2REEA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
NYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase, lyase
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2reeA00
2FS5A 4Y49C 2F5IA 1RO5A 2I00A 4I49A 3W6SA 1QSMA 1WWZA 4KVOE 1YVOA 3QAHA 2X7BA 2J8RA 3DR8A 2B3UA 1M4IA 3TOBA 5IX3A 3FNCA 3F5BA 4AG7A 2G0BA 5J8FA 5EBVA 4MJ8A 3WR7A 2H5MA 3JVNA 4HNWB 2OZHA 3F0AA 2IL4A 1S3ZA 2PQ8A 4AG9A 3H4QA 1S7KA 2GANA 4LX9A 3GYAA 2ZXVA 4KLWA 1VKCA 2WPXA 1P0HA 2CY2A 4E8OA 3I3GA 4II9A 2B58A 2NMTA 3B8GA 3TCVA 4CAVA 3TFYA 4B5PB 3LD2A 2Q04A 1J4JA 2JEVA 2B3VA 5E96A 4H6ZA 2Z11A 3CXSA 4KZTA 4YGOA 2KCWA 1FY7A 1OZPA 5H86A 4NSQA 2FCKA 3GY9A 1QSRA 3UY5A 4H6UA 3R9GA 4MI4A 4PV6A 4CS0B 4XPLA 3EO4A 2VBQA 2OH1A 5IV0A 2R7HA 1Z9UA 4E0AA 3CXPA 2VXKA 1XF8A 3D8PA 4BMHA 2HV2A 4ORFA 4RI1A 2FIWA 1Q2YA 1Z4RA 2Q44A 4KOWA 4JJXA 4E2AA 2ZW7A 1QSOA 2HUZA 2D4PA 1NSLA 4OAEA 2ATRA 4PK2A 4YFJA 3KKWA 1N71A 2VEZA 1XEBA 5IB0A 3DSBA 3MGDA 1QSTA 3OWCA 2PDOA 1MJ9A 1S60A 5CNPA 2JDDA 2B5GA 1CM0A 3P2FA 2QECA 1B6BA 4CAWA 2BEIA 2ZPAA 4XPDC 3TO6A 3CXQA 2VI7A 3T9YA 2BSWA 4Y49B 2C27A 4KVME 5EC4A 5GCNA 3FRMA 2FSRA 3JUWA 3SXNA 1ON0A 2B4DB 3FBUA 2OU2A 2I79A 4B5OA 3TTHA 1PUAA 3C26A 1WK4A 3DR6A 4CRZB 2P6GA 1M4DA 4KUAA 1MJBA 1K4JA 2R8VA 5I0CA 1YR0A 4CRYB 1TIQA 5HMNA 2J8NA 2Q4VA 1KZFA 1Q2CA 4KOSA 4XPKA 4FD5A 2Q4YA 4R3KA 3P2HA 1YLEA 2G3TA 3FIXA 2GE3A 4PSWA 1IIDA 1B87A 3V8IA 5J8CA 4NF1A 4J3GA 4ZBGA 1MJAA 4YRHA 4NCZA 2G3AA 3R1KA 4M85A 1U6MA 2P6FA 4UWIA 3I9SA 2QIRA 5F48A 1YVKA 4L89A 4LUAA 4JWPA 3TO7A 3W6XA 4DNCA 4NXYA 5F46A 2J8MA 1Y9KA 2PR8A 2RC4A 4AVAA 2Z10A 1BO4A 3S6KA 1GHEA 2O28A 4AVBA 4KORA 1IYKA 2ZW6A 1NE9A 3BJ7A 1QSNA 3D2MA 5C82A 4KOYA 4NEXA 2ZW5A 2VZZA 3S6GA 1YX0A 2JLMA 1S7LA 2P0WA 2ARHA 3FYNA 1RXTA 4U9YA 3PGPA 4XNHC 3SXOA 4MY0A 2CNTA 4JD6A 5F49A 3PP9A 2FT0A 3D2PA 4HNXB 3SHPA 2PRBA 1V0CA 4UWJA 3IWGA 4UBRA 2PR1A 1Q2DA 3EY5A 5JPHA 4B5PA 4MBUA 1YREA 4IUSA 1XIXA 4XPDB 4QB9A 2OZGA 3NE7A 5JQ4A 2QMLA 2REFA 3GKRA 3E0KA 4GS4A 4U9ZA 1M1DA 2PC1A 4U5YA 1P4NA 3S6HA 3LODA 3W91A 4H89A 2OB0A 2D4OA 2REEA 3G3SA 4IF5A 2R98A 1I1DA 3R9EA 3RYOA 4EVYA 4F6AA 2FL4A 4AB7A 1LRZA 2AE6A 2GIVA 3IGRA 4FD6A 1R57A 1KUXA 1PU9A 4PSXA 4F0YA 5DWNA 3TO9A 4HNYB 3R9FA 3BLNA 3S6FA 5KTCA 3DNSA 4KOVA 2VZYA 5KTDA 1S7NA 1Y9WA 5DWMA 2HQYA 3EFAA 4KUBA 3R95A 4RS2A 2CNSA 1CJWA 1VHSA 3PZJA 1Z4EA 3R96A 1IICA 4MY3A 4JXQA 3TE4A 1I21A 3QB8A 4QC6A 4AVCA 2VQYA 2DXQA 3TT2A 4K30A 4KVXA 2B4DA 5H84A 4R9MA 1IYLA 3TOAA 4FD4A 4XNHB 1S7FA 4QBJA 2BL1A 2Q7BA 1KUVA 4MHDA 2B5GB 1NMTA 2EVNA 2CNMA 3VWDA 1Y7RA 5FVJA 4KLVA 2AJ6A 2Q0YA 2P6EA 2B4BA 5KTAA 2PSWA 2FE7A 1XMTA 1S5KA 3EXNA 2EUIA 4KOTA 4QUSA 3T90A 2Y0MA 3ZZIA 4ONUA 2A4NA 3D3SA 4OADA 4R87A 4X5KA 1SQHA 1M44A 2JDCA 3BJ8A 3VWEA 1UFHA 2R1IA 4R57A 5C88A 1YGHA 1I12A 2BUEA 3N7ZA 2ZW4A 1M4GA 3DDDA 2Z0ZA 4PK3A 4OLLA 2WPWA 1XE4A 1L0CA 1IB1E 4KOUA 3F8KA 1KUYA 4R3LA 1BOBA 2FIAA 5F47A 5ISVA 3FB3A 3K9UA 5HH1A 4JXRA 1MK4A 3FXTA 1YK3A 2K5TA 3ZJ0A 4FD7A 2OZUA 4QVTA 4UA3A 3G8WA 4HKFA 2FXFA 4M3SA 4CAXA 3EC4A 4KOXA 4L8AA 4JLYA
chains in the Genus database with same CATH superfamily
4GXHA 2FS5A 2ZENA 2F5IA 4Y49C 1RO5A 2I00A 2IQ6A 4I49A 6CPAA 3W6SA 2AFMA 1QSMA 1WWZA 4KVOE 2RFHA 1YVOA 3QAHA 4R7MA 2X7BA 2AFUA 1IU8A 2ZEDA 4ZI6A 2J8RA 3DR8A 2B3UA 1M4IA 2YGWA 4ZX9A 3TOBA 5IX3A 3FNCA 5IB9A 4UEFA 2PJ0A 3F5BA 5LYIA 4MRIA 2J9AA 2WZNA 4NJQA 4AG7A 2G0BA 3PB4X 3HLPA 5J8FA 5EBVA 4MJ8A 2C1CA 3WR7A 3CZXA 2H5MA 5G20A 3JVNA 2CF4A 5ELYA 4HNWB 5G21A 2OZHA 3F0AA 2IL4A 1S3ZA 2POKA 1F57A 1CX8A 2PQ8A 4AG9A 3H4QA 3VARA 2NSMA 1HEEA 4MCQA 4OKOA 4P10A 2DF5A 1S7KA 2GANA 4ZGYB 4LX9A 3GYAA 2ZXVA 4KLWA 1AMPA 3NH5A 4A31A 1VKCA 2WPXA 1PCAA 1P0HA 2CY2A 4E8OA 2DEAA 3I3GA 5BWAB 2B58A 4II9A 2NMTA 4R6TA 3SJEA 4RUHA 5K8OA 3B8GA 3TCVA 4A37A 4CAVA 3TFYA 3IEHA 3WABA 4P4IA 4B5PB 1NSAA 3LD2A 2Q04A 4ZX8A 1IOIA 4MMOA 3PB6X 3B35A 4UCNA 1J4JA 2JEVA 1LAMA 3KHXA 1VIXA 2B3VA 3B2YA 5E96A 4M6GA 4H6ZA 2Z11A 3D7GA 3CXSA 4F0XA 4KZTA 4YGOA 4NGMA 4A2ZA 3D4UA 4OC0A 2KCWA 1FY7A 1BLLE 4P4FA 1OZPA 4NGSA 5H86A 4NSQA 2PCUA 3T8WA 2CXAA 3FEEA 2FCKA 2PIZA 2PJ8A 3GB0A 3GY9A 4P6YA 3RO0A 1KWMA 1QSRA 1XJOA 3B3TA 3UY5A 3S9LA 4H6UA 1CP7A 4IAVA 3R9GA 2F7VA 1JWQA 4MI4A 4PV6A 3FVLA 3PFOA 2QYVA 4CS0B 4XPLA 5DS0A 3PRTA 2PJ6A 2VBQA 2OH1A 2GU2A 3EO4A 2R7HA 1Z9UA 5AG4A 1IY7A 4E0AA 2Z3MA 5IV0A 1ARMA 2PJ3A 4MFPA 2ZEHA 3CXPA 2VXKA 1XF8A 2GFQA 4NGNA 4UIAA 3D8PA 2XEGA 4CAEA 4BMHA 2GLJA 3SJFA 2HV2A 2YNCC 4ORFA 3TC8A 4RI1A 2FIWA 1Q2YA 1Y0RA 1Z4RA 2Q44A 1TF9A 4KOWA 5THWA 1ZG8A 5HVFA 8CPAA 4JJXA 5A28A 4E2AA 2ZW7A 1QSOA 4YU9A 3VH9A 1Z8WA 2HUZA 2D4PA 1NSLA 5EMIA 4A33A 4OAEA 2ATRA 3CPAA 2IJZA 2DPTA 4PXEA 3FF3A 4PK2A 3B3CA 4YFJA 3KKWA 5LYFA 1N71A 1PYTB 2VEZA 1XEBA 5IB0A 1XMBA 3DSBA 3MGDA 1QSTA 3OWCA 2PDOA 1VGYA 4C2ZA 1MJ9A 3IU1A 2EK8A 1S60A 2BOAA 2YNDA 3MN8A 4M6HA 5CNPA 2JDDA 1TKHA 1Z2LA 2B5GA 1CM0A 3LWUA 3P2FA 2QECA 1B6BA 2PIYA 2AFOA 3B3SA 4KSIA 4CAWA 1TKFA 2BEIA 2ZPAA 3SI1A 2GLFA 1VHOA 4XPDC 1ELLP 3FECA 3TO6A 2XEIA 3CXQA 3QAYA 2QJ8A 2ZEFA 2VI7A 3T9YA 2CTBA 2BSWA 4Y49B 3KZWA 2C27A 4KVME 4UEZA 5EC4A 5GCNA 3FRMA 2FSRA 2PJBA 2YNEA 3JUWA 3SXNA 5A27A 1ON0A 2AFZA 2B4DB 2WUUA 3BHXA 3FBUA 2OU2A 2I79A 2C6GA 4B5OA 1TXRA 3TTHA 1PUAA 3C26A 2AFSA 4KS9A 3VATA 3IJ3A 1WK4A 3I1UA 2HB6A 1DTDA 3GUXA 4UF4A 3H5ZA 4NGPA 5AGEA 3DR6A 4UEEA 2P6GA 4CRZB 1M4DA 1XRYA 4KUAA 1MJBA 1K4JA 1BPNA 5D29A 2R8VA 5LRGA 5I0CA 1YR0A 3KQXA 3KI9A 4CRYB 1TIQA 5JGFA 3L2NA 5HMNA 4MHZA 3NA6A 2J8NA 3IWWA 2Q4VA 3CPXA 1KZFA 3FEDA 4B14A 1Q2CA 4BINA 4KOSA 2PJ2A 4MHPA 4PQAA 4FD5A 4XPKA 1OBRA 2Q4YA 4R3KA 4NGRA 2Q4ZA 3P2HA 1YLEA 2G3TA 3PBEA 2BO9A 3FIXA 2GE3A 3FMCA 2ZEMA 4PSWA 1IIDA 1B87A 3V8IA 4OC4A 3D7HA 3A9LA 4NF1A 5J8CA 1ZG9A 1LFWA 3BXMA 1MJAA 4J3GA 4ZBGA 1ARLA 5HVGA 1Z8LA 4NCZA 2G3AA 3HUVA 3R1KA 4YRHA 1XBUA 4M85A 1U6MA 3NFZA 2P6FA 3KR5A 4EWTA 4Z65A 4UWIA 4W9YA 4ONWA 3K9TA 3I9SA 2QIRA 5F48A 1FT7A 1YVKA 3NH8A 4L89A 4NGTA 4OC2A 4UIBA 4MFZA 3S9NA 4K3NA 4LUAA 4JWPA 4LQGA 1BPMA 2O4HA 4UFWA 3TO7A 3W6XA 4RN7A 4DNCA 4NXYA 5F46A 2J8MA 1Y9KA 2ABZA 1HDQA 1Y7EA 3K2KA 3KHZA 2PR8A 2RC4A 2CTCA 3KL9A 2ZEPA 4OC1A 4Q7AA 4AVAA 3D66A 4C7IA 3PFEA 2Z10A 4CGNA 5HVHA 1BO4A 3MRUA 4GM5A 1ZLHA 3S6KA 3TX8A 1AUGA 4WWVA 2ZEOA 2Z3LA 4JZ0A 1GHEA 2O28A 4AVBA 4KORA 1IYKA 2ZW6A 1YW6A 5G22A 4P44A 5LRJA 1NE9A 3BJ7A 2C6CA 1QSNA 3IIBA 3D2MA 1ELMP 4Q38A 4CGMA 5CBMA 5C82A 4KOYA 4IK2A 1YLOA 4NEXA 3IFEA 2ZW5A 2VZZA 4OMEA 5AG5A 2PJ4A 3S6GA 2EWBA 4B10A 1YX0A 3RZAA 2JLMA 1S7LA 3IO1A 2P0WA 2PJCA 1LCPA 2ARHA 4TWEA 4CYOA 3FYNA 2FVGA 1XFOA 1RXTA 4U9YA 3PGPA 2F8HA 4XNHC 4F9VA 4CYPA 3NH4A 2G9DA 3V38A 3SXOA 3KASA 1DE4C 4MY0A 2CNTA 2V8HA 2ZOGA 4JD6A 5F49A 3SI0A 3B3VA 3PP9A 2FT0A 3D2PA 4M6IA 4HNXB 3IU2A 3SHPA 5LRKA 2PRBA 1V0CA 1CPSA 4UWJA 3IWGA 3RBUA 3WC6A 2O53A 3KR4A 3PB9X 4UBRA 5HXDA 2PR1A 3FX6A 1GYTA 1Q2DA 3PB7X 4CYQA 3EY5A 1ZO0A 1R3NA 3D7FA 5JPHA 3RAMA 4B5PA 4A38A 1QQ9A 3NE8A 4MBUA 3V7ZA 1YREA 3N5FA 4IUSA 4MCPA 2AFXA 1XIXA 4XPDB 4QB9A 4R76A 2OZGA 4PXBA 2WSAA 5JH9A 1Z8XA 4PXCA 2CIJA 3NE7A 5JQ4A 5K8MA 2WYRA 2QMLA 2REFA 4MHNA 3PB8X 3GKRA 3E0KA 2V8GA 4C7HA 4GS4A 4OIWA 4U9ZA 4BD9A 3JTKA 1M1DA 2PC1A 4P4JA 4U5YA 1P4NA 3S6HA 3LODA 3W91A 4H89A 4G1PA 1RTQA 1X10A 2OB0A 2D4OA 2REEA 4A94A 4EMEA 2ANPA 3FH4A 4B6ZA 3H8FA 2PVVA 3G3SA 4IF5A 4UFXA 2R98A 1I1DA 3R9EA 3RYOA 4EVYA 4X2TA 2I3CA 4F6AA 3CT9A 4CGLA 2FL4A 1F2OA 4AB7A 1F2PA 5LYLA 1A2ZA 1LRZA 2AE6A 2EO8A 5F09A 2GIVA 1JQGA 3IGRA 4FD6A 2EK9A 1R57A 4B12A 4DUKA 1KUXA 1VHEA 4KSFA 1PU9A 4MFKA 2OOTA 4KSAA 4UCPA 3B7IA 4P4BA 4PSXA 4F0YA 5DWNA 3JRUA 3TO9A 2JBKA 2ZEEA 3PEIA 4HNYB 4JYWA 5LYDA 3R9FA 2ZEGA 3BLNA 3S6FA 5KTCA 3DNSA 4KOVA 2VZYA 4LQ6A 3WC5A 1LOKA 2PRQA 4CGPA 3WC7A 5KTDA 2XEJA 1S7NA 1Y9WA 2HC9A 3H8EA 4AXVA 5DWMA 2Q43A 4CAFA 4MFJA 3GIUA 4MFLA 3DLJA 2HQYA 1X12A 2BCOA 3EFAA 1BAVA 4KUBA 4OC5A 4WJBA 4MXUA 3R95A 4A30A 4CYNA 1M4LA 4NJRA 3D68A 1R43A 3ISZA 4RS2A 2CNSA 1CJWA 2VL1A 4MFQA 5D8NA 3SI2A 1CG2A 1VHSA 3LMSA 2V8DA 5AG7A 3SJXA 2PJAA 3PZJA 5J1QA 1Z4EA 4ZYQA 3H8GA 3R96A 1IICA 4MY3A 1Q7LA 2DPSA 2Z3OA 2V77A 4NFRA 4JXQA 3TE4A 1I21A 3QB8A 4QC6A 4AVCA 2VQYA 4FAIA 2DXQA 4MCRA 3TT2A 4K30A 1AYEA 2RB7A 4KVXA 2PJ9A 2B4DA 2PJ5A 2Z3KA 5H84A 4FUUA 4ZY0A 2PE3A 2JBJA 2C6PA 4H2KA 4R9MA 1YW4A 4X3RA 4A39A 3CDXA 1EE3P 1LAPA 1IYLA 1IGBA 2PJ1A 3FJUA 3TOAA 4FD4A 3WT4A 1IOFA 4OP4A 4XNHB 1S7FA 4R8FA 4CGOA 4QBJA 2BL1A 4HPSA 1ZLIA 2Q7BA 1KUVA 4MHDA 2B5GB 1NMTA 2EVNA 4YWYA 2CNMA 3VWDA 1Y7RA 4UCMA 5FVJA 4KLVA 2AJ6A 2Q0YA 3IC1A 5AG6A 2EBJA 1QMUA 4TNUA 3D7DA 3KGQA 3KQZA 2P6EA 2B4BA 5KTAA 2PSWA 4DJLA 4F8ZA 1HDUA 4ZY2A 5JM6A 2FE7A 3ISXA 1XMTA 1S5KA 2ZELA 2ODFA 5K8PA 3EXNA 2EUIA 4KOTA 4QUSA 3T90A 2Y0MA 3ZZIA 4ONUA 4CPAA 2V8VA 1XOVA 4C68A 3DGVA 4A32A 1H8LA 2A4NA 3D3SA 4OADA 4R87A 1SQHA 4X5KA 3PBBA 4IHMA 4X8IA 4EFDA 1M44A 2JDCA 3BJ8A 3BI0A 3VWEA 1UFHA 4ZY1A 7CPAA 4FWUA 1TF8A 2Q7SA 2Q51A 2R1IA 4R57A 5C88A 1YGHA 1I12A 2BUEA 4P45A 5K8NA 4UFVA 3N7ZA 2ZW4A 1YQEA 1M4GA 4B11A 4MCSA 3LACA 3DDDA 4NGQA 3RNZA 4F9UA 2Z0ZA 4PK3A 5CPAA 1UWYA 3GLJA 4OLLA 2WPWA 1XE4A 1L0CA 2XEFA 1CPXA 1IB1E 4PXDA 4OC3A 4P4EA 3D67A 4FBEA 3BI1A 2PJ7A 4KOUA 4OIDA 3F8KA 1KUYA 4R3LA 1CP6A 4P4DA 1BOBA 1YMEA 2FIAA 3B3WA 2IMOA 1Z5RA 5F47A 5ISVA 3FB3A 3K9UA 4MHYA 2JEWA 4JXRA 5HH1A 1MK4A 5I4MA 4O23A 2OR4A 2ZOFA 3QNVA 4PPZA 1LANA 2GREA 3FXTA 3SJGA 1FNOA 4A95A 2AFWA 1TKJA 1YK3A 2K5TA 2YNCA 1CBXA 3ZJ0A 4FD7A 1YSJA 4C2YA 2OZUA 1ZG7A 2Z3PA 2PVWA 4BBHA 4QVTA 4C2XA 5G1ZA 3IWEA 4UA3A 2NYQA 2QVPA 4B13A 3G8WA 4HKFA 4Q36A 2FXFA 2Z3NA 4DYOA 4M3SA 1Y0YA 1Z8TA 3S9MA 4CAXA 3EC4A 4KOXA 4L8AA 4JLYA
chains in the Genus database with same CATH topology
2FS5A 4Y49C 2F5IA 1RO5A 2I00A 4I49A 3W6SA 1QSMA 1WWZA 4KVOE 1YVOA 3QAHA 2X7BA 2J8RA 3DR8A 2B3UA 1M4IA 2YGWA 3TOBA 5IX3A 3FNCA 3F5BA 4AG7A 2G0BA 5J8FA 5EBVA 4MJ8A 3WR7A 2H5MA 5G20A 3JVNA 4HNWB 5G21A 2OZHA 3F0AA 2IL4A 1S3ZA 2PQ8A 4AG9A 3H4QA 4ZGYB 1S7KA 2GANA 4LX9A 3GYAA 2ZXVA 4KLWA 4A31A 1VKCA 2WPXA 5BWAB 1P0HA 2CY2A 4E8OA 3I3GA 4II9A 2B58A 2NMTA 3B8GA 3TCVA 4CAVA 3TFYA 4B5PB 3LD2A 2Q04A 4UCNA 1J4JA 2JEVA 2B3VA 5E96A 4H6ZA 2Z11A 3CXSA 4F0XA 4KZTA 4YGOA 4A2ZA 2KCWA 1FY7A 1OZPA 5H86A 4NSQA 2CXAA 2FCKA 3GY9A 1QSRA 3UY5A 4H6UA 3R9GA 4MI4A 4PV6A 4CS0B 4XPLA 3EO4A 2VBQA 2OH1A 5IV0A 5AG4A 2R7HA 1Z9UA 4E0AA 2Z3MA 4MFPA 3CXPA 2VXKA 1XF8A 3D8PA 4CAEA 4BMHA 2HV2A 2YNCC 4ORFA 4RI1A 2FIWA 1Q2YA 1Z4RA 2Q44A 4KOWA 4JJXA 5A28A 4E2AA 2ZW7A 1QSOA 2HUZA 2D4PA 1NSLA 4A33A 4OAEA 2ATRA 2DPTA 4PK2A 4YFJA 3KKWA 1N71A 2VEZA 1XEBA 5IB0A 3DSBA 3MGDA 1QSTA 3OWCA 2PDOA 4C2ZA 1MJ9A 3IU1A 1S60A 2YNDA 5CNPA 2JDDA 2B5GA 1CM0A 3P2FA 2QECA 1B6BA 4CAWA 2BEIA 2ZPAA 4XPDC 3TO6A 3CXQA 2VI7A 3T9YA 2BSWA 4Y49B 2C27A 4KVME 5EC4A 5GCNA 3FRMA 2FSRA 2YNEA 3JUWA 3SXNA 5A27A 1ON0A 2WUUA 2B4DB 3FBUA 2OU2A 2I79A 4B5OA 3TTHA 1PUAA 3C26A 4KS9A 1WK4A 3H5ZA 5AGEA 3DR6A 4CRZB 2P6GA 1M4DA 4KUAA 1MJBA 1K4JA 2R8VA 5I0CA 1YR0A 4CRYB 1TIQA 5HMNA 2J8NA 2Q4VA 1KZFA 4B14A 1Q2CA 4KOSA 4XPKA 4FD5A 2Q4YA 4R3KA 3P2HA 1YLEA 2G3TA 3FIXA 2GE3A 4PSWA 1IIDA 1B87A 3V8IA 3A9LA 4NF1A 5J8CA 4J3GA 4ZBGA 1MJAA 4YRHA 4NCZA 2G3AA 3R1KA 4M85A 1U6MA 2P6FA 4UWIA 3I9SA 2QIRA 5F48A 1YVKA 4L89A 4MFZA 4LUAA 4JWPA 4UFWA 3TO7A 3W6XA 4DNCA 4NXYA 5F46A 2J8MA 1Y9KA 2PR8A 2RC4A 4CGNA 4AVAA 4C7IA 2Z10A 1BO4A 3S6KA 2Z3LA 1GHEA 2O28A 4AVBA 4KORA 1IYKA 2ZW6A 5G22A 1NE9A 3BJ7A 1QSNA 3D2MA 4Q38A 4CGMA 5C82A 4KOYA 4NEXA 2ZW5A 2VZZA 5AG5A 3S6GA 4B10A 1YX0A 2JLMA 1S7LA 2P0WA 2ARHA 4CYOA 3FYNA 1RXTA 4U9YA 3PGPA 4XNHC 4CYPA 3SXOA 4MY0A 2CNTA 4JD6A 5F49A 3PP9A 2FT0A 3D2PA 4HNXB 3IU2A 3SHPA 2PRBA 1V0CA 4UWJA 3IWGA 4UBRA 2PR1A 1Q2DA 4CYQA 3EY5A 1ZO0A 5JPHA 4B5PA 4MBUA 1YREA 4IUSA 1XIXA 4XPDB 4QB9A 2OZGA 2WSAA 3NE7A 5JQ4A 2QMLA 2REFA 3GKRA 3E0KA 4C7HA 4GS4A 4U9ZA 3JTKA 1M1DA 2PC1A 4U5YA 1P4NA 3S6HA 3LODA 3W91A 4H89A 2OB0A 2D4OA 2REEA 3G3SA 4IF5A 4UFXA 2R98A 1I1DA 3R9EA 3RYOA 4EVYA 4F6AA 4CGLA 2FL4A 4AB7A 1LRZA 2AE6A 2GIVA 3IGRA 4FD6A 4B12A 1R57A 1KUXA 4KSFA 1PU9A 4MFKA 4KSAA 4UCPA 4PSXA 4F0YA 5DWNA 3TO9A 4HNYB 3R9FA 3BLNA 3S6FA 5KTCA 3DNSA 4KOVA 2VZYA 4CGPA 5KTDA 1S7NA 1Y9WA 5DWMA 4CAFA 4MFJA 4MFLA 2HQYA 3EFAA 4A30A 4CYNA 4KUBA 3R95A 4RS2A 2CNSA 1CJWA 4MFQA 1VHSA 5AG7A 3PZJA 1Z4EA 3R96A 1IICA 4MY3A 2DPSA 2Z3OA 4JXQA 3TE4A 1I21A 3QB8A 4QC6A 4AVCA 2VQYA 2DXQA 3TT2A 4K30A 4KVXA 2B4DA 2Z3KA 5H84A 4R9MA 1IYLA 3TOAA 4FD4A 4XNHB 1S7FA 4CGOA 4QBJA 2BL1A 2Q7BA 1KUVA 4MHDA 2B5GB 1NMTA 2EVNA 2CNMA 3VWDA 1Y7RA 4UCMA 5FVJA 4KLVA 2AJ6A 2Q0YA 5AG6A 2P6EA 2B4BA 5KTAA 2PSWA 2FE7A 1XMTA 1S5KA 3EXNA 2EUIA 4KOTA 4QUSA 3T90A 2Y0MA 3ZZIA 4ONUA 4C68A 4A32A 2A4NA 3D3SA 4OADA 4R87A 4X5KA 1SQHA 1M44A 2JDCA 3BJ8A 3VWEA 1UFHA 2R1IA 4R57A 5C88A 1YGHA 1I12A 2BUEA 4UFVA 3N7ZA 2ZW4A 1M4GA 4B11A 3DDDA 2Z0ZA 4PK3A 4OLLA 2WPWA 1XE4A 1L0CA 1IB1E 4KOUA 3F8KA 1KUYA 4R3LA 1BOBA 2FIAA 5F47A 5ISVA 3FB3A 3K9UA 5HH1A 4JXRA 1MK4A 3FXTA 4A95A 2YNCA 1YK3A 2K5TA 3ZJ0A 4FD7A 4C2YA 2OZUA 2Z3PA 4BBHA 4QVTA 4C2XA 5G1ZA 3IWEA 4UA3A 4B13A 3G8WA 4HKFA 4Q36A 2FXFA 2Z3NA 4M3SA 4CAXA 3EC4A 4KOXA 4L8AA 4JLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  4Y49 C;  2F5I A;  1RO5 A;  2I00 A;  4I49 A;  3W6S A;  1QSM A;  1WWZ A;  4KVO E;  1YVO A;  3QAH A;  2X7B A;  2J8R A;  3DR8 A;  2B3U A;  1M4I A;  3TOB A;  5IX3 A;  3FNC A;  3F5B A;  4AG7 A;  2G0B A;  5J8F A;  5EBV A;  4MJ8 A;  3WR7 A;  2H5M A;  3JVN A;  4HNW B;  2OZH A;  3F0A A;  2IL4 A;  1S3Z A;  2PQ8 A;  4AG9 A;  3H4Q A;  1S7K A;  2GAN A;  4LX9 A;  3GYA A;  2ZXV A;  4KLW A;  1VKC A;  2WPX A;  1P0H A;  2CY2 A;  4E8O A;  3I3G A;  4II9 A;  2B58 A;  2NMT A;  3B8G A;  3TCV A;  4CAV A;  3TFY A;  4B5P B;  3LD2 A;  2Q04 A;  1J4J A;  2JEV A;  2B3V A;  5E96 A;  4H6Z A;  2Z11 A;  3CXS A;  4KZT A;  4YGO A;  2KCW A;  1FY7 A;  1OZP A;  5H86 A;  4NSQ A;  2FCK A;  3GY9 A;  1QSR A;  3UY5 A;  4H6U A;  3R9G A;  4MI4 A;  4PV6 A;  4CS0 B;  4XPL A;  3EO4 A;  2VBQ A;  2OH1 A;  5IV0 A;  2R7H A;  1Z9U A;  4E0A A;  3CXP A;  2VXK A;  1XF8 A;  3D8P A;  4BMH A;  2HV2 A;  4ORF A;  4RI1 A;  2FIW A;  1Q2Y A;  1Z4R A;  2Q44 A;  4KOW A;  4JJX A;  4E2A A;  2ZW7 A;  1QSO A;  2HUZ A;  2D4P A;  1NSL A;  4OAE A;  2ATR A;  4PK2 A;  4YFJ A;  3KKW A;  1N71 A;  2VEZ A;  1XEB A;  5IB0 A;  3DSB A;  3MGD A;  1QST A;  3OWC A;  2PDO A;  1MJ9 A;  1S60 A;  5CNP A;  2JDD A;  2B5G A;  1CM0 A;  3P2F A;  2QEC A;  1B6B A;  4CAW A;  2BEI A;  2ZPA A;  4XPD C;  3TO6 A;  3CXQ A;  2VI7 A;  3T9Y A;  2BSW A;  4Y49 B;  2C27 A;  4KVM E;  5EC4 A;  5GCN A;  3FRM A;  2FSR A;  3JUW A;  3SXN A;  1ON0 A;  2B4D B;  3FBU A;  2OU2 A;  2I79 A;  4B5O A;  3TTH A;  1PUA A;  3C26 A;  1WK4 A;  3DR6 A;  4CRZ B;  2P6G A;  1M4D A;  4KUA A;  1MJB A;  1K4J A;  2R8V A;  5I0C A;  1YR0 A;  4CRY B;  1TIQ A;  5HMN A;  2J8N A;  2Q4V A;  1KZF A;  1Q2C A;  4KOS A;  4XPK A;  4FD5 A;  2Q4Y A;  4R3K A;  3P2H A;  1YLE A;  2G3T A;  3FIX A;  2GE3 A;  4PSW A;  1IID A;  1B87 A;  3V8I A;  5J8C A;  4NF1 A;  4J3G A;  4ZBG A;  1MJA A;  4YRH A;  4NCZ A;  2G3A A;  3R1K A;  4M85 A;  1U6M A;  2P6F A;  4UWI A;  3I9S A;  2QIR A;  5F48 A;  1YVK A;  4L89 A;  4LUA A;  4JWP A;  3TO7 A;  3W6X A;  4DNC A;  4NXY A;  5F46 A;  2J8M A;  1Y9K A;  2PR8 A;  2RC4 A;  4AVA A;  2Z10 A;  1BO4 A;  3S6K A;  1GHE A;  2O28 A;  4AVB A;  4KOR A;  1IYK A;  2ZW6 A;  1NE9 A;  3BJ7 A;  1QSN A;  3D2M A;  5C82 A;  4KOY A;  4NEX A;  2ZW5 A;  2VZZ A;  3S6G A;  1YX0 A;  2JLM A;  1S7L A;  2P0W A;  2ARH A;  3FYN A;  1RXT A;  4U9Y A;  3PGP A;  4XNH C;  3SXO A;  4MY0 A;  2CNT A;  4JD6 A;  5F49 A;  3PP9 A;  2FT0 A;  3D2P A;  4HNX B;  3SHP A;  2PRB A;  1V0C A;  4UWJ A;  3IWG A;  4UBR A;  2PR1 A;  1Q2D A;  3EY5 A;  5JPH A;  4B5P A;  4MBU A;  1YRE A;  4IUS A;  1XIX A;  4XPD B;  4QB9 A;  2OZG A;  3NE7 A;  5JQ4 A;  2QML A;  2REF A;  3GKR A;  3E0K A;  4GS4 A;  4U9Z A;  1M1D A;  2PC1 A;  4U5Y A;  1P4N A;  3S6H A;  3LOD A;  3W91 A;  4H89 A;  2OB0 A;  2D4O A;  2REE A;  3G3S A;  4IF5 A;  2R98 A;  1I1D A;  3R9E A;  3RYO A;  4EVY A;  4F6A A;  2FL4 A;  4AB7 A;  1LRZ A;  2AE6 A;  2GIV A;  3IGR A;  4FD6 A;  1R57 A;  1KUX A;  1PU9 A;  4PSX A;  4F0Y A;  5DWN A;  3TO9 A;  4HNY B;  3R9F A;  3BLN A;  3S6F A;  5KTC A;  3DNS A;  4KOV A;  2VZY A;  5KTD A;  1S7N A;  1Y9W A;  5DWM A;  2HQY A;  3EFA A;  4KUB A;  3R95 A;  4RS2 A;  2CNS A;  1CJW A;  1VHS A;  3PZJ A;  1Z4E A;  3R96 A;  1IIC A;  4MY3 A;  4JXQ A;  3TE4 A;  1I21 A;  3QB8 A;  4QC6 A;  4AVC A;  2VQY A;  2DXQ A;  3TT2 A;  4K30 A;  4KVX A;  2B4D A;  5H84 A;  4R9M A;  1IYL A;  3TOA A;  4FD4 A;  4XNH B;  1S7F A;  4QBJ A;  2BL1 A;  2Q7B A;  1KUV A;  4MHD A;  2B5G B;  1NMT A;  2EVN A;  2CNM A;  3VWD A;  1Y7R A;  5FVJ A;  4KLV A;  2AJ6 A;  2Q0Y A;  2P6E A;  2B4B A;  5KTA A;  2PSW A;  2FE7 A;  1XMT A;  1S5K A;  3EXN A;  2EUI A;  4KOT A;  4QUS A;  3T90 A;  2Y0M A;  3ZZI A;  4ONU A;  2A4N A;  3D3S A;  4OAD A;  4R87 A;  4X5K A;  1SQH A;  1M44 A;  2JDC A;  3BJ8 A;  3VWE A;  1UFH A;  2R1I A;  4R57 A;  5C88 A;  1YGH A;  1I12 A;  2BUE A;  3N7Z A;  2ZW4 A;  1M4G A;  3DDD A;  2Z0Z A;  4PK3 A;  4OLL A;  2WPW A;  1XE4 A;  1L0C A;  1IB1 E;  4KOU A;  3F8K A;  1KUY A;  4R3L A;  1BOB A;  2FIA A;  5F47 A;  5ISV A;  3FB3 A;  3K9U A;  5HH1 A;  4JXR A;  1MK4 A;  3FXT A;  1YK3 A;  2K5T A;  3ZJ0 A;  4FD7 A;  2OZU A;  4QVT A;  4UA3 A;  3G8W A;  4HKF A;  2FXF A;  4M3S A;  4CAX A;  3EC4 A;  4KOX A;  4L8A A;  4JLY A; 
#chains in the Genus database with same CATH topology
 4GXH A;  2FS5 A;  2ZEN A;  2F5I A;  4Y49 C;  1RO5 A;  2I00 A;  2IQ6 A;  4I49 A;  6CPA A;  3W6S A;  2AFM A;  1QSM A;  1WWZ A;  4KVO E;  2RFH A;  1YVO A;  3QAH A;  4R7M A;  2X7B A;  2AFU A;  1IU8 A;  2ZED A;  4ZI6 A;  2J8R A;  3DR8 A;  2B3U A;  1M4I A;  2YGW A;  4ZX9 A;  3TOB A;  5IX3 A;  3FNC A;  5IB9 A;  4UEF A;  2PJ0 A;  3F5B A;  5LYI A;  4MRI A;  2J9A A;  2WZN A;  4NJQ A;  4AG7 A;  2G0B A;  3PB4 X;  3HLP A;  5J8F A;  5EBV A;  4MJ8 A;  2C1C A;  3WR7 A;  3CZX A;  2H5M A;  5G20 A;  3JVN A;  2CF4 A;  5ELY A;  4HNW B;  5G21 A;  2OZH A;  3F0A A;  2IL4 A;  1S3Z A;  2POK A;  1F57 A;  1CX8 A;  2PQ8 A;  4AG9 A;  3H4Q A;  3VAR A;  2NSM A;  1HEE A;  4MCQ A;  4OKO A;  4P10 A;  2DF5 A;  1S7K A;  2GAN A;  4ZGY B;  4LX9 A;  3GYA A;  2ZXV A;  4KLW A;  1AMP A;  3NH5 A;  4A31 A;  1VKC A;  2WPX A;  1PCA A;  1P0H A;  2CY2 A;  4E8O A;  2DEA A;  3I3G A;  5BWA B;  2B58 A;  4II9 A;  2NMT A;  4R6T A;  3SJE A;  4RUH A;  5K8O A;  3B8G A;  3TCV A;  4A37 A;  4CAV A;  3TFY A;  3IEH A;  3WAB A;  4P4I A;  4B5P B;  1NSA A;  3LD2 A;  2Q04 A;  4ZX8 A;  1IOI A;  4MMO A;  3PB6 X;  3B35 A;  4UCN A;  1J4J A;  2JEV A;  1LAM A;  3KHX A;  1VIX A;  2B3V A;  3B2Y A;  5E96 A;  4M6G A;  4H6Z A;  2Z11 A;  3D7G A;  3CXS A;  4F0X A;  4KZT A;  4YGO A;  4NGM A;  4A2Z A;  3D4U A;  4OC0 A;  2KCW A;  1FY7 A;  1BLL E;  4P4F A;  1OZP A;  4NGS A;  5H86 A;  4NSQ A;  2PCU A;  3T8W A;  2CXA A;  3FEE A;  2FCK A;  2PIZ A;  2PJ8 A;  3GB0 A;  3GY9 A;  4P6Y A;  3RO0 A;  1KWM A;  1QSR A;  1XJO A;  3B3T A;  3UY5 A;  3S9L A;  4H6U A;  1CP7 A;  4IAV A;  3R9G A;  2F7V A;  1JWQ A;  4MI4 A;  4PV6 A;  3FVL A;  3PFO A;  2QYV A;  4CS0 B;  4XPL A;  5DS0 A;  3PRT A;  2PJ6 A;  2VBQ A;  2OH1 A;  2GU2 A;  3EO4 A;  2R7H A;  1Z9U A;  5AG4 A;  1IY7 A;  4E0A A;  2Z3M A;  5IV0 A;  1ARM A;  2PJ3 A;  4MFP A;  2ZEH A;  3CXP A;  2VXK A;  1XF8 A;  2GFQ A;  4NGN A;  4UIA A;  3D8P A;  2XEG A;  4CAE A;  4BMH A;  2GLJ A;  3SJF A;  2HV2 A;  2YNC C;  4ORF A;  3TC8 A;  4RI1 A;  2FIW A;  1Q2Y A;  1Y0R A;  1Z4R A;  2Q44 A;  1TF9 A;  4KOW A;  5THW A;  1ZG8 A;  5HVF A;  8CPA A;  4JJX A;  5A28 A;  4E2A A;  2ZW7 A;  1QSO A;  4YU9 A;  3VH9 A;  1Z8W A;  2HUZ A;  2D4P A;  1NSL A;  5EMI A;  4A33 A;  4OAE A;  2ATR A;  3CPA A;  2IJZ A;  2DPT A;  4PXE A;  3FF3 A;  4PK2 A;  3B3C A;  4YFJ A;  3KKW A;  5LYF A;  1N71 A;  1PYT B;  2VEZ A;  1XEB A;  5IB0 A;  1XMB A;  3DSB A;  3MGD A;  1QST A;  3OWC A;  2PDO A;  1VGY A;  4C2Z A;  1MJ9 A;  3IU1 A;  2EK8 A;  1S60 A;  2BOA A;  2YND A;  3MN8 A;  4M6H A;  5CNP A;  2JDD A;  1TKH A;  1Z2L A;  2B5G A;  1CM0 A;  3LWU A;  3P2F A;  2QEC A;  1B6B A;  2PIY A;  2AFO A;  3B3S A;  4KSI A;  4CAW A;  1TKF A;  2BEI A;  2ZPA A;  3SI1 A;  2GLF A;  1VHO A;  4XPD C;  1ELL P;  3FEC A;  3TO6 A;  2XEI A;  3CXQ A;  3QAY A;  2QJ8 A;  2ZEF A;  2VI7 A;  3T9Y A;  2CTB A;  2BSW A;  4Y49 B;  3KZW A;  2C27 A;  4KVM E;  4UEZ A;  5EC4 A;  5GCN A;  3FRM A;  2FSR A;  2PJB A;  2YNE A;  3JUW A;  3SXN A;  5A27 A;  1ON0 A;  2AFZ A;  2B4D B;  2WUU A;  3BHX A;  3FBU A;  2OU2 A;  2I79 A;  2C6G A;  4B5O A;  1TXR A;  3TTH A;  1PUA A;  3C26 A;  2AFS A;  4KS9 A;  3VAT A;  3IJ3 A;  1WK4 A;  3I1U A;  2HB6 A;  1DTD A;  3GUX A;  4UF4 A;  3H5Z A;  4NGP A;  5AGE A;  3DR6 A;  4UEE A;  2P6G A;  4CRZ B;  1M4D A;  1XRY A;  4KUA A;  1MJB A;  1K4J A;  1BPN A;  5D29 A;  2R8V A;  5LRG A;  5I0C A;  1YR0 A;  3KQX A;  3KI9 A;  4CRY B;  1TIQ A;  5JGF A;  3L2N A;  5HMN A;  4MHZ A;  3NA6 A;  2J8N A;  3IWW A;  2Q4V A;  3CPX A;  1KZF A;  3FED A;  4B14 A;  1Q2C A;  4BIN A;  4KOS A;  2PJ2 A;  4MHP A;  4PQA A;  4FD5 A;  4XPK A;  1OBR A;  2Q4Y A;  4R3K A;  4NGR A;  2Q4Z A;  3P2H A;  1YLE A;  2G3T A;  3PBE A;  2BO9 A;  3FIX A;  2GE3 A;  3FMC A;  2ZEM A;  4PSW A;  1IID A;  1B87 A;  3V8I A;  4OC4 A;  3D7H A;  3A9L A;  4NF1 A;  5J8C A;  1ZG9 A;  1LFW A;  3BXM A;  1MJA A;  4J3G A;  4ZBG A;  1ARL A;  5HVG A;  1Z8L A;  4NCZ A;  2G3A A;  3HUV A;  3R1K A;  4YRH A;  1XBU A;  4M85 A;  1U6M A;  3NFZ A;  2P6F A;  3KR5 A;  4EWT A;  4Z65 A;  4UWI A;  4W9Y A;  4ONW A;  3K9T A;  3I9S A;  2QIR A;  5F48 A;  1FT7 A;  1YVK A;  3NH8 A;  4L89 A;  4NGT A;  4OC2 A;  4UIB A;  4MFZ A;  3S9N A;  4K3N A;  4LUA A;  4JWP A;  4LQG A;  1BPM A;  2O4H A;  4UFW A;  3TO7 A;  3W6X A;  4RN7 A;  4DNC A;  4NXY A;  5F46 A;  2J8M A;  1Y9K A;  2ABZ A;  1HDQ A;  1Y7E A;  3K2K A;  3KHZ A;  2PR8 A;  2RC4 A;  2CTC A;  3KL9 A;  2ZEP A;  4OC1 A;  4Q7A A;  4AVA A;  3D66 A;  4C7I A;  3PFE A;  2Z10 A;  4CGN A;  5HVH A;  1BO4 A;  3MRU A;  4GM5 A;  1ZLH A;  3S6K A;  3TX8 A;  1AUG A;  4WWV A;  2ZEO A;  2Z3L A;  4JZ0 A;  1GHE A;  2O28 A;  4AVB A;  4KOR A;  1IYK A;  2ZW6 A;  1YW6 A;  5G22 A;  4P44 A;  5LRJ A;  1NE9 A;  3BJ7 A;  2C6C A;  1QSN A;  3IIB A;  3D2M A;  1ELM P;  4Q38 A;  4CGM A;  5CBM A;  5C82 A;  4KOY A;  4IK2 A;  1YLO A;  4NEX A;  3IFE A;  2ZW5 A;  2VZZ A;  4OME A;  5AG5 A;  2PJ4 A;  3S6G A;  2EWB A;  4B10 A;  1YX0 A;  3RZA A;  2JLM A;  1S7L A;  3IO1 A;  2P0W A;  2PJC A;  1LCP A;  2ARH A;  4TWE A;  4CYO A;  3FYN A;  2FVG A;  1XFO A;  1RXT A;  4U9Y A;  3PGP A;  2F8H A;  4XNH C;  4F9V A;  4CYP A;  3NH4 A;  2G9D A;  3V38 A;  3SXO A;  3KAS A;  1DE4 C;  4MY0 A;  2CNT A;  2V8H A;  2ZOG A;  4JD6 A;  5F49 A;  3SI0 A;  3B3V A;  3PP9 A;  2FT0 A;  3D2P A;  4M6I A;  4HNX B;  3IU2 A;  3SHP A;  5LRK A;  2PRB A;  1V0C A;  1CPS A;  4UWJ A;  3IWG A;  3RBU A;  3WC6 A;  2O53 A;  3KR4 A;  3PB9 X;  4UBR A;  5HXD A;  2PR1 A;  3FX6 A;  1GYT A;  1Q2D A;  3PB7 X;  4CYQ A;  3EY5 A;  1ZO0 A;  1R3N A;  3D7F A;  5JPH A;  3RAM A;  4B5P A;  4A38 A;  1QQ9 A;  3NE8 A;  4MBU A;  3V7Z A;  1YRE A;  3N5F A;  4IUS A;  4MCP A;  2AFX A;  1XIX A;  4XPD B;  4QB9 A;  4R76 A;  2OZG A;  4PXB A;  2WSA A;  5JH9 A;  1Z8X A;  4PXC A;  2CIJ A;  3NE7 A;  5JQ4 A;  5K8M A;  2WYR A;  2QML A;  2REF A;  4MHN A;  3PB8 X;  3GKR A;  3E0K A;  2V8G A;  4C7H A;  4GS4 A;  4OIW A;  4U9Z A;  4BD9 A;  3JTK A;  1M1D A;  2PC1 A;  4P4J A;  4U5Y A;  1P4N A;  3S6H A;  3LOD A;  3W91 A;  4H89 A;  4G1P A;  1RTQ A;  1X10 A;  2OB0 A;  2D4O A;  2REE A;  4A94 A;  4EME A;  2ANP A;  3FH4 A;  4B6Z A;  3H8F A;  2PVV A;  3G3S A;  4IF5 A;  4UFX A;  2R98 A;  1I1D A;  3R9E A;  3RYO A;  4EVY A;  4X2T A;  2I3C A;  4F6A A;  3CT9 A;  4CGL A;  2FL4 A;  1F2O A;  4AB7 A;  1F2P A;  5LYL A;  1A2Z A;  1LRZ A;  2AE6 A;  2EO8 A;  5F09 A;  2GIV A;  1JQG A;  3IGR A;  4FD6 A;  2EK9 A;  1R57 A;  4B12 A;  4DUK A;  1KUX A;  1VHE A;  4KSF A;  1PU9 A;  4MFK A;  2OOT A;  4KSA A;  4UCP A;  3B7I A;  4P4B A;  4PSX A;  4F0Y A;  5DWN A;  3JRU A;  3TO9 A;  2JBK A;  2ZEE A;  3PEI A;  4HNY B;  4JYW A;  5LYD A;  3R9F A;  2ZEG A;  3BLN A;  3S6F A;  5KTC A;  3DNS A;  4KOV A;  2VZY A;  4LQ6 A;  3WC5 A;  1LOK A;  2PRQ A;  4CGP A;  3WC7 A;  5KTD A;  2XEJ A;  1S7N A;  1Y9W A;  2HC9 A;  3H8E A;  4AXV A;  5DWM A;  2Q43 A;  4CAF A;  4MFJ A;  3GIU A;  4MFL A;  3DLJ A;  2HQY A;  1X12 A;  2BCO A;  3EFA A;  1BAV A;  4KUB A;  4OC5 A;  4WJB A;  4MXU A;  3R95 A;  4A30 A;  4CYN A;  1M4L A;  4NJR A;  3D68 A;  1R43 A;  3ISZ A;  4RS2 A;  2CNS A;  1CJW A;  2VL1 A;  4MFQ A;  5D8N A;  3SI2 A;  1CG2 A;  1VHS A;  3LMS A;  2V8D A;  5AG7 A;  3SJX A;  2PJA A;  3PZJ A;  5J1Q A;  1Z4E A;  4ZYQ A;  3H8G A;  3R96 A;  1IIC A;  4MY3 A;  1Q7L A;  2DPS A;  2Z3O A;  2V77 A;  4NFR A;  4JXQ A;  3TE4 A;  1I21 A;  3QB8 A;  4QC6 A;  4AVC A;  2VQY A;  4FAI A;  2DXQ A;  4MCR A;  3TT2 A;  4K30 A;  1AYE A;  2RB7 A;  4KVX A;  2PJ9 A;  2B4D A;  2PJ5 A;  2Z3K A;  5H84 A;  4FUU A;  4ZY0 A;  2PE3 A;  2JBJ A;  2C6P A;  4H2K A;  4R9M A;  1YW4 A;  4X3R A;  4A39 A;  3CDX A;  1EE3 P;  1LAP A;  1IYL A;  1IGB A;  2PJ1 A;  3FJU A;  3TOA A;  4FD4 A;  3WT4 A;  1IOF A;  4OP4 A;  4XNH B;  1S7F A;  4R8F A;  4CGO A;  4QBJ A;  2BL1 A;  4HPS A;  1ZLI A;  2Q7B A;  1KUV A;  4MHD A;  2B5G B;  1NMT A;  2EVN A;  4YWY A;  2CNM A;  3VWD A;  1Y7R A;  4UCM A;  5FVJ A;  4KLV A;  2AJ6 A;  2Q0Y A;  3IC1 A;  5AG6 A;  2EBJ A;  1QMU A;  4TNU A;  3D7D A;  3KGQ A;  3KQZ A;  2P6E A;  2B4B A;  5KTA A;  2PSW A;  4DJL A;  4F8Z A;  1HDU A;  4ZY2 A;  5JM6 A;  2FE7 A;  3ISX A;  1XMT A;  1S5K A;  2ZEL A;  2ODF A;  5K8P A;  3EXN A;  2EUI A;  4KOT A;  4QUS A;  3T90 A;  2Y0M A;  3ZZI A;  4ONU A;  4CPA A;  2V8V A;  1XOV A;  4C68 A;  3DGV A;  4A32 A;  1H8L A;  2A4N A;  3D3S A;  4OAD A;  4R87 A;  1SQH A;  4X5K A;  3PBB A;  4IHM A;  4X8I A;  4EFD A;  1M44 A;  2JDC A;  3BJ8 A;  3BI0 A;  3VWE A;  1UFH A;  4ZY1 A;  7CPA A;  4FWU A;  1TF8 A;  2Q7S A;  2Q51 A;  2R1I A;  4R57 A;  5C88 A;  1YGH A;  1I12 A;  2BUE A;  4P45 A;  5K8N A;  4UFV A;  3N7Z A;  2ZW4 A;  1YQE A;  1M4G A;  4B11 A;  4MCS A;  3LAC A;  3DDD A;  4NGQ A;  3RNZ A;  4F9U A;  2Z0Z A;  4PK3 A;  5CPA A;  1UWY A;  3GLJ A;  4OLL A;  2WPW A;  1XE4 A;  1L0C A;  2XEF A;  1CPX A;  1IB1 E;  4PXD A;  4OC3 A;  4P4E A;  3D67 A;  4FBE A;  3BI1 A;  2PJ7 A;  4KOU A;  4OID A;  3F8K A;  1KUY A;  4R3L A;  1CP6 A;  4P4D A;  1BOB A;  1YME A;  2FIA A;  3B3W A;  2IMO A;  1Z5R A;  5F47 A;  5ISV A;  3FB3 A;  3K9U A;  4MHY A;  2JEW A;  4JXR A;  5HH1 A;  1MK4 A;  5I4M A;  4O23 A;  2OR4 A;  2ZOF A;  3QNV A;  4PPZ A;  1LAN A;  2GRE A;  3FXT A;  3SJG A;  1FNO A;  4A95 A;  2AFW A;  1TKJ A;  1YK3 A;  2K5T A;  2YNC A;  1CBX A;  3ZJ0 A;  4FD7 A;  1YSJ A;  4C2Y A;  2OZU A;  1ZG7 A;  2Z3P A;  2PVW A;  4BBH A;  4QVT A;  4C2X A;  5G1Z A;  3IWE A;  4UA3 A;  2NYQ A;  2QVP A;  4B13 A;  3G8W A;  4HKF A;  4Q36 A;  2FXF A;  2Z3N A;  4DYO A;  4M3S A;  1Y0Y A;  1Z8T A;  3S9M A;  4CAX A;  3EC4 A;  4KOX A;  4L8A A;  4JLY A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  4Y49 C;  2F5I A;  1RO5 A;  2I00 A;  4I49 A;  3W6S A;  1QSM A;  1WWZ A;  4KVO E;  1YVO A;  3QAH A;  2X7B A;  2J8R A;  3DR8 A;  2B3U A;  1M4I A;  2YGW A;  3TOB A;  5IX3 A;  3FNC A;  3F5B A;  4AG7 A;  2G0B A;  5J8F A;  5EBV A;  4MJ8 A;  3WR7 A;  2H5M A;  5G20 A;  3JVN A;  4HNW B;  5G21 A;  2OZH A;  3F0A A;  2IL4 A;  1S3Z A;  2PQ8 A;  4AG9 A;  3H4Q A;  4ZGY B;  1S7K A;  2GAN A;  4LX9 A;  3GYA A;  2ZXV A;  4KLW A;  4A31 A;  1VKC A;  2WPX A;  5BWA B;  1P0H A;  2CY2 A;  4E8O A;  3I3G A;  4II9 A;  2B58 A;  2NMT A;  3B8G A;  3TCV A;  4CAV A;  3TFY A;  4B5P B;  3LD2 A;  2Q04 A;  4UCN A;  1J4J A;  2JEV A;  2B3V A;  5E96 A;  4H6Z A;  2Z11 A;  3CXS A;  4F0X A;  4KZT A;  4YGO A;  4A2Z A;  2KCW A;  1FY7 A;  1OZP A;  5H86 A;  4NSQ A;  2CXA A;  2FCK A;  3GY9 A;  1QSR A;  3UY5 A;  4H6U A;  3R9G A;  4MI4 A;  4PV6 A;  4CS0 B;  4XPL A;  3EO4 A;  2VBQ A;  2OH1 A;  5IV0 A;  5AG4 A;  2R7H A;  1Z9U A;  4E0A A;  2Z3M A;  4MFP A;  3CXP A;  2VXK A;  1XF8 A;  3D8P A;  4CAE A;  4BMH A;  2HV2 A;  2YNC C;  4ORF A;  4RI1 A;  2FIW A;  1Q2Y A;  1Z4R A;  2Q44 A;  4KOW A;  4JJX A;  5A28 A;  4E2A A;  2ZW7 A;  1QSO A;  2HUZ A;  2D4P A;  1NSL A;  4A33 A;  4OAE A;  2ATR A;  2DPT A;  4PK2 A;  4YFJ A;  3KKW A;  1N71 A;  2VEZ A;  1XEB A;  5IB0 A;  3DSB A;  3MGD A;  1QST A;  3OWC A;  2PDO A;  4C2Z A;  1MJ9 A;  3IU1 A;  1S60 A;  2YND A;  5CNP A;  2JDD A;  2B5G A;  1CM0 A;  3P2F A;  2QEC A;  1B6B A;  4CAW A;  2BEI A;  2ZPA A;  4XPD C;  3TO6 A;  3CXQ A;  2VI7 A;  3T9Y A;  2BSW A;  4Y49 B;  2C27 A;  4KVM E;  5EC4 A;  5GCN A;  3FRM A;  2FSR A;  2YNE A;  3JUW A;  3SXN A;  5A27 A;  1ON0 A;  2WUU A;  2B4D B;  3FBU A;  2OU2 A;  2I79 A;  4B5O A;  3TTH A;  1PUA A;  3C26 A;  4KS9 A;  1WK4 A;  3H5Z A;  5AGE A;  3DR6 A;  4CRZ B;  2P6G A;  1M4D A;  4KUA A;  1MJB A;  1K4J A;  2R8V A;  5I0C A;  1YR0 A;  4CRY B;  1TIQ A;  5HMN A;  2J8N A;  2Q4V A;  1KZF A;  4B14 A;  1Q2C A;  4KOS A;  4XPK A;  4FD5 A;  2Q4Y A;  4R3K A;  3P2H A;  1YLE A;  2G3T A;  3FIX A;  2GE3 A;  4PSW A;  1IID A;  1B87 A;  3V8I A;  3A9L A;  4NF1 A;  5J8C A;  4J3G A;  4ZBG A;  1MJA A;  4YRH A;  4NCZ A;  2G3A A;  3R1K A;  4M85 A;  1U6M A;  2P6F A;  4UWI A;  3I9S A;  2QIR A;  5F48 A;  1YVK A;  4L89 A;  4MFZ A;  4LUA A;  4JWP A;  4UFW A;  3TO7 A;  3W6X A;  4DNC A;  4NXY A;  5F46 A;  2J8M A;  1Y9K A;  2PR8 A;  2RC4 A;  4CGN A;  4AVA A;  4C7I A;  2Z10 A;  1BO4 A;  3S6K A;  2Z3L A;  1GHE A;  2O28 A;  4AVB A;  4KOR A;  1IYK A;  2ZW6 A;  5G22 A;  1NE9 A;  3BJ7 A;  1QSN A;  3D2M A;  4Q38 A;  4CGM A;  5C82 A;  4KOY A;  4NEX A;  2ZW5 A;  2VZZ A;  5AG5 A;  3S6G A;  4B10 A;  1YX0 A;  2JLM A;  1S7L A;  2P0W A;  2ARH A;  4CYO A;  3FYN A;  1RXT A;  4U9Y A;  3PGP A;  4XNH C;  4CYP A;  3SXO A;  4MY0 A;  2CNT A;  4JD6 A;  5F49 A;  3PP9 A;  2FT0 A;  3D2P A;  4HNX B;  3IU2 A;  3SHP A;  2PRB A;  1V0C A;  4UWJ A;  3IWG A;  4UBR A;  2PR1 A;  1Q2D A;  4CYQ A;  3EY5 A;  1ZO0 A;  5JPH A;  4B5P A;  4MBU A;  1YRE A;  4IUS A;  1XIX A;  4XPD B;  4QB9 A;  2OZG A;  2WSA A;  3NE7 A;  5JQ4 A;  2QML A;  2REF A;  3GKR A;  3E0K A;  4C7H A;  4GS4 A;  4U9Z A;  3JTK A;  1M1D A;  2PC1 A;  4U5Y A;  1P4N A;  3S6H A;  3LOD A;  3W91 A;  4H89 A;  2OB0 A;  2D4O A;  2REE A;  3G3S A;  4IF5 A;  4UFX A;  2R98 A;  1I1D A;  3R9E A;  3RYO A;  4EVY A;  4F6A A;  4CGL A;  2FL4 A;  4AB7 A;  1LRZ A;  2AE6 A;  2GIV A;  3IGR A;  4FD6 A;  4B12 A;  1R57 A;  1KUX A;  4KSF A;  1PU9 A;  4MFK A;  4KSA A;  4UCP A;  4PSX A;  4F0Y A;  5DWN A;  3TO9 A;  4HNY B;  3R9F A;  3BLN A;  3S6F A;  5KTC A;  3DNS A;  4KOV A;  2VZY A;  4CGP A;  5KTD A;  1S7N A;  1Y9W A;  5DWM A;  4CAF A;  4MFJ A;  4MFL A;  2HQY A;  3EFA A;  4A30 A;  4CYN A;  4KUB A;  3R95 A;  4RS2 A;  2CNS A;  1CJW A;  4MFQ A;  1VHS A;  5AG7 A;  3PZJ A;  1Z4E A;  3R96 A;  1IIC A;  4MY3 A;  2DPS A;  2Z3O A;  4JXQ A;  3TE4 A;  1I21 A;  3QB8 A;  4QC6 A;  4AVC A;  2VQY A;  2DXQ A;  3TT2 A;  4K30 A;  4KVX A;  2B4D A;  2Z3K A;  5H84 A;  4R9M A;  1IYL A;  3TOA A;  4FD4 A;  4XNH B;  1S7F A;  4CGO A;  4QBJ A;  2BL1 A;  2Q7B A;  1KUV A;  4MHD A;  2B5G B;  1NMT A;  2EVN A;  2CNM A;  3VWD A;  1Y7R A;  4UCM A;  5FVJ A;  4KLV A;  2AJ6 A;  2Q0Y A;  5AG6 A;  2P6E A;  2B4B A;  5KTA A;  2PSW A;  2FE7 A;  1XMT A;  1S5K A;  3EXN A;  2EUI A;  4KOT A;  4QUS A;  3T90 A;  2Y0M A;  3ZZI A;  4ONU A;  4C68 A;  4A32 A;  2A4N A;  3D3S A;  4OAD A;  4R87 A;  4X5K A;  1SQH A;  1M44 A;  2JDC A;  3BJ8 A;  3VWE A;  1UFH A;  2R1I A;  4R57 A;  5C88 A;  1YGH A;  1I12 A;  2BUE A;  4UFV A;  3N7Z A;  2ZW4 A;  1M4G A;  4B11 A;  3DDD A;  2Z0Z A;  4PK3 A;  4OLL A;  2WPW A;  1XE4 A;  1L0C A;  1IB1 E;  4KOU A;  3F8K A;  1KUY A;  4R3L A;  1BOB A;  2FIA A;  5F47 A;  5ISV A;  3FB3 A;  3K9U A;  5HH1 A;  4JXR A;  1MK4 A;  3FXT A;  4A95 A;  2YNC A;  1YK3 A;  2K5T A;  3ZJ0 A;  4FD7 A;  4C2Y A;  2OZU A;  2Z3P A;  4BBH A;  4QVT A;  4C2X A;  5G1Z A;  3IWE A;  4UA3 A;  4B13 A;  3G8W A;  4HKF A;  4Q36 A;  2FXF A;  2Z3N A;  4M3S A;  4CAX A;  3EC4 A;  4KOX A;  4L8A A;  4JLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...