4KOXA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with cefalotin
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4koxA00
1Y9KA 4PSXA 2JDDA 2FE7A 4M3SA 1VKCA 1M4IA 5JQ4A 1QSMA 2PRBA 1I21A 3DR8A 1QSTA 1YLEA 3BLNA 1P4NA 2Q44A 4KOTA 4R57A 3T9YA 2AE6A 2QMLA 3IGRA 3B8GA 2ATRA 4OAEA 5H86A 4KOXA 2P6FA 2KCWA 2GANA 2Z0ZA 4FD4A 4YFJA 4UBRA 3S6HA 1NE9A 4AVAA 2J8MA 1Z9UA 3P2FA 2BEIA 1XMTA 4NSQA 4KLVA 4M85A 5F47A 4J3GA 1IYKA 3BJ7A 1XF8A 4NF1A 3F8KA 4CRZB 1MJAA 3FRMA 3DNSA 3FXTA 2FL4A 3ZZIA 3EC4A 3TE4A 3CXPA 4QUSA 1Q2YA 5IV0A 4AVCA 2ZW7A 4R3KA 1S7FA 2CNMA 2Q4YA 4PK2A 4II9A 3T90A 2ZW4A 1IICA 2CY2A 2VEZA 1U6MA 1RXTA 2PQ8A 4H6UA 3F0AA 1KUYA 1TIQA 2B3UA 1IYLA 3C26A 4H6ZA 2ZW5A 3V8IA 2G0BA 3I9SA 5J8FA 3TT2A 3H4QA 2Z10A 3TCVA 2BUEA 4AB7A 3PGPA 2P0WA 1MK4A 3LODA 4PK3A 4YRHA 3VWEA 4BMHA 2J8RA 4KVXA 1KUVA 2O28A 2VZZA 4U5YA 4KVOE 2PC1A 4B5PB 4E0AA 3G8WA 4CAWA 1M44A 5EBVA 3MGDA 1J4JA 2PSWA 2X7BA 3D3SA 3FIXA 4F0YA 4JJXA 1SQHA 4MY3A 3D2PA 4R87A 3S6FA 2VBQA 4XPDB 4NXYA 1I12A 1R57A 1YX0A 3N7ZA 2QIRA 4JXRA 3FBUA 2G3AA 2Q7BA 1WWZA 3QB8A 3K9UA 3WR7A 4QC6A 4B5OA 2JDCA 4JD6A 1M4DA 1NMTA 4JXQA 2OH1A 2OU2A 5DWNA 3FYNA 4MHDA 2Q04A 3S6GA 5FVJA 4L89A 1IIDA 4E2AA 1KUXA 2A4NA 2HUZA 4B5PA 3JVNA 4Y49B 3D2MA 5E96A 1ON0A 3CXQA 3G3SA 3SXOA 3ZJ0A 1S5KA 2I00A 5H84A 2Z11A 3PZJA 5GCNA 3IWGA 4MJ8A 1YGHA 2B4DB 2R1IA 3LD2A 4ONUA 3UY5A 5KTDA 1M1DA 2B4BA 1YVOA 3GYAA 4UWJA 2VZYA 3EFAA 4NCZA 1K4JA 4EVYA 3RYOA 4PSWA 4CAVA 4XNHC 1BO4A 4KUBA 4ZBGA 1M4GA 5HMNA 2PR8A 4KOYA 4R3LA 1Z4EA 2R8VA 4MI4A 3KKWA 2FS5A 5I0CA 1L0CA 3D8PA 3DDDA 3E0KA 3P2HA 2Y0MA 3EY5A 4LUAA 2IL4A 3DR6A 1IB1E 4FD6A 2OB0A 2FXFA 2NMTA 1GHEA 1YK3A 2OZHA 2WPXA 1Z4RA 3W6XA 2B5GB 3TO6A 1XEBA 2R98A 2VQYA 4AVBA 5F46A 2AJ6A 2ZPAA 4RI1A 4X5KA 4KOVA 2BL1A 4CRYB 2B4DA 4QVTA 2WPWA 2K5TA 4KZTA 1PUAA 5J8CA 3R9GA 1YVKA 4DNCA 3EXNA 5C82A 1YR0A 4IF5A 4HNWB 4CS0B 2Q0YA 4FD7A 4UA3A 1XIXA 2C27A 3GKRA 1S3ZA 2VXKA 1WK4A 4UWIA 2D4PA 4NEXA 2PR1A 3TOBA 3R1KA 5HH1A 1MJBA 2JLMA 2ARHA 2F5IA 4KOSA 4QBJA 4MY0A 1Y7RA 4LX9A 5JPHA 2FIAA 4XPLA 4ORFA 3R9EA 4XNHB 4AG9A 1NSLA 3I3GA 3EO4A 4RS2A 4JLYA 3FNCA 1B87A 4U9YA 3TO9A 3BJ8A 2B5GA 2CNTA 2FT0A 3GY9A 1KZFA 3PP9A 4PV6A 4H89A 2I79A 2QECA 3TTHA 4U9ZA 2B3VA 4FD5A 5IB0A 2B58A 2HV2A 5KTAA 2FIWA 5EC4A 2ZXVA 4KOWA 3NE7A 1XE4A 2ZW6A 3JUWA 3SHPA 2BSWA 4HKFA 1Y9WA 1PU9A 1UFHA 4XPDC 2J8NA 2R7HA 2EUIA 3SXNA 4OADA 2OZGA 4JWPA 1YREA 1FY7A 2GE3A 2FSRA 2GIVA 4YGOA 4AG7A 1B6BA 1Q2CA 2JEVA 2RC4A 3TO7A 4F6AA 4MBUA 3F5BA 5ISVA 3S6KA 5KTCA 1RO5A 2PDOA 1Q2DA 1QSNA 3W6SA 3VWDA 2OZUA 3FB3A 1N71A 2EVNA 2P6GA 1P0HA 3TOAA 3QAHA 1QSRA 1CM0A 4QB9A 5F49A 4R9MA 3DSBA 2P6EA 4KORA 4Y49C 4KUAA 2VI7A 4E8OA 2REEA 1BOBA 2HQYA 4XPKA 3CXSA 2REFA 3R95A 1I1DA 2G3TA 1VHSA 3R96A 4KLWA 1V0CA 1S7NA 2CNSA 2DXQA 1OZPA 4IUSA 3W91A 1S60A 4KVME 5IX3A 1S7LA 4OLLA 4K30A 2Q4VA 3TFYA 3R9FA 5CNPA 1S7KA 4HNYB 5DWMA 3OWCA 4CAXA 1LRZA 4L8AA 4I49A 5C88A 1CJWA 4KOUA 2FCKA 5F48A 4HNXB 1MJ9A 4GS4A 2D4OA 2H5MA 1QSOA
chains in the Genus database with same CATH superfamily
1Y9KA 3H5ZA 4PSXA 1VIXA 2JDDA 4YU9A 1YMEA 2FE7A 4MHYA 4P4DA 4M3SA 1VKCA 1M4IA 3KASA 5JQ4A 5BWAB 4ZYQA 1YLOA 1QSMA 2PRBA 3KGQA 3WC7A 1I21A 3DR8A 3MN8A 2CF4A 5AG4A 1QSTA 1YLEA 2PJ8A 3BLNA 3S9NA 3LWUA 1P4NA 2Q44A 4F9VA 4OC4A 1Z5RA 4A32A 4O23A 4UIBA 4KOTA 4KSAA 4UFVA 4R57A 5K8NA 1CP6A 3T9YA 2AE6A 4MCQA 1Z8LA 2QMLA 3IGRA 4H2KA 3B8GA 2ATRA 3H8GA 3JTKA 3SJGA 3K9TA 4OAEA 5H86A 4OKOA 3PFEA 4NGSA 1TF9A 4JYWA 1CPSA 3IWWA 4KOXA 5K8PA 2DPSA 2P6FA 1KWMA 2KCWA 2GANA 3D7HA 2Z0ZA 3FMCA 4FD4A 4FWUA 4YFJA 1YW6A 2WSAA 4UBRA 2WZNA 5ELYA 3S6HA 3PB8X 2BCOA 3RZAA 1NE9A 4MMOA 4P4FA 1PCAA 2J8MA 1Z9UA 3B35A 3P2FA 4P4BA 2ZOGA 4AVAA 3GLJA 4UEFA 1BAVA 1XJOA 1XMTA 2BEIA 4NSQA 4KLVA 1X12A 4M85A 5F47A 4MHNA 1X10A 4J3GA 1IYKA 1R3NA 3BJ7A 2PJ7A 1XF8A 3KZWA 4CGMA 4NF1A 3F8KA 4CRZB 1MJAA 4R7MA 4MFLA 1CP7A 4P4IA 4CGNA 3FRMA 4P44A 1LFWA 3DNSA 3FXTA 1EE3P 3KHXA 4RUHA 2FL4A 4R6TA 2CIJA 3EC4A 3CXPA 3TC8A 3ZZIA 4CAFA 3TE4A 4QUSA 3WC6A 2ABZA 4OC0A 4MHPA 2V8DA 4P45A 3SJFA 1Q2YA 5IV0A 2J9AA 1VHOA 2ZW7A 3D67A 4AVCA 4R3KA 3IIBA 4HPSA 1S7FA 3PRTA 4Z65A 2CNMA 1VGYA 3ISZA 4Q36A 4ZY0A 5LYIA 2Q4YA 4PK2A 4MXUA 3SI1A 2PVWA 4II9A 3T90A 2F8HA 1YSJA 1IICA 1IGBA 2CY2A 2VEZA 2ZW4A 3BI1A 3D66A 4X3RA 4C2XA 1U6MA 1RXTA 3RNZA 4NGMA 1JWQA 1IOIA 2PQ8A 3FECA 5HVHA 4H6UA 4UCPA 3F0AA 3KR5A 2GREA 1KUYA 1TIQA 2B3UA 1IYLA 3BXMA 4WWVA 3BI0A 3IC1A 4P4EA 4F8ZA 3C26A 4H6ZA 4NGRA 2ZW5A 3V8IA 4OIWA 4M6HA 4A38A 1BLLE 3IU2A 2G0BA 5LRKA 3T8WA 4OC1A 3I9SA 5J8FA 4A37A 4ZI6A 2DPTA 3TT2A 3H4QA 2ZENA 4DYOA 2Z10A 2ZEGA 5THWA 3S9MA 2BUEA 4JZ0A 3TCVA 4AB7A 4UIAA 3PGPA 2P0WA 1MK4A 2PIYA 2AFOA 2EO8A 3LODA 1GYTA 4PK3A 3V38A 3HUVA 2WYRA 4YRHA 5F09A 2YNCC 3B3TA 4NGQA 3VWEA 4BMHA 3NA6A 2J8RA 4F9UA 4KVXA 1ZG7A 2Q51A 2PJ5A 1KUVA 4MFZA 2O28A 2VZZA 4U5YA 4KVOE 2PC1A 4FAIA 4B5PB 4E0AA 2V77A 3G8WA 4CAWA 4EWTA 1ARMA 4PXDA 1M44A 3FH4A 3KQZA 5EBVA 3MGDA 4UF4A 3D7GA 1J4JA 2PSWA 2X7BA 1Y0RA 3IJ3A 4PPZA 3D3SA 3FIXA 3SI2A 4JJXA 4F0YA 5LRJA 1SQHA 4BBHA 1LAPA 4MY3A 4FUUA 2NYQA 2C6CA 3B7IA 3D2PA 4A39A 2AFWA 4WJBA 2PCUA 4R87A 3A9LA 3S6FA 2VBQA 2RFHA 2O4HA 4K3NA 7CPAA 5DS0A 4KSFA 4P6YA 4XPDB 4LQ6A 4NXYA 1I12A 1M4LA 1R57A 1YX0A 3N7ZA 2QIRA 4JXRA 4A95A 3FBUA 4Q7AA 5D29A 2G3AA 1NSAA 2Q7BA 4C68A 1WWZA 2JEWA 3K9UA 3QB8A 3WR7A 4BINA 3KI9A 4QC6A 4B5OA 2AFUA 2JDCA 1XRYA 3QNVA 5IB9A 1YQEA 3IO1A 4JD6A 1M4DA 1NMTA 4JXQA 2OH1A 2OU2A 4PXCA 4IK2A 5DWNA 1FNOA 8CPAA 2EBJA 3HLPA 1LANA 1Z8TA 5G22A 2EWBA 3FYNA 2PIZA 3QAYA 4MHDA 4OC2A 3B2YA 2Q04A 2ANPA 4X2TA 1F57A 4EFDA 3S6GA 3V7ZA 2ZEEA 2YNEA 3N5FA 3NH4A 4B11A 5FVJA 3CPXA 4L89A 2GLFA 2IMOA 3NE8A 3VARA 1IIDA 4E2AA 1KUXA 2A4NA 3VATA 2HUZA 1CG2A 4B5PA 3JVNA 3FEEA 4Y49B 3D2MA 5E96A 3IFEA 1ON0A 3NH8A 1CPXA 3CXQA 3G3SA 3PBEA 3SXOA 3ZJ0A 3KQXA 1S5KA 2I00A 4A31A 1Z2LA 2GU2A 5G21A 5H84A 2AFXA 2Z11A 3PZJA 3VH9A 4B13A 5GCNA 2PJ6A 4ZX8A 3IWGA 1AUGA 4MJ8A 1R43A 1YGHA 2B4DB 2ODFA 3CPAA 2R1IA 3LD2A 3DLJA 4ONUA 3UY5A 2XEJA 5KTDA 5JH9A 1CX8A 1M1DA 5LYFA 2B4BA 2CTBA 1YVOA 2FVGA 5LRGA 2QJ8A 2AFMA 3WC5A 1DE4C 3GYAA 2VZYA 4UWJA 3EFAA 4NCZA 4G1PA 1H8LA 1K4JA 4CAEA 4EVYA 3RYOA 4PSWA 2CXAA 4CAVA 4XNHC 2GFQA 4DJLA 5K8OA 1BO4A 2CTCA 2PJ1A 3FX6A 5CPAA 4CGOA 4KUBA 3FJUA 3SJXA 2ZEFA 4KS9A 3D4UA 4NGTA 1M4GA 4ZBGA 5HMNA 2PR8A 2Z3LA 4KOYA 4NFRA 4R3LA 4UFXA 4DUKA 4F0XA 1Z4EA 3D7FA 3CDXA 5LYDA 2R8VA 4IHMA 4MFJA 2ZEOA 4MI4A 3KKWA 2FS5A 4Q38A 4FBEA 5I0CA 1JQGA 3PFOA 4UEZA 1ZG8A 1L0CA 3D8PA 3GIUA 4CGPA 3DDDA 3E0KA 1QMUA 3KR4A 3MRUA 3P2HA 3L2NA 4GXHA 2AFSA 2PJ9A 2Y0MA 3PB4X 2PJBA 3EY5A 3IWEA 4LUAA 2Q4ZA 2IL4A 2PJ2A 1IB1E 3DR6A 4FD6A 2OB0A 2ZELA 2FXFA 5JGFA 4UEEA 2NMTA 2JBKA 4ZY1A 2PJ3A 1GHEA 1OBRA 1YK3A 2IQ6A 2OZHA 4OC5A 4LQGA 4CYNA 2O53A 2WPXA 1ZLHA 3SI0A 1Z4RA 2ZEHA 4MFQA 1HDUA 3FVLA 3W6XA 4MCSA 2PVVA 2B5GB 2DEAA 3TO6A 5A28A 4C7IA 2XEGA 1XEBA 1HEEA 2R98A 4MRIA 4C2YA 2VQYA 4AVBA 1BPNA 2Z3NA 3B3WA 2AJ6A 5F46A 2ZPAA 1YW4A 4AXVA 4RI1A 4X5KA 4CYOA 4KOVA 2BL1A 4CRYB 3PBBA 2B4DA 2PJCA 4B14A 4QVTA 3FF3A 3KL9A 2WPWA 3CZXA 2K5TA 4NGPA 4IAVA 4KZTA 1PUAA 5J8CA 4BD9A 3TX8A 4CYQA 2EK8A 3R9GA 1QQ9A 4MFKA 3RBUA 4A33A 1YVKA 2ZEDA 4OC3A 3RO0A 4DNCA 3EXNA 4R8FA 5G1ZA 5CBMA 3CT9A 5C82A 4M6IA 1YR0A 3ISXA 4ONWA 4IF5A 1FT7A 4HNWB 1ZG9A 2Q0YA 4CS0B 4FD7A 4TNUA 2ZEPA 4UA3A 1XIXA 3D68A 2C27A 4X8IA 2ZEMA 1ZLIA 3GKRA 1S3ZA 1RTQA 2VXKA 2PRQA 1PYTB 1WK4A 4UWIA 2D4PA 2POKA 2Z3MA 2PR1A 4NEXA 3TOBA 3R1KA 5K8MA 5HH1A 1AMPA 1MJBA 1XMBA 3S9LA 2JLMA 2V8HA 4OP4A 2ARHA 1Y0YA 2F5IA 1ELMP 4KOSA 2I3CA 4ZX9A 4QBJA 1ZO0A 3PEIA 4B10A 4MY0A 1Y7RA 1XBUA 4LX9A 2YGWA 4CPAA 2FIAA 4XPLA 5JPHA 3PB6X 1TF8A 2C1CA 5AG6A 4ORFA 3PB7X 4P10A 4XNHB 3R9EA 4AG9A 2JBJA 4EMEA 1NSLA 3I3GA 1ELLP 2WUUA 3EO4A 4RS2A 3D7DA 3IU1A 1CBXA 1XFOA 4JLYA 3FNCA 1B87A 4U9YA 3TO9A 3BJ8A 2IJZA 2B5GA 2CNTA 2FT0A 3GY9A 1KZFA 3PP9A 4PV6A 4H89A 2I79A 2QECA 4P4JA 3TTHA 1HDQA 3K2KA 4GM5A 1IOFA 2GLJA 2VL1A 4U9ZA 3H8EA 1Q7LA 4OMEA 2B3VA 3I1UA 2Z3KA 4FD5A 2XEFA 3IEHA 5IB0A 2YNDA 5HVFA 2B58A 4ZGYB 1XOVA 3PB9X 2HV2A 5KTAA 1TKHA 3BHXA 2FIWA 4UCMA 3WT4A 5EC4A 2ZXVA 2DF5A 3NE7A 4KOWA 4NJRA 5A27A 1XE4A 3NH5A 2ZW6A 3JUWA 3SHPA 1TKJA 2BSWA 2V8GA 4HKFA 1Y9WA 4MHZA 1PU9A 4MCPA 4A2ZA 2C6PA 1UFHA 2OR4A 2J8NA 4XPDC 2R7HA 1UWYA 4CYPA 5J1QA 4PXBA 2EUIA 3SXNA 3B3SA 3LMSA 4OADA 2OZGA 4JWPA 5AG7A 1LCPA 1YREA 1FY7A 1VHEA 2FSRA 2GE3A 2GIVA 2ZOFA 3DGVA 4NJQA 5AGEA 4YGOA 4AG7A 4M6GA 4A30A 2XEIA 5HXDA 2PJ4A 3H8FA 1B6BA 1Q2CA 2JEVA 2RC4A 3JRUA 1IY7A 3B3VA 3TO7A 4MBUA 4B6ZA 4F6AA 3F5BA 5ISVA 2RB7A 3S6KA 5KTCA 4CGLA 1RO5A 2PDOA 2BOAA 1Q2DA 2G9DA 1QSNA 5EMIA 4YWYA 2EK9A 3B3CA 3W6SA 3VWDA 2PJ0A 2OZUA 4C7HA 2C6GA 1BPMA 1DTDA 3FB3A 3GB0A 4W9YA 1N71A 2F7VA 5JM6A 2EVNA 2P6GA 1P0HA 3TOAA 2QYVA 1F2PA 1Z8WA 3GUXA 3QAHA 3RAMA 4ZY2A 1QSRA 5D8NA 1CM0A 4QB9A 2Z3PA 4R76A 5F49A 1Z8XA 2V8VA 4R9MA 3DSBA 2AFZA 2P6EA 2Q43A 4KORA 4NGNA 4Y49C 3WABA 4KUAA 1AYEA 4OIDA 3KHZA 2VI7A 4E8OA 2REEA 1BOBA 2HQYA 4A94A 4MCRA 4UFWA 4XPKA 2Z3OA 3CXSA 2REFA 2NSMA 3R95A 1LAMA 4PQAA 1I1DA 2G3TA 1F2OA 1VHSA 3R96A 5G20A 6CPAA 4KLWA 1LOKA 1V0CA 1S7NA 2CNSA 2DXQA 2PJAA 1OZPA 4MFPA 4IUSA 1A2ZA 4C2ZA 3W91A 1S60A 4KVME 5IX3A 5I4MA 5LYLA 2YNCA 4KSIA 1S7LA 1Y7EA 4K30A 2Q4VA 4OLLA 3SJEA 3TFYA 3R9FA 5CNPA 4PXEA 1S7KA 1TKFA 4HNYB 5DWMA 2HC9A 3FEDA 3OWCA 4B12A 4CAXA 1LRZA 4UCNA 3LACA 4L8AA 4TWEA 1TXRA 1IU8A 4I49A 5C88A 1CJWA 4RN7A 2Q7SA 2PE3A 4KOUA 2FCKA 5F48A 3NFZA 5HVGA 2BO9A 4HNXB 1ARLA 2OOTA 1MJ9A 4GS4A 2D4OA 2QVPA 2H5MA 5AG5A 2HB6A 1QSOA
chains in the Genus database with same CATH topology
1Y9KA 3H5ZA 4PSXA 2JDDA 2FE7A 4M3SA 1VKCA 1M4IA 5JQ4A 5BWAB 1QSMA 2PRBA 1I21A 3DR8A 5AG4A 1QSTA 1YLEA 3BLNA 1P4NA 2Q44A 4A32A 4KOTA 4KSAA 4UFVA 4R57A 3T9YA 2AE6A 2QMLA 3IGRA 3JTKA 2ATRA 3B8GA 4OAEA 5H86A 4KOXA 2DPSA 2P6FA 2KCWA 2GANA 2Z0ZA 4FD4A 4YFJA 2WSAA 4UBRA 3S6HA 1NE9A 4AVAA 2J8MA 1Z9UA 3P2FA 2BEIA 1XMTA 4NSQA 4KLVA 4M85A 5F47A 4J3GA 1IYKA 3BJ7A 1XF8A 4CGMA 4NF1A 3F8KA 4CRZB 1MJAA 4MFLA 4CGNA 3FRMA 3DNSA 3FXTA 2FL4A 3ZZIA 3EC4A 4CAFA 3CXPA 3TE4A 4QUSA 1Q2YA 5IV0A 4AVCA 2ZW7A 4R3KA 1S7FA 2CNMA 4Q36A 2Q4YA 4PK2A 4II9A 3T90A 2ZW4A 1IICA 2CY2A 2VEZA 4C2XA 1U6MA 1RXTA 2PQ8A 4H6UA 4UCPA 3F0AA 1KUYA 1TIQA 2B3UA 1IYLA 3C26A 4H6ZA 2ZW5A 3V8IA 3IU2A 2G0BA 3I9SA 5J8FA 2DPTA 3TT2A 3H4QA 2Z10A 3TCVA 2BUEA 4AB7A 3PGPA 2P0WA 1MK4A 3LODA 4PK3A 4YRHA 2YNCC 3VWEA 4BMHA 2J8RA 4KVXA 1KUVA 4MFZA 2O28A 2VZZA 4U5YA 4KVOE 2PC1A 4B5PB 4E0AA 3G8WA 4CAWA 1M44A 5EBVA 3MGDA 1J4JA 2PSWA 2X7BA 3D3SA 3FIXA 4F0YA 4JJXA 1SQHA 4BBHA 4MY3A 3D2PA 4R87A 3A9LA 3S6FA 2VBQA 4KSFA 4XPDB 4NXYA 1I12A 1R57A 1YX0A 3N7ZA 2QIRA 4JXRA 4A95A 3FBUA 2G3AA 2Q7BA 4C68A 1WWZA 3QB8A 3K9UA 3WR7A 4QC6A 4B5OA 2JDCA 4JD6A 1M4DA 1NMTA 4JXQA 2OH1A 2OU2A 5DWNA 5G22A 3FYNA 4MHDA 2Q04A 3S6GA 2YNEA 4B11A 5FVJA 4L89A 1IIDA 4E2AA 1KUXA 2A4NA 2HUZA 4B5PA 3JVNA 4Y49B 3D2MA 5E96A 1ON0A 3CXQA 3G3SA 3SXOA 3ZJ0A 1S5KA 2I00A 4A31A 5G21A 5H84A 4B13A 2Z11A 3PZJA 5GCNA 3IWGA 4MJ8A 1YGHA 2B4DB 2R1IA 3LD2A 4ONUA 3UY5A 5KTDA 1M1DA 2B4BA 1YVOA 3GYAA 4UWJA 2VZYA 3EFAA 4NCZA 4CAEA 1K4JA 4EVYA 3RYOA 4PSWA 2CXAA 4CAVA 4XNHC 1BO4A 4CGOA 4KUBA 4KS9A 4ZBGA 1M4GA 5HMNA 2PR8A 2Z3LA 4KOYA 4R3LA 4UFXA 4F0XA 1Z4EA 2R8VA 4MFJA 4MI4A 3KKWA 2FS5A 4Q38A 5I0CA 4CGPA 1L0CA 3D8PA 3DDDA 3E0KA 3P2HA 2Y0MA 3EY5A 4LUAA 3IWEA 2IL4A 3DR6A 1IB1E 4FD6A 2OB0A 2FXFA 2NMTA 1GHEA 1YK3A 2OZHA 4CYNA 2WPXA 1Z4RA 4MFQA 3W6XA 2B5GB 3TO6A 5A28A 4C7IA 1XEBA 2R98A 4C2YA 2VQYA 4AVBA 2Z3NA 5F46A 2AJ6A 2ZPAA 4RI1A 4X5KA 4CYOA 4KOVA 2BL1A 4CRYB 2B4DA 4B14A 4QVTA 2WPWA 2K5TA 4KZTA 1PUAA 5J8CA 4CYQA 3R9GA 4MFKA 4A33A 1YVKA 4DNCA 3EXNA 5G1ZA 5C82A 1YR0A 4IF5A 4HNWB 4CS0B 2Q0YA 4FD7A 4UA3A 1XIXA 2C27A 3GKRA 1S3ZA 2VXKA 1WK4A 4UWIA 2D4PA 2Z3MA 2PR1A 4NEXA 3TOBA 3R1KA 5HH1A 1MJBA 2JLMA 2ARHA 2F5IA 4KOSA 4QBJA 1ZO0A 4B10A 4MY0A 1Y7RA 4LX9A 2YGWA 5JPHA 2FIAA 4XPLA 5AG6A 4ORFA 3R9EA 4XNHB 4AG9A 1NSLA 3I3GA 2WUUA 3EO4A 4RS2A 3IU1A 4JLYA 3FNCA 1B87A 4U9YA 3TO9A 3BJ8A 2B5GA 2CNTA 2FT0A 3GY9A 1KZFA 3PP9A 4PV6A 4H89A 2I79A 2QECA 3TTHA 4U9ZA 2B3VA 4FD5A 2Z3KA 5IB0A 2YNDA 2B58A 4ZGYB 2HV2A 5KTAA 4UCMA 2FIWA 5EC4A 2ZXVA 4KOWA 3NE7A 5A27A 1XE4A 2ZW6A 3JUWA 3SHPA 2BSWA 4HKFA 1Y9WA 1PU9A 4A2ZA 1UFHA 4XPDC 2J8NA 2R7HA 4CYPA 2EUIA 3SXNA 4OADA 2OZGA 4JWPA 5AG7A 1YREA 1FY7A 2GE3A 2FSRA 2GIVA 4YGOA 4AG7A 5AGEA 4A30A 1B6BA 1Q2CA 2JEVA 2RC4A 3TO7A 4F6AA 4MBUA 3F5BA 5ISVA 3S6KA 5KTCA 4CGLA 1RO5A 2PDOA 1Q2DA 1QSNA 3W6SA 3VWDA 2OZUA 4C7HA 3FB3A 1N71A 2EVNA 2P6GA 1P0HA 3TOAA 3QAHA 1QSRA 1CM0A 4QB9A 2Z3PA 5F49A 4R9MA 3DSBA 2P6EA 4KORA 4Y49C 4KUAA 2VI7A 4E8OA 2REEA 1BOBA 2HQYA 4UFWA 4XPKA 2Z3OA 3CXSA 2REFA 3R95A 1I1DA 2G3TA 1VHSA 3R96A 5G20A 4KLWA 1V0CA 1S7NA 2CNSA 2DXQA 1OZPA 4MFPA 4IUSA 4C2ZA 3W91A 1S60A 4KVME 5IX3A 2YNCA 1S7LA 4OLLA 4K30A 2Q4VA 3TFYA 3R9FA 5CNPA 1S7KA 4HNYB 5DWMA 3OWCA 4B12A 4CAXA 1LRZA 4UCNA 4L8AA 4I49A 5C88A 1CJWA 4KOUA 2FCKA 5F48A 4HNXB 1MJ9A 4GS4A 2D4OA 2H5MA 5AG5A 1QSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9K A;  4PSX A;  2JDD A;  2FE7 A;  4M3S A;  1VKC A;  1M4I A;  5JQ4 A;  1QSM A;  2PRB A;  1I21 A;  3DR8 A;  1QST A;  1YLE A;  3BLN A;  1P4N A;  2Q44 A;  4KOT A;  4R57 A;  3T9Y A;  2AE6 A;  2QML A;  3IGR A;  3B8G A;  2ATR A;  4OAE A;  5H86 A;  4KOX A;  2P6F A;  2KCW A;  2GAN A;  2Z0Z A;  4FD4 A;  4YFJ A;  4UBR A;  3S6H A;  1NE9 A;  4AVA A;  2J8M A;  1Z9U A;  3P2F A;  2BEI A;  1XMT A;  4NSQ A;  4KLV A;  4M85 A;  5F47 A;  4J3G A;  1IYK A;  3BJ7 A;  1XF8 A;  4NF1 A;  3F8K A;  4CRZ B;  1MJA A;  3FRM A;  3DNS A;  3FXT A;  2FL4 A;  3ZZI A;  3EC4 A;  3TE4 A;  3CXP A;  4QUS A;  1Q2Y A;  5IV0 A;  4AVC A;  2ZW7 A;  4R3K A;  1S7F A;  2CNM A;  2Q4Y A;  4PK2 A;  4II9 A;  3T90 A;  2ZW4 A;  1IIC A;  2CY2 A;  2VEZ A;  1U6M A;  1RXT A;  2PQ8 A;  4H6U A;  3F0A A;  1KUY A;  1TIQ A;  2B3U A;  1IYL A;  3C26 A;  4H6Z A;  2ZW5 A;  3V8I A;  2G0B A;  3I9S A;  5J8F A;  3TT2 A;  3H4Q A;  2Z10 A;  3TCV A;  2BUE A;  4AB7 A;  3PGP A;  2P0W A;  1MK4 A;  3LOD A;  4PK3 A;  4YRH A;  3VWE A;  4BMH A;  2J8R A;  4KVX A;  1KUV A;  2O28 A;  2VZZ A;  4U5Y A;  4KVO E;  2PC1 A;  4B5P B;  4E0A A;  3G8W A;  4CAW A;  1M44 A;  5EBV A;  3MGD A;  1J4J A;  2PSW A;  2X7B A;  3D3S A;  3FIX A;  4F0Y A;  4JJX A;  1SQH A;  4MY3 A;  3D2P A;  4R87 A;  3S6F A;  2VBQ A;  4XPD B;  4NXY A;  1I12 A;  1R57 A;  1YX0 A;  3N7Z A;  2QIR A;  4JXR A;  3FBU A;  2G3A A;  2Q7B A;  1WWZ A;  3QB8 A;  3K9U A;  3WR7 A;  4QC6 A;  4B5O A;  2JDC A;  4JD6 A;  1M4D A;  1NMT A;  4JXQ A;  2OH1 A;  2OU2 A;  5DWN A;  3FYN A;  4MHD A;  2Q04 A;  3S6G A;  5FVJ A;  4L89 A;  1IID A;  4E2A A;  1KUX A;  2A4N A;  2HUZ A;  4B5P A;  3JVN A;  4Y49 B;  3D2M A;  5E96 A;  1ON0 A;  3CXQ A;  3G3S A;  3SXO A;  3ZJ0 A;  1S5K A;  2I00 A;  5H84 A;  2Z11 A;  3PZJ A;  5GCN A;  3IWG A;  4MJ8 A;  1YGH A;  2B4D B;  2R1I A;  3LD2 A;  4ONU A;  3UY5 A;  5KTD A;  1M1D A;  2B4B A;  1YVO A;  3GYA A;  4UWJ A;  2VZY A;  3EFA A;  4NCZ A;  1K4J A;  4EVY A;  3RYO A;  4PSW A;  4CAV A;  4XNH C;  1BO4 A;  4KUB A;  4ZBG A;  1M4G A;  5HMN A;  2PR8 A;  4KOY A;  4R3L A;  1Z4E A;  2R8V A;  4MI4 A;  3KKW A;  2FS5 A;  5I0C A;  1L0C A;  3D8P A;  3DDD A;  3E0K A;  3P2H A;  2Y0M A;  3EY5 A;  4LUA A;  2IL4 A;  3DR6 A;  1IB1 E;  4FD6 A;  2OB0 A;  2FXF A;  2NMT A;  1GHE A;  1YK3 A;  2OZH A;  2WPX A;  1Z4R A;  3W6X A;  2B5G B;  3TO6 A;  1XEB A;  2R98 A;  2VQY A;  4AVB A;  5F46 A;  2AJ6 A;  2ZPA A;  4RI1 A;  4X5K A;  4KOV A;  2BL1 A;  4CRY B;  2B4D A;  4QVT A;  2WPW A;  2K5T A;  4KZT A;  1PUA A;  5J8C A;  3R9G A;  1YVK A;  4DNC A;  3EXN A;  5C82 A;  1YR0 A;  4IF5 A;  4HNW B;  4CS0 B;  2Q0Y A;  4FD7 A;  4UA3 A;  1XIX A;  2C27 A;  3GKR A;  1S3Z A;  2VXK A;  1WK4 A;  4UWI A;  2D4P A;  4NEX A;  2PR1 A;  3TOB A;  3R1K A;  5HH1 A;  1MJB A;  2JLM A;  2ARH A;  2F5I A;  4KOS A;  4QBJ A;  4MY0 A;  1Y7R A;  4LX9 A;  5JPH A;  2FIA A;  4XPL A;  4ORF A;  3R9E A;  4XNH B;  4AG9 A;  1NSL A;  3I3G A;  3EO4 A;  4RS2 A;  4JLY A;  3FNC A;  1B87 A;  4U9Y A;  3TO9 A;  3BJ8 A;  2B5G A;  2CNT A;  2FT0 A;  3GY9 A;  1KZF A;  3PP9 A;  4PV6 A;  4H89 A;  2I79 A;  2QEC A;  3TTH A;  4U9Z A;  2B3V A;  4FD5 A;  5IB0 A;  2B58 A;  2HV2 A;  5KTA A;  2FIW A;  5EC4 A;  2ZXV A;  4KOW A;  3NE7 A;  1XE4 A;  2ZW6 A;  3JUW A;  3SHP A;  2BSW A;  4HKF A;  1Y9W A;  1PU9 A;  1UFH A;  4XPD C;  2J8N A;  2R7H A;  2EUI A;  3SXN A;  4OAD A;  2OZG A;  4JWP A;  1YRE A;  1FY7 A;  2GE3 A;  2FSR A;  2GIV A;  4YGO A;  4AG7 A;  1B6B A;  1Q2C A;  2JEV A;  2RC4 A;  3TO7 A;  4F6A A;  4MBU A;  3F5B A;  5ISV A;  3S6K A;  5KTC A;  1RO5 A;  2PDO A;  1Q2D A;  1QSN A;  3W6S A;  3VWD A;  2OZU A;  3FB3 A;  1N71 A;  2EVN A;  2P6G A;  1P0H A;  3TOA A;  3QAH A;  1QSR A;  1CM0 A;  4QB9 A;  5F49 A;  4R9M A;  3DSB A;  2P6E A;  4KOR A;  4Y49 C;  4KUA A;  2VI7 A;  4E8O A;  2REE A;  1BOB A;  2HQY A;  4XPK A;  3CXS A;  2REF A;  3R95 A;  1I1D A;  2G3T A;  1VHS A;  3R96 A;  4KLW A;  1V0C A;  1S7N A;  2CNS A;  2DXQ A;  1OZP A;  4IUS A;  3W91 A;  1S60 A;  4KVM E;  5IX3 A;  1S7L A;  4OLL A;  4K30 A;  2Q4V A;  3TFY A;  3R9F A;  5CNP A;  1S7K A;  4HNY B;  5DWM A;  3OWC A;  4CAX A;  1LRZ A;  4L8A A;  4I49 A;  5C88 A;  1CJW A;  4KOU A;  2FCK A;  5F48 A;  4HNX B;  1MJ9 A;  4GS4 A;  2D4O A;  2H5M A;  1QSO A; 
#chains in the Genus database with same CATH topology
 1Y9K A;  3H5Z A;  4PSX A;  1VIX A;  2JDD A;  4YU9 A;  1YME A;  2FE7 A;  4MHY A;  4P4D A;  4M3S A;  1VKC A;  1M4I A;  3KAS A;  5JQ4 A;  5BWA B;  4ZYQ A;  1YLO A;  1QSM A;  2PRB A;  3KGQ A;  3WC7 A;  1I21 A;  3DR8 A;  3MN8 A;  2CF4 A;  5AG4 A;  1QST A;  1YLE A;  2PJ8 A;  3BLN A;  3S9N A;  3LWU A;  1P4N A;  2Q44 A;  4F9V A;  4OC4 A;  1Z5R A;  4A32 A;  4O23 A;  4UIB A;  4KOT A;  4KSA A;  4UFV A;  4R57 A;  5K8N A;  1CP6 A;  3T9Y A;  2AE6 A;  4MCQ A;  1Z8L A;  2QML A;  3IGR A;  4H2K A;  3B8G A;  2ATR A;  3H8G A;  3JTK A;  3SJG A;  3K9T A;  4OAE A;  5H86 A;  4OKO A;  3PFE A;  4NGS A;  1TF9 A;  4JYW A;  1CPS A;  3IWW A;  4KOX A;  5K8P A;  2DPS A;  2P6F A;  1KWM A;  2KCW A;  2GAN A;  3D7H A;  2Z0Z A;  3FMC A;  4FD4 A;  4FWU A;  4YFJ A;  1YW6 A;  2WSA A;  4UBR A;  2WZN A;  5ELY A;  3S6H A;  3PB8 X;  2BCO A;  3RZA A;  1NE9 A;  4MMO A;  4P4F A;  1PCA A;  2J8M A;  1Z9U A;  3B35 A;  3P2F A;  4P4B A;  2ZOG A;  4AVA A;  3GLJ A;  4UEF A;  1BAV A;  1XJO A;  1XMT A;  2BEI A;  4NSQ A;  4KLV A;  1X12 A;  4M85 A;  5F47 A;  4MHN A;  1X10 A;  4J3G A;  1IYK A;  1R3N A;  3BJ7 A;  2PJ7 A;  1XF8 A;  3KZW A;  4CGM A;  4NF1 A;  3F8K A;  4CRZ B;  1MJA A;  4R7M A;  4MFL A;  1CP7 A;  4P4I A;  4CGN A;  3FRM A;  4P44 A;  1LFW A;  3DNS A;  3FXT A;  1EE3 P;  3KHX A;  4RUH A;  2FL4 A;  4R6T A;  2CIJ A;  3EC4 A;  3CXP A;  3TC8 A;  3ZZI A;  4CAF A;  3TE4 A;  4QUS A;  3WC6 A;  2ABZ A;  4OC0 A;  4MHP A;  2V8D A;  4P45 A;  3SJF A;  1Q2Y A;  5IV0 A;  2J9A A;  1VHO A;  2ZW7 A;  3D67 A;  4AVC A;  4R3K A;  3IIB A;  4HPS A;  1S7F A;  3PRT A;  4Z65 A;  2CNM A;  1VGY A;  3ISZ A;  4Q36 A;  4ZY0 A;  5LYI A;  2Q4Y A;  4PK2 A;  4MXU A;  3SI1 A;  2PVW A;  4II9 A;  3T90 A;  2F8H A;  1YSJ A;  1IIC A;  1IGB A;  2CY2 A;  2VEZ A;  2ZW4 A;  3BI1 A;  3D66 A;  4X3R A;  4C2X A;  1U6M A;  1RXT A;  3RNZ A;  4NGM A;  1JWQ A;  1IOI A;  2PQ8 A;  3FEC A;  5HVH A;  4H6U A;  4UCP A;  3F0A A;  3KR5 A;  2GRE A;  1KUY A;  1TIQ A;  2B3U A;  1IYL A;  3BXM A;  4WWV A;  3BI0 A;  3IC1 A;  4P4E A;  4F8Z A;  3C26 A;  4H6Z A;  4NGR A;  2ZW5 A;  3V8I A;  4OIW A;  4M6H A;  4A38 A;  1BLL E;  3IU2 A;  2G0B A;  5LRK A;  3T8W A;  4OC1 A;  3I9S A;  5J8F A;  4A37 A;  4ZI6 A;  2DPT A;  3TT2 A;  3H4Q A;  2ZEN A;  4DYO A;  2Z10 A;  2ZEG A;  5THW A;  3S9M A;  2BUE A;  4JZ0 A;  3TCV A;  4AB7 A;  4UIA A;  3PGP A;  2P0W A;  1MK4 A;  2PIY A;  2AFO A;  2EO8 A;  3LOD A;  1GYT A;  4PK3 A;  3V38 A;  3HUV A;  2WYR A;  4YRH A;  5F09 A;  2YNC C;  3B3T A;  4NGQ A;  3VWE A;  4BMH A;  3NA6 A;  2J8R A;  4F9U A;  4KVX A;  1ZG7 A;  2Q51 A;  2PJ5 A;  1KUV A;  4MFZ A;  2O28 A;  2VZZ A;  4U5Y A;  4KVO E;  2PC1 A;  4FAI A;  4B5P B;  4E0A A;  2V77 A;  3G8W A;  4CAW A;  4EWT A;  1ARM A;  4PXD A;  1M44 A;  3FH4 A;  3KQZ A;  5EBV A;  3MGD A;  4UF4 A;  3D7G A;  1J4J A;  2PSW A;  2X7B A;  1Y0R A;  3IJ3 A;  4PPZ A;  3D3S A;  3FIX A;  3SI2 A;  4JJX A;  4F0Y A;  5LRJ A;  1SQH A;  4BBH A;  1LAP A;  4MY3 A;  4FUU A;  2NYQ A;  2C6C A;  3B7I A;  3D2P A;  4A39 A;  2AFW A;  4WJB A;  2PCU A;  4R87 A;  3A9L A;  3S6F A;  2VBQ A;  2RFH A;  2O4H A;  4K3N A;  7CPA A;  5DS0 A;  4KSF A;  4P6Y A;  4XPD B;  4LQ6 A;  4NXY A;  1I12 A;  1M4L A;  1R57 A;  1YX0 A;  3N7Z A;  2QIR A;  4JXR A;  4A95 A;  3FBU A;  4Q7A A;  5D29 A;  2G3A A;  1NSA A;  2Q7B A;  4C68 A;  1WWZ A;  2JEW A;  3K9U A;  3QB8 A;  3WR7 A;  4BIN A;  3KI9 A;  4QC6 A;  4B5O A;  2AFU A;  2JDC A;  1XRY A;  3QNV A;  5IB9 A;  1YQE A;  3IO1 A;  4JD6 A;  1M4D A;  1NMT A;  4JXQ A;  2OH1 A;  2OU2 A;  4PXC A;  4IK2 A;  5DWN A;  1FNO A;  8CPA A;  2EBJ A;  3HLP A;  1LAN A;  1Z8T A;  5G22 A;  2EWB A;  3FYN A;  2PIZ A;  3QAY A;  4MHD A;  4OC2 A;  3B2Y A;  2Q04 A;  2ANP A;  4X2T A;  1F57 A;  4EFD A;  3S6G A;  3V7Z A;  2ZEE A;  2YNE A;  3N5F A;  3NH4 A;  4B11 A;  5FVJ A;  3CPX A;  4L89 A;  2GLF A;  2IMO A;  3NE8 A;  3VAR A;  1IID A;  4E2A A;  1KUX A;  2A4N A;  3VAT A;  2HUZ A;  1CG2 A;  4B5P A;  3JVN A;  3FEE A;  4Y49 B;  3D2M A;  5E96 A;  3IFE A;  1ON0 A;  3NH8 A;  1CPX A;  3CXQ A;  3G3S A;  3PBE A;  3SXO A;  3ZJ0 A;  3KQX A;  1S5K A;  2I00 A;  4A31 A;  1Z2L A;  2GU2 A;  5G21 A;  5H84 A;  2AFX A;  2Z11 A;  3PZJ A;  3VH9 A;  4B13 A;  5GCN A;  2PJ6 A;  4ZX8 A;  3IWG A;  1AUG A;  4MJ8 A;  1R43 A;  1YGH A;  2B4D B;  2ODF A;  3CPA A;  2R1I A;  3LD2 A;  3DLJ A;  4ONU A;  3UY5 A;  2XEJ A;  5KTD A;  5JH9 A;  1CX8 A;  1M1D A;  5LYF A;  2B4B A;  2CTB A;  1YVO A;  2FVG A;  5LRG A;  2QJ8 A;  2AFM A;  3WC5 A;  1DE4 C;  3GYA A;  2VZY A;  4UWJ A;  3EFA A;  4NCZ A;  4G1P A;  1H8L A;  1K4J A;  4CAE A;  4EVY A;  3RYO A;  4PSW A;  2CXA A;  4CAV A;  4XNH C;  2GFQ A;  4DJL A;  5K8O A;  1BO4 A;  2CTC A;  2PJ1 A;  3FX6 A;  5CPA A;  4CGO A;  4KUB A;  3FJU A;  3SJX A;  2ZEF A;  4KS9 A;  3D4U A;  4NGT A;  1M4G A;  4ZBG A;  5HMN A;  2PR8 A;  2Z3L A;  4KOY A;  4NFR A;  4R3L A;  4UFX A;  4DUK A;  4F0X A;  1Z4E A;  3D7F A;  3CDX A;  5LYD A;  2R8V A;  4IHM A;  4MFJ A;  2ZEO A;  4MI4 A;  3KKW A;  2FS5 A;  4Q38 A;  4FBE A;  5I0C A;  1JQG A;  3PFO A;  4UEZ A;  1ZG8 A;  1L0C A;  3D8P A;  3GIU A;  4CGP A;  3DDD A;  3E0K A;  1QMU A;  3KR4 A;  3MRU A;  3P2H A;  3L2N A;  4GXH A;  2AFS A;  2PJ9 A;  2Y0M A;  3PB4 X;  2PJB A;  3EY5 A;  3IWE A;  4LUA A;  2Q4Z A;  2IL4 A;  2PJ2 A;  1IB1 E;  3DR6 A;  4FD6 A;  2OB0 A;  2ZEL A;  2FXF A;  5JGF A;  4UEE A;  2NMT A;  2JBK A;  4ZY1 A;  2PJ3 A;  1GHE A;  1OBR A;  1YK3 A;  2IQ6 A;  2OZH A;  4OC5 A;  4LQG A;  4CYN A;  2O53 A;  2WPX A;  1ZLH A;  3SI0 A;  1Z4R A;  2ZEH A;  4MFQ A;  1HDU A;  3FVL A;  3W6X A;  4MCS A;  2PVV A;  2B5G B;  2DEA A;  3TO6 A;  5A28 A;  4C7I A;  2XEG A;  1XEB A;  1HEE A;  2R98 A;  4MRI A;  4C2Y A;  2VQY A;  4AVB A;  1BPN A;  2Z3N A;  3B3W A;  2AJ6 A;  5F46 A;  2ZPA A;  1YW4 A;  4AXV A;  4RI1 A;  4X5K A;  4CYO A;  4KOV A;  2BL1 A;  4CRY B;  3PBB A;  2B4D A;  2PJC A;  4B14 A;  4QVT A;  3FF3 A;  3KL9 A;  2WPW A;  3CZX A;  2K5T A;  4NGP A;  4IAV A;  4KZT A;  1PUA A;  5J8C A;  4BD9 A;  3TX8 A;  4CYQ A;  2EK8 A;  3R9G A;  1QQ9 A;  4MFK A;  3RBU A;  4A33 A;  1YVK A;  2ZED A;  4OC3 A;  3RO0 A;  4DNC A;  3EXN A;  4R8F A;  5G1Z A;  5CBM A;  3CT9 A;  5C82 A;  4M6I A;  1YR0 A;  3ISX A;  4ONW A;  4IF5 A;  1FT7 A;  4HNW B;  1ZG9 A;  2Q0Y A;  4CS0 B;  4FD7 A;  4TNU A;  2ZEP A;  4UA3 A;  1XIX A;  3D68 A;  2C27 A;  4X8I A;  2ZEM A;  1ZLI A;  3GKR A;  1S3Z A;  1RTQ A;  2VXK A;  2PRQ A;  1PYT B;  1WK4 A;  4UWI A;  2D4P A;  2POK A;  2Z3M A;  2PR1 A;  4NEX A;  3TOB A;  3R1K A;  5K8M A;  5HH1 A;  1AMP A;  1MJB A;  1XMB A;  3S9L A;  2JLM A;  2V8H A;  4OP4 A;  2ARH A;  1Y0Y A;  2F5I A;  1ELM P;  4KOS A;  2I3C A;  4ZX9 A;  4QBJ A;  1ZO0 A;  3PEI A;  4B10 A;  4MY0 A;  1Y7R A;  1XBU A;  4LX9 A;  2YGW A;  4CPA A;  2FIA A;  4XPL A;  5JPH A;  3PB6 X;  1TF8 A;  2C1C A;  5AG6 A;  4ORF A;  3PB7 X;  4P10 A;  4XNH B;  3R9E A;  4AG9 A;  2JBJ A;  4EME A;  1NSL A;  3I3G A;  1ELL P;  2WUU A;  3EO4 A;  4RS2 A;  3D7D A;  3IU1 A;  1CBX A;  1XFO A;  4JLY A;  3FNC A;  1B87 A;  4U9Y A;  3TO9 A;  3BJ8 A;  2IJZ A;  2B5G A;  2CNT A;  2FT0 A;  3GY9 A;  1KZF A;  3PP9 A;  4PV6 A;  4H89 A;  2I79 A;  2QEC A;  4P4J A;  3TTH A;  1HDQ A;  3K2K A;  4GM5 A;  1IOF A;  2GLJ A;  2VL1 A;  4U9Z A;  3H8E A;  1Q7L A;  4OME A;  2B3V A;  3I1U A;  2Z3K A;  4FD5 A;  2XEF A;  3IEH A;  5IB0 A;  2YND A;  5HVF A;  2B58 A;  4ZGY B;  1XOV A;  3PB9 X;  2HV2 A;  5KTA A;  1TKH A;  3BHX A;  2FIW A;  4UCM A;  3WT4 A;  5EC4 A;  2ZXV A;  2DF5 A;  3NE7 A;  4KOW A;  4NJR A;  5A27 A;  1XE4 A;  3NH5 A;  2ZW6 A;  3JUW A;  3SHP A;  1TKJ A;  2BSW A;  2V8G A;  4HKF A;  1Y9W A;  4MHZ A;  1PU9 A;  4MCP A;  4A2Z A;  2C6P A;  1UFH A;  2OR4 A;  2J8N A;  4XPD C;  2R7H A;  1UWY A;  4CYP A;  5J1Q A;  4PXB A;  2EUI A;  3SXN A;  3B3S A;  3LMS A;  4OAD A;  2OZG A;  4JWP A;  5AG7 A;  1LCP A;  1YRE A;  1FY7 A;  1VHE A;  2FSR A;  2GE3 A;  2GIV A;  2ZOF A;  3DGV A;  4NJQ A;  5AGE A;  4YGO A;  4AG7 A;  4M6G A;  4A30 A;  2XEI A;  5HXD A;  2PJ4 A;  3H8F A;  1B6B A;  1Q2C A;  2JEV A;  2RC4 A;  3JRU A;  1IY7 A;  3B3V A;  3TO7 A;  4MBU A;  4B6Z A;  4F6A A;  3F5B A;  5ISV A;  2RB7 A;  3S6K A;  5KTC A;  4CGL A;  1RO5 A;  2PDO A;  2BOA A;  1Q2D A;  2G9D A;  1QSN A;  5EMI A;  4YWY A;  2EK9 A;  3B3C A;  3W6S A;  3VWD A;  2PJ0 A;  2OZU A;  4C7H A;  2C6G A;  1BPM A;  1DTD A;  3FB3 A;  3GB0 A;  4W9Y A;  1N71 A;  2F7V A;  5JM6 A;  2EVN A;  2P6G A;  1P0H A;  3TOA A;  2QYV A;  1F2P A;  1Z8W A;  3GUX A;  3QAH A;  3RAM A;  4ZY2 A;  1QSR A;  5D8N A;  1CM0 A;  4QB9 A;  2Z3P A;  4R76 A;  5F49 A;  1Z8X A;  2V8V A;  4R9M A;  3DSB A;  2AFZ A;  2P6E A;  2Q43 A;  4KOR A;  4NGN A;  4Y49 C;  3WAB A;  4KUA A;  1AYE A;  4OID A;  3KHZ A;  2VI7 A;  4E8O A;  2REE A;  1BOB A;  2HQY A;  4A94 A;  4MCR A;  4UFW A;  4XPK A;  2Z3O A;  3CXS A;  2REF A;  2NSM A;  3R95 A;  1LAM A;  4PQA A;  1I1D A;  2G3T A;  1F2O A;  1VHS A;  3R96 A;  5G20 A;  6CPA A;  4KLW A;  1LOK A;  1V0C A;  1S7N A;  2CNS A;  2DXQ A;  2PJA A;  1OZP A;  4MFP A;  4IUS A;  1A2Z A;  4C2Z A;  3W91 A;  1S60 A;  4KVM E;  5IX3 A;  5I4M A;  5LYL A;  2YNC A;  4KSI A;  1S7L A;  1Y7E A;  4K30 A;  2Q4V A;  4OLL A;  3SJE A;  3TFY A;  3R9F A;  5CNP A;  4PXE A;  1S7K A;  1TKF A;  4HNY B;  5DWM A;  2HC9 A;  3FED A;  3OWC A;  4B12 A;  4CAX A;  1LRZ A;  4UCN A;  3LAC A;  4L8A A;  4TWE A;  1TXR A;  1IU8 A;  4I49 A;  5C88 A;  1CJW A;  4RN7 A;  2Q7S A;  2PE3 A;  4KOU A;  2FCK A;  5F48 A;  3NFZ A;  5HVG A;  2BO9 A;  4HNX B;  1ARL A;  2OOT A;  1MJ9 A;  4GS4 A;  2D4O A;  2QVP A;  2H5M A;  5AG5 A;  2HB6 A;  1QSO A; 
#chains in the Genus database with same CATH homology
 1Y9K A;  3H5Z A;  4PSX A;  2JDD A;  2FE7 A;  4M3S A;  1VKC A;  1M4I A;  5JQ4 A;  5BWA B;  1QSM A;  2PRB A;  1I21 A;  3DR8 A;  5AG4 A;  1QST A;  1YLE A;  3BLN A;  1P4N A;  2Q44 A;  4A32 A;  4KOT A;  4KSA A;  4UFV A;  4R57 A;  3T9Y A;  2AE6 A;  2QML A;  3IGR A;  3JTK A;  2ATR A;  3B8G A;  4OAE A;  5H86 A;  4KOX A;  2DPS A;  2P6F A;  2KCW A;  2GAN A;  2Z0Z A;  4FD4 A;  4YFJ A;  2WSA A;  4UBR A;  3S6H A;  1NE9 A;  4AVA A;  2J8M A;  1Z9U A;  3P2F A;  2BEI A;  1XMT A;  4NSQ A;  4KLV A;  4M85 A;  5F47 A;  4J3G A;  1IYK A;  3BJ7 A;  1XF8 A;  4CGM A;  4NF1 A;  3F8K A;  4CRZ B;  1MJA A;  4MFL A;  4CGN A;  3FRM A;  3DNS A;  3FXT A;  2FL4 A;  3ZZI A;  3EC4 A;  4CAF A;  3CXP A;  3TE4 A;  4QUS A;  1Q2Y A;  5IV0 A;  4AVC A;  2ZW7 A;  4R3K A;  1S7F A;  2CNM A;  4Q36 A;  2Q4Y A;  4PK2 A;  4II9 A;  3T90 A;  2ZW4 A;  1IIC A;  2CY2 A;  2VEZ A;  4C2X A;  1U6M A;  1RXT A;  2PQ8 A;  4H6U A;  4UCP A;  3F0A A;  1KUY A;  1TIQ A;  2B3U A;  1IYL A;  3C26 A;  4H6Z A;  2ZW5 A;  3V8I A;  3IU2 A;  2G0B A;  3I9S A;  5J8F A;  2DPT A;  3TT2 A;  3H4Q A;  2Z10 A;  3TCV A;  2BUE A;  4AB7 A;  3PGP A;  2P0W A;  1MK4 A;  3LOD A;  4PK3 A;  4YRH A;  2YNC C;  3VWE A;  4BMH A;  2J8R A;  4KVX A;  1KUV A;  4MFZ A;  2O28 A;  2VZZ A;  4U5Y A;  4KVO E;  2PC1 A;  4B5P B;  4E0A A;  3G8W A;  4CAW A;  1M44 A;  5EBV A;  3MGD A;  1J4J A;  2PSW A;  2X7B A;  3D3S A;  3FIX A;  4F0Y A;  4JJX A;  1SQH A;  4BBH A;  4MY3 A;  3D2P A;  4R87 A;  3A9L A;  3S6F A;  2VBQ A;  4KSF A;  4XPD B;  4NXY A;  1I12 A;  1R57 A;  1YX0 A;  3N7Z A;  2QIR A;  4JXR A;  4A95 A;  3FBU A;  2G3A A;  2Q7B A;  4C68 A;  1WWZ A;  3QB8 A;  3K9U A;  3WR7 A;  4QC6 A;  4B5O A;  2JDC A;  4JD6 A;  1M4D A;  1NMT A;  4JXQ A;  2OH1 A;  2OU2 A;  5DWN A;  5G22 A;  3FYN A;  4MHD A;  2Q04 A;  3S6G A;  2YNE A;  4B11 A;  5FVJ A;  4L89 A;  1IID A;  4E2A A;  1KUX A;  2A4N A;  2HUZ A;  4B5P A;  3JVN A;  4Y49 B;  3D2M A;  5E96 A;  1ON0 A;  3CXQ A;  3G3S A;  3SXO A;  3ZJ0 A;  1S5K A;  2I00 A;  4A31 A;  5G21 A;  5H84 A;  4B13 A;  2Z11 A;  3PZJ A;  5GCN A;  3IWG A;  4MJ8 A;  1YGH A;  2B4D B;  2R1I A;  3LD2 A;  4ONU A;  3UY5 A;  5KTD A;  1M1D A;  2B4B A;  1YVO A;  3GYA A;  4UWJ A;  2VZY A;  3EFA A;  4NCZ A;  4CAE A;  1K4J A;  4EVY A;  3RYO A;  4PSW A;  2CXA A;  4CAV A;  4XNH C;  1BO4 A;  4CGO A;  4KUB A;  4KS9 A;  4ZBG A;  1M4G A;  5HMN A;  2PR8 A;  2Z3L A;  4KOY A;  4R3L A;  4UFX A;  4F0X A;  1Z4E A;  2R8V A;  4MFJ A;  4MI4 A;  3KKW A;  2FS5 A;  4Q38 A;  5I0C A;  4CGP A;  1L0C A;  3D8P A;  3DDD A;  3E0K A;  3P2H A;  2Y0M A;  3EY5 A;  4LUA A;  3IWE A;  2IL4 A;  3DR6 A;  1IB1 E;  4FD6 A;  2OB0 A;  2FXF A;  2NMT A;  1GHE A;  1YK3 A;  2OZH A;  4CYN A;  2WPX A;  1Z4R A;  4MFQ A;  3W6X A;  2B5G B;  3TO6 A;  5A28 A;  4C7I A;  1XEB A;  2R98 A;  4C2Y A;  2VQY A;  4AVB A;  2Z3N A;  5F46 A;  2AJ6 A;  2ZPA A;  4RI1 A;  4X5K A;  4CYO A;  4KOV A;  2BL1 A;  4CRY B;  2B4D A;  4B14 A;  4QVT A;  2WPW A;  2K5T A;  4KZT A;  1PUA A;  5J8C A;  4CYQ A;  3R9G A;  4MFK A;  4A33 A;  1YVK A;  4DNC A;  3EXN A;  5G1Z A;  5C82 A;  1YR0 A;  4IF5 A;  4HNW B;  4CS0 B;  2Q0Y A;  4FD7 A;  4UA3 A;  1XIX A;  2C27 A;  3GKR A;  1S3Z A;  2VXK A;  1WK4 A;  4UWI A;  2D4P A;  2Z3M A;  2PR1 A;  4NEX A;  3TOB A;  3R1K A;  5HH1 A;  1MJB A;  2JLM A;  2ARH A;  2F5I A;  4KOS A;  4QBJ A;  1ZO0 A;  4B10 A;  4MY0 A;  1Y7R A;  4LX9 A;  2YGW A;  5JPH A;  2FIA A;  4XPL A;  5AG6 A;  4ORF A;  3R9E A;  4XNH B;  4AG9 A;  1NSL A;  3I3G A;  2WUU A;  3EO4 A;  4RS2 A;  3IU1 A;  4JLY A;  3FNC A;  1B87 A;  4U9Y A;  3TO9 A;  3BJ8 A;  2B5G A;  2CNT A;  2FT0 A;  3GY9 A;  1KZF A;  3PP9 A;  4PV6 A;  4H89 A;  2I79 A;  2QEC A;  3TTH A;  4U9Z A;  2B3V A;  4FD5 A;  2Z3K A;  5IB0 A;  2YND A;  2B58 A;  4ZGY B;  2HV2 A;  5KTA A;  4UCM A;  2FIW A;  5EC4 A;  2ZXV A;  4KOW A;  3NE7 A;  5A27 A;  1XE4 A;  2ZW6 A;  3JUW A;  3SHP A;  2BSW A;  4HKF A;  1Y9W A;  1PU9 A;  4A2Z A;  1UFH A;  4XPD C;  2J8N A;  2R7H A;  4CYP A;  2EUI A;  3SXN A;  4OAD A;  2OZG A;  4JWP A;  5AG7 A;  1YRE A;  1FY7 A;  2GE3 A;  2FSR A;  2GIV A;  4YGO A;  4AG7 A;  5AGE A;  4A30 A;  1B6B A;  1Q2C A;  2JEV A;  2RC4 A;  3TO7 A;  4F6A A;  4MBU A;  3F5B A;  5ISV A;  3S6K A;  5KTC A;  4CGL A;  1RO5 A;  2PDO A;  1Q2D A;  1QSN A;  3W6S A;  3VWD A;  2OZU A;  4C7H A;  3FB3 A;  1N71 A;  2EVN A;  2P6G A;  1P0H A;  3TOA A;  3QAH A;  1QSR A;  1CM0 A;  4QB9 A;  2Z3P A;  5F49 A;  4R9M A;  3DSB A;  2P6E A;  4KOR A;  4Y49 C;  4KUA A;  2VI7 A;  4E8O A;  2REE A;  1BOB A;  2HQY A;  4UFW A;  4XPK A;  2Z3O A;  3CXS A;  2REF A;  3R95 A;  1I1D A;  2G3T A;  1VHS A;  3R96 A;  5G20 A;  4KLW A;  1V0C A;  1S7N A;  2CNS A;  2DXQ A;  1OZP A;  4MFP A;  4IUS A;  4C2Z A;  3W91 A;  1S60 A;  4KVM E;  5IX3 A;  2YNC A;  1S7L A;  4OLL A;  4K30 A;  2Q4V A;  3TFY A;  3R9F A;  5CNP A;  1S7K A;  4HNY B;  5DWM A;  3OWC A;  4B12 A;  4CAX A;  1LRZ A;  4UCN A;  4L8A A;  4I49 A;  5C88 A;  1CJW A;  4KOU A;  2FCK A;  5F48 A;  4HNX B;  1MJ9 A;  4GS4 A;  2D4O A;  2H5M A;  5AG5 A;  1QSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...