2Z0ZA

Crystal structure of putative acetyltransferase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
194
structure length
194
Chain Sequence
MWAFPERFEGRHVRLEPLALAHLPAFLRHYDPEVYRFLSRAPVAPTEEALRAHLEGLLGEPGRVNWAILFGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLPDGAFRDDVVYSVLKEEWPGVKARLEARLYGASGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA1799
publication title Genetic Encoding of 3-Iodo-l-Tyrosine in Escherichia coli for Single-Wavelength Anomalous Dispersion Phasing in Protein Crystallography
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 66
structure length 194
sequence length 194
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2z0zA00
3DR8A 4XNHC 4B5PA 1PU9A 3BLNA 2BEIA 1M1DA 1S7FA 2B4BA 3FB3A 1XE4A 5J8FA 1YX0A 3CXSA 1YVKA 1P0HA 1S3ZA 2B4DB 2OB0A 1MJAA 2NMTA 3R96A 3E0KA 4QBJA 2D4PA 2P0WA 2DXQA 1NE9A 1S7LA 4OLLA 4M85A 3F8KA 4OADA 3FNCA 3UY5A 4BMHA 4IUSA 1FY7A 2OU2A 1UFHA 3H4QA 4AG7A 3BJ7A 2JDDA 3R95A 3T90A 4NF1A 2QECA 4NEXA 3NE7A 2G3TA 4MY3A 2IL4A 1NSLA 4MY0A 4QC6A 1IIDA 3KKWA 1Y7RA 3TO6A 3G8WA 2PC1A 4FD6A 3R1KA 3TO9A 3G3SA 1Y9KA 4UA3A 3WR7A 3VWDA 2VEZA 5JQ4A 2JDCA 2G3AA 4II9A 4Y49B 2BL1A 2CY2A 1B87A 3TOBA 2Q0YA 3JUWA 2Q04A 1IICA 1Q2CA 3FYNA 2B3UA 2B5GB 3BJ8A 1KUXA 4L89A 3D3SA 5E96A 2CNTA 5DWMA 1CM0A 5EBVA 2ZW4A 4UWIA 2CNMA 4B5OA 4KOUA 2ZW5A 2QMLA 4QUSA 1YGHA 3F0AA 4R3KA 1MJ9A 1Z9UA 1KZFA 1M4IA 4E8OA 3S6HA 4AVAA 5F46A 3RYOA 1VKCA 1YVOA 4IF5A 4PV6A 4FD7A 3TOAA 2FIWA 4XPDC 4HNWB 4H6ZA 4UWJA 5H84A 5ISVA 5DWNA 3D2MA 1QSTA 3D8PA 4J3GA 2VXKA 3FXTA 4JXQA 4I49A 1J4JA 4R57A 1YR0A 2PDOA 4OAEA 2R1IA 3TCVA 3EFAA 2ATRA 3LD2A 1Z4RA 1ON0A 4NCZA 2J8RA 2JEVA 2FT0A 3V8IA 2OZGA 4LX9A 3SHPA 3S6GA 2I00A 3GKRA 3P2HA 3T9YA 2KCWA 1BO4A 4CAXA 3DSBA 3OWCA 4CAWA 4UBRA 2PQ8A 4HNYB 5JPHA 3MGDA 4YFJA 3DDDA 3FBUA 4AVBA 1RO5A 3SXOA 2BUEA 5C88A 3D2PA 3EY5A 3I3GA 3LODA 1XEBA 4L8AA 3VWEA 2R98A 2P6GA 4KORA 2AE6A 5EC4A 4KUAA 3QAHA 5F48A 1OZPA 5IB0A 3IWGA 4DNCA 3K9UA 1R57A 3TO7A 4HKFA 1QSMA 5FVJA 2B4DA 1M4DA 3I9SA 4EVYA 3EXNA 4KOTA 4ZBGA 1CJWA 4ORFA 2X7BA 2OH1A 1TIQA 4U9ZA 3DNSA 4PK2A 5HH1A 3TT2A 1M4GA 4AB7A 2Z0ZA 2Z10A 5GCNA 3FIXA 3TFYA 3W91A 4F6AA 4E2AA 4KUBA 4MHDA 2PRBA 2RC4A 2ZXVA 2ZPAA 4Y49C 4ONUA 2GE3A 1NMTA 4NSQA 1S7NA 1PUAA 4K30A 4PSXA 2R7HA 2GIVA 4CRYB 2Q4VA 1Z4EA 4CAVA 5F49A 3W6XA 2Q7BA 5KTAA 4MJ8A 2HQYA 3PP9A 1L0CA 3C26A 4KOYA 2FL4A 3EO4A 1WWZA 4FD4A 4U9YA 3R9FA 1I1DA 2J8MA 1YK3A 2Q4YA 3PGPA 2GANA 4X5KA 2P6FA 4B5PB 2J8NA 2H5MA 2B3VA 2B5GA 4GS4A 2Y0MA 3EC4A 1BOBA 3IGRA 4QB9A 2CNSA 3B8GA 2EUIA 4KOVA 4R3LA 5F47A 3ZJ0A 4MI4A 1QSRA 3N7ZA 4R87A 2HV2A 5J8CA 2PR1A 4XNHB 1GHEA 1N71A 4PK3A 1S7KA 4CS0B 2BSWA 4E0AA 1XIXA 5IV0A 2B58A 4YGOA 2P6EA 4AVCA 2WPWA 1YREA 2JLMA 4KOWA 4KVOE 4KOXA 2ZW7A 2OZUA 2Q44A 1WK4A 3SXNA 1MK4A 2K5TA 2FE7A 2FS5A 2FXFA 1MJBA 2VQYA 1VHSA 2C27A 2REEA 4KZTA 2EVNA 2VZYA 2FIAA 5IX3A 5HMNA 4HNXB 1SQHA 4NXYA 4KLVA 2FCKA 4JD6A 1I21A 4KVXA 2D4OA 3DR6A 3GY9A 4QVTA 2FSRA 1LRZA 1P4NA 4H6UA 3QB8A 2I79A 4JXRA 3P2FA 5KTCA 4XPLA 3R9EA 2HUZA 1V0CA 4JJXA 1U6MA 4XPKA 1IB1E 2PSWA 4PSWA 5H86A 4JLYA 5I0CA 1YLEA 4YRHA 3S6KA 1Q2YA 4JWPA 1I12A 1S5KA 3PZJA 4FD5A 4LUAA 4KLWA 3W6SA 2VI7A 2VZZA 2Z11A 2A4NA 2PR8A 3ZZIA 4MBUA 3F5BA 1IYKA 1Y9WA 5CNPA 1Q2DA 2AJ6A 3GYAA 3TTHA 1XMTA 3TE4A 4F0YA 2VBQA 2ZW6A 4CRZB 3FRMA 2WPXA 2F5IA 4R9MA 5KTDA 3JVNA 2ARHA 1IYLA 1K4JA 1KUYA 1QSOA 4M3SA 1QSNA 4U5YA 2QIRA 2REFA 1S60A 4KVME 1B6BA 1KUVA 3R9GA 2O28A 4AG9A 4XPDB 2R8VA 1M44A 4H89A 5C82A 3CXQA 1XF8A 4RS2A 1RXTA 4KOSA 2G0BA 2OZHA 3S6FA 4RI1A 3CXPA
chains in the Genus database with same CATH superfamily
3DR8A 4XNHC 1CPSA 2Q4ZA 5K8MA 4B5PA 1PU9A 3BLNA 2YGWA 1IU8A 1ELMP 2BEIA 1M1DA 1S7FA 4NJQA 2B4BA 3FB3A 1XE4A 2IQ6A 5J8FA 3NE8A 1YX0A 1AYEA 3CXSA 1YVKA 3IFEA 1P0HA 1S3ZA 4ZY2A 2B4DB 3RBUA 3SJXA 2OB0A 1MJAA 2ZEPA 2NMTA 1ZLIA 3R96A 3E0KA 4UCNA 1CX8A 1Z8XA 3QNVA 2D4PA 4UCMA 2P0WA 5CPAA 4QBJA 2DXQA 1R43A 1NE9A 1S7LA 4OLLA 2OOTA 3BHXA 3BXMA 4FBEA 4M85A 3F8KA 4OADA 3FNCA 3UY5A 4UF4A 3RAMA 4FUUA 4IUSA 4BMHA 3VATA 3PBBA 1FY7A 4TWEA 2OU2A 3GLJA 1LOKA 1UFHA 3H4QA 2FVGA 3KGQA 2Z3MA 2V8HA 2F7VA 1CP6A 4AG7A 3BJ7A 3IU2A 1HEEA 1XRYA 2PJ0A 5K8NA 2JDDA 3R95A 4C2XA 1OBRA 4C68A 2WSAA 3T90A 4NF1A 2BO9A 2QECA 3MRUA 3VARA 4NEXA 4NFRA 3NE7A 2G3TA 4MY3A 2IL4A 3KR5A 1NSLA 2PJ2A 2PJ3A 2Z3PA 4R7MA 4UFWA 2NYQA 2CTBA 3LMSA 2Q7SA 4B13A 4MY0A 3TC8A 5JM6A 3QAYA 3D67A 4OC2A 1IIDA 4QC6A 1LFWA 1LCPA 3KKWA 1Y7RA 2ZEHA 4OC5A 3TO6A 3G8WA 2PC1A 2RFHA 3H8EA 5AGEA 4B14A 1LANA 2ANPA 2F8HA 3CDXA 4FD6A 4UEEA 4CGNA 1AMPA 3R1KA 1YMEA 1TXRA 3TO9A 5AG7A 3G3SA 1Y9KA 1Y0YA 2CF4A 4UA3A 3H8GA 3WR7A 3VWDA 2VEZA 5JQ4A 1CP7A 4OIDA 4X2TA 2JDCA 5AG4A 3V38A 2G3AA 4II9A 4O23A 2BL1A 4MFPA 4Y49B 4FAIA 2CY2A 4OC0A 1B87A 3RNZA 3TOBA 3IEHA 4ZX8A 2Q0YA 3JUWA 2Q04A 1IICA 4EWTA 2QYVA 2HC9A 1Q2CA 4P6YA 4X8IA 4IK2A 1Y7EA 3CPXA 1Z8LA 2B3UA 3FYNA 3SI2A 2B5GB 3BJ8A 5HVFA 1KUXA 4BD9A 4L89A 3D3SA 2V8VA 5E96A 2CNTA 3BI1A 3PRTA 4P4BA 5DWMA 5IB9A 1CM0A 4NGMA 5EBVA 5F09A 1PYTB 3DLJA 1ZG8A 5G1ZA 1ZO0A 2ZW4A 4UWIA 2CNMA 4B5OA 3GUXA 3PEIA 4KOUA 2VL1A 2ZW5A 3SI1A 4NGTA 2QMLA 4ONWA 1F57A 1YGHA 3F0AA 4QUSA 4R3KA 1IGBA 4EMEA 1BPMA 1MJ9A 2DEAA 4GXHA 4MFJA 3KHZA 1Q7LA 1Z9UA 4OC3A 2ZOFA 1KZFA 1M4IA 4C2YA 3S6HA 4AVAA 4A31A 4HPSA 4E8OA 4RUHA 5F46A 3IIBA 3FX6A 4B10A 3RYOA 1VKCA 4ZGYB 1YVOA 2AFWA 3FEDA 4G1PA 1KWMA 4A39A 4IF5A 4KSFA 4PV6A 4ZY0A 4FD7A 4KSIA 3TOAA 2FIWA 4XPDC 1XFOA 4H6ZA 4HNWB 4MRIA 4UWJA 5AG6A 2ZEEA 4MFQA 5H84A 5ISVA 5DWNA 3D2MA 4WWVA 1QSTA 3D8PA 1Z5RA 4J3GA 2VXKA 3FXTA 4MCRA 4JXQA 2V8DA 4I49A 4UEZA 1J4JA 3H8FA 4R57A 1YR0A 3N5FA 4JYWA 1YW4A 1YQEA 2PDOA 1JWQA 2XEGA 4P4DA 5LRKA 4R76A 2PJAA 4OAEA 4ZYQA 3L2NA 2YNDA 1M4LA 2R1IA 3TCVA 4DYOA 1F2OA 2ATRA 3EFAA 4IHMA 3LD2A 1Z4RA 1YSJA 4P45A 1ON0A 4NCZA 2J8RA 3BI0A 2JEVA 1RTQA 2FT0A 3V8IA 2OZGA 4LX9A 5JGFA 3PFEA 6CPAA 3SHPA 3B3CA 2QJ8A 4KS9A 3S6GA 2I00A 2XEJA 3GKRA 3P2HA 3KL9A 4PXBA 2KCWA 2Q51A 3T9YA 1BO4A 4CAXA 3DSBA 4CGMA 1Z8TA 3OWCA 4CAWA 4NGSA 4MFZA 1GYTA 2PJ9A 4UBRA 2PQ8A 4HNYB 3A9LA 2PVWA 2DPSA 5JPHA 3IO1A 3MGDA 3WC5A 2PJ1A 4YFJA 4PPZA 3NH4A 3DDDA 3FBUA 3KI9A 4AVBA 4B12A 1RO5A 3SXOA 4C2ZA 2BUEA 4PQAA 5C88A 3D2PA 4C7HA 1FT7A 2BOAA 3EY5A 3HUVA 1ZG7A 2YNEA 3I3GA 3LODA 4A38A 1XEBA 3FVLA 3KQXA 4L8AA 1Z8WA 3VWEA 1ARMA 2C6PA 2R98A 2ZEGA 2AFZA 2P6GA 2PJ7A 3B2YA 4KORA 2AE6A 5EC4A 4KUAA 3QAHA 4Z65A 5F48A 5G20A 1OZPA 5IB0A 3IWGA 4MCPA 3IU1A 4DNCA 3NA6A 5HXDA 3PFOA 2WYRA 3K9UA 3WC6A 4AXVA 1R57A 2GLFA 3TO7A 4HKFA 1QSMA 4M6HA 5FVJA 2B4DA 1M4DA 3I9SA 3B3TA 4EVYA 3EXNA 4KOTA 3RO0A 4ZBGA 1CJWA 4ORFA 3CZXA 2IJZA 2X7BA 3FH4A 4UIBA 2OH1A 3PB6X 2GU2A 4CYPA 2ZELA 1TIQA 4DUKA 1QMUA 4U9ZA 3IJ3A 3DNSA 4PK2A 5HH1A 4EFDA 3TT2A 1AUGA 1M4GA 1UWYA 2HB6A 1XOVA 3ISZA 4AB7A 1NSAA 3KHXA 1XJOA 2Z3KA 2Z0ZA 3NH8A 3RZAA 2V8GA 2Z10A 5GCNA 3FIXA 4LQ6A 3WC7A 4B6ZA 3TFYA 3W91A 4F6AA 4E2AA 4KUBA 2ZOGA 4MHDA 2PRBA 2RC4A 2OR4A 7CPAA 2ZXVA 1ELLP 2DF5A 2ZPAA 4Y49C 5J1QA 5AG5A 2AFSA 4OP4A 4ONUA 2GE3A 4CGPA 1NMTA 1VIXA 4NSQA 3HLPA 1S7NA 1PUAA 5LRGA 1ARLA 4CAEA 1X10A 2RB7A 4K30A 4PSXA 2R7HA 5A28A 2GIVA 4F8ZA 5D29A 4CRYB 2Q4VA 1Z4EA 1LAMA 2AFXA 5F49A 4CAVA 3W6XA 2Q7BA 4CGLA 3WT4A 5KTAA 2JBJA 4MJ8A 5DS0A 2HQYA 3SJGA 3PP9A 4K3NA 1L0CA 3C26A 2ZEOA 4KOYA 5G22A 2FL4A 3EO4A 1WWZA 2AFMA 2CTCA 4FD4A 4U9YA 2ZEDA 4P4JA 3R9FA 1I1DA 4UCPA 2J8MA 1YK3A 2Q4YA 1ZLHA 4F9UA 1PCAA 3PGPA 2ABZA 4PXEA 4YWYA 2GANA 4X5KA 2PE3A 2ODFA 1TKFA 2P6FA 4P4IA 1CBXA 4B5PB 2J8NA 3CT9A 4WJBA 2H5MA 2B3VA 2B5GA 4MMOA 4CYOA 1EE3P 4GS4A 5BWAB 2ZEMA 2Y0MA 3EC4A 1BOBA 1HDQA 3D4UA 4IAVA 4B11A 1TF8A 3IGRA 4QB9A 2CNSA 3B7IA 2GLJA 3B8GA 4UIAA 4BINA 2EUIA 4RN7A 4KOVA 4R3LA 2XEFA 1IOFA 4P4EA 5F47A 1FNOA 3D68A 3ZJ0A 4MI4A 1QSRA 1R3NA 3N7ZA 1QQ9A 4OC4A 4CAFA 4R87A 4ZI6A 2HV2A 5J8CA 4DJLA 2O53A 2PR1A 4PXDA 4XNHB 5CBMA 1GHEA 1N71A 2C6GA 4LQGA 1S7KA 4PK3A 4C7IA 4CS0B 4ZX9A 4UFXA 5I4MA 5EMIA 3PBEA 2EK8A 4FWUA 4A95A 3K2KA 2V77A 3PB9X 2EO8A 3IC1A 2C6CA 2AFOA 2J9AA 2PCUA 2PJCA 2BSWA 3SJEA 1XIXA 3GIUA 4E0AA 2B58A 5IV0A 3LWUA 4YGOA 2P6EA 2Q43A 4AVCA 1YLOA 2WPWA 1YREA 2JLMA 4KOWA 4KVOE 4KOXA 2PJ8A 2ZW7A 2OZUA 2Q44A 1CPXA 1WK4A 3SXNA 4F0XA 1MK4A 2EBJA 2K5TA 1A2ZA 2FE7A 3B3VA 2FS5A 1TKJA 5THWA 3B3SA 3V7ZA 5JH9A 2FXFA 1IY7A 5K8PA 1DE4C 1ZG9A 3S9NA 1MJBA 2VQYA 1VHSA 4UEFA 2C27A 4CYNA 2PJBA 3D7HA 2Z3NA 2REEA 4KZTA 3MN8A 3DGVA 2EVNA 4OMEA 2EWBA 2ZENA 4GM5A 2VZYA 1XBUA 5LYDA 2FIAA 5IX3A 5HMNA 4HNXB 1SQHA 3FF3A 2POKA 4NXYA 4P44A 4KLVA 4Q7AA 2FCKA 4JD6A 4NGQA 1VGYA 1I21A 2PJ5A 3ISXA 4KVXA 3D7DA 1H8LA 2D4OA 3D7FA 3DR6A 4PXCA 5D8NA 3GY9A 4MHYA 5ELYA 4QVTA 1DTDA 4X3RA 2FSRA 3KR4A 2EK9A 3D66A 4F9VA 8CPAA 1CG2A 5HVGA 1LRZA 1P4NA 1VHOA 3JRUA 2BCOA 2I79A 3QB8A 4H6UA 5LYIA 4JXRA 3P2FA 3S9MA 5KTCA 4XPLA 3R9EA 2CXAA 2HUZA 1BLLE 1V0CA 1BPNA 4A32A 3KZWA 2QVPA 3IWWA 4JJXA 5K8OA 1U6MA 4XPKA 2GREA 1IB1E 2PRQA 2PSWA 4PSWA 4A2ZA 5H86A 3TX8A 1Y0RA 5HVHA 4JLYA 5I0CA 1YLEA 4YRHA 4MHNA 4MHZA 4NJRA 3S6KA 2PJ6A 1IOIA 1Q2YA 4JWPA 3B35A 1I12A 1Z2LA 4NGNA 2G9DA 4YU9A 4NGPA 4A33A 1S5KA 3PZJA 2JBKA 3PB8X 3I1UA 4OC1A 4FD5A 3LACA 4LUAA 3PB7X 4KLWA 4UFVA 3W6SA 2WZNA 4ZY1A 2VI7A 3WABA 2I3CA 2VZZA 3T8WA 2Z11A 1JQGA 4OKOA 5G21A 2O4HA 2A4NA 2PR8A 3SJFA 3ZZIA 1BAVA 4MBUA 3F5BA 2XEIA 1YW6A 2PIYA 1IYKA 1Y9WA 5CNPA 2YNCC 4M6IA 4KSAA 1Q2DA 2AJ6A 2AFUA 3GYAA 3GB0A 4MFKA 2IMOA 3FEEA 1XMTA 3B3WA 3CPAA 3KASA 3NFZA 4MHPA 4P10A 3TTHA 3TE4A 1XMBA 4F0YA 2VBQA 1HDUA 2ZW6A 2JEWA 4BBHA 4CRZB 3D7GA 4TNUA 3FRMA 2WPXA 4CYQA 2F5IA 2PIZA 4R9MA 5KTDA 2WUUA 3JVNA 4MFLA 5LYFA 2CIJA 3SI0A 1X12A 2ARHA 4NGRA 1IYLA 1K4JA 1KUYA 1LAPA 3FMCA 4M6GA 1F2PA 1QSOA 4P4FA 2NSMA 4M3SA 3H5ZA 5A27A 1QSNA 4A94A 4MXUA 4R8FA 4U5YA 2QIRA 2REFA 1S60A 4A37A 2DPTA 2Z3LA 3PB4X 4KVME 1VHEA 1TKHA 1B6BA 4A30A 4CPAA 2YNCA 4JZ0A 4MCSA 1KUVA 2GFQA 3R9GA 2O28A 4AG9A 3JTKA 4MCQA 2R8VA 1M44A 4XPDB 4H89A 5C82A 2C1CA 4CGOA 3S9LA 4Q36A 4R6TA 3NH5A 2ZEFA 3FJUA 4H2KA 2PVVA 4OIWA 2Z3OA 3CXQA 1XF8A 3FECA 4RS2A 1RXTA 5LYLA 4KOSA 1TF9A 4Q38A 2G0BA 2PJ4A 5LRJA 3VH9A 2OZHA 3KQZA 4W9YA 3IWEA 3S6FA 4RI1A 3CXPA 3K9TA
chains in the Genus database with same CATH topology
3DR8A 4XNHC 4B5PA 1PU9A 3BLNA 2YGWA 2BEIA 1M1DA 1S7FA 2B4BA 3FB3A 1XE4A 5J8FA 1YX0A 3CXSA 1YVKA 1P0HA 1S3ZA 2B4DB 2OB0A 1MJAA 2NMTA 3R96A 3E0KA 4UCNA 4QBJA 2D4PA 4UCMA 2P0WA 2DXQA 1NE9A 1S7LA 4OLLA 4M85A 3F8KA 4OADA 3FNCA 3UY5A 4BMHA 4IUSA 1FY7A 2OU2A 1UFHA 3H4QA 2Z3MA 4AG7A 3BJ7A 3IU2A 2JDDA 3R95A 4C2XA 4C68A 2WSAA 3T90A 4NF1A 2QECA 4NEXA 3NE7A 2G3TA 4MY3A 2IL4A 1NSLA 2Z3PA 4UFWA 4B13A 4MY0A 4QC6A 1IIDA 3KKWA 1Y7RA 3TO6A 3G8WA 2PC1A 4B14A 5AGEA 4CGNA 4FD6A 3R1KA 3TO9A 5AG7A 3G3SA 1Y9KA 4UA3A 3WR7A 3VWDA 2VEZA 5JQ4A 2JDCA 5AG4A 2G3AA 4II9A 4Y49B 2BL1A 4MFPA 2CY2A 1B87A 3TOBA 2Q0YA 3JUWA 2Q04A 1IICA 1Q2CA 3FYNA 2B3UA 2B5GB 3BJ8A 1KUXA 4L89A 3D3SA 5E96A 2CNTA 5DWMA 1CM0A 5EBVA 5G1ZA 1ZO0A 2ZW4A 4UWIA 2CNMA 4B5OA 4KOUA 2ZW5A 2QMLA 4QUSA 1YGHA 3F0AA 4R3KA 1MJ9A 4MFJA 1Z9UA 1KZFA 1M4IA 4C2YA 3S6HA 4AVAA 4A31A 4E8OA 5F46A 4B10A 3RYOA 1VKCA 4ZGYB 1YVOA 4IF5A 4KSFA 4PV6A 4FD7A 3TOAA 2FIWA 4XPDC 4HNWB 4H6ZA 4UWJA 5AG6A 5H84A 4MFQA 5ISVA 5DWNA 3D2MA 1QSTA 3D8PA 4J3GA 2VXKA 3FXTA 4JXQA 4I49A 1J4JA 4R57A 1YR0A 2PDOA 4OAEA 2YNDA 2R1IA 3TCVA 3EFAA 2ATRA 3LD2A 1Z4RA 1ON0A 4NCZA 2J8RA 2JEVA 2FT0A 3V8IA 2OZGA 4LX9A 3SHPA 3S6GA 4KS9A 2I00A 3GKRA 3P2HA 3T9YA 2KCWA 1BO4A 4CAXA 3DSBA 4CGMA 3OWCA 4CAWA 4MFZA 4UBRA 2PQ8A 4HNYB 3A9LA 2DPSA 5JPHA 3MGDA 4YFJA 3DDDA 3FBUA 4AVBA 4B12A 1RO5A 3SXOA 4C2ZA 2BUEA 5C88A 3D2PA 4C7HA 3EY5A 2YNEA 3I3GA 3LODA 1XEBA 4L8AA 3VWEA 2R98A 2P6GA 4KORA 2AE6A 5EC4A 4KUAA 3QAHA 5F48A 5G20A 1OZPA 5IB0A 3IWGA 3IU1A 4DNCA 3K9UA 1R57A 3TO7A 4HKFA 1QSMA 5FVJA 2B4DA 1M4DA 3I9SA 4EVYA 3EXNA 4KOTA 4ZBGA 1CJWA 4ORFA 2X7BA 2OH1A 4CYPA 1TIQA 4U9ZA 3DNSA 4PK2A 5HH1A 3TT2A 1M4GA 4AB7A 2Z3KA 2Z0ZA 2Z10A 5GCNA 3FIXA 3TFYA 3W91A 4F6AA 4E2AA 4KUBA 4MHDA 2PRBA 2RC4A 2ZXVA 2ZPAA 4Y49C 5AG5A 4ONUA 2GE3A 4CGPA 1NMTA 4NSQA 1S7NA 1PUAA 4CAEA 4K30A 4PSXA 2R7HA 5A28A 2GIVA 4CRYB 2Q4VA 1Z4EA 4CAVA 5F49A 3W6XA 2Q7BA 4CGLA 5KTAA 4MJ8A 2HQYA 3PP9A 1L0CA 3C26A 4KOYA 5G22A 2FL4A 3EO4A 1WWZA 4FD4A 4U9YA 3R9FA 1I1DA 4UCPA 2J8MA 1YK3A 2Q4YA 3PGPA 2GANA 4X5KA 2P6FA 4B5PB 2J8NA 2H5MA 2B3VA 2B5GA 4CYOA 4GS4A 5BWAB 2Y0MA 3EC4A 1BOBA 4B11A 3IGRA 4QB9A 2CNSA 3B8GA 2EUIA 4KOVA 4R3LA 5F47A 3ZJ0A 4MI4A 1QSRA 3N7ZA 4CAFA 4R87A 2HV2A 5J8CA 2PR1A 4XNHB 1GHEA 1N71A 4PK3A 4C7IA 1S7KA 4CS0B 4UFXA 4A95A 2BSWA 4E0AA 1XIXA 5IV0A 2B58A 4YGOA 2P6EA 4AVCA 2WPWA 1YREA 2JLMA 4KOWA 4KVOE 4KOXA 2ZW7A 2OZUA 2Q44A 1WK4A 3SXNA 4F0XA 1MK4A 2K5TA 2FE7A 2FS5A 2FXFA 1MJBA 2VQYA 1VHSA 4CYNA 2C27A 2Z3NA 2REEA 4KZTA 2EVNA 2VZYA 2FIAA 5IX3A 5HMNA 4HNXB 1SQHA 4NXYA 4KLVA 2FCKA 4JD6A 1I21A 4KVXA 2D4OA 3DR6A 3GY9A 4QVTA 2FSRA 1LRZA 1P4NA 4H6UA 3QB8A 2I79A 4JXRA 3P2FA 5KTCA 4XPLA 3R9EA 2CXAA 2HUZA 1V0CA 4A32A 4JJXA 1U6MA 4XPKA 1IB1E 4A2ZA 2PSWA 4PSWA 5H86A 4JLYA 5I0CA 1YLEA 4YRHA 3S6KA 1Q2YA 4JWPA 1I12A 4A33A 1S5KA 3PZJA 4FD5A 4LUAA 4KLWA 4UFVA 3W6SA 2VI7A 2VZZA 2Z11A 5G21A 2A4NA 2PR8A 3ZZIA 4MBUA 3F5BA 1IYKA 1Y9WA 5CNPA 2YNCC 4KSAA 1Q2DA 2AJ6A 3GYAA 4MFKA 3TTHA 1XMTA 3TE4A 4F0YA 2VBQA 2ZW6A 4BBHA 4CRZB 4CYQA 3FRMA 2WPXA 2F5IA 4R9MA 5KTDA 2WUUA 3JVNA 4MFLA 2ARHA 1IYLA 1K4JA 1KUYA 1QSOA 4M3SA 3H5ZA 5A27A 1QSNA 4U5YA 2QIRA 2REFA 1S60A 2DPTA 2Z3LA 4KVME 1B6BA 4A30A 2YNCA 1KUVA 3R9GA 2O28A 4AG9A 3JTKA 4XPDB 2R8VA 1M44A 4H89A 5C82A 4CGOA 4Q36A 2Z3OA 3CXQA 1XF8A 4RS2A 1RXTA 4KOSA 4Q38A 2G0BA 2OZHA 3IWEA 3S6FA 4RI1A 3CXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR8 A;  4XNH C;  4B5P A;  1PU9 A;  3BLN A;  2BEI A;  1M1D A;  1S7F A;  2B4B A;  3FB3 A;  1XE4 A;  5J8F A;  1YX0 A;  3CXS A;  1YVK A;  1P0H A;  1S3Z A;  2B4D B;  2OB0 A;  1MJA A;  2NMT A;  3R96 A;  3E0K A;  4QBJ A;  2D4P A;  2P0W A;  2DXQ A;  1NE9 A;  1S7L A;  4OLL A;  4M85 A;  3F8K A;  4OAD A;  3FNC A;  3UY5 A;  4BMH A;  4IUS A;  1FY7 A;  2OU2 A;  1UFH A;  3H4Q A;  4AG7 A;  3BJ7 A;  2JDD A;  3R95 A;  3T90 A;  4NF1 A;  2QEC A;  4NEX A;  3NE7 A;  2G3T A;  4MY3 A;  2IL4 A;  1NSL A;  4MY0 A;  4QC6 A;  1IID A;  3KKW A;  1Y7R A;  3TO6 A;  3G8W A;  2PC1 A;  4FD6 A;  3R1K A;  3TO9 A;  3G3S A;  1Y9K A;  4UA3 A;  3WR7 A;  3VWD A;  2VEZ A;  5JQ4 A;  2JDC A;  2G3A A;  4II9 A;  4Y49 B;  2BL1 A;  2CY2 A;  1B87 A;  3TOB A;  2Q0Y A;  3JUW A;  2Q04 A;  1IIC A;  1Q2C A;  3FYN A;  2B3U A;  2B5G B;  3BJ8 A;  1KUX A;  4L89 A;  3D3S A;  5E96 A;  2CNT A;  5DWM A;  1CM0 A;  5EBV A;  2ZW4 A;  4UWI A;  2CNM A;  4B5O A;  4KOU A;  2ZW5 A;  2QML A;  4QUS A;  1YGH A;  3F0A A;  4R3K A;  1MJ9 A;  1Z9U A;  1KZF A;  1M4I A;  4E8O A;  3S6H A;  4AVA A;  5F46 A;  3RYO A;  1VKC A;  1YVO A;  4IF5 A;  4PV6 A;  4FD7 A;  3TOA A;  2FIW A;  4XPD C;  4HNW B;  4H6Z A;  4UWJ A;  5H84 A;  5ISV A;  5DWN A;  3D2M A;  1QST A;  3D8P A;  4J3G A;  2VXK A;  3FXT A;  4JXQ A;  4I49 A;  1J4J A;  4R57 A;  1YR0 A;  2PDO A;  4OAE A;  2R1I A;  3TCV A;  3EFA A;  2ATR A;  3LD2 A;  1Z4R A;  1ON0 A;  4NCZ A;  2J8R A;  2JEV A;  2FT0 A;  3V8I A;  2OZG A;  4LX9 A;  3SHP A;  3S6G A;  2I00 A;  3GKR A;  3P2H A;  3T9Y A;  2KCW A;  1BO4 A;  4CAX A;  3DSB A;  3OWC A;  4CAW A;  4UBR A;  2PQ8 A;  4HNY B;  5JPH A;  3MGD A;  4YFJ A;  3DDD A;  3FBU A;  4AVB A;  1RO5 A;  3SXO A;  2BUE A;  5C88 A;  3D2P A;  3EY5 A;  3I3G A;  3LOD A;  1XEB A;  4L8A A;  3VWE A;  2R98 A;  2P6G A;  4KOR A;  2AE6 A;  5EC4 A;  4KUA A;  3QAH A;  5F48 A;  1OZP A;  5IB0 A;  3IWG A;  4DNC A;  3K9U A;  1R57 A;  3TO7 A;  4HKF A;  1QSM A;  5FVJ A;  2B4D A;  1M4D A;  3I9S A;  4EVY A;  3EXN A;  4KOT A;  4ZBG A;  1CJW A;  4ORF A;  2X7B A;  2OH1 A;  1TIQ A;  4U9Z A;  3DNS A;  4PK2 A;  5HH1 A;  3TT2 A;  1M4G A;  4AB7 A;  2Z0Z A;  2Z10 A;  5GCN A;  3FIX A;  3TFY A;  3W91 A;  4F6A A;  4E2A A;  4KUB A;  4MHD A;  2PRB A;  2RC4 A;  2ZXV A;  2ZPA A;  4Y49 C;  4ONU A;  2GE3 A;  1NMT A;  4NSQ A;  1S7N A;  1PUA A;  4K30 A;  4PSX A;  2R7H A;  2GIV A;  4CRY B;  2Q4V A;  1Z4E A;  4CAV A;  5F49 A;  3W6X A;  2Q7B A;  5KTA A;  4MJ8 A;  2HQY A;  3PP9 A;  1L0C A;  3C26 A;  4KOY A;  2FL4 A;  3EO4 A;  1WWZ A;  4FD4 A;  4U9Y A;  3R9F A;  1I1D A;  2J8M A;  1YK3 A;  2Q4Y A;  3PGP A;  2GAN A;  4X5K A;  2P6F A;  4B5P B;  2J8N A;  2H5M A;  2B3V A;  2B5G A;  4GS4 A;  2Y0M A;  3EC4 A;  1BOB A;  3IGR A;  4QB9 A;  2CNS A;  3B8G A;  2EUI A;  4KOV A;  4R3L A;  5F47 A;  3ZJ0 A;  4MI4 A;  1QSR A;  3N7Z A;  4R87 A;  2HV2 A;  5J8C A;  2PR1 A;  4XNH B;  1GHE A;  1N71 A;  4PK3 A;  1S7K A;  4CS0 B;  2BSW A;  4E0A A;  1XIX A;  5IV0 A;  2B58 A;  4YGO A;  2P6E A;  4AVC A;  2WPW A;  1YRE A;  2JLM A;  4KOW A;  4KVO E;  4KOX A;  2ZW7 A;  2OZU A;  2Q44 A;  1WK4 A;  3SXN A;  1MK4 A;  2K5T A;  2FE7 A;  2FS5 A;  2FXF A;  1MJB A;  2VQY A;  1VHS A;  2C27 A;  2REE A;  4KZT A;  2EVN A;  2VZY A;  2FIA A;  5IX3 A;  5HMN A;  4HNX B;  1SQH A;  4NXY A;  4KLV A;  2FCK A;  4JD6 A;  1I21 A;  4KVX A;  2D4O A;  3DR6 A;  3GY9 A;  4QVT A;  2FSR A;  1LRZ A;  1P4N A;  4H6U A;  3QB8 A;  2I79 A;  4JXR A;  3P2F A;  5KTC A;  4XPL A;  3R9E A;  2HUZ A;  1V0C A;  4JJX A;  1U6M A;  4XPK A;  1IB1 E;  2PSW A;  4PSW A;  5H86 A;  4JLY A;  5I0C A;  1YLE A;  4YRH A;  3S6K A;  1Q2Y A;  4JWP A;  1I12 A;  1S5K A;  3PZJ A;  4FD5 A;  4LUA A;  4KLW A;  3W6S A;  2VI7 A;  2VZZ A;  2Z11 A;  2A4N A;  2PR8 A;  3ZZI A;  4MBU A;  3F5B A;  1IYK A;  1Y9W A;  5CNP A;  1Q2D A;  2AJ6 A;  3GYA A;  3TTH A;  1XMT A;  3TE4 A;  4F0Y A;  2VBQ A;  2ZW6 A;  4CRZ B;  3FRM A;  2WPX A;  2F5I A;  4R9M A;  5KTD A;  3JVN A;  2ARH A;  1IYL A;  1K4J A;  1KUY A;  1QSO A;  4M3S A;  1QSN A;  4U5Y A;  2QIR A;  2REF A;  1S60 A;  4KVM E;  1B6B A;  1KUV A;  3R9G A;  2O28 A;  4AG9 A;  4XPD B;  2R8V A;  1M44 A;  4H89 A;  5C82 A;  3CXQ A;  1XF8 A;  4RS2 A;  1RXT A;  4KOS A;  2G0B A;  2OZH A;  3S6F A;  4RI1 A;  3CXP A; 
#chains in the Genus database with same CATH topology
 3DR8 A;  4XNH C;  1CPS A;  2Q4Z A;  5K8M A;  4B5P A;  1PU9 A;  3BLN A;  2YGW A;  1IU8 A;  1ELM P;  2BEI A;  1M1D A;  1S7F A;  4NJQ A;  2B4B A;  3FB3 A;  1XE4 A;  2IQ6 A;  5J8F A;  3NE8 A;  1YX0 A;  1AYE A;  3CXS A;  1YVK A;  3IFE A;  1P0H A;  1S3Z A;  4ZY2 A;  2B4D B;  3RBU A;  3SJX A;  2OB0 A;  1MJA A;  2ZEP A;  2NMT A;  1ZLI A;  3R96 A;  3E0K A;  4UCN A;  1CX8 A;  1Z8X A;  3QNV A;  2D4P A;  4UCM A;  2P0W A;  5CPA A;  4QBJ A;  2DXQ A;  1R43 A;  1NE9 A;  1S7L A;  4OLL A;  2OOT A;  3BHX A;  3BXM A;  4FBE A;  4M85 A;  3F8K A;  4OAD A;  3FNC A;  3UY5 A;  4UF4 A;  3RAM A;  4FUU A;  4IUS A;  4BMH A;  3VAT A;  3PBB A;  1FY7 A;  4TWE A;  2OU2 A;  3GLJ A;  1LOK A;  1UFH A;  3H4Q A;  2FVG A;  3KGQ A;  2Z3M A;  2V8H A;  2F7V A;  1CP6 A;  4AG7 A;  3BJ7 A;  3IU2 A;  1HEE A;  1XRY A;  2PJ0 A;  5K8N A;  2JDD A;  3R95 A;  4C2X A;  1OBR A;  4C68 A;  2WSA A;  3T90 A;  4NF1 A;  2BO9 A;  2QEC A;  3MRU A;  3VAR A;  4NEX A;  4NFR A;  3NE7 A;  2G3T A;  4MY3 A;  2IL4 A;  3KR5 A;  1NSL A;  2PJ2 A;  2PJ3 A;  2Z3P A;  4R7M A;  4UFW A;  2NYQ A;  2CTB A;  3LMS A;  2Q7S A;  4B13 A;  4MY0 A;  3TC8 A;  5JM6 A;  3QAY A;  3D67 A;  4OC2 A;  1IID A;  4QC6 A;  1LFW A;  1LCP A;  3KKW A;  1Y7R A;  2ZEH A;  4OC5 A;  3TO6 A;  3G8W A;  2PC1 A;  2RFH A;  3H8E A;  5AGE A;  4B14 A;  1LAN A;  2ANP A;  2F8H A;  3CDX A;  4FD6 A;  4UEE A;  4CGN A;  1AMP A;  3R1K A;  1YME A;  1TXR A;  3TO9 A;  5AG7 A;  3G3S A;  1Y9K A;  1Y0Y A;  2CF4 A;  4UA3 A;  3H8G A;  3WR7 A;  3VWD A;  2VEZ A;  5JQ4 A;  1CP7 A;  4OID A;  4X2T A;  2JDC A;  5AG4 A;  3V38 A;  2G3A A;  4II9 A;  4O23 A;  2BL1 A;  4MFP A;  4Y49 B;  4FAI A;  2CY2 A;  4OC0 A;  1B87 A;  3RNZ A;  3TOB A;  3IEH A;  4ZX8 A;  2Q0Y A;  3JUW A;  2Q04 A;  1IIC A;  4EWT A;  2QYV A;  2HC9 A;  1Q2C A;  4P6Y A;  4X8I A;  4IK2 A;  1Y7E A;  3CPX A;  1Z8L A;  2B3U A;  3FYN A;  3SI2 A;  2B5G B;  3BJ8 A;  5HVF A;  1KUX A;  4BD9 A;  4L89 A;  3D3S A;  2V8V A;  5E96 A;  2CNT A;  3BI1 A;  3PRT A;  4P4B A;  5DWM A;  5IB9 A;  1CM0 A;  4NGM A;  5EBV A;  5F09 A;  1PYT B;  3DLJ A;  1ZG8 A;  5G1Z A;  1ZO0 A;  2ZW4 A;  4UWI A;  2CNM A;  4B5O A;  3GUX A;  3PEI A;  4KOU A;  2VL1 A;  2ZW5 A;  3SI1 A;  4NGT A;  2QML A;  4ONW A;  1F57 A;  1YGH A;  3F0A A;  4QUS A;  4R3K A;  1IGB A;  4EME A;  1BPM A;  1MJ9 A;  2DEA A;  4GXH A;  4MFJ A;  3KHZ A;  1Q7L A;  1Z9U A;  4OC3 A;  2ZOF A;  1KZF A;  1M4I A;  4C2Y A;  3S6H A;  4AVA A;  4A31 A;  4HPS A;  4E8O A;  4RUH A;  5F46 A;  3IIB A;  3FX6 A;  4B10 A;  3RYO A;  1VKC A;  4ZGY B;  1YVO A;  2AFW A;  3FED A;  4G1P A;  1KWM A;  4A39 A;  4IF5 A;  4KSF A;  4PV6 A;  4ZY0 A;  4FD7 A;  4KSI A;  3TOA A;  2FIW A;  4XPD C;  1XFO A;  4H6Z A;  4HNW B;  4MRI A;  4UWJ A;  5AG6 A;  2ZEE A;  4MFQ A;  5H84 A;  5ISV A;  5DWN A;  3D2M A;  4WWV A;  1QST A;  3D8P A;  1Z5R A;  4J3G A;  2VXK A;  3FXT A;  4MCR A;  4JXQ A;  2V8D A;  4I49 A;  4UEZ A;  1J4J A;  3H8F A;  4R57 A;  1YR0 A;  3N5F A;  4JYW A;  1YW4 A;  1YQE A;  2PDO A;  1JWQ A;  2XEG A;  4P4D A;  5LRK A;  4R76 A;  2PJA A;  4OAE A;  4ZYQ A;  3L2N A;  2YND A;  1M4L A;  2R1I A;  3TCV A;  4DYO A;  1F2O A;  2ATR A;  3EFA A;  4IHM A;  3LD2 A;  1Z4R A;  1YSJ A;  4P45 A;  1ON0 A;  4NCZ A;  2J8R A;  3BI0 A;  2JEV A;  1RTQ A;  2FT0 A;  3V8I A;  2OZG A;  4LX9 A;  5JGF A;  3PFE A;  6CPA A;  3SHP A;  3B3C A;  2QJ8 A;  4KS9 A;  3S6G A;  2I00 A;  2XEJ A;  3GKR A;  3P2H A;  3KL9 A;  4PXB A;  2KCW A;  2Q51 A;  3T9Y A;  1BO4 A;  4CAX A;  3DSB A;  4CGM A;  1Z8T A;  3OWC A;  4CAW A;  4NGS A;  4MFZ A;  1GYT A;  2PJ9 A;  4UBR A;  2PQ8 A;  4HNY B;  3A9L A;  2PVW A;  2DPS A;  5JPH A;  3IO1 A;  3MGD A;  3WC5 A;  2PJ1 A;  4YFJ A;  4PPZ A;  3NH4 A;  3DDD A;  3FBU A;  3KI9 A;  4AVB A;  4B12 A;  1RO5 A;  3SXO A;  4C2Z A;  2BUE A;  4PQA A;  5C88 A;  3D2P A;  4C7H A;  1FT7 A;  2BOA A;  3EY5 A;  3HUV A;  1ZG7 A;  2YNE A;  3I3G A;  3LOD A;  4A38 A;  1XEB A;  3FVL A;  3KQX A;  4L8A A;  1Z8W A;  3VWE A;  1ARM A;  2C6P A;  2R98 A;  2ZEG A;  2AFZ A;  2P6G A;  2PJ7 A;  3B2Y A;  4KOR A;  2AE6 A;  5EC4 A;  4KUA A;  3QAH A;  4Z65 A;  5F48 A;  5G20 A;  1OZP A;  5IB0 A;  3IWG A;  4MCP A;  3IU1 A;  4DNC A;  3NA6 A;  5HXD A;  3PFO A;  2WYR A;  3K9U A;  3WC6 A;  4AXV A;  1R57 A;  2GLF A;  3TO7 A;  4HKF A;  1QSM A;  4M6H A;  5FVJ A;  2B4D A;  1M4D A;  3I9S A;  3B3T A;  4EVY A;  3EXN A;  4KOT A;  3RO0 A;  4ZBG A;  1CJW A;  4ORF A;  3CZX A;  2IJZ A;  2X7B A;  3FH4 A;  4UIB A;  2OH1 A;  3PB6 X;  2GU2 A;  4CYP A;  2ZEL A;  1TIQ A;  4DUK A;  1QMU A;  4U9Z A;  3IJ3 A;  3DNS A;  4PK2 A;  5HH1 A;  4EFD A;  3TT2 A;  1AUG A;  1M4G A;  1UWY A;  2HB6 A;  1XOV A;  3ISZ A;  4AB7 A;  1NSA A;  3KHX A;  1XJO A;  2Z3K A;  2Z0Z A;  3NH8 A;  3RZA A;  2V8G A;  2Z10 A;  5GCN A;  3FIX A;  4LQ6 A;  3WC7 A;  4B6Z A;  3TFY A;  3W91 A;  4F6A A;  4E2A A;  4KUB A;  2ZOG A;  4MHD A;  2PRB A;  2RC4 A;  2OR4 A;  7CPA A;  2ZXV A;  1ELL P;  2DF5 A;  2ZPA A;  4Y49 C;  5J1Q A;  5AG5 A;  2AFS A;  4OP4 A;  4ONU A;  2GE3 A;  4CGP A;  1NMT A;  1VIX A;  4NSQ A;  3HLP A;  1S7N A;  1PUA A;  5LRG A;  1ARL A;  4CAE A;  1X10 A;  2RB7 A;  4K30 A;  4PSX A;  2R7H A;  5A28 A;  2GIV A;  4F8Z A;  5D29 A;  4CRY B;  2Q4V A;  1Z4E A;  1LAM A;  2AFX A;  5F49 A;  4CAV A;  3W6X A;  2Q7B A;  4CGL A;  3WT4 A;  5KTA A;  2JBJ A;  4MJ8 A;  5DS0 A;  2HQY A;  3SJG A;  3PP9 A;  4K3N A;  1L0C A;  3C26 A;  2ZEO A;  4KOY A;  5G22 A;  2FL4 A;  3EO4 A;  1WWZ A;  2AFM A;  2CTC A;  4FD4 A;  4U9Y A;  2ZED A;  4P4J A;  3R9F A;  1I1D A;  4UCP A;  2J8M A;  1YK3 A;  2Q4Y A;  1ZLH A;  4F9U A;  1PCA A;  3PGP A;  2ABZ A;  4PXE A;  4YWY A;  2GAN A;  4X5K A;  2PE3 A;  2ODF A;  1TKF A;  2P6F A;  4P4I A;  1CBX A;  4B5P B;  2J8N A;  3CT9 A;  4WJB A;  2H5M A;  2B3V A;  2B5G A;  4MMO A;  4CYO A;  1EE3 P;  4GS4 A;  5BWA B;  2ZEM A;  2Y0M A;  3EC4 A;  1BOB A;  1HDQ A;  3D4U A;  4IAV A;  4B11 A;  1TF8 A;  3IGR A;  4QB9 A;  2CNS A;  3B7I A;  2GLJ A;  3B8G A;  4UIA A;  4BIN A;  2EUI A;  4RN7 A;  4KOV A;  4R3L A;  2XEF A;  1IOF A;  4P4E A;  5F47 A;  1FNO A;  3D68 A;  3ZJ0 A;  4MI4 A;  1QSR A;  1R3N A;  3N7Z A;  1QQ9 A;  4OC4 A;  4CAF A;  4R87 A;  4ZI6 A;  2HV2 A;  5J8C A;  4DJL A;  2O53 A;  2PR1 A;  4PXD A;  4XNH B;  5CBM A;  1GHE A;  1N71 A;  2C6G A;  4LQG A;  1S7K A;  4PK3 A;  4C7I A;  4CS0 B;  4ZX9 A;  4UFX A;  5I4M A;  5EMI A;  3PBE A;  2EK8 A;  4FWU A;  4A95 A;  3K2K A;  2V77 A;  3PB9 X;  2EO8 A;  3IC1 A;  2C6C A;  2AFO A;  2J9A A;  2PCU A;  2PJC A;  2BSW A;  3SJE A;  1XIX A;  3GIU A;  4E0A A;  2B58 A;  5IV0 A;  3LWU A;  4YGO A;  2P6E A;  2Q43 A;  4AVC A;  1YLO A;  2WPW A;  1YRE A;  2JLM A;  4KOW A;  4KVO E;  4KOX A;  2PJ8 A;  2ZW7 A;  2OZU A;  2Q44 A;  1CPX A;  1WK4 A;  3SXN A;  4F0X A;  1MK4 A;  2EBJ A;  2K5T A;  1A2Z A;  2FE7 A;  3B3V A;  2FS5 A;  1TKJ A;  5THW A;  3B3S A;  3V7Z A;  5JH9 A;  2FXF A;  1IY7 A;  5K8P A;  1DE4 C;  1ZG9 A;  3S9N A;  1MJB A;  2VQY A;  1VHS A;  4UEF A;  2C27 A;  4CYN A;  2PJB A;  3D7H A;  2Z3N A;  2REE A;  4KZT A;  3MN8 A;  3DGV A;  2EVN A;  4OME A;  2EWB A;  2ZEN A;  4GM5 A;  2VZY A;  1XBU A;  5LYD A;  2FIA A;  5IX3 A;  5HMN A;  4HNX B;  1SQH A;  3FF3 A;  2POK A;  4NXY A;  4P44 A;  4KLV A;  4Q7A A;  2FCK A;  4JD6 A;  4NGQ A;  1VGY A;  1I21 A;  2PJ5 A;  3ISX A;  4KVX A;  3D7D A;  1H8L A;  2D4O A;  3D7F A;  3DR6 A;  4PXC A;  5D8N A;  3GY9 A;  4MHY A;  5ELY A;  4QVT A;  1DTD A;  4X3R A;  2FSR A;  3KR4 A;  2EK9 A;  3D66 A;  4F9V A;  8CPA A;  1CG2 A;  5HVG A;  1LRZ A;  1P4N A;  1VHO A;  3JRU A;  2BCO A;  2I79 A;  3QB8 A;  4H6U A;  5LYI A;  4JXR A;  3P2F A;  3S9M A;  5KTC A;  4XPL A;  3R9E A;  2CXA A;  2HUZ A;  1BLL E;  1V0C A;  1BPN A;  4A32 A;  3KZW A;  2QVP A;  3IWW A;  4JJX A;  5K8O A;  1U6M A;  4XPK A;  2GRE A;  1IB1 E;  2PRQ A;  2PSW A;  4PSW A;  4A2Z A;  5H86 A;  3TX8 A;  1Y0R A;  5HVH A;  4JLY A;  5I0C A;  1YLE A;  4YRH A;  4MHN A;  4MHZ A;  4NJR A;  3S6K A;  2PJ6 A;  1IOI A;  1Q2Y A;  4JWP A;  3B35 A;  1I12 A;  1Z2L A;  4NGN A;  2G9D A;  4YU9 A;  4NGP A;  4A33 A;  1S5K A;  3PZJ A;  2JBK A;  3PB8 X;  3I1U A;  4OC1 A;  4FD5 A;  3LAC A;  4LUA A;  3PB7 X;  4KLW A;  4UFV A;  3W6S A;  2WZN A;  4ZY1 A;  2VI7 A;  3WAB A;  2I3C A;  2VZZ A;  3T8W A;  2Z11 A;  1JQG A;  4OKO A;  5G21 A;  2O4H A;  2A4N A;  2PR8 A;  3SJF A;  3ZZI A;  1BAV A;  4MBU A;  3F5B A;  2XEI A;  1YW6 A;  2PIY A;  1IYK A;  1Y9W A;  5CNP A;  2YNC C;  4M6I A;  4KSA A;  1Q2D A;  2AJ6 A;  2AFU A;  3GYA A;  3GB0 A;  4MFK A;  2IMO A;  3FEE A;  1XMT A;  3B3W A;  3CPA A;  3KAS A;  3NFZ A;  4MHP A;  4P10 A;  3TTH A;  3TE4 A;  1XMB A;  4F0Y A;  2VBQ A;  1HDU A;  2ZW6 A;  2JEW A;  4BBH A;  4CRZ B;  3D7G A;  4TNU A;  3FRM A;  2WPX A;  4CYQ A;  2F5I A;  2PIZ A;  4R9M A;  5KTD A;  2WUU A;  3JVN A;  4MFL A;  5LYF A;  2CIJ A;  3SI0 A;  1X12 A;  2ARH A;  4NGR A;  1IYL A;  1K4J A;  1KUY A;  1LAP A;  3FMC A;  4M6G A;  1F2P A;  1QSO A;  4P4F A;  2NSM A;  4M3S A;  3H5Z A;  5A27 A;  1QSN A;  4A94 A;  4MXU A;  4R8F A;  4U5Y A;  2QIR A;  2REF A;  1S60 A;  4A37 A;  2DPT A;  2Z3L A;  3PB4 X;  4KVM E;  1VHE A;  1TKH A;  1B6B A;  4A30 A;  4CPA A;  2YNC A;  4JZ0 A;  4MCS A;  1KUV A;  2GFQ A;  3R9G A;  2O28 A;  4AG9 A;  3JTK A;  4MCQ A;  2R8V A;  1M44 A;  4XPD B;  4H89 A;  5C82 A;  2C1C A;  4CGO A;  3S9L A;  4Q36 A;  4R6T A;  3NH5 A;  2ZEF A;  3FJU A;  4H2K A;  2PVV A;  4OIW A;  2Z3O A;  3CXQ A;  1XF8 A;  3FEC A;  4RS2 A;  1RXT A;  5LYL A;  4KOS A;  1TF9 A;  4Q38 A;  2G0B A;  2PJ4 A;  5LRJ A;  3VH9 A;  2OZH A;  3KQZ A;  4W9Y A;  3IWE A;  3S6F A;  4RI1 A;  3CXP A;  3K9T A; 
#chains in the Genus database with same CATH homology
 3DR8 A;  4XNH C;  4B5P A;  1PU9 A;  3BLN A;  2YGW A;  2BEI A;  1M1D A;  1S7F A;  2B4B A;  3FB3 A;  1XE4 A;  5J8F A;  1YX0 A;  3CXS A;  1YVK A;  1P0H A;  1S3Z A;  2B4D B;  2OB0 A;  1MJA A;  2NMT A;  3R96 A;  3E0K A;  4UCN A;  4QBJ A;  2D4P A;  4UCM A;  2P0W A;  2DXQ A;  1NE9 A;  1S7L A;  4OLL A;  4M85 A;  3F8K A;  4OAD A;  3FNC A;  3UY5 A;  4BMH A;  4IUS A;  1FY7 A;  2OU2 A;  1UFH A;  3H4Q A;  2Z3M A;  4AG7 A;  3BJ7 A;  3IU2 A;  2JDD A;  3R95 A;  4C2X A;  4C68 A;  2WSA A;  3T90 A;  4NF1 A;  2QEC A;  4NEX A;  3NE7 A;  2G3T A;  4MY3 A;  2IL4 A;  1NSL A;  2Z3P A;  4UFW A;  4B13 A;  4MY0 A;  4QC6 A;  1IID A;  3KKW A;  1Y7R A;  3TO6 A;  3G8W A;  2PC1 A;  4B14 A;  5AGE A;  4CGN A;  4FD6 A;  3R1K A;  3TO9 A;  5AG7 A;  3G3S A;  1Y9K A;  4UA3 A;  3WR7 A;  3VWD A;  2VEZ A;  5JQ4 A;  2JDC A;  5AG4 A;  2G3A A;  4II9 A;  4Y49 B;  2BL1 A;  4MFP A;  2CY2 A;  1B87 A;  3TOB A;  2Q0Y A;  3JUW A;  2Q04 A;  1IIC A;  1Q2C A;  3FYN A;  2B3U A;  2B5G B;  3BJ8 A;  1KUX A;  4L89 A;  3D3S A;  5E96 A;  2CNT A;  5DWM A;  1CM0 A;  5EBV A;  5G1Z A;  1ZO0 A;  2ZW4 A;  4UWI A;  2CNM A;  4B5O A;  4KOU A;  2ZW5 A;  2QML A;  4QUS A;  1YGH A;  3F0A A;  4R3K A;  1MJ9 A;  4MFJ A;  1Z9U A;  1KZF A;  1M4I A;  4C2Y A;  3S6H A;  4AVA A;  4A31 A;  4E8O A;  5F46 A;  4B10 A;  3RYO A;  1VKC A;  4ZGY B;  1YVO A;  4IF5 A;  4KSF A;  4PV6 A;  4FD7 A;  3TOA A;  2FIW A;  4XPD C;  4HNW B;  4H6Z A;  4UWJ A;  5AG6 A;  5H84 A;  4MFQ A;  5ISV A;  5DWN A;  3D2M A;  1QST A;  3D8P A;  4J3G A;  2VXK A;  3FXT A;  4JXQ A;  4I49 A;  1J4J A;  4R57 A;  1YR0 A;  2PDO A;  4OAE A;  2YND A;  2R1I A;  3TCV A;  3EFA A;  2ATR A;  3LD2 A;  1Z4R A;  1ON0 A;  4NCZ A;  2J8R A;  2JEV A;  2FT0 A;  3V8I A;  2OZG A;  4LX9 A;  3SHP A;  3S6G A;  4KS9 A;  2I00 A;  3GKR A;  3P2H A;  3T9Y A;  2KCW A;  1BO4 A;  4CAX A;  3DSB A;  4CGM A;  3OWC A;  4CAW A;  4MFZ A;  4UBR A;  2PQ8 A;  4HNY B;  3A9L A;  2DPS A;  5JPH A;  3MGD A;  4YFJ A;  3DDD A;  3FBU A;  4AVB A;  4B12 A;  1RO5 A;  3SXO A;  4C2Z A;  2BUE A;  5C88 A;  3D2P A;  4C7H A;  3EY5 A;  2YNE A;  3I3G A;  3LOD A;  1XEB A;  4L8A A;  3VWE A;  2R98 A;  2P6G A;  4KOR A;  2AE6 A;  5EC4 A;  4KUA A;  3QAH A;  5F48 A;  5G20 A;  1OZP A;  5IB0 A;  3IWG A;  3IU1 A;  4DNC A;  3K9U A;  1R57 A;  3TO7 A;  4HKF A;  1QSM A;  5FVJ A;  2B4D A;  1M4D A;  3I9S A;  4EVY A;  3EXN A;  4KOT A;  4ZBG A;  1CJW A;  4ORF A;  2X7B A;  2OH1 A;  4CYP A;  1TIQ A;  4U9Z A;  3DNS A;  4PK2 A;  5HH1 A;  3TT2 A;  1M4G A;  4AB7 A;  2Z3K A;  2Z0Z A;  2Z10 A;  5GCN A;  3FIX A;  3TFY A;  3W91 A;  4F6A A;  4E2A A;  4KUB A;  4MHD A;  2PRB A;  2RC4 A;  2ZXV A;  2ZPA A;  4Y49 C;  5AG5 A;  4ONU A;  2GE3 A;  4CGP A;  1NMT A;  4NSQ A;  1S7N A;  1PUA A;  4CAE A;  4K30 A;  4PSX A;  2R7H A;  5A28 A;  2GIV A;  4CRY B;  2Q4V A;  1Z4E A;  4CAV A;  5F49 A;  3W6X A;  2Q7B A;  4CGL A;  5KTA A;  4MJ8 A;  2HQY A;  3PP9 A;  1L0C A;  3C26 A;  4KOY A;  5G22 A;  2FL4 A;  3EO4 A;  1WWZ A;  4FD4 A;  4U9Y A;  3R9F A;  1I1D A;  4UCP A;  2J8M A;  1YK3 A;  2Q4Y A;  3PGP A;  2GAN A;  4X5K A;  2P6F A;  4B5P B;  2J8N A;  2H5M A;  2B3V A;  2B5G A;  4CYO A;  4GS4 A;  5BWA B;  2Y0M A;  3EC4 A;  1BOB A;  4B11 A;  3IGR A;  4QB9 A;  2CNS A;  3B8G A;  2EUI A;  4KOV A;  4R3L A;  5F47 A;  3ZJ0 A;  4MI4 A;  1QSR A;  3N7Z A;  4CAF A;  4R87 A;  2HV2 A;  5J8C A;  2PR1 A;  4XNH B;  1GHE A;  1N71 A;  4PK3 A;  4C7I A;  1S7K A;  4CS0 B;  4UFX A;  4A95 A;  2BSW A;  4E0A A;  1XIX A;  5IV0 A;  2B58 A;  4YGO A;  2P6E A;  4AVC A;  2WPW A;  1YRE A;  2JLM A;  4KOW A;  4KVO E;  4KOX A;  2ZW7 A;  2OZU A;  2Q44 A;  1WK4 A;  3SXN A;  4F0X A;  1MK4 A;  2K5T A;  2FE7 A;  2FS5 A;  2FXF A;  1MJB A;  2VQY A;  1VHS A;  4CYN A;  2C27 A;  2Z3N A;  2REE A;  4KZT A;  2EVN A;  2VZY A;  2FIA A;  5IX3 A;  5HMN A;  4HNX B;  1SQH A;  4NXY A;  4KLV A;  2FCK A;  4JD6 A;  1I21 A;  4KVX A;  2D4O A;  3DR6 A;  3GY9 A;  4QVT A;  2FSR A;  1LRZ A;  1P4N A;  4H6U A;  3QB8 A;  2I79 A;  4JXR A;  3P2F A;  5KTC A;  4XPL A;  3R9E A;  2CXA A;  2HUZ A;  1V0C A;  4A32 A;  4JJX A;  1U6M A;  4XPK A;  1IB1 E;  4A2Z A;  2PSW A;  4PSW A;  5H86 A;  4JLY A;  5I0C A;  1YLE A;  4YRH A;  3S6K A;  1Q2Y A;  4JWP A;  1I12 A;  4A33 A;  1S5K A;  3PZJ A;  4FD5 A;  4LUA A;  4KLW A;  4UFV A;  3W6S A;  2VI7 A;  2VZZ A;  2Z11 A;  5G21 A;  2A4N A;  2PR8 A;  3ZZI A;  4MBU A;  3F5B A;  1IYK A;  1Y9W A;  5CNP A;  2YNC C;  4KSA A;  1Q2D A;  2AJ6 A;  3GYA A;  4MFK A;  3TTH A;  1XMT A;  3TE4 A;  4F0Y A;  2VBQ A;  2ZW6 A;  4BBH A;  4CRZ B;  4CYQ A;  3FRM A;  2WPX A;  2F5I A;  4R9M A;  5KTD A;  2WUU A;  3JVN A;  4MFL A;  2ARH A;  1IYL A;  1K4J A;  1KUY A;  1QSO A;  4M3S A;  3H5Z A;  5A27 A;  1QSN A;  4U5Y A;  2QIR A;  2REF A;  1S60 A;  2DPT A;  2Z3L A;  4KVM E;  1B6B A;  4A30 A;  2YNC A;  1KUV A;  3R9G A;  2O28 A;  4AG9 A;  3JTK A;  4XPD B;  2R8V A;  1M44 A;  4H89 A;  5C82 A;  4CGO A;  4Q36 A;  2Z3O A;  3CXQ A;  1XF8 A;  4RS2 A;  1RXT A;  4KOS A;  4Q38 A;  2G0B A;  2OZH A;  3IWE A;  3S6F A;  4RI1 A;  3CXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...