2Z0ZA

Crystal structure of putative acetyltransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLYGASGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA1799
publication title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 66
structure length 194
sequence length 194
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z0zA00
4QC6A 1PU9A 2FXFA 3TT2A 2ATRA 3SXNA 3W6SA 2A4NA 2R98A 5KTCA 2P6EA 3BLNA 4AG7A 3UY5A 1WK4A 4R57A 2HUZA 4AVCA 1M4IA 2B4BA 1XF8A 2Y0MA 2BSWA 1S7KA 5HMNA 2R8VA 2PDOA 3F5BA 3EC4A 3D3SA 5JQ4A 3I3GA 5F48A 2CNSA 4H89A 3I9SA 4AG9A 2G0BA 4FD4A 3TOAA 1VKCA 3G8WA 3EO4A 4UA3A 4L8AA 3TO7A 4CAXA 2CNTA 1Y9WA 1Y9KA 4U9ZA 1Q2YA 3QAHA 2Q44A 3F8KA 3GYAA 4KUAA 2H5MA 1MK4A 5IV0A 5FVJA 3E0KA 1IIDA 4YGOA 1YLEA 2DXQA 3GKRA 3IGRA 2VQYA 4PSXA 1YX0A 4BMHA 2OZHA 2PSWA 2P0WA 3D8PA 1IB1E 4Y49C 1I21A 4K30A 4I49A 4OLLA 3FB3A 4MY3A 1KUVA 2D4PA 1BOBA 2FIWA 2FCKA 3CXQA 3F0AA 2R7HA 1M1DA 4HNYB 1NMTA 1QSRA 3R9FA 2IL4A 5I0CA 3MGDA 4R9MA 3TO6A 1V0CA 4JLYA 4NF1A 1I1DA 5IB0A 1S7FA 3TOBA 4U9YA 4II9A 3JUWA 3DSBA 4AB7A 4CS0B 2REFA 3BJ8A 2FIAA 1PUAA 4CRYB 4MY0A 2QECA 4KOVA 2GIVA 3LODA 4DNCA 3H4QA 2VEZA 4F6AA 3ZJ0A 1R57A 2OH1A 4QVTA 2RC4A 2J8RA 3FYNA 1BO4A 4FD5A 4IUSA 1Q2CA 3N7ZA 4ONUA 4QBJA 5C82A 3SHPA 4JXQA 2B5GA 5DWNA 4AVAA 1B6BA 4M3SA 2NMTA 1SQHA 2K5TA 4JXRA 4KOWA 1GHEA 2Z11A 2QIRA 4RI1A 4UWJA 2Q7BA 4MJ8A 2R1IA 3D2MA 4HNWB 1NSLA 2ZXVA 4PSWA 2ZW6A 3PGPA 3GY9A 3T90A 4KOYA 2F5IA 3P2FA 2AE6A 4R3LA 3R96A 4E8OA 4YFJA 1FY7A 5F49A 2J8NA 1OZPA 4ZBGA 1N71A 3R9GA 3T9YA 5F46A 2ARHA 2Q04A 3QB8A 4KZTA 2I00A 1QSTA 2OZUA 1IYKA 1TIQA 2VI7A 3TE4A 2ZPAA 3C26A 3DNSA 4LUAA 4NXYA 3FXTA 1S7LA 4Y49B 1S7NA 4XNHC 3RYOA 2GANA 2WPWA 2EUIA 4JJXA 1M4DA 1YR0A 2BL1A 5H84A 2J8MA 3FBUA 2B58A 5J8FA 4B5PA 4E0AA 3IWGA 3S6GA 3V8IA 1KZFA 2P6FA 2PQ8A 2BUEA 4H6ZA 1WWZA 1M4GA 3VWDA 4KOXA 4R3KA 3TFYA 1IYLA 2VBQA 1UFHA 4GS4A 1XMTA 4UBRA 2VXKA 3SXOA 5KTDA 3DDDA 2G3TA 1VHSA 1QSMA 3G3SA 4LX9A 1QSNA 1MJBA 5IX3A 3S6KA 2FT0A 4JD6A 5J8CA 4J3GA 2Q0YA 5DWMA 2PRBA 1K4JA 3R1KA 2PR1A 1CM0A 1J4JA 2EVNA 2G3AA 1Z4EA 4KUBA 4MI4A 3WR7A 1B87A 2FSRA 2I79A 2CNMA 5HH1A 4L89A 1XIXA 1KUYA 1Y7RA 4CAWA 2B3UA 1YREA 3W6XA 2FE7A 3R95A 5H86A 2O28A 3CXSA 2JEVA 3BJ7A 1QSOA 1P0HA 2Z10A 4KOSA 4M85A 4AVBA 4XPDC 1MJ9A 3LD2A 1S3ZA 3W91A 2B5GB 1Q2DA 3VWEA 1CJWA 3P2HA 1Z9UA 2GE3A 4IF5A 4ORFA 5EC4A 2WPXA 2Q4VA 3EY5A 1I12A 1P4NA 5C88A 4UWIA 4KORA 2VZYA 3TCVA 4NCZA 1YVOA 4OADA 2PR8A 2REEA 2AJ6A 4PK2A 4KVME 2OZGA 3JVNA 1NE9A 2HQYA 2ZW7A 2CY2A 4HNXB 2FS5A 1KUXA 4RS2A 4XPKA 4R87A 4YRHA 4MBUA 4XNHB 4F0YA 4FD6A 5F47A 1ON0A 3K9UA 4KOTA 4KVXA 1LRZA 4EVYA 2ZW4A 1YVKA 1Z4RA 3FRMA 3DR6A 2OB0A 2B3VA 2D4OA 2Z0ZA 2PC1A 3B8GA 1L0CA 3R9EA 2Q4YA 4KLVA 1M44A 3KKWA 3S6FA 3TO9A 3FIXA 4B5OA 4OAEA 2B4DA 2OU2A 5JPHA 4FD7A 3DR8A 2QMLA 4PV6A 3EFAA 4QB9A 3PP9A 5GCNA 2C27A 2KCWA 4B5PB 4U5YA 2B4DB 3D2PA 4NSQA 2ZW5A 3EXNA 4H6UA 4MHDA 5E96A 2BEIA 4NEXA 2VZZA 5KTAA 4JWPA 4XPLA 4CAVA 3FNCA 5EBVA 2X7BA 4HKFA 4KOUA 4QUSA 1YGHA 1XE4A 4CRZB 3OWCA 1IICA 4KVOE 3S6HA 5ISVA 2JDCA 2JDDA 4KLWA 2P6GA 1S5KA 1MJAA 3PZJA 4XPDB 4E2AA 1S60A 5CNPA 3ZZIA 4PK3A 4X5KA 3TTHA 1RXTA 1XEBA 3CXPA 2FL4A 1U6MA 1YK3A 2HV2A 2JLMA 3NE7A 1RO5A
chains in the Genus database with same CATH superfamily
3CZXA 2ANPA 3GLJA 4QC6A 5A27A 1PU9A 1TXRA 4ZI6A 2FXFA 7CPAA 3TT2A 1ZO0A 3PB6X 2ATRA 3SXNA 4DYOA 3B3TA 2A4NA 2R98A 3W6SA 2EK8A 5KTCA 2P6EA 3BLNA 4AG7A 4MCPA 3UY5A 2I3CA 2NSMA 1WK4A 4R57A 2PJ5A 1TKJA 2PJ8A 2PRQA 2HUZA 1RTQA 2AFUA 1M4IA 2B4BA 3GUXA 2PE3A 3SJXA 4AVCA 1FT7A 3FH4A 1XJOA 1Z8WA 1LAPA 4G1PA 1XF8A 2Y0MA 2BSWA 1S7KA 2ZOGA 3D7DA 1ZG9A 2AFXA 1M4LA 4RN7A 4B11A 3N5FA 5HMNA 2R8VA 3H8FA 3D67A 1XRYA 2PJ9A 3NE8A 2AFWA 4MFKA 4UFWA 2PDOA 3F5BA 4C7HA 3B3SA 3EC4A 2PJAA 3D3SA 5JQ4A 2WYRA 3I3GA 5F48A 3RAMA 4EWTA 1OBRA 2CNSA 3CDXA 2QYVA 3KQXA 3I9SA 2GU2A 4H89A 4RUHA 4ZY1A 4AG9A 5CPAA 4UEZA 2G0BA 4FD4A 5K8NA 3TOAA 4OMEA 1VKCA 3IEHA 3G8WA 3EO4A 4CGPA 3D66A 4UA3A 3SJEA 4L8AA 3TO7A 4CAXA 3GIUA 2CNTA 3KZWA 4YU9A 1Y9WA 1Y9KA 3FEEA 2ZEMA 4U9ZA 1Q2YA 3QAHA 4UEEA 4LQGA 2Q44A 1TF8A 2PJ6A 4DUKA 3F8KA 3GYAA 1X12A 1KWMA 4KUAA 4PXCA 1BAVA 3D68A 3I1UA 1IGBA 1XFOA 1MK4A 2H5MA 4YWYA 5IV0A 3WC7A 4ZGYB 3TE4A 2Q7SA 4P45A 2EK9A 3IU1A 5FVJA 3E0KA 1IIDA 4YGOA 2Z3LA 4EMEA 1YLEA 2DXQA 1Z8TA 2PVWA 3GKRA 3IGRA 1ZG7A 3SJGA 2VQYA 4PSXA 4ZX9A 5K8PA 1YX0A 3H8EA 4NGSA 4BMHA 1JQGA 2YNCA 5BWAB 2OZHA 4UEFA 2Z3KA 2PSWA 2RFHA 2P0WA 1BPNA 4P4EA 1VGYA 1CX8A 3D8PA 4MRIA 2C6CA 5EMIA 1F57A 3IC1A 1IB1E 2PVVA 1VIXA 1I21A 4Q36A 4Y49C 4B6ZA 2PJ1A 4K30A 4I49A 2XEJA 3NH4A 4OLLA 3FB3A 2PJ0A 4MY3A 2G9DA 3CT9A 4ZX8A 2OR4A 4CYNA 1KUVA 2D4PA 2WUUA 2EBJA 1BOBA 4P4JA 4A31A 2Z3PA 2FIWA 2FCKA 2ZEPA 4CAFA 1Y0YA 3CXQA 1YW6A 5LRKA 3F0AA 2R7HA 1ARMA 1M1DA 4HNYB 1NMTA 1QSRA 3R9FA 2IL4A 1YLOA 2YNCC 4P6YA 2XEGA 2OOTA 2AFZA 5I0CA 3MGDA 2EWBA 4R9MA 3TO6A 3PB9X 1V0CA 4JLYA 4FWUA 4NF1A 3MN8A 1I1DA 3QNVA 4FBEA 5IB0A 1S7FA 3TOBA 4MHZA 4U9YA 4II9A 3JUWA 4NGQA 2ZELA 3DSBA 3TX8A 2O4HA 4AB7A 2REFA 4NJRA 4CS0B 3BJ8A 2FIAA 1PUAA 3KGQA 4CRYB 4MY0A 3GB0A 2QECA 2POKA 1LCPA 4KOVA 2V8VA 2PIZA 2GIVA 2ZEEA 3LODA 3H4QA 4DNCA 3K9TA 2VEZA 1ZLIA 4F6AA 4IK2A 3ZJ0A 4P10A 1PCAA 1R57A 2OH1A 5THWA 4KSIA 4MCRA 3JTKA 4KS9A 3L2NA 4QVTA 2RC4A 3NH8A 2J8RA 2ZEOA 4UIAA 2C6GA 3FYNA 1BO4A 4FD5A 4IUSA 4CYPA 1Q2CA 3N7ZA 4O23A 2ZEDA 4ONUA 4QBJA 5C82A 2JBJA 4OC4A 4P4FA 2O53A 3SHPA 2J9AA 4JXQA 4A32A 4F9VA 2B5GA 5DWNA 1CP7A 4MFPA 5LYIA 2PJ7A 4AVAA 2Z3OA 4HPSA 4EFDA 1B6BA 3BXMA 4M3SA 4JYWA 3IWEA 2NMTA 1SQHA 4M6HA 2K5TA 4JXRA 5AG4A 3T8WA 3FJUA 1VHEA 4KOWA 3VATA 1GHEA 2PJCA 4JZ0A 2Z11A 5I4MA 4NGMA 2QIRA 4RI1A 2PJ3A 3FX6A 4P44A 1ZG8A 2DPSA 4UWJA 5HVFA 2Q7BA 5G22A 3B3CA 5HVGA 3IO1A 4MJ8A 2R1IA 4A2ZA 1LOKA 3D2MA 2ZEFA 3FMCA 2AFSA 2Q4ZA 4HNWB 2ZXVA 1NSLA 4R76A 4PSWA 2ZW6A 3PFOA 3RZAA 3PGPA 3GY9A 3IIBA 3T90A 1FNOA 4KOYA 2F5IA 2JBKA 4A38A 3FVLA 2FVGA 3P2FA 2CXAA 2AE6A 4R3LA 3R96A 4MCQA 4UIBA 4OIWA 5G20A 4E8OA 1UWYA 4YFJA 5JGFA 4X8IA 4CPAA 4ZYQA 1FY7A 5F49A 1F2PA 2J8NA 1OZPA 1TKFA 4ZBGA 1N71A 3RBUA 3R9GA 3NH5A 3IWWA 3T9YA 4C2YA 2AFMA 4A94A 5F46A 3BI0A 2CIJA 4FUUA 2ARHA 3KR4A 2QJ8A 4NGRA 4OC1A 2Q04A 1XMBA 3QB8A 4BBHA 4KZTA 4MFZA 2I00A 1QSTA 1Z8LA 2OZUA 4PXDA 1IYKA 1TIQA 2VI7A 1NSAA 2ZPAA 3B7IA 4MMOA 4OC2A 4P4DA 2NYQA 4Q38A 1QMUA 3C26A 4WWVA 3DNSA 3PFEA 2V77A 4LUAA 4NXYA 1YW4A 4UCMA 1AUGA 3FXTA 2JEWA 1S7LA 2ZENA 4Y49B 5HXDA 1S7NA 4XNHC 3RYOA 1CP6A 2GANA 4CGMA 2DPTA 2WPWA 2V8HA 3VH9A 2EUIA 4JJXA 1M4DA 1YR0A 2BL1A 1HEEA 3B2YA 5H84A 2J8MA 4NJQA 3FBUA 4C2ZA 5AGEA 1VHOA 1XOVA 4H2KA 4OC3A 2B58A 4A95A 5J8FA 4B5PA 1X10A 4E0AA 3PBBA 3HLPA 3IWGA 4Z65A 4WJBA 3S6GA 4ZY0A 2ZEHA 4Q7AA 3V8IA 1KZFA 1Q7LA 2P6FA 2PQ8A 2YNDA 3BI1A 2BUEA 4H6ZA 2GLJA 1WWZA 1M4GA 5HVHA 3S9NA 4PPZA 4W9YA 1IY7A 4KOXA 3VWDA 4R3KA 4B14A 3TFYA 1IYLA 2VBQA 4CGLA 1UFHA 1ELMP 4GS4A 1XMTA 4UBRA 5AG5A 2VXKA 3SXOA 1HDQA 1A2ZA 5KTDA 1ELLP 3BHXA 3DDDA 2G3TA 1VHSA 3SI0A 1QSMA 3VARA 3G3SA 4LX9A 1QSNA 1MJBA 4X2TA 5IX3A 3S6KA 4GXHA 2FT0A 4JD6A 5J8CA 4J3GA 4OP4A 1EE3P 4CAEA 2Q0YA 5DWMA 2PRBA 1AYEA 2V8DA 3PB4X 4KSFA 1K4JA 3R1KA 1CPSA 2PR1A 5K8OA 3QAYA 1CM0A 1J4JA 1AMPA 4OKOA 1BLLE 2EVNA 2WSAA 4OIDA 5AG6A 1YQEA 1QQ9A 4LQ6A 2BCOA 2G3AA 1Z4EA 4KUBA 4MI4A 3WR7A 4NGNA 4DJLA 1ARLA 1B87A 3PB8X 2FSRA 2I79A 1IOIA 2CNMA 2C6PA 5HH1A 2GREA 3NFZA 4L89A 1Y0RA 1XIXA 2BOAA 4UCPA 1KUYA 1Y7RA 4CAWA 4ONWA 5J1QA 2B3UA 2DF5A 1Z5RA 3JRUA 1YREA 5LYLA 3W6XA 2IJZA 2FE7A 3R95A 5H86A 3SJFA 2O28A 1TKHA 2JEVA 3BJ7A 3CXSA 4P4IA 5G1ZA 4CGNA 1QSOA 2RB7A 2ZOFA 1P0HA 2PIYA 2Z10A 3FEDA 3HUVA 4KOSA 2CTBA 4M85A 4NGPA 4XPDC 3WABA 4AVBA 1MJ9A 1R43A 3LD2A 1S3ZA 2CTCA 3W91A 2B5GB 1Q2DA 4MFQA 3VWEA 1CJWA 4NGTA 3P2HA 1Z9UA 2GFQA 2GE3A 3D4UA 5JH9A 4IF5A 4ORFA 4PXBA 5D8NA 2GLFA 2Q4VA 2WPXA 1I12A 3EY5A 5EC4A 4B12A 1P4NA 5C88A 5DS0A 4UWIA 3IFEA 4M6GA 4MCSA 1CBXA 3WT4A 4KORA 2VZYA 1Z2LA 1DE4C 2BO9A 3TCVA 4NCZA 2PCUA 1YVOA 3DGVA 2VL1A 2PR8A 4OADA 4UFVA 4C68A 4CGOA 2REEA 3KL9A 2AJ6A 4PK2A 3D7GA 1GYTA 4KVME 2OZGA 3IU2A 3KR5A 4MFJA 2IQ6A 3JVNA 1NE9A 3MRUA 3CPAA 2HQYA 4A39A 4A33A 2ZW7A 2CY2A 4HNXB 4MXUA 3KQZA 1R3NA 1KUXA 2FS5A 1JWQA 1ZLHA 8CPAA 4RS2A 4XPKA 4R87A 4YRHA 4OC0A 2HC9A 3WC5A 4MBUA 2PJ4A 3PBEA 4XNHB 4F0YA 3D7FA 4MFLA 4FD6A 2DEAA 1CG2A 5ELYA 5F47A 1ON0A 5LRGA 3K9UA 4KOTA 1IOFA 4X3RA 4KVXA 5F09A 1LRZA 4EVYA 6CPAA 3SI1A 2ZW4A 3TC8A 1YMEA 1YVKA 1Z4RA 3FECA 3FRMA 2F7VA 2Q43A 2OB0A 2B3VA 3DR6A 2D4OA 2Z0ZA 3D7HA 1H8LA 2PC1A 3B8GA 3RO0A 1L0CA 3R9EA 2Q4YA 4K3NA 2WZNA 4KLVA 4OC5A 1M44A 4F8ZA 3KKWA 3KHXA 3S6FA 3TO9A 3LACA 3KI9A 1BPMA 3FIXA 4IHMA 4B5OA 4OAEA 4BINA 1TF9A 2B4DA 2OU2A 4ZY2A 3B3WA 5JPHA 3PB7X 4FD7A 3DR8A 4PQAA 4M6IA 3A9LA 1HDUA 1LFWA 2C1CA 3ISXA 4C7IA 4CYQA 1F2OA 2QMLA 1CPXA 3LMSA 4IAVA 2Z3NA 4PV6A 4UCNA 3EFAA 4QB9A 3S9MA 4MHNA 1YSJA 2YNEA 3PP9A 3SI2A 5JM6A 5K8MA 5GCNA 2C27A 2KCWA 4A37A 4B5PB 2IMOA 2ZEGA 4U5YA 3V7ZA 3ISZA 2AFOA 2B4DB 2QVPA 4MHYA 5AG7A 1Z8XA 3PRTA 4R7MA 3D2PA 3V38A 3B35A 4R8FA 4NSQA 2ZW5A 3FF3A 3EXNA 3B3VA 3K2KA 4H6UA 2ODFA 4MHDA 5E96A 4BD9A 2BEIA 3LWUA 2VZZA 1IU8A 4MHPA 4NEXA 3H8GA 3KASA 4JWPA 5D29A 4XPLA 5KTAA 5LYFA 4CAVA 4UFXA 3FNCA 2PJBA 3DLJA 4TWEA 4CYOA 2F8HA 1PYTB 2YGWA 5EBVA 2X7BA 4C2XA 4HKFA 5IB9A 4NFRA 4PXEA 5CBMA 2CF4A 4KOUA 4QUSA 3KHZA 1YGHA 1XE4A 4CRZB 1DTDA 5LYDA 2PJ2A 1Y7EA 2V8GA 3OWCA 2Q51A 5A28A 1IICA 4P4BA 4KVOE 4KSAA 2ABZA 5LRJA 3S9LA 3S6HA 4F9UA 5ISVA 2JDCA 2EO8A 4F0XA 2JDDA 4KLWA 3H5ZA 2XEIA 4TNUA 1XBUA 1LANA 3NA6A 4AXVA 2P6GA 1S5KA 1MJAA 3PZJA 4XPDB 4E2AA 2HB6A 1S60A 5CNPA 4B13A 3ZZIA 4GM5A 4PK3A 4X5KA 3TTHA 3RNZA 1LAMA 4A30A 2Z3MA 1RXTA 4UF4A 1XEBA 3IJ3A 3CPXA 4B10A 3WC6A 4R6TA 4FAIA 3CXPA 2FL4A 1U6MA 1YK3A 5G21A 2HV2A 2JLMA 2XEFA 3NE7A 3PEIA 1RO5A
chains in the Genus database with same CATH topology
4QC6A 5A27A 1PU9A 2FXFA 3TT2A 1ZO0A 2ATRA 3SXNA 3W6SA 2A4NA 2R98A 5KTCA 2P6EA 3BLNA 4AG7A 3UY5A 1WK4A 4R57A 2HUZA 4AVCA 1M4IA 2B4BA 1XF8A 2Y0MA 2BSWA 1S7KA 5HMNA 4B11A 2R8VA 4C7HA 4MFKA 4UFWA 2PDOA 3F5BA 3EC4A 3D3SA 5JQ4A 3I3GA 5F48A 2CNSA 4H89A 3I9SA 4AG9A 2G0BA 4FD4A 3TOAA 1VKCA 3G8WA 3EO4A 4CGPA 4UA3A 4L8AA 3TO7A 4CAXA 2CNTA 1Y9WA 1Y9KA 4U9ZA 1Q2YA 3QAHA 2Q44A 3F8KA 3GYAA 4KUAA 2H5MA 1MK4A 5IV0A 4ZGYB 3IU1A 5FVJA 3E0KA 1IIDA 4YGOA 2Z3LA 1YLEA 2DXQA 3GKRA 3IGRA 2VQYA 4PSXA 1YX0A 4BMHA 2YNCA 5BWAB 2OZHA 2Z3KA 2PSWA 2P0WA 3D8PA 1IB1E 4Q36A 1I21A 4Y49C 4K30A 4I49A 4OLLA 3FB3A 4MY3A 4CYNA 1KUVA 2D4PA 2WUUA 1BOBA 4A31A 2Z3PA 2FIWA 2FCKA 4CAFA 3CXQA 3F0AA 2R7HA 1M1DA 4HNYB 1NMTA 1QSRA 3R9FA 2IL4A 2YNCC 5I0CA 3MGDA 4R9MA 3TO6A 1V0CA 4JLYA 4NF1A 1I1DA 5IB0A 1S7FA 3TOBA 4U9YA 4II9A 3JUWA 3DSBA 4AB7A 4CS0B 2REFA 3BJ8A 2FIAA 1PUAA 4CRYB 4MY0A 2QECA 4KOVA 2GIVA 3LODA 4DNCA 3H4QA 2VEZA 4F6AA 3ZJ0A 1R57A 2OH1A 3JTKA 4KS9A 4QVTA 2RC4A 2J8RA 3FYNA 1BO4A 4FD5A 4IUSA 4CYPA 1Q2CA 3N7ZA 4ONUA 4QBJA 5C82A 3SHPA 4A32A 4JXQA 2B5GA 5DWNA 4AVAA 4MFPA 2Z3OA 1B6BA 4M3SA 3IWEA 2NMTA 1SQHA 2K5TA 4JXRA 5AG4A 4KOWA 1GHEA 2Z11A 2QIRA 4RI1A 2DPSA 4UWJA 2Q7BA 5G22A 4MJ8A 4A2ZA 2R1IA 3D2MA 4HNWB 1NSLA 2ZXVA 4PSWA 2ZW6A 3PGPA 3GY9A 3T90A 4KOYA 2F5IA 3P2FA 2CXAA 2AE6A 4R3LA 3R96A 5G20A 4E8OA 4YFJA 1FY7A 5F49A 2J8NA 1OZPA 4ZBGA 1N71A 3R9GA 3T9YA 4C2YA 5F46A 2ARHA 2Q04A 3QB8A 4BBHA 4KZTA 4MFZA 2I00A 1QSTA 2OZUA 1IYKA 1TIQA 2VI7A 4Q38A 2ZPAA 3TE4A 3C26A 3DNSA 4LUAA 4NXYA 4UCMA 3FXTA 1S7LA 4Y49B 1S7NA 4XNHC 3RYOA 2GANA 4CGMA 2DPTA 2WPWA 2EUIA 4JJXA 1M4DA 1YR0A 2BL1A 5H84A 2J8MA 4C2ZA 3FBUA 5AGEA 2B58A 4A95A 5J8FA 4B5PA 4E0AA 3IWGA 3S6GA 3V8IA 1KZFA 2YNDA 2P6FA 2PQ8A 2BUEA 4H6ZA 1WWZA 1M4GA 3VWDA 4KOXA 4R3KA 4B14A 3TFYA 1IYLA 2VBQA 4CGLA 1UFHA 4GS4A 1XMTA 4UBRA 5AG5A 2VXKA 3SXOA 5KTDA 3DDDA 2G3TA 1VHSA 1QSMA 3G3SA 4LX9A 1QSNA 1MJBA 5IX3A 3S6KA 2FT0A 4JD6A 5J8CA 4J3GA 4CAEA 2Q0YA 5DWMA 2PRBA 4KSFA 1K4JA 3R1KA 2PR1A 1CM0A 1J4JA 2EVNA 2WSAA 5AG6A 2G3AA 1Z4EA 4KUBA 4MI4A 3WR7A 1B87A 2FSRA 2I79A 2CNMA 5HH1A 4L89A 1XIXA 4UCPA 1KUYA 1Y7RA 4CAWA 2B3UA 1YREA 3W6XA 2FE7A 3R95A 5H86A 2O28A 3CXSA 2JEVA 3BJ7A 5G1ZA 4CGNA 1QSOA 1P0HA 2Z10A 4KOSA 4M85A 4AVBA 4XPDC 1MJ9A 3LD2A 1S3ZA 3W91A 2B5GB 1Q2DA 4MFQA 3VWEA 1CJWA 3P2HA 1Z9UA 2GE3A 4IF5A 4ORFA 5EC4A 2WPXA 2Q4VA 3EY5A 1I12A 4B12A 1P4NA 5C88A 4UWIA 4KORA 2VZYA 3TCVA 4NCZA 1YVOA 4OADA 2PR8A 4UFVA 4C68A 4CGOA 2REEA 2AJ6A 4PK2A 4KVME 2OZGA 3IU2A 4MFJA 3JVNA 1NE9A 2HQYA 4A33A 2ZW7A 2CY2A 4HNXB 2FS5A 1KUXA 4RS2A 4XPKA 4R87A 4YRHA 4MBUA 4XNHB 4F0YA 4MFLA 4FD6A 5F47A 1ON0A 3K9UA 4KOTA 4KVXA 1LRZA 4EVYA 2ZW4A 1YVKA 1Z4RA 3FRMA 3DR6A 2OB0A 2B3VA 2D4OA 2Z0ZA 2PC1A 3B8GA 1L0CA 3R9EA 2Q4YA 4KLVA 1M44A 3KKWA 3S6FA 3TO9A 3FIXA 4B5OA 4OAEA 2B4DA 2OU2A 5JPHA 4FD7A 3DR8A 3A9LA 4C7IA 4CYQA 2QMLA 4PV6A 4UCNA 2Z3NA 3EFAA 4QB9A 2YNEA 3PP9A 5GCNA 2C27A 2KCWA 4B5PB 4U5YA 2B4DB 5AG7A 3D2PA 4NSQA 2ZW5A 3EXNA 4H6UA 4MHDA 5E96A 2BEIA 4NEXA 2VZZA 5KTAA 4JWPA 4XPLA 4CAVA 4UFXA 3FNCA 4CYOA 2YGWA 5EBVA 2X7BA 4C2XA 4HKFA 4KOUA 4QUSA 1YGHA 1XE4A 4CRZB 3OWCA 5A28A 1IICA 4KVOE 4KSAA 3S6HA 5ISVA 2JDCA 4F0XA 2JDDA 4KLWA 3H5ZA 2P6GA 1S5KA 1MJAA 3PZJA 4XPDB 4E2AA 1S60A 5CNPA 4B13A 3ZZIA 4PK3A 4X5KA 3TTHA 4A30A 2Z3MA 1RXTA 1XEBA 4B10A 3CXPA 2FL4A 1U6MA 1YK3A 5G21A 2HV2A 2JLMA 3NE7A 1RO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QC6 A;  1PU9 A;  2FXF A;  3TT2 A;  2ATR A;  3SXN A;  3W6S A;  2A4N A;  2R98 A;  5KTC A;  2P6E A;  3BLN A;  4AG7 A;  3UY5 A;  1WK4 A;  4R57 A;  2HUZ A;  4AVC A;  1M4I A;  2B4B A;  1XF8 A;  2Y0M A;  2BSW A;  1S7K A;  5HMN A;  2R8V A;  2PDO A;  3F5B A;  3EC4 A;  3D3S A;  5JQ4 A;  3I3G A;  5F48 A;  2CNS A;  4H89 A;  3I9S A;  4AG9 A;  2G0B A;  4FD4 A;  3TOA A;  1VKC A;  3G8W A;  3EO4 A;  4UA3 A;  4L8A A;  3TO7 A;  4CAX A;  2CNT A;  1Y9W A;  1Y9K A;  4U9Z A;  1Q2Y A;  3QAH A;  2Q44 A;  3F8K A;  3GYA A;  4KUA A;  2H5M A;  1MK4 A;  5IV0 A;  5FVJ A;  3E0K A;  1IID A;  4YGO A;  1YLE A;  2DXQ A;  3GKR A;  3IGR A;  2VQY A;  4PSX A;  1YX0 A;  4BMH A;  2OZH A;  2PSW A;  2P0W A;  3D8P A;  1IB1 E;  4Y49 C;  1I21 A;  4K30 A;  4I49 A;  4OLL A;  3FB3 A;  4MY3 A;  1KUV A;  2D4P A;  1BOB A;  2FIW A;  2FCK A;  3CXQ A;  3F0A A;  2R7H A;  1M1D A;  4HNY B;  1NMT A;  1QSR A;  3R9F A;  2IL4 A;  5I0C A;  3MGD A;  4R9M A;  3TO6 A;  1V0C A;  4JLY A;  4NF1 A;  1I1D A;  5IB0 A;  1S7F A;  3TOB A;  4U9Y A;  4II9 A;  3JUW A;  3DSB A;  4AB7 A;  4CS0 B;  2REF A;  3BJ8 A;  2FIA A;  1PUA A;  4CRY B;  4MY0 A;  2QEC A;  4KOV A;  2GIV A;  3LOD A;  4DNC A;  3H4Q A;  2VEZ A;  4F6A A;  3ZJ0 A;  1R57 A;  2OH1 A;  4QVT A;  2RC4 A;  2J8R A;  3FYN A;  1BO4 A;  4FD5 A;  4IUS A;  1Q2C A;  3N7Z A;  4ONU A;  4QBJ A;  5C82 A;  3SHP A;  4JXQ A;  2B5G A;  5DWN A;  4AVA A;  1B6B A;  4M3S A;  2NMT A;  1SQH A;  2K5T A;  4JXR A;  4KOW A;  1GHE A;  2Z11 A;  2QIR A;  4RI1 A;  4UWJ A;  2Q7B A;  4MJ8 A;  2R1I A;  3D2M A;  4HNW B;  1NSL A;  2ZXV A;  4PSW A;  2ZW6 A;  3PGP A;  3GY9 A;  3T90 A;  4KOY A;  2F5I A;  3P2F A;  2AE6 A;  4R3L A;  3R96 A;  4E8O A;  4YFJ A;  1FY7 A;  5F49 A;  2J8N A;  1OZP A;  4ZBG A;  1N71 A;  3R9G A;  3T9Y A;  5F46 A;  2ARH A;  2Q04 A;  3QB8 A;  4KZT A;  2I00 A;  1QST A;  2OZU A;  1IYK A;  1TIQ A;  2VI7 A;  3TE4 A;  2ZPA A;  3C26 A;  3DNS A;  4LUA A;  4NXY A;  3FXT A;  1S7L A;  4Y49 B;  1S7N A;  4XNH C;  3RYO A;  2GAN A;  2WPW A;  2EUI A;  4JJX A;  1M4D A;  1YR0 A;  2BL1 A;  5H84 A;  2J8M A;  3FBU A;  2B58 A;  5J8F A;  4B5P A;  4E0A A;  3IWG A;  3S6G A;  3V8I A;  1KZF A;  2P6F A;  2PQ8 A;  2BUE A;  4H6Z A;  1WWZ A;  1M4G A;  3VWD A;  4KOX A;  4R3K A;  3TFY A;  1IYL A;  2VBQ A;  1UFH A;  4GS4 A;  1XMT A;  4UBR A;  2VXK A;  3SXO A;  5KTD A;  3DDD A;  2G3T A;  1VHS A;  1QSM A;  3G3S A;  4LX9 A;  1QSN A;  1MJB A;  5IX3 A;  3S6K A;  2FT0 A;  4JD6 A;  5J8C A;  4J3G A;  2Q0Y A;  5DWM A;  2PRB A;  1K4J A;  3R1K A;  2PR1 A;  1CM0 A;  1J4J A;  2EVN A;  2G3A A;  1Z4E A;  4KUB A;  4MI4 A;  3WR7 A;  1B87 A;  2FSR A;  2I79 A;  2CNM A;  5HH1 A;  4L89 A;  1XIX A;  1KUY A;  1Y7R A;  4CAW A;  2B3U A;  1YRE A;  3W6X A;  2FE7 A;  3R95 A;  5H86 A;  2O28 A;  3CXS A;  2JEV A;  3BJ7 A;  1QSO A;  1P0H A;  2Z10 A;  4KOS A;  4M85 A;  4AVB A;  4XPD C;  1MJ9 A;  3LD2 A;  1S3Z A;  3W91 A;  2B5G B;  1Q2D A;  3VWE A;  1CJW A;  3P2H A;  1Z9U A;  2GE3 A;  4IF5 A;  4ORF A;  5EC4 A;  2WPX A;  2Q4V A;  3EY5 A;  1I12 A;  1P4N A;  5C88 A;  4UWI A;  4KOR A;  2VZY A;  3TCV A;  4NCZ A;  1YVO A;  4OAD A;  2PR8 A;  2REE A;  2AJ6 A;  4PK2 A;  4KVM E;  2OZG A;  3JVN A;  1NE9 A;  2HQY A;  2ZW7 A;  2CY2 A;  4HNX B;  2FS5 A;  1KUX A;  4RS2 A;  4XPK A;  4R87 A;  4YRH A;  4MBU A;  4XNH B;  4F0Y A;  4FD6 A;  5F47 A;  1ON0 A;  3K9U A;  4KOT A;  4KVX A;  1LRZ A;  4EVY A;  2ZW4 A;  1YVK A;  1Z4R A;  3FRM A;  3DR6 A;  2OB0 A;  2B3V A;  2D4O A;  2Z0Z A;  2PC1 A;  3B8G A;  1L0C A;  3R9E A;  2Q4Y A;  4KLV A;  1M44 A;  3KKW A;  3S6F A;  3TO9 A;  3FIX A;  4B5O A;  4OAE A;  2B4D A;  2OU2 A;  5JPH A;  4FD7 A;  3DR8 A;  2QML A;  4PV6 A;  3EFA A;  4QB9 A;  3PP9 A;  5GCN A;  2C27 A;  2KCW A;  4B5P B;  4U5Y A;  2B4D B;  3D2P A;  4NSQ A;  2ZW5 A;  3EXN A;  4H6U A;  4MHD A;  5E96 A;  2BEI A;  4NEX A;  2VZZ A;  5KTA A;  4JWP A;  4XPL A;  4CAV A;  3FNC A;  5EBV A;  2X7B A;  4HKF A;  4KOU A;  4QUS A;  1YGH A;  1XE4 A;  4CRZ B;  3OWC A;  1IIC A;  4KVO E;  3S6H A;  5ISV A;  2JDC A;  2JDD A;  4KLW A;  2P6G A;  1S5K A;  1MJA A;  3PZJ A;  4XPD B;  4E2A A;  1S60 A;  5CNP A;  3ZZI A;  4PK3 A;  4X5K A;  3TTH A;  1RXT A;  1XEB A;  3CXP A;  2FL4 A;  1U6M A;  1YK3 A;  2HV2 A;  2JLM A;  3NE7 A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 3CZX A;  2ANP A;  3GLJ A;  4QC6 A;  5A27 A;  1PU9 A;  1TXR A;  4ZI6 A;  2FXF A;  7CPA A;  3TT2 A;  1ZO0 A;  3PB6 X;  2ATR A;  3SXN A;  4DYO A;  3B3T A;  2A4N A;  2R98 A;  3W6S A;  2EK8 A;  5KTC A;  2P6E A;  3BLN A;  4AG7 A;  4MCP A;  3UY5 A;  2I3C A;  2NSM A;  1WK4 A;  4R57 A;  2PJ5 A;  1TKJ A;  2PJ8 A;  2PRQ A;  2HUZ A;  1RTQ A;  2AFU A;  1M4I A;  2B4B A;  3GUX A;  2PE3 A;  3SJX A;  4AVC A;  1FT7 A;  3FH4 A;  1XJO A;  1Z8W A;  1LAP A;  4G1P A;  1XF8 A;  2Y0M A;  2BSW A;  1S7K A;  2ZOG A;  3D7D A;  1ZG9 A;  2AFX A;  1M4L A;  4RN7 A;  4B11 A;  3N5F A;  5HMN A;  2R8V A;  3H8F A;  3D67 A;  1XRY A;  2PJ9 A;  3NE8 A;  2AFW A;  4MFK A;  4UFW A;  2PDO A;  3F5B A;  4C7H A;  3B3S A;  3EC4 A;  2PJA A;  3D3S A;  5JQ4 A;  2WYR A;  3I3G A;  5F48 A;  3RAM A;  4EWT A;  1OBR A;  2CNS A;  3CDX A;  2QYV A;  3KQX A;  3I9S A;  2GU2 A;  4H89 A;  4RUH A;  4ZY1 A;  4AG9 A;  5CPA A;  4UEZ A;  2G0B A;  4FD4 A;  5K8N A;  3TOA A;  4OME A;  1VKC A;  3IEH A;  3G8W A;  3EO4 A;  4CGP A;  3D66 A;  4UA3 A;  3SJE A;  4L8A A;  3TO7 A;  4CAX A;  3GIU A;  2CNT A;  3KZW A;  4YU9 A;  1Y9W A;  1Y9K A;  3FEE A;  2ZEM A;  4U9Z A;  1Q2Y A;  3QAH A;  4UEE A;  4LQG A;  2Q44 A;  1TF8 A;  2PJ6 A;  4DUK A;  3F8K A;  3GYA A;  1X12 A;  1KWM A;  4KUA A;  4PXC A;  1BAV A;  3D68 A;  3I1U A;  1IGB A;  1XFO A;  1MK4 A;  2H5M A;  4YWY A;  5IV0 A;  3WC7 A;  4ZGY B;  3TE4 A;  2Q7S A;  4P45 A;  2EK9 A;  3IU1 A;  5FVJ A;  3E0K A;  1IID A;  4YGO A;  2Z3L A;  4EME A;  1YLE A;  2DXQ A;  1Z8T A;  2PVW A;  3GKR A;  3IGR A;  1ZG7 A;  3SJG A;  2VQY A;  4PSX A;  4ZX9 A;  5K8P A;  1YX0 A;  3H8E A;  4NGS A;  4BMH A;  1JQG A;  2YNC A;  5BWA B;  2OZH A;  4UEF A;  2Z3K A;  2PSW A;  2RFH A;  2P0W A;  1BPN A;  4P4E A;  1VGY A;  1CX8 A;  3D8P A;  4MRI A;  2C6C A;  5EMI A;  1F57 A;  3IC1 A;  1IB1 E;  2PVV A;  1VIX A;  1I21 A;  4Q36 A;  4Y49 C;  4B6Z A;  2PJ1 A;  4K30 A;  4I49 A;  2XEJ A;  3NH4 A;  4OLL A;  3FB3 A;  2PJ0 A;  4MY3 A;  2G9D A;  3CT9 A;  4ZX8 A;  2OR4 A;  4CYN A;  1KUV A;  2D4P A;  2WUU A;  2EBJ A;  1BOB A;  4P4J A;  4A31 A;  2Z3P A;  2FIW A;  2FCK A;  2ZEP A;  4CAF A;  1Y0Y A;  3CXQ A;  1YW6 A;  5LRK A;  3F0A A;  2R7H A;  1ARM A;  1M1D A;  4HNY B;  1NMT A;  1QSR A;  3R9F A;  2IL4 A;  1YLO A;  2YNC C;  4P6Y A;  2XEG A;  2OOT A;  2AFZ A;  5I0C A;  3MGD A;  2EWB A;  4R9M A;  3TO6 A;  3PB9 X;  1V0C A;  4JLY A;  4FWU A;  4NF1 A;  3MN8 A;  1I1D A;  3QNV A;  4FBE A;  5IB0 A;  1S7F A;  3TOB A;  4MHZ A;  4U9Y A;  4II9 A;  3JUW A;  4NGQ A;  2ZEL A;  3DSB A;  3TX8 A;  2O4H A;  4AB7 A;  2REF A;  4NJR A;  4CS0 B;  3BJ8 A;  2FIA A;  1PUA A;  3KGQ A;  4CRY B;  4MY0 A;  3GB0 A;  2QEC A;  2POK A;  1LCP A;  4KOV A;  2V8V A;  2PIZ A;  2GIV A;  2ZEE A;  3LOD A;  3H4Q A;  4DNC A;  3K9T A;  2VEZ A;  1ZLI A;  4F6A A;  4IK2 A;  3ZJ0 A;  4P10 A;  1PCA A;  1R57 A;  2OH1 A;  5THW A;  4KSI A;  4MCR A;  3JTK A;  4KS9 A;  3L2N A;  4QVT A;  2RC4 A;  3NH8 A;  2J8R A;  2ZEO A;  4UIA A;  2C6G A;  3FYN A;  1BO4 A;  4FD5 A;  4IUS A;  4CYP A;  1Q2C A;  3N7Z A;  4O23 A;  2ZED A;  4ONU A;  4QBJ A;  5C82 A;  2JBJ A;  4OC4 A;  4P4F A;  2O53 A;  3SHP A;  2J9A A;  4JXQ A;  4A32 A;  4F9V A;  2B5G A;  5DWN A;  1CP7 A;  4MFP A;  5LYI A;  2PJ7 A;  4AVA A;  2Z3O A;  4HPS A;  4EFD A;  1B6B A;  3BXM A;  4M3S A;  4JYW A;  3IWE A;  2NMT A;  1SQH A;  4M6H A;  2K5T A;  4JXR A;  5AG4 A;  3T8W A;  3FJU A;  1VHE A;  4KOW A;  3VAT A;  1GHE A;  2PJC A;  4JZ0 A;  2Z11 A;  5I4M A;  4NGM A;  2QIR A;  4RI1 A;  2PJ3 A;  3FX6 A;  4P44 A;  1ZG8 A;  2DPS A;  4UWJ A;  5HVF A;  2Q7B A;  5G22 A;  3B3C A;  5HVG A;  3IO1 A;  4MJ8 A;  2R1I A;  4A2Z A;  1LOK A;  3D2M A;  2ZEF A;  3FMC A;  2AFS A;  2Q4Z A;  4HNW B;  2ZXV A;  1NSL A;  4R76 A;  4PSW A;  2ZW6 A;  3PFO A;  3RZA A;  3PGP A;  3GY9 A;  3IIB A;  3T90 A;  1FNO A;  4KOY A;  2F5I A;  2JBK A;  4A38 A;  3FVL A;  2FVG A;  3P2F A;  2CXA A;  2AE6 A;  4R3L A;  3R96 A;  4MCQ A;  4UIB A;  4OIW A;  5G20 A;  4E8O A;  1UWY A;  4YFJ A;  5JGF A;  4X8I A;  4CPA A;  4ZYQ A;  1FY7 A;  5F49 A;  1F2P A;  2J8N A;  1OZP A;  1TKF A;  4ZBG A;  1N71 A;  3RBU A;  3R9G A;  3NH5 A;  3IWW A;  3T9Y A;  4C2Y A;  2AFM A;  4A94 A;  5F46 A;  3BI0 A;  2CIJ A;  4FUU A;  2ARH A;  3KR4 A;  2QJ8 A;  4NGR A;  4OC1 A;  2Q04 A;  1XMB A;  3QB8 A;  4BBH A;  4KZT A;  4MFZ A;  2I00 A;  1QST A;  1Z8L A;  2OZU A;  4PXD A;  1IYK A;  1TIQ A;  2VI7 A;  1NSA A;  2ZPA A;  3B7I A;  4MMO A;  4OC2 A;  4P4D A;  2NYQ A;  4Q38 A;  1QMU A;  3C26 A;  4WWV A;  3DNS A;  3PFE A;  2V77 A;  4LUA A;  4NXY A;  1YW4 A;  4UCM A;  1AUG A;  3FXT A;  2JEW A;  1S7L A;  2ZEN A;  4Y49 B;  5HXD A;  1S7N A;  4XNH C;  3RYO A;  1CP6 A;  2GAN A;  4CGM A;  2DPT A;  2WPW A;  2V8H A;  3VH9 A;  2EUI A;  4JJX A;  1M4D A;  1YR0 A;  2BL1 A;  1HEE A;  3B2Y A;  5H84 A;  2J8M A;  4NJQ A;  3FBU A;  4C2Z A;  5AGE A;  1VHO A;  1XOV A;  4H2K A;  4OC3 A;  2B58 A;  4A95 A;  5J8F A;  4B5P A;  1X10 A;  4E0A A;  3PBB A;  3HLP A;  3IWG A;  4Z65 A;  4WJB A;  3S6G A;  4ZY0 A;  2ZEH A;  4Q7A A;  3V8I A;  1KZF A;  1Q7L A;  2P6F A;  2PQ8 A;  2YND A;  3BI1 A;  2BUE A;  4H6Z A;  2GLJ A;  1WWZ A;  1M4G A;  5HVH A;  3S9N A;  4PPZ A;  4W9Y A;  1IY7 A;  4KOX A;  3VWD A;  4R3K A;  4B14 A;  3TFY A;  1IYL A;  2VBQ A;  4CGL A;  1UFH A;  1ELM P;  4GS4 A;  1XMT A;  4UBR A;  5AG5 A;  2VXK A;  3SXO A;  1HDQ A;  1A2Z A;  5KTD A;  1ELL P;  3BHX A;  3DDD A;  2G3T A;  1VHS A;  3SI0 A;  1QSM A;  3VAR A;  3G3S A;  4LX9 A;  1QSN A;  1MJB A;  4X2T A;  5IX3 A;  3S6K A;  4GXH A;  2FT0 A;  4JD6 A;  5J8C A;  4J3G A;  4OP4 A;  1EE3 P;  4CAE A;  2Q0Y A;  5DWM A;  2PRB A;  1AYE A;  2V8D A;  3PB4 X;  4KSF A;  1K4J A;  3R1K A;  1CPS A;  2PR1 A;  5K8O A;  3QAY A;  1CM0 A;  1J4J A;  1AMP A;  4OKO A;  1BLL E;  2EVN A;  2WSA A;  4OID A;  5AG6 A;  1YQE A;  1QQ9 A;  4LQ6 A;  2BCO A;  2G3A A;  1Z4E A;  4KUB A;  4MI4 A;  3WR7 A;  4NGN A;  4DJL A;  1ARL A;  1B87 A;  3PB8 X;  2FSR A;  2I79 A;  1IOI A;  2CNM A;  2C6P A;  5HH1 A;  2GRE A;  3NFZ A;  4L89 A;  1Y0R A;  1XIX A;  2BOA A;  4UCP A;  1KUY A;  1Y7R A;  4CAW A;  4ONW A;  5J1Q A;  2B3U A;  2DF5 A;  1Z5R A;  3JRU A;  1YRE A;  5LYL A;  3W6X A;  2IJZ A;  2FE7 A;  3R95 A;  5H86 A;  3SJF A;  2O28 A;  1TKH A;  2JEV A;  3BJ7 A;  3CXS A;  4P4I A;  5G1Z A;  4CGN A;  1QSO A;  2RB7 A;  2ZOF A;  1P0H A;  2PIY A;  2Z10 A;  3FED A;  3HUV A;  4KOS A;  2CTB A;  4M85 A;  4NGP A;  4XPD C;  3WAB A;  4AVB A;  1MJ9 A;  1R43 A;  3LD2 A;  1S3Z A;  2CTC A;  3W91 A;  2B5G B;  1Q2D A;  4MFQ A;  3VWE A;  1CJW A;  4NGT A;  3P2H A;  1Z9U A;  2GFQ A;  2GE3 A;  3D4U A;  5JH9 A;  4IF5 A;  4ORF A;  4PXB A;  5D8N A;  2GLF A;  2Q4V A;  2WPX A;  1I12 A;  3EY5 A;  5EC4 A;  4B12 A;  1P4N A;  5C88 A;  5DS0 A;  4UWI A;  3IFE A;  4M6G A;  4MCS A;  1CBX A;  3WT4 A;  4KOR A;  2VZY A;  1Z2L A;  1DE4 C;  2BO9 A;  3TCV A;  4NCZ A;  2PCU A;  1YVO A;  3DGV A;  2VL1 A;  2PR8 A;  4OAD A;  4UFV A;  4C68 A;  4CGO A;  2REE A;  3KL9 A;  2AJ6 A;  4PK2 A;  3D7G A;  1GYT A;  4KVM E;  2OZG A;  3IU2 A;  3KR5 A;  4MFJ A;  2IQ6 A;  3JVN A;  1NE9 A;  3MRU A;  3CPA A;  2HQY A;  4A39 A;  4A33 A;  2ZW7 A;  2CY2 A;  4HNX B;  4MXU A;  3KQZ A;  1R3N A;  1KUX A;  2FS5 A;  1JWQ A;  1ZLH A;  8CPA A;  4RS2 A;  4XPK A;  4R87 A;  4YRH A;  4OC0 A;  2HC9 A;  3WC5 A;  4MBU A;  2PJ4 A;  3PBE A;  4XNH B;  4F0Y A;  3D7F A;  4MFL A;  4FD6 A;  2DEA A;  1CG2 A;  5ELY A;  5F47 A;  1ON0 A;  5LRG A;  3K9U A;  4KOT A;  1IOF A;  4X3R A;  4KVX A;  5F09 A;  1LRZ A;  4EVY A;  6CPA A;  3SI1 A;  2ZW4 A;  3TC8 A;  1YME A;  1YVK A;  1Z4R A;  3FEC A;  3FRM A;  2F7V A;  2Q43 A;  2OB0 A;  2B3V A;  3DR6 A;  2D4O A;  2Z0Z A;  3D7H A;  1H8L A;  2PC1 A;  3B8G A;  3RO0 A;  1L0C A;  3R9E A;  2Q4Y A;  4K3N A;  2WZN A;  4KLV A;  4OC5 A;  1M44 A;  4F8Z A;  3KKW A;  3KHX A;  3S6F A;  3TO9 A;  3LAC A;  3KI9 A;  1BPM A;  3FIX A;  4IHM A;  4B5O A;  4OAE A;  4BIN A;  1TF9 A;  2B4D A;  2OU2 A;  4ZY2 A;  3B3W A;  5JPH A;  3PB7 X;  4FD7 A;  3DR8 A;  4PQA A;  4M6I A;  3A9L A;  1HDU A;  1LFW A;  2C1C A;  3ISX A;  4C7I A;  4CYQ A;  1F2O A;  2QML A;  1CPX A;  3LMS A;  4IAV A;  2Z3N A;  4PV6 A;  4UCN A;  3EFA A;  4QB9 A;  3S9M A;  4MHN A;  1YSJ A;  2YNE A;  3PP9 A;  3SI2 A;  5JM6 A;  5K8M A;  5GCN A;  2C27 A;  2KCW A;  4A37 A;  4B5P B;  2IMO A;  2ZEG A;  4U5Y A;  3V7Z A;  3ISZ A;  2AFO A;  2B4D B;  2QVP A;  4MHY A;  5AG7 A;  1Z8X A;  3PRT A;  4R7M A;  3D2P A;  3V38 A;  3B35 A;  4R8F A;  4NSQ A;  2ZW5 A;  3FF3 A;  3EXN A;  3B3V A;  3K2K A;  4H6U A;  2ODF A;  4MHD A;  5E96 A;  4BD9 A;  2BEI A;  3LWU A;  2VZZ A;  1IU8 A;  4MHP A;  4NEX A;  3H8G A;  3KAS A;  4JWP A;  5D29 A;  4XPL A;  5KTA A;  5LYF A;  4CAV A;  4UFX A;  3FNC A;  2PJB A;  3DLJ A;  4TWE A;  4CYO A;  2F8H A;  1PYT B;  2YGW A;  5EBV A;  2X7B A;  4C2X A;  4HKF A;  5IB9 A;  4NFR A;  4PXE A;  5CBM A;  2CF4 A;  4KOU A;  4QUS A;  3KHZ A;  1YGH A;  1XE4 A;  4CRZ B;  1DTD A;  5LYD A;  2PJ2 A;  1Y7E A;  2V8G A;  3OWC A;  2Q51 A;  5A28 A;  1IIC A;  4P4B A;  4KVO E;  4KSA A;  2ABZ A;  5LRJ A;  3S9L A;  3S6H A;  4F9U A;  5ISV A;  2JDC A;  2EO8 A;  4F0X A;  2JDD A;  4KLW A;  3H5Z A;  2XEI A;  4TNU A;  1XBU A;  1LAN A;  3NA6 A;  4AXV A;  2P6G A;  1S5K A;  1MJA A;  3PZJ A;  4XPD B;  4E2A A;  2HB6 A;  1S60 A;  5CNP A;  4B13 A;  3ZZI A;  4GM5 A;  4PK3 A;  4X5K A;  3TTH A;  3RNZ A;  1LAM A;  4A30 A;  2Z3M A;  1RXT A;  4UF4 A;  1XEB A;  3IJ3 A;  3CPX A;  4B10 A;  3WC6 A;  4R6T A;  4FAI A;  3CXP A;  2FL4 A;  1U6M A;  1YK3 A;  5G21 A;  2HV2 A;  2JLM A;  2XEF A;  3NE7 A;  3PEI A;  1RO5 A; 
#chains in the Genus database with same CATH homology
 4QC6 A;  5A27 A;  1PU9 A;  2FXF A;  3TT2 A;  1ZO0 A;  2ATR A;  3SXN A;  3W6S A;  2A4N A;  2R98 A;  5KTC A;  2P6E A;  3BLN A;  4AG7 A;  3UY5 A;  1WK4 A;  4R57 A;  2HUZ A;  4AVC A;  1M4I A;  2B4B A;  1XF8 A;  2Y0M A;  2BSW A;  1S7K A;  5HMN A;  4B11 A;  2R8V A;  4C7H A;  4MFK A;  4UFW A;  2PDO A;  3F5B A;  3EC4 A;  3D3S A;  5JQ4 A;  3I3G A;  5F48 A;  2CNS A;  4H89 A;  3I9S A;  4AG9 A;  2G0B A;  4FD4 A;  3TOA A;  1VKC A;  3G8W A;  3EO4 A;  4CGP A;  4UA3 A;  4L8A A;  3TO7 A;  4CAX A;  2CNT A;  1Y9W A;  1Y9K A;  4U9Z A;  1Q2Y A;  3QAH A;  2Q44 A;  3F8K A;  3GYA A;  4KUA A;  2H5M A;  1MK4 A;  5IV0 A;  4ZGY B;  3IU1 A;  5FVJ A;  3E0K A;  1IID A;  4YGO A;  2Z3L A;  1YLE A;  2DXQ A;  3GKR A;  3IGR A;  2VQY A;  4PSX A;  1YX0 A;  4BMH A;  2YNC A;  5BWA B;  2OZH A;  2Z3K A;  2PSW A;  2P0W A;  3D8P A;  1IB1 E;  4Q36 A;  1I21 A;  4Y49 C;  4K30 A;  4I49 A;  4OLL A;  3FB3 A;  4MY3 A;  4CYN A;  1KUV A;  2D4P A;  2WUU A;  1BOB A;  4A31 A;  2Z3P A;  2FIW A;  2FCK A;  4CAF A;  3CXQ A;  3F0A A;  2R7H A;  1M1D A;  4HNY B;  1NMT A;  1QSR A;  3R9F A;  2IL4 A;  2YNC C;  5I0C A;  3MGD A;  4R9M A;  3TO6 A;  1V0C A;  4JLY A;  4NF1 A;  1I1D A;  5IB0 A;  1S7F A;  3TOB A;  4U9Y A;  4II9 A;  3JUW A;  3DSB A;  4AB7 A;  4CS0 B;  2REF A;  3BJ8 A;  2FIA A;  1PUA A;  4CRY B;  4MY0 A;  2QEC A;  4KOV A;  2GIV A;  3LOD A;  4DNC A;  3H4Q A;  2VEZ A;  4F6A A;  3ZJ0 A;  1R57 A;  2OH1 A;  3JTK A;  4KS9 A;  4QVT A;  2RC4 A;  2J8R A;  3FYN A;  1BO4 A;  4FD5 A;  4IUS A;  4CYP A;  1Q2C A;  3N7Z A;  4ONU A;  4QBJ A;  5C82 A;  3SHP A;  4A32 A;  4JXQ A;  2B5G A;  5DWN A;  4AVA A;  4MFP A;  2Z3O A;  1B6B A;  4M3S A;  3IWE A;  2NMT A;  1SQH A;  2K5T A;  4JXR A;  5AG4 A;  4KOW A;  1GHE A;  2Z11 A;  2QIR A;  4RI1 A;  2DPS A;  4UWJ A;  2Q7B A;  5G22 A;  4MJ8 A;  4A2Z A;  2R1I A;  3D2M A;  4HNW B;  1NSL A;  2ZXV A;  4PSW A;  2ZW6 A;  3PGP A;  3GY9 A;  3T90 A;  4KOY A;  2F5I A;  3P2F A;  2CXA A;  2AE6 A;  4R3L A;  3R96 A;  5G20 A;  4E8O A;  4YFJ A;  1FY7 A;  5F49 A;  2J8N A;  1OZP A;  4ZBG A;  1N71 A;  3R9G A;  3T9Y A;  4C2Y A;  5F46 A;  2ARH A;  2Q04 A;  3QB8 A;  4BBH A;  4KZT A;  4MFZ A;  2I00 A;  1QST A;  2OZU A;  1IYK A;  1TIQ A;  2VI7 A;  4Q38 A;  2ZPA A;  3TE4 A;  3C26 A;  3DNS A;  4LUA A;  4NXY A;  4UCM A;  3FXT A;  1S7L A;  4Y49 B;  1S7N A;  4XNH C;  3RYO A;  2GAN A;  4CGM A;  2DPT A;  2WPW A;  2EUI A;  4JJX A;  1M4D A;  1YR0 A;  2BL1 A;  5H84 A;  2J8M A;  4C2Z A;  3FBU A;  5AGE A;  2B58 A;  4A95 A;  5J8F A;  4B5P A;  4E0A A;  3IWG A;  3S6G A;  3V8I A;  1KZF A;  2YND A;  2P6F A;  2PQ8 A;  2BUE A;  4H6Z A;  1WWZ A;  1M4G A;  3VWD A;  4KOX A;  4R3K A;  4B14 A;  3TFY A;  1IYL A;  2VBQ A;  4CGL A;  1UFH A;  4GS4 A;  1XMT A;  4UBR A;  5AG5 A;  2VXK A;  3SXO A;  5KTD A;  3DDD A;  2G3T A;  1VHS A;  1QSM A;  3G3S A;  4LX9 A;  1QSN A;  1MJB A;  5IX3 A;  3S6K A;  2FT0 A;  4JD6 A;  5J8C A;  4J3G A;  4CAE A;  2Q0Y A;  5DWM A;  2PRB A;  4KSF A;  1K4J A;  3R1K A;  2PR1 A;  1CM0 A;  1J4J A;  2EVN A;  2WSA A;  5AG6 A;  2G3A A;  1Z4E A;  4KUB A;  4MI4 A;  3WR7 A;  1B87 A;  2FSR A;  2I79 A;  2CNM A;  5HH1 A;  4L89 A;  1XIX A;  4UCP A;  1KUY A;  1Y7R A;  4CAW A;  2B3U A;  1YRE A;  3W6X A;  2FE7 A;  3R95 A;  5H86 A;  2O28 A;  3CXS A;  2JEV A;  3BJ7 A;  5G1Z A;  4CGN A;  1QSO A;  1P0H A;  2Z10 A;  4KOS A;  4M85 A;  4AVB A;  4XPD C;  1MJ9 A;  3LD2 A;  1S3Z A;  3W91 A;  2B5G B;  1Q2D A;  4MFQ A;  3VWE A;  1CJW A;  3P2H A;  1Z9U A;  2GE3 A;  4IF5 A;  4ORF A;  5EC4 A;  2WPX A;  2Q4V A;  3EY5 A;  1I12 A;  4B12 A;  1P4N A;  5C88 A;  4UWI A;  4KOR A;  2VZY A;  3TCV A;  4NCZ A;  1YVO A;  4OAD A;  2PR8 A;  4UFV A;  4C68 A;  4CGO A;  2REE A;  2AJ6 A;  4PK2 A;  4KVM E;  2OZG A;  3IU2 A;  4MFJ A;  3JVN A;  1NE9 A;  2HQY A;  4A33 A;  2ZW7 A;  2CY2 A;  4HNX B;  2FS5 A;  1KUX A;  4RS2 A;  4XPK A;  4R87 A;  4YRH A;  4MBU A;  4XNH B;  4F0Y A;  4MFL A;  4FD6 A;  5F47 A;  1ON0 A;  3K9U A;  4KOT A;  4KVX A;  1LRZ A;  4EVY A;  2ZW4 A;  1YVK A;  1Z4R A;  3FRM A;  3DR6 A;  2OB0 A;  2B3V A;  2D4O A;  2Z0Z A;  2PC1 A;  3B8G A;  1L0C A;  3R9E A;  2Q4Y A;  4KLV A;  1M44 A;  3KKW A;  3S6F A;  3TO9 A;  3FIX A;  4B5O A;  4OAE A;  2B4D A;  2OU2 A;  5JPH A;  4FD7 A;  3DR8 A;  3A9L A;  4C7I A;  4CYQ A;  2QML A;  4PV6 A;  4UCN A;  2Z3N A;  3EFA A;  4QB9 A;  2YNE A;  3PP9 A;  5GCN A;  2C27 A;  2KCW A;  4B5P B;  4U5Y A;  2B4D B;  5AG7 A;  3D2P A;  4NSQ A;  2ZW5 A;  3EXN A;  4H6U A;  4MHD A;  5E96 A;  2BEI A;  4NEX A;  2VZZ A;  5KTA A;  4JWP A;  4XPL A;  4CAV A;  4UFX A;  3FNC A;  4CYO A;  2YGW A;  5EBV A;  2X7B A;  4C2X A;  4HKF A;  4KOU A;  4QUS A;  1YGH A;  1XE4 A;  4CRZ B;  3OWC A;  5A28 A;  1IIC A;  4KVO E;  4KSA A;  3S6H A;  5ISV A;  2JDC A;  4F0X A;  2JDD A;  4KLW A;  3H5Z A;  2P6G A;  1S5K A;  1MJA A;  3PZJ A;  4XPD B;  4E2A A;  1S60 A;  5CNP A;  4B13 A;  3ZZI A;  4PK3 A;  4X5K A;  3TTH A;  4A30 A;  2Z3M A;  1RXT A;  1XEB A;  4B10 A;  3CXP A;  2FL4 A;  1U6M A;  1YK3 A;  5G21 A;  2HV2 A;  2JLM A;  3NE7 A;  1RO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...