7DE 2A37A 1BI1A 1OPLA 5HK3A 5DM7R 2O53A 1UECA 2P6FA 3S9LA 3GIBA 2PQWA 2F1LA 4TNUA 3UWNA 2D1XA 3RUXA 5LJ5j 3URGA 1TIQA 2MWOA 2DBKA 3PMIA 1S7FA 2EKHA 1MJBA 5GJVB 2PZ1A 1XJOA 4AXVA 1AD5A 1QMUA 4FT4A 3CT9A 3HUVA 3CD6A 4QUSA 1D0YA 2Z0WA 1IGBA 2QMLA 2QYVA 3TO7A 4IUQA 5L23A 5K8PA 3GNGA 1NPPA 3TCJA 4P6YA 2MF2A 1OULA 3VWEA 3P8DA 1PKTA 3E2UA 3PGGA 3V8KA 5CNPA 1Y96A 3X24B 3B7IA 4N0AC 4MXUA 4JJBA 3BW1A 1WHKA 2D0NA 3BHXA 3KBGA 1GYTA 1PD1A 2F8HA 4F7UB 1D3BB 3OYJA 2Q44A 2DBMA 2G3TA 2OTJQ 4MMOA 3M57A 5IHNA 3RERA 4JYWA 4OC3A 4P4FA 1NBEB 1R3NA 1YSJA 4M7AF 1TUDA 1D09B 3B3SA 1H8KA 1MV0B 4X9DA 3JB9H 3QUIA 5EMIA 4DOVA 3VU3C 3V7SA 4KSFA 3FNCA 1FNOA 2POKA 2K7AA 3LODA 3CMAA 1YW6A 3G71T 4CGMA 2LX9A 4QB9A 1LANA 1QVGP 2HBPA 1PRLC 2BUEA 1AWXA 4GY5A 1K9MU 2GREA 3TVTA 4M78B 4BDZA 1X6BA 2PIZA 2CY2A 4CRYB 2VXKA 3RKXA 3VRZA 4BINA 5GMKi 4RMOA 1PNJA 2NYQA 3RMQA 4XNHB 3GBQA 4M78F 2EQIA 4OMPA 3R6NA 1IOFA 3LWIA 4X9CA 5CCAA 5KTCA 4CC7A 2AFOA 3SJEA 2YWWA 4ATOA 1RXTA 4YGOA 1HK9A 2DKGA 3EXNA 3QBYA 4JZ3A 1MUZA 4AFSC 4B5PA 5IX3A 1OPKA 1WGSA 1IIDA 4UFXA 4CYPA 2PU9B 1G8XA 2YGWA 1AT1B 1UGQB 4E7LA 2DVEA 1U06A 3CPFA 1KQSS 1JEGA 2RJDA 4LDUA 2CP3A 4CAEA 5LJ5f 1HJDA 1VQ4A 1GBRA 1T3LA 1GCPA 4XK8E 4BE1A 4DEXA 2Q7BA 4MDWA 1NZ9A 2GFQA 5I21A 2ROLA 3DLJA 1TWBA 3S6HA 2PJ0A 3M4YA 3IGRA 2AZSA 1UTIA 4PK4A 4AT1B 5LJ5d 1TTHB 4UEZA 1Y57A 2MWPA 4MY0A 1KJWA 3HFOA 3ZEHA 2NMTA 2YNCA 2YSQA 3KL9A 3BJ8A 2B4BA 2PR8A 3UF4A 2YRVA 2EYYA 2LCCA 2VL1A 2GF7A 2IIMA 2PVWA 2HAXA 1ABOA 2QQAA 1XBUA 1Z9ZA 2O28A 3CBPA 2VZZA 2Q4ZA 2E41A 1JJ2P 3R6OA 3G4SQ 5EBVA 2WYRA 3C0CA 3OYNA 1TG0A 3FJUA 3RZAA 1Z9QA 2RJCA 3EHQA 4CPAA 3EFRA 1H8LA 3WC6A 4RTYA 1AMPA 1ABQA 1YW4A 2DXCA 2CKKA 4BI4A 4JRQA 3NFZA 4RTXA 3SEMA 4MFLA 4RCCA 4WF2A 2X35A 5A0DA 1QSMA 2VASA 2WSCE 4KGVB 4IHMA 4H6UA 3D66A 3H0FA 3PIPA 2HNIA 1Z9UA 4RTVA 1S1NA 2IQ6A 3WVEB 3GIUA 4CRZB 2DRKA 2HSPA 2YUPA 2F2WA 2EYQA 4B11A 1MJAA 3EFSA 1OX9A 5IXBA 4BACA 2OH1A 3WT4A 1K1ZA 4E7JA 3C95A 4QW2A 1Q86C 4J7FA 3LGLA 4FD5A 3CMAT 5G20A 5LRKA 2FIAA 4P45A 4QVTA 3DKMA 4HNYB 2PJ3A 3R96A 2ZXVA 4Z8AA 2V8DA 3H8GA 4RTTA 1N27A 4OGEA 4CGPA 4E6RA 2RI5A 3NE7A 4F8ZA 4RG8A 3K2KA 1RO5A 2RQUA 5HVHA 4BDYA 4C8QE 2FSRA 1RAHB 2NLUA 1Z8TA 1IXDA 2COZA 3KQZA 1G5VA 4HCKA 3BDUA 4J9HA 3KXTA 1HD3A 2F5TX 4ZY2A 4XAXB 4B5OA 4OAEA 1YI2Q 4CGLA 3I3GA 1TKHA 5D6YA 3D67A 3VATA 2K5FA 4R87A 2KXDA 1XOVA 3CCMA 4KOVA 2QQRA 2RHZA 2VEZA 4Z89A 1UWYA 3JCMV 2V8HA 1VQ8T 2QGGA 2IPOB 2F5IA 2MYSA 5FW9A 1VQOA 4ONUA 4J9FA 5C6SA 4CGOA 2LQNA 1LPLA 3SXOA 2ZEEA 3TFYA 2D4OA 2VZYA 2XDBA 2PVVA 4MHDA 1M1DA 1VQNA 2KGTA 3TTHA 1MGQA 2E6ZA 2M02A 2XK0A 3X20B 3V8JA 4IKFA 4EIKA 1S72Q 4A30A 3MP1A 5GAOm 3META 4XTYA 2DL5A 2DLPA 4A37A 1ZUYA 3OMGA 3R1KA 4M7DG 2FEIA 4NGMA 3EG3A 2VWFA 2P6EA 2OTJT 1U6MA 4RN7A 3QYHB 2IJZA 4FWUA 1X2QA 3VS1A 1YI2A 3GUXA 2Q4VA 2ZELA 1CJWA 1M1GA 4NGSA 1BIBA 1NG2A 1GCQC 2CXAA 2H3JA 1C0MA 2QJ8A 2C27A 2LNHB 1UHFA 2KT8A 4PPZA 3S6FA 1Q2DA 5AG7A 2YNCC 2QQ9A 2HQHA 3FVLA 2I3CA 4J9GA 2OOTA 2LMJA 1MJ9A 1AZEA 1AHJB 3J7AF 2V1RA 4IURA 2DL7A 1YP5A 1S72T 1KIKA 2FZGB 4KS9A 4GLKA 5JM6A 2JLMA 5FRMA 4A95A 4MZMA 4BD3A 4F7UA 3OYGA 2CYZB 1W70A 2LJ1A 2EPDA 4KT0E 3CPWS 2XU8A 1XNIA 4CYOA 4YTLA 2J7IA 3CXCS 1QP3A 3E0KA 1VQPQ 2EJGA 1GHEA 2E3HA 2KVQG 4OB0B 1VGYA 4ELYC 3FIXA 4J6YA 2RJEA 2HKNA 1ZLMA 4E7ZA 2B3UA 4CC3A 1KUVA 4JUVA 3LGFA 2YLBA 4L89A 3IIBA 2SRCA 5THWA 3VH9A 4KZTA 2FRWA 3EH2A 3X25B 2JEVA 4DNCA 1VUBA 2DL3A 3LWUA 2QDYB 1SEMA 4M78C 3FXTA 3SI1A 3KFVA 2AHJB 4C0GA 1LVKA 3TX8A 4Y49C 5CK9A 1YVKA 5K8OA 3RAMA 2M0OA 3L2NA 3TREA 1Y0MA 4BY6B 1ZG8A 2HSEB 2WZNA 4UWJA 2V8VA 1VQLA 3G71A 5IB0A 2HQEA 1M1KC 1D3BA 5CKDA 3EGXA 3D8PA 4Y49B 4C92F 4RUGA 2DL4A 1CP6A 1BK2A 1R77A 1WLPB 2CZ1B 2RD1A 4NGPA 3ZZIA 1UJYA 2WACA 2LQ8A 2HD0A 5FRNA 2EBPA 1IRXA 4PLLA 3JB9J 3IEHA 5GANd 1WHMA 1FMVA 3GF5A 3I35A 2E4HA 3FMCA 2YLCA 1HEEA 2F2VA 5CVIA 1AUGA 3HRSA 5KYNA 2KY9A 4ZY0A 5DLOA 3VS5A 4BB7A 3VS4A 4E8OA 3I56Q 4KSAA 4PJLA 4FW1A 1QCNA 4QQ6A 1VQ4T 4R3LA 1YGHA 5F09A 5KTDA 2PC1A 2GLFA 1YWOA 2DD5A 2ZZDA 4NGNA 3EAEA 4UEEA 4C5GA 1ELLP 1XRYA 3KI9A 4F6AA 4J83A 2LRQA 1ON0A 3FEOA 2PIYA 1R0BG 1XMTA 3CPAA 4K30A 2FE7A 2I0NA 2L0AA 1YK3A 4JJXA 2OZUA 4FCYA 2DE0X 3B8GA 1Q82C 4HT8A 4IK2A 3PBBA 3QAHA 2R57A 1BLLE 2WPXA 5G21A 3RBBB 1ZG7A 4NJRA 1NSAA 3PVQA 2MIOA 3HP9A 1VOMA 3A1PA 3TC8A 4OIDA 1YMEA 2DA9A 3REBB 1V0CA 2O4HA 2EKOA 4AG7A 1T0HA 3JCMh 1D1CA 1ZBXA 1N8RU 5EC7A 1YITQ 2DIQA 2ZW6A 4OGCA 3SJXA 2DZ9A 1KHIA 5LJ3e 3JB9I 1Z4EA 4OMNA 2P0QA 1VQ8Q 3CC4A 4MCRA 4MHZA 5ISVA 1GL5A 2KQWA 4QT7A 2OI3A 1O9SA 4IIOA 1UGVA 2NUTB 3D3SA 1ZLHA 2JS0A 2VUBA 4NS5A 1UGRB 3CMEQ 5GJWB 1M4GA 3JB9F 4MJ8A 3QPHA 3SB2A 1YJWQ 4UCPA 4C5EA 1TKJA 2PJ2A 2RQRA 1N9RA 2B4DA 2L2PA 4H89A 3RO0A 4KOYA 3OYFA 2F7VA 1QVFS 1FWZA 4X3RA 1D1BA 4MMKA 3CCET 4D8DA 1RAGB 4ELZC 2XD0A 4U9ZA 3A9LA 1KG1A 4Z88A 1M4IA 5AYFA 2H5MA 1KSWA 4M7DA 3JB9D 3MHXA 3D7FA 1R57A 4F0XA 5DY9A 4J7IA 2QGFB 4DYOA 2JUFA 1ZQ1A 1VQPA 1VYUA 3CXPA 4JXRA 2HQXA 4LQGA 1K0SA 4C8QG 4MCSA 3IO1A 1LJOA 4Q38A 3H8FA 3D7GA 4M78D 1BI3A 2A0FB 4E7KA 1YIJA 1WXUA 1YJNT 1PHTA 3WABA 4C2YA 4J6XA 4CAFA 4KLWA 1PG5B 2EGEA 5KYUA 4BE2A 4B10A 3SXNA 4MFKA 4KGZB 2AFZA 2B86A 1BCOA 1RABB 2XICA 2PE3A 4HNWB 3KUFA 3CCVA 1KC8U 3TO6A 3JVNA 2QK0A 2ZEMA 1Y96B 1I07A 3M55A 3VRYA 1M90R 2PR1A 2P4RA 2O01E 1JQGA 4NGRA 3LW5E 3R9FA 4F7UG 2JW4A 3SD4A 4JLGA 1VQ7Q 1Q7LA 2QEXA 2KE9A 2LCSA 2V8GA 3V8LA 1IREB 3NTIA 1RLPC 4M77D 2YNDA 1P4NA 3C4SA 3NPFA 4NCZA 1MMDA 3CC7T 2OB0A 4A4GA 1QP2A 2PJ7A 3T9YA 3CCJA 1XJWB 2LZ6B 4XQ3A 2RQTA 4DBFA 2PJ8A 2RH2A 4DA4A 3CMAQ 5GMKl 1W4SA 2EVRA 3G4ST 2CH4A 1KD1C 4PXCA 4X8IA 1EFNA 2OAWA 2EGAA 2A4NA 2GBQA 1WIEA 2DO3A 4MZPA 2G9DA 2NYSA 1UUEA 1UGSB 5KYUB 3J81E 4FW2A 1M4ZA 2KRSA 4OC1A 5D29A 3PMTA 2AKLA 3CCVQ 3PGPA 2EQUA 4FM4B 3OYHA 1VQMQ 5KYWB 5M9OA 3S3NA 3I55T 3WC5A 2PJ5A 1YJ9Q 4EMKC 3V7CA 3M5AA 5CO7A 2L3RA 4EMEA 3HTRA 1IO6A 3RMSA 2M9UA 2CF4A 2ZEDA 1KD1U 2VQYA 5AG4A 2E64A 1X69A 4JJCA 4J9BA 4UC4A 3QJ6A 4A33A 4O6JA 4OKOA 1RAEB 4J9CA 5FROA 2LX7A 2QA4Q 1K9AA 4AFUC 4XPDB 1JJ2S 1MNEA 2LP5A 4M75A 4JXQA 1VHSA 3OBWA 1Y9KA 2F2XA 1YHQT 1FT7A 3B3CA 4BE0A 1VYVA 1L0CA 1ARLA 1IU8A 4MHNA 2V26A 2V77A 5F47A 3JAME 1JRIA 4MHYA 1Q81U 3OYDA 2K9GA 4M7DC 4P4IA 3QZ5B 1PCAA 4NL3A 2C6CA 1YX0A 2JM8A 4J9DA 3B35A 1G2BA 4FU6A 1RI0A 3JCMQ 4OC5A 3S3OA 2D8HA 1YJNQ 4RCBA 3OYKA 4DBHA 2CSQA 3CCUQ 4KUDK 2Z3KA 4JDSA 1N5ZA 8ATCB 4E7IA 2AT1B 4NGTA 1QMCA 5AGEA 2BZ8A 3T8WA 1Z8WA 3CC2Q 2NUPB 2A08A 2ZEOA 1QVGA 2V8IA 4F17A 4DQ2A 3GOXA 2JVVA 2RN8A 4F7UE 2PRQA 4GS4A 5D6WA 1CP7A 4OB3B 4C8QF 2CP7A 2QA4A 1UDLA 2HDAA 2PVGB 1M3AA 4B14A 3G4SA 2DXUA 3ZL7C 3GLJA 2ZOGA 2JDCA 4M75C 5I11A 2Z11A 3IU2A 2Z3LA 3CQTA 1Z2LA 2VC8A 3A5ZB 2MCNA 1WXBA 2KYBA 4PJNA 3QZ9B 4BD9A 3QAYA 3OMCA 4P4BA 2QQBA 4II9A 5KYXA 3F5BA 3CMET 4M77C 5KYWA 1K4US 3I56T 2R7HA 4FUUA 3S9NA 3E9GA 2EYZA 5GMKm 2K2VA 3DNSA 1D0ZA 2I79A 4MFPA 2BOAA 1ACMB 3HL8A 2M1HA 5J26A 5CAIA 4NJQA 2Z3PA 1P92A 5LJ3d 1IGUA 3NMZC 1AOJA 1V1CA 2QIRA 4IF5A 1YHQA 3B2YA 1M90U 2LT4A 1CPXA 4BMHA 1P0HA 1AZGB 4JJNK 1BBZA 2DILA 2DMOA 3CCUT 1K73C 2Q0YA 3V7ZA 1FX7A 3OYAA 3FECA 2KYMA 4ZN3A 1RI9A 4UWIA 3SI2A 2K5TA 3PP9A 2OTLQ 1IGQA 4KVXA 2Q51A 4CC2A 2IVWA 3CC2A 3MRUA 4KBMB 3H8ZA 4C8QA 3OSSC 2DTHA 2JM9A 1I12A 3FRMA 3UA7A 2JTMA 2C06A 2JXBA 2OZGA 2KEAA 1ZSZA 1N71A 1K73R 1BPNA 4BBHA 3OYIA 5AG5A 2K3BA 4E7SA 3I9QA 4M77A 4V2SA 2O88A 2DNUA 5KE2A 2FVUA 4PL6A 2CIJA 4PJOG 4OB1B 3CCLQ 3JCMb 3MEUA 3M4GA 2RFHA 4LUAA 1M1KU 1B3QA 4KSIA 1YR0A 1I1DA 2ZEGA 2CP6A 3G8WA 1VQ5T 3D68A 4LDXA 1SQHA 2EGCA 1G3TA 1Y7XA 4QVZA 2EQMA 2O9VA 3H41A 1XEBA 4C92G 2F5KA 4JRIA 4XU1A 3OS2A 4KULA 2M51A 2B4DB 2DJQA 4MCPA 2EAYA 4PXBA 1E7OA 1WI7A 3CCST 1KD1R 2ZENA 4NXYA 2E12A 5JPHA 5KYYA 4M78A 1QWEA 4HVUA 3IC1A 4XTZA 2WSFE 4PJOD 4A2ZA 2GLJA 1F2OA 1QVFP 3JCMc 4RG2A 2M16A 2DXTA 1AWOA 2Z3MA 4PJOE 5LJ3h 2EYXA 5LJ5h 2JBJA 3OYLA 2GFAA 1ZSGA 3FBUA 4PLIA 5I4MA 3CCVT 2VGMA 3M53A 1ZUUA 2AKKA 2MPXC 5CQYA 1IYKA 1NSLA 4HKFA 3LACA 5K8NA 1I81A 2OAUA 3VUZA 3CC4T 4XPDC 2XI9A 2BZYA 4QBJA 3PEIA 5D7UA 1G3WA 2ZPHB 1LAPA 2JMCA 1HYOA 2KRMA 2YUQA 3I5RA 3M58A 4MMLA 2FYKA 3HPWA 4BUGA 2REFA 4IUTA 3DB3A 2BE9B 1HSQA 1VYTA 2FO0A 1DJ7B 2XHCA 4JZ4A 4P4JA 4RKUE 2HV2A 4LUEA 5KE3A 3CC7Q 5KYYB 4C5IA 1Z5RA 4M7AB 1X2KA 2RC4A 1YNZA 5JGFA 1WYXA 2MMPA 4F0YA 1YLEA 1WQWA 3VUBA 3PFEA 2Q7SA 1U1SA 1Q2CA 2D9TA 4B9XA 4XTVA 2P6GA 1SKUB 5I2MA 4X2TA 2PDOA 1GFCA 5C88A 5GMKe 2LJ3A 1BI2A 2PJ4A 2AIRB 5IXFA 4KOSA 4M4ZA 3N7ZA 3LD2A 4RUHA 2JNGA 3MP8A 1K76A 2GQVA 2RQVA 1OX8A 3T90A 2QAZA 3MJXA 4EDUA 3KHZA 4C8QD 2J9AA 4WCIA 1JJ2A 3QSUA 4J8OA 4LNPA 4C5HA 3CCRQ 2BL1A 4KOWA 1Y9WA 3L2ZA 1VQMA 2RJFA 3CCJT 1QSNA 3P8HA 4Y92A 4Q36A 2CNTA 2GANA 1UJ0A 1FY7A 4BY6C 2PRBA 6CPAA 3EFOA 4ZY1A 5BWAB 2J8MA 1Q2YA 1Z4RA 1B34A 3ZBDA 1GXIE 1R0CB 3P2FA 1CKAA 2DTOA 4K11A 3QWYA 1S60A 2KRNA 2OR4A 2HMAA 3I1UA 3E19A 4UEFA 4ZYQA 1QSRA 3DSBA 2ZW4A 2OTJA 1XIXA 3SHWA 2X51A 2ZCFB 4M75G 3Q1JA 3CCSQ 1H92A 2GQIA 4MDXA 4U9YA 1IYLA 2V8KA 2HBWA 2G3RA 1F1BB 2BUDA 2QYZA 5GAN8 3TEEA 2F69A 3UA6A 4RTWA 1C6VX 3LWHA 1B87A 4A94A 3AHUA 4PSWA 1VQKA 4MFJA 3FIFA 2HUZA 3JUWA 4HA8A 5J3BA 4PJOB 2ABLA 2EVNA 4ZGEB 2GCXA 1QKWA 2CP5A 2A3LA 1ZSZC 3M54A 4JLYA 2PSWA 2QQSA 2FPDA 3ISXA 3EHRA 2DETA 4KH1B 3EGDA 5L8RE 5LL6S 1H3ZA 1WX6A 1VKCA 1KFZA 2BO9A 2QTXA 4FYWB 4IUUA 2JBKA 1VQ7A 5LJ3j 2K3XA 3A8MB 3EG9B 2JN0A 1E6GA 4D8KA 1UHCA 5F48A 3OYYA 1EIFA 3NH8A 4FD6A 2PQ8A 4CAXA 4PJMA 2X3XD 3BE3A 1VQLQ 1VQ4Q 3KHXA 5F46A 3CCMQ 2HKQB 3VARA 2ODFA 4OADA 5F49A 1B6BA 2O4XA 5A28A 4OP4A 3H8EA 2DF6A 4M6IA 4R76A 1N8RC 2P4TA 1ZA2B 1RAAB 1WHLA 1YCYA 4M77E 3HRUA 2FG0A 1C1AA 1LCPA 4O5VA 1WFWA 2DAQA 2FHDA 3GKRA 3HFNA 2D4PA 3ME9A 4F9UA 4ZGDB 8AT1B 2W10A 4C92D 4UIAA 4W9YA 3SJFA 1OYXA 1QSTA 5CKHA 3N5FA 1Q7YU 2ED1A 4G1PA 4FYYB 2LC4A 2W0ZA 4CYQA 4UFWA 2K5IA 1WJRA 1BB9A 2K79A 4M78E 4RTZA 1YFNA 2VGNA 5IN1A 5FWCA 1AEYA 2XKOC 4PFPA 4A32A 4B12A 1ZUKA 2LCLA 3CPWP 3R95A 4C2ZA 3PB4X 3H0IA 1Q95G 3CXSA 1BIAA 3TT2A 3HHTB 2YDLA 2YRCA 3PE0A 9ATCB 2X7BA 4E47A 2AFWA 4C0DC 3F0AA 3KKWA 3M0RA 3M0PA 3QJYA 4M77B 5HKCA 3FYNA 4UCMA 4CYNA 2FPEA 2YRDA 2ENMA 2NUZA 4KH0B 3QHSA 1JBMA 4C92A 4Z02A 4CI0C 4R56A 3J80E 1BO4A 4M7DF 3T9NA 2DEQA 1TSFA 4C0DB 4DBQA 2BTTA 3SDZA 4DBRA 2Q43A 1M3CA 3M59A 4PXDA 2EYWA 4M78G 5CQXA 3IWEA 4PFZA 4KOXA 4II1A 3EG0A 5DS0A 3TSWA 3ASKA 4IAVA 1NJIC 1E6HA 2RNAA 1VQ6T 3KZWA 4Q5WA 3PNWC 1J3TA 1IHWA 3RNZA 1VQ5Q 1LOJA 2FZKB 2C1CA 2X4XA 1AVZC 5AG6A 3TOBA 3RNJA 2XDPA 4EWTA 3EGXB 2XEIA 3FB3A 2PNIA 1VIXA 3CPXA 3L2RA 3CXCA 5LYDA 4OC0A 3ER0A 4M7AD 2CP2A 2QXFA 4A4HA 5FWBA 2AFUA 2IG0A 1CPSA 2PJAA 4QVCA 5GAN3 4Z65A 5HXDA 1QSOA 3A8OB 2B3VA 4R7MA 4MFZA 1U3OA 2JOYA 2VB6A 4J3GA 2VKNA 2H8HA 2Q04A 3EG2A 1M1FA 1FXXA 2EO8A 3QG1A 1DTDA 1VQ6A 1AWJA 4M75B 1B07A 4OLLA 4OF1A 7AT1B 1SRMA 2DVJA 3S3MA 5HH1A 3OYCA 2C0IA 4FBEA 1S7LA 3FB9A 3VV0A 4M6GA 4M7AA 3WR7A 1IZ6A 2CZ0B 4LDVA 1TXQA 1IY7A 4NF1A 2HCKA 3HRTA 4LE9A 1WXTA 4A4EA 3VWDA 1K4JA 1CKBA 3KASA 2L8DA 3KR5A 2VV5A 4OVAA 2BKDN 1UGPB 2P0KA 3D7HA 3PFSA 1UB4A 2BE7D 2CP0A 2X4WA 5GAOl 1YI2T 3FC3A 4ESRA 1QVGS 2DERA 2I00A 1K9MR 1ZHIA 4KVME 3EO4A 3MPUB 2C0TA 4MRIA 1NEBA 4HCCA 1VHOA 4PQAA 3A8HB 2CSIA 4H2KA 2NWMA 4AFQC 1YBYA 2YXYA 2FZCB 2Z0ZA 4ZBGA 2IMOA 2CREA 1BAVA 1Z8XA 4M75F 3HLPA 4O23A 1Y71A 1WJSA 4UCNA 1NLPC 3H9NA 1Q82R 2DEAA 2EFIA 1VQOT 2R98A 1RADB 5KYXB 4J6WA 1ZO0A 1OOTA 2QDLA 2AJ6A 2J6FA 4C92B 2VI7A 4EMKB 1OZ3A 4Q7AA 2KI7A 3CEYA 5AT1B 1Q82U 4L5GA 3NE8A 4HNXB 4JWPA 3TE4A 5GAN6 4XNHC 1PWTA 1WZOA 4NL2A 2ED0A 3G6EA 1CX8A 3EFOB 1R8OB 4B6ZA 5GAOn 3D2MA 3C12A 5IB9A 1EZZB 4C0ZA 4QVDA 2OTLT 3MN8A 1LNXA
chains in the Genus database with same CATH topology
3GPLA 3M9QA 2DTIA 3X28B 2RI2A 2B8AA 4C8QB 4R55A 3L2VA 3ZFJA 3L2WA 2KAFA 5HY6A 4PKCC 1UFFA 3QKJA 5C0MA 2K2MA 2D0QB 3G6ET 3UDCA 2E70A 2E10A 1UEBA 1M5Q1 3N5BB 2GFUA 4JJDA 3E9FA 2E5QA 4C92C 1HXDA 2ZPBB 5LJ5g 2WSEE 5CIUA 2RHXA 2CUDA 3MO8A 1GFDA 5A2QE 4XU2A 4JRPA 4F7UF 5I2SA 5GAMh 4LD9K 2AK5A 4M7AC 3DB4A 4ZNXA 1KQ1A 2XG8D 1ARKA 3F70A 4LUDA 4N4HA 2VXFA 2X3WD 3QWXX 3OQ5A 5FLXE 5FU6B 4JPBW 5A0GA 3CCRT 2JTFA 1RUWA 2J6OA 1W2BA 3FLGA 2YUOA 3OB9A 2EIFA 1X6OA 2CT3A 3G7ZA 1VQ7T 4QQGA 1SSFA 2DYBA 5CKEA 3OBYA 3X26B 4ZTJA 2DIGA 2ZPFB 2X4JA 2KROA 4J5YA 2KXCA 5IAYA 1I8FA 2I2LA 2LVMA 4JS4A 1VQKT 2DK3A 2JMAA 1TUCA 5LJ3g 4OB2B 1WA7A 3PVLA 2CT4A 1ZX6A 4FSSA 1PRMC 4OP0A 1JWQA 2BZXA 2L3SA 3OS5A 1U1TA 2E65A 4GBQA 1KC8C 3LX7A 2CS7A 4EFDA 1JXOA 4OMOA 3OYMA 1I4K1 2R5AA 1MV3A 5IH2A 2X4YA 4ME7A 5GAOp 3WXMB 2VXEA 2EJ9A 3CCUA 4Y28E 3NHNA 2CZ6B 2V1QA 2JTEA 4TVRA 3CCLT 1VQMT 1M8VA 1K8AC 1VIFA 3FJ5A 4OMMA 1SPKA 2DPPB 5GANf 2XDDA 4OMFB 1WJQA 1GCQA 4C92E 4AG2C 2RK2A 4OMLA 3M0UA 3CMEA 1QVPA 4XU3A 5CKFA 2Y90A 2DL8A 2PTKA 1SHGA 1OV3A 2RQWA 2YT6A 3RKWA 3IQLA 3I5SA 2J6KA 1CSKA 1MHNA 2D6FA 3A8GB 2ZPGB 5HCKA 3GP8A 3L1AA 5GAOr 3OW2A 2K3YA 2MI6A 1N6AA 3JB9G 2RF0A 2YHTA 4N0AA 3RESA 3V7RA 3OA6A 1NM7A 2FRYA 2CGHA 1X01A 1XQHA 1KQ2A 1QW1A 2R58A 4Y91A 3M0SA 3VS3A 1Q81C 2HEQA 5GANe 3UT1A 5KCOA 3E1SA 1M8MA 5KCHA 3L2QA 4M7AE 2ESWA 2RHYA 5GAMe 1K8AU 1WDXA 3VS2A 4VUBA 4EMHA 2A36A 2EJFA 5GAN7 3TU4K 2MAMA 2ECZA 5CKBA 2RK1A 3JCMg 2RA2A 2KSSA 2A28A 1YJWT 3I56A 3OYEA 3FRNA 4OMQA 4QQDA 4PJOC 1NYGA 3CCSA 2E5KA 2EQJA 1SRLA 3CC2T 2LQKA 1G83A 3CD6T 2QA4T 3QXEB 2HB6A 1X43A 2HC9A 5EG2A 4R0KA 4PNOA 3DLMA 3BFMA 5GAN2 4M75E 4J9EA 4FT2A 2RB6A 1RLQC 1YWPA 1U8RA 2QEXT 3MEVA 2LNVA 3O8VA 3C94A 3VS0A 1YJ9T 1YJ9A 4CC4B 1UG1A 2J05A 3CCQA 2LT1A 3A98A 3SWNA 2EW3A 4XTXA 4M7DD 2DM1A 1SHFA 1JO8A 2D8JA 1YJNA 3JCMX 1I5LA 3OW2S 1YN8A 1VQ5A 4JS5A 3RIRA 4RTUA 1G3YA 2E6NA 4PJOF 1X6GA 4LQ6A 3LH0A 5GAN5 1QCFA 3OS0A 1G3SA 2JS2A 2PUKB 4IUPA 3VKIA 4KRTA 2FB7A 4MZTA 4M75D 1FMKA 1AWWA 2KR3A 4AFZC 1H3HA 3JCMJ 4N4IA 4M7DB 1YITA 3SWNB 4HCZA 3JCMW 2C0OA 5GMKj 1VQ9A 4N4GA 1ZBJA 4P5NA 2DZCA 1NPRA 3PIOA 2J06A 4M77G 1VQLT 4D6WA 2FPFA 5GAMf 1JU5C 1NE8A 4LD6A 2PVOB 2L3PA 2CZ7B 1VIEA 2GTJA 1JB0E 1I0CA 3NTKA 2DD4A 1V29B 1WNLA 4XTUA 3DLLA 5IHKA 1SSHA 2O2OA 2RI3A 1KQSA 3HKSA 5FU7B 1PKSA 5KH6A 2L3QA 4L59A 4A53A 1QLYA 2MOXA 1K73U 3TSZA 1U5SA 1S72A 1YITT 2P0PA 3JCMP 5GAOq 1M90C 2EQKA 3CBOA 2GNCA 2M0YA 1X27A 3PTAA 4HXJA 3QYGB 5A0LA 4GLMA 3NGPA 3CCEA 4JLIA 1N9SA 4A54A 2QI2A 1M3BA 3JRZA 2KT1A 3VYGA 5LJ5e 2O9SA 1Y07A 4JRKA 4L6V5 2CUBA 4LDYA 1PSFA 2CDTA 1XTDA 3GNFB 4EMKA 2KK4A 4HVWA 4FSXA 2RMOA 2K4YA 5GMKh 2LDMA 2E1HA 5GAMg 2A7YA 1M30A 3EGUA 4A63B 1VQNT 4XTWA 3M0QA 3VYHB 4A4FA 2G6FX 5J39A 3SFMA 1VQ8A 3REAB 2LJ0A 3I55A 4E7HA 5IHIA 4M7AG 1I1JA 1YIJT 1VA7A 2LQWA 2Y4YA 1YJWA 3CZXA 2DX1A 4FL6A 1QKXA 3NTHA 2YUNA 4EPCA 3P8BB 3L2UA 1BU1A 4EMGA 2KBTA 5FU7C 3BDLA 1W2BS 2V8JA 3NFCA 3MP6A 1FYNA 2JZ2A 1BKBA 4J9IA 4C0FA 4AG1C 2RHIA 3O5ZA 3UATA 4X1VA 3MEWA 3CC7A 3VS7A 5GANg 3OYBA 2PVDB 4XU0A 2OTLA 2KDSA 2O31A 3INZA 2PUOB 1JQQA 3RKYA 1X75C 3CCQT 3OSVA 4HCBA 3BY7A 3M56A 3CBMA 3WVDB 1M9SA 4BI3A 1O75A 3U23A 5GANh 4ZTFA 3CCLA 1NEGA 2SEMA 2LTOA 1RL2A 1OEBA 2XIDA 3JCMe 3S6WA 1UE9A 3M0TA 3CPWA 3CCRA 2K57A 1OZ2A 1PSEA 3ULRB 2ZPEB 3SWNC 5FU6C 4M77F 2CH4W 3PT9A 4ZGJB 1VQPT 4F16A 3LYIA 2ZGWA 1NLOC 2K6DA 4ORZA 2O4XB 5GAMd 2ROTA 5LJ3f 2R5MA 1WPYA 4IIMA 3MEAA 3L42A 1NYFA 3QO3A 2GTOA 5GAN4 4LN2A 4DOWA 1GRIA 2XMFA 3EG1A 2Y4XA 4NOYA 2VVKA 3VS6A 5IT9E 3JCMd 2K5LA 2RPNA 1W6XA 1YCSB 5D6XA 1H641 1Q86U 3JCMf 4C8QC 2GGRA 3FDRA 4PJOA 5DLQE 1A0NB 3JV3A 2RM4A 3H6ZA 3OY9A 1BYMA 2ZPIB 4HT9A 4HKEA 5I22A 4FIBA 2DJZA 1LCKA 3HSBA 4BI8B 4M6HA 1T0JA 1NJIU 1W1FA 3LH5A 1JXMA 3H0HA 1VQ9T 1T3SA 2KNBB 2L89A 3JSCA 2EWNA 4A4KA 5GANj 4HVVA 3A8LB 4CRIA 2JT4A 2VYTA 4ZN1A 1QVFA 4IUVA 4B9WA 1B34B 1WQ7A 3CCMT 4DEYA 1KHCA 4KUIA 4X34A 1K0XA 1TH7A 2RHUA 2OJ2A 3OS1A 2RO0A 3VJPA 3QIIA 1BI0A 3GLXA 1K9MC 1Q7YC 1OI1A 2AZVA 5GAMj 2FL7A 5HK0A 2DRMA 3LLRA 1M27C 5ECAA 3THKA 2L5QA 3UPUA 4F14A 2KMTA 4LDWA 5CR2A 3MCAB 3FJPA 2BIVA 3QDRB 1QWFA 1GBQA 2DXBA 4M7DE 2A37A 1BI1A 1OPLA 5DM7R 5HK3A 1UECA 3GIBA 2PQWA 3UWNA 2D1XA 3RUXA 5LJ5j 3URGA 2MWOA 2DBKA 3PMIA 2EKHA 5GJVB 2PZ1A 1AD5A 4FT4A 3CD6A 4IUQA 5L23A 3GNGA 1NPPA 3TCJA 2MF2A 3P8DA 1PKTA 3PGGA 3V8KA 1Y96A 3X24B 4N0AC 4JJBA 3BW1A 2D0NA 3KBGA 4F7UB 1D3BB 3OYJA 2DBMA 3M57A 5IHNA 3RERA 4M7AF 1TUDA 1H8KA 1MV0B 4X9DA 3JB9H 3QUIA 5EMIA 4DOVA 3VU3C 3V7SA 2K7AA 3CMAA 3G71T 2LX9A 2HBPA 1PRLC 1AWXA 4GY5A 1K9MU 3TVTA 4M78B 4BDZA 1X6BA 3RKXA 3VRZA 4BINA 5GMKi 4RMOA 1PNJA 3RMQA 3GBQA 4OMPA 2EQIA 3R6NA 4M78F 3LWIA 4X9CA 5CCAA 4CC7A 4ATOA 1HK9A 2DKGA 4JZ3A 3QBYA 1MUZA 4AFSC 1OPKA 1WGSA 2PU9B 4E7LA 1UGQB 2DVEA 1U06A 3CPFA 1KQSS 1JEGA 2RJDA 4LDUA 5LJ5f 1HJDA 1VQ4A 1GBRA 1T3LA 1GCPA 4XK8E 4BE1A 4DEXA 4MDWA 1NZ9A 5I21A 2ROLA 3M4YA 2AZSA 1UTIA 5LJ5d 1Y57A 2MWPA 1KJWA 3HFOA 3ZEHA 2YSQA 3UF4A 2YRVA 2EYYA 2LCCA 2GF7A 2IIMA 2HAXA 1ABOA 2QQAA 1Z9ZA 3CBPA 2E41A 3R6OA 3C0CA 3OYNA 1TG0A 1Z9QA 2RJCA 3EHQA 3EFRA 4RTYA 1ABQA 2DXCA 2CKKA 4BI4A 4JRQA 4RTXA 3SEMA 4RCCA 4WF2A 2X35A 5A0DA 2WSCE 3H0FA 3PIPA 2HNIA 4RTVA 1S1NA 3WVEB 2DRKA 2HSPA 2YUPA 2F2WA 2EYQA 5IXBA 3EFSA 4BACA 1K1ZA 4E7JA 3C95A 4QW2A 1Q86C 4J7FA 3LGLA 3CMAT 3DKMA 4Z8AA 4RTTA 1N27A 4OGEA 4E6RA 2RI5A 4RG8A 2RQUA 4BDYA 4C8QE 2NLUA 1G5VA 4HCKA 4J9HA 3BDUA 3KXTA 1HD3A 2F5TX 4XAXB 5D6YA 2K5FA 2KXDA 1XOVA 3CCMA 2QQRA 2RHZA 4Z89A 3JCMV 1VQ8T 5FW9A 1VQOA 4J9FA 5C6SA 2LQNA 2XDBA 1VQNA 2KGTA 1MGQA 2E6ZA 2XK0A 3X20B 3V8JA 4IKFA 4EIKA 3MP1A 5GAOm 3META 4XTYA 2DL5A 2DLPA 1ZUYA 3OMGA 4M7DG 2FEIA 3EG3A 2VWFA 2OTJT 4RN7A 3QYHB 1X2QA 3VS1A 1YI2A 1M1GA 1NG2A 1BIBA 1GCQC 2H3JA 2LNHB 1UHFA 2KT8A 2QQ9A 4J9GA 2LMJA 1AZEA 1AHJB 3J7AF 2V1RA 4IURA 2DL7A 1YP5A 1S72T 1KIKA 4GLKA 5FRMA 4MZMA 4BD3A 4F7UA 3OYGA 2CYZB 1W70A 2LJ1A 2EPDA 4KT0E 3CPWS 2XU8A 1XNIA 4YTLA 2J7IA 3CXCS 1QP3A 2EJGA 2KVQG 4OB0B 4ELYC 4J6YA 2RJEA 1ZLMA 4CC3A 4JUVA 3LGFA 2YLBA 2SRCA 2FRWA 3X25B 1VUBA 2DL3A 2QDYB 1SEMA 4M78C 3KFVA 2AHJB 4C0GA 5CK9A 2M0OA 3TREA 1Y0MA 4BY6B 1VQLA 3G71A 2HQEA 1M1KC 1D3BA 5CKDA 4C92F 4RUGA 2DL4A 1BK2A 1WLPB 2CZ1B 2RD1A 1UJYA 2WACA 2LQ8A 2HD0A 5FRNA 2EBPA 4PLLA 3JB9J 5GANd 3I35A 3GF5A 2YLCA 2F2VA 5CVIA 3HRSA 2KY9A 5DLOA 3VS5A 4BB7A 3VS4A 4QQ6A 1VQ4T 1YWOA 2DD5A 2ZZDA 3EAEA 4C5GA 4J83A 2LRQA 3FEOA 2I0NA 2L0AA 2DE0X 1Q82C 4HT8A 2R57A 3RBBB 3PVQA 2MIOA 3HP9A 2DA9A 3REBB 2EKOA 1T0HA 3JCMh 1ZBXA 1N8RU 5EC7A 2DIQA 4OGCA 2DZ9A 1KHIA 5LJ3e 3JB9I 4OMNA 2P0QA 3CC4A 1GL5A 2KQWA 4QT7A 2OI3A 4IIOA 1O9SA 1UGVA 2JS0A 2VUBA 4NS5A 1UGRB 5GJWB 3JB9F 3QPHA 3SB2A 4C5EA 2RQRA 1N9RA 2L2PA 3OYFA 1QVFS 1FWZA 4MMKA 3CCET 4D8DA 4ELZC 2XD0A 1KG1A 4Z88A 5AYFA 1KSWA 4M7DA 3JB9D 3MHXA 5DY9A 4J7IA 2JUFA 1ZQ1A 1VQPA 1VYUA 2HQXA 1K0SA 4C8QG 1LJOA 4M78D 1BI3A 4E7KA 1YIJA 1WXUA 1YJNT 1PHTA 4J6XA 2EGEA 4BE2A 2B86A 2XICA 3KUFA 3CCVA 1KC8U 1Y96B 1I07A 3M55A 3VRYA 2P4RA 2O01E 3LW5E 4F7UG 2JW4A 3SD4A 4JLGA 2QEXA 2KE9A 2LCSA 3V8LA 1IREB 3NTIA 1RLPC 4M77D 3NPFA 3C4SA 3CC7T 4A4GA 1QP2A 3CCJA 2LZ6B 4XQ3A 2RQTA 2RH2A 4DA4A 5GMKl 2EVRA 1W4SA 3G4ST 2CH4A 1KD1C 1EFNA 2OAWA 2EGAA 2GBQA 1WIEA 2DO3A 4MZPA 1UUEA 1UGSB 3J81E 1M4ZA 2KRSA 3PMTA 2AKLA 2EQUA 4FM4B 3OYHA 5M9OA 3S3NA 3I55T 4EMKC 3V7CA 3M5AA 5CO7A 2L3RA 1IO6A 3RMSA 2M9UA 1KD1U 2E64A 1X69A 4JJCA 4J9BA 4UC4A 3QJ6A 4O6JA 4J9CA 5FROA 2LX7A 1K9AA 4AFUC 1JJ2S 2LP5A 4M75A 3OBWA 2F2XA 1YHQT 4BE0A 1VYVA 3JAME 1JRIA 1Q81U 3OYDA 2K9GA 4M7DC 3QZ5B 4NL3A 2JM8A 4J9DA 4FU6A 1G2BA 3JCMQ 1RI0A 3S3OA 2D8HA 4RCBA 3OYKA 2CSQA 4KUDK 4JDSA 1N5ZA 4E7IA 2BZ8A 2A08A 1QVGA 2V8IA 4F17A 4DQ2A 3GOXA 2RN8A 2JVVA 4F7UE 5D6WA 4OB3B 4C8QF 2QA4A 1UDLA 2HDAA 2PVGB 1M3AA 3G4SA 2DXUA 3ZL7C 5I11A 4M75C 3CQTA 2VC8A 2MCNA 3A5ZB 1WXBA 2KYBA 3QZ9B 3QAYA 3OMCA 2QQBA 3CMET 4M77C 1K4US 3I56T 3E9GA 2EYZA 5GMKm 2K2VA 3HL8A 2M1HA 5J26A 5CAIA 1P92A 5LJ3d 3NMZC 1AOJA 1V1CA 1YHQA 1M90U 2LT4A 1AZGB 4JJNK 1BBZA 2DILA 2DMOA 3CCUT 1K73C 1FX7A 3OYAA 2KYMA 4ZN3A 1RI9A 4CC2A 2IVWA 3CC2A 4KBMB 3H8ZA 4C8QA 3OSSC 2JM9A 2DTHA 3UA7A 2JTMA 2C06A 2JXBA 2KEAA 3OYIA 2K3BA 3I9QA 4M77A 4V2SA 2O88A 2DNUA 5KE2A 2FVUA 4PL6A 4PJOG 4OB1B 3JCMb 3MEUA 3M4GA 1M1KU 1B3QA 1VQ5T 4LDXA 2EGCA 1G3TA 1Y7XA 4QVZA 2EQMA 2O9VA 3H41A 4C92G 2F5KA 4JRIA 4XU1A 3OS2A 4KULA 2M51A 2DJQA 2EAYA 1E7OA 1WI7A 3CCST 2E12A 4M78A 1QWEA 4HVUA 4XTZA 2WSFE 4PJOD 3JCMc 4RG2A 2M16A 2DXTA 1AWOA 4PJOE 5LJ3h 2EYXA 5LJ5h 3OYLA 2GFAA 1ZSGA 4PLIA 3CCVT 2VGMA 3M53A 1ZUUA 2AKKA 5CQYA 1I81A 2OAUA 3VUZA 3CC4T 2XI9A 2BZYA 1G3WA 2ZPHB 2JMCA 2KRMA 2YUQA 3I5RA 3M58A 4MMLA 2FYKA 3HPWA 4BUGA 4IUTA 3DB3A 1HSQA 1VYTA 2FO0A 1DJ7B 4JZ4A 2XHCA 4RKUE 4LUEA 5KE3A 4C5IA 4M7AB 1X2KA 1YNZA 1WYXA 2MMPA 1WQWA 3VUBA 2Q7SA 1U1SA 2D9TA 4B9XA 4XTVA 5I2MA 1GFCA 5GMKe 2LJ3A 1BI2A 5IXFA 4M4ZA 2JNGA 3MP8A 1K76A 2GQVA 2RQVA 4EDUA 4C8QD 4WCIA 1JJ2A 3QSUA 4LNPA 4J8OA 4C5HA 3L2ZA 1VQMA 2RJFA 3CCJT 4Y92A 3P8HA 1UJ0A 4BY6C 1B34A 3ZBDA 1GXIE 1CKAA 2DTOA 4K11A 3QWYA 2KRNA 3E19A 2OTJA 3SHWA 2ZCFB 4M75G 3Q1JA 1H92A 2GQIA 4MDXA 2V8KA 2HBWA 2G3RA 2BUDA 5GAN8 3TEEA 2F69A 3UA6A 4RTWA 3LWHA 3AHUA 1VQKA 3FIFA 4HA8A 5J3BA 4PJOB 2ABLA 4ZGEB 2GCXA 1QKWA 2A3LA 3M54A 2QQSA 2FPDA 3EHRA 5L8RE 5LL6S 1H3ZA 1WX6A 1KFZA 2QTXA 4IUUA 1VQ7A 5LJ3j 2K3XA 3A8MB 2JN0A 1E6GA 4D8KA 1UHCA 3OYYA 1EIFA 2X3XD 2ODFA 2O4XA 2DF6A 4M6IA 1N8RC 2P4TA 1YCYA 4M77E 3HRUA 2FG0A 4O5VA 1WFWA 2DAQA 2FHDA 3HFNA 3ME9A 4ZGDB 2W10A 4C92D 1OYXA 5CKHA 1Q7YU 2ED1A 2LC4A 2W0ZA 2K5IA 1WJRA 1BB9A 2K79A 4M78E 4RTZA 2VGNA 5IN1A 5FWCA 1AEYA 2XKOC 1ZUKA 2LCLA 3H0IA 1BIAA 3HHTB 2YDLA 3PE0A 4E47A 4C0DC 3M0RA 3M0PA 3QJYA 4M77B 5HKCA 2FPEA 2ENMA 2NUZA 3QHSA 1JBMA 4C92A 4Z02A 4CI0C 4R56A 3J80E 4M7DF 3T9NA 2DEQA 4C0DB 2BTTA 3SDZA 1M3CA 3M59A 2EYWA 4M78G 5CQXA 4II1A 3EG0A 3TSWA 3ASKA 1NJIC 1E6HA 2RNAA 1VQ6T 4Q5WA 3PNWC 1J3TA 1LOJA 2X4XA 1AVZC 3RNJA 2XDPA 2PNIA 3L2RA 3CXCA 3ER0A 4M7AD 2QXFA 4A4HA 5FWBA 2IG0A 4QVCA 5GAN3 3A8OB 1U3OA 2JOYA 2VKNA 2H8HA 3EG2A 1M1FA 1FXXA 3QG1A 1VQ6A 1AWJA 4M75B 1B07A 4OF1A 1SRMA 2DVJA 3S3MA 3OYCA 2C0IA 3FB9A 3VV0A 4M6GA 4M7AA 1IZ6A 2CZ0B 4LDVA 2HCKA 4LE9A 3HRTA 1WXTA 4A4EA 1CKBA 2L8DA 2VV5A 4OVAA 2BKDN 1UGPB 2P0KA 1UB4A 3PFSA 2X4WA 5GAOl 1YI2T 3FC3A 4ESRA 1QVGS 1ZHIA 2C0TA 1NEBA 4HCCA 3A8HB 2CSIA 2NWMA 4AFQC 1YBYA 2CREA 4M75F 1Y71A 1WJSA 1NLPC 2EFIA 1VQOT 4J6WA 1OOTA 2QDLA 2J6FA 4C92B 4EMKB 1OZ3A 1Q82U 3CEYA 4L5GA 3NE8A 5GAN6 1PWTA 4NL2A 2ED0A 3G6EA 1R8OB 5GAOn 3C12A 4C0ZA 4QVDA 2OTLT 1LNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZG B;  1BBZ A;  2DIL A;  4HVW A;  2DMO A;  2RMO A;  4Z8A A;  4RTT A;  1UFF A;  4E6R A;  1M30 A;  2KYM A;  1RI9 A;  3EGU A;  2RQU A;  4A63 B;  2K2M A;  3M0Q A;  4CC2 A;  4HCK A;  4J9H A;  1HD3 A;  2G6F X;  4JJD A;  2JM9 A;  3UA7 A;  2JXB A;  3REA B;  2KXD A;  2KEA A;  1XOV A;  2LJ0 A;  2CUD A;  5IHI A;  4Z89 A;  1I1J A;  2K3B A;  1GFD A;  3I9Q A;  2O88 A;  2DNU A;  1VA7 A;  2LQW A;  5FW9 A;  4J9F A;  2LQN A;  2AK5 A;  3CZX A;  2DX1 A;  1B3Q A;  1QKX A;  4ZNX A;  2YUN A;  1ARK A;  4LUD A;  1BU1 A;  2X3W D;  3QWX X;  2KBT A;  2EGC A;  2KGT A;  2O9V A;  3H41 A;  4EIK A;  4JPB W;  1FYN A;  2DL5 A;  2DLP A;  2M51 A;  4J9I A;  1ZUY A;  2DJQ A;  4AG1 C;  1RUW A;  1E7O A;  1WI7 A;  3O5Z A;  3UAT A;  4X1V A;  3VS7 A;  1QWE A;  4HVU A;  2FEI A;  2J6O A;  3EG3 A;  2O31 A;  2VWF A;  2YUO A;  1JQQ A;  4RN7 A;  2CT3 A;  1X2Q A;  3VS1 A;  1AWO A;  1NG2 A;  2EYX A;  1GCQ C;  2DYB A;  1ZSG A;  1ZUU A;  2AKK A;  2LNH B;  1UHF A;  2KT8 A;  3U23 A;  1NEG A;  2SEM A;  2KRO A;  1OEB A;  2BZY A;  2KXC A;  4J9G A;  1UE9 A;  2LMJ A;  3M0T A;  2JMC A;  1AZE A;  2KRM A;  2YUQ A;  3I5R A;  2V1R A;  2DL7 A;  1YP5 A;  3ULR B;  1KIK A;  2JMA A;  1TUC A;  1HSQ A;  1VYT A;  2FO0 A;  2CH4 W;  4JZ4 A;  1W70 A;  4F16 A;  2LJ1 A;  2EPD A;  1WA7 A;  3PVL A;  4LUE A;  2CT4 A;  1NLO C;  2K6D A;  2J7I A;  1X2K A;  4ORZ A;  1YNZ A;  1ZX6 A;  1WYX A;  4FSS A;  1ZLM A;  2Q7S A;  1PRM C;  2ROT A;  4CC3 A;  1JWQ A;  2BZX A;  2SRC A;  2L3S A;  4IIM A;  1GFC A;  1NYF A;  2FRW A;  2GTO A;  2LJ3 A;  4LN2 A;  4GBQ A;  5IXF A;  4M4Z A;  2DL3 A;  1GRI A;  1K76 A;  1SEM A;  2XMF A;  3EG1 A;  3KFV A;  2RQV A;  2VVK A;  1JXO A;  4OMO A;  3VS6 A;  4WCI A;  1MV3 A;  1Y0M A;  4LNP A;  5IH2 A;  2RPN A;  1W6X A;  4Y92 A;  1YCS B;  3NHN A;  2V1Q A;  1UJ0 A;  4RUG A;  2JTE A;  2DL4 A;  1BK2 A;  2GGR A;  1WLP B;  3FJ5 A;  4OMM A;  1SPK A;  1A0N B;  3JV3 A;  1UJY A;  1CKA A;  1GCQ A;  2EBP A;  3QWY A;  4K11 A;  4AG2 C;  2KRN A;  5I22 A;  4OML A;  3M0U A;  3I35 A;  3SHW A;  2DL8 A;  2PTK A;  2F2V A;  1SHG A;  1OV3 A;  2GQI A;  2RQW A;  1LCK A;  1H92 A;  3VS5 A;  2YT6 A;  3VS4 A;  3IQL A;  3I5S A;  4M6H A;  2J6K A;  1CSK A;  2HBW A;  1T0J A;  1W1F A;  3LH5 A;  1JXM A;  3H0H A;  1T3S A;  2KNB B;  5HCK A;  1YWO A;  3UA6 A;  4HVV A;  4RTW A;  2JT4 A;  2RF0 A;  2ABL A;  1QKW A;  2I0N A;  1NM7 A;  2L0A A;  2FRY A;  4DEY A;  2DE0 X;  2FPD A;  3EHR A;  1K0X A;  3RBB B;  1WX6 A;  1KFZ A;  3PVQ A;  2MIO A;  3M0S A;  2OJ2 A;  3VS3 A;  2HEQ A;  2DA9 A;  3REB B;  1T0H A;  1E6G A;  4D8K A;  1M8M A;  1UHC A;  5EC7 A;  2ESW A;  2X3X D;  1WDX A;  4OMN A;  3VS2 A;  1GL5 A;  4QT7 A;  2ODF A;  2OI3 A;  4IIO A;  2A36 A;  1UGV A;  2AZV A;  2ECZ A;  2DRM A;  2JS0 A;  1M27 C;  2DF6 A;  5ECA A;  5GJW B;  4M6I A;  3THK A;  2RQR A;  4F14 A;  2A28 A;  2L2P A;  1QWF A;  1GBQ A;  2A37 A;  4OMQ A;  1OPL A;  1UEC A;  2FG0 A;  4D8D A;  1NYG A;  1WFW A;  4Z88 A;  2D1X A;  1KSW A;  2E5K A;  2W10 A;  1SRL A;  2DBK A;  2EKH A;  5GJV B;  2PZ1 A;  1AD5 A;  1VYU A;  1G83 A;  2ED1 A;  2W0Z A;  1K0S A;  5L23 A;  1BB9 A;  1X43 A;  2K79 A;  1PKT A;  4RTZ A;  5FWC A;  1WXU A;  1AEY A;  1PHT A;  4R0K A;  1ZUK A;  2EGE A;  3H0I A;  4JJB A;  2B86 A;  2D0N A;  4J9E A;  2YDL A;  3PE0 A;  1RLQ C;  1YWP A;  2DBM A;  1I07 A;  3M0R A;  3M0P A;  3VRY A;  2P4R A;  3VS0 A;  5IHN A;  1UG1 A;  4CC4 B;  2FPE A;  2JW4 A;  2ENM A;  2NUZ A;  2J05 A;  2KE9 A;  1TUD A;  2LCS A;  3A98 A;  1H8K A;  1MV0 B;  1RLP C;  2EW3 A;  3NPF A;  5EMI A;  2DM1 A;  2BTT A;  1M3C A;  2EYW A;  1SHF A;  2K7A A;  1JO8 A;  2D8J A;  2LZ6 B;  2RQT A;  1PRL C;  1AWX A;  1YN8 A;  2EVR A;  2CH4 A;  3EG0 A;  3TVT A;  3TSW A;  1EFN A;  1E6H A;  2OAW A;  2RNA A;  2EGA A;  1X6B A;  2GBQ A;  1WIE A;  1J3T A;  4RTU A;  1UUE A;  3VRZ A;  4BIN A;  1AVZ C;  1PNJ A;  1X6G A;  2KRS A;  3GBQ A;  4OMP A;  2EQI A;  3R6N A;  3RNJ A;  4LQ6 A;  1QCF A;  2PNI A;  4CC7 A;  2AKL A;  2JS2 A;  4JZ3 A;  5FWB A;  4KRT A;  1MUZ A;  4AFS C;  1FMK A;  1OPK A;  1AWW A;  2KR3 A;  4AFZ C;  1H3H A;  1U3O A;  2VKN A;  2H8H A;  3EG2 A;  1IO6 A;  1U06 A;  1JEG A;  1AWJ A;  1X69 A;  4JJC A;  4J9B A;  2C0O A;  1HJD A;  1B07 A;  1GBR A;  1T3L A;  1GCP A;  1ZBJ A;  4J9C A;  1SRM A;  4DEX A;  2DVJ A;  2LX7 A;  1K9A A;  2C0I A;  4AFU C;  2LP5 A;  4M6G A;  2F2X A;  2J06 A;  2ROL A;  1VYV A;  2HCK A;  4LE9 A;  1WXT A;  2FPF A;  2AZS A;  1CKB A;  1UTI A;  1JU5 C;  2K9G A;  2L3P A;  1Y57 A;  2JM8 A;  4J9D A;  1G2B A;  1KJW A;  2GTJ A;  2YSQ A;  1I0C A;  4ESR A;  2D8H A;  3UF4 A;  2CSQ A;  2EYY A;  1N5Z A;  2IIM A;  2BZ8 A;  5IHK A;  1SSH A;  2C0T A;  2O2O A;  2A08 A;  1NEB A;  4F17 A;  1ABO A;  2CSI A;  1Z9Z A;  2RN8 A;  2NWM A;  4AFQ C;  1PKS A;  2L3Q A;  1QLY A;  1UDL A;  2HDA A;  2MOX A;  2CRE A;  1M3A A;  3TSZ A;  1U5S A;  3C0C A;  1TG0 A;  1Z9Q A;  1NLP C;  3EHQ A;  3ZL7 C;  5I11 A;  2GNC A;  2M0Y A;  1X27 A;  3CQT A;  1ABQ A;  4RTY A;  1OOT A;  2MCN A;  1WXB A;  2QDL A;  4RTX A;  2KYB A;  4HXJ A;  3SEM A;  2J6F A;  3QAY A;  4GLM A;  3NGP A;  3NE8 A;  3H0F A;  1K4U S;  4RTV A;  1M3B A;  1S1N A;  2EYZ A;  1PWT A;  2ED0 A;  2KT1 A;  2DRK A;  2O9S A;  2HSP A;  2YUP A;  2F2W A;  5IXB A;  2CUB A;  1K1Z A;  2CDT A;  3NMZ C;  1AOJ A;  1V1C A; 
#chains in the Genus database with same CATH topology
 3GPL A;  3M9Q A;  2DTI A;  3X28 B;  2RI2 A;  2B8A A;  4L8A A;  4C8Q B;  1M4D A;  1YHQ Q;  4R55 A;  3L2V A;  3ZFJ A;  3L2W A;  2DYI A;  1XE4 A;  2KAF A;  5HY6 A;  4PKC C;  1M4L A;  1S7K A;  1HDQ A;  1UFF A;  2ZW5 A;  1B7T A;  3QKJ A;  5C0M A;  4QC6 A;  1PC0 A;  4CGN A;  1M2V A;  2K2M A;  2D0Q B;  5CPA A;  3G6E T;  3UDC A;  2E70 A;  2E10 A;  1UEB A;  4KVO E;  1M5Q 1;  1TF9 A;  3N5B B;  2GFU A;  4KOU A;  4JJD A;  3E9F A;  2E5Q A;  1BCM A;  4C92 C;  4OIW A;  1HXD A;  2CTC A;  2WUU A;  2ZPB B;  5LJ5 g;  2WSE E;  5CIU A;  2RHX A;  2CUD A;  3MO8 A;  1X10 A;  5CBM A;  4ZI6 A;  4JRP A;  5A2Q E;  4XU2 A;  1GFD A;  4F7U F;  5I2S A;  1KQS P;  5GAM h;  5G22 A;  4LD9 K;  2R1I A;  2AK5 A;  2ZEP A;  7CPA A;  4M7A C;  3DB4 A;  1KQ1 A;  4ZNX A;  3CXC P;  4E2A A;  2XG8 D;  1ARK A;  3F70 A;  4AMC A;  1A2Z A;  4LUD A;  3FED A;  4N4H A;  1OQK A;  2VXF A;  1M44 A;  2X3W D;  3QWX X;  1ZLI A;  3OQ5 A;  3JRU A;  1SF9 A;  5FLX E;  5FU6 B;  4JPB W;  5A0G A;  3QB8 A;  3CCR T;  1RAC B;  3BXM A;  2JTF A;  1RUW A;  2ARH A;  2OU2 A;  4AG9 A;  2CNM A;  4PJJ A;  1M2V B;  3D7S B;  8CPA A;  2J6O A;  1W2B A;  1QCO A;  3FLG A;  2YUO A;  2PCU A;  3OB9 A;  2EIF A;  4FD7 A;  5I0C A;  1X6O A;  3KR4 A;  2CT3 A;  1D0X A;  3G7Z A;  3KQX A;  1K8A R;  1VQ7 T;  4QQG A;  1F2P A;  1TOV A;  1V76 A;  1SSF A;  4UFV A;  2DYB A;  2OZH A;  5CKE A;  3OBY A;  3X26 B;  4YRH A;  1TUG B;  4ZTJ A;  2DIG A;  2ZPF B;  4RS2 A;  4KGX B;  2X4J A;  2KRO A;  4J5Y A;  2KXC A;  5IAY A;  1I8F A;  2I2L A;  2LVM A;  3G71 Q;  2Q4Y A;  3S9M A;  4JS4 A;  1VQK T;  1OU8 A;  2DK3 A;  4A39 A;  2JMA A;  2AFS A;  1TUC A;  5LJ3 g;  1NE9 A;  3QNV A;  5JH9 A;  4OB2 B;  3BI1 A;  3OWC A;  2CTB A;  1WA7 A;  3PVL A;  3PB9 X;  2CT4 A;  3EC4 A;  4KOR A;  2PJB A;  3RBU A;  5HVF A;  1ZX6 A;  1YQE A;  4FSS A;  1PRM C;  4CAV A;  4OP0 A;  1JWQ A;  3GB0 A;  2BZX A;  2L3S A;  2ZEH A;  3OS5 A;  5LRG A;  4LXC A;  2QEC A;  1U1T A;  2E65 A;  1PYT B;  4GBQ A;  3NH5 A;  1KC8 C;  3LX7 A;  2REE A;  2CS7 A;  5J8F A;  4XPK A;  4EFD A;  1JXO A;  4OMO A;  3OYM A;  2COW A;  1I4K 1;  2R5A A;  1MV3 A;  2X4Y A;  4ME7 A;  5IH2 A;  5GAO p;  1Y7R A;  5ELY A;  3WXM B;  2VXE A;  2EJ9 A;  3CCU A;  4AVC A;  4Y28 E;  2EK8 A;  3NHN A;  2CZ6 B;  2V1Q A;  4FAI A;  4AB7 A;  2JTE A;  4TVR A;  3CCL T;  2QTV A;  1VQM T;  4C7I A;  1M8V A;  5K8M A;  1N8R R;  3F8K A;  1K8A C;  1VIF A;  3FJ5 A;  4OMM A;  1SPK A;  3JTK A;  2DPP B;  5GAN f;  2XDD A;  4OMF B;  1WJQ A;  4CAW A;  1GCQ A;  4C92 E;  4AG2 C;  2RK2 A;  4OML A;  3NH4 A;  2ZOF A;  3M0U A;  4KUB A;  3CME A;  1QVP A;  4XU3 A;  2RB7 A;  3PZJ A;  5CKF A;  2Y90 A;  3H4Q A;  2DL8 A;  2PTK A;  4ONW A;  3TOA A;  1SHG A;  1OV3 A;  2RQW A;  4I49 A;  2YT6 A;  3RKW A;  3GY9 A;  3IQL A;  3I5S A;  4F9V A;  2J6K A;  1CSK A;  1MHN A;  1YLO A;  5G1Z A;  2GE3 A;  2D6F A;  3A8G B;  3DR6 A;  2XEF A;  2ZPG B;  5HCK A;  2PJ9 A;  2COY A;  4E2F B;  3GP8 A;  1VQK Q;  3L1A A;  4QKU A;  5GAO r;  4ORF A;  4KLV A;  3OW2 A;  3FH4 A;  2AFM A;  2K3Y A;  2MI6 A;  1N6A A;  3JB9 G;  4HPS A;  2RF0 A;  1IIC A;  2YHT A;  4N0A A;  3RES A;  3V7R A;  3OA6 A;  1NM7 A;  2J8R A;  4YU9 A;  2FRY A;  2CGH A;  1RAF B;  5E96 A;  1X01 A;  1W2B P;  1XQH A;  1KQ2 A;  1QW1 A;  2R58 A;  2R8V A;  3PB7 X;  5LRJ A;  4Y91 A;  3M0S A;  3VS3 A;  1Q81 C;  4FYX B;  2HEQ A;  5GAN e;  3UT1 A;  3CXQ A;  5KCO A;  3E1S A;  1M8M A;  5KCH A;  5C82 A;  3L2Q A;  3B3W A;  4M7A E;  3BJ7 A;  1TF8 A;  3K9U A;  2ESW A;  2RHY A;  5GAM e;  1K8A U;  4B13 A;  1WDX A;  3VS2 A;  1VQ9 Q;  3EGD B;  4VUB A;  1QQJ A;  4EMH A;  4MY3 A;  3IU1 A;  4PXE A;  4GM5 A;  2A36 A;  2EJF A;  5GAN 7;  1LFW A;  3TU4 K;  2MAM A;  2ECZ A;  5CKB A;  4R8F A;  2RK1 A;  3JCM g;  2ATC B;  2RA2 A;  2DPS A;  2BCO A;  2KSS A;  4B6M A;  2A28 A;  3KGQ A;  1CM0 A;  1MMG A;  5H86 A;  1YJW T;  2J8N A;  3I56 A;  2FXF A;  3EH1 A;  3OYE A;  3W6X A;  3S6G A;  4MCQ A;  3FRN A;  2E3I A;  4OMQ A;  4H6Z A;  4QQD A;  4X5K A;  2EWB A;  1M1K R;  4PJO C;  3DGV A;  1NYG A;  1LRZ A;  3PBE A;  4FD4 A;  4R9M A;  3CCS A;  2P0W A;  3V8I A;  2E5K A;  1DE4 C;  2EQJ A;  4OC4 A;  3RYO A;  2Y0M A;  1SRL A;  3CC2 T;  3QDF A;  2LQK A;  2MK5 A;  1G83 A;  3CD6 T;  3W91 A;  2QA4 T;  3QXE B;  2HB6 A;  2FT0 A;  4ZX8 A;  1X43 A;  2HC9 A;  5EG2 A;  2FVG A;  4R0K A;  4MI4 A;  4PNO A;  3DLM A;  3H5Z A;  3BFM A;  5GAN 2;  4M75 E;  4J9E A;  4FT2 A;  2RB6 A;  1RLQ C;  1YWP A;  1U8R A;  2QEX T;  3MEV A;  3FEE A;  2LNV A;  2WSA A;  3O8V A;  3C94 A;  4PFO A;  5DWM A;  3VS0 A;  1YJ9 T;  3GYA A;  1YJ9 A;  4CC4 B;  1UG1 A;  1PM3 A;  2OX7 A;  2J05 A;  3CCQ A;  2LT1 A;  3A98 A;  3SWN A;  3V38 A;  2EW3 A;  4XTX A;  4M7D D;  2EBJ A;  2DM1 A;  2GIV A;  1SHF A;  1JO8 A;  2D8J A;  1YJN A;  3JCM X;  1I5L A;  2AFX A;  3OW2 S;  1YN8 A;  1S7N A;  1HDU A;  3I55 Q;  3G6E Q;  1VQ5 A;  1EE3 P;  4JS5 A;  3RIR A;  4RTU A;  2XEJ A;  1FMW A;  1KWM A;  1G3Y A;  2E6N A;  4PJO F;  1X6G A;  4WTO B;  4PSX A;  4LQ6 A;  3LH0 A;  5GAN 5;  1QCF A;  5D8N A;  3ZJ0 A;  2DXQ A;  3OS0 A;  1G3S A;  2JS2 A;  1J4J A;  2JDD A;  2PUK B;  4IUP A;  3VKI A;  3IWW A;  5HMN A;  4KRT A;  2FB7 A;  4MZT A;  1D1A A;  4M75 D;  1FMK A;  1AWW A;  3R9E A;  2KR3 A;  1XF8 A;  4AFZ C;  1H3H A;  3CCQ Q;  3JCM J;  4N4I A;  4M7D B;  1YIT A;  3SWN B;  2Z3O A;  1S3Z A;  4HCZ A;  2B5G A;  1YIJ Q;  3JCM W;  5A27 A;  4AVA A;  2C0O A;  5GMK j;  3IJ3 A;  1VQ9 A;  4N4G A;  1ZBJ A;  1VHE A;  4P5N A;  2C6P A;  2ZPA A;  3PB8 X;  1TKF A;  4R3K A;  2DZC A;  2ATR A;  4P44 A;  3G3S A;  2QAS A;  3UY5 A;  1NPR A;  3PIO A;  4OME A;  2J06 A;  4M77 G;  1VQO Q;  1VQL T;  4D6W A;  1ZA1 B;  2FPF A;  5GAM f;  4PV6 A;  2QEX Q;  3PRT A;  1JU5 C;  5J1Q A;  2VBQ A;  1NE8 A;  5FVJ A;  4LD6 A;  2PVO B;  4DJL A;  1VQN Q;  2L3P A;  4K3N A;  2CZ7 B;  1VIE A;  2GTJ A;  1JB0 E;  1I0C A;  3NTK A;  2DD4 A;  1V29 B;  2NSM A;  2ZW7 A;  5IV0 A;  1WNL A;  4XTU A;  2QVP A;  1EX4 A;  3IWG A;  3DLL A;  1IB1 E;  1IHV A;  5IHK A;  1SSH A;  4ZGY B;  1S5K A;  2B5G B;  2O2O A;  5EC4 A;  2BSW A;  2RI3 A;  1XMB A;  1KQS A;  4LX9 A;  3HKS A;  4C68 A;  5FU7 B;  1ZG9 A;  1PKS A;  2L3Q A;  4L59 A;  4A53 A;  5KH6 A;  4ZX9 A;  1QLY A;  1IB8 A;  2MOX A;  1K73 U;  2X9H A;  3TSZ A;  1U5S A;  1S72 A;  1YIT T;  4MBU A;  1X12 A;  2P0P A;  3JCM P;  5GAO q;  1KUX A;  1M90 C;  2EQK A;  5JQ4 A;  3CBO A;  1M2O A;  4TWE A;  2GNC A;  2M0Y A;  1X27 A;  6AT1 B;  4MFQ A;  4P4E A;  3PTA A;  4HXJ A;  3QYG B;  5A0L A;  1I21 A;  3FX6 A;  4GLM A;  2ABZ A;  3NGP A;  3CCE A;  3IFE A;  4JLI A;  1N9S A;  2G0B A;  4A54 A;  2QI2 A;  2BEI A;  4F04 B;  1OU9 A;  1M3B A;  3ISZ A;  3K9T A;  3JRZ A;  1WWZ A;  4PK3 A;  2KT1 A;  3VYG A;  5LJ5 e;  1Y07 A;  2O9S A;  1Q86 R;  4JRK A;  4L6V 5;  2H3E B;  2CUB A;  4LDY A;  1Y0Y A;  3FF3 A;  1PSF A;  2NUP A;  2CDT A;  2B58 A;  1XTD A;  2C6G A;  3GNF B;  4KOT A;  4EMK A;  1Q81 R;  1KZF A;  2KK4 A;  4HVW A;  4FSX A;  2JEW A;  4E0A A;  2RMO A;  4FYV B;  4YWY A;  1OZP A;  2K4Y A;  5GMK h;  2EUI A;  4JZ0 A;  3S6K A;  5J8C A;  2LDM A;  2E1H A;  3DR8 A;  5DWN A;  5GAM g;  2A7Y A;  1AYE A;  1M30 A;  2FCK A;  2Z10 A;  3EGU A;  4IUS A;  3SI0 A;  4A63 B;  1VQN T;  4PK2 A;  1F57 A;  4AVB A;  4RI1 A;  4XTW A;  3G1J A;  3M0Q A;  3VYH B;  1NMT A;  3CCJ Q;  4A4F A;  2G6F X;  3EY5 A;  5J39 A;  4A38 A;  2ZAE A;  3SFM A;  1VQ8 A;  3REA B;  2PJC A;  1Q7Y R;  2LJ0 A;  3I55 A;  4E7H A;  1YVO A;  4M3S A;  4UBR A;  3CDX A;  5IHI A;  4M7A G;  1I1J A;  1YIJ T;  1ARM A;  4KUA A;  1VA7 A;  2LQW A;  2Z3N A;  1Y7E A;  2Y4Y A;  3DDD A;  3C26 A;  1YJW A;  3EFA A;  3CZX A;  2DX1 A;  4FL6 A;  1QKX A;  3NTH A;  2YUN A;  4EPC A;  4OC2 A;  3P8B B;  5H84 A;  2NUT A;  3L2U A;  1BU1 A;  4EMG A;  2KBT A;  2HL5 C;  5FU7 C;  3BDL A;  1W2B S;  2V8J A;  3RR6 A;  3NFC A;  3TO9 A;  3MP6 A;  2AE6 A;  2FL4 A;  1FYN A;  2JZ2 A;  2DEU A;  1BKB A;  1WHG A;  4J9I A;  4C0F A;  4AG1 C;  2RHI A;  4A31 A;  4YFJ A;  3O5Z A;  3UAT A;  4X1V A;  1Z8L A;  3MEW A;  3CC7 A;  1KUY A;  3VS7 A;  4NSQ A;  5GAN g;  1RAI B;  3OYB A;  2PVD B;  4XU0 A;  2OTL A;  1IOI A;  2KDS A;  2O31 A;  3INZ A;  2PUO B;  2FIW A;  1JQQ A;  3RKY A;  1X75 C;  3CCQ T;  3MGD A;  3PFO A;  3OSV A;  4HCB A;  1PU9 A;  3OW2 P;  3BY7 A;  3SHP A;  1ZSZ B;  3M56 A;  3CBM A;  1XFO A;  3WVD B;  1M9S A;  3BLN A;  1KC8 R;  4BI3 A;  1O75 A;  1SG5 A;  3U23 A;  5GAN h;  4ZTF A;  3CCL A;  3BI0 A;  1NEG A;  4NFR A;  4WJB A;  2SEM A;  2LTO A;  1RL2 A;  3NA6 A;  1OEB A;  2XID A;  3JCM e;  2G3A A;  2ANP A;  3S6W A;  1UE9 A;  3M0T A;  3CPW A;  3CCR A;  2XEG A;  1CBX A;  4CS0 B;  3W6S A;  2K57 A;  1OZ2 A;  1PSE A;  4UF4 A;  3ULR B;  2ZPE B;  3SWN C;  3D7D A;  5FU6 C;  5GCN A;  1I5O B;  4M77 F;  2CH4 W;  3PT9 A;  4ZGJ B;  1VQP T;  1BPM A;  4F16 A;  3LYI A;  1VQ6 Q;  1TXR A;  2ZGW A;  1NLO C;  2K6D A;  3CCE Q;  4ANJ A;  4ORZ A;  4MHP A;  2DPT A;  2O4X B;  3TQ7 P;  5GAM d;  2ROT A;  5LJ3 f;  2R5M A;  2CNS A;  1MMN A;  1WPY A;  3MEA A;  3L42 A;  4IIM A;  1NYF A;  3QO3 A;  2GTO A;  5GAN 4;  1LOK A;  4LN2 A;  1QQ9 A;  4DOW A;  1GRI A;  2GU2 A;  2HL3 A;  2DFU A;  2XMF A;  2Y4X A;  3EG1 A;  4NOY A;  2VVK A;  1PD0 A;  3VS6 A;  3TCV A;  2IL4 A;  3LMS A;  3B3T A;  5IT9 E;  3CD6 Q;  3JCM d;  2K5L A;  2RPN A;  3MKD A;  1MK4 A;  1OBR A;  2KCW A;  1W6X A;  1UFH A;  2JJ9 A;  1YCS B;  5D6X A;  1H64 1;  1R43 A;  1Q86 U;  5LYI A;  4C7H A;  4GXH A;  3JCM f;  4C8Q C;  2EK9 A;  2GGR A;  3FDR A;  4UIB A;  4PJO A;  1MMA A;  5DLQ E;  2YNE A;  4JD6 A;  1A0N B;  3JV3 A;  4UA3 A;  2RM4 A;  3H6Z A;  1WHH A;  3OY9 A;  1BYM A;  1KK7 A;  3B3V A;  1PCX A;  2ZPI B;  4HKE A;  4HT9 A;  3P2H A;  5I22 A;  1PUA A;  4FIB A;  1NJI R;  2WPW A;  3R9G A;  2DJZ A;  5KTA A;  3EG9 A;  5HVG A;  1LCK A;  1WK4 A;  3HSB A;  2DF5 A;  3RDV A;  4BI8 B;  4M6H A;  4U5Y A;  1T0J A;  1NJI U;  3D2P A;  1W1F A;  3LH5 A;  1JXM A;  1YRE A;  3H0H A;  1VQ9 T;  1T3S A;  2KNB B;  2L89 A;  3JSC A;  2EWN A;  4A4K A;  5GAN j;  1BOB A;  4HVV A;  3A8L B;  4CRI A;  4R6T A;  4DUK A;  2JT4 A;  1TU0 B;  2VYT A;  4M85 A;  4ZN1 A;  1QVF A;  4IUV A;  2HQY A;  5LYL A;  4B9W A;  1B34 B;  1WQ7 A;  3CCM T;  4DEY A;  2PJ6 A;  3I9S A;  1KHC A;  4KUI A;  4WWV A;  4X34 A;  1K0X A;  1WHJ A;  1TH7 A;  4EVY A;  4NEX A;  2FS5 A;  2RHU A;  4NGQ A;  3SJG A;  2OJ2 A;  4P4D A;  5LYF A;  2ZEF A;  1LAM A;  1CG2 A;  3OS1 A;  2RO0 A;  1MND A;  3VJP A;  3WC7 A;  3QII A;  1BI0 A;  3GLX A;  4B5P B;  4R57 A;  2PJ1 A;  4P10 A;  2P84 A;  4XPL A;  1K9M C;  1ELM P;  3CC4 Q;  1RTQ A;  1Q7Y C;  1OI1 A;  2AZV A;  5GAM j;  2FL7 A;  5HK0 A;  2DRM A;  3LLR A;  1M27 C;  5ECA A;  2QG9 B;  3AT1 B;  2L5Q A;  3THK A;  3UPU A;  3PB6 X;  4F14 A;  2KMT A;  4LDW A;  5CR2 A;  3D4U A;  3MCA B;  3FJP A;  1Y0R A;  2BIV A;  3QDR B;  1TS9 A;  1QWF A;  1GBQ A;  2HZY A;  4C2X A;  2DXB A;  4M7D E;  2A37 A;  1BI1 A;  1OPL A;  5HK3 A;  5DM7 R;  2O53 A;  1UEC A;  2P6F A;  3S9L A;  3GIB A;  2PQW A;  2F1L A;  4TNU A;  3UWN A;  2D1X A;  3RUX A;  5LJ5 j;  3URG A;  1TIQ A;  2MWO A;  2DBK A;  3PMI A;  1S7F A;  2EKH A;  1MJB A;  5GJV B;  2PZ1 A;  1XJO A;  4AXV A;  1AD5 A;  1QMU A;  4FT4 A;  3CT9 A;  3HUV A;  3CD6 A;  4QUS A;  1D0Y A;  2Z0W A;  1IGB A;  2QML A;  2QYV A;  3TO7 A;  4IUQ A;  5L23 A;  5K8P A;  3GNG A;  1NPP A;  3TCJ A;  4P6Y A;  2MF2 A;  1OUL A;  3VWE A;  3P8D A;  1PKT A;  3E2U A;  3PGG A;  3V8K A;  5CNP A;  1Y96 A;  3X24 B;  3B7I A;  4N0A C;  4MXU A;  4JJB A;  3BW1 A;  1WHK A;  2D0N A;  3BHX A;  3KBG A;  1GYT A;  1PD1 A;  2F8H A;  4F7U B;  1D3B B;  3OYJ A;  2Q44 A;  2DBM A;  2G3T A;  2OTJ Q;  4MMO A;  3M57 A;  5IHN A;  3RER A;  4JYW A;  4OC3 A;  4P4F A;  1NBE B;  1R3N A;  1YSJ A;  4M7A F;  1TUD A;  1D09 B;  3B3S A;  1H8K A;  1MV0 B;  4X9D A;  3JB9 H;  3QUI A;  5EMI A;  4DOV A;  3VU3 C;  3V7S A;  4KSF A;  3FNC A;  1FNO A;  2POK A;  2K7A A;  3LOD A;  3CMA A;  1YW6 A;  3G71 T;  4CGM A;  2LX9 A;  4QB9 A;  1LAN A;  1QVG P;  2HBP A;  1PRL C;  2BUE A;  1AWX A;  4GY5 A;  1K9M U;  2GRE A;  3TVT A;  4M78 B;  4BDZ A;  1X6B A;  2PIZ A;  2CY2 A;  4CRY B;  2VXK A;  3RKX A;  3VRZ A;  4BIN A;  5GMK i;  4RMO A;  1PNJ A;  2NYQ A;  3RMQ A;  4XNH B;  3GBQ A;  4M78 F;  2EQI A;  4OMP A;  3R6N A;  1IOF A;  3LWI A;  4X9C A;  5CCA A;  5KTC A;  4CC7 A;  2AFO A;  3SJE A;  2YWW A;  4ATO A;  1RXT A;  4YGO A;  1HK9 A;  2DKG A;  3EXN A;  3QBY A;  4JZ3 A;  1MUZ A;  4AFS C;  4B5P A;  5IX3 A;  1OPK A;  1WGS A;  1IID A;  4UFX A;  4CYP A;  2PU9 B;  1G8X A;  2YGW A;  1AT1 B;  1UGQ B;  4E7L A;  2DVE A;  1U06 A;  3CPF A;  1KQS S;  1JEG A;  2RJD A;  4LDU A;  2CP3 A;  4CAE A;  5LJ5 f;  1HJD A;  1VQ4 A;  1GBR A;  1T3L A;  1GCP A;  4XK8 E;  4BE1 A;  4DEX A;  2Q7B A;  4MDW A;  1NZ9 A;  2GFQ A;  5I21 A;  2ROL A;  3DLJ A;  1TWB A;  3S6H A;  2PJ0 A;  3M4Y A;  3IGR A;  2AZS A;  1UTI A;  4PK4 A;  4AT1 B;  5LJ5 d;  1TTH B;  4UEZ A;  1Y57 A;  2MWP A;  4MY0 A;  1KJW A;  3HFO A;  3ZEH A;  2NMT A;  2YNC A;  2YSQ A;  3KL9 A;  3BJ8 A;  2B4B A;  2PR8 A;  3UF4 A;  2YRV A;  2EYY A;  2LCC A;  2VL1 A;  2GF7 A;  2IIM A;  2PVW A;  2HAX A;  1ABO A;  2QQA A;  1XBU A;  1Z9Z A;  2O28 A;  3CBP A;  2VZZ A;  2Q4Z A;  2E41 A;  1JJ2 P;  3R6O A;  3G4S Q;  5EBV A;  2WYR A;  3C0C A;  3OYN A;  1TG0 A;  3FJU A;  3RZA A;  1Z9Q A;  2RJC A;  3EHQ A;  4CPA A;  3EFR A;  1H8L A;  3WC6 A;  4RTY A;  1AMP A;  1ABQ A;  1YW4 A;  2DXC A;  2CKK A;  4BI4 A;  4JRQ A;  3NFZ A;  4RTX A;  3SEM A;  4MFL A;  4RCC A;  4WF2 A;  2X35 A;  5A0D A;  1QSM A;  2VAS A;  2WSC E;  4KGV B;  4IHM A;  4H6U A;  3D66 A;  3H0F A;  3PIP A;  2HNI A;  1Z9U A;  4RTV A;  1S1N A;  2IQ6 A;  3WVE B;  3GIU A;  4CRZ B;  2DRK A;  2HSP A;  2YUP A;  2F2W A;  2EYQ A;  4B11 A;  1MJA A;  3EFS A;  1OX9 A;  5IXB A;  4BAC A;  2OH1 A;  3WT4 A;  1K1Z A;  4E7J A;  3C95 A;  4QW2 A;  1Q86 C;  4J7F A;  3LGL A;  4FD5 A;  3CMA T;  5G20 A;  5LRK A;  2FIA A;  4P45 A;  4QVT A;  3DKM A;  4HNY B;  2PJ3 A;  3R96 A;  2ZXV A;  4Z8A A;  2V8D A;  3H8G A;  4RTT A;  1N27 A;  4OGE A;  4CGP A;  4E6R A;  2RI5 A;  3NE7 A;  4F8Z A;  4RG8 A;  3K2K A;  1RO5 A;  2RQU A;  5HVH A;  4BDY A;  4C8Q E;  2FSR A;  1RAH B;  2NLU A;  1Z8T A;  1IXD A;  2COZ A;  3KQZ A;  1G5V A;  4HCK A;  3BDU A;  4J9H A;  3KXT A;  1HD3 A;  2F5T X;  4ZY2 A;  4XAX B;  4B5O A;  4OAE A;  1YI2 Q;  4CGL A;  3I3G A;  1TKH A;  5D6Y A;  3D67 A;  3VAT A;  2K5F A;  4R87 A;  2KXD A;  1XOV A;  3CCM A;  4KOV A;  2QQR A;  2RHZ A;  2VEZ A;  4Z89 A;  1UWY A;  3JCM V;  2V8H A;  1VQ8 T;  2QGG A;  2IPO B;  2F5I A;  2MYS A;  5FW9 A;  1VQO A;  4ONU A;  4J9F A;  5C6S A;  4CGO A;  2LQN A;  1LPL A;  3SXO A;  2ZEE A;  3TFY A;  2D4O A;  2VZY A;  2XDB A;  2PVV A;  4MHD A;  1M1D A;  1VQN A;  2KGT A;  3TTH A;  1MGQ A;  2E6Z A;  2M02 A;  2XK0 A;  3X20 B;  3V8J A;  4IKF A;  4EIK A;  1S72 Q;  4A30 A;  3MP1 A;  5GAO m;  3MET A;  4XTY A;  2DL5 A;  2DLP A;  4A37 A;  1ZUY A;  3OMG A;  3R1K A;  4M7D G;  2FEI A;  4NGM A;  3EG3 A;  2VWF A;  2P6E A;  2OTJ T;  1U6M A;  4RN7 A;  3QYH B;  2IJZ A;  4FWU A;  1X2Q A;  3VS1 A;  1YI2 A;  3GUX A;  2Q4V A;  2ZEL A;  1CJW A;  1M1G A;  4NGS A;  1BIB A;  1NG2 A;  1GCQ C;  2CXA A;  2H3J A;  1C0M A;  2QJ8 A;  2C27 A;  2LNH B;  1UHF A;  2KT8 A;  4PPZ A;  3S6F A;  1Q2D A;  5AG7 A;  2YNC C;  2QQ9 A;  2HQH A;  3FVL A;  2I3C A;  4J9G A;  2OOT A;  2LMJ A;  1MJ9 A;  1AZE A;  1AHJ B;  3J7A F;  2V1R A;  4IUR A;  2DL7 A;  1YP5 A;  1S72 T;  1KIK A;  2FZG B;  4KS9 A;  4GLK A;  5JM6 A;  2JLM A;  5FRM A;  4A95 A;  4MZM A;  4BD3 A;  4F7U A;  3OYG A;  2CYZ B;  1W70 A;  2LJ1 A;  2EPD A;  4KT0 E;  3CPW S;  2XU8 A;  1XNI A;  4CYO A;  4YTL A;  2J7I A;  3CXC S;  1QP3 A;  3E0K A;  1VQP Q;  2EJG A;  1GHE A;  2E3H A;  2KVQ G;  4OB0 B;  1VGY A;  4ELY C;  3FIX A;  4J6Y A;  2RJE A;  2HKN A;  1ZLM A;  4E7Z A;  2B3U A;  4CC3 A;  1KUV A;  4JUV A;  3LGF A;  2YLB A;  4L89 A;  3IIB A;  2SRC A;  5THW A;  3VH9 A;  4KZT A;  2FRW A;  3EH2 A;  3X25 B;  2JEV A;  4DNC A;  1VUB A;  2DL3 A;  3LWU A;  2QDY B;  1SEM A;  4M78 C;  3FXT A;  3SI1 A;  3KFV A;  2AHJ B;  4C0G A;  1LVK A;  3TX8 A;  4Y49 C;  5CK9 A;  1YVK A;  5K8O A;  3RAM A;  2M0O A;  3L2N A;  3TRE A;  1Y0M A;  4BY6 B;  1ZG8 A;  2HSE B;  2WZN A;  4UWJ A;  2V8V A;  1VQL A;  3G71 A;  5IB0 A;  2HQE A;  1M1K C;  1D3B A;  5CKD A;  3EGX A;  3D8P A;  4Y49 B;  4C92 F;  4RUG A;  2DL4 A;  1CP6 A;  1BK2 A;  1R77 A;  1WLP B;  2CZ1 B;  2RD1 A;  4NGP A;  3ZZI A;  1UJY A;  2WAC A;  2LQ8 A;  2HD0 A;  5FRN A;  2EBP A;  1IRX A;  4PLL A;  3JB9 J;  3IEH A;  5GAN d;  1WHM A;  1FMV A;  3GF5 A;  3I35 A;  2E4H A;  3FMC A;  2YLC A;  1HEE A;  2F2V A;  5CVI A;  1AUG A;  3HRS A;  5KYN A;  2KY9 A;  4ZY0 A;  5DLO A;  3VS5 A;  4BB7 A;  3VS4 A;  4E8O A;  3I56 Q;  4KSA A;  4PJL A;  4FW1 A;  1QCN A;  4QQ6 A;  1VQ4 T;  4R3L A;  1YGH A;  5F09 A;  5KTD A;  2PC1 A;  2GLF A;  1YWO A;  2DD5 A;  2ZZD A;  4NGN A;  3EAE A;  4UEE A;  4C5G A;  1ELL P;  1XRY A;  3KI9 A;  4F6A A;  4J83 A;  2LRQ A;  1ON0 A;  3FEO A;  2PIY A;  1R0B G;  1XMT A;  3CPA A;  4K30 A;  2FE7 A;  2I0N A;  2L0A A;  1YK3 A;  4JJX A;  2OZU A;  4FCY A;  2DE0 X;  3B8G A;  1Q82 C;  4HT8 A;  4IK2 A;  3PBB A;  3QAH A;  2R57 A;  1BLL E;  2WPX A;  5G21 A;  3RBB B;  1ZG7 A;  4NJR A;  1NSA A;  3PVQ A;  2MIO A;  3HP9 A;  1VOM A;  3A1P A;  3TC8 A;  4OID A;  1YME A;  2DA9 A;  3REB B;  1V0C A;  2O4H A;  2EKO A;  4AG7 A;  1T0H A;  3JCM h;  1D1C A;  1ZBX A;  1N8R U;  5EC7 A;  1YIT Q;  2DIQ A;  2ZW6 A;  4OGC A;  3SJX A;  2DZ9 A;  1KHI A;  5LJ3 e;  3JB9 I;  1Z4E A;  4OMN A;  2P0Q A;  1VQ8 Q;  3CC4 A;  4MCR A;  4MHZ A;  5ISV A;  1GL5 A;  2KQW A;  4QT7 A;  2OI3 A;  1O9S A;  4IIO A;  1UGV A;  2NUT B;  3D3S A;  1ZLH A;  2JS0 A;  2VUB A;  4NS5 A;  1UGR B;  3CME Q;  5GJW B;  1M4G A;  3JB9 F;  4MJ8 A;  3QPH A;  3SB2 A;  1YJW Q;  4UCP A;  4C5E A;  1TKJ A;  2PJ2 A;  2RQR A;  1N9R A;  2B4D A;  2L2P A;  4H89 A;  3RO0 A;  4KOY A;  3OYF A;  2F7V A;  1QVF S;  1FWZ A;  4X3R A;  1D1B A;  4MMK A;  3CCE T;  4D8D A;  1RAG B;  4ELZ C;  2XD0 A;  4U9Z A;  3A9L A;  1KG1 A;  4Z88 A;  1M4I A;  5AYF A;  2H5M A;  1KSW A;  4M7D A;  3JB9 D;  3MHX A;  3D7F A;  1R57 A;  4F0X A;  5DY9 A;  4J7I A;  2QGF B;  4DYO A;  2JUF A;  1ZQ1 A;  1VQP A;  1VYU A;  3CXP A;  4JXR A;  2HQX A;  4LQG A;  1K0S A;  4C8Q G;  4MCS A;  3IO1 A;  1LJO A;  4Q38 A;  3H8F A;  3D7G A;  4M78 D;  1BI3 A;  2A0F B;  4E7K A;  1YIJ A;  1WXU A;  1YJN T;  1PHT A;  3WAB A;  4C2Y A;  4J6X A;  4CAF A;  4KLW A;  1PG5 B;  2EGE A;  5KYU A;  4BE2 A;  4B10 A;  3SXN A;  4MFK A;  4KGZ B;  2AFZ A;  2B86 A;  1BCO A;  1RAB B;  2XIC A;  2PE3 A;  4HNW B;  3KUF A;  3CCV A;  1KC8 U;  3TO6 A;  3JVN A;  2QK0 A;  2ZEM A;  1Y96 B;  1I07 A;  3M55 A;  3VRY A;  1M90 R;  2PR1 A;  2P4R A;  2O01 E;  1JQG A;  4NGR A;  3LW5 E;  3R9F A;  4F7U G;  2JW4 A;  3SD4 A;  4JLG A;  1VQ7 Q;  1Q7L A;  2QEX A;  2KE9 A;  2LCS A;  2V8G A;  3V8L A;  1IRE B;  3NTI A;  1RLP C;  4M77 D;  2YND A;  1P4N A;  3C4S A;  3NPF A;  4NCZ A;  1MMD A;  3CC7 T;  2OB0 A;  4A4G A;  1QP2 A;  2PJ7 A;  3T9Y A;  3CCJ A;  1XJW B;  2LZ6 B;  4XQ3 A;  2RQT A;  4DBF A;  2PJ8 A;  2RH2 A;  4DA4 A;  3CMA Q;  5GMK l;  1W4S A;  2EVR A;  3G4S T;  2CH4 A;  1KD1 C;  4PXC A;  4X8I A;  1EFN A;  2OAW A;  2EGA A;  2A4N A;  2GBQ A;  1WIE A;  2DO3 A;  4MZP A;  2G9D A;  2NYS A;  1UUE A;  1UGS B;  5KYU B;  3J81 E;  4FW2 A;  1M4Z A;  2KRS A;  4OC1 A;  5D29 A;  3PMT A;  2AKL A;  3CCV Q;  3PGP A;  2EQU A;  4FM4 B;  3OYH A;  1VQM Q;  5KYW B;  5M9O A;  3S3N A;  3I55 T;  3WC5 A;  2PJ5 A;  1YJ9 Q;  4EMK C;  3V7C A;  3M5A A;  5CO7 A;  2L3R A;  4EME A;  3HTR A;  1IO6 A;  3RMS A;  2M9U A;  2CF4 A;  2ZED A;  1KD1 U;  2VQY A;  5AG4 A;  2E64 A;  1X69 A;  4JJC A;  4J9B A;  4UC4 A;  3QJ6 A;  4A33 A;  4O6J A;  4OKO A;  1RAE B;  4J9C A;  5FRO A;  2LX7 A;  2QA4 Q;  1K9A A;  4AFU C;  4XPD B;  1JJ2 S;  1MNE A;  2LP5 A;  4M75 A;  4JXQ A;  1VHS A;  3OBW A;  1Y9K A;  2F2X A;  1YHQ T;  1FT7 A;  3B3C A;  4BE0 A;  1VYV A;  1L0C A;  1ARL A;  1IU8 A;  4MHN A;  2V26 A;  2V77 A;  5F47 A;  3JAM E;  1JRI A;  4MHY A;  1Q81 U;  3OYD A;  2K9G A;  4M7D C;  4P4I A;  3QZ5 B;  1PCA A;  4NL3 A;  2C6C A;  1YX0 A;  2JM8 A;  4J9D A;  3B35 A;  1G2B A;  4FU6 A;  1RI0 A;  3JCM Q;  4OC5 A;  3S3O A;  2D8H A;  1YJN Q;  4RCB A;  3OYK A;  4DBH A;  2CSQ A;  3CCU Q;  4KUD K;  2Z3K A;  4JDS A;  1N5Z A;  8ATC B;  4E7I A;  2AT1 B;  4NGT A;  1QMC A;  5AGE A;  2BZ8 A;  3T8W A;  1Z8W A;  3CC2 Q;  2NUP B;  2A08 A;  2ZEO A;  1QVG A;  2V8I A;  4F17 A;  4DQ2 A;  3GOX A;  2JVV A;  2RN8 A;  4F7U E;  2PRQ A;  4GS4 A;  5D6W A;  1CP7 A;  4OB3 B;  4C8Q F;  2CP7 A;  2QA4 A;  1UDL A;  2HDA A;  2PVG B;  1M3A A;  4B14 A;  3G4S A;  2DXU A;  3ZL7 C;  3GLJ A;  2ZOG A;  2JDC A;  4M75 C;  5I11 A;  2Z11 A;  3IU2 A;  2Z3L A;  3CQT A;  1Z2L A;  2VC8 A;  3A5Z B;  2MCN A;  1WXB A;  2KYB A;  4PJN A;  3QZ9 B;  4BD9 A;  3QAY A;  3OMC A;  4P4B A;  2QQB A;  4II9 A;  5KYX A;  3F5B A;  3CME T;  4M77 C;  5KYW A;  1K4U S;  3I56 T;  2R7H A;  4FUU A;  3S9N A;  3E9G A;  2EYZ A;  5GMK m;  2K2V A;  3DNS A;  1D0Z A;  2I79 A;  4MFP A;  2BOA A;  1ACM B;  3HL8 A;  2M1H A;  5J26 A;  5CAI A;  4NJQ A;  2Z3P A;  1P92 A;  5LJ3 d;  1IGU A;  3NMZ C;  1AOJ A;  1V1C A;  2QIR A;  4IF5 A;  1YHQ A;  3B2Y A;  1M90 U;  2LT4 A;  1CPX A;  4BMH A;  1P0H A;  1AZG B;  4JJN K;  1BBZ A;  2DIL A;  2DMO A;  3CCU T;  1K73 C;  2Q0Y A;  3V7Z A;  1FX7 A;  3OYA A;  3FEC A;  2KYM A;  4ZN3 A;  1RI9 A;  4UWI A;  3SI2 A;  2K5T A;  3PP9 A;  2OTL Q;  1IGQ A;  4KVX A;  2Q51 A;  4CC2 A;  2IVW A;  3CC2 A;  3MRU A;  4KBM B;  3H8Z A;  4C8Q A;  3OSS C;  2DTH A;  2JM9 A;  1I12 A;  3FRM A;  3UA7 A;  2JTM A;  2C06 A;  2JXB A;  2OZG A;  2KEA A;  1ZSZ A;  1N71 A;  1K73 R;  1BPN A;  4BBH A;  3OYI A;  5AG5 A;  2K3B A;  4E7S A;  3I9Q A;  4M77 A;  4V2S A;  2O88 A;  2DNU A;  5KE2 A;  2FVU A;  4PL6 A;  2CIJ A;  4PJO G;  4OB1 B;  3CCL Q;  3JCM b;  3MEU A;  3M4G A;  2RFH A;  4LUA A;  1M1K U;  1B3Q A;  4KSI A;  1YR0 A;  1I1D A;  2ZEG A;  2CP6 A;  3G8W A;  1VQ5 T;  3D68 A;  4LDX A;  1SQH A;  2EGC A;  1G3T A;  1Y7X A;  4QVZ A;  2EQM A;  2O9V A;  3H41 A;  1XEB A;  4C92 G;  2F5K A;  4JRI A;  4XU1 A;  3OS2 A;  4KUL A;  2M51 A;  2B4D B;  2DJQ A;  4MCP A;  2EAY A;  4PXB A;  1E7O A;  1WI7 A;  3CCS T;  1KD1 R;  2ZEN A;  4NXY A;  2E12 A;  5JPH A;  5KYY A;  4M78 A;  1QWE A;  4HVU A;  3IC1 A;  4XTZ A;  2WSF E;  4PJO D;  4A2Z A;  2GLJ A;  1F2O A;  1QVF P;  3JCM c;  4RG2 A;  2M16 A;  2DXT A;  1AWO A;  2Z3M A;  4PJO E;  5LJ3 h;  2EYX A;  5LJ5 h;  2JBJ A;  3OYL A;  2GFA A;  1ZSG A;  3FBU A;  4PLI A;  5I4M A;  3CCV T;  2VGM A;  3M53 A;  1ZUU A;  2AKK A;  2MPX C;  5CQY A;  1IYK A;  1NSL A;  4HKF A;  3LAC A;  5K8N A;  1I81 A;  2OAU A;  3VUZ A;  3CC4 T;  4XPD C;  2XI9 A;  2BZY A;  4QBJ A;  3PEI A;  5D7U A;  1G3W A;  2ZPH B;  1LAP A;  2JMC A;  1HYO A;  2KRM A;  2YUQ A;  3I5R A;  3M58 A;  4MML A;  2FYK A;  3HPW A;  4BUG A;  2REF A;  4IUT A;  3DB3 A;  2BE9 B;  1HSQ A;  1VYT A;  2FO0 A;  1DJ7 B;  2XHC A;  4JZ4 A;  4P4J A;  4RKU E;  2HV2 A;  4LUE A;  5KE3 A;  3CC7 Q;  5KYY B;  4C5I A;  1Z5R A;  4M7A B;  1X2K A;  2RC4 A;  1YNZ A;  5JGF A;  1WYX A;  2MMP A;  4F0Y A;  1YLE A;  1WQW A;  3VUB A;  3PFE A;  2Q7S A;  1U1S A;  1Q2C A;  2D9T A;  4B9X A;  4XTV A;  2P6G A;  1SKU B;  5I2M A;  4X2T A;  2PDO A;  1GFC A;  5C88 A;  5GMK e;  2LJ3 A;  1BI2 A;  2PJ4 A;  2AIR B;  5IXF A;  4KOS A;  4M4Z A;  3N7Z A;  3LD2 A;  4RUH A;  2JNG A;  3MP8 A;  1K76 A;  2GQV A;  2RQV A;  1OX8 A;  3T90 A;  2QAZ A;  3MJX A;  4EDU A;  3KHZ A;  4C8Q D;  2J9A A;  4WCI A;  1JJ2 A;  3QSU A;  4J8O A;  4LNP A;  4C5H A;  3CCR Q;  2BL1 A;  4KOW A;  1Y9W A;  3L2Z A;  1VQM A;  2RJF A;  3CCJ T;  1QSN A;  3P8H A;  4Y92 A;  4Q36 A;  2CNT A;  2GAN A;  1UJ0 A;  1FY7 A;  4BY6 C;  2PRB A;  6CPA A;  3EFO A;  4ZY1 A;  5BWA B;  2J8M A;  1Q2Y A;  1Z4R A;  1B34 A;  3ZBD A;  1GXI E;  1R0C B;  3P2F A;  1CKA A;  2DTO A;  4K11 A;  3QWY A;  1S60 A;  2KRN A;  2OR4 A;  2HMA A;  3I1U A;  3E19 A;  4UEF A;  4ZYQ A;  1QSR A;  3DSB A;  2ZW4 A;  2OTJ A;  1XIX A;  3SHW A;  2X51 A;  2ZCF B;  4M75 G;  3Q1J A;  3CCS Q;  1H92 A;  2GQI A;  4MDX A;  4U9Y A;  1IYL A;  2V8K A;  2HBW A;  2G3R A;  1F1B B;  2BUD A;  2QYZ A;  5GAN 8;  3TEE A;  2F69 A;  3UA6 A;  4RTW A;  1C6V X;  3LWH A;  1B87 A;  4A94 A;  3AHU A;  4PSW A;  1VQK A;  4MFJ A;  3FIF A;  2HUZ A;  3JUW A;  4HA8 A;  5J3B A;  4PJO B;  2ABL A;  2EVN A;  4ZGE B;  2GCX A;  1QKW A;  2CP5 A;  2A3L A;  1ZSZ C;  3M54 A;  4JLY A;  2PSW A;  2QQS A;  2FPD A;  3ISX A;  3EHR A;  2DET A;  4KH1 B;  3EGD A;  5L8R E;  5LL6 S;  1H3Z A;  1WX6 A;  1VKC A;  1KFZ A;  2BO9 A;  2QTX A;  4FYW B;  4IUU A;  2JBK A;  1VQ7 A;  5LJ3 j;  2K3X A;  3A8M B;  3EG9 B;  2JN0 A;  1E6G A;  4D8K A;  1UHC A;  5F48 A;  3OYY A;  1EIF A;  3NH8 A;  4FD6 A;  2PQ8 A;  4CAX A;  4PJM A;  2X3X D;  3BE3 A;  1VQL Q;  1VQ4 Q;  3KHX A;  5F46 A;  3CCM Q;  2HKQ B;  3VAR A;  2ODF A;  4OAD A;  5F49 A;  1B6B A;  2O4X A;  5A28 A;  4OP4 A;  3H8E A;  2DF6 A;  4M6I A;  4R76 A;  1N8R C;  2P4T A;  1ZA2 B;  1RAA B;  1WHL A;  1YCY A;  4M77 E;  3HRU A;  2FG0 A;  1C1A A;  1LCP A;  4O5V A;  1WFW A;  2DAQ A;  2FHD A;  3GKR A;  3HFN A;  2D4P A;  3ME9 A;  4F9U A;  4ZGD B;  8AT1 B;  2W10 A;  4C92 D;  4UIA A;  4W9Y A;  3SJF A;  1OYX A;  1QST A;  5CKH A;  3N5F A;  1Q7Y U;  2ED1 A;  4G1P A;  4FYY B;  2LC4 A;  2W0Z A;  4CYQ A;  4UFW A;  2K5I A;  1WJR A;  1BB9 A;  2K79 A;  4M78 E;  4RTZ A;  1YFN A;  2VGN A;  5IN1 A;  5FWC A;  1AEY A;  2XKO C;  4PFP A;  4A32 A;  4B12 A;  1ZUK A;  2LCL A;  3CPW P;  3R95 A;  4C2Z A;  3PB4 X;  3H0I A;  1Q95 G;  3CXS A;  1BIA A;  3TT2 A;  3HHT B;  2YDL A;  2YRC A;  3PE0 A;  9ATC B;  2X7B A;  4E47 A;  2AFW A;  4C0D C;  3F0A A;  3KKW A;  3M0R A;  3M0P A;  3QJY A;  4M77 B;  5HKC A;  3FYN A;  4UCM A;  4CYN A;  2FPE A;  2YRD A;  2ENM A;  2NUZ A;  4KH0 B;  3QHS A;  1JBM A;  4C92 A;  4Z02 A;  4CI0 C;  4R56 A;  3J80 E;  1BO4 A;  4M7D F;  3T9N A;  2DEQ A;  1TSF A;  4C0D B;  4DBQ A;  2BTT A;  3SDZ A;  4DBR A;  2Q43 A;  1M3C A;  3M59 A;  4PXD A;  2EYW A;  4M78 G;  5CQX A;  3IWE A;  4PFZ A;  4KOX A;  4II1 A;  3EG0 A;  5DS0 A;  3TSW A;  3ASK A;  4IAV A;  1NJI C;  1E6H A;  2RNA A;  1VQ6 T;  3KZW A;  4Q5W A;  3PNW C;  1J3T A;  1IHW A;  3RNZ A;  1VQ5 Q;  1LOJ A;  2FZK B;  2C1C A;  2X4X A;  1AVZ C;  5AG6 A;  3TOB A;  3RNJ A;  2XDP A;  4EWT A;  3EGX B;  2XEI A;  3FB3 A;  2PNI A;  1VIX A;  3CPX A;  3L2R A;  3CXC A;  5LYD A;  4OC0 A;  3ER0 A;  4M7A D;  2CP2 A;  2QXF A;  4A4H A;  5FWB A;  2AFU A;  2IG0 A;  1CPS A;  2PJA A;  4QVC A;  5GAN 3;  4Z65 A;  5HXD A;  1QSO A;  3A8O B;  2B3V A;  4R7M A;  4MFZ A;  1U3O A;  2JOY A;  2VB6 A;  4J3G A;  2VKN A;  2H8H A;  2Q04 A;  3EG2 A;  1M1F A;  1FXX A;  2EO8 A;  3QG1 A;  1DTD A;  1VQ6 A;  1AWJ A;  4M75 B;  1B07 A;  4OLL A;  4OF1 A;  7AT1 B;  1SRM A;  2DVJ A;  3S3M A;  5HH1 A;  3OYC A;  2C0I A;  4FBE A;  1S7L A;  3FB9 A;  3VV0 A;  4M6G A;  4M7A A;  3WR7 A;  1IZ6 A;  2CZ0 B;  4LDV A;  1TXQ A;  1IY7 A;  4NF1 A;  2HCK A;  3HRT A;  4LE9 A;  1WXT A;  4A4E A;  3VWD A;  1K4J A;  1CKB A;  3KAS A;  2L8D A;  3KR5 A;  2VV5 A;  4OVA A;  2BKD N;  1UGP B;  2P0K A;  3D7H A;  3PFS A;  1UB4 A;  2BE7 D;  2CP0 A;  2X4W A;  5GAO l;  1YI2 T;  3FC3 A;  4ESR A;  1QVG S;  2DER A;  2I00 A;  1K9M R;  1ZHI A;  4KVM E;  3EO4 A;  3MPU B;  2C0T A;  4MRI A;  1NEB A;  4HCC A;  1VHO A;  4PQA A;  3A8H B;  2CSI A;  4H2K A;  2NWM A;  4AFQ C;  1YBY A;  2YXY A;  2FZC B;  2Z0Z A;  4ZBG A;  2IMO A;  2CRE A;  1BAV A;  1Z8X A;  4M75 F;  3HLP A;  4O23 A;  1Y71 A;  1WJS A;  4UCN A;  1NLP C;  3H9N A;  1Q82 R;  2DEA A;  2EFI A;  1VQO T;  2R98 A;  1RAD B;  5KYX B;  4J6W A;  1ZO0 A;  1OOT A;  2QDL A;  2AJ6 A;  2J6F A;  4C92 B;  2VI7 A;  4EMK B;  1OZ3 A;  4Q7A A;  2KI7 A;  3CEY A;  5AT1 B;  1Q82 U;  4L5G A;  3NE8 A;  4HNX B;  4JWP A;  3TE4 A;  5GAN 6;  4XNH C;  1PWT A;  1WZO A;  4NL2 A;  2ED0 A;  3G6E A;  1CX8 A;  3EFO B;  1R8O B;  4B6Z A;  5GAO n;  3D2M A;  3C12 A;  5IB9 A;  1EZZ B;  4C0Z A;  4QVD A;  2OTL T;  3MN8 A;  1LNX A; 
#chains in the Genus database with same CATH homology
 3GPL A;  3M9Q A;  2DTI A;  3X28 B;  2RI2 A;  2B8A A;  4C8Q B;  4R55 A;  3L2V A;  3ZFJ A;  3L2W A;  2KAF A;  5HY6 A;  4PKC C;  1UFF A;  3QKJ A;  5C0M A;  2K2M A;  2D0Q B;  3G6E T;  3UDC A;  2E70 A;  2E10 A;  1UEB A;  1M5Q 1;  3N5B B;  2GFU A;  4JJD A;  3E9F A;  2E5Q A;  4C92 C;  1HXD A;  2ZPB B;  5LJ5 g;  2WSE E;  5CIU A;  2RHX A;  2CUD A;  3MO8 A;  1GFD A;  5A2Q E;  4XU2 A;  4JRP A;  4F7U F;  5I2S A;  5GAM h;  4LD9 K;  2AK5 A;  4M7A C;  3DB4 A;  4ZNX A;  1KQ1 A;  2XG8 D;  1ARK A;  3F70 A;  4LUD A;  4N4H A;  2VXF A;  2X3W D;  3QWX X;  3OQ5 A;  5FLX E;  5FU6 B;  4JPB W;  5A0G A;  3CCR T;  2JTF A;  1RUW A;  2J6O A;  1W2B A;  3FLG A;  2YUO A;  3OB9 A;  2EIF A;  1X6O A;  2CT3 A;  3G7Z A;  1VQ7 T;  4QQG A;  1SSF A;  2DYB A;  5CKE A;  3OBY A;  3X26 B;  4ZTJ A;  2DIG A;  2ZPF B;  2X4J A;  2KRO A;  4J5Y A;  2KXC A;  5IAY A;  1I8F A;  2I2L A;  2LVM A;  4JS4 A;  1VQK T;  2DK3 A;  2JMA A;  1TUC A;  5LJ3 g;  4OB2 B;  1WA7 A;  3PVL A;  2CT4 A;  1ZX6 A;  4FSS A;  1PRM C;  4OP0 A;  1JWQ A;  2BZX A;  2L3S A;  3OS5 A;  1U1T A;  2E65 A;  4GBQ A;  1KC8 C;  3LX7 A;  2CS7 A;  4EFD A;  1JXO A;  4OMO A;  3OYM A;  1I4K 1;  2R5A A;  1MV3 A;  5IH2 A;  2X4Y A;  4ME7 A;  5GAO p;  3WXM B;  2VXE A;  2EJ9 A;  3CCU A;  4Y28 E;  3NHN A;  2CZ6 B;  2V1Q A;  2JTE A;  4TVR A;  3CCL T;  1VQM T;  1M8V A;  1K8A C;  1VIF A;  3FJ5 A;  4OMM A;  1SPK A;  2DPP B;  5GAN f;  2XDD A;  4OMF B;  1WJQ A;  1GCQ A;  4C92 E;  4AG2 C;  2RK2 A;  4OML A;  3M0U A;  3CME A;  1QVP A;  4XU3 A;  5CKF A;  2Y90 A;  2DL8 A;  2PTK A;  1SHG A;  1OV3 A;  2RQW A;  2YT6 A;  3RKW A;  3IQL A;  3I5S A;  2J6K A;  1CSK A;  1MHN A;  2D6F A;  3A8G B;  2ZPG B;  5HCK A;  3GP8 A;  3L1A A;  5GAO r;  3OW2 A;  2K3Y A;  2MI6 A;  1N6A A;  3JB9 G;  2RF0 A;  2YHT A;  4N0A A;  3RES A;  3V7R A;  3OA6 A;  1NM7 A;  2FRY A;  2CGH A;  1X01 A;  1XQH A;  1KQ2 A;  1QW1 A;  2R58 A;  4Y91 A;  3M0S A;  3VS3 A;  1Q81 C;  2HEQ A;  5GAN e;  3UT1 A;  5KCO A;  3E1S A;  1M8M A;  5KCH A;  3L2Q A;  4M7A E;  2ESW A;  2RHY A;  5GAM e;  1K8A U;  1WDX A;  3VS2 A;  4VUB A;  4EMH A;  2A36 A;  2EJF A;  5GAN 7;  3TU4 K;  2MAM A;  2ECZ A;  5CKB A;  2RK1 A;  3JCM g;  2RA2 A;  2KSS A;  2A28 A;  1YJW T;  3I56 A;  3OYE A;  3FRN A;  4OMQ A;  4QQD A;  4PJO C;  1NYG A;  3CCS A;  2E5K A;  2EQJ A;  1SRL A;  3CC2 T;  2LQK A;  1G83 A;  3CD6 T;  2QA4 T;  3QXE B;  2HB6 A;  1X43 A;  2HC9 A;  5EG2 A;  4R0K A;  4PNO A;  3DLM A;  3BFM A;  5GAN 2;  4M75 E;  4J9E A;  4FT2 A;  2RB6 A;  1RLQ C;  1YWP A;  1U8R A;  2QEX T;  3MEV A;  2LNV A;  3O8V A;  3C94 A;  3VS0 A;  1YJ9 T;  1YJ9 A;  4CC4 B;  1UG1 A;  2J05 A;  3CCQ A;  2LT1 A;  3A98 A;  3SWN A;  2EW3 A;  4XTX A;  4M7D D;  2DM1 A;  1SHF A;  1JO8 A;  2D8J A;  1YJN A;  3JCM X;  1I5L A;  3OW2 S;  1YN8 A;  1VQ5 A;  4JS5 A;  3RIR A;  4RTU A;  1G3Y A;  2E6N A;  4PJO F;  1X6G A;  4LQ6 A;  3LH0 A;  5GAN 5;  1QCF A;  3OS0 A;  1G3S A;  2JS2 A;  2PUK B;  4IUP A;  3VKI A;  4KRT A;  2FB7 A;  4MZT A;  4M75 D;  1FMK A;  1AWW A;  2KR3 A;  4AFZ C;  1H3H A;  3JCM J;  4N4I A;  4M7D B;  1YIT A;  3SWN B;  4HCZ A;  3JCM W;  2C0O A;  5GMK j;  1VQ9 A;  4N4G A;  1ZBJ A;  4P5N A;  2DZC A;  1NPR A;  3PIO A;  2J06 A;  4M77 G;  1VQL T;  4D6W A;  2FPF A;  5GAM f;  1JU5 C;  1NE8 A;  4LD6 A;  2PVO B;  2L3P A;  2CZ7 B;  1VIE A;  2GTJ A;  1JB0 E;  1I0C A;  3NTK A;  2DD4 A;  1V29 B;  1WNL A;  4XTU A;  3DLL A;  5IHK A;  1SSH A;  2O2O A;  2RI3 A;  1KQS A;  3HKS A;  5FU7 B;  1PKS A;  5KH6 A;  2L3Q A;  4L59 A;  4A53 A;  1QLY A;  2MOX A;  1K73 U;  3TSZ A;  1U5S A;  1S72 A;  1YIT T;  2P0P A;  3JCM P;  5GAO q;  1M90 C;  2EQK A;  3CBO A;  2GNC A;  2M0Y A;  1X27 A;  3PTA A;  4HXJ A;  3QYG B;  5A0L A;  4GLM A;  3NGP A;  3CCE A;  4JLI A;  1N9S A;  4A54 A;  2QI2 A;  1M3B A;  3JRZ A;  2KT1 A;  3VYG A;  5LJ5 e;  2O9S A;  1Y07 A;  4JRK A;  4L6V 5;  2CUB A;  4LDY A;  1PSF A;  2CDT A;  1XTD A;  3GNF B;  4EMK A;  2KK4 A;  4HVW A;  4FSX A;  2RMO A;  2K4Y A;  5GMK h;  2LDM A;  2E1H A;  5GAM g;  2A7Y A;  1M30 A;  3EGU A;  4A63 B;  1VQN T;  4XTW A;  3M0Q A;  3VYH B;  4A4F A;  2G6F X;  5J39 A;  3SFM A;  1VQ8 A;  3REA B;  2LJ0 A;  3I55 A;  4E7H A;  5IHI A;  4M7A G;  1I1J A;  1YIJ T;  1VA7 A;  2LQW A;  2Y4Y A;  1YJW A;  3CZX A;  2DX1 A;  4FL6 A;  1QKX A;  3NTH A;  2YUN A;  4EPC A;  3P8B B;  3L2U A;  1BU1 A;  4EMG A;  2KBT A;  5FU7 C;  3BDL A;  1W2B S;  2V8J A;  3NFC A;  3MP6 A;  1FYN A;  2JZ2 A;  1BKB A;  4J9I A;  4C0F A;  4AG1 C;  2RHI A;  3O5Z A;  3UAT A;  4X1V A;  3MEW A;  3CC7 A;  3VS7 A;  5GAN g;  3OYB A;  2PVD B;  4XU0 A;  2OTL A;  2KDS A;  2O31 A;  3INZ A;  2PUO B;  1JQQ A;  3RKY A;  1X75 C;  3CCQ T;  3OSV A;  4HCB A;  3BY7 A;  3M56 A;  3CBM A;  3WVD B;  1M9S A;  4BI3 A;  1O75 A;  3U23 A;  5GAN h;  4ZTF A;  3CCL A;  1NEG A;  2SEM A;  2LTO A;  1RL2 A;  1OEB A;  2XID A;  3JCM e;  3S6W A;  1UE9 A;  3M0T A;  3CPW A;  3CCR A;  2K57 A;  1OZ2 A;  1PSE A;  3ULR B;  2ZPE B;  3SWN C;  5FU6 C;  4M77 F;  2CH4 W;  3PT9 A;  4ZGJ B;  1VQP T;  4F16 A;  3LYI A;  2ZGW A;  1NLO C;  2K6D A;  4ORZ A;  2O4X B;  5GAM d;  2ROT A;  5LJ3 f;  2R5M A;  1WPY A;  4IIM A;  3MEA A;  3L42 A;  1NYF A;  3QO3 A;  2GTO A;  5GAN 4;  4LN2 A;  4DOW A;  1GRI A;  2XMF A;  3EG1 A;  2Y4X A;  4NOY A;  2VVK A;  3VS6 A;  5IT9 E;  3JCM d;  2K5L A;  2RPN A;  1W6X A;  1YCS B;  5D6X A;  1H64 1;  1Q86 U;  3JCM f;  4C8Q C;  2GGR A;  3FDR A;  4PJO A;  5DLQ E;  1A0N B;  3JV3 A;  2RM4 A;  3H6Z A;  3OY9 A;  1BYM A;  2ZPI B;  4HT9 A;  4HKE A;  5I22 A;  4FIB A;  2DJZ A;  1LCK A;  3HSB A;  4BI8 B;  4M6H A;  1T0J A;  1NJI U;  1W1F A;  3LH5 A;  1JXM A;  3H0H A;  1VQ9 T;  1T3S A;  2KNB B;  2L89 A;  3JSC A;  2EWN A;  4A4K A;  5GAN j;  4HVV A;  3A8L B;  4CRI A;  2JT4 A;  2VYT A;  4ZN1 A;  1QVF A;  4IUV A;  4B9W A;  1B34 B;  1WQ7 A;  3CCM T;  4DEY A;  1KHC A;  4KUI A;  4X34 A;  1K0X A;  1TH7 A;  2RHU A;  2OJ2 A;  3OS1 A;  2RO0 A;  3VJP A;  3QII A;  1BI0 A;  3GLX A;  1K9M C;  1Q7Y C;  1OI1 A;  2AZV A;  5GAM j;  2FL7 A;  5HK0 A;  2DRM A;  3LLR A;  1M27 C;  5ECA A;  3THK A;  2L5Q A;  3UPU A;  4F14 A;  2KMT A;  4LDW A;  5CR2 A;  3MCA B;  3FJP A;  2BIV A;  3QDR B;  1QWF A;  1GBQ A;  2DXB A;  4M7D E;  2A37 A;  1BI1 A;  1OPL A;  5DM7 R;  5HK3 A;  1UEC A;  3GIB A;  2PQW A;  3UWN A;  2D1X A;  3RUX A;  5LJ5 j;  3URG A;  2MWO A;  2DBK A;  3PMI A;  2EKH A;  5GJV B;  2PZ1 A;  1AD5 A;  4FT4 A;  3CD6 A;  4IUQ A;  5L23 A;  3GNG A;  1NPP A;  3TCJ A;  2MF2 A;  3P8D A;  1PKT A;  3PGG A;  3V8K A;  1Y96 A;  3X24 B;  4N0A C;  4JJB A;  3BW1 A;  2D0N A;  3KBG A;  4F7U B;  1D3B B;  3OYJ A;  2DBM A;  3M57 A;  5IHN A;  3RER A;  4M7A F;  1TUD A;  1H8K A;  1MV0 B;  4X9D A;  3JB9 H;  3QUI A;  5EMI A;  4DOV A;  3VU3 C;  3V7S A;  2K7A A;  3CMA A;  3G71 T;  2LX9 A;  2HBP A;  1PRL C;  1AWX A;  4GY5 A;  1K9M U;  3TVT A;  4M78 B;  4BDZ A;  1X6B A;  3RKX A;  3VRZ A;  4BIN A;  5GMK i;  4RMO A;  1PNJ A;  3RMQ A;  3GBQ A;  4OMP A;  2EQI A;  3R6N A;  4M78 F;  3LWI A;  4X9C A;  5CCA A;  4CC7 A;  4ATO A;  1HK9 A;  2DKG A;  4JZ3 A;  3QBY A;  1MUZ A;  4AFS C;  1OPK A;  1WGS A;  2PU9 B;  4E7L A;  1UGQ B;  2DVE A;  1U06 A;  3CPF A;  1KQS S;  1JEG A;  2RJD A;  4LDU A;  5LJ5 f;  1HJD A;  1VQ4 A;  1GBR A;  1T3L A;  1GCP A;  4XK8 E;  4BE1 A;  4DEX A;  4MDW A;  1NZ9 A;  5I21 A;  2ROL A;  3M4Y A;  2AZS A;  1UTI A;  5LJ5 d;  1Y57 A;  2MWP A;  1KJW A;  3HFO A;  3ZEH A;  2YSQ A;  3UF4 A;  2YRV A;  2EYY A;  2LCC A;  2GF7 A;  2IIM A;  2HAX A;  1ABO A;  2QQA A;  1Z9Z A;  3CBP A;  2E41 A;  3R6O A;  3C0C A;  3OYN A;  1TG0 A;  1Z9Q A;  2RJC A;  3EHQ A;  3EFR A;  4RTY A;  1ABQ A;  2DXC A;  2CKK A;  4BI4 A;  4JRQ A;  4RTX A;  3SEM A;  4RCC A;  4WF2 A;  2X35 A;  5A0D A;  2WSC E;  3H0F A;  3PIP A;  2HNI A;  4RTV A;  1S1N A;  3WVE B;  2DRK A;  2HSP A;  2YUP A;  2F2W A;  2EYQ A;  5IXB A;  3EFS A;  4BAC A;  1K1Z A;  4E7J A;  3C95 A;  4QW2 A;  1Q86 C;  4J7F A;  3LGL A;  3CMA T;  3DKM A;  4Z8A A;  4RTT A;  1N27 A;  4OGE A;  4E6R A;  2RI5 A;  4RG8 A;  2RQU A;  4BDY A;  4C8Q E;  2NLU A;  1G5V A;  4HCK A;  4J9H A;  3BDU A;  3KXT A;  1HD3 A;  2F5T X;  4XAX B;  5D6Y A;  2K5F A;  2KXD A;  1XOV A;  3CCM A;  2QQR A;  2RHZ A;  4Z89 A;  3JCM V;  1VQ8 T;  5FW9 A;  1VQO A;  4J9F A;  5C6S A;  2LQN A;  2XDB A;  1VQN A;  2KGT A;  1MGQ A;  2E6Z A;  2XK0 A;  3X20 B;  3V8J A;  4IKF A;  4EIK A;  3MP1 A;  5GAO m;  3MET A;  4XTY A;  2DL5 A;  2DLP A;  1ZUY A;  3OMG A;  4M7D G;  2FEI A;  3EG3 A;  2VWF A;  2OTJ T;  4RN7 A;  3QYH B;  1X2Q A;  3VS1 A;  1YI2 A;  1M1G A;  1NG2 A;  1BIB A;  1GCQ C;  2H3J A;  2LNH B;  1UHF A;  2KT8 A;  2QQ9 A;  4J9G A;  2LMJ A;  1AZE A;  1AHJ B;  3J7A F;  2V1R A;  4IUR A;  2DL7 A;  1YP5 A;  1S72 T;  1KIK A;  4GLK A;  5FRM A;  4MZM A;  4BD3 A;  4F7U A;  3OYG A;  2CYZ B;  1W70 A;  2LJ1 A;  2EPD A;  4KT0 E;  3CPW S;  2XU8 A;  1XNI A;  4YTL A;  2J7I A;  3CXC S;  1QP3 A;  2EJG A;  2KVQ G;  4OB0 B;  4ELY C;  4J6Y A;  2RJE A;  1ZLM A;  4CC3 A;  4JUV A;  3LGF A;  2YLB A;  2SRC A;  2FRW A;  3X25 B;  1VUB A;  2DL3 A;  2QDY B;  1SEM A;  4M78 C;  3KFV A;  2AHJ B;  4C0G A;  5CK9 A;  2M0O A;  3TRE A;  1Y0M A;  4BY6 B;  1VQL A;  3G71 A;  2HQE A;  1M1K C;  1D3B A;  5CKD A;  4C92 F;  4RUG A;  2DL4 A;  1BK2 A;  1WLP B;  2CZ1 B;  2RD1 A;  1UJY A;  2WAC A;  2LQ8 A;  2HD0 A;  5FRN A;  2EBP A;  4PLL A;  3JB9 J;  5GAN d;  3I35 A;  3GF5 A;  2YLC A;  2F2V A;  5CVI A;  3HRS A;  2KY9 A;  5DLO A;  3VS5 A;  4BB7 A;  3VS4 A;  4QQ6 A;  1VQ4 T;  1YWO A;  2DD5 A;  2ZZD A;  3EAE A;  4C5G A;  4J83 A;  2LRQ A;  3FEO A;  2I0N A;  2L0A A;  2DE0 X;  1Q82 C;  4HT8 A;  2R57 A;  3RBB B;  3PVQ A;  2MIO A;  3HP9 A;  2DA9 A;  3REB B;  2EKO A;  1T0H A;  3JCM h;  1ZBX A;  1N8R U;  5EC7 A;  2DIQ A;  4OGC A;  2DZ9 A;  1KHI A;  5LJ3 e;  3JB9 I;  4OMN A;  2P0Q A;  3CC4 A;  1GL5 A;  2KQW A;  4QT7 A;  2OI3 A;  4IIO A;  1O9S A;  1UGV A;  2JS0 A;  2VUB A;  4NS5 A;  1UGR B;  5GJW B;  3JB9 F;  3QPH A;  3SB2 A;  4C5E A;  2RQR A;  1N9R A;  2L2P A;  3OYF A;  1QVF S;  1FWZ A;  4MMK A;  3CCE T;  4D8D A;  4ELZ C;  2XD0 A;  1KG1 A;  4Z88 A;  5AYF A;  1KSW A;  4M7D A;  3JB9 D;  3MHX A;  5DY9 A;  4J7I A;  2JUF A;  1ZQ1 A;  1VQP A;  1VYU A;  2HQX A;  1K0S A;  4C8Q G;  1LJO A;  4M78 D;  1BI3 A;  4E7K A;  1YIJ A;  1WXU A;  1YJN T;  1PHT A;  4J6X A;  2EGE A;  4BE2 A;  2B86 A;  2XIC A;  3KUF A;  3CCV A;  1KC8 U;  1Y96 B;  1I07 A;  3M55 A;  3VRY A;  2P4R A;  2O01 E;  3LW5 E;  4F7U G;  2JW4 A;  3SD4 A;  4JLG A;  2QEX A;  2KE9 A;  2LCS A;  3V8L A;  1IRE B;  3NTI A;  1RLP C;  4M77 D;  3NPF A;  3C4S A;  3CC7 T;  4A4G A;  1QP2 A;  3CCJ A;  2LZ6 B;  4XQ3 A;  2RQT A;  2RH2 A;  4DA4 A;  5GMK l;  2EVR A;  1W4S A;  3G4S T;  2CH4 A;  1KD1 C;  1EFN A;  2OAW A;  2EGA A;  2GBQ A;  1WIE A;  2DO3 A;  4MZP A;  1UUE A;  1UGS B;  3J81 E;  1M4Z A;  2KRS A;  3PMT A;  2AKL A;  2EQU A;  4FM4 B;  3OYH A;  5M9O A;  3S3N A;  3I55 T;  4EMK C;  3V7C A;  3M5A A;  5CO7 A;  2L3R A;  1IO6 A;  3RMS A;  2M9U A;  1KD1 U;  2E64 A;  1X69 A;  4JJC A;  4J9B A;  4UC4 A;  3QJ6 A;  4O6J A;  4J9C A;  5FRO A;  2LX7 A;  1K9A A;  4AFU C;  1JJ2 S;  2LP5 A;  4M75 A;  3OBW A;  2F2X A;  1YHQ T;  4BE0 A;  1VYV A;  3JAM E;  1JRI A;  1Q81 U;  3OYD A;  2K9G A;  4M7D C;  3QZ5 B;  4NL3 A;  2JM8 A;  4J9D A;  4FU6 A;  1G2B A;  3JCM Q;  1RI0 A;  3S3O A;  2D8H A;  4RCB A;  3OYK A;  2CSQ A;  4KUD K;  4JDS A;  1N5Z A;  4E7I A;  2BZ8 A;  2A08 A;  1QVG A;  2V8I A;  4F17 A;  4DQ2 A;  3GOX A;  2RN8 A;  2JVV A;  4F7U E;  5D6W A;  4OB3 B;  4C8Q F;  2QA4 A;  1UDL A;  2HDA A;  2PVG B;  1M3A A;  3G4S A;  2DXU A;  3ZL7 C;  5I11 A;  4M75 C;  3CQT A;  2VC8 A;  2MCN A;  3A5Z B;  1WXB A;  2KYB A;  3QZ9 B;  3QAY A;  3OMC A;  2QQB A;  3CME T;  4M77 C;  1K4U S;  3I56 T;  3E9G A;  2EYZ A;  5GMK m;  2K2V A;  3HL8 A;  2M1H A;  5J26 A;  5CAI A;  1P92 A;  5LJ3 d;  3NMZ C;  1AOJ A;  1V1C A;  1YHQ A;  1M90 U;  2LT4 A;  1AZG B;  4JJN K;  1BBZ A;  2DIL A;  2DMO A;  3CCU T;  1K73 C;  1FX7 A;  3OYA A;  2KYM A;  4ZN3 A;  1RI9 A;  4CC2 A;  2IVW A;  3CC2 A;  4KBM B;  3H8Z A;  4C8Q A;  3OSS C;  2JM9 A;  2DTH A;  3UA7 A;  2JTM A;  2C06 A;  2JXB A;  2KEA A;  3OYI A;  2K3B A;  3I9Q A;  4M77 A;  4V2S A;  2O88 A;  2DNU A;  5KE2 A;  2FVU A;  4PL6 A;  4PJO G;  4OB1 B;  3JCM b;  3MEU A;  3M4G A;  1M1K U;  1B3Q A;  1VQ5 T;  4LDX A;  2EGC A;  1G3T A;  1Y7X A;  4QVZ A;  2EQM A;  2O9V A;  3H41 A;  4C92 G;  2F5K A;  4JRI A;  4XU1 A;  3OS2 A;  4KUL A;  2M51 A;  2DJQ A;  2EAY A;  1E7O A;  1WI7 A;  3CCS T;  2E12 A;  4M78 A;  1QWE A;  4HVU A;  4XTZ A;  2WSF E;  4PJO D;  3JCM c;  4RG2 A;  2M16 A;  2DXT A;  1AWO A;  4PJO E;  5LJ3 h;  2EYX A;  5LJ5 h;  3OYL A;  2GFA A;  1ZSG A;  4PLI A;  3CCV T;  2VGM A;  3M53 A;  1ZUU A;  2AKK A;  5CQY A;  1I81 A;  2OAU A;  3VUZ A;  3CC4 T;  2XI9 A;  2BZY A;  1G3W A;  2ZPH B;  2JMC A;  2KRM A;  2YUQ A;  3I5R A;  3M58 A;  4MML A;  2FYK A;  3HPW A;  4BUG A;  4IUT A;  3DB3 A;  1HSQ A;  1VYT A;  2FO0 A;  1DJ7 B;  4JZ4 A;  2XHC A;  4RKU E;  4LUE A;  5KE3 A;  4C5I A;  4M7A B;  1X2K A;  1YNZ A;  1WYX A;  2MMP A;  1WQW A;  3VUB A;  2Q7S A;  1U1S A;  2D9T A;  4B9X A;  4XTV A;  5I2M A;  1GFC A;  5GMK e;  2LJ3 A;  1BI2 A;  5IXF A;  4M4Z A;  2JNG A;  3MP8 A;  1K76 A;  2GQV A;  2RQV A;  4EDU A;  4C8Q D;  4WCI A;  1JJ2 A;  3QSU A;  4LNP A;  4J8O A;  4C5H A;  3L2Z A;  1VQM A;  2RJF A;  3CCJ T;  4Y92 A;  3P8H A;  1UJ0 A;  4BY6 C;  1B34 A;  3ZBD A;  1GXI E;  1CKA A;  2DTO A;  4K11 A;  3QWY A;  2KRN A;  3E19 A;  2OTJ A;  3SHW A;  2ZCF B;  4M75 G;  3Q1J A;  1H92 A;  2GQI A;  4MDX A;  2V8K A;  2HBW A;  2G3R A;  2BUD A;  5GAN 8;  3TEE A;  2F69 A;  3UA6 A;  4RTW A;  3LWH A;  3AHU A;  1VQK A;  3FIF A;  4HA8 A;  5J3B A;  4PJO B;  2ABL A;  4ZGE B;  2GCX A;  1QKW A;  2A3L A;  3M54 A;  2QQS A;  2FPD A;  3EHR A;  5L8R E;  5LL6 S;  1H3Z A;  1WX6 A;  1KFZ A;  2QTX A;  4IUU A;  1VQ7 A;  5LJ3 j;  2K3X A;  3A8M B;  2JN0 A;  1E6G A;  4D8K A;  1UHC A;  3OYY A;  1EIF A;  2X3X D;  2ODF A;  2O4X A;  2DF6 A;  4M6I A;  1N8R C;  2P4T A;  1YCY A;  4M77 E;  3HRU A;  2FG0 A;  4O5V A;  1WFW A;  2DAQ A;  2FHD A;  3HFN A;  3ME9 A;  4ZGD B;  2W10 A;  4C92 D;  1OYX A;  5CKH A;  1Q7Y U;  2ED1 A;  2LC4 A;  2W0Z A;  2K5I A;  1WJR A;  1BB9 A;  2K79 A;  4M78 E;  4RTZ A;  2VGN A;  5IN1 A;  5FWC A;  1AEY A;  2XKO C;  1ZUK A;  2LCL A;  3H0I A;  1BIA A;  3HHT B;  2YDL A;  3PE0 A;  4E47 A;  4C0D C;  3M0R A;  3M0P A;  3QJY A;  4M77 B;  5HKC A;  2FPE A;  2ENM A;  2NUZ A;  3QHS A;  1JBM A;  4C92 A;  4Z02 A;  4CI0 C;  4R56 A;  3J80 E;  4M7D F;  3T9N A;  2DEQ A;  4C0D B;  2BTT A;  3SDZ A;  1M3C A;  3M59 A;  2EYW A;  4M78 G;  5CQX A;  4II1 A;  3EG0 A;  3TSW A;  3ASK A;  1NJI C;  1E6H A;  2RNA A;  1VQ6 T;  4Q5W A;  3PNW C;  1J3T A;  1LOJ A;  2X4X A;  1AVZ C;  3RNJ A;  2XDP A;  2PNI A;  3L2R A;  3CXC A;  3ER0 A;  4M7A D;  2QXF A;  4A4H A;  5FWB A;  2IG0 A;  4QVC A;  5GAN 3;  3A8O B;  1U3O A;  2JOY A;  2VKN A;  2H8H A;  3EG2 A;  1M1F A;  1FXX A;  3QG1 A;  1VQ6 A;  1AWJ A;  4M75 B;  1B07 A;  4OF1 A;  1SRM A;  2DVJ A;  3S3M A;  3OYC A;  2C0I A;  3FB9 A;  3VV0 A;  4M6G A;  4M7A A;  1IZ6 A;  2CZ0 B;  4LDV A;  2HCK A;  4LE9 A;  3HRT A;  1WXT A;  4A4E A;  1CKB A;  2L8D A;  2VV5 A;  4OVA A;  2BKD N;  1UGP B;  2P0K A;  1UB4 A;  3PFS A;  2X4W A;  5GAO l;  1YI2 T;  3FC3 A;  4ESR A;  1QVG S;  1ZHI A;  2C0T A;  1NEB A;  4HCC A;  3A8H B;  2CSI A;  2NWM A;  4AFQ C;  1YBY A;  2CRE A;  4M75 F;  1Y71 A;  1WJS A;  1NLP C;  2EFI A;  1VQO T;  4J6W A;  1OOT A;  2QDL A;  2J6F A;  4C92 B;  4EMK B;  1OZ3 A;  1Q82 U;  3CEY A;  4L5G A;  3NE8 A;  5GAN 6;  1PWT A;  4NL2 A;  2ED0 A;  3G6E A;  1R8O B;  5GAO n;  3C12 A;  4C0Z A;  4QVD A;  2OTL T;  1LNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...