4KOXA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefalotin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4koxA00
4KZTA 2GIVA 2NMTA 4H6ZA 1QSNA 4F0YA 1I12A 4OADA 2PDOA 1YGHA 2ARHA 3CXSA 2BL1A 1YREA 2GE3A 1MJBA 3BLNA 3DSBA 4Y49C 4OLLA 5HMNA 4IF5A 1VKCA 3TT2A 1KUYA 1VHSA 4PK2A 4E8OA 2FE7A 2QECA 3TO6A 2R7HA 4R3LA 3TTHA 4M85A 4XPKA 2PR8A 3TO9A 5HH1A 2ZW6A 3G3SA 3T9YA 4KVXA 2BUEA 3IWGA 3JUWA 3P2HA 3R95A 4UA3A 1YX0A 5GCNA 5H86A 4KOUA 4K30A 2OU2A 2PC1A 1CJWA 4HNYB 4QB9A 2OB0A 2B58A 2FSRA 2R8VA 5F46A 4QBJA 4AG7A 4RS2A 1YLEA 4LUAA 4KOSA 5E96A 4JXQA 3P2FA 2Q04A 1IYKA 2F5IA 4AG9A 3SXNA 3FXTA 2IL4A 3VWDA 1S7KA 1TIQA 4YFJA 4MJ8A 1QSRA 3G8WA 1KUVA 2JLMA 2P6GA 1PUAA 1NE9A 2VXKA 2VZZA 2JEVA 3IGRA 3CXPA 1XMTA 3B8GA 4MHDA 4MI4A 1MK4A 4FD5A 1XEBA 4H6UA 1KUXA 2B5GA 4II9A 3R1KA 4MBUA 4L8AA 2H5MA 1YR0A 2D4PA 1NSLA 3E0KA 1KZFA 2EVNA 4J3GA 2C27A 2PRBA 5EBVA 2PSWA 2OZHA 2Q44A 1B6BA 1Q2DA 1YK3A 4MY0A 1Z4EA 3S6GA 3K9UA 2P6EA 5EC4A 3GYAA 4UBRA 4KOVA 1YVKA 2BSWA 2J8MA 4PV6A 4XNHB 3S6HA 5J8FA 2Q4YA 2R1IA 3EFAA 1M4DA 1S5KA 1S7LA 3LODA 4QUSA 1ON0A 2OH1A 4CAXA 4E2AA 1IICA 2Y0MA 3R9FA 1IB1E 2FL4A 1Q2CA 4CAWA 1S7NA 3ZZIA 4U9YA 5C88A 1OZPA 2ZW5A 3NE7A 2KCWA 1GHEA 4PSXA 4R57A 3FYNA 4YGOA 3SHPA 1Y7RA 1FY7A 4NCZA 2X7BA 4GS4A 2HV2A 2REFA 2VBQA 2CY2A 3KKWA 2Q7BA 3RYOA 3FRMA 3V8IA 4H89A 4PK3A 1V0CA 2O28A 4QC6A 2D4OA 2Q4VA 3DR8A 4KVOE 2FT0A 5KTDA 3GKRA 4B5PB 3I9SA 1S3ZA 2K5TA 2B4DB 4KLVA 1BOBA 2CNSA 4LX9A 3LD2A 4HNXB 3TOAA 2B4BA 3ZJ0A 3SXOA 2G3AA 4F6AA 3FBUA 1QSOA 2ZXVA 3EO4A 2Z10A 4JLYA 4AB7A 3TOBA 1S60A 1K4JA 2QMLA 4JJXA 3I3GA 4NF1A 4PSWA 2B3UA 1N71A 4CRZB 1P4NA 2Z11A 5CNPA 1MJAA 1Y9KA 3DNSA 1MJ9A 1PU9A 2ATRA 3R9EA 4R87A 2P0WA 5J8CA 1I21A 2I00A 2WPWA 4XPLA 1SQHA 4UWJA 1XIXA 5ISVA 2OZUA 4KUAA 4IUSA 4KUBA 2FIWA 2EUIA 4ORFA 1WK4A 2VEZA 5F49A 3D8PA 4ZBGA 4ONUA 3R9GA 4CRYB 2R98A 2RC4A 4KORA 2PQ8A 4M3SA 2AE6A 4NEXA 1R57A 3S6FA 3EY5A 4OAEA 4CAVA 1CM0A 2GANA 4I49A 2J8RA 4BMHA 5IX3A 5KTAA 1XF8A 2VI7A 1QSMA 4CS0B 2FS5A 2AJ6A 3D2MA 4NXYA 2BEIA 1B87A 5F48A 4AVBA 3TCVA 5FVJA 1QSTA 1L0CA 3WR7A 3MGDA 1IYLA 3CXQA 3PZJA 2J8NA 2CNMA 3D3SA 2P6FA 4EVYA 4FD7A 3R96A 4KOXA 4DNCA 1RXTA 2OZGA 5KTCA 5JPHA 2QIRA 1Y9WA 2FCKA 2REEA 4XPDB 1LRZA 4HKFA 4YRHA 1J4JA 1NMTA 4AVAA 5IV0A 2G3TA 3F5BA 4R3KA 2CNTA 3FNCA 5DWNA 4XNHC 3PP9A 4X5KA 4U9ZA 3VWEA 5I0CA 3GY9A 1Z4RA 2I79A 4FD6A 4UWIA 3W6SA 1S7FA 1M4IA 5JQ4A 4U5YA 3TO7A 4KOWA 1M4GA 2PR1A 3W6XA 2Z0ZA 4QVTA 1U6MA 4RI1A 5DWMA 4B5OA 4B5PA 2ZW7A 4JD6A 2B4DA 2A4NA 3F0AA 2FIAA 4XPDC 4KOYA 3PGPA 1Z9UA 4JXRA 1WWZA 2HUZA 2FXFA 4R9MA 3D2PA 3JVNA 3C26A 2ZPAA 3EC4A 3DR6A 1RO5A 2B3VA 3W91A 2WPXA 3DDDA 3FB3A 3TE4A 3EXNA 1M1DA 1P0HA 1IIDA 2B5GB 1BO4A 4NSQA 4L89A 5IB0A 1UFHA 5C82A 3OWCA 3QAHA 4KOTA 3T90A 4MY3A 2JDDA 2DXQA 3N7ZA 5H84A 4KVME 3S6KA 3UY5A 4AVCA 2JDCA 3QB8A 4Y49B 4FD4A 5F47A 1Q2YA 3H4QA 1I1DA 2VQYA 1XE4A 3BJ7A 4E0AA 1YVOA 2VZYA 1M44A 2ZW4A 2Q0YA 4HNWB 4KLWA 3TFYA 2HQYA 3F8KA 3FIXA 2G0BA 3BJ8A 4JWPA
chains in the Genus database with same CATH superfamily
1F57A 3B2YA 4KZTA 3RNZA 2I3CA 2GIVA 4H2KA 3NA6A 4ZGYB 6CPAA 4EFDA 2NMTA 4H6ZA 2PJ9A 1QSNA 2EK8A 5AG7A 4F0YA 1I12A 4OMEA 1CG2A 4OADA 2PDOA 4P4JA 4DJLA 1YGHA 2ARHA 4ZYQA 3CXSA 2G9DA 2BL1A 4OC5A 3PB9X 1YREA 2GE3A 1Q7LA 1MJBA 4OIWA 3BLNA 3DSBA 3VH9A 4P4EA 4Y49C 1PCAA 1ZG9A 2PJ0A 5CPAA 1BPNA 3KHXA 3I1UA 3KASA 4RN7A 4NGNA 1IU8A 2C6CA 4OLLA 3SJFA 3H8EA 5HMNA 4C7IA 5HVGA 4IF5A 4M6HA 1VKCA 2ZELA 4FWUA 3TT2A 4EWTA 1KUYA 1VHSA 4PK2A 4E8OA 2FE7A 4OIDA 4UFWA 2QECA 3TO6A 2R7HA 4KSAA 4MFPA 4R3LA 1AYEA 2BCOA 4UFVA 3TTHA 4ZI6A 3IEHA 4M85A 4XPKA 1ARMA 2PR8A 3TO9A 3VARA 2ODFA 5HH1A 3D7DA 2ZW6A 1LFWA 3G3SA 4NJRA 3T9YA 3PB4X 3L2NA 4Q36A 4KVXA 4NGRA 2BUEA 3IWGA 3JUWA 3HLPA 3P2HA 3R95A 2ZEPA 4UA3A 1YX0A 4UCPA 5GCNA 3B3SA 5H86A 1RTQA 3CPXA 4KOUA 2OU2A 3MRUA 4K30A 2PC1A 1CJWA 4HNYB 3PFEA 2OB0A 4MMOA 3LACA 2B58A 2FSRA 4QB9A 4UEEA 3B3CA 2R8VA 1H8LA 3KR4A 3KZWA 5F46A 3B3VA 3GUXA 4QBJA 3CDXA 2NYQA 1BLLE 4MFJA 4OC4A 4AG7A 4RS2A 1YLEA 2ZEMA 3IC1A 4LUAA 2CXAA 4KOSA 5E96A 1CP6A 3VATA 4JXQA 3P2FA 2JEWA 4CAFA 1Z2LA 2Q04A 4OC0A 4W9YA 1IYKA 3MN8A 3KHZA 2F5IA 1GYTA 4AG9A 4OC3A 1Z8XA 3FXTA 2IL4A 2PJ7A 3SI1A 1X10A 1LCPA 1S7KA 3DGVA 3NH8A 3VWDA 1TIQA 4YFJA 4MJ8A 4UEZA 1QSRA 5K8NA 1YLOA 3H5ZA 3KQXA 1LANA 3G8WA 1KUVA 2EWBA 2JLMA 4A32A 4IAVA 4C2XA 3GIUA 4OKOA 2P6GA 5HVHA 1PUAA 1NE9A 4G1PA 1JWQA 2Z3MA 1LAPA 2VXKA 2VZZA 2JBJA 2ABZA 1CX8A 2JEVA 4MFLA 3NH4A 3IGRA 4A39A 1VHOA 1XMTA 3CXPA 3NH5A 4F8ZA 2HC9A 1TKJA 2Q51A 1LAMA 3B8GA 4MHDA 4MI4A 5AG4A 2PVVA 1MK4A 4FD5A 3V7ZA 2GFQA 4B14A 5JGFA 2PJ4A 1XMBA 4TWEA 1XEBA 2IJZA 4FAIA 4H6UA 1KUXA 4NGPA 5JM6A 2B5GA 4II9A 3R1KA 4MBUA 4L8AA 2H5MA 3PBBA 3FVLA 1YR0A 4UIAA 4A2ZA 2D4PA 1IOFA 1HEEA 5LRJA 4NGTA 1NSLA 3E0KA 3IO1A 1KZFA 4R8FA 2EVNA 5KTAA 4C2YA 4J3GA 2C27A 2PRBA 4FBEA 1LOKA 4K3NA 4KSFA 5EBVA 5A28A 4Q7AA 2F8HA 2PSWA 4MHPA 7CPAA 3N5FA 2OZHA 2Q44A 4MCSA 2CTCA 3B7IA 1FNOA 1B6BA 2WUUA 2V8VA 4PXDA 1Q2DA 1QQ9A 2V8DA 1YK3A 2YNDA 4MY0A 4C68A 1Z4EA 3KR5A 3S6GA 3K9UA 2P6EA 5EC4A 3GYAA 1TXRA 4UBRA 4A95A 4KOVA 1YVKA 4CGMA 2BSWA 2J8MA 2PRQA 3B3WA 4PV6A 4XNHB 3S6HA 2Q4YA 5EMIA 1HDUA 5J8FA 1KWMA 4F9VA 2R1IA 2XEJA 4GXHA 4CYNA 5LYFA 5K8MA 3EFAA 1M4DA 1S5KA 1S7LA 2GREA 3SI0A 3LODA 4QUSA 1ON0A 4MCRA 2OH1A 1XJOA 4CAXA 4E2AA 1Y0YA 1IICA 2C6GA 2PJ8A 2Y0MA 1CBXA 5D29A 3FJUA 3R9FA 4P45A 2XEGA 2XEFA 1YSJA 1IB1E 2FL4A 1Q2CA 2Z3LA 2Z3KA 4CAWA 2ANPA 3LMSA 5AG6A 3SJGA 4A31A 1S7NA 4P4FA 3ZZIA 1AMPA 4U9YA 4CGNA 3TX8A 5C88A 1OZPA 2ZW5A 3NE7A 2KCWA 1GHEA 1R43A 2PJ2A 3FYNA 4LQGA 4PSXA 4R57A 4YGOA 3SHPA 4BBHA 1Y7RA 1FY7A 2Z3NA 2X7BA 4NCZA 1Z8LA 3S9MA 4GS4A 2HV2A 2REFA 2VBQA 3A9LA 3BI1A 1TKFA 2IMOA 4ZX8A 1ZG7A 2CY2A 3ISZA 3KKWA 2O4HA 1IOIA 4F0XA 5THWA 4CAEA 5LRKA 3FMCA 2Q7BA 3GLJA 3RYOA 3FRMA 3D66A 2BOAA 3V8IA 4H89A 2VL1A 5BWAB 4MCPA 4PK3A 2YNEA 1V0CA 2O28A 4KSIA 1XRYA 3IWWA 2PJ5A 4CPAA 4QC6A 2D4OA 2BO9A 1F2OA 1UWYA 1YQEA 2Q4VA 4PXBA 4Z65A 3LWUA 3DR8A 3ISXA 4ONWA 2CF4A 4KVOE 2FT0A 5KTDA 3GKRA 4B5PB 3I9SA 3V38A 2PJCA 1S3ZA 2EK9A 2AFMA 2C6PA 3WC5A 2K5TA 1ZO0A 5G20A 2B4DB 2ZOFA 1BOBA 3FECA 4KLVA 4WJBA 3T8WA 3WC7A 1AUGA 4YU9A 2CNSA 4LX9A 5DS0A 3LD2A 3NFZA 4HNXB 3TOAA 2B4BA 3ZJ0A 3SXOA 3PEIA 3TC8A 4R6TA 2G3AA 2ZEDA 3CPAA 4F6AA 3D7FA 1IY7A 3RAMA 4PXCA 3FBUA 1QSOA 2ZXVA 1YW4A 4Q38A 1Z8TA 1XOVA 3EO4A 2Z10A 2ZENA 4JLYA 4AB7A 3TOBA 1S60A 3SXNA 1K4JA 2QMLA 3FX6A 4JJXA 3KI9A 3I3GA 4NGQA 4NF1A 4A33A 3BI0A 3GB0A 4PSWA 2B3UA 1N71A 4UFXA 4CRZB 1P4NA 2Z11A 5CNPA 1MJAA 1Y9KA 3DNSA 1MJ9A 1PU9A 1PYTB 2XEIA 3DLJA 3QAYA 2ATRA 2OOTA 3R9EA 4R87A 2P0WA 2ZEOA 5G21A 1A2ZA 5J8CA 1I21A 2I00A 4C7HA 2WPWA 4XPLA 3IJ3A 1SQHA 4UWJA 4OP4A 1XIXA 2AFUA 3PB7X 5ISVA 2J9AA 2OZUA 1ZG8A 2RFHA 5D8NA 3SJXA 4KUAA 2PJ3A 4YWYA 2Q43A 4IUSA 4KUBA 2FIWA 2EUIA 4MCQA 4MFKA 4ORFA 1WK4A 2VEZA 3BXMA 2EBJA 5JH9A 5F49A 3D8PA 4PXEA 4ONUA 4ZBGA 3R9GA 4CRYB 2QVPA 3IU1A 4F9UA 3S9LA 2R98A 4UCNA 2RC4A 4KORA 2ZOGA 1JQGA 2PQ8A 3CZXA 2PVWA 4M3SA 2AE6A 4NEXA 5G22A 1R57A 3S6FA 1IGBA 4ZY0A 4R76A 2DPSA 3EY5A 4OAEA 2NSMA 3NE8A 4OC1A 4CAVA 1ELMP 2HB6A 1CM0A 2GANA 2PJ6A 2J8RA 4I49A 3D4UA 4MXUA 4BMHA 3IIBA 5IX3A 4ZX9A 4O23A 4IK2A 2GLFA 4CYPA 4DUKA 1XF8A 5F09A 5J1QA 2VI7A 1QSMA 4PPZA 4CS0B 2FS5A 2AJ6A 4CYOA 2QYVA 3D2MA 4NXYA 2BEIA 1B87A 5F48A 4A38A 4AVBA 3QNVA 3TCVA 5FVJA 5HXDA 3S9NA 1ELLP 3H8FA 1QMUA 1QSTA 1L0CA 1DE4C 3WR7A 1ZLIA 1IYLA 3CXQA 3MGDA 1VIXA 3PZJA 2J8NA 4MHNA 1TKHA 2CNMA 3D3SA 3HUVA 2P6FA 1YMEA 2PJ1A 2AFXA 2DF5A 3D67A 5A27A 4EVYA 2AFOA 4FD7A 3R96A 4KOXA 2Z3OA 5LRGA 4DNCA 3KL9A 2V77A 2GLJA 2O53A 2OZGA 1RXTA 4MFZA 5KTCA 5JPHA 2QIRA 1Y9WA 2FCKA 2YNCA 2AFSA 2REEA 4XPDB 1LRZA 3IFEA 1CPXA 4HKFA 2V8HA 4YRHA 3PB6X 2Q7SA 4CGPA 1J4JA 1NMTA 2F7VA 3WT4A 8CPAA 4TNUA 3B3TA 3SJEA 4AVAA 5IV0A 2G3TA 3F5BA 2PIZA 4B12A 1NSAA 4R3KA 2CNTA 3FNCA 1VHEA 5DWNA 4XNHC 3IU2A 3PP9A 4X5KA 4DYOA 3WC6A 2PE3A 4B13A 4R7MA 4U9ZA 3WABA 3D7HA 3JTKA 3VWEA 5I0CA 1XFOA 3GY9A 2EO8A 3CT9A 4P44A 4C2ZA 1Z4RA 4P4BA 1HDQA 4RUHA 2I79A 2QJ8A 4FD6A 4P6YA 4UWIA 3SI2A 3W6SA 1S7FA 3RO0A 3D7GA 1M4IA 2WZNA 2JBKA 5LYLA 5JQ4A 4U5YA 2ZEHA 3TO7A 4B10A 4KOWA 2YNCC 1M4GA 2PR1A 3W6XA 2Z0ZA 3IWEA 4QVTA 1CP7A 4JYWA 1U6MA 3FH4A 1TF9A 4WWVA 4RI1A 5DWMA 3RZAA 2ZEFA 3PB8X 4B5OA 4B5PA 2DPTA 2Z3PA 5AGEA 1FT7A 2ZW7A 4JD6A 3FF3A 2B4DA 2A4NA 3F0AA 2FIAA 1YW6A 3B35A 4M6GA 5ELYA 5K8OA 4UIBA 4XPDC 3PFOA 4KOYA 1ZLHA 3PGPA 4ZY2A 5LYDA 4B6ZA 1Z8WA 1Z9UA 2OR4A 3JRUA 4JXRA 4EMEA 2CIJA 2ZEEA 2YGWA 3D68A 4X2TA 1WWZA 1TF8A 3K9TA 2WYRA 2PCUA 1CPSA 2HUZA 4A94A 4ZY1A 2FXFA 4R9MA 1Y7EA 2IQ6A 3D2PA 4CYQA 4MRIA 3JVNA 1Z5RA 3C26A 4PQAA 2ZPAA 4IHMA 5LYIA 3EC4A 3KGQA 1ARLA 3DR6A 1RO5A 2B3VA 4MFQA 1XBUA 3W91A 2WPXA 1X12A 3DDDA 4NGMA 2AFZA 5CBMA 2PJAA 3FB3A 3FEEA 4HPSA 3TE4A 3EXNA 1M1DA 1P0HA 1IIDA 4LQ6A 2B5GB 4X3RA 1DTDA 1Y0RA 1BO4A 2PIYA 2C1CA 5HVFA 2CTBA 4NSQA 4P4IA 2ZEGA 4L89A 3KQZA 2V8GA 5I4MA 5IB0A 4NJQA 2RB7A 1UFHA 5C82A 3OWCA 4KS9A 2PJBA 3QAHA 3RBUA 4KOTA 4A30A 3T90A 4P10A 4MY3A 4NFRA 4UCMA 3BHXA 2JDDA 5K8PA 2DXQA 3N7ZA 5H84A 4AXVA 2GU2A 3K2KA 4KVME 3S6KA 4CGOA 1BPMA 2POKA 3PBEA 4FUUA 4UEFA 4UF4A 2Q4ZA 3UY5A 3PRTA 4AVCA 2JDCA 3QB8A 3FEDA 4Y49B 1EE3P 2DEAA 1BAVA 1F2PA 1OBRA 1Q2YA 3H4QA 4FD4A 5F47A 1I1DA 1R3NA 2AFWA 2VQYA 1XE4A 3BJ7A 4E0AA 4B11A 1M4LA 1YVOA 4MHZA 4OC2A 4BD9A 4GM5A 2VZYA 5IB9A 1M44A 2WSAA 2ZW4A 3H8GA 4P4DA 1VGYA 2Q0YA 5AG5A 4HNWB 5G1ZA 4KLWA 4NGSA 3TFYA 2HQYA 4MHYA 2FVGA 3F8KA 3FIXA 4JZ0A 4M6IA 4X8IA 2G0BA 4CGLA 3BJ8A 4JWPA 4BINA 4A37A
chains in the Genus database with same CATH topology
4KZTA 2GIVA 4ZGYB 2NMTA 4H6ZA 5AG7A 1QSNA 4F0YA 1I12A 4OADA 2PDOA 1YGHA 2ARHA 3CXSA 2BL1A 1YREA 2GE3A 1MJBA 3BLNA 3DSBA 4Y49C 4OLLA 5HMNA 4C7IA 4IF5A 1VKCA 3TT2A 1KUYA 1VHSA 4PK2A 4E8OA 2FE7A 4UFWA 2QECA 3TO6A 2R7HA 4KSAA 4MFPA 4R3LA 4UFVA 3TTHA 4M85A 4XPKA 2PR8A 3TO9A 5HH1A 2ZW6A 3G3SA 3T9YA 4Q36A 4KVXA 2BUEA 3IWGA 3JUWA 3P2HA 3R95A 4UA3A 1YX0A 4UCPA 5GCNA 5H86A 4KOUA 2OU2A 4K30A 2PC1A 4HNYB 1CJWA 4QB9A 2OB0A 2B58A 2FSRA 2R8VA 5F46A 4QBJA 4MFJA 4AG7A 4RS2A 1YLEA 4LUAA 2CXAA 4KOSA 5E96A 4JXQA 3P2FA 4CAFA 2Q04A 1IYKA 2F5IA 4AG9A 3SXNA 3FXTA 2IL4A 3VWDA 1S7KA 1TIQA 4YFJA 4MJ8A 1QSRA 3H5ZA 3G8WA 1KUVA 2JLMA 4A32A 4C2XA 2P6GA 1PUAA 1NE9A 2Z3MA 2VXKA 2VZZA 4MFLA 2JEVA 3IGRA 3CXPA 1XMTA 3B8GA 4MHDA 4MI4A 5AG4A 1MK4A 4FD5A 4B14A 1XEBA 4H6UA 1KUXA 2B5GA 4II9A 3R1KA 4MBUA 4L8AA 2H5MA 1YR0A 4A2ZA 2D4PA 1NSLA 3E0KA 1KZFA 2EVNA 4C2YA 4J3GA 2C27A 2PRBA 4KSFA 5EBVA 5A28A 2PSWA 2OZHA 2Q44A 1B6BA 2WUUA 1Q2DA 1YK3A 2YNDA 4MY0A 4C68A 1Z4EA 3S6GA 3K9UA 2P6EA 5EC4A 3GYAA 4UBRA 4A95A 4KOVA 1YVKA 4CGMA 2BSWA 2J8MA 4PV6A 4XNHB 3S6HA 5J8FA 2Q4YA 2R1IA 4CYNA 3EFAA 1M4DA 1S5KA 1S7LA 3LODA 4QUSA 1ON0A 2OH1A 4CAXA 4E2AA 1IICA 2Y0MA 3R9FA 1IB1E 2FL4A 1Q2CA 2Z3LA 2Z3KA 4CAWA 5AG6A 4A31A 1S7NA 3ZZIA 4U9YA 4CGNA 5C88A 1OZPA 2ZW5A 3NE7A 2KCWA 1GHEA 4PSXA 4R57A 3FYNA 4YGOA 4BBHA 3SHPA 1Y7RA 1FY7A 2Z3NA 2X7BA 4NCZA 4GS4A 2HV2A 2REFA 2VBQA 3A9LA 2CY2A 3KKWA 4F0XA 4CAEA 2Q7BA 3RYOA 3FRMA 3V8IA 4H89A 5BWAB 4PK3A 2YNEA 1V0CA 2O28A 4QC6A 2D4OA 2Q4VA 3DR8A 4KVOE 2FT0A 5KTDA 3GKRA 4B5PB 3I9SA 1S3ZA 2K5TA 1ZO0A 5G20A 2B4DB 4KLVA 1BOBA 2CNSA 4LX9A 3LD2A 4HNXB 3TOAA 2B4BA 3ZJ0A 3SXOA 2G3AA 4F6AA 3FBUA 1QSOA 2ZXVA 4Q38A 3EO4A 2Z10A 4JLYA 4AB7A 3TOBA 1S60A 1K4JA 2QMLA 4JJXA 3I3GA 4NF1A 4A33A 4PSWA 2B3UA 1N71A 4UFXA 4CRZB 1P4NA 2Z11A 5CNPA 1MJAA 1Y9KA 3DNSA 1MJ9A 1PU9A 2ATRA 3R9EA 4R87A 2P0WA 5G21A 5J8CA 1I21A 2I00A 4C7HA 2WPWA 4XPLA 1SQHA 4UWJA 1XIXA 5ISVA 2OZUA 4KUAA 4IUSA 4KUBA 2FIWA 2EUIA 4MFKA 4ORFA 1WK4A 2VEZA 5F49A 3D8PA 4ZBGA 4ONUA 3R9GA 4CRYB 3IU1A 2R98A 4UCNA 2RC4A 4KORA 2PQ8A 5G22A 4M3SA 2AE6A 4NEXA 1R57A 3S6FA 2DPSA 3EY5A 4OAEA 4CAVA 1CM0A 2GANA 4I49A 2J8RA 4BMHA 5IX3A 5KTAA 4CYPA 1XF8A 2VI7A 1QSMA 4CS0B 2FS5A 2AJ6A 4CYOA 3D2MA 4NXYA 2BEIA 1B87A 5F48A 4AVBA 3TCVA 5FVJA 1QSTA 1L0CA 3WR7A 3MGDA 1IYLA 3CXQA 3PZJA 2J8NA 2CNMA 3D3SA 2P6FA 5A27A 4EVYA 4FD7A 3R96A 4KOXA 2Z3OA 4DNCA 1RXTA 2OZGA 4MFZA 5KTCA 5JPHA 2QIRA 1Y9WA 2FCKA 2YNCA 2REEA 4XPDB 1LRZA 4HKFA 4YRHA 4CGPA 1J4JA 1NMTA 4AVAA 5IV0A 2G3TA 3F5BA 4B12A 4R3KA 2CNTA 3FNCA 5DWNA 4XNHC 3IU2A 3PP9A 4X5KA 4B13A 4U9ZA 3JTKA 3VWEA 5I0CA 3GY9A 4C2ZA 1Z4RA 2I79A 4FD6A 4UWIA 3W6SA 1S7FA 1M4IA 5JQ4A 4U5YA 3TO7A 4B10A 4KOWA 2YNCC 1M4GA 2PR1A 3W6XA 2Z0ZA 3IWEA 4QVTA 1U6MA 4RI1A 5DWMA 4B5OA 4B5PA 2DPTA 2Z3PA 5AGEA 2ZW7A 4JD6A 2B4DA 2A4NA 3F0AA 2FIAA 4XPDC 4KOYA 3PGPA 1Z9UA 4JXRA 2YGWA 1WWZA 2HUZA 2FXFA 4R9MA 3D2PA 4CYQA 3JVNA 3C26A 2ZPAA 3EC4A 3DR6A 1RO5A 2B3VA 4MFQA 3W91A 2WPXA 3DDDA 3FB3A 3TE4A 3EXNA 1M1DA 1P0HA 1IIDA 2B5GB 1BO4A 4NSQA 4L89A 5IB0A 1UFHA 5C82A 3OWCA 4KS9A 3QAHA 4A30A 4KOTA 3T90A 4MY3A 4UCMA 2JDDA 2DXQA 3N7ZA 5H84A 4KVME 3S6KA 4CGOA 3UY5A 4AVCA 2JDCA 3QB8A 4Y49B 4FD4A 5F47A 1Q2YA 3H4QA 1I1DA 2VQYA 1XE4A 3BJ7A 4E0AA 4B11A 1YVOA 2VZYA 1M44A 2WSAA 2ZW4A 2Q0YA 5AG5A 4HNWB 5G1ZA 4KLWA 3TFYA 2HQYA 3F8KA 3FIXA 2G0BA 4CGLA 3BJ8A 4JWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZT A;  2GIV A;  2NMT A;  4H6Z A;  1QSN A;  4F0Y A;  1I12 A;  4OAD A;  2PDO A;  1YGH A;  2ARH A;  3CXS A;  2BL1 A;  1YRE A;  2GE3 A;  1MJB A;  3BLN A;  3DSB A;  4Y49 C;  4OLL A;  5HMN A;  4IF5 A;  1VKC A;  3TT2 A;  1KUY A;  1VHS A;  4PK2 A;  4E8O A;  2FE7 A;  2QEC A;  3TO6 A;  2R7H A;  4R3L A;  3TTH A;  4M85 A;  4XPK A;  2PR8 A;  3TO9 A;  5HH1 A;  2ZW6 A;  3G3S A;  3T9Y A;  4KVX A;  2BUE A;  3IWG A;  3JUW A;  3P2H A;  3R95 A;  4UA3 A;  1YX0 A;  5GCN A;  5H86 A;  4KOU A;  4K30 A;  2OU2 A;  2PC1 A;  1CJW A;  4HNY B;  4QB9 A;  2OB0 A;  2B58 A;  2FSR A;  2R8V A;  5F46 A;  4QBJ A;  4AG7 A;  4RS2 A;  1YLE A;  4LUA A;  4KOS A;  5E96 A;  4JXQ A;  3P2F A;  2Q04 A;  1IYK A;  2F5I A;  4AG9 A;  3SXN A;  3FXT A;  2IL4 A;  3VWD A;  1S7K A;  1TIQ A;  4YFJ A;  4MJ8 A;  1QSR A;  3G8W A;  1KUV A;  2JLM A;  2P6G A;  1PUA A;  1NE9 A;  2VXK A;  2VZZ A;  2JEV A;  3IGR A;  3CXP A;  1XMT A;  3B8G A;  4MHD A;  4MI4 A;  1MK4 A;  4FD5 A;  1XEB A;  4H6U A;  1KUX A;  2B5G A;  4II9 A;  3R1K A;  4MBU A;  4L8A A;  2H5M A;  1YR0 A;  2D4P A;  1NSL A;  3E0K A;  1KZF A;  2EVN A;  4J3G A;  2C27 A;  2PRB A;  5EBV A;  2PSW A;  2OZH A;  2Q44 A;  1B6B A;  1Q2D A;  1YK3 A;  4MY0 A;  1Z4E A;  3S6G A;  3K9U A;  2P6E A;  5EC4 A;  3GYA A;  4UBR A;  4KOV A;  1YVK A;  2BSW A;  2J8M A;  4PV6 A;  4XNH B;  3S6H A;  5J8F A;  2Q4Y A;  2R1I A;  3EFA A;  1M4D A;  1S5K A;  1S7L A;  3LOD A;  4QUS A;  1ON0 A;  2OH1 A;  4CAX A;  4E2A A;  1IIC A;  2Y0M A;  3R9F A;  1IB1 E;  2FL4 A;  1Q2C A;  4CAW A;  1S7N A;  3ZZI A;  4U9Y A;  5C88 A;  1OZP A;  2ZW5 A;  3NE7 A;  2KCW A;  1GHE A;  4PSX A;  4R57 A;  3FYN A;  4YGO A;  3SHP A;  1Y7R A;  1FY7 A;  4NCZ A;  2X7B A;  4GS4 A;  2HV2 A;  2REF A;  2VBQ A;  2CY2 A;  3KKW A;  2Q7B A;  3RYO A;  3FRM A;  3V8I A;  4H89 A;  4PK3 A;  1V0C A;  2O28 A;  4QC6 A;  2D4O A;  2Q4V A;  3DR8 A;  4KVO E;  2FT0 A;  5KTD A;  3GKR A;  4B5P B;  3I9S A;  1S3Z A;  2K5T A;  2B4D B;  4KLV A;  1BOB A;  2CNS A;  4LX9 A;  3LD2 A;  4HNX B;  3TOA A;  2B4B A;  3ZJ0 A;  3SXO A;  2G3A A;  4F6A A;  3FBU A;  1QSO A;  2ZXV A;  3EO4 A;  2Z10 A;  4JLY A;  4AB7 A;  3TOB A;  1S60 A;  1K4J A;  2QML A;  4JJX A;  3I3G A;  4NF1 A;  4PSW A;  2B3U A;  1N71 A;  4CRZ B;  1P4N A;  2Z11 A;  5CNP A;  1MJA A;  1Y9K A;  3DNS A;  1MJ9 A;  1PU9 A;  2ATR A;  3R9E A;  4R87 A;  2P0W A;  5J8C A;  1I21 A;  2I00 A;  2WPW A;  4XPL A;  1SQH A;  4UWJ A;  1XIX A;  5ISV A;  2OZU A;  4KUA A;  4IUS A;  4KUB A;  2FIW A;  2EUI A;  4ORF A;  1WK4 A;  2VEZ A;  5F49 A;  3D8P A;  4ZBG A;  4ONU A;  3R9G A;  4CRY B;  2R98 A;  2RC4 A;  4KOR A;  2PQ8 A;  4M3S A;  2AE6 A;  4NEX A;  1R57 A;  3S6F A;  3EY5 A;  4OAE A;  4CAV A;  1CM0 A;  2GAN A;  4I49 A;  2J8R A;  4BMH A;  5IX3 A;  5KTA A;  1XF8 A;  2VI7 A;  1QSM A;  4CS0 B;  2FS5 A;  2AJ6 A;  3D2M A;  4NXY A;  2BEI A;  1B87 A;  5F48 A;  4AVB A;  3TCV A;  5FVJ A;  1QST A;  1L0C A;  3WR7 A;  3MGD A;  1IYL A;  3CXQ A;  3PZJ A;  2J8N A;  2CNM A;  3D3S A;  2P6F A;  4EVY A;  4FD7 A;  3R96 A;  4KOX A;  4DNC A;  1RXT A;  2OZG A;  5KTC A;  5JPH A;  2QIR A;  1Y9W A;  2FCK A;  2REE A;  4XPD B;  1LRZ A;  4HKF A;  4YRH A;  1J4J A;  1NMT A;  4AVA A;  5IV0 A;  2G3T A;  3F5B A;  4R3K A;  2CNT A;  3FNC A;  5DWN A;  4XNH C;  3PP9 A;  4X5K A;  4U9Z A;  3VWE A;  5I0C A;  3GY9 A;  1Z4R A;  2I79 A;  4FD6 A;  4UWI A;  3W6S A;  1S7F A;  1M4I A;  5JQ4 A;  4U5Y A;  3TO7 A;  4KOW A;  1M4G A;  2PR1 A;  3W6X A;  2Z0Z A;  4QVT A;  1U6M A;  4RI1 A;  5DWM A;  4B5O A;  4B5P A;  2ZW7 A;  4JD6 A;  2B4D A;  2A4N A;  3F0A A;  2FIA A;  4XPD C;  4KOY A;  3PGP A;  1Z9U A;  4JXR A;  1WWZ A;  2HUZ A;  2FXF A;  4R9M A;  3D2P A;  3JVN A;  3C26 A;  2ZPA A;  3EC4 A;  3DR6 A;  1RO5 A;  2B3V A;  3W91 A;  2WPX A;  3DDD A;  3FB3 A;  3TE4 A;  3EXN A;  1M1D A;  1P0H A;  1IID A;  2B5G B;  1BO4 A;  4NSQ A;  4L89 A;  5IB0 A;  1UFH A;  5C82 A;  3OWC A;  3QAH A;  4KOT A;  3T90 A;  4MY3 A;  2JDD A;  2DXQ A;  3N7Z A;  5H84 A;  4KVM E;  3S6K A;  3UY5 A;  4AVC A;  2JDC A;  3QB8 A;  4Y49 B;  4FD4 A;  5F47 A;  1Q2Y A;  3H4Q A;  1I1D A;  2VQY A;  1XE4 A;  3BJ7 A;  4E0A A;  1YVO A;  2VZY A;  1M44 A;  2ZW4 A;  2Q0Y A;  4HNW B;  4KLW A;  3TFY A;  2HQY A;  3F8K A;  3FIX A;  2G0B A;  3BJ8 A;  4JWP A; 
#chains in the Genus database with same CATH topology
 1F57 A;  3B2Y A;  4KZT A;  3RNZ A;  2I3C A;  2GIV A;  4H2K A;  3NA6 A;  4ZGY B;  6CPA A;  4EFD A;  2NMT A;  4H6Z A;  2PJ9 A;  1QSN A;  2EK8 A;  5AG7 A;  4F0Y A;  1I12 A;  4OME A;  1CG2 A;  4OAD A;  2PDO A;  4P4J A;  4DJL A;  1YGH A;  2ARH A;  4ZYQ A;  3CXS A;  2G9D A;  2BL1 A;  4OC5 A;  3PB9 X;  1YRE A;  2GE3 A;  1Q7L A;  1MJB A;  4OIW A;  3BLN A;  3DSB A;  3VH9 A;  4P4E A;  4Y49 C;  1PCA A;  1ZG9 A;  2PJ0 A;  5CPA A;  1BPN A;  3KHX A;  3I1U A;  3KAS A;  4RN7 A;  4NGN A;  1IU8 A;  2C6C A;  4OLL A;  3SJF A;  3H8E A;  5HMN A;  4C7I A;  5HVG A;  4IF5 A;  4M6H A;  1VKC A;  2ZEL A;  4FWU A;  3TT2 A;  4EWT A;  1KUY A;  1VHS A;  4PK2 A;  4E8O A;  2FE7 A;  4OID A;  4UFW A;  2QEC A;  3TO6 A;  2R7H A;  4KSA A;  4MFP A;  4R3L A;  1AYE A;  2BCO A;  4UFV A;  3TTH A;  4ZI6 A;  3IEH A;  4M85 A;  4XPK A;  1ARM A;  2PR8 A;  3TO9 A;  3VAR A;  2ODF A;  5HH1 A;  3D7D A;  2ZW6 A;  1LFW A;  3G3S A;  4NJR A;  3T9Y A;  3PB4 X;  3L2N A;  4Q36 A;  4KVX A;  4NGR A;  2BUE A;  3IWG A;  3JUW A;  3HLP A;  3P2H A;  3R95 A;  2ZEP A;  4UA3 A;  1YX0 A;  4UCP A;  5GCN A;  3B3S A;  5H86 A;  1RTQ A;  3CPX A;  4KOU A;  2OU2 A;  3MRU A;  4K30 A;  2PC1 A;  1CJW A;  4HNY B;  3PFE A;  2OB0 A;  4MMO A;  3LAC A;  2B58 A;  2FSR A;  4QB9 A;  4UEE A;  3B3C A;  2R8V A;  1H8L A;  3KR4 A;  3KZW A;  5F46 A;  3B3V A;  3GUX A;  4QBJ A;  3CDX A;  2NYQ A;  1BLL E;  4MFJ A;  4OC4 A;  4AG7 A;  4RS2 A;  1YLE A;  2ZEM A;  3IC1 A;  4LUA A;  2CXA A;  4KOS A;  5E96 A;  1CP6 A;  3VAT A;  4JXQ A;  3P2F A;  2JEW A;  4CAF A;  1Z2L A;  2Q04 A;  4OC0 A;  4W9Y A;  1IYK A;  3MN8 A;  3KHZ A;  2F5I A;  1GYT A;  4AG9 A;  4OC3 A;  1Z8X A;  3FXT A;  2IL4 A;  2PJ7 A;  3SI1 A;  1X10 A;  1LCP A;  1S7K A;  3DGV A;  3NH8 A;  3VWD A;  1TIQ A;  4YFJ A;  4MJ8 A;  4UEZ A;  1QSR A;  5K8N A;  1YLO A;  3H5Z A;  3KQX A;  1LAN A;  3G8W A;  1KUV A;  2EWB A;  2JLM A;  4A32 A;  4IAV A;  4C2X A;  3GIU A;  4OKO A;  2P6G A;  5HVH A;  1PUA A;  1NE9 A;  4G1P A;  1JWQ A;  2Z3M A;  1LAP A;  2VXK A;  2VZZ A;  2JBJ A;  2ABZ A;  1CX8 A;  2JEV A;  4MFL A;  3NH4 A;  3IGR A;  4A39 A;  1VHO A;  1XMT A;  3CXP A;  3NH5 A;  4F8Z A;  2HC9 A;  1TKJ A;  2Q51 A;  1LAM A;  3B8G A;  4MHD A;  4MI4 A;  5AG4 A;  2PVV A;  1MK4 A;  4FD5 A;  3V7Z A;  2GFQ A;  4B14 A;  5JGF A;  2PJ4 A;  1XMB A;  4TWE A;  1XEB A;  2IJZ A;  4FAI A;  4H6U A;  1KUX A;  4NGP A;  5JM6 A;  2B5G A;  4II9 A;  3R1K A;  4MBU A;  4L8A A;  2H5M A;  3PBB A;  3FVL A;  1YR0 A;  4UIA A;  4A2Z A;  2D4P A;  1IOF A;  1HEE A;  5LRJ A;  4NGT A;  1NSL A;  3E0K A;  3IO1 A;  1KZF A;  4R8F A;  2EVN A;  5KTA A;  4C2Y A;  4J3G A;  2C27 A;  2PRB A;  4FBE A;  1LOK A;  4K3N A;  4KSF A;  5EBV A;  5A28 A;  4Q7A A;  2F8H A;  2PSW A;  4MHP A;  7CPA A;  3N5F A;  2OZH A;  2Q44 A;  4MCS A;  2CTC A;  3B7I A;  1FNO A;  1B6B A;  2WUU A;  2V8V A;  4PXD A;  1Q2D A;  1QQ9 A;  2V8D A;  1YK3 A;  2YND A;  4MY0 A;  4C68 A;  1Z4E A;  3KR5 A;  3S6G A;  3K9U A;  2P6E A;  5EC4 A;  3GYA A;  1TXR A;  4UBR A;  4A95 A;  4KOV A;  1YVK A;  4CGM A;  2BSW A;  2J8M A;  2PRQ A;  3B3W A;  4PV6 A;  4XNH B;  3S6H A;  2Q4Y A;  5EMI A;  1HDU A;  5J8F A;  1KWM A;  4F9V A;  2R1I A;  2XEJ A;  4GXH A;  4CYN A;  5LYF A;  5K8M A;  3EFA A;  1M4D A;  1S5K A;  1S7L A;  2GRE A;  3SI0 A;  3LOD A;  4QUS A;  1ON0 A;  4MCR A;  2OH1 A;  1XJO A;  4CAX A;  4E2A A;  1Y0Y A;  1IIC A;  2C6G A;  2PJ8 A;  2Y0M A;  1CBX A;  5D29 A;  3FJU A;  3R9F A;  4P45 A;  2XEG A;  2XEF A;  1YSJ A;  1IB1 E;  2FL4 A;  1Q2C A;  2Z3L A;  2Z3K A;  4CAW A;  2ANP A;  3LMS A;  5AG6 A;  3SJG A;  4A31 A;  1S7N A;  4P4F A;  3ZZI A;  1AMP A;  4U9Y A;  4CGN A;  3TX8 A;  5C88 A;  1OZP A;  2ZW5 A;  3NE7 A;  2KCW A;  1GHE A;  1R43 A;  2PJ2 A;  3FYN A;  4LQG A;  4PSX A;  4R57 A;  4YGO A;  3SHP A;  4BBH A;  1Y7R A;  1FY7 A;  2Z3N A;  2X7B A;  4NCZ A;  1Z8L A;  3S9M A;  4GS4 A;  2HV2 A;  2REF A;  2VBQ A;  3A9L A;  3BI1 A;  1TKF A;  2IMO A;  4ZX8 A;  1ZG7 A;  2CY2 A;  3ISZ A;  3KKW A;  2O4H A;  1IOI A;  4F0X A;  5THW A;  4CAE A;  5LRK A;  3FMC A;  2Q7B A;  3GLJ A;  3RYO A;  3FRM A;  3D66 A;  2BOA A;  3V8I A;  4H89 A;  2VL1 A;  5BWA B;  4MCP A;  4PK3 A;  2YNE A;  1V0C A;  2O28 A;  4KSI A;  1XRY A;  3IWW A;  2PJ5 A;  4CPA A;  4QC6 A;  2D4O A;  2BO9 A;  1F2O A;  1UWY A;  1YQE A;  2Q4V A;  4PXB A;  4Z65 A;  3LWU A;  3DR8 A;  3ISX A;  4ONW A;  2CF4 A;  4KVO E;  2FT0 A;  5KTD A;  3GKR A;  4B5P B;  3I9S A;  3V38 A;  2PJC A;  1S3Z A;  2EK9 A;  2AFM A;  2C6P A;  3WC5 A;  2K5T A;  1ZO0 A;  5G20 A;  2B4D B;  2ZOF A;  1BOB A;  3FEC A;  4KLV A;  4WJB A;  3T8W A;  3WC7 A;  1AUG A;  4YU9 A;  2CNS A;  4LX9 A;  5DS0 A;  3LD2 A;  3NFZ A;  4HNX B;  3TOA A;  2B4B A;  3ZJ0 A;  3SXO A;  3PEI A;  3TC8 A;  4R6T A;  2G3A A;  2ZED A;  3CPA A;  4F6A A;  3D7F A;  1IY7 A;  3RAM A;  4PXC A;  3FBU A;  1QSO A;  2ZXV A;  1YW4 A;  4Q38 A;  1Z8T A;  1XOV A;  3EO4 A;  2Z10 A;  2ZEN A;  4JLY A;  4AB7 A;  3TOB A;  1S60 A;  3SXN A;  1K4J A;  2QML A;  3FX6 A;  4JJX A;  3KI9 A;  3I3G A;  4NGQ A;  4NF1 A;  4A33 A;  3BI0 A;  3GB0 A;  4PSW A;  2B3U A;  1N71 A;  4UFX A;  4CRZ B;  1P4N A;  2Z11 A;  5CNP A;  1MJA A;  1Y9K A;  3DNS A;  1MJ9 A;  1PU9 A;  1PYT B;  2XEI A;  3DLJ A;  3QAY A;  2ATR A;  2OOT A;  3R9E A;  4R87 A;  2P0W A;  2ZEO A;  5G21 A;  1A2Z A;  5J8C A;  1I21 A;  2I00 A;  4C7H A;  2WPW A;  4XPL A;  3IJ3 A;  1SQH A;  4UWJ A;  4OP4 A;  1XIX A;  2AFU A;  3PB7 X;  5ISV A;  2J9A A;  2OZU A;  1ZG8 A;  2RFH A;  5D8N A;  3SJX A;  4KUA A;  2PJ3 A;  4YWY A;  2Q43 A;  4IUS A;  4KUB A;  2FIW A;  2EUI A;  4MCQ A;  4MFK A;  4ORF A;  1WK4 A;  2VEZ A;  3BXM A;  2EBJ A;  5JH9 A;  5F49 A;  3D8P A;  4PXE A;  4ONU A;  4ZBG A;  3R9G A;  4CRY B;  2QVP A;  3IU1 A;  4F9U A;  3S9L A;  2R98 A;  4UCN A;  2RC4 A;  4KOR A;  2ZOG A;  1JQG A;  2PQ8 A;  3CZX A;  2PVW A;  4M3S A;  2AE6 A;  4NEX A;  5G22 A;  1R57 A;  3S6F A;  1IGB A;  4ZY0 A;  4R76 A;  2DPS A;  3EY5 A;  4OAE A;  2NSM A;  3NE8 A;  4OC1 A;  4CAV A;  1ELM P;  2HB6 A;  1CM0 A;  2GAN A;  2PJ6 A;  2J8R A;  4I49 A;  3D4U A;  4MXU A;  4BMH A;  3IIB A;  5IX3 A;  4ZX9 A;  4O23 A;  4IK2 A;  2GLF A;  4CYP A;  4DUK A;  1XF8 A;  5F09 A;  5J1Q A;  2VI7 A;  1QSM A;  4PPZ A;  4CS0 B;  2FS5 A;  2AJ6 A;  4CYO A;  2QYV A;  3D2M A;  4NXY A;  2BEI A;  1B87 A;  5F48 A;  4A38 A;  4AVB A;  3QNV A;  3TCV A;  5FVJ A;  5HXD A;  3S9N A;  1ELL P;  3H8F A;  1QMU A;  1QST A;  1L0C A;  1DE4 C;  3WR7 A;  1ZLI A;  1IYL A;  3CXQ A;  3MGD A;  1VIX A;  3PZJ A;  2J8N A;  4MHN A;  1TKH A;  2CNM A;  3D3S A;  3HUV A;  2P6F A;  1YME A;  2PJ1 A;  2AFX A;  2DF5 A;  3D67 A;  5A27 A;  4EVY A;  2AFO A;  4FD7 A;  3R96 A;  4KOX A;  2Z3O A;  5LRG A;  4DNC A;  3KL9 A;  2V77 A;  2GLJ A;  2O53 A;  2OZG A;  1RXT A;  4MFZ A;  5KTC A;  5JPH A;  2QIR A;  1Y9W A;  2FCK A;  2YNC A;  2AFS A;  2REE A;  4XPD B;  1LRZ A;  3IFE A;  1CPX A;  4HKF A;  2V8H A;  4YRH A;  3PB6 X;  2Q7S A;  4CGP A;  1J4J A;  1NMT A;  2F7V A;  3WT4 A;  8CPA A;  4TNU A;  3B3T A;  3SJE A;  4AVA A;  5IV0 A;  2G3T A;  3F5B A;  2PIZ A;  4B12 A;  1NSA A;  4R3K A;  2CNT A;  3FNC A;  1VHE A;  5DWN A;  4XNH C;  3IU2 A;  3PP9 A;  4X5K A;  4DYO A;  3WC6 A;  2PE3 A;  4B13 A;  4R7M A;  4U9Z A;  3WAB A;  3D7H A;  3JTK A;  3VWE A;  5I0C A;  1XFO A;  3GY9 A;  2EO8 A;  3CT9 A;  4P44 A;  4C2Z A;  1Z4R A;  4P4B A;  1HDQ A;  4RUH A;  2I79 A;  2QJ8 A;  4FD6 A;  4P6Y A;  4UWI A;  3SI2 A;  3W6S A;  1S7F A;  3RO0 A;  3D7G A;  1M4I A;  2WZN A;  2JBK A;  5LYL A;  5JQ4 A;  4U5Y A;  2ZEH A;  3TO7 A;  4B10 A;  4KOW A;  2YNC C;  1M4G A;  2PR1 A;  3W6X A;  2Z0Z A;  3IWE A;  4QVT A;  1CP7 A;  4JYW A;  1U6M A;  3FH4 A;  1TF9 A;  4WWV A;  4RI1 A;  5DWM A;  3RZA A;  2ZEF A;  3PB8 X;  4B5O A;  4B5P A;  2DPT A;  2Z3P A;  5AGE A;  1FT7 A;  2ZW7 A;  4JD6 A;  3FF3 A;  2B4D A;  2A4N A;  3F0A A;  2FIA A;  1YW6 A;  3B35 A;  4M6G A;  5ELY A;  5K8O A;  4UIB A;  4XPD C;  3PFO A;  4KOY A;  1ZLH A;  3PGP A;  4ZY2 A;  5LYD A;  4B6Z A;  1Z8W A;  1Z9U A;  2OR4 A;  3JRU A;  4JXR A;  4EME A;  2CIJ A;  2ZEE A;  2YGW A;  3D68 A;  4X2T A;  1WWZ A;  1TF8 A;  3K9T A;  2WYR A;  2PCU A;  1CPS A;  2HUZ A;  4A94 A;  4ZY1 A;  2FXF A;  4R9M A;  1Y7E A;  2IQ6 A;  3D2P A;  4CYQ A;  4MRI A;  3JVN A;  1Z5R A;  3C26 A;  4PQA A;  2ZPA A;  4IHM A;  5LYI A;  3EC4 A;  3KGQ A;  1ARL A;  3DR6 A;  1RO5 A;  2B3V A;  4MFQ A;  1XBU A;  3W91 A;  2WPX A;  1X12 A;  3DDD A;  4NGM A;  2AFZ A;  5CBM A;  2PJA A;  3FB3 A;  3FEE A;  4HPS A;  3TE4 A;  3EXN A;  1M1D A;  1P0H A;  1IID A;  4LQ6 A;  2B5G B;  4X3R A;  1DTD A;  1Y0R A;  1BO4 A;  2PIY A;  2C1C A;  5HVF A;  2CTB A;  4NSQ A;  4P4I A;  2ZEG A;  4L89 A;  3KQZ A;  2V8G A;  5I4M A;  5IB0 A;  4NJQ A;  2RB7 A;  1UFH A;  5C82 A;  3OWC A;  4KS9 A;  2PJB A;  3QAH A;  3RBU A;  4KOT A;  4A30 A;  3T90 A;  4P10 A;  4MY3 A;  4NFR A;  4UCM A;  3BHX A;  2JDD A;  5K8P A;  2DXQ A;  3N7Z A;  5H84 A;  4AXV A;  2GU2 A;  3K2K A;  4KVM E;  3S6K A;  4CGO A;  1BPM A;  2POK A;  3PBE A;  4FUU A;  4UEF A;  4UF4 A;  2Q4Z A;  3UY5 A;  3PRT A;  4AVC A;  2JDC A;  3QB8 A;  3FED A;  4Y49 B;  1EE3 P;  2DEA A;  1BAV A;  1F2P A;  1OBR A;  1Q2Y A;  3H4Q A;  4FD4 A;  5F47 A;  1I1D A;  1R3N A;  2AFW A;  2VQY A;  1XE4 A;  3BJ7 A;  4E0A A;  4B11 A;  1M4L A;  1YVO A;  4MHZ A;  4OC2 A;  4BD9 A;  4GM5 A;  2VZY A;  5IB9 A;  1M44 A;  2WSA A;  2ZW4 A;  3H8G A;  4P4D A;  1VGY A;  2Q0Y A;  5AG5 A;  4HNW B;  5G1Z A;  4KLW A;  4NGS A;  3TFY A;  2HQY A;  4MHY A;  2FVG A;  3F8K A;  3FIX A;  4JZ0 A;  4M6I A;  4X8I A;  2G0B A;  4CGL A;  3BJ8 A;  4JWP A;  4BIN A;  4A37 A; 
#chains in the Genus database with same CATH homology
 4KZT A;  2GIV A;  4ZGY B;  2NMT A;  4H6Z A;  5AG7 A;  1QSN A;  4F0Y A;  1I12 A;  4OAD A;  2PDO A;  1YGH A;  2ARH A;  3CXS A;  2BL1 A;  1YRE A;  2GE3 A;  1MJB A;  3BLN A;  3DSB A;  4Y49 C;  4OLL A;  5HMN A;  4C7I A;  4IF5 A;  1VKC A;  3TT2 A;  1KUY A;  1VHS A;  4PK2 A;  4E8O A;  2FE7 A;  4UFW A;  2QEC A;  3TO6 A;  2R7H A;  4KSA A;  4MFP A;  4R3L A;  4UFV A;  3TTH A;  4M85 A;  4XPK A;  2PR8 A;  3TO9 A;  5HH1 A;  2ZW6 A;  3G3S A;  3T9Y A;  4Q36 A;  4KVX A;  2BUE A;  3IWG A;  3JUW A;  3P2H A;  3R95 A;  4UA3 A;  1YX0 A;  4UCP A;  5GCN A;  5H86 A;  4KOU A;  2OU2 A;  4K30 A;  2PC1 A;  4HNY B;  1CJW A;  4QB9 A;  2OB0 A;  2B58 A;  2FSR A;  2R8V A;  5F46 A;  4QBJ A;  4MFJ A;  4AG7 A;  4RS2 A;  1YLE A;  4LUA A;  2CXA A;  4KOS A;  5E96 A;  4JXQ A;  3P2F A;  4CAF A;  2Q04 A;  1IYK A;  2F5I A;  4AG9 A;  3SXN A;  3FXT A;  2IL4 A;  3VWD A;  1S7K A;  1TIQ A;  4YFJ A;  4MJ8 A;  1QSR A;  3H5Z A;  3G8W A;  1KUV A;  2JLM A;  4A32 A;  4C2X A;  2P6G A;  1PUA A;  1NE9 A;  2Z3M A;  2VXK A;  2VZZ A;  4MFL A;  2JEV A;  3IGR A;  3CXP A;  1XMT A;  3B8G A;  4MHD A;  4MI4 A;  5AG4 A;  1MK4 A;  4FD5 A;  4B14 A;  1XEB A;  4H6U A;  1KUX A;  2B5G A;  4II9 A;  3R1K A;  4MBU A;  4L8A A;  2H5M A;  1YR0 A;  4A2Z A;  2D4P A;  1NSL A;  3E0K A;  1KZF A;  2EVN A;  4C2Y A;  4J3G A;  2C27 A;  2PRB A;  4KSF A;  5EBV A;  5A28 A;  2PSW A;  2OZH A;  2Q44 A;  1B6B A;  2WUU A;  1Q2D A;  1YK3 A;  2YND A;  4MY0 A;  4C68 A;  1Z4E A;  3S6G A;  3K9U A;  2P6E A;  5EC4 A;  3GYA A;  4UBR A;  4A95 A;  4KOV A;  1YVK A;  4CGM A;  2BSW A;  2J8M A;  4PV6 A;  4XNH B;  3S6H A;  5J8F A;  2Q4Y A;  2R1I A;  4CYN A;  3EFA A;  1M4D A;  1S5K A;  1S7L A;  3LOD A;  4QUS A;  1ON0 A;  2OH1 A;  4CAX A;  4E2A A;  1IIC A;  2Y0M A;  3R9F A;  1IB1 E;  2FL4 A;  1Q2C A;  2Z3L A;  2Z3K A;  4CAW A;  5AG6 A;  4A31 A;  1S7N A;  3ZZI A;  4U9Y A;  4CGN A;  5C88 A;  1OZP A;  2ZW5 A;  3NE7 A;  2KCW A;  1GHE A;  4PSX A;  4R57 A;  3FYN A;  4YGO A;  4BBH A;  3SHP A;  1Y7R A;  1FY7 A;  2Z3N A;  2X7B A;  4NCZ A;  4GS4 A;  2HV2 A;  2REF A;  2VBQ A;  3A9L A;  2CY2 A;  3KKW A;  4F0X A;  4CAE A;  2Q7B A;  3RYO A;  3FRM A;  3V8I A;  4H89 A;  5BWA B;  4PK3 A;  2YNE A;  1V0C A;  2O28 A;  4QC6 A;  2D4O A;  2Q4V A;  3DR8 A;  4KVO E;  2FT0 A;  5KTD A;  3GKR A;  4B5P B;  3I9S A;  1S3Z A;  2K5T A;  1ZO0 A;  5G20 A;  2B4D B;  4KLV A;  1BOB A;  2CNS A;  4LX9 A;  3LD2 A;  4HNX B;  3TOA A;  2B4B A;  3ZJ0 A;  3SXO A;  2G3A A;  4F6A A;  3FBU A;  1QSO A;  2ZXV A;  4Q38 A;  3EO4 A;  2Z10 A;  4JLY A;  4AB7 A;  3TOB A;  1S60 A;  1K4J A;  2QML A;  4JJX A;  3I3G A;  4NF1 A;  4A33 A;  4PSW A;  2B3U A;  1N71 A;  4UFX A;  4CRZ B;  1P4N A;  2Z11 A;  5CNP A;  1MJA A;  1Y9K A;  3DNS A;  1MJ9 A;  1PU9 A;  2ATR A;  3R9E A;  4R87 A;  2P0W A;  5G21 A;  5J8C A;  1I21 A;  2I00 A;  4C7H A;  2WPW A;  4XPL A;  1SQH A;  4UWJ A;  1XIX A;  5ISV A;  2OZU A;  4KUA A;  4IUS A;  4KUB A;  2FIW A;  2EUI A;  4MFK A;  4ORF A;  1WK4 A;  2VEZ A;  5F49 A;  3D8P A;  4ZBG A;  4ONU A;  3R9G A;  4CRY B;  3IU1 A;  2R98 A;  4UCN A;  2RC4 A;  4KOR A;  2PQ8 A;  5G22 A;  4M3S A;  2AE6 A;  4NEX A;  1R57 A;  3S6F A;  2DPS A;  3EY5 A;  4OAE A;  4CAV A;  1CM0 A;  2GAN A;  4I49 A;  2J8R A;  4BMH A;  5IX3 A;  5KTA A;  4CYP A;  1XF8 A;  2VI7 A;  1QSM A;  4CS0 B;  2FS5 A;  2AJ6 A;  4CYO A;  3D2M A;  4NXY A;  2BEI A;  1B87 A;  5F48 A;  4AVB A;  3TCV A;  5FVJ A;  1QST A;  1L0C A;  3WR7 A;  3MGD A;  1IYL A;  3CXQ A;  3PZJ A;  2J8N A;  2CNM A;  3D3S A;  2P6F A;  5A27 A;  4EVY A;  4FD7 A;  3R96 A;  4KOX A;  2Z3O A;  4DNC A;  1RXT A;  2OZG A;  4MFZ A;  5KTC A;  5JPH A;  2QIR A;  1Y9W A;  2FCK A;  2YNC A;  2REE A;  4XPD B;  1LRZ A;  4HKF A;  4YRH A;  4CGP A;  1J4J A;  1NMT A;  4AVA A;  5IV0 A;  2G3T A;  3F5B A;  4B12 A;  4R3K A;  2CNT A;  3FNC A;  5DWN A;  4XNH C;  3IU2 A;  3PP9 A;  4X5K A;  4B13 A;  4U9Z A;  3JTK A;  3VWE A;  5I0C A;  3GY9 A;  4C2Z A;  1Z4R A;  2I79 A;  4FD6 A;  4UWI A;  3W6S A;  1S7F A;  1M4I A;  5JQ4 A;  4U5Y A;  3TO7 A;  4B10 A;  4KOW A;  2YNC C;  1M4G A;  2PR1 A;  3W6X A;  2Z0Z A;  3IWE A;  4QVT A;  1U6M A;  4RI1 A;  5DWM A;  4B5O A;  4B5P A;  2DPT A;  2Z3P A;  5AGE A;  2ZW7 A;  4JD6 A;  2B4D A;  2A4N A;  3F0A A;  2FIA A;  4XPD C;  4KOY A;  3PGP A;  1Z9U A;  4JXR A;  2YGW A;  1WWZ A;  2HUZ A;  2FXF A;  4R9M A;  3D2P A;  4CYQ A;  3JVN A;  3C26 A;  2ZPA A;  3EC4 A;  3DR6 A;  1RO5 A;  2B3V A;  4MFQ A;  3W91 A;  2WPX A;  3DDD A;  3FB3 A;  3TE4 A;  3EXN A;  1M1D A;  1P0H A;  1IID A;  2B5G B;  1BO4 A;  4NSQ A;  4L89 A;  5IB0 A;  1UFH A;  5C82 A;  3OWC A;  4KS9 A;  3QAH A;  4A30 A;  4KOT A;  3T90 A;  4MY3 A;  4UCM A;  2JDD A;  2DXQ A;  3N7Z A;  5H84 A;  4KVM E;  3S6K A;  4CGO A;  3UY5 A;  4AVC A;  2JDC A;  3QB8 A;  4Y49 B;  4FD4 A;  5F47 A;  1Q2Y A;  3H4Q A;  1I1D A;  2VQY A;  1XE4 A;  3BJ7 A;  4E0A A;  4B11 A;  1YVO A;  2VZY A;  1M44 A;  2WSA A;  2ZW4 A;  2Q0Y A;  5AG5 A;  4HNW B;  5G1Z A;  4KLW A;  3TFY A;  2HQY A;  3F8K A;  3FIX A;  2G0B A;  4CGL A;  3BJ8 A;  4JWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...