2REEA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
b'NYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase, lyase
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2reeA00
3I9SA 2WPWA 3TFYA 3F0AA 1M4DA 4JLYA 5DWMA 3IGRA 2B4DB 4MBUA 4HNWB 4KVXA 3SXNA 1QSNA 4KUAA 4ZBGA 1CM0A 5F49A 3FXTA 3R9FA 1YVKA 2C27A 3IWGA 4OADA 2Q4YA 4KOWA 4DNCA 2R8VA 3MGDA 1WK4A 4YFJA 2ZW4A 3R9GA 5GCNA 5JPHA 4U5YA 4H6UA 1Z4RA 4Y49B 2P6EA 2X7BA 3G3SA 2Q04A 1IB1E 4XPDB 3TOAA 4F6AA 2IL4A 5DWNA 1KUVA 4CS0B 3TCVA 2VBQA 2P6GA 3W6SA 3DDDA 1K4JA 1IIDA 1S5KA 2OB0A 4QB9A 2OZHA 2B4BA 4L89A 2OZUA 1ON0A 2GIVA 3GY9A 3EO4A 1P0HA 4KOXA 3T9YA 5ISVA 4E2AA 3R95A 1RXTA 5E96A 3VWEA 4II9A 1TIQA 4JD6A 4HKFA 1LRZA 4QUSA 2ZXVA 4XNHC 5J8CA 2WPXA 3TOBA 1CJWA 2OH1A 3VWDA 4NCZA 4PSXA 2K5TA 4FD4A 3WR7A 3CXPA 3NE7A 2FS5A 4CRYB 4F0YA 3S6GA 2GANA 4LUAA 4R57A 4KOSA 4CRZB 4ORFA 2VZZA 1WWZA 3BJ8A 4AVBA 2PR1A 2ZW7A 4B5PB 5KTAA 2QECA 2D4PA 4IF5A 2F5IA 4H6ZA 3KKWA 4CAVA 2ZPAA 5KTDA 1NE9A 1NMTA 2FIWA 1XIXA 1UFHA 1PU9A 1VKCA 1IICA 1S60A 2VXKA 4UBRA 1R57A 2B58A 1Q2YA 2JEVA 3B8GA 3N7ZA 3S6KA 2J8RA 1MJBA 1MK4A 2ZW6A 3E0KA 4U9ZA 3D8PA 2REEA 2B5GA 4KLWA 3H4QA 1MJ9A 1XE4A 4M3SA 2I79A 4JWPA 1BOBA 4PV6A 1M1DA 2P0WA 1M4IA 2FIAA 1BO4A 3G8WA 4Y49C 1Q2DA 2D4OA 3GKRA 4XPDC 4NF1A 4RI1A 4UWJA 3FRMA 4KZTA 1MJAA 2VQYA 4KORA 2Q7BA 1QSTA 1S7LA 1S3ZA 4QVTA 2G0BA 1VHSA 4NEXA 1GHEA 2FL4A 2B4DA 3R9EA 3LODA 4E0AA 2BEIA 5IX3A 4YRHA 3D2MA 2HQYA 4AVCA 5I0CA 2AE6A 1Z4EA 1P4NA 5C82A 2VZYA 2JDCA 1Z9UA 3LD2A 2EVNA 4EVYA 4QC6A 4PSWA 3EC4A 1L0CA 2QMLA 5CNPA 3GYAA 1M44A 4PK2A 2VEZA 4KLVA 1YGHA 3FBUA 3K9UA 4QBJA 4U9YA 4KOUA 3TO6A 2HV2A 3PP9A 4FD5A 3UY5A 3I3GA 4JXQA 2CNTA 3P2FA 1OZPA 3S6HA 1XEBA 4OLLA 4CAXA 1V0CA 2Q44A 1I1DA 1Y9WA 3PGPA 1S7FA 2ARHA 2P6FA 4AG9A 4AG7A 2QIRA 2Z0ZA 2B5GB 2FT0A 4RS2A 2G3TA 4FD7A 5J8FA 3T90A 2FXFA 2PSWA 2BSWA 4HNYB 4X5KA 4KOYA 1YK3A 1PUAA 4MY3A 3S6FA 3R1KA 3W6XA 5H86A 3EFAA 1S7KA 2J8MA 3OWCA 3JUWA 4HNXB 4UWIA 3D2PA 3V8IA 3ZJ0A 1YREA 3QB8A 1RO5A 3SXOA 1U6MA 2BL1A 3FIXA 2B3UA 2Q0YA 4R3LA 2KCWA 2J8NA 3DR8A 2PDOA 1KUXA 2FE7A 2OZGA 1Y7RA 3TO9A 4M85A 5KTCA 2FSRA 1I21A 4B5PA 2DXQA 5HH1A 3TTHA 5F48A 1J4JA 1M4GA 4KOVA 3R96A 4MY0A 4J3GA 2Z10A 2AJ6A 2PRBA 2B3VA 4I49A 5HMNA 4UA3A 4GS4A 5C88A 2EUIA 1S7NA 4YGOA 2FCKA 2Y0MA 5FVJA 4KVOE 2CNSA 3JVNA 2I00A 1KUYA 1YX0A 2Z11A 5F47A 2ZW5A 5EBVA 1B87A 3QAHA 3ZZIA 3D3SA 3TE4A 5H84A 4K30A 3TT2A 1NSLA 1I12A 2OU2A 3DNSA 2REFA 3PZJA 3BJ7A 3F5BA 4NXYA 4H89A 2PC1A 3DR6A 2BUEA 2R1IA 4E8OA 2A4NA 4OAEA 2VI7A 3FNCA 4KUBA 5IB0A 3TO7A 3CXQA 3C26A 3FB3A 1SQHA 2PQ8A 4KOTA 1XMTA 4MJ8A 1IYKA 1QSOA 1YR0A 4JXRA 4ONUA 1Q2CA 2GE3A 4FD6A 4CAWA 4XPLA 2PR8A 4KVME 3CXSA 5JQ4A 2NMTA 2CNMA 2G3AA 3BLNA 4IUSA 5F46A 1QSRA 2RC4A 2H5MA 4PK3A 4MHDA 3W91A 1KZFA 4AB7A 1IYLA 4JJXA 4XNHB 3EY5A 1B6BA 4R9MA 1YLEA 4XPKA 1YVOA 3F8KA 5EC4A 4LX9A 3DSBA 2CY2A 1QSMA 3RYOA 2JLMA 2Q4VA 4NSQA 4R87A 1FY7A 3SHPA 3FYNA 1Y9KA 2HUZA 1N71A 4L8AA 2ATRA 3P2HA 5IV0A 2JDDA 2R7HA 3EXNA 1XF8A 4BMHA 4MI4A 4B5OA 4R3KA 2R98A 4AVAA 2O28A
chains in the Genus database with same CATH superfamily
3LMSA 2C6GA 4CGNA 2XEGA 4P6YA 3I9SA 4BD9A 1Y0YA 2WPWA 3TFYA 4C7HA 4KS9A 4R8FA 4MFZA 3F0AA 4NGSA 4O23A 1M4DA 2PVVA 1ELMP 4JLYA 5DWMA 3BHXA 3IGRA 2B4DB 4MBUA 4B12A 1R43A 2FVGA 4HNWB 4KVXA 4MFPA 1BLLE 5D29A 1Y7EA 3KHZA 3SJXA 3SXNA 4F0XA 2BOAA 3RAMA 4ZY2A 4UFVA 4R6TA 1QSNA 4KUAA 4GXHA 4ZBGA 4YWYA 5HVFA 4B11A 4C2ZA 3PB7X 4OKOA 4CYQA 1CM0A 5F49A 4IK2A 3FXTA 2BO9A 4ZYQA 6CPAA 1LAPA 4PXCA 1YVKA 3R9FA 3DLJA 2C27A 1TKHA 3B3SA 3IWGA 4OADA 2Q4YA 4KOWA 3B7IA 4X8IA 4DNCA 2R8VA 3IJ3A 3MGDA 1CP6A 2WUUA 1IOIA 3BI1A 4OC2A 1WK4A 4YFJA 2ZW4A 3R9GA 5JM6A 1KWMA 5GCNA 2PJBA 4UFXA 5JPHA 3NH4A 4U5YA 4H6UA 1Z4RA 4Y49B 3S9LA 2P6EA 2X7BA 3G3SA 2Q04A 1IB1E 4KSAA 4XPDB 3TOAA 3TC8A 2IL4A 2PCUA 2WZNA 1KUVA 5DWNA 4CS0B 4F6AA 3TCVA 4CGLA 2VBQA 1R3NA 5K8OA 2P6GA 2Q4ZA 3FEDA 3W6SA 3DDDA 1K4JA 1IIDA 1M4LA 1S5KA 2OB0A 3PB9X 2OZHA 3B3TA 3PFEA 4QB9A 4UCNA 3V7ZA 2B4BA 4C68A 4Z65A 4BBHA 1CPSA 4L89A 4OC5A 4UIBA 2OZUA 1ON0A 5IB9A 2GIVA 2C6PA 1YW6A 1H8LA 3GY9A 3EO4A 1ZLIA 4TNUA 1P0HA 3SI0A 2PIZA 4KOXA 3T9YA 5ISVA 4E2AA 3R95A 5AGEA 1RXTA 2PJ6A 5E96A 1VIXA 2C1CA 2ZEPA 3IEHA 3PB6X 4DYOA 5CBMA 5K8MA 2JEWA 3VWEA 3RBUA 4II9A 1F2PA 5LRJA 1TIQA 1HEEA 8CPAA 4JD6A 3SI1A 3SJEA 2PVWA 1VHOA 2AFZA 3KASA 4HKFA 1LRZA 2V8DA 2BCOA 4QUSA 1YSJA 2ZXVA 4XNHC 5THWA 4B14A 3PEIA 4EMEA 3ISXA 5J8CA 2WPXA 3TOBA 4H2KA 2AFUA 1CJWA 4MCPA 4CGOA 2OH1A 3IWEA 4ZY1A 3VWDA 5LRKA 4P45A 2PE3A 2GREA 2RB7A 1TF9A 1AUGA 4NCZA 4PSXA 2K5TA 2CTBA 4FD4A 3S9MA 5LYDA 3CXPA 2I3CA 3NE7A 3WR7A 4NGNA 4C2XA 4P4JA 1Z8LA 4YU9A 2FS5A 4MRIA 4CRYB 3L2NA 3IWWA 4F0YA 3S6GA 4A94A 3B2YA 2GANA 4LUAA 4UCPA 3RNZA 5A27A 4NGQA 4MMOA 4IHMA 1CP7A 1F57A 4MXUA 1YW4A 4R57A 3MRUA 4KOSA 3B35A 4CRZB 4ORFA 2VZZA 4CPAA 1WWZA 4CYNA 2OR4A 3BJ8A 1XJOA 4AVBA 4NFRA 2PR1A 2ZW7A 4B5PB 4P4EA 5KTAA 2AFMA 2QECA 2D4PA 1YMEA 3WC7A 4IF5A 2F5IA 2GLJA 3FJUA 4PXBA 2IJZA 3PB4X 4H6ZA 2JBJA 3KKWA 4CAVA 2PIYA 2ZPAA 5KTDA 4Q38A 1TF8A 4P4DA 4A2ZA 1NE9A 1NMTA 2FIWA 1XIXA 4GM5A 1UFHA 4ZGYB 1PU9A 3K2KA 4UCMA 2VL1A 1Z8WA 1VKCA 3GLJA 2OOTA 1IICA 1S60A 2VXKA 2PJ5A 3B3VA 4UBRA 1R57A 2B58A 1X12A 2GLFA 2ZOGA 1Q2YA 1BPMA 1ZG8A 2ANPA 2G9DA 2JEVA 3B8GA 1DE4C 2CF4A 3JRUA 2PJ8A 4CYPA 3N7ZA 3S6KA 2J8RA 1MJBA 1MK4A 4M6HA 2ZW6A 3E0KA 4U9ZA 1F2OA 3D8PA 2REEA 2B5GA 4OC1A 4UIAA 4KLWA 4C7IA 3H4QA 4NGPA 1MJ9A 4MHNA 4P4BA 1CBXA 1XE4A 2ODFA 4M3SA 4B13A 3NA6A 3PB8X 2QVPA 2I79A 4JWPA 1BOBA 4PV6A 3KGQA 1M1DA 3KZWA 2P0WA 1M4IA 1TXRA 2FIAA 1BO4A 3G8WA 7CPAA 3B3WA 3I1UA 2YNCC 4Y49C 2F8HA 1Q2DA 4B10A 2D4OA 1JQGA 3GKRA 3DGVA 4XPDC 2O4HA 4NF1A 4CYOA 4RI1A 2F7VA 2Z3OA 4UWJA 3FRMA 3H8FA 3KHXA 4KZTA 4UF4A 2YNEA 1MJAA 4G1PA 1CPXA 2VQYA 3K9TA 1X10A 4KORA 2ABZA 2WSAA 2Q7BA 3RO0A 1IY7A 1UWYA 3NH5A 4IAVA 1QSTA 3D66A 3NE8A 3T8WA 1S7LA 1S3ZA 4FUUA 2PJ9A 2CXAA 2ZEDA 1GYTA 4QVTA 2G0BA 1VHSA 4NEXA 1GHEA 2FL4A 5F09A 2B4DA 2YNDA 3R9EA 1XMBA 3LODA 4MFLA 4OP4A 4E0AA 2IMOA 2BEIA 2EK9A 4NJQA 5IX3A 4YRHA 3D2MA 3PBEA 1CG2A 4TWEA 1ZLHA 2HQYA 4AVCA 3CPAA 3IC1A 5I0CA 2AE6A 3KI9A 5G22A 1Z4EA 1P4NA 4X3RA 5C82A 2VZYA 2JDCA 1Z9UA 3LD2A 4A33A 5CPAA 1ARLA 2EVNA 4EVYA 4QC6A 3HLPA 3FMCA 4PSWA 2Z3PA 3EC4A 1L0CA 4JYWA 2QMLA 2V8GA 5CNPA 4AXVA 3GYAA 4R76A 1M44A 2XEIA 4PK2A 4MCSA 5EMIA 2VEZA 4OIDA 4KLVA 1YGHA 1NSAA 2WYRA 3GIUA 5I4MA 1TKFA 3FEEA 1PYTB 3FBUA 3FX6A 3K9UA 1A2ZA 4U9YA 2XEFA 4QBJA 4ZX8A 3VATA 2YNCA 4M6IA 3D67A 3NFZA 4KOUA 3TO6A 2PJ2A 4MCRA 2HV2A 1OBRA 1QMUA 3PP9A 3QNVA 5AG6A 4FD5A 3UY5A 2Z3MA 2EWBA 4FWUA 3I3GA 4JXQA 4A31A 2CNTA 2EBJA 3P2FA 4LQGA 4Q7AA 1OZPA 2GU2A 1XEBA 4RN7A 1Z2LA 3KR4A 3S6HA 4WJBA 3VARA 4RUHA 4KSFA 4OLLA 4F8ZA 5K8PA 3RZAA 4CAXA 2ZEHA 3PFOA 1V0CA 3MN8A 1VGYA 4NJRA 5LYFA 2Q44A 1I1DA 1Y9WA 3PGPA 1S7FA 2ARHA 2P6FA 2XEJA 4AG9A 3ZJ0A 4A30A 4AG7A 2QIRA 2Z0ZA 3WC6A 1FNOA 3HUVA 2IQ6A 5LRGA 2B5GB 5BWAB 2FT0A 4RS2A 2G3TA 4FD7A 5J8FA 3FH4A 2FXFA 2PSWA 1XBUA 2BSWA 5G1ZA 4HNYB 4X5KA 3T90A 4KOYA 2ZELA 4NGTA 1YK3A 1PUAA 2DF5A 1Y0RA 2Z3NA 3WT4A 4MY3A 3S6FA 3R1KA 4NGMA 1XOVA 2PJ3A 3PRTA 4PPZA 3W6XA 2PJ4A 4ZI6A 3D7FA 5H86A 1JWQA 3WC5A 5HXDA 3EFAA 4MHPA 1S7KA 4WWVA 2J8MA 1YQEA 3H5ZA 3B3CA 3OWCA 1DTDA 1Z8TA 3JUWA 4HNXB 3D2PA 2V8HA 4P10A 1YREA 2HB6A 4P44A 4UWIA 3V8IA 3QB8A 3WABA 1RO5A 3SXOA 3VH9A 5HVGA 4F9UA 1LCPA 1U6MA 2BL1A 3FIXA 4F9VA 2B3UA 2Q0YA 4OIWA 1ZO0A 4R3LA 3QAYA 2KCWA 4PXDA 2Q43A 1XRYA 4A32A 4OC0A 2ZEOA 3D4UA 5AG4A 2J8NA 3DR8A 2Z3LA 5A28A 2PDOA 1KUXA 4P4IA 2FE7A 5K8NA 2OZGA 2PRQA 4BINA 2PJ1A 2PJ7A 1HDQA 1Y7RA 3TO9A 2ZEMA 4M85A 4X2TA 5KTCA 4MFJA 1AMPA 2QYVA 2CIJA 2FSRA 4DJLA 1I21A 2POKA 3KL9A 4B5PA 1ARMA 2DXQA 4CAEA 5HH1A 1LOKA 3TTHA 1Z8XA 5F48A 4CGMA 1J4JA 1M4GA 2V8VA 4HPSA 5G20A 1AYEA 4KOVA 2HC9A 2C6CA 3R96A 4ONWA 4MY0A 4J3GA 3TX8A 2Z10A 2AJ6A 1ELLP 3IU1A 3JTKA 2PRBA 3PBBA 2B3VA 4UEZA 3GB0A 4I49A 5HMNA 2Z3KA 4UEEA 2AFWA 4GS4A 4UA3A 5C88A 2EUIA 2GFQA 4P4FA 3SJFA 3IO1A 3KQZA 1S7NA 2NYQA 2RFHA 4YGOA 2FCKA 2Y0MA 2EK8A 5FVJA 4K3NA 2ZEEA 2CNSA 4KVOE 1QQ9A 4OMEA 3D7DA 3H8EA 3JVNA 4MCQA 4B6ZA 2I00A 1KUYA 1YX0A 2Z11A 3IIBA 5F47A 2ZW5A 3ISZA 5D8NA 4EFDA 2EO8A 4EWTA 3H8GA 3IU2A 2AFXA 4A39A 4C2YA 1XFOA 5EBVA 1B87A 3QAHA 3ZZIA 3D3SA 2J9AA 4UEFA 3TE4A 1BPNA 5H84A 3LACA 3D7HA 4K30A 4MHZA 4Q36A 3TT2A 1NSLA 1VHEA 4ZY0A 1I12A 4PXEA 5HVHA 2AFSA 2OU2A 3KR5A 3DNSA 1ZG9A 2REFA 3PZJA 4CGPA 3BJ7A 3CZXA 3GUXA 2JBKA 4LQ6A 3D68A 3F5BA 1FT7A 4NXYA 4H89A 2PC1A 3DR6A 2BUEA 2R1IA 4E8OA 1IU8A 2A4NA 2Q7SA 5DS0A 4OAEA 2VI7A 3FNCA 4KUBA 5IB0A 4JZ0A 3TO7A 2PJAA 5LYIA 3CXQA 3C26A 3FB3A 1SQHA 2PQ8A 4KOTA 3BXMA 1XMTA 4MJ8A 4MHYA 1IYKA 1PCAA 1QSOA 1YR0A 1ZG7A 2ZEFA 2QJ8A 2ZOFA 4JXRA 5ELYA 4ONUA 4OC3A 1Q2CA 3CDXA 2GE3A 1RTQA 3KQXA 3BI0A 4FD6A 4CAWA 4XPLA 2PJ0A 2PR8A 3CT9A 3FF3A 5AG5A 4KVME 1Q7LA 3CXSA 2NMTA 2CNMA 2G3AA 3BLNA 4IUSA 5F46A 5JQ4A 1CX8A 2AFOA 4UFWA 1QSRA 2DPSA 2RC4A 2H5MA 4PK3A 3SI2A 1LAMA 4MHDA 4MFKA 4CAFA 4DUKA 3W91A 5JH9A 1KZFA 4AB7A 1IYLA 4JJXA 1EE3P 4XNHB 3EY5A 1B6BA 5J1QA 4R7MA 2PJCA 3N5FA 4OC4A 4R9MA 4A37A 2DEAA 1YLEA 4XPKA 4ZX9A 3V38A 1YVOA 2DPTA 3F8KA 3SJGA 5EC4A 4LX9A 3DSBA 3S9NA 2CTCA 2Q51A 2CY2A 1QSMA 3RYOA 5LYLA 3D7GA 4PQAA 4W9YA 2O53A 5AG7A 2JLMA 2Q4VA 4MFQA 4NSQA 4R87A 4NGRA 1FY7A 1IGBA 3SHPA 4M6GA 3FYNA 1Y9KA 2HUZA 1N71A 4L8AA 4A38A 2YGWA 2ATRA 3P2HA 2ZEGA 2NSMA 2ZENA 3FECA 5IV0A 2JDDA 3FVLA 2R7HA 3EXNA 1XF8A 3IFEA 4BMHA 4MI4A 4FBEA 3A9LA 4B5OA 5G21A 1BAVA 1Z5RA 1IOFA 1TKJA 1LANA 2R98A 2V77A 4R3KA 4A95A 4AVAA 3CPXA 1YLOA 3LWUA 1HDUA 4FAIA 5JGFA 1LFWA 4KSIA 2O28A 3NH8A
chains in the Genus database with same CATH topology
4CGNA 3I9SA 2WPWA 3TFYA 4C7HA 4KS9A 4MFZA 3F0AA 1M4DA 4JLYA 5DWMA 3IGRA 2B4DB 4MBUA 4B12A 4HNWB 4KVXA 4MFPA 3SXNA 4F0XA 4UFVA 1QSNA 4KUAA 4B11A 4ZBGA 4C2ZA 4CYQA 1CM0A 5F49A 3FXTA 3R9FA 1YVKA 2C27A 3IWGA 4OADA 2Q4YA 4KOWA 4DNCA 2R8VA 3MGDA 2WUUA 1WK4A 4YFJA 2ZW4A 3R9GA 5GCNA 4UFXA 5JPHA 4U5YA 4H6UA 1Z4RA 4Y49B 2P6EA 2X7BA 3G3SA 2Q04A 1IB1E 4KSAA 4XPDB 3TOAA 4F6AA 2IL4A 5DWNA 1KUVA 4CS0B 3TCVA 4CGLA 2VBQA 2P6GA 3W6SA 3DDDA 1K4JA 1IIDA 1S5KA 2OB0A 4QB9A 4UCNA 2OZHA 2B4BA 4C68A 4BBHA 4L89A 2OZUA 1ON0A 2GIVA 3GY9A 3EO4A 1P0HA 4KOXA 3T9YA 5ISVA 4E2AA 3R95A 5AGEA 1RXTA 5E96A 3VWEA 4II9A 1TIQA 4JD6A 4HKFA 1LRZA 4QUSA 2ZXVA 4XNHC 4B14A 5J8CA 2WPXA 3TOBA 1CJWA 4CGOA 2OH1A 3IWEA 3VWDA 4NCZA 4PSXA 2K5TA 4FD4A 3WR7A 3CXPA 3NE7A 4C2XA 2FS5A 4CRYB 4F0YA 3S6GA 2GANA 4LUAA 4UCPA 5A27A 4R57A 4KOSA 4CRZB 4ORFA 2VZZA 4CYNA 1WWZA 3BJ8A 4AVBA 2PR1A 2ZW7A 4B5PB 5KTAA 2QECA 2D4PA 4IF5A 2F5IA 4H6ZA 3KKWA 4CAVA 2ZPAA 5KTDA 4Q38A 4A2ZA 1NE9A 1NMTA 2FIWA 1XIXA 1UFHA 4ZGYB 1PU9A 4UCMA 1VKCA 1IICA 1S60A 2VXKA 4UBRA 1R57A 2B58A 1Q2YA 2JEVA 3B8GA 4CYPA 3N7ZA 3S6KA 2J8RA 1MJBA 1MK4A 2ZW6A 3E0KA 4U9ZA 3D8PA 2REEA 2B5GA 4C7IA 4KLWA 3H4QA 1MJ9A 1XE4A 4M3SA 4B13A 2I79A 4JWPA 1BOBA 4PV6A 1M1DA 2P0WA 1M4IA 2FIAA 1BO4A 3G8WA 2YNCC 4Y49C 1Q2DA 4B10A 2D4OA 3GKRA 4XPDC 4NF1A 4CYOA 4RI1A 2Z3OA 4UWJA 3FRMA 4KZTA 2YNEA 1MJAA 2VQYA 4KORA 2WSAA 2Q7BA 1QSTA 1S7LA 1S3ZA 2CXAA 4QVTA 2G0BA 1VHSA 4NEXA 1GHEA 2FL4A 2B4DA 2YNDA 3R9EA 3LODA 4MFLA 4E0AA 2BEIA 5IX3A 4YRHA 3D2MA 2HQYA 4AVCA 5I0CA 2AE6A 5G22A 1Z4EA 1P4NA 5C82A 2VZYA 2JDCA 1Z9UA 3LD2A 4A33A 2EVNA 4EVYA 4QC6A 4PSWA 2Z3PA 3EC4A 1L0CA 2QMLA 5CNPA 3GYAA 1M44A 4PK2A 2VEZA 4KLVA 1YGHA 3FBUA 3K9UA 4QBJA 4U9YA 2YNCA 4KOUA 3TO6A 2HV2A 3PP9A 5AG6A 4FD5A 3UY5A 2Z3MA 4A31A 3I3GA 4JXQA 2CNTA 3P2FA 1OZPA 3S6HA 1XEBA 4KSFA 4OLLA 4CAXA 1V0CA 2Q44A 1I1DA 1Y9WA 3PGPA 1S7FA 2ARHA 2P6FA 4AG9A 4A30A 4AG7A 2QIRA 2Z0ZA 2B5GB 5BWAB 2FT0A 4RS2A 2G3TA 4FD7A 5J8FA 3T90A 2FXFA 2PSWA 2BSWA 5G1ZA 4HNYB 4X5KA 4KOYA 1YK3A 1PUAA 2Z3NA 4MY3A 3S6FA 3R1KA 3W6XA 5H86A 3EFAA 1S7KA 2J8MA 3H5ZA 3OWCA 3JUWA 4HNXB 4UWIA 3D2PA 3V8IA 3ZJ0A 1YREA 3QB8A 1RO5A 3SXOA 1U6MA 2BL1A 3FIXA 2B3UA 2Q0YA 1ZO0A 4R3LA 2KCWA 4A32A 5AG4A 2J8NA 3DR8A 2Z3LA 5A28A 2PDOA 1KUXA 2FE7A 2OZGA 1Y7RA 3TO9A 4M85A 5KTCA 4MFJA 2FSRA 1I21A 4B5PA 4CAEA 2DXQA 5HH1A 3TTHA 5F48A 4CGMA 1J4JA 1M4GA 5G20A 4KOVA 3R96A 4MY0A 4J3GA 2Z10A 2AJ6A 3IU1A 3JTKA 2PRBA 2B3VA 4I49A 5HMNA 2Z3KA 4UA3A 4GS4A 5C88A 2EUIA 1S7NA 4YGOA 2FCKA 2Y0MA 5FVJA 4KVOE 2CNSA 3JVNA 2I00A 1KUYA 1YX0A 2Z11A 5F47A 2ZW5A 3IU2A 4C2YA 5EBVA 1B87A 3QAHA 3ZZIA 3D3SA 3TE4A 5H84A 4K30A 4Q36A 3TT2A 1NSLA 1I12A 2OU2A 3DNSA 2REFA 3PZJA 4CGPA 3BJ7A 3F5BA 4NXYA 4H89A 2PC1A 3DR6A 2BUEA 2R1IA 4E8OA 2A4NA 4OAEA 2VI7A 3FNCA 4KUBA 5IB0A 3TO7A 3CXQA 3C26A 3FB3A 1SQHA 2PQ8A 4KOTA 1XMTA 4MJ8A 1IYKA 1QSOA 1YR0A 4JXRA 4ONUA 1Q2CA 2GE3A 4FD6A 4CAWA 4XPLA 2PR8A 5AG5A 4KVME 3CXSA 5JQ4A 2NMTA 2CNMA 2G3AA 3BLNA 4IUSA 5F46A 4UFWA 1QSRA 2DPSA 2RC4A 2H5MA 4PK3A 4MHDA 4MFKA 4CAFA 3W91A 1KZFA 4AB7A 1IYLA 4JJXA 4XNHB 3EY5A 1B6BA 4R9MA 1YLEA 4XPKA 1YVOA 2DPTA 3F8KA 5EC4A 4LX9A 3DSBA 2CY2A 1QSMA 3RYOA 5AG7A 2JLMA 2Q4VA 4MFQA 4NSQA 4R87A 1FY7A 3SHPA 3FYNA 1Y9KA 2HUZA 1N71A 4L8AA 2YGWA 2ATRA 3P2HA 5IV0A 2JDDA 2R7HA 3EXNA 1XF8A 4BMHA 4MI4A 3A9LA 4B5OA 5G21A 4R3KA 2R98A 4A95A 4AVAA 2O28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I9S A;  2WPW A;  3TFY A;  3F0A A;  1M4D A;  4JLY A;  5DWM A;  3IGR A;  2B4D B;  4MBU A;  4HNW B;  4KVX A;  3SXN A;  1QSN A;  4KUA A;  4ZBG A;  1CM0 A;  5F49 A;  3FXT A;  3R9F A;  1YVK A;  2C27 A;  3IWG A;  4OAD A;  2Q4Y A;  4KOW A;  4DNC A;  2R8V A;  3MGD A;  1WK4 A;  4YFJ A;  2ZW4 A;  3R9G A;  5GCN A;  5JPH A;  4U5Y A;  4H6U A;  1Z4R A;  4Y49 B;  2P6E A;  2X7B A;  3G3S A;  2Q04 A;  1IB1 E;  4XPD B;  3TOA A;  4F6A A;  2IL4 A;  5DWN A;  1KUV A;  4CS0 B;  3TCV A;  2VBQ A;  2P6G A;  3W6S A;  3DDD A;  1K4J A;  1IID A;  1S5K A;  2OB0 A;  4QB9 A;  2OZH A;  2B4B A;  4L89 A;  2OZU A;  1ON0 A;  2GIV A;  3GY9 A;  3EO4 A;  1P0H A;  4KOX A;  3T9Y A;  5ISV A;  4E2A A;  3R95 A;  1RXT A;  5E96 A;  3VWE A;  4II9 A;  1TIQ A;  4JD6 A;  4HKF A;  1LRZ A;  4QUS A;  2ZXV A;  4XNH C;  5J8C A;  2WPX A;  3TOB A;  1CJW A;  2OH1 A;  3VWD A;  4NCZ A;  4PSX A;  2K5T A;  4FD4 A;  3WR7 A;  3CXP A;  3NE7 A;  2FS5 A;  4CRY B;  4F0Y A;  3S6G A;  2GAN A;  4LUA A;  4R57 A;  4KOS A;  4CRZ B;  4ORF A;  2VZZ A;  1WWZ A;  3BJ8 A;  4AVB A;  2PR1 A;  2ZW7 A;  4B5P B;  5KTA A;  2QEC A;  2D4P A;  4IF5 A;  2F5I A;  4H6Z A;  3KKW A;  4CAV A;  2ZPA A;  5KTD A;  1NE9 A;  1NMT A;  2FIW A;  1XIX A;  1UFH A;  1PU9 A;  1VKC A;  1IIC A;  1S60 A;  2VXK A;  4UBR A;  1R57 A;  2B58 A;  1Q2Y A;  2JEV A;  3B8G A;  3N7Z A;  3S6K A;  2J8R A;  1MJB A;  1MK4 A;  2ZW6 A;  3E0K A;  4U9Z A;  3D8P A;  2REE A;  2B5G A;  4KLW A;  3H4Q A;  1MJ9 A;  1XE4 A;  4M3S A;  2I79 A;  4JWP A;  1BOB A;  4PV6 A;  1M1D A;  2P0W A;  1M4I A;  2FIA A;  1BO4 A;  3G8W A;  4Y49 C;  1Q2D A;  2D4O A;  3GKR A;  4XPD C;  4NF1 A;  4RI1 A;  4UWJ A;  3FRM A;  4KZT A;  1MJA A;  2VQY A;  4KOR A;  2Q7B A;  1QST A;  1S7L A;  1S3Z A;  4QVT A;  2G0B A;  1VHS A;  4NEX A;  1GHE A;  2FL4 A;  2B4D A;  3R9E A;  3LOD A;  4E0A A;  2BEI A;  5IX3 A;  4YRH A;  3D2M A;  2HQY A;  4AVC A;  5I0C A;  2AE6 A;  1Z4E A;  1P4N A;  5C82 A;  2VZY A;  2JDC A;  1Z9U A;  3LD2 A;  2EVN A;  4EVY A;  4QC6 A;  4PSW A;  3EC4 A;  1L0C A;  2QML A;  5CNP A;  3GYA A;  1M44 A;  4PK2 A;  2VEZ A;  4KLV A;  1YGH A;  3FBU A;  3K9U A;  4QBJ A;  4U9Y A;  4KOU A;  3TO6 A;  2HV2 A;  3PP9 A;  4FD5 A;  3UY5 A;  3I3G A;  4JXQ A;  2CNT A;  3P2F A;  1OZP A;  3S6H A;  1XEB A;  4OLL A;  4CAX A;  1V0C A;  2Q44 A;  1I1D A;  1Y9W A;  3PGP A;  1S7F A;  2ARH A;  2P6F A;  4AG9 A;  4AG7 A;  2QIR A;  2Z0Z A;  2B5G B;  2FT0 A;  4RS2 A;  2G3T A;  4FD7 A;  5J8F A;  3T90 A;  2FXF A;  2PSW A;  2BSW A;  4HNY B;  4X5K A;  4KOY A;  1YK3 A;  1PUA A;  4MY3 A;  3S6F A;  3R1K A;  3W6X A;  5H86 A;  3EFA A;  1S7K A;  2J8M A;  3OWC A;  3JUW A;  4HNX B;  4UWI A;  3D2P A;  3V8I A;  3ZJ0 A;  1YRE A;  3QB8 A;  1RO5 A;  3SXO A;  1U6M A;  2BL1 A;  3FIX A;  2B3U A;  2Q0Y A;  4R3L A;  2KCW A;  2J8N A;  3DR8 A;  2PDO A;  1KUX A;  2FE7 A;  2OZG A;  1Y7R A;  3TO9 A;  4M85 A;  5KTC A;  2FSR A;  1I21 A;  4B5P A;  2DXQ A;  5HH1 A;  3TTH A;  5F48 A;  1J4J A;  1M4G A;  4KOV A;  3R96 A;  4MY0 A;  4J3G A;  2Z10 A;  2AJ6 A;  2PRB A;  2B3V A;  4I49 A;  5HMN A;  4UA3 A;  4GS4 A;  5C88 A;  2EUI A;  1S7N A;  4YGO A;  2FCK A;  2Y0M A;  5FVJ A;  4KVO E;  2CNS A;  3JVN A;  2I00 A;  1KUY A;  1YX0 A;  2Z11 A;  5F47 A;  2ZW5 A;  5EBV A;  1B87 A;  3QAH A;  3ZZI A;  3D3S A;  3TE4 A;  5H84 A;  4K30 A;  3TT2 A;  1NSL A;  1I12 A;  2OU2 A;  3DNS A;  2REF A;  3PZJ A;  3BJ7 A;  3F5B A;  4NXY A;  4H89 A;  2PC1 A;  3DR6 A;  2BUE A;  2R1I A;  4E8O A;  2A4N A;  4OAE A;  2VI7 A;  3FNC A;  4KUB A;  5IB0 A;  3TO7 A;  3CXQ A;  3C26 A;  3FB3 A;  1SQH A;  2PQ8 A;  4KOT A;  1XMT A;  4MJ8 A;  1IYK A;  1QSO A;  1YR0 A;  4JXR A;  4ONU A;  1Q2C A;  2GE3 A;  4FD6 A;  4CAW A;  4XPL A;  2PR8 A;  4KVM E;  3CXS A;  5JQ4 A;  2NMT A;  2CNM A;  2G3A A;  3BLN A;  4IUS A;  5F46 A;  1QSR A;  2RC4 A;  2H5M A;  4PK3 A;  4MHD A;  3W91 A;  1KZF A;  4AB7 A;  1IYL A;  4JJX A;  4XNH B;  3EY5 A;  1B6B A;  4R9M A;  1YLE A;  4XPK A;  1YVO A;  3F8K A;  5EC4 A;  4LX9 A;  3DSB A;  2CY2 A;  1QSM A;  3RYO A;  2JLM A;  2Q4V A;  4NSQ A;  4R87 A;  1FY7 A;  3SHP A;  3FYN A;  1Y9K A;  2HUZ A;  1N71 A;  4L8A A;  2ATR A;  3P2H A;  5IV0 A;  2JDD A;  2R7H A;  3EXN A;  1XF8 A;  4BMH A;  4MI4 A;  4B5O A;  4R3K A;  2R98 A;  4AVA A;  2O28 A; 
#chains in the Genus database with same CATH topology
 3LMS A;  2C6G A;  4CGN A;  2XEG A;  4P6Y A;  3I9S A;  4BD9 A;  1Y0Y A;  2WPW A;  3TFY A;  4C7H A;  4KS9 A;  4R8F A;  4MFZ A;  3F0A A;  4NGS A;  4O23 A;  1M4D A;  2PVV A;  1ELM P;  4JLY A;  5DWM A;  3BHX A;  3IGR A;  2B4D B;  4MBU A;  4B12 A;  1R43 A;  2FVG A;  4HNW B;  4KVX A;  4MFP A;  1BLL E;  5D29 A;  1Y7E A;  3KHZ A;  3SJX A;  3SXN A;  4F0X A;  2BOA A;  3RAM A;  4ZY2 A;  4UFV A;  4R6T A;  1QSN A;  4KUA A;  4GXH A;  4ZBG A;  4YWY A;  5HVF A;  4B11 A;  4C2Z A;  3PB7 X;  4OKO A;  4CYQ A;  1CM0 A;  5F49 A;  4IK2 A;  3FXT A;  2BO9 A;  4ZYQ A;  6CPA A;  1LAP A;  4PXC A;  1YVK A;  3R9F A;  3DLJ A;  2C27 A;  1TKH A;  3B3S A;  3IWG A;  4OAD A;  2Q4Y A;  4KOW A;  3B7I A;  4X8I A;  4DNC A;  2R8V A;  3IJ3 A;  3MGD A;  1CP6 A;  2WUU A;  1IOI A;  3BI1 A;  4OC2 A;  1WK4 A;  4YFJ A;  2ZW4 A;  3R9G A;  5JM6 A;  1KWM A;  5GCN A;  2PJB A;  4UFX A;  5JPH A;  3NH4 A;  4U5Y A;  4H6U A;  1Z4R A;  4Y49 B;  3S9L A;  2P6E A;  2X7B A;  3G3S A;  2Q04 A;  1IB1 E;  4KSA A;  4XPD B;  3TOA A;  3TC8 A;  2IL4 A;  2PCU A;  2WZN A;  1KUV A;  5DWN A;  4CS0 B;  4F6A A;  3TCV A;  4CGL A;  2VBQ A;  1R3N A;  5K8O A;  2P6G A;  2Q4Z A;  3FED A;  3W6S A;  3DDD A;  1K4J A;  1IID A;  1M4L A;  1S5K A;  2OB0 A;  3PB9 X;  2OZH A;  3B3T A;  3PFE A;  4QB9 A;  4UCN A;  3V7Z A;  2B4B A;  4C68 A;  4Z65 A;  4BBH A;  1CPS A;  4L89 A;  4OC5 A;  4UIB A;  2OZU A;  1ON0 A;  5IB9 A;  2GIV A;  2C6P A;  1YW6 A;  1H8L A;  3GY9 A;  3EO4 A;  1ZLI A;  4TNU A;  1P0H A;  3SI0 A;  2PIZ A;  4KOX A;  3T9Y A;  5ISV A;  4E2A A;  3R95 A;  5AGE A;  1RXT A;  2PJ6 A;  5E96 A;  1VIX A;  2C1C A;  2ZEP A;  3IEH A;  3PB6 X;  4DYO A;  5CBM A;  5K8M A;  2JEW A;  3VWE A;  3RBU A;  4II9 A;  1F2P A;  5LRJ A;  1TIQ A;  1HEE A;  8CPA A;  4JD6 A;  3SI1 A;  3SJE A;  2PVW A;  1VHO A;  2AFZ A;  3KAS A;  4HKF A;  1LRZ A;  2V8D A;  2BCO A;  4QUS A;  1YSJ A;  2ZXV A;  4XNH C;  5THW A;  4B14 A;  3PEI A;  4EME A;  3ISX A;  5J8C A;  2WPX A;  3TOB A;  4H2K A;  2AFU A;  1CJW A;  4MCP A;  4CGO A;  2OH1 A;  3IWE A;  4ZY1 A;  3VWD A;  5LRK A;  4P45 A;  2PE3 A;  2GRE A;  2RB7 A;  1TF9 A;  1AUG A;  4NCZ A;  4PSX A;  2K5T A;  2CTB A;  4FD4 A;  3S9M A;  5LYD A;  3CXP A;  2I3C A;  3NE7 A;  3WR7 A;  4NGN A;  4C2X A;  4P4J A;  1Z8L A;  4YU9 A;  2FS5 A;  4MRI A;  4CRY B;  3L2N A;  3IWW A;  4F0Y A;  3S6G A;  4A94 A;  3B2Y A;  2GAN A;  4LUA A;  4UCP A;  3RNZ A;  5A27 A;  4NGQ A;  4MMO A;  4IHM A;  1CP7 A;  1F57 A;  4MXU A;  1YW4 A;  4R57 A;  3MRU A;  4KOS A;  3B35 A;  4CRZ B;  4ORF A;  2VZZ A;  4CPA A;  1WWZ A;  4CYN A;  2OR4 A;  3BJ8 A;  1XJO A;  4AVB A;  4NFR A;  2PR1 A;  2ZW7 A;  4B5P B;  4P4E A;  5KTA A;  2AFM A;  2QEC A;  2D4P A;  1YME A;  3WC7 A;  4IF5 A;  2F5I A;  2GLJ A;  3FJU A;  4PXB A;  2IJZ A;  3PB4 X;  4H6Z A;  2JBJ A;  3KKW A;  4CAV A;  2PIY A;  2ZPA A;  5KTD A;  4Q38 A;  1TF8 A;  4P4D A;  4A2Z A;  1NE9 A;  1NMT A;  2FIW A;  1XIX A;  4GM5 A;  1UFH A;  4ZGY B;  1PU9 A;  3K2K A;  4UCM A;  2VL1 A;  1Z8W A;  1VKC A;  3GLJ A;  2OOT A;  1IIC A;  1S60 A;  2VXK A;  2PJ5 A;  3B3V A;  4UBR A;  1R57 A;  2B58 A;  1X12 A;  2GLF A;  2ZOG A;  1Q2Y A;  1BPM A;  1ZG8 A;  2ANP A;  2G9D A;  2JEV A;  3B8G A;  1DE4 C;  2CF4 A;  3JRU A;  2PJ8 A;  4CYP A;  3N7Z A;  3S6K A;  2J8R A;  1MJB A;  1MK4 A;  4M6H A;  2ZW6 A;  3E0K A;  4U9Z A;  1F2O A;  3D8P A;  2REE A;  2B5G A;  4OC1 A;  4UIA A;  4KLW A;  4C7I A;  3H4Q A;  4NGP A;  1MJ9 A;  4MHN A;  4P4B A;  1CBX A;  1XE4 A;  2ODF A;  4M3S A;  4B13 A;  3NA6 A;  3PB8 X;  2QVP A;  2I79 A;  4JWP A;  1BOB A;  4PV6 A;  3KGQ A;  1M1D A;  3KZW A;  2P0W A;  1M4I A;  1TXR A;  2FIA A;  1BO4 A;  3G8W A;  7CPA A;  3B3W A;  3I1U A;  2YNC C;  4Y49 C;  2F8H A;  1Q2D A;  4B10 A;  2D4O A;  1JQG A;  3GKR A;  3DGV A;  4XPD C;  2O4H A;  4NF1 A;  4CYO A;  4RI1 A;  2F7V A;  2Z3O A;  4UWJ A;  3FRM A;  3H8F A;  3KHX A;  4KZT A;  4UF4 A;  2YNE A;  1MJA A;  4G1P A;  1CPX A;  2VQY A;  3K9T A;  1X10 A;  4KOR A;  2ABZ A;  2WSA A;  2Q7B A;  3RO0 A;  1IY7 A;  1UWY A;  3NH5 A;  4IAV A;  1QST A;  3D66 A;  3NE8 A;  3T8W A;  1S7L A;  1S3Z A;  4FUU A;  2PJ9 A;  2CXA A;  2ZED A;  1GYT A;  4QVT A;  2G0B A;  1VHS A;  4NEX A;  1GHE A;  2FL4 A;  5F09 A;  2B4D A;  2YND A;  3R9E A;  1XMB A;  3LOD A;  4MFL A;  4OP4 A;  4E0A A;  2IMO A;  2BEI A;  2EK9 A;  4NJQ A;  5IX3 A;  4YRH A;  3D2M A;  3PBE A;  1CG2 A;  4TWE A;  1ZLH A;  2HQY A;  4AVC A;  3CPA A;  3IC1 A;  5I0C A;  2AE6 A;  3KI9 A;  5G22 A;  1Z4E A;  1P4N A;  4X3R A;  5C82 A;  2VZY A;  2JDC A;  1Z9U A;  3LD2 A;  4A33 A;  5CPA A;  1ARL A;  2EVN A;  4EVY A;  4QC6 A;  3HLP A;  3FMC A;  4PSW A;  2Z3P A;  3EC4 A;  1L0C A;  4JYW A;  2QML A;  2V8G A;  5CNP A;  4AXV A;  3GYA A;  4R76 A;  1M44 A;  2XEI A;  4PK2 A;  4MCS A;  5EMI A;  2VEZ A;  4OID A;  4KLV A;  1YGH A;  1NSA A;  2WYR A;  3GIU A;  5I4M A;  1TKF A;  3FEE A;  1PYT B;  3FBU A;  3FX6 A;  3K9U A;  1A2Z A;  4U9Y A;  2XEF A;  4QBJ A;  4ZX8 A;  3VAT A;  2YNC A;  4M6I A;  3D67 A;  3NFZ A;  4KOU A;  3TO6 A;  2PJ2 A;  4MCR A;  2HV2 A;  1OBR A;  1QMU A;  3PP9 A;  3QNV A;  5AG6 A;  4FD5 A;  3UY5 A;  2Z3M A;  2EWB A;  4FWU A;  3I3G A;  4JXQ A;  4A31 A;  2CNT A;  2EBJ A;  3P2F A;  4LQG A;  4Q7A A;  1OZP A;  2GU2 A;  1XEB A;  4RN7 A;  1Z2L A;  3KR4 A;  3S6H A;  4WJB A;  3VAR A;  4RUH A;  4KSF A;  4OLL A;  4F8Z A;  5K8P A;  3RZA A;  4CAX A;  2ZEH A;  3PFO A;  1V0C A;  3MN8 A;  1VGY A;  4NJR A;  5LYF A;  2Q44 A;  1I1D A;  1Y9W A;  3PGP A;  1S7F A;  2ARH A;  2P6F A;  2XEJ A;  4AG9 A;  3ZJ0 A;  4A30 A;  4AG7 A;  2QIR A;  2Z0Z A;  3WC6 A;  1FNO A;  3HUV A;  2IQ6 A;  5LRG A;  2B5G B;  5BWA B;  2FT0 A;  4RS2 A;  2G3T A;  4FD7 A;  5J8F A;  3FH4 A;  2FXF A;  2PSW A;  1XBU A;  2BSW A;  5G1Z A;  4HNY B;  4X5K A;  3T90 A;  4KOY A;  2ZEL A;  4NGT A;  1YK3 A;  1PUA A;  2DF5 A;  1Y0R A;  2Z3N A;  3WT4 A;  4MY3 A;  3S6F A;  3R1K A;  4NGM A;  1XOV A;  2PJ3 A;  3PRT A;  4PPZ A;  3W6X A;  2PJ4 A;  4ZI6 A;  3D7F A;  5H86 A;  1JWQ A;  3WC5 A;  5HXD A;  3EFA A;  4MHP A;  1S7K A;  4WWV A;  2J8M A;  1YQE A;  3H5Z A;  3B3C A;  3OWC A;  1DTD A;  1Z8T A;  3JUW A;  4HNX B;  3D2P A;  2V8H A;  4P10 A;  1YRE A;  2HB6 A;  4P44 A;  4UWI A;  3V8I A;  3QB8 A;  3WAB A;  1RO5 A;  3SXO A;  3VH9 A;  5HVG A;  4F9U A;  1LCP A;  1U6M A;  2BL1 A;  3FIX A;  4F9V A;  2B3U A;  2Q0Y A;  4OIW A;  1ZO0 A;  4R3L A;  3QAY A;  2KCW A;  4PXD A;  2Q43 A;  1XRY A;  4A32 A;  4OC0 A;  2ZEO A;  3D4U A;  5AG4 A;  2J8N A;  3DR8 A;  2Z3L A;  5A28 A;  2PDO A;  1KUX A;  4P4I A;  2FE7 A;  5K8N A;  2OZG A;  2PRQ A;  4BIN A;  2PJ1 A;  2PJ7 A;  1HDQ A;  1Y7R A;  3TO9 A;  2ZEM A;  4M85 A;  4X2T A;  5KTC A;  4MFJ A;  1AMP A;  2QYV A;  2CIJ A;  2FSR A;  4DJL A;  1I21 A;  2POK A;  3KL9 A;  4B5P A;  1ARM A;  2DXQ A;  4CAE A;  5HH1 A;  1LOK A;  3TTH A;  1Z8X A;  5F48 A;  4CGM A;  1J4J A;  1M4G A;  2V8V A;  4HPS A;  5G20 A;  1AYE A;  4KOV A;  2HC9 A;  2C6C A;  3R96 A;  4ONW A;  4MY0 A;  4J3G A;  3TX8 A;  2Z10 A;  2AJ6 A;  1ELL P;  3IU1 A;  3JTK A;  2PRB A;  3PBB A;  2B3V A;  4UEZ A;  3GB0 A;  4I49 A;  5HMN A;  2Z3K A;  4UEE A;  2AFW A;  4GS4 A;  4UA3 A;  5C88 A;  2EUI A;  2GFQ A;  4P4F A;  3SJF A;  3IO1 A;  3KQZ A;  1S7N A;  2NYQ A;  2RFH A;  4YGO A;  2FCK A;  2Y0M A;  2EK8 A;  5FVJ A;  4K3N A;  2ZEE A;  2CNS A;  4KVO E;  1QQ9 A;  4OME A;  3D7D A;  3H8E A;  3JVN A;  4MCQ A;  4B6Z A;  2I00 A;  1KUY A;  1YX0 A;  2Z11 A;  3IIB A;  5F47 A;  2ZW5 A;  3ISZ A;  5D8N A;  4EFD A;  2EO8 A;  4EWT A;  3H8G A;  3IU2 A;  2AFX A;  4A39 A;  4C2Y A;  1XFO A;  5EBV A;  1B87 A;  3QAH A;  3ZZI A;  3D3S A;  2J9A A;  4UEF A;  3TE4 A;  1BPN A;  5H84 A;  3LAC A;  3D7H A;  4K30 A;  4MHZ A;  4Q36 A;  3TT2 A;  1NSL A;  1VHE A;  4ZY0 A;  1I12 A;  4PXE A;  5HVH A;  2AFS A;  2OU2 A;  3KR5 A;  3DNS A;  1ZG9 A;  2REF A;  3PZJ A;  4CGP A;  3BJ7 A;  3CZX A;  3GUX A;  2JBK A;  4LQ6 A;  3D68 A;  3F5B A;  1FT7 A;  4NXY A;  4H89 A;  2PC1 A;  3DR6 A;  2BUE A;  2R1I A;  4E8O A;  1IU8 A;  2A4N A;  2Q7S A;  5DS0 A;  4OAE A;  2VI7 A;  3FNC A;  4KUB A;  5IB0 A;  4JZ0 A;  3TO7 A;  2PJA A;  5LYI A;  3CXQ A;  3C26 A;  3FB3 A;  1SQH A;  2PQ8 A;  4KOT A;  3BXM A;  1XMT A;  4MJ8 A;  4MHY A;  1IYK A;  1PCA A;  1QSO A;  1YR0 A;  1ZG7 A;  2ZEF A;  2QJ8 A;  2ZOF A;  4JXR A;  5ELY A;  4ONU A;  4OC3 A;  1Q2C A;  3CDX A;  2GE3 A;  1RTQ A;  3KQX A;  3BI0 A;  4FD6 A;  4CAW A;  4XPL A;  2PJ0 A;  2PR8 A;  3CT9 A;  3FF3 A;  5AG5 A;  4KVM E;  1Q7L A;  3CXS A;  2NMT A;  2CNM A;  2G3A A;  3BLN A;  4IUS A;  5F46 A;  5JQ4 A;  1CX8 A;  2AFO A;  4UFW A;  1QSR A;  2DPS A;  2RC4 A;  2H5M A;  4PK3 A;  3SI2 A;  1LAM A;  4MHD A;  4MFK A;  4CAF A;  4DUK A;  3W91 A;  5JH9 A;  1KZF A;  4AB7 A;  1IYL A;  4JJX A;  1EE3 P;  4XNH B;  3EY5 A;  1B6B A;  5J1Q A;  4R7M A;  2PJC A;  3N5F A;  4OC4 A;  4R9M A;  4A37 A;  2DEA A;  1YLE A;  4XPK A;  4ZX9 A;  3V38 A;  1YVO A;  2DPT A;  3F8K A;  3SJG A;  5EC4 A;  4LX9 A;  3DSB A;  3S9N A;  2CTC A;  2Q51 A;  2CY2 A;  1QSM A;  3RYO A;  5LYL A;  3D7G A;  4PQA A;  4W9Y A;  2O53 A;  5AG7 A;  2JLM A;  2Q4V A;  4MFQ A;  4NSQ A;  4R87 A;  4NGR A;  1FY7 A;  1IGB A;  3SHP A;  4M6G A;  3FYN A;  1Y9K A;  2HUZ A;  1N71 A;  4L8A A;  4A38 A;  2YGW A;  2ATR A;  3P2H A;  2ZEG A;  2NSM A;  2ZEN A;  3FEC A;  5IV0 A;  2JDD A;  3FVL A;  2R7H A;  3EXN A;  1XF8 A;  3IFE A;  4BMH A;  4MI4 A;  4FBE A;  3A9L A;  4B5O A;  5G21 A;  1BAV A;  1Z5R A;  1IOF A;  1TKJ A;  1LAN A;  2R98 A;  2V77 A;  4R3K A;  4A95 A;  4AVA A;  3CPX A;  1YLO A;  3LWU A;  1HDU A;  4FAI A;  5JGF A;  1LFW A;  4KSI A;  2O28 A;  3NH8 A; 
#chains in the Genus database with same CATH homology
 4CGN A;  3I9S A;  2WPW A;  3TFY A;  4C7H A;  4KS9 A;  4MFZ A;  3F0A A;  1M4D A;  4JLY A;  5DWM A;  3IGR A;  2B4D B;  4MBU A;  4B12 A;  4HNW B;  4KVX A;  4MFP A;  3SXN A;  4F0X A;  4UFV A;  1QSN A;  4KUA A;  4B11 A;  4ZBG A;  4C2Z A;  4CYQ A;  1CM0 A;  5F49 A;  3FXT A;  3R9F A;  1YVK A;  2C27 A;  3IWG A;  4OAD A;  2Q4Y A;  4KOW A;  4DNC A;  2R8V A;  3MGD A;  2WUU A;  1WK4 A;  4YFJ A;  2ZW4 A;  3R9G A;  5GCN A;  4UFX A;  5JPH A;  4U5Y A;  4H6U A;  1Z4R A;  4Y49 B;  2P6E A;  2X7B A;  3G3S A;  2Q04 A;  1IB1 E;  4KSA A;  4XPD B;  3TOA A;  4F6A A;  2IL4 A;  5DWN A;  1KUV A;  4CS0 B;  3TCV A;  4CGL A;  2VBQ A;  2P6G A;  3W6S A;  3DDD A;  1K4J A;  1IID A;  1S5K A;  2OB0 A;  4QB9 A;  4UCN A;  2OZH A;  2B4B A;  4C68 A;  4BBH A;  4L89 A;  2OZU A;  1ON0 A;  2GIV A;  3GY9 A;  3EO4 A;  1P0H A;  4KOX A;  3T9Y A;  5ISV A;  4E2A A;  3R95 A;  5AGE A;  1RXT A;  5E96 A;  3VWE A;  4II9 A;  1TIQ A;  4JD6 A;  4HKF A;  1LRZ A;  4QUS A;  2ZXV A;  4XNH C;  4B14 A;  5J8C A;  2WPX A;  3TOB A;  1CJW A;  4CGO A;  2OH1 A;  3IWE A;  3VWD A;  4NCZ A;  4PSX A;  2K5T A;  4FD4 A;  3WR7 A;  3CXP A;  3NE7 A;  4C2X A;  2FS5 A;  4CRY B;  4F0Y A;  3S6G A;  2GAN A;  4LUA A;  4UCP A;  5A27 A;  4R57 A;  4KOS A;  4CRZ B;  4ORF A;  2VZZ A;  4CYN A;  1WWZ A;  3BJ8 A;  4AVB A;  2PR1 A;  2ZW7 A;  4B5P B;  5KTA A;  2QEC A;  2D4P A;  4IF5 A;  2F5I A;  4H6Z A;  3KKW A;  4CAV A;  2ZPA A;  5KTD A;  4Q38 A;  4A2Z A;  1NE9 A;  1NMT A;  2FIW A;  1XIX A;  1UFH A;  4ZGY B;  1PU9 A;  4UCM A;  1VKC A;  1IIC A;  1S60 A;  2VXK A;  4UBR A;  1R57 A;  2B58 A;  1Q2Y A;  2JEV A;  3B8G A;  4CYP A;  3N7Z A;  3S6K A;  2J8R A;  1MJB A;  1MK4 A;  2ZW6 A;  3E0K A;  4U9Z A;  3D8P A;  2REE A;  2B5G A;  4C7I A;  4KLW A;  3H4Q A;  1MJ9 A;  1XE4 A;  4M3S A;  4B13 A;  2I79 A;  4JWP A;  1BOB A;  4PV6 A;  1M1D A;  2P0W A;  1M4I A;  2FIA A;  1BO4 A;  3G8W A;  2YNC C;  4Y49 C;  1Q2D A;  4B10 A;  2D4O A;  3GKR A;  4XPD C;  4NF1 A;  4CYO A;  4RI1 A;  2Z3O A;  4UWJ A;  3FRM A;  4KZT A;  2YNE A;  1MJA A;  2VQY A;  4KOR A;  2WSA A;  2Q7B A;  1QST A;  1S7L A;  1S3Z A;  2CXA A;  4QVT A;  2G0B A;  1VHS A;  4NEX A;  1GHE A;  2FL4 A;  2B4D A;  2YND A;  3R9E A;  3LOD A;  4MFL A;  4E0A A;  2BEI A;  5IX3 A;  4YRH A;  3D2M A;  2HQY A;  4AVC A;  5I0C A;  2AE6 A;  5G22 A;  1Z4E A;  1P4N A;  5C82 A;  2VZY A;  2JDC A;  1Z9U A;  3LD2 A;  4A33 A;  2EVN A;  4EVY A;  4QC6 A;  4PSW A;  2Z3P A;  3EC4 A;  1L0C A;  2QML A;  5CNP A;  3GYA A;  1M44 A;  4PK2 A;  2VEZ A;  4KLV A;  1YGH A;  3FBU A;  3K9U A;  4QBJ A;  4U9Y A;  2YNC A;  4KOU A;  3TO6 A;  2HV2 A;  3PP9 A;  5AG6 A;  4FD5 A;  3UY5 A;  2Z3M A;  4A31 A;  3I3G A;  4JXQ A;  2CNT A;  3P2F A;  1OZP A;  3S6H A;  1XEB A;  4KSF A;  4OLL A;  4CAX A;  1V0C A;  2Q44 A;  1I1D A;  1Y9W A;  3PGP A;  1S7F A;  2ARH A;  2P6F A;  4AG9 A;  4A30 A;  4AG7 A;  2QIR A;  2Z0Z A;  2B5G B;  5BWA B;  2FT0 A;  4RS2 A;  2G3T A;  4FD7 A;  5J8F A;  3T90 A;  2FXF A;  2PSW A;  2BSW A;  5G1Z A;  4HNY B;  4X5K A;  4KOY A;  1YK3 A;  1PUA A;  2Z3N A;  4MY3 A;  3S6F A;  3R1K A;  3W6X A;  5H86 A;  3EFA A;  1S7K A;  2J8M A;  3H5Z A;  3OWC A;  3JUW A;  4HNX B;  4UWI A;  3D2P A;  3V8I A;  3ZJ0 A;  1YRE A;  3QB8 A;  1RO5 A;  3SXO A;  1U6M A;  2BL1 A;  3FIX A;  2B3U A;  2Q0Y A;  1ZO0 A;  4R3L A;  2KCW A;  4A32 A;  5AG4 A;  2J8N A;  3DR8 A;  2Z3L A;  5A28 A;  2PDO A;  1KUX A;  2FE7 A;  2OZG A;  1Y7R A;  3TO9 A;  4M85 A;  5KTC A;  4MFJ A;  2FSR A;  1I21 A;  4B5P A;  4CAE A;  2DXQ A;  5HH1 A;  3TTH A;  5F48 A;  4CGM A;  1J4J A;  1M4G A;  5G20 A;  4KOV A;  3R96 A;  4MY0 A;  4J3G A;  2Z10 A;  2AJ6 A;  3IU1 A;  3JTK A;  2PRB A;  2B3V A;  4I49 A;  5HMN A;  2Z3K A;  4UA3 A;  4GS4 A;  5C88 A;  2EUI A;  1S7N A;  4YGO A;  2FCK A;  2Y0M A;  5FVJ A;  4KVO E;  2CNS A;  3JVN A;  2I00 A;  1KUY A;  1YX0 A;  2Z11 A;  5F47 A;  2ZW5 A;  3IU2 A;  4C2Y A;  5EBV A;  1B87 A;  3QAH A;  3ZZI A;  3D3S A;  3TE4 A;  5H84 A;  4K30 A;  4Q36 A;  3TT2 A;  1NSL A;  1I12 A;  2OU2 A;  3DNS A;  2REF A;  3PZJ A;  4CGP A;  3BJ7 A;  3F5B A;  4NXY A;  4H89 A;  2PC1 A;  3DR6 A;  2BUE A;  2R1I A;  4E8O A;  2A4N A;  4OAE A;  2VI7 A;  3FNC A;  4KUB A;  5IB0 A;  3TO7 A;  3CXQ A;  3C26 A;  3FB3 A;  1SQH A;  2PQ8 A;  4KOT A;  1XMT A;  4MJ8 A;  1IYK A;  1QSO A;  1YR0 A;  4JXR A;  4ONU A;  1Q2C A;  2GE3 A;  4FD6 A;  4CAW A;  4XPL A;  2PR8 A;  5AG5 A;  4KVM E;  3CXS A;  5JQ4 A;  2NMT A;  2CNM A;  2G3A A;  3BLN A;  4IUS A;  5F46 A;  4UFW A;  1QSR A;  2DPS A;  2RC4 A;  2H5M A;  4PK3 A;  4MHD A;  4MFK A;  4CAF A;  3W91 A;  1KZF A;  4AB7 A;  1IYL A;  4JJX A;  4XNH B;  3EY5 A;  1B6B A;  4R9M A;  1YLE A;  4XPK A;  1YVO A;  2DPT A;  3F8K A;  5EC4 A;  4LX9 A;  3DSB A;  2CY2 A;  1QSM A;  3RYO A;  5AG7 A;  2JLM A;  2Q4V A;  4MFQ A;  4NSQ A;  4R87 A;  1FY7 A;  3SHP A;  3FYN A;  1Y9K A;  2HUZ A;  1N71 A;  4L8A A;  2YGW A;  2ATR A;  3P2H A;  5IV0 A;  2JDD A;  2R7H A;  3EXN A;  1XF8 A;  4BMH A;  4MI4 A;  3A9L A;  4B5O A;  5G21 A;  4R3K A;  2R98 A;  4A95 A;  4AVA A;  2O28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...