2REEA

Crystal structure of the loading gnatl domain of cura from lyngbya majuscula
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
NYYNLRHPKIEDLRDLIALETLCWSENLQVDNEEIYRRIFKIPQGQFILELEDKIVGAIYSQRIDNPQLLDNKTCTQVPLLHTESGVVVQLLAVNILPELQNQGLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYSPMPMAEYIHQKNESGLLVDPLLRFHQIHGAKIEKLLPGYRPKDWENQTCGVLVSYDIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, lyase
molecule keywords CurA
publication title GNAT-like strategy for polyketide chain initiation.
pubmed doi rcsb
source organism Lyngbya majuscula
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature ec 2.3.1.38: [Acyl-carrier-protein] S-acetyltransferase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2reeA00
2O28A 3FRMA 4IF5A 3V8IA 2B3UA 3ZZIA 4CRYB 4B5OA 4DNCA 2PR1A 1TIQA 4KOVA 2H5MA 1Z4RA 3FB3A 2B4DB 2GE3A 2Z10A 2VZYA 1KUVA 4F6AA 4R3LA 4HNYB 2ZW4A 4U9YA 3IWGA 3B8GA 4NF1A 2OZGA 4UA3A 4PK3A 2JEVA 4KVME 3TCVA 3MGDA 4R87A 3TOBA 3I9SA 4H89A 5JPHA 4JWPA 2FE7A 4HKFA 3W6XA 1UFHA 3DR8A 4UWIA 2KCWA 3DDDA 1B6BA 4ZBGA 2G3TA 4NCZA 4MBUA 4MY3A 1VKCA 1RXTA 1GHEA 5F49A 1L0CA 2HQYA 4JJXA 4CRZB 3LODA 2B5GB 3EFAA 5I0CA 1IB1E 3R96A 2VBQA 2GIVA 2VZZA 1WWZA 2REFA 3RYOA 2P6FA 4KUBA 1S7FA 1S7NA 1NSLA 2BL1A 2QECA 3R1KA 2B4DA 4FD5A 2EUIA 4XPDB 4EVYA 1YK3A 4H6ZA 1PUAA 1XIXA 2OZUA 2Z0ZA 4AVBA 1S7LA 3C26A 4JXRA 3TOAA 3T90A 1KZFA 3PP9A 4II9A 5HH1A 5DWNA 3S6GA 1PU9A 2FSRA 2Q44A 1MJAA 4CAWA 1M44A 4XPLA 4Y49B 5J8FA 2Q04A 2JLMA 3GY9A 3JVNA 2OH1A 1QSNA 1M4DA 1Y9KA 3EC4A 4IUSA 4KZTA 1Y9WA 1KUXA 2ZW7A 1K4JA 3SHPA 3D2MA 2X7BA 3TO9A 3FNCA 4KUAA 3CXPA 5ISVA 3KKWA 2D4PA 2Q4VA 2B3VA 2AE6A 1YLEA 4CAVA 2D4OA 3EY5A 3W6SA 3EO4A 4OADA 1VHSA 2PRBA 1YGHA 2FXFA 3PGPA 2B5GA 4QUSA 3BLNA 1YR0A 3S6KA 3FIXA 5IV0A 3FYNA 4R3KA 3F5BA 2BUEA 4MY0A 3QB8A 3NE7A 4UWJA 2I00A 4PV6A 3TO7A 3S6HA 4KOTA 3D3SA 5IB0A 3QAHA 1XE4A 4QVTA 2PC1A 2R98A 5HMNA 4NEXA 4E0AA 2EVNA 2ZW5A 2ZPAA 1P4NA 3UY5A 3TE4A 3TT2A 3FBUA 4QBJA 1NE9A 4F0YA 2P6GA 3LD2A 3N7ZA 3D8PA 1XMTA 4JD6A 3WR7A 1MJBA 4GS4A 4AG7A 2R8VA 1KUYA 2HV2A 1IYKA 3E0KA 1S3ZA 4Y49C 2GANA 3P2HA 2BSWA 4XPKA 3JUWA 4FD4A 3DR6A 4XNHB 1FY7A 1MJ9A 1CM0A 2CNSA 4KVOE 2FIWA 5C88A 1V0CA 4ONUA 1QSOA 2VI7A 1YREA 2B58A 4CAXA 1U6MA 2J8MA 1MK4A 4I49A 3IGRA 2HUZA 3EXNA 1R57A 1Z4EA 1M4GA 3FXTA 2CY2A 2BEIA 3VWEA 1LRZA 2ZXVA 4AG9A 3DSBA 4KLWA 2PR8A 2Q4YA 4MJ8A 2WPWA 3W91A 3OWCA 2NMTA 3PZJA 4PSXA 4AVAA 5F46A 3GYAA 3R9FA 2R1IA 2OZHA 1P0HA 4H6UA 2JDCA 1Q2YA 2A4NA 2R7HA 4BMHA 2FS5A 3F8KA 3TTHA 4M85A 4YFJA 4KOSA 5DWMA 1Q2DA 4LX9A 3G8WA 1N71A 4RS2A 5C82A 3BJ8A 4AB7A 1IYLA 2J8NA 3BJ7A 1ON0A 4KOXA 5CNPA 1S60A 4K30A 4RI1A 2ARHA 1CJWA 2C27A 2Q7BA 4YRHA 5J8CA 2F5IA 1Y7RA 4XNHC 5F47A 4FD7A 4OLLA 4E2AA 4L8AA 5KTCA 4PK2A 3VWDA 5EC4A 3GKRA 3R9EA 4MI4A 2P0WA 5H86A 4U9ZA 3R95A 5GCNA 4X5KA 3G3SA 4B5PB 2QIRA 4KOYA 4MHDA 2VEZA 3SXNA 2ATRA 4XPDC 1I12A 4FD6A 1M4IA 2CNTA 4KVXA 1J4JA 1SQHA 2PDOA 3P2FA 1XF8A 1YX0A 4KLVA 5H84A 2FCKA 1IICA 3T9YA 4NXYA 2FL4A 4HNXB 2I79A 1I21A 1S7KA 3CXSA 4CS0B 1B87A 3TFYA 4J3GA 1I1DA 4U5YA 1S5KA 2Q0YA 4HNWB 1Q2CA 3SXOA 2JDDA 1YVOA 2K5TA 1NMTA 2G3AA 2RC4A 4ORFA 2PQ8A 5FVJA 3TO6A 2AJ6A 3K9UA 2CNMA 3ZJ0A 5IX3A 4KORA 2B4BA 2IL4A 4QB9A 2DXQA 4KOWA 1QSMA 1YVKA 1BOBA 2P6EA 2QMLA 3H4QA 1WK4A 2PSWA 4B5PA 2J8RA 2VQYA 4OAEA 5F48A 1Z9UA 4JXQA 2WPXA 4L89A 2FIAA 2Z11A 2REEA 5E96A 4LUAA 1BO4A 4R57A 5EBVA 4AVCA 1XEBA 3F0AA 3R9GA 4M3SA 5JQ4A 1M1DA 1OZPA 2OB0A 4R9MA 2VXKA 3CXQA 2Y0MA 2G0BA 3DNSA 2OU2A 1RO5A 2ZW6A 3I3GA 4KOUA 3S6FA 5KTDA 1QSTA 4PSWA 4E8OA 4NSQA 3D2PA 1QSRA 4QC6A 4YGOA 5KTAA 2FT0A 4JLYA 4UBRA 1IIDA
chains in the Genus database with same CATH superfamily
1YW4A 2O28A 3FRMA 4IF5A 3V38A 2B3UA 3D7FA 3V8IA 4FAIA 3ZZIA 4P4EA 5HVHA 4CRYB 4B5OA 4NJRA 2PR1A 1TIQA 4KOVA 2H5MA 4DNCA 1Z4RA 3FECA 3FB3A 2B4DB 3GUXA 4PXBA 2GE3A 2Z10A 3CT9A 2VZYA 1YW6A 4MXUA 3B35A 4BBHA 1KUVA 2XEFA 4A32A 2CF4A 2PJ8A 4R6TA 3K9TA 5CBMA 4F6AA 4R3LA 2DPTA 4HNYB 1IY7A 1GYTA 1TXRA 2ZW4A 3PBEA 4U9YA 3IWGA 3B8GA 4NF1A 1XJOA 3FEDA 2ZOGA 3D7GA 2OZGA 4UA3A 4MHYA 4PK3A 2JEVA 4CPAA 3IEHA 4CYQA 1CPXA 4KVME 4MHNA 3MGDA 4OIWA 3TCVA 4R87A 3TOBA 3I9SA 4H89A 5EMIA 5AGEA 3IU2A 5JPHA 3HUVA 4IAVA 1YSJA 1QMUA 5K8MA 4JWPA 2FE7A 2WZNA 4HKFA 3NE8A 3W6XA 3TX8A 1UFHA 4MCSA 2PVWA 3DR8A 4UWIA 4X2TA 1TKHA 2KCWA 3DDDA 1B6BA 3KQXA 4ZBGA 3ISXA 4F0XA 2G3TA 4NCZA 4X3RA 4MBUA 2PJ5A 4MY3A 1ARLA 1FT7A 3NH8A 4B6ZA 1VKCA 1AYEA 4A94A 1F2PA 1KWMA 4X8IA 1RXTA 3NFZA 1GHEA 3A9LA 1BPNA 5F49A 5BWAB 1L0CA 2HQYA 2PJBA 2PJ9A 4JJXA 4CRZB 4MMOA 1BPMA 2Z3PA 3LODA 2B5GB 3EFAA 2GLJA 2V77A 2Z3NA 4H2KA 2YNDA 5HVGA 1M4LA 5I0CA 4LQGA 1LCPA 2RB7A 5G20A 2FVGA 1IB1E 8CPAA 3R96A 2VBQA 4P6YA 4PQAA 3CDXA 4Q36A 2GIVA 2C6GA 2VZZA 1YLOA 4CGMA 1WWZA 2REFA 1TKFA 1Z8TA 4B13A 1DE4C 3RYOA 2P6FA 4KUBA 1S7FA 1VIXA 1S7NA 4Q38A 4UFWA 2PCUA 3KGQA 1NSLA 4CYOA 2BL1A 1TF9A 3IWWA 2QECA 3R1KA 2B4DA 2Z3LA 1XRYA 1Y7EA 1AUGA 4FD5A 4MCRA 5LRJA 5JGFA 2EUIA 4XPDB 4EVYA 4UF4A 4FUUA 1YK3A 4H6ZA 1PUAA 1XIXA 4UFXA 3FX6A 5AG6A 1IGBA 2OZUA 4OMEA 2Z0ZA 4PXDA 2DEAA 4NGNA 4AVBA 4RUHA 1S7LA 2YGWA 2Z3OA 3C26A 4MFJA 4JXRA 3TOAA 3T90A 2ZENA 1KZFA 2PJ4A 3B3CA 3PP9A 4UEZA 4II9A 4OP4A 5HH1A 1LANA 5DWNA 3GLJA 3S6GA 1PU9A 2FSRA 2Q44A 4R8FA 1MJAA 4UCPA 4A31A 2CTBA 4CAWA 1M44A 4XPLA 4Y49B 5J8FA 5J1QA 2Q04A 3SJFA 2PJ3A 2JLMA 1Q7LA 1QQ9A 3GY9A 3JVNA 4NJQA 2Q51A 5LYIA 3H8EA 2OH1A 1QSNA 1M4DA 2PJ7A 1Y9KA 1XFOA 2YNCA 3EC4A 4IUSA 1XBUA 4EMEA 4KZTA 3PB4X 1Y9WA 3B2YA 1KUXA 2DF5A 2Q7SA 2PJ0A 2ZW7A 1K4JA 5LRGA 3SHPA 2POKA 4OC5A 4MFQA 3D2MA 3ISZA 3PBBA 2X7BA 1XMBA 3TO9A 2ZEEA 3FNCA 2C6CA 4KUAA 1CP6A 3CXPA 4WWVA 1R3NA 5ISVA 3IWEA 2Z3MA 3KKWA 4LQ6A 3WABA 4C68A 1ZG7A 4P45A 2D4PA 2AFMA 2PRQA 2Q4VA 5G1ZA 2B3VA 2AE6A 4CGPA 3BXMA 1YLEA 4CAVA 2D4OA 3EY5A 2HC9A 3W6SA 3EO4A 1ELMP 2EO8A 3N5FA 4OADA 4F8ZA 2DPSA 3NA6A 1VHSA 2PRBA 1YGHA 2FXFA 3PGPA 2B5GA 1H8LA 4FBEA 2XEJA 3QAYA 4QUSA 3SJGA 4YU9A 4UCMA 4C2YA 3BLNA 1YR0A 4NGRA 3S6KA 3B3VA 3FIXA 5IV0A 2EWBA 3FYNA 2PJCA 4R3KA 1F57A 3F5BA 2BUEA 4MY0A 3VARA 3QB8A 3NE7A 4UWJA 2I00A 4P4JA 4PV6A 4M6HA 3TO7A 4EWTA 2IMOA 4K3NA 3S6HA 2PJ2A 4R76A 1BLLE 4KOTA 3D3SA 3BI1A 5IB0A 3QAHA 1XE4A 2O53A 4QVTA 2PC1A 2CIJA 2R98A 4NGSA 4OC1A 5HMNA 3IU1A 2ANPA 4NEXA 4G1PA 2Q4ZA 2BOAA 4E0AA 2ZEHA 2EVNA 1PCAA 2ZW5A 2ZPAA 5D8NA 4OC2A 5K8OA 2AFXA 2Q43A 3WC7A 1LAPA 1P4NA 3SI2A 2F7VA 1OBRA 1Y0RA 3UY5A 3TE4A 3TT2A 3FBUA 3NH4A 4QBJA 4GM5A 3B3TA 4WJBA 1ARMA 1UWYA 1NE9A 2AFUA 2YNEA 4F0YA 2P6GA 1VHEA 4MHZA 3LWUA 3LD2A 4OIDA 1IOIA 4HPSA 2JBJA 1X12A 3S9LA 3N7ZA 4C2ZA 3D8PA 2EK8A 4CYNA 1AMPA 1XMTA 4JD6A 3WR7A 2PJAA 2C6PA 3PRTA 1MJBA 3PEIA 3H8FA 4GS4A 3RO0A 4AG7A 2R8VA 3S9NA 1KUYA 2AFWA 2HV2A 3QNVA 1IYKA 3E0KA 3KHXA 3PB6X 4A30A 1S3ZA 4Y49C 3D4UA 2GANA 3P2HA 2BSWA 3CPXA 4XPKA 3RNZA 3JUWA 1JWQA 2JEWA 4FD4A 2CTCA 3DR6A 2ODFA 4XNHB 1IOFA 4UIAA 1FY7A 4CGNA 1R43A 1MJ9A 1CM0A 2CNSA 5A27A 6CPAA 3MN8A 4KVOE 2FIWA 1YMEA 1EE3P 5C88A 2GLFA 4JYWA 1V0CA 3KR4A 4ONUA 1QSOA 2VI7A 1YREA 2B58A 4CAXA 5THWA 1U6MA 5K8PA 2IJZA 2J8MA 1MK4A 3KASA 4M6GA 4PXEA 5CPAA 5HVFA 1VGYA 1LOKA 3B7IA 4B14A 5LRKA 4I49A 3IGRA 4NFRA 5G22A 2HUZA 2V8GA 3EXNA 2ABZA 4UEFA 1R57A 3B3SA 1Z4EA 4MFZA 1M4GA 2WYRA 4O23A 4OKOA 3BHXA 3FXTA 5G21A 2CY2A 3FH4A 5HXDA 2RFHA 2BEIA 2XEIA 3VWEA 2EK9A 1LRZA 2ZXVA 4AG9A 3DSBA 2XEGA 2GREA 1XOVA 2ZELA 4OC3A 4KLWA 2PR8A 4NGPA 4F9UA 4UFVA 1DTDA 2WUUA 2Q4YA 4MJ8A 3IO1A 5JM6A 5AG7A 2WPWA 3W91A 3SJEA 3OWCA 1Z8LA 2F8HA 3VATA 2NMTA 3PZJA 2HB6A 1ZLHA 4PSXA 1Z8XA 4AVAA 5F46A 4P44A 3GYAA 4MFKA 2GFQA 3R9FA 3FMCA 4DUKA 2R1IA 3FJUA 2OZHA 1P0HA 2BO9A 2IQ6A 1ELLP 4PXCA 4H6UA 2JDCA 3L2NA 1Q2YA 2A4NA 3PB7X 3WT4A 3KI9A 2R7HA 4UCNA 4A2ZA 2ZEGA 2ZOFA 4BMHA 2PE3A 4YWYA 1ZO0A 4ZGYB 4C7IA 2YNCC 4OC0A 2C1CA 2FS5A 3F8KA 3VH9A 3IJ3A 3TTHA 2QVPA 4M85A 4YFJA 3B3WA 4KOSA 2ZEMA 3JTKA 5DWMA 3TC8A 1Q2DA 3D68A 3CZXA 4LX9A 4P4IA 3G8WA 1N71A 4CGOA 4RS2A 5C82A 3BJ8A 4AB7A 1IYLA 3FEEA 4KSAA 2J8NA 3BJ7A 1ON0A 2V8HA 4KOXA 4NGMA 5CNPA 1S60A 1CP7A 2ZEDA 4K30A 4RI1A 2ARHA 1CJWA 3IIBA 2C27A 1CG2A 4UIBA 2Q7BA 3D7DA 5JH9A 4MFPA 4YRHA 2GU2A 3T8WA 5J8CA 2F5IA 4ZX8A 1Y7RA 4XNHC 4B12A 5F47A 1CPSA 2JBKA 4FD7A 4GXHA 4OLLA 2J9AA 3D66A 5LYFA 2G9DA 2NSMA 4E2AA 4L8AA 2V8VA 4PK2A 4KS9A 4Q7AA 2WSAA 5EC4A 3VWDA 5KTCA 3GKRA 4A95A 4MFLA 2EBJA 3R9EA 4MI4A 4A33A 2PJ6A 2P0WA 3H8GA 3LACA 3PB8X 4U9ZA 5H86A 3R95A 4CAEA 5F09A 5GCNA 4X5KA 5IB9A 2ZEFA 4PPZA 1TF8A 3G3SA 4B5PB 2QIRA 4KOYA 4MHDA 1IU8A 2VEZA 1A2ZA 4FWUA 3SXNA 2ATRA 4OC4A 4XPDC 4ZY2A 1HEEA 1I12A 4FD6A 1M4IA 4TWEA 2CNTA 1NSAA 4KVXA 4CAFA 2PJ1A 4UEEA 4EFDA 4IK2A 1J4JA 1SQHA 3LMSA 4NGTA 4A39A 2PDOA 3H5ZA 3P2FA 1XF8A 2BCOA 1YX0A 4KLVA 5H84A 2FCKA 1IICA 2PIYA 4B11A 5AG5A 3V7ZA 2O4HA 3T9YA 5AG4A 4ONWA 4MCQA 4ZY1A 3K2KA 2CXAA 2FL4A 4NXYA 1RTQA 4CGLA 2PVVA 4HNXB 5LYDA 5D29A 2I79A 1I21A 1S7KA 2OOTA 3CXSA 4CS0B 4W9YA 4B10A 4DYOA 4M6IA 1B87A 3TFYA 3KL9A 4J3GA 1I1DA 3CPAA 4U5YA 3SI0A 1S5KA 2Q0YA 4HNWB 4AXVA 7CPAA 1CBXA 1Q2CA 4A37A 1TKJA 3SJXA 1Z5RA 2OR4A 3SXOA 4P4BA 1Z2LA 5ELYA 3WC5A 1LAMA 1X10A 1ZLIA 2JDDA 1LFWA 3S9MA 2Z3KA 1YVOA 3PB9X 2K5TA 1NMTA 1HDQA 4C2XA 1PYTB 2G3AA 2RC4A 2I3CA 4P4DA 4ORFA 3KQZA 3DGVA 2PQ8A 2QYVA 4KSFA 4MHPA 4TNUA 5FVJA 3BI0A 3TO6A 2AJ6A 2VL1A 3K9UA 2CNMA 3ZJ0A 4DJLA 5IX3A 4RN7A 3GB0A 4KORA 4BINA 2B4BA 2IL4A 3I1UA 4QB9A 3IFEA 2DXQA 4KOWA 4BD9A 1QSMA 1YVKA 1Y0YA 3FF3A 2AFZA 3RZAA 1Z8WA 5K8NA 3WC6A 1BOBA 2P6EA 1F2OA 1FNOA 2QMLA 3H4QA 1WK4A 2PSWA 3D7HA 2J8RA 2VQYA 2QJ8A 3MRUA 3KHZA 4OAEA 2AFSA 4B5PA 5F48A 1Z9UA 4MCPA 3SI1A 2NYQA 4P10A 4C7HA 4Z65A 4JXQA 3RBUA 5A28A 2WPXA 4JZ0A 2FIAA 4L89A 3D67A 1BAVA 1YQEA 2Z11A 2REEA 4IHMA 4NGQA 3RAMA 4ZYQA 5E96A 4LUAA 3NH5A 1BO4A 4R57A 5EBVA 4P4FA 2PIZA 5DS0A 5LYLA 1VHOA 2ZEPA 4AVCA 1HDUA 1XEBA 3F0AA 3R9GA 2AFOA 2ZEOA 4M3SA 4ZI6A 5JQ4A 1M1DA 1JQGA 1OZPA 2OB0A 4R9MA 2VXKA 3DLJA 3GIUA 3CXQA 3IC1A 3FVLA 2V8DA 2Y0MA 4R7MA 2G0BA 3DNSA 2OU2A 1RO5A 2ZW6A 3HLPA 3I3GA 4KOUA 3S6FA 1QSTA 5KTDA 3PFOA 3KZWA 4CYPA 4PSWA 4E8OA 4NSQA 1ZG8A 3D2PA 1ZG9A 1QSRA 5I4MA 4ZY0A 4QC6A 3JRUA 1CX8A 4YGOA 3KR5A 4MRIA 5KTAA 4F9VA 4KSIA 4ZX9A 2FT0A 4JLYA 4A38A 4UBRA 1IIDA 3PFEA
chains in the Genus database with same CATH topology
2O28A 3FRMA 4IF5A 3V8IA 2B3UA 3ZZIA 4CRYB 4B5OA 4DNCA 2PR1A 1TIQA 4KOVA 2H5MA 1Z4RA 3FB3A 2B4DB 2GE3A 2Z10A 2VZYA 4BBHA 1KUVA 4A32A 4F6AA 4R3LA 2DPTA 4HNYB 2ZW4A 4U9YA 3IWGA 3B8GA 4NF1A 2OZGA 4UA3A 4CYQA 4PK3A 2JEVA 4KVME 3TCVA 3MGDA 4R87A 3TOBA 3I9SA 4H89A 5AGEA 3IU2A 5JPHA 4JWPA 2FE7A 4HKFA 3W6XA 1UFHA 3DR8A 4UWIA 2KCWA 3DDDA 1B6BA 4ZBGA 4F0XA 2G3TA 4NCZA 4MBUA 4MY3A 1VKCA 1RXTA 1GHEA 3A9LA 5F49A 5BWAB 1L0CA 2HQYA 4JJXA 4CRZB 2Z3PA 3LODA 2B5GB 3EFAA 2Z3NA 2YNDA 5I0CA 5G20A 1IB1E 3R96A 2VBQA 4Q36A 4CGMA 2GIVA 2VZZA 1WWZA 2REFA 4B13A 3RYOA 2P6FA 4KUBA 1S7FA 4UFWA 1S7NA 4Q38A 4CYOA 1NSLA 2BL1A 2QECA 3R1KA 2B4DA 2Z3LA 4FD5A 2EUIA 4XPDB 4EVYA 1YK3A 4H6ZA 1PUAA 1XIXA 4UFXA 5AG6A 2OZUA 2Z0ZA 4AVBA 1S7LA 2YGWA 2Z3OA 3C26A 4MFJA 4JXRA 3TOAA 3T90A 1KZFA 3PP9A 4II9A 5HH1A 5DWNA 3S6GA 1PU9A 2FSRA 2Q44A 1MJAA 4UCPA 4A31A 4CAWA 1M44A 4XPLA 4Y49B 5J8FA 2Q04A 2JLMA 3GY9A 3JVNA 2OH1A 1QSNA 1M4DA 1Y9KA 2YNCA 3EC4A 4IUSA 4KZTA 1Y9WA 1KUXA 2ZW7A 1K4JA 3SHPA 4MFQA 3D2MA 2X7BA 3TO9A 3FNCA 4KUAA 3CXPA 5ISVA 3IWEA 2Z3MA 3KKWA 4C68A 2D4PA 5G1ZA 2Q4VA 2B3VA 2AE6A 4CGPA 1YLEA 4CAVA 2D4OA 3EY5A 3W6SA 3EO4A 4OADA 2DPSA 1VHSA 2PRBA 1YGHA 2FXFA 3PGPA 2B5GA 4QUSA 4UCMA 4C2YA 3BLNA 1YR0A 3S6KA 3FIXA 5IV0A 3FYNA 4R3KA 3F5BA 2BUEA 4MY0A 3QB8A 3NE7A 4UWJA 2I00A 4PV6A 3TO7A 3S6HA 4KOTA 3D3SA 5IB0A 3QAHA 1XE4A 4QVTA 2PC1A 2R98A 5HMNA 3IU1A 4NEXA 4E0AA 2EVNA 2ZW5A 2ZPAA 1P4NA 3UY5A 3TE4A 3TT2A 3FBUA 4QBJA 1NE9A 2YNEA 4F0YA 2P6GA 3LD2A 3N7ZA 4C2ZA 3D8PA 4CYNA 1XMTA 4JD6A 3WR7A 1MJBA 4GS4A 4AG7A 2R8VA 1KUYA 2HV2A 1IYKA 3E0KA 4A30A 1S3ZA 4Y49C 2GANA 3P2HA 2BSWA 4XPKA 3JUWA 4FD4A 3DR6A 4XNHB 1FY7A 4CGNA 1MJ9A 1CM0A 2CNSA 5A27A 4KVOE 2FIWA 5C88A 1V0CA 4ONUA 1QSOA 2VI7A 1YREA 2B58A 4CAXA 1U6MA 2J8MA 1MK4A 4B14A 4I49A 3IGRA 5G22A 2HUZA 3EXNA 1R57A 1Z4EA 4MFZA 1M4GA 3FXTA 5G21A 2CY2A 2BEIA 3VWEA 1LRZA 2ZXVA 4AG9A 3DSBA 4KLWA 2PR8A 4UFVA 2WUUA 2Q4YA 4MJ8A 5AG7A 2WPWA 3W91A 3OWCA 2NMTA 3PZJA 4PSXA 4AVAA 5F46A 3GYAA 4MFKA 3R9FA 2R1IA 2OZHA 1P0HA 4H6UA 2JDCA 1Q2YA 2A4NA 4UCNA 2R7HA 4A2ZA 4BMHA 4ZGYB 1ZO0A 4C7IA 2YNCC 2FS5A 3F8KA 3TTHA 4M85A 4YFJA 4KOSA 3JTKA 5DWMA 1Q2DA 4LX9A 3G8WA 1N71A 4CGOA 4RS2A 5C82A 3BJ8A 4AB7A 1IYLA 4KSAA 2J8NA 3BJ7A 1ON0A 4KOXA 5CNPA 1S60A 4K30A 4RI1A 2ARHA 1CJWA 2C27A 2Q7BA 4MFPA 4YRHA 5J8CA 2F5IA 1Y7RA 4XNHC 4B12A 5F47A 4FD7A 4OLLA 4E2AA 4L8AA 5KTCA 4PK2A 4KS9A 3VWDA 2WSAA 5EC4A 3GKRA 4A95A 4MFLA 3R9EA 4MI4A 4A33A 2P0WA 5H86A 4U9ZA 3R95A 4CAEA 5GCNA 4X5KA 3G3SA 4B5PB 2QIRA 4KOYA 4MHDA 2VEZA 3SXNA 2ATRA 4XPDC 1I12A 4FD6A 1M4IA 2CNTA 4KVXA 4CAFA 1J4JA 1SQHA 2PDOA 3H5ZA 3P2FA 1XF8A 1YX0A 4KLVA 5H84A 2FCKA 1IICA 4B11A 5AG5A 3T9YA 5AG4A 2CXAA 2FL4A 4NXYA 4CGLA 4HNXB 2I79A 1I21A 1S7KA 3CXSA 4CS0B 4B10A 1B87A 3TFYA 4J3GA 1I1DA 4U5YA 1S5KA 2Q0YA 4HNWB 1Q2CA 3SXOA 2JDDA 2Z3KA 1YVOA 2K5TA 1NMTA 4C2XA 2G3AA 2RC4A 4ORFA 2PQ8A 4KSFA 5FVJA 3TO6A 2AJ6A 3K9UA 2CNMA 3ZJ0A 5IX3A 4KORA 2B4BA 2IL4A 4QB9A 2DXQA 4KOWA 1QSMA 1YVKA 1BOBA 2P6EA 2QMLA 3H4QA 1WK4A 2PSWA 4B5PA 2J8RA 2VQYA 4OAEA 5F48A 1Z9UA 4C7HA 4JXQA 5A28A 2WPXA 4L89A 2FIAA 2Z11A 2REEA 5E96A 4LUAA 1BO4A 4R57A 5EBVA 4AVCA 1XEBA 3F0AA 3R9GA 4M3SA 5JQ4A 1M1DA 1OZPA 2OB0A 4R9MA 2VXKA 3CXQA 2Y0MA 2G0BA 3DNSA 2OU2A 1RO5A 2ZW6A 3I3GA 4KOUA 3S6FA 5KTDA 1QSTA 4CYPA 4PSWA 4E8OA 4NSQA 3D2PA 1QSRA 4QC6A 4YGOA 5KTAA 2FT0A 4JLYA 4UBRA 1IIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O28 A;  3FRM A;  4IF5 A;  3V8I A;  2B3U A;  3ZZI A;  4CRY B;  4B5O A;  4DNC A;  2PR1 A;  1TIQ A;  4KOV A;  2H5M A;  1Z4R A;  3FB3 A;  2B4D B;  2GE3 A;  2Z10 A;  2VZY A;  1KUV A;  4F6A A;  4R3L A;  4HNY B;  2ZW4 A;  4U9Y A;  3IWG A;  3B8G A;  4NF1 A;  2OZG A;  4UA3 A;  4PK3 A;  2JEV A;  4KVM E;  3TCV A;  3MGD A;  4R87 A;  3TOB A;  3I9S A;  4H89 A;  5JPH A;  4JWP A;  2FE7 A;  4HKF A;  3W6X A;  1UFH A;  3DR8 A;  4UWI A;  2KCW A;  3DDD A;  1B6B A;  4ZBG A;  2G3T A;  4NCZ A;  4MBU A;  4MY3 A;  1VKC A;  1RXT A;  1GHE A;  5F49 A;  1L0C A;  2HQY A;  4JJX A;  4CRZ B;  3LOD A;  2B5G B;  3EFA A;  5I0C A;  1IB1 E;  3R96 A;  2VBQ A;  2GIV A;  2VZZ A;  1WWZ A;  2REF A;  3RYO A;  2P6F A;  4KUB A;  1S7F A;  1S7N A;  1NSL A;  2BL1 A;  2QEC A;  3R1K A;  2B4D A;  4FD5 A;  2EUI A;  4XPD B;  4EVY A;  1YK3 A;  4H6Z A;  1PUA A;  1XIX A;  2OZU A;  2Z0Z A;  4AVB A;  1S7L A;  3C26 A;  4JXR A;  3TOA A;  3T90 A;  1KZF A;  3PP9 A;  4II9 A;  5HH1 A;  5DWN A;  3S6G A;  1PU9 A;  2FSR A;  2Q44 A;  1MJA A;  4CAW A;  1M44 A;  4XPL A;  4Y49 B;  5J8F A;  2Q04 A;  2JLM A;  3GY9 A;  3JVN A;  2OH1 A;  1QSN A;  1M4D A;  1Y9K A;  3EC4 A;  4IUS A;  4KZT A;  1Y9W A;  1KUX A;  2ZW7 A;  1K4J A;  3SHP A;  3D2M A;  2X7B A;  3TO9 A;  3FNC A;  4KUA A;  3CXP A;  5ISV A;  3KKW A;  2D4P A;  2Q4V A;  2B3V A;  2AE6 A;  1YLE A;  4CAV A;  2D4O A;  3EY5 A;  3W6S A;  3EO4 A;  4OAD A;  1VHS A;  2PRB A;  1YGH A;  2FXF A;  3PGP A;  2B5G A;  4QUS A;  3BLN A;  1YR0 A;  3S6K A;  3FIX A;  5IV0 A;  3FYN A;  4R3K A;  3F5B A;  2BUE A;  4MY0 A;  3QB8 A;  3NE7 A;  4UWJ A;  2I00 A;  4PV6 A;  3TO7 A;  3S6H A;  4KOT A;  3D3S A;  5IB0 A;  3QAH A;  1XE4 A;  4QVT A;  2PC1 A;  2R98 A;  5HMN A;  4NEX A;  4E0A A;  2EVN A;  2ZW5 A;  2ZPA A;  1P4N A;  3UY5 A;  3TE4 A;  3TT2 A;  3FBU A;  4QBJ A;  1NE9 A;  4F0Y A;  2P6G A;  3LD2 A;  3N7Z A;  3D8P A;  1XMT A;  4JD6 A;  3WR7 A;  1MJB A;  4GS4 A;  4AG7 A;  2R8V A;  1KUY A;  2HV2 A;  1IYK A;  3E0K A;  1S3Z A;  4Y49 C;  2GAN A;  3P2H A;  2BSW A;  4XPK A;  3JUW A;  4FD4 A;  3DR6 A;  4XNH B;  1FY7 A;  1MJ9 A;  1CM0 A;  2CNS A;  4KVO E;  2FIW A;  5C88 A;  1V0C A;  4ONU A;  1QSO A;  2VI7 A;  1YRE A;  2B58 A;  4CAX A;  1U6M A;  2J8M A;  1MK4 A;  4I49 A;  3IGR A;  2HUZ A;  3EXN A;  1R57 A;  1Z4E A;  1M4G A;  3FXT A;  2CY2 A;  2BEI A;  3VWE A;  1LRZ A;  2ZXV A;  4AG9 A;  3DSB A;  4KLW A;  2PR8 A;  2Q4Y A;  4MJ8 A;  2WPW A;  3W91 A;  3OWC A;  2NMT A;  3PZJ A;  4PSX A;  4AVA A;  5F46 A;  3GYA A;  3R9F A;  2R1I A;  2OZH A;  1P0H A;  4H6U A;  2JDC A;  1Q2Y A;  2A4N A;  2R7H A;  4BMH A;  2FS5 A;  3F8K A;  3TTH A;  4M85 A;  4YFJ A;  4KOS A;  5DWM A;  1Q2D A;  4LX9 A;  3G8W A;  1N71 A;  4RS2 A;  5C82 A;  3BJ8 A;  4AB7 A;  1IYL A;  2J8N A;  3BJ7 A;  1ON0 A;  4KOX A;  5CNP A;  1S60 A;  4K30 A;  4RI1 A;  2ARH A;  1CJW A;  2C27 A;  2Q7B A;  4YRH A;  5J8C A;  2F5I A;  1Y7R A;  4XNH C;  5F47 A;  4FD7 A;  4OLL A;  4E2A A;  4L8A A;  5KTC A;  4PK2 A;  3VWD A;  5EC4 A;  3GKR A;  3R9E A;  4MI4 A;  2P0W A;  5H86 A;  4U9Z A;  3R95 A;  5GCN A;  4X5K A;  3G3S A;  4B5P B;  2QIR A;  4KOY A;  4MHD A;  2VEZ A;  3SXN A;  2ATR A;  4XPD C;  1I12 A;  4FD6 A;  1M4I A;  2CNT A;  4KVX A;  1J4J A;  1SQH A;  2PDO A;  3P2F A;  1XF8 A;  1YX0 A;  4KLV A;  5H84 A;  2FCK A;  1IIC A;  3T9Y A;  4NXY A;  2FL4 A;  4HNX B;  2I79 A;  1I21 A;  1S7K A;  3CXS A;  4CS0 B;  1B87 A;  3TFY A;  4J3G A;  1I1D A;  4U5Y A;  1S5K A;  2Q0Y A;  4HNW B;  1Q2C A;  3SXO A;  2JDD A;  1YVO A;  2K5T A;  1NMT A;  2G3A A;  2RC4 A;  4ORF A;  2PQ8 A;  5FVJ A;  3TO6 A;  2AJ6 A;  3K9U A;  2CNM A;  3ZJ0 A;  5IX3 A;  4KOR A;  2B4B A;  2IL4 A;  4QB9 A;  2DXQ A;  4KOW A;  1QSM A;  1YVK A;  1BOB A;  2P6E A;  2QML A;  3H4Q A;  1WK4 A;  2PSW A;  4B5P A;  2J8R A;  2VQY A;  4OAE A;  5F48 A;  1Z9U A;  4JXQ A;  2WPX A;  4L89 A;  2FIA A;  2Z11 A;  2REE A;  5E96 A;  4LUA A;  1BO4 A;  4R57 A;  5EBV A;  4AVC A;  1XEB A;  3F0A A;  3R9G A;  4M3S A;  5JQ4 A;  1M1D A;  1OZP A;  2OB0 A;  4R9M A;  2VXK A;  3CXQ A;  2Y0M A;  2G0B A;  3DNS A;  2OU2 A;  1RO5 A;  2ZW6 A;  3I3G A;  4KOU A;  3S6F A;  5KTD A;  1QST A;  4PSW A;  4E8O A;  4NSQ A;  3D2P A;  1QSR A;  4QC6 A;  4YGO A;  5KTA A;  2FT0 A;  4JLY A;  4UBR A;  1IID A; 
#chains in the Genus database with same CATH topology
 1YW4 A;  2O28 A;  3FRM A;  4IF5 A;  3V38 A;  2B3U A;  3D7F A;  3V8I A;  4FAI A;  3ZZI A;  4P4E A;  5HVH A;  4CRY B;  4B5O A;  4NJR A;  2PR1 A;  1TIQ A;  4KOV A;  2H5M A;  4DNC A;  1Z4R A;  3FEC A;  3FB3 A;  2B4D B;  3GUX A;  4PXB A;  2GE3 A;  2Z10 A;  3CT9 A;  2VZY A;  1YW6 A;  4MXU A;  3B35 A;  4BBH A;  1KUV A;  2XEF A;  4A32 A;  2CF4 A;  2PJ8 A;  4R6T A;  3K9T A;  5CBM A;  4F6A A;  4R3L A;  2DPT A;  4HNY B;  1IY7 A;  1GYT A;  1TXR A;  2ZW4 A;  3PBE A;  4U9Y A;  3IWG A;  3B8G A;  4NF1 A;  1XJO A;  3FED A;  2ZOG A;  3D7G A;  2OZG A;  4UA3 A;  4MHY A;  4PK3 A;  2JEV A;  4CPA A;  3IEH A;  4CYQ A;  1CPX A;  4KVM E;  4MHN A;  3MGD A;  4OIW A;  3TCV A;  4R87 A;  3TOB A;  3I9S A;  4H89 A;  5EMI A;  5AGE A;  3IU2 A;  5JPH A;  3HUV A;  4IAV A;  1YSJ A;  1QMU A;  5K8M A;  4JWP A;  2FE7 A;  2WZN A;  4HKF A;  3NE8 A;  3W6X A;  3TX8 A;  1UFH A;  4MCS A;  2PVW A;  3DR8 A;  4UWI A;  4X2T A;  1TKH A;  2KCW A;  3DDD A;  1B6B A;  3KQX A;  4ZBG A;  3ISX A;  4F0X A;  2G3T A;  4NCZ A;  4X3R A;  4MBU A;  2PJ5 A;  4MY3 A;  1ARL A;  1FT7 A;  3NH8 A;  4B6Z A;  1VKC A;  1AYE A;  4A94 A;  1F2P A;  1KWM A;  4X8I A;  1RXT A;  3NFZ A;  1GHE A;  3A9L A;  1BPN A;  5F49 A;  5BWA B;  1L0C A;  2HQY A;  2PJB A;  2PJ9 A;  4JJX A;  4CRZ B;  4MMO A;  1BPM A;  2Z3P A;  3LOD A;  2B5G B;  3EFA A;  2GLJ A;  2V77 A;  2Z3N A;  4H2K A;  2YND A;  5HVG A;  1M4L A;  5I0C A;  4LQG A;  1LCP A;  2RB7 A;  5G20 A;  2FVG A;  1IB1 E;  8CPA A;  3R96 A;  2VBQ A;  4P6Y A;  4PQA A;  3CDX A;  4Q36 A;  2GIV A;  2C6G A;  2VZZ A;  1YLO A;  4CGM A;  1WWZ A;  2REF A;  1TKF A;  1Z8T A;  4B13 A;  1DE4 C;  3RYO A;  2P6F A;  4KUB A;  1S7F A;  1VIX A;  1S7N A;  4Q38 A;  4UFW A;  2PCU A;  3KGQ A;  1NSL A;  4CYO A;  2BL1 A;  1TF9 A;  3IWW A;  2QEC A;  3R1K A;  2B4D A;  2Z3L A;  1XRY A;  1Y7E A;  1AUG A;  4FD5 A;  4MCR A;  5LRJ A;  5JGF A;  2EUI A;  4XPD B;  4EVY A;  4UF4 A;  4FUU A;  1YK3 A;  4H6Z A;  1PUA A;  1XIX A;  4UFX A;  3FX6 A;  5AG6 A;  1IGB A;  2OZU A;  4OME A;  2Z0Z A;  4PXD A;  2DEA A;  4NGN A;  4AVB A;  4RUH A;  1S7L A;  2YGW A;  2Z3O A;  3C26 A;  4MFJ A;  4JXR A;  3TOA A;  3T90 A;  2ZEN A;  1KZF A;  2PJ4 A;  3B3C A;  3PP9 A;  4UEZ A;  4II9 A;  4OP4 A;  5HH1 A;  1LAN A;  5DWN A;  3GLJ A;  3S6G A;  1PU9 A;  2FSR A;  2Q44 A;  4R8F A;  1MJA A;  4UCP A;  4A31 A;  2CTB A;  4CAW A;  1M44 A;  4XPL A;  4Y49 B;  5J8F A;  5J1Q A;  2Q04 A;  3SJF A;  2PJ3 A;  2JLM A;  1Q7L A;  1QQ9 A;  3GY9 A;  3JVN A;  4NJQ A;  2Q51 A;  5LYI A;  3H8E A;  2OH1 A;  1QSN A;  1M4D A;  2PJ7 A;  1Y9K A;  1XFO A;  2YNC A;  3EC4 A;  4IUS A;  1XBU A;  4EME A;  4KZT A;  3PB4 X;  1Y9W A;  3B2Y A;  1KUX A;  2DF5 A;  2Q7S A;  2PJ0 A;  2ZW7 A;  1K4J A;  5LRG A;  3SHP A;  2POK A;  4OC5 A;  4MFQ A;  3D2M A;  3ISZ A;  3PBB A;  2X7B A;  1XMB A;  3TO9 A;  2ZEE A;  3FNC A;  2C6C A;  4KUA A;  1CP6 A;  3CXP A;  4WWV A;  1R3N A;  5ISV A;  3IWE A;  2Z3M A;  3KKW A;  4LQ6 A;  3WAB A;  4C68 A;  1ZG7 A;  4P45 A;  2D4P A;  2AFM A;  2PRQ A;  2Q4V A;  5G1Z A;  2B3V A;  2AE6 A;  4CGP A;  3BXM A;  1YLE A;  4CAV A;  2D4O A;  3EY5 A;  2HC9 A;  3W6S A;  3EO4 A;  1ELM P;  2EO8 A;  3N5F A;  4OAD A;  4F8Z A;  2DPS A;  3NA6 A;  1VHS A;  2PRB A;  1YGH A;  2FXF A;  3PGP A;  2B5G A;  1H8L A;  4FBE A;  2XEJ A;  3QAY A;  4QUS A;  3SJG A;  4YU9 A;  4UCM A;  4C2Y A;  3BLN A;  1YR0 A;  4NGR A;  3S6K A;  3B3V A;  3FIX A;  5IV0 A;  2EWB A;  3FYN A;  2PJC A;  4R3K A;  1F57 A;  3F5B A;  2BUE A;  4MY0 A;  3VAR A;  3QB8 A;  3NE7 A;  4UWJ A;  2I00 A;  4P4J A;  4PV6 A;  4M6H A;  3TO7 A;  4EWT A;  2IMO A;  4K3N A;  3S6H A;  2PJ2 A;  4R76 A;  1BLL E;  4KOT A;  3D3S A;  3BI1 A;  5IB0 A;  3QAH A;  1XE4 A;  2O53 A;  4QVT A;  2PC1 A;  2CIJ A;  2R98 A;  4NGS A;  4OC1 A;  5HMN A;  3IU1 A;  2ANP A;  4NEX A;  4G1P A;  2Q4Z A;  2BOA A;  4E0A A;  2ZEH A;  2EVN A;  1PCA A;  2ZW5 A;  2ZPA A;  5D8N A;  4OC2 A;  5K8O A;  2AFX A;  2Q43 A;  3WC7 A;  1LAP A;  1P4N A;  3SI2 A;  2F7V A;  1OBR A;  1Y0R A;  3UY5 A;  3TE4 A;  3TT2 A;  3FBU A;  3NH4 A;  4QBJ A;  4GM5 A;  3B3T A;  4WJB A;  1ARM A;  1UWY A;  1NE9 A;  2AFU A;  2YNE A;  4F0Y A;  2P6G A;  1VHE A;  4MHZ A;  3LWU A;  3LD2 A;  4OID A;  1IOI A;  4HPS A;  2JBJ A;  1X12 A;  3S9L A;  3N7Z A;  4C2Z A;  3D8P A;  2EK8 A;  4CYN A;  1AMP A;  1XMT A;  4JD6 A;  3WR7 A;  2PJA A;  2C6P A;  3PRT A;  1MJB A;  3PEI A;  3H8F A;  4GS4 A;  3RO0 A;  4AG7 A;  2R8V A;  3S9N A;  1KUY A;  2AFW A;  2HV2 A;  3QNV A;  1IYK A;  3E0K A;  3KHX A;  3PB6 X;  4A30 A;  1S3Z A;  4Y49 C;  3D4U A;  2GAN A;  3P2H A;  2BSW A;  3CPX A;  4XPK A;  3RNZ A;  3JUW A;  1JWQ A;  2JEW A;  4FD4 A;  2CTC A;  3DR6 A;  2ODF A;  4XNH B;  1IOF A;  4UIA A;  1FY7 A;  4CGN A;  1R43 A;  1MJ9 A;  1CM0 A;  2CNS A;  5A27 A;  6CPA A;  3MN8 A;  4KVO E;  2FIW A;  1YME A;  1EE3 P;  5C88 A;  2GLF A;  4JYW A;  1V0C A;  3KR4 A;  4ONU A;  1QSO A;  2VI7 A;  1YRE A;  2B58 A;  4CAX A;  5THW A;  1U6M A;  5K8P A;  2IJZ A;  2J8M A;  1MK4 A;  3KAS A;  4M6G A;  4PXE A;  5CPA A;  5HVF A;  1VGY A;  1LOK A;  3B7I A;  4B14 A;  5LRK A;  4I49 A;  3IGR A;  4NFR A;  5G22 A;  2HUZ A;  2V8G A;  3EXN A;  2ABZ A;  4UEF A;  1R57 A;  3B3S A;  1Z4E A;  4MFZ A;  1M4G A;  2WYR A;  4O23 A;  4OKO A;  3BHX A;  3FXT A;  5G21 A;  2CY2 A;  3FH4 A;  5HXD A;  2RFH A;  2BEI A;  2XEI A;  3VWE A;  2EK9 A;  1LRZ A;  2ZXV A;  4AG9 A;  3DSB A;  2XEG A;  2GRE A;  1XOV A;  2ZEL A;  4OC3 A;  4KLW A;  2PR8 A;  4NGP A;  4F9U A;  4UFV A;  1DTD A;  2WUU A;  2Q4Y A;  4MJ8 A;  3IO1 A;  5JM6 A;  5AG7 A;  2WPW A;  3W91 A;  3SJE A;  3OWC A;  1Z8L A;  2F8H A;  3VAT A;  2NMT A;  3PZJ A;  2HB6 A;  1ZLH A;  4PSX A;  1Z8X A;  4AVA A;  5F46 A;  4P44 A;  3GYA A;  4MFK A;  2GFQ A;  3R9F A;  3FMC A;  4DUK A;  2R1I A;  3FJU A;  2OZH A;  1P0H A;  2BO9 A;  2IQ6 A;  1ELL P;  4PXC A;  4H6U A;  2JDC A;  3L2N A;  1Q2Y A;  2A4N A;  3PB7 X;  3WT4 A;  3KI9 A;  2R7H A;  4UCN A;  4A2Z A;  2ZEG A;  2ZOF A;  4BMH A;  2PE3 A;  4YWY A;  1ZO0 A;  4ZGY B;  4C7I A;  2YNC C;  4OC0 A;  2C1C A;  2FS5 A;  3F8K A;  3VH9 A;  3IJ3 A;  3TTH A;  2QVP A;  4M85 A;  4YFJ A;  3B3W A;  4KOS A;  2ZEM A;  3JTK A;  5DWM A;  3TC8 A;  1Q2D A;  3D68 A;  3CZX A;  4LX9 A;  4P4I A;  3G8W A;  1N71 A;  4CGO A;  4RS2 A;  5C82 A;  3BJ8 A;  4AB7 A;  1IYL A;  3FEE A;  4KSA A;  2J8N A;  3BJ7 A;  1ON0 A;  2V8H A;  4KOX A;  4NGM A;  5CNP A;  1S60 A;  1CP7 A;  2ZED A;  4K30 A;  4RI1 A;  2ARH A;  1CJW A;  3IIB A;  2C27 A;  1CG2 A;  4UIB A;  2Q7B A;  3D7D A;  5JH9 A;  4MFP A;  4YRH A;  2GU2 A;  3T8W A;  5J8C A;  2F5I A;  4ZX8 A;  1Y7R A;  4XNH C;  4B12 A;  5F47 A;  1CPS A;  2JBK A;  4FD7 A;  4GXH A;  4OLL A;  2J9A A;  3D66 A;  5LYF A;  2G9D A;  2NSM A;  4E2A A;  4L8A A;  2V8V A;  4PK2 A;  4KS9 A;  4Q7A A;  2WSA A;  5EC4 A;  3VWD A;  5KTC A;  3GKR A;  4A95 A;  4MFL A;  2EBJ A;  3R9E A;  4MI4 A;  4A33 A;  2PJ6 A;  2P0W A;  3H8G A;  3LAC A;  3PB8 X;  4U9Z A;  5H86 A;  3R95 A;  4CAE A;  5F09 A;  5GCN A;  4X5K A;  5IB9 A;  2ZEF A;  4PPZ A;  1TF8 A;  3G3S A;  4B5P B;  2QIR A;  4KOY A;  4MHD A;  1IU8 A;  2VEZ A;  1A2Z A;  4FWU A;  3SXN A;  2ATR A;  4OC4 A;  4XPD C;  4ZY2 A;  1HEE A;  1I12 A;  4FD6 A;  1M4I A;  4TWE A;  2CNT A;  1NSA A;  4KVX A;  4CAF A;  2PJ1 A;  4UEE A;  4EFD A;  4IK2 A;  1J4J A;  1SQH A;  3LMS A;  4NGT A;  4A39 A;  2PDO A;  3H5Z A;  3P2F A;  1XF8 A;  2BCO A;  1YX0 A;  4KLV A;  5H84 A;  2FCK A;  1IIC A;  2PIY A;  4B11 A;  5AG5 A;  3V7Z A;  2O4H A;  3T9Y A;  5AG4 A;  4ONW A;  4MCQ A;  4ZY1 A;  3K2K A;  2CXA A;  2FL4 A;  4NXY A;  1RTQ A;  4CGL A;  2PVV A;  4HNX B;  5LYD A;  5D29 A;  2I79 A;  1I21 A;  1S7K A;  2OOT A;  3CXS A;  4CS0 B;  4W9Y A;  4B10 A;  4DYO A;  4M6I A;  1B87 A;  3TFY A;  3KL9 A;  4J3G A;  1I1D A;  3CPA A;  4U5Y A;  3SI0 A;  1S5K A;  2Q0Y A;  4HNW B;  4AXV A;  7CPA A;  1CBX A;  1Q2C A;  4A37 A;  1TKJ A;  3SJX A;  1Z5R A;  2OR4 A;  3SXO A;  4P4B A;  1Z2L A;  5ELY A;  3WC5 A;  1LAM A;  1X10 A;  1ZLI A;  2JDD A;  1LFW A;  3S9M A;  2Z3K A;  1YVO A;  3PB9 X;  2K5T A;  1NMT A;  1HDQ A;  4C2X A;  1PYT B;  2G3A A;  2RC4 A;  2I3C A;  4P4D A;  4ORF A;  3KQZ A;  3DGV A;  2PQ8 A;  2QYV A;  4KSF A;  4MHP A;  4TNU A;  5FVJ A;  3BI0 A;  3TO6 A;  2AJ6 A;  2VL1 A;  3K9U A;  2CNM A;  3ZJ0 A;  4DJL A;  5IX3 A;  4RN7 A;  3GB0 A;  4KOR A;  4BIN A;  2B4B A;  2IL4 A;  3I1U A;  4QB9 A;  3IFE A;  2DXQ A;  4KOW A;  4BD9 A;  1QSM A;  1YVK A;  1Y0Y A;  3FF3 A;  2AFZ A;  3RZA A;  1Z8W A;  5K8N A;  3WC6 A;  1BOB A;  2P6E A;  1F2O A;  1FNO A;  2QML A;  3H4Q A;  1WK4 A;  2PSW A;  3D7H A;  2J8R A;  2VQY A;  2QJ8 A;  3MRU A;  3KHZ A;  4OAE A;  2AFS A;  4B5P A;  5F48 A;  1Z9U A;  4MCP A;  3SI1 A;  2NYQ A;  4P10 A;  4C7H A;  4Z65 A;  4JXQ A;  3RBU A;  5A28 A;  2WPX A;  4JZ0 A;  2FIA A;  4L89 A;  3D67 A;  1BAV A;  1YQE A;  2Z11 A;  2REE A;  4IHM A;  4NGQ A;  3RAM A;  4ZYQ A;  5E96 A;  4LUA A;  3NH5 A;  1BO4 A;  4R57 A;  5EBV A;  4P4F A;  2PIZ A;  5DS0 A;  5LYL A;  1VHO A;  2ZEP A;  4AVC A;  1HDU A;  1XEB A;  3F0A A;  3R9G A;  2AFO A;  2ZEO A;  4M3S A;  4ZI6 A;  5JQ4 A;  1M1D A;  1JQG A;  1OZP A;  2OB0 A;  4R9M A;  2VXK A;  3DLJ A;  3GIU A;  3CXQ A;  3IC1 A;  3FVL A;  2V8D A;  2Y0M A;  4R7M A;  2G0B A;  3DNS A;  2OU2 A;  1RO5 A;  2ZW6 A;  3HLP A;  3I3G A;  4KOU A;  3S6F A;  1QST A;  5KTD A;  3PFO A;  3KZW A;  4CYP A;  4PSW A;  4E8O A;  4NSQ A;  1ZG8 A;  3D2P A;  1ZG9 A;  1QSR A;  5I4M A;  4ZY0 A;  4QC6 A;  3JRU A;  1CX8 A;  4YGO A;  3KR5 A;  4MRI A;  5KTA A;  4F9V A;  4KSI A;  4ZX9 A;  2FT0 A;  4JLY A;  4A38 A;  4UBR A;  1IID A;  3PFE A; 
#chains in the Genus database with same CATH homology
 2O28 A;  3FRM A;  4IF5 A;  3V8I A;  2B3U A;  3ZZI A;  4CRY B;  4B5O A;  4DNC A;  2PR1 A;  1TIQ A;  4KOV A;  2H5M A;  1Z4R A;  3FB3 A;  2B4D B;  2GE3 A;  2Z10 A;  2VZY A;  4BBH A;  1KUV A;  4A32 A;  4F6A A;  4R3L A;  2DPT A;  4HNY B;  2ZW4 A;  4U9Y A;  3IWG A;  3B8G A;  4NF1 A;  2OZG A;  4UA3 A;  4CYQ A;  4PK3 A;  2JEV A;  4KVM E;  3TCV A;  3MGD A;  4R87 A;  3TOB A;  3I9S A;  4H89 A;  5AGE A;  3IU2 A;  5JPH A;  4JWP A;  2FE7 A;  4HKF A;  3W6X A;  1UFH A;  3DR8 A;  4UWI A;  2KCW A;  3DDD A;  1B6B A;  4ZBG A;  4F0X A;  2G3T A;  4NCZ A;  4MBU A;  4MY3 A;  1VKC A;  1RXT A;  1GHE A;  3A9L A;  5F49 A;  5BWA B;  1L0C A;  2HQY A;  4JJX A;  4CRZ B;  2Z3P A;  3LOD A;  2B5G B;  3EFA A;  2Z3N A;  2YND A;  5I0C A;  5G20 A;  1IB1 E;  3R96 A;  2VBQ A;  4Q36 A;  4CGM A;  2GIV A;  2VZZ A;  1WWZ A;  2REF A;  4B13 A;  3RYO A;  2P6F A;  4KUB A;  1S7F A;  4UFW A;  1S7N A;  4Q38 A;  4CYO A;  1NSL A;  2BL1 A;  2QEC A;  3R1K A;  2B4D A;  2Z3L A;  4FD5 A;  2EUI A;  4XPD B;  4EVY A;  1YK3 A;  4H6Z A;  1PUA A;  1XIX A;  4UFX A;  5AG6 A;  2OZU A;  2Z0Z A;  4AVB A;  1S7L A;  2YGW A;  2Z3O A;  3C26 A;  4MFJ A;  4JXR A;  3TOA A;  3T90 A;  1KZF A;  3PP9 A;  4II9 A;  5HH1 A;  5DWN A;  3S6G A;  1PU9 A;  2FSR A;  2Q44 A;  1MJA A;  4UCP A;  4A31 A;  4CAW A;  1M44 A;  4XPL A;  4Y49 B;  5J8F A;  2Q04 A;  2JLM A;  3GY9 A;  3JVN A;  2OH1 A;  1QSN A;  1M4D A;  1Y9K A;  2YNC A;  3EC4 A;  4IUS A;  4KZT A;  1Y9W A;  1KUX A;  2ZW7 A;  1K4J A;  3SHP A;  4MFQ A;  3D2M A;  2X7B A;  3TO9 A;  3FNC A;  4KUA A;  3CXP A;  5ISV A;  3IWE A;  2Z3M A;  3KKW A;  4C68 A;  2D4P A;  5G1Z A;  2Q4V A;  2B3V A;  2AE6 A;  4CGP A;  1YLE A;  4CAV A;  2D4O A;  3EY5 A;  3W6S A;  3EO4 A;  4OAD A;  2DPS A;  1VHS A;  2PRB A;  1YGH A;  2FXF A;  3PGP A;  2B5G A;  4QUS A;  4UCM A;  4C2Y A;  3BLN A;  1YR0 A;  3S6K A;  3FIX A;  5IV0 A;  3FYN A;  4R3K A;  3F5B A;  2BUE A;  4MY0 A;  3QB8 A;  3NE7 A;  4UWJ A;  2I00 A;  4PV6 A;  3TO7 A;  3S6H A;  4KOT A;  3D3S A;  5IB0 A;  3QAH A;  1XE4 A;  4QVT A;  2PC1 A;  2R98 A;  5HMN A;  3IU1 A;  4NEX A;  4E0A A;  2EVN A;  2ZW5 A;  2ZPA A;  1P4N A;  3UY5 A;  3TE4 A;  3TT2 A;  3FBU A;  4QBJ A;  1NE9 A;  2YNE A;  4F0Y A;  2P6G A;  3LD2 A;  3N7Z A;  4C2Z A;  3D8P A;  4CYN A;  1XMT A;  4JD6 A;  3WR7 A;  1MJB A;  4GS4 A;  4AG7 A;  2R8V A;  1KUY A;  2HV2 A;  1IYK A;  3E0K A;  4A30 A;  1S3Z A;  4Y49 C;  2GAN A;  3P2H A;  2BSW A;  4XPK A;  3JUW A;  4FD4 A;  3DR6 A;  4XNH B;  1FY7 A;  4CGN A;  1MJ9 A;  1CM0 A;  2CNS A;  5A27 A;  4KVO E;  2FIW A;  5C88 A;  1V0C A;  4ONU A;  1QSO A;  2VI7 A;  1YRE A;  2B58 A;  4CAX A;  1U6M A;  2J8M A;  1MK4 A;  4B14 A;  4I49 A;  3IGR A;  5G22 A;  2HUZ A;  3EXN A;  1R57 A;  1Z4E A;  4MFZ A;  1M4G A;  3FXT A;  5G21 A;  2CY2 A;  2BEI A;  3VWE A;  1LRZ A;  2ZXV A;  4AG9 A;  3DSB A;  4KLW A;  2PR8 A;  4UFV A;  2WUU A;  2Q4Y A;  4MJ8 A;  5AG7 A;  2WPW A;  3W91 A;  3OWC A;  2NMT A;  3PZJ A;  4PSX A;  4AVA A;  5F46 A;  3GYA A;  4MFK A;  3R9F A;  2R1I A;  2OZH A;  1P0H A;  4H6U A;  2JDC A;  1Q2Y A;  2A4N A;  4UCN A;  2R7H A;  4A2Z A;  4BMH A;  4ZGY B;  1ZO0 A;  4C7I A;  2YNC C;  2FS5 A;  3F8K A;  3TTH A;  4M85 A;  4YFJ A;  4KOS A;  3JTK A;  5DWM A;  1Q2D A;  4LX9 A;  3G8W A;  1N71 A;  4CGO A;  4RS2 A;  5C82 A;  3BJ8 A;  4AB7 A;  1IYL A;  4KSA A;  2J8N A;  3BJ7 A;  1ON0 A;  4KOX A;  5CNP A;  1S60 A;  4K30 A;  4RI1 A;  2ARH A;  1CJW A;  2C27 A;  2Q7B A;  4MFP A;  4YRH A;  5J8C A;  2F5I A;  1Y7R A;  4XNH C;  4B12 A;  5F47 A;  4FD7 A;  4OLL A;  4E2A A;  4L8A A;  5KTC A;  4PK2 A;  4KS9 A;  3VWD A;  2WSA A;  5EC4 A;  3GKR A;  4A95 A;  4MFL A;  3R9E A;  4MI4 A;  4A33 A;  2P0W A;  5H86 A;  4U9Z A;  3R95 A;  4CAE A;  5GCN A;  4X5K A;  3G3S A;  4B5P B;  2QIR A;  4KOY A;  4MHD A;  2VEZ A;  3SXN A;  2ATR A;  4XPD C;  1I12 A;  4FD6 A;  1M4I A;  2CNT A;  4KVX A;  4CAF A;  1J4J A;  1SQH A;  2PDO A;  3H5Z A;  3P2F A;  1XF8 A;  1YX0 A;  4KLV A;  5H84 A;  2FCK A;  1IIC A;  4B11 A;  5AG5 A;  3T9Y A;  5AG4 A;  2CXA A;  2FL4 A;  4NXY A;  4CGL A;  4HNX B;  2I79 A;  1I21 A;  1S7K A;  3CXS A;  4CS0 B;  4B10 A;  1B87 A;  3TFY A;  4J3G A;  1I1D A;  4U5Y A;  1S5K A;  2Q0Y A;  4HNW B;  1Q2C A;  3SXO A;  2JDD A;  2Z3K A;  1YVO A;  2K5T A;  1NMT A;  4C2X A;  2G3A A;  2RC4 A;  4ORF A;  2PQ8 A;  4KSF A;  5FVJ A;  3TO6 A;  2AJ6 A;  3K9U A;  2CNM A;  3ZJ0 A;  5IX3 A;  4KOR A;  2B4B A;  2IL4 A;  4QB9 A;  2DXQ A;  4KOW A;  1QSM A;  1YVK A;  1BOB A;  2P6E A;  2QML A;  3H4Q A;  1WK4 A;  2PSW A;  4B5P A;  2J8R A;  2VQY A;  4OAE A;  5F48 A;  1Z9U A;  4C7H A;  4JXQ A;  5A28 A;  2WPX A;  4L89 A;  2FIA A;  2Z11 A;  2REE A;  5E96 A;  4LUA A;  1BO4 A;  4R57 A;  5EBV A;  4AVC A;  1XEB A;  3F0A A;  3R9G A;  4M3S A;  5JQ4 A;  1M1D A;  1OZP A;  2OB0 A;  4R9M A;  2VXK A;  3CXQ A;  2Y0M A;  2G0B A;  3DNS A;  2OU2 A;  1RO5 A;  2ZW6 A;  3I3G A;  4KOU A;  3S6F A;  5KTD A;  1QST A;  4CYP A;  4PSW A;  4E8O A;  4NSQ A;  3D2P A;  1QSR A;  4QC6 A;  4YGO A;  5KTA A;  2FT0 A;  4JLY A;  4UBR A;  1IID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...