4E8OA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
147
structure length
147
Chain Sequence
GMNIMPISESQLSDWLALRCLLWPDHEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNGTQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aac(6')-Ih protein
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 34
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e8oA00
4PK2A 4XPLA 3R9EA 2FIAA 4AG7A 3BJ8A 4KLWA 4HNYB 3MGDA 2B5GB 4KLVA 2GE3A 3F5BA 3FBUA 1S3ZA 2PDOA 2QECA 3D2PA 1S60A 3JUWA 3TCVA 4AG9A 1L0CA 2CNSA 1S7NA 2G0BA 2QIRA 1J4JA 4KOYA 2ZPAA 5IB0A 3G8WA 4PSXA 3FYNA 2O28A 2FS5A 2CY2A 1XIXA 2J8RA 3FB3A 4CRYB 3QB8A 1PUAA 5J8FA 1Z4EA 2FIWA 4IUSA 4CAVA 4FD5A 1CM0A 4Y49C 4PSWA 3RYOA 4B5PB 5C88A 5EC4A 3FNCA 3KKWA 1B87A 2PQ8A 1S7KA 4R3KA 5F47A 3K9UA 4MHDA 2QMLA 4L8AA 4MI4A 3W6XA 1Z4RA 1QSRA 4IF5A 4OLLA 1YVKA 4JXQA 4QVTA 2ZW7A 2D4PA 3VWDA 4CAWA 1YREA 4KOVA 2R98A 3TFYA 2OZHA 3FXTA 3TT2A 4NXYA 3GYAA 1M4GA 3EC4A 4OAEA 5F48A 3VWEA 4RS2A 2KCWA 3F8KA 3DR8A 2JDDA 3R9GA 1IYLA 4Y49B 1RXTA 3S6KA 4KUAA 1YX0A 3PP9A 4CRZB 4AVBA 4I49A 3DSBA 5IV0A 2DXQA 2GIVA 2CNMA 5GCNA 2G3AA 4YRHA 1YR0A 3QAHA 4E2AA 4KORA 2OB0A 2ZW4A 2OZUA 3SXOA 1RO5A 3GY9A 4FD4A 2P6EA 2Q04A 4R57A 2FL4A 5C82A 3W6SA 2FE7A 3B8GA 4KOXA 4R87A 3EY5A 1XEBA 1FY7A 1XF8A 5J8CA 1KUYA 2ARHA 1PU9A 2REEA 1R57A 3OWCA 5ISVA 3T9YA 4AB7A 2ZXVA 4F6AA 2J8MA 4JXRA 4LUAA 2K5TA 2VXKA 1S5KA 4E0AA 3S6FA 2CNTA 4H6UA 2GANA 3GKRA 1UFHA 3SXNA 2ATRA 5F46A 1XE4A 5H86A 1Q2YA 4PK3A 1KZFA 5I0CA 3DR6A 4JD6A 3EFAA 3G3SA 1WWZA 3TE4A 3S6HA 3TOBA 3V8IA 4KUBA 4YGOA 4ONUA 5H84A 4LX9A 1WK4A 3R9FA 3P2FA 4QB9A 3T90A 2VEZA 4M3SA 5FVJA 4NCZA 1NMTA 2P0WA 2Q4YA 4X5KA 4NEXA 2P6FA 4EVYA 4AVCA 2VBQA 3I3GA 4UWJA 2JDCA 2RC4A 4U5YA 1P0HA 4UBRA 3EO4A 2B5GA 3DNSA 1BO4A 5DWNA 4KZTA 4E8OA 4JJXA 3PGPA 1Y9KA 3TOAA 3LD2A 4R9MA 2OH1A 3BJ7A 4XPKA 3PZJA 4JLYA 5EBVA 2NMTA 4L89A 5KTCA 4KOWA 4CS0B 3TO7A 1KUXA 3CXQA 2B4DA 1VHSA 5CNPA 2VQYA 1V0CA 3DDDA 1OZPA 1QSOA 3N7ZA 3ZJ0A 4ZBGA 1U6MA 2B3VA 4QC6A 4KOTA 2FT0A 1MK4A 2B4BA 4J3GA 1IYKA 4DNCA 2Z10A 1YK3A 4MY3A 4NF1A 4F0YA 4M85A 2A4NA 4KOUA 2JEVA 1BOBA 2REFA 4BMHA 2H5MA 4B5PA 4UA3A 4HNWB 2JLMA 1MJAA 4OADA 2BEIA 2G3TA 3ZZIA 3UY5A 2J8NA 2FCKA 2HV2A 4KOSA 1Y9WA 2OU2A 2PR8A 4II9A 1S7LA 2AE6A 3W91A 1M4IA 1I12A 2VI7A 4GS4A 1NE9A 3D2MA 4ORFA 3R95A 2R8VA 2VZZA 4MY0A 3IWGA 4H89A 5F49A 4AVAA 3CXSA 3TO9A 2VZYA 3WR7A 2C27A 1B6BA 2BSWA 4PV6A 4XPDC 4KVXA 2AJ6A 3C26A 5JPHA 1MJBA 3FRMA 2WPWA 2FSRA 2HQYA 1IIDA 3D8PA 3LODA 2R7HA 2OZGA 1SQHA 2PC1A 4FD6A 2I00A 4JWPA 2BUEA 4R3LA 4HNXB 1QSTA 2B4DB 1YLEA 1MJ9A 1N71A 3IGRA 2X7BA 2EUIA 4XNHC 1LRZA 5HH1A 2D4OA 4CAXA 4QBJA 3BLNA 1YGHA 3CXPA 1M1DA 3SHPA 4K30A 3S6GA 3I9SA 1S7FA 2I79A 1P4NA 1M4DA 4XPDB 2FXFA 1QSMA 4QUSA 2B3UA 2P6GA 5KTDA 5IX3A 1TIQA 5E96A 5JQ4A 3H4QA 4KVME 1XMTA 2WPXA 4U9ZA 1IICA 3FIXA 4MJ8A 3EXNA 2EVNA 2B58A 3D3SA 1Q2CA 2F5IA 1CJWA 1GHEA 1ON0A 3E0KA 4XNHB 5DWMA 1QSNA 1NSLA 3R1KA 2Q44A 4FD7A 1IB1E 3R96A 1Z9UA 2Y0MA 1KUVA 2HUZA 2Z0ZA 3P2HA 2PSWA 4B5OA 2R1IA 2BL1A 5KTAA 2Q0YA 2ZW6A 1K4JA 2IL4A 3TO6A 2Z11A 1VKCA 1Y7RA 3JVNA 4U9YA 1I21A 4RI1A 1YVOA 3TTHA 2PR1A 4YFJA 2Q7BA 4HKFA 3F0AA 5HMNA 4NSQA 4KVOE 3NE7A 2ZW5A 4H6ZA 1M44A 4MBUA 2PRBA 1I1DA 2Q4VA 4UWIA 1Q2DA
chains in the Genus database with same CATH superfamily
4PK2A 4LQ6A 3V7ZA 3RBUA 4XPLA 2O4HA 2Q4ZA 3R9EA 5A27A 4P45A 2C6CA 2FIAA 4AG7A 3PFOA 3BJ8A 4KLWA 2Q43A 4HNYB 1Z5RA 2YGWA 2WUUA 3MGDA 2B5GB 4PXCA 4C2ZA 1NSAA 4KLVA 1VGYA 1Z8LA 4NGRA 2GE3A 3F5BA 4OIDA 3FBUA 1S3ZA 2PDOA 2QECA 3D2PA 3FH4A 4DUKA 1S60A 3D7GA 3JUWA 3TCVA 4AG9A 3K2KA 5AG7A 4IHMA 5J1QA 3KQZA 1L0CA 2WZNA 4B6ZA 3RZAA 4IAVA 2CNSA 1Y7EA 1S7NA 4EWTA 3H8EA 2G0BA 4ZX8A 4TWEA 2QIRA 1J4JA 3CZXA 4M6HA 3FECA 4ZY2A 4KOYA 1ARMA 2ZPAA 1IOFA 1VHOA 1FNOA 4PXEA 4UCPA 5IB0A 3G8WA 3IWWA 4Z65A 2WSAA 4PSXA 3FYNA 3RNZA 3K9TA 2I3CA 3PFEA 2PJ9A 5LYFA 4ONWA 3SJFA 2O28A 2IMOA 4F9VA 4A37A 2FS5A 2CY2A 1XIXA 2YNEA 2XEIA 2J8RA 3FB3A 4MHPA 4CRYB 5DS0A 1XMBA 3KL9A 1TF8A 3QB8A 3IC1A 3S9NA 1PUAA 5J8FA 2XEGA 4NGSA 1Z4EA 2AFXA 2FIWA 4IUSA 4UEZA 3VARA 4B12A 4CAVA 4FD5A 1CM0A 4Y49C 4PSWA 3RYOA 4B5PB 5C88A 5EC4A 2DF5A 4BD9A 8CPAA 1TKHA 4H2KA 3S9MA 4ZGYB 2CXAA 2NSMA 2RFHA 3D4UA 3FNCA 1LOKA 3KKWA 1B87A 2PQ8A 4O23A 1S7KA 1LAMA 4R3KA 5F47A 3K9UA 2GREA 4MHDA 4CYQA 3H5ZA 4A30A 2QMLA 1DTDA 4L8AA 2PJ4A 4DYOA 4MI4A 5LYLA 5K8PA 2XEJA 4YWYA 3W6XA 1Z4RA 1QSRA 2XEFA 4IF5A 4MFJA 3TC8A 4OLLA 1YVKA 4Q7AA 4R7MA 1LFWA 4JXQA 4QVTA 2Z3LA 2ZW7A 2D4PA 3B35A 3VWDA 4C2YA 4CAWA 1YREA 3IU1A 3IO1A 3T8WA 3B3TA 1KWMA 4KOVA 2R98A 4A32A 3TFYA 2ZEEA 2IJZA 1Q7LA 2OZHA 3B7IA 3FXTA 4NJRA 3TT2A 1XBUA 1ELMP 4NXYA 2HC9A 1A2ZA 1Y0YA 1YW4A 1ZLHA 4F9UA 3GYAA 1M4GA 2C6PA 2YNCC 3BXMA 4UF4A 4A33A 4C7IA 1HDQA 3IIBA 4MRIA 3EC4A 3WT4A 4GXHA 4OAEA 4CYNA 2AFWA 3D7DA 4KSFA 5F48A 3VWEA 3MRUA 5G21A 4MHYA 4RS2A 5A28A 2HB6A 2KCWA 1YSJA 3F8KA 1H8LA 3DR8A 3KZWA 4BBHA 4FWUA 4CYOA 2JDDA 3R9GA 1IYLA 2AFZA 4GM5A 1HDUA 4Y49B 3PRTA 1X10A 1RXTA 3D7FA 3S6KA 2IQ6A 1XOVA 4KUAA 4UIBA 4P4EA 1YX0A 3PP9A 2PE3A 4UCMA 3NH4A 2OR4A 4CRZB 4AVBA 1ZO0A 4I49A 4B11A 2AFMA 4ZY1A 3DSBA 4LQGA 4OKOA 3IEHA 5IV0A 1AUGA 2DXQA 2GIVA 4CPAA 2CNMA 3KHXA 5GCNA 2G3AA 4YRHA 1ZG9A 3D66A 1YR0A 3QAHA 4G1PA 3V38A 1LAPA 4UEEA 4KORA 4E2AA 2ANPA 2OB0A 1YLOA 2ZW4A 2PJ1A 2OZUA 3DGVA 3SXOA 1RO5A 3GY9A 4FD4A 4WWVA 2P6EA 2Q04A 4R57A 4NGNA 1CP6A 4NJQA 4R8FA 5I4MA 2FL4A 2G9DA 4M6GA 3W6SA 3LACA 4P44A 2F8HA 1CX8A 2DPSA 5C82A 5JH9A 3ISXA 4MCQA 2FE7A 3B8GA 3GLJA 4KOXA 4R87A 1JQGA 2ZELA 3EY5A 2C6GA 3D7HA 5AG6A 2CTCA 5EMIA 3B3CA 1XEBA 1FY7A 1XF8A 5J8CA 4PPZA 1KUYA 2ARHA 1ZG7A 1PU9A 2REEA 1R57A 3OWCA 5K8MA 5ISVA 1BAVA 3SI0A 3T9YA 3WABA 4AB7A 2ZXVA 4F6AA 2ZOGA 4FUUA 2J8MA 4K3NA 4JXRA 4LUAA 4OIWA 4F8ZA 2ZENA 3KQXA 2K5TA 2VXKA 1YW6A 4RUHA 1S5KA 4E0AA 3S6FA 2FVGA 2CNTA 3QNVA 4H6UA 1BLLE 4CGLA 2AFUA 2GANA 3GKRA 2PIZA 1UFHA 3SXNA 2ATRA 3D67A 5F46A 4Q38A 4HPSA 1XE4A 4CYPA 1VIXA 1Q2YA 4PK3A 5H86A 1KZFA 3B2YA 2PCUA 4A39A 5I0CA 3DR6A 2PJ5A 4JD6A 3EFAA 3G3SA 1R43A 1WWZA 2O53A 2PJ7A 2V8DA 4JZ0A 3PB4X 3TE4A 3S6HA 3TOBA 4UCNA 3V8IA 4A31A 4CAFA 3QAYA 2F7VA 4KUBA 4YGOA 4NGTA 4ONUA 3KGQA 1CPSA 4X2TA 3KASA 3CPAA 5ELYA 4MHZA 2CTBA 5H84A 4NGQA 4LX9A 1WK4A 3R9FA 3P2FA 4QB9A 1F2OA 3T90A 2PJ8A 2VEZA 4M3SA 3I1UA 4W9YA 1JWQA 3FVLA 4P4JA 4UFWA 3HUVA 5FVJA 4NCZA 1NMTA 3GUXA 2P0WA 2Q4YA 1PYTB 1CBXA 4NEXA 4X5KA 2P6FA 3CT9A 4A95A 2CIJA 4EVYA 4AVCA 3H8FA 1LCPA 2VBQA 2Z3PA 4OP4A 4WJBA 3I3GA 4UWJA 4UEFA 3KHZA 4FBEA 4ZYQA 2JDCA 2RC4A 4U5YA 1P0HA 3NFZA 4UBRA 3EO4A 2B5GA 3DNSA 1ARLA 4OC1A 1BO4A 5DWNA 2QJ8A 4KZTA 4E8OA 1TXRA 3SJEA 3VH9A 3CPXA 4JJXA 3PB6X 5LRKA 3PGPA 1Y9KA 4OC0A 3TOAA 4OC5A 5D8NA 3FMCA 3FEDA 3LD2A 4R9MA 1ZG8A 2EK9A 2OH1A 3BJ7A 4OMEA 4XPKA 3PZJA 2Q7SA 2J9AA 4JLYA 3JTKA 5EBVA 2BCOA 2NMTA 4MCPA 1QQ9A 4L89A 4KOWA 5KTCA 4CS0B 3TO7A 3IFEA 2Z3KA 2EK8A 1KUXA 2ZEFA 3H8GA 3CXQA 2ZOFA 2B4DA 1VHSA 5CNPA 2VQYA 1V0CA 3DDDA 4TNUA 3IJ3A 1AMPA 1OZPA 1QSOA 3N7ZA 6CPAA 5HVFA 3ZJ0A 5F09A 4ZBGA 1U6MA 2B3VA 3MN8A 4QC6A 1ZLIA 4KOTA 2FT0A 1MK4A 1R3NA 2B4BA 2QYVA 4J3GA 1IYKA 4ZX9A 1CPXA 4DNCA 3SI1A 5HVHA 2Z10A 1YK3A 4KS9A 4MY3A 4NF1A 4F0YA 1TKFA 2RB7A 4M85A 3KR5A 4MFPA 3SJGA 1Z8TA 3WC7A 2V77A 2A4NA 1AYEA 4KOUA 5LRJA 2VL1A 2ZEPA 2JEVA 2EO8A 1BOBA 2AFSA 2REFA 4BMHA 2H5MA 4B5PA 3B3WA 3FEEA 4UA3A 4HNWB 3PB7X 2JLMA 2Z3NA 1MJAA 4OADA 5CPAA 2ZEDA 2BEIA 1Y0RA 2G3TA 3BI1A 5AG4A 1Z2LA 3ZZIA 3UY5A 1RTQA 2J8NA 1BPMA 4MFKA 1CP7A 2PJCA 4P4IA 2FCKA 4P6YA 2HV2A 1Z8XA 5JGFA 3SI2A 4KOSA 4NGMA 3LMSA 1Y9WA 3RAMA 4A2ZA 3GIUA 4UFVA 5IB9A 1ELLP 2GLJA 2OU2A 2PJ6A 2PR8A 4II9A 1S7LA 3ISZA 4MFLA 2AE6A 5G1ZA 3W91A 1M4IA 3IU2A 1I12A 2VI7A 4GS4A 1NE9A 4M6IA 5LYDA 3D2MA 2Q51A 4ORFA 3R95A 2JBKA 2R8VA 2VZZA 4B13A 4MY0A 3IWGA 2V8HA 4H89A 1PCAA 5F49A 4AVAA 3CXSA 4P4DA 3TO9A 2VZYA 3WR7A 4MFQA 1IGBA 2C27A 4NFRA 1TKJA 3NE8A 1B6BA 1TF9A 2BSWA 2PJ3A 4OC2A 4PV6A 3PBEA 4XPDC 2V8VA 1QMUA 3WC6A 4KVXA 4R6TA 3B3SA 2AJ6A 3C26A 2PRQA 5JPHA 1MJBA 3FRMA 2WPWA 2BO9A 2ZEHA 3FF3A 1XRYA 2FSRA 2HQYA 2EBJA 4YU9A 4CAEA 1IIDA 5G20A 3D8PA 3LODA 3WC5A 2R7HA 1M4LA 2OZGA 2V8GA 4MFZA 4KSAA 1SQHA 4AXVA 2PC1A 4FD6A 5AGEA 2BOAA 2I00A 5AG5A 3BHXA 3GB0A 2BUEA 4JWPA 4PXDA 4R3LA 3HLPA 4HNXB 1QSTA 2B4DB 1YLEA 2Z3OA 1MJ9A 3S9LA 1N71A 2PJBA 3IGRA 2PJAA 2X7BA 2EUIA 4XNHC 3BI0A 4OC4A 4F0XA 1LRZA 2DEAA 3N5FA 5HH1A 4C2XA 2D4OA 2C1CA 4CAXA 4UIAA 4QBJA 3BLNA 2ZEOA 4MMOA 1VHEA 1YGHA 3D68A 3NA6A 4MCRA 3TX8A 2Z3MA 4DJLA 3CXPA 3LWUA 1M1DA 1YQEA 5K8NA 3SHPA 4K30A 4FAIA 3S6GA 2YNCA 2ZEGA 3I9SA 1Z8WA 4IK2A 1S7FA 2I79A 2JEWA 1P4NA 5THWA 4ZY0A 3A9LA 1M4DA 4XPDB 5D29A 2FXFA 4BINA 1QSMA 4QUSA 3KR4A 4OC3A 2WYRA 2B3UA 2P6GA 2QVPA 4UFXA 5IX3A 5KTDA 1TIQA 4B14A 4X3RA 5E96A 5JQ4A 2ZEMA 3FX6A 2POKA 3H4QA 4KVME 1XMTA 5BWAB 3FJUA 4R76A 5CBMA 2WPXA 4U9ZA 1IICA 3FIXA 4MJ8A 3EXNA 7CPAA 2EVNA 1DE4C 3VATA 2B58A 5LRGA 4MXUA 3RO0A 4ZI6A 1GYTA 2EWBA 1FT7A 1X12A 4CGNA 4EFDA 1HEEA 4CGOA 5JM6A 2GU2A 3D3SA 1Q2CA 2ABZA 4JYWA 1XFOA 4KSIA 2F5IA 2OOTA 4RN7A 1EE3P 5HXDA 1CJWA 1GHEA 1ON0A 3E0KA 2JBJA 4XNHB 5DWMA 1QSNA 1LANA 4CGMA 3B3VA 1NSLA 4EMEA 3R1KA 2Q44A 2PJ0A 2PVWA 4B10A 4FD7A 5HVGA 1IB1E 3R96A 3NH8A 1Z9UA 1IOIA 5K8OA 4C7HA 4A94A 2Y0MA 1KUVA 2HUZA 2Z0ZA 3P2HA 1F2PA 4P10A 3L2NA 3PB9X 2CF4A 2YNDA 3KI9A 2ODFA 4P4FA 1F57A 4C68A 3PBBA 2PSWA 1CG2A 3JRUA 4B5OA 2R1IA 3NH5A 2BL1A 5KTAA 2Q0YA 1BPNA 4MCSA 4PQAA 2ZW6A 1K4JA 2IL4A 1XJOA 3TO6A 2Z11A 4Q36A 1VKCA 1Y7RA 4MHNA 4CGPA 3PB8X 5G22A 3JVNA 4U9YA 1I21A 2GFQA 2PVVA 1UWYA 1YVOA 4RI1A 5LYIA 2PR1A 3TTHA 4X8IA 4NGPA 2NYQA 2PIYA 4YFJA 3SJXA 3IWEA 4HKFA 2Q7BA 3F0AA 1YMEA 5HMNA 4NSQA 1IY7A 4KVOE 4P4BA 3NE7A 1IU8A 2DPTA 2GLFA 3CDXA 2AFOA 3DLJA 1OBRA 2ZW5A 4H6ZA 1M44A 2PJ2A 4MBUA 4PXBA 4A38A 3PEIA 2PRBA 1I1DA 2Q4VA 4UWIA 1Q2DA
chains in the Genus database with same CATH topology
4PK2A 4XPLA 3R9EA 5A27A 2FIAA 4AG7A 3BJ8A 4KLWA 4HNYB 2YGWA 2WUUA 3MGDA 2B5GB 4C2ZA 4KLVA 2GE3A 3F5BA 3FBUA 1S3ZA 2PDOA 2QECA 3D2PA 1S60A 3JUWA 3TCVA 4AG9A 5AG7A 1L0CA 2CNSA 1S7NA 2G0BA 2QIRA 1J4JA 4KOYA 2ZPAA 5IB0A 4UCPA 3G8WA 2WSAA 4PSXA 3FYNA 2O28A 2FS5A 2CY2A 1XIXA 2YNEA 2J8RA 3FB3A 4CRYB 3QB8A 1PUAA 5J8FA 1Z4EA 2FIWA 4IUSA 4B12A 4CAVA 4FD5A 1CM0A 4Y49C 4PSWA 3RYOA 4B5PB 5C88A 5EC4A 4ZGYB 2CXAA 3FNCA 3KKWA 1B87A 2PQ8A 1S7KA 4R3KA 5F47A 3K9UA 4MHDA 4CYQA 3H5ZA 4A30A 2QMLA 4L8AA 4MI4A 3W6XA 1Z4RA 1QSRA 4IF5A 4MFJA 4OLLA 1YVKA 4JXQA 4QVTA 2Z3LA 2ZW7A 2D4PA 3VWDA 4C2YA 4CAWA 1YREA 3IU1A 4KOVA 2R98A 4A32A 3TFYA 2OZHA 3FXTA 3TT2A 4NXYA 3GYAA 1M4GA 2YNCC 4C7IA 4A33A 3EC4A 4OAEA 4CYNA 5F48A 4KSFA 3VWEA 5G21A 4RS2A 5A28A 2KCWA 3F8KA 3DR8A 4BBHA 4CYOA 2JDDA 3R9GA 1IYLA 4Y49B 1RXTA 3S6KA 4KUAA 1YX0A 3PP9A 4UCMA 4CRZB 4AVBA 1ZO0A 4I49A 4B11A 3DSBA 5IV0A 2DXQA 2GIVA 2CNMA 5GCNA 2G3AA 4YRHA 1YR0A 3QAHA 4E2AA 4KORA 2OB0A 2ZW4A 2OZUA 3SXOA 1RO5A 3GY9A 4FD4A 2P6EA 2Q04A 4R57A 2FL4A 5C82A 3W6SA 2DPSA 2FE7A 3B8GA 4KOXA 4R87A 3EY5A 5AG6A 1XEBA 1FY7A 1XF8A 5J8CA 1KUYA 2ARHA 1PU9A 2REEA 1R57A 3OWCA 5ISVA 3T9YA 4AB7A 2ZXVA 4F6AA 2J8MA 4JXRA 4LUAA 2K5TA 2VXKA 1S5KA 4E0AA 3S6FA 2CNTA 4H6UA 4CGLA 2GANA 3GKRA 1UFHA 3SXNA 2ATRA 5F46A 4Q38A 4CYPA 1XE4A 5H86A 1Q2YA 4PK3A 1KZFA 5I0CA 3DR6A 4JD6A 3EFAA 3G3SA 1WWZA 3TE4A 3S6HA 3TOBA 4UCNA 3V8IA 4A31A 4CAFA 4KUBA 4YGOA 4ONUA 5H84A 4LX9A 1WK4A 3R9FA 3P2FA 4QB9A 3T90A 2VEZA 4M3SA 4UFWA 5FVJA 4NCZA 1NMTA 2P0WA 2Q4YA 4A95A 4X5KA 4NEXA 2P6FA 4EVYA 4AVCA 2VBQA 2Z3PA 3I3GA 4UWJA 2JDCA 2RC4A 4U5YA 1P0HA 4UBRA 3EO4A 2B5GA 3DNSA 1BO4A 5DWNA 4KZTA 4E8OA 4JJXA 3PGPA 1Y9KA 3TOAA 3LD2A 4R9MA 2OH1A 3BJ7A 4XPKA 3PZJA 4JLYA 5EBVA 3JTKA 2NMTA 4L89A 5KTCA 4KOWA 4CS0B 3TO7A 2Z3KA 1KUXA 3CXQA 2B4DA 1VHSA 5CNPA 2VQYA 1V0CA 3DDDA 1OZPA 1QSOA 3N7ZA 3ZJ0A 4ZBGA 1U6MA 2B3VA 4QC6A 4KOTA 2FT0A 1MK4A 2B4BA 4J3GA 1IYKA 4DNCA 2Z10A 1YK3A 4KS9A 4MY3A 4NF1A 4F0YA 4M85A 4MFPA 2A4NA 4KOUA 2JEVA 1BOBA 2REFA 4BMHA 2H5MA 4B5PA 4UA3A 4HNWB 2JLMA 2Z3NA 1MJAA 4OADA 2BEIA 2G3TA 5AG4A 3ZZIA 3UY5A 2J8NA 4MFKA 2FCKA 2HV2A 4KOSA 1Y9WA 4A2ZA 4UFVA 2OU2A 2PR8A 4II9A 1S7LA 4MFLA 2AE6A 5G1ZA 3W91A 1M4IA 3IU2A 1I12A 2VI7A 4GS4A 1NE9A 3D2MA 4ORFA 3R95A 2R8VA 2VZZA 4B13A 4MY0A 3IWGA 4H89A 5F49A 4AVAA 3CXSA 3TO9A 2VZYA 3WR7A 4MFQA 2C27A 1B6BA 2BSWA 4PV6A 4XPDC 4KVXA 2AJ6A 3C26A 5JPHA 1MJBA 3FRMA 2WPWA 2FSRA 2HQYA 4CAEA 1IIDA 5G20A 3D8PA 3LODA 2R7HA 2OZGA 4MFZA 4KSAA 1SQHA 2PC1A 4FD6A 5AGEA 2I00A 5AG5A 4JWPA 2BUEA 4R3LA 4HNXB 1QSTA 2B4DB 1YLEA 2Z3OA 1MJ9A 1N71A 3IGRA 2X7BA 2EUIA 4XNHC 4F0XA 1LRZA 5HH1A 4C2XA 2D4OA 4CAXA 4QBJA 3BLNA 1YGHA 2Z3MA 3CXPA 1M1DA 3SHPA 4K30A 3S6GA 2YNCA 3I9SA 1S7FA 2I79A 1P4NA 3A9LA 1M4DA 4XPDB 2FXFA 1QSMA 4QUSA 2B3UA 2P6GA 4UFXA 5KTDA 5IX3A 1TIQA 4B14A 5E96A 5JQ4A 3H4QA 4KVME 1XMTA 5BWAB 2WPXA 4U9ZA 1IICA 3FIXA 4MJ8A 3EXNA 2EVNA 2B58A 4CGNA 4CGOA 3D3SA 1Q2CA 2F5IA 1CJWA 1GHEA 1ON0A 3E0KA 4XNHB 5DWMA 1QSNA 4CGMA 1NSLA 3R1KA 2Q44A 4B10A 4FD7A 1IB1E 3R96A 1Z9UA 4C7HA 2Y0MA 1KUVA 2HUZA 2Z0ZA 3P2HA 2YNDA 4C68A 2PSWA 4B5OA 2R1IA 2BL1A 5KTAA 2Q0YA 2ZW6A 1K4JA 2IL4A 3TO6A 2Z11A 4Q36A 1VKCA 1Y7RA 4CGPA 5G22A 3JVNA 4U9YA 1I21A 4RI1A 1YVOA 3TTHA 2PR1A 4YFJA 3IWEA 4HKFA 2Q7BA 3F0AA 5HMNA 4NSQA 4KVOE 3NE7A 2DPTA 2ZW5A 4H6ZA 1M44A 4MBUA 2PRBA 1I1DA 2Q4VA 4UWIA 1Q2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK2 A;  4XPL A;  3R9E A;  2FIA A;  4AG7 A;  3BJ8 A;  4KLW A;  4HNY B;  3MGD A;  2B5G B;  4KLV A;  2GE3 A;  3F5B A;  3FBU A;  1S3Z A;  2PDO A;  2QEC A;  3D2P A;  1S60 A;  3JUW A;  3TCV A;  4AG9 A;  1L0C A;  2CNS A;  1S7N A;  2G0B A;  2QIR A;  1J4J A;  4KOY A;  2ZPA A;  5IB0 A;  3G8W A;  4PSX A;  3FYN A;  2O28 A;  2FS5 A;  2CY2 A;  1XIX A;  2J8R A;  3FB3 A;  4CRY B;  3QB8 A;  1PUA A;  5J8F A;  1Z4E A;  2FIW A;  4IUS A;  4CAV A;  4FD5 A;  1CM0 A;  4Y49 C;  4PSW A;  3RYO A;  4B5P B;  5C88 A;  5EC4 A;  3FNC A;  3KKW A;  1B87 A;  2PQ8 A;  1S7K A;  4R3K A;  5F47 A;  3K9U A;  4MHD A;  2QML A;  4L8A A;  4MI4 A;  3W6X A;  1Z4R A;  1QSR A;  4IF5 A;  4OLL A;  1YVK A;  4JXQ A;  4QVT A;  2ZW7 A;  2D4P A;  3VWD A;  4CAW A;  1YRE A;  4KOV A;  2R98 A;  3TFY A;  2OZH A;  3FXT A;  3TT2 A;  4NXY A;  3GYA A;  1M4G A;  3EC4 A;  4OAE A;  5F48 A;  3VWE A;  4RS2 A;  2KCW A;  3F8K A;  3DR8 A;  2JDD A;  3R9G A;  1IYL A;  4Y49 B;  1RXT A;  3S6K A;  4KUA A;  1YX0 A;  3PP9 A;  4CRZ B;  4AVB A;  4I49 A;  3DSB A;  5IV0 A;  2DXQ A;  2GIV A;  2CNM A;  5GCN A;  2G3A A;  4YRH A;  1YR0 A;  3QAH A;  4E2A A;  4KOR A;  2OB0 A;  2ZW4 A;  2OZU A;  3SXO A;  1RO5 A;  3GY9 A;  4FD4 A;  2P6E A;  2Q04 A;  4R57 A;  2FL4 A;  5C82 A;  3W6S A;  2FE7 A;  3B8G A;  4KOX A;  4R87 A;  3EY5 A;  1XEB A;  1FY7 A;  1XF8 A;  5J8C A;  1KUY A;  2ARH A;  1PU9 A;  2REE A;  1R57 A;  3OWC A;  5ISV A;  3T9Y A;  4AB7 A;  2ZXV A;  4F6A A;  2J8M A;  4JXR A;  4LUA A;  2K5T A;  2VXK A;  1S5K A;  4E0A A;  3S6F A;  2CNT A;  4H6U A;  2GAN A;  3GKR A;  1UFH A;  3SXN A;  2ATR A;  5F46 A;  1XE4 A;  5H86 A;  1Q2Y A;  4PK3 A;  1KZF A;  5I0C A;  3DR6 A;  4JD6 A;  3EFA A;  3G3S A;  1WWZ A;  3TE4 A;  3S6H A;  3TOB A;  3V8I A;  4KUB A;  4YGO A;  4ONU A;  5H84 A;  4LX9 A;  1WK4 A;  3R9F A;  3P2F A;  4QB9 A;  3T90 A;  2VEZ A;  4M3S A;  5FVJ A;  4NCZ A;  1NMT A;  2P0W A;  2Q4Y A;  4X5K A;  4NEX A;  2P6F A;  4EVY A;  4AVC A;  2VBQ A;  3I3G A;  4UWJ A;  2JDC A;  2RC4 A;  4U5Y A;  1P0H A;  4UBR A;  3EO4 A;  2B5G A;  3DNS A;  1BO4 A;  5DWN A;  4KZT A;  4E8O A;  4JJX A;  3PGP A;  1Y9K A;  3TOA A;  3LD2 A;  4R9M A;  2OH1 A;  3BJ7 A;  4XPK A;  3PZJ A;  4JLY A;  5EBV A;  2NMT A;  4L89 A;  5KTC A;  4KOW A;  4CS0 B;  3TO7 A;  1KUX A;  3CXQ A;  2B4D A;  1VHS A;  5CNP A;  2VQY A;  1V0C A;  3DDD A;  1OZP A;  1QSO A;  3N7Z A;  3ZJ0 A;  4ZBG A;  1U6M A;  2B3V A;  4QC6 A;  4KOT A;  2FT0 A;  1MK4 A;  2B4B A;  4J3G A;  1IYK A;  4DNC A;  2Z10 A;  1YK3 A;  4MY3 A;  4NF1 A;  4F0Y A;  4M85 A;  2A4N A;  4KOU A;  2JEV A;  1BOB A;  2REF A;  4BMH A;  2H5M A;  4B5P A;  4UA3 A;  4HNW B;  2JLM A;  1MJA A;  4OAD A;  2BEI A;  2G3T A;  3ZZI A;  3UY5 A;  2J8N A;  2FCK A;  2HV2 A;  4KOS A;  1Y9W A;  2OU2 A;  2PR8 A;  4II9 A;  1S7L A;  2AE6 A;  3W91 A;  1M4I A;  1I12 A;  2VI7 A;  4GS4 A;  1NE9 A;  3D2M A;  4ORF A;  3R95 A;  2R8V A;  2VZZ A;  4MY0 A;  3IWG A;  4H89 A;  5F49 A;  4AVA A;  3CXS A;  3TO9 A;  2VZY A;  3WR7 A;  2C27 A;  1B6B A;  2BSW A;  4PV6 A;  4XPD C;  4KVX A;  2AJ6 A;  3C26 A;  5JPH A;  1MJB A;  3FRM A;  2WPW A;  2FSR A;  2HQY A;  1IID A;  3D8P A;  3LOD A;  2R7H A;  2OZG A;  1SQH A;  2PC1 A;  4FD6 A;  2I00 A;  4JWP A;  2BUE A;  4R3L A;  4HNX B;  1QST A;  2B4D B;  1YLE A;  1MJ9 A;  1N71 A;  3IGR A;  2X7B A;  2EUI A;  4XNH C;  1LRZ A;  5HH1 A;  2D4O A;  4CAX A;  4QBJ A;  3BLN A;  1YGH A;  3CXP A;  1M1D A;  3SHP A;  4K30 A;  3S6G A;  3I9S A;  1S7F A;  2I79 A;  1P4N A;  1M4D A;  4XPD B;  2FXF A;  1QSM A;  4QUS A;  2B3U A;  2P6G A;  5KTD A;  5IX3 A;  1TIQ A;  5E96 A;  5JQ4 A;  3H4Q A;  4KVM E;  1XMT A;  2WPX A;  4U9Z A;  1IIC A;  3FIX A;  4MJ8 A;  3EXN A;  2EVN A;  2B58 A;  3D3S A;  1Q2C A;  2F5I A;  1CJW A;  1GHE A;  1ON0 A;  3E0K A;  4XNH B;  5DWM A;  1QSN A;  1NSL A;  3R1K A;  2Q44 A;  4FD7 A;  1IB1 E;  3R96 A;  1Z9U A;  2Y0M A;  1KUV A;  2HUZ A;  2Z0Z A;  3P2H A;  2PSW A;  4B5O A;  2R1I A;  2BL1 A;  5KTA A;  2Q0Y A;  2ZW6 A;  1K4J A;  2IL4 A;  3TO6 A;  2Z11 A;  1VKC A;  1Y7R A;  3JVN A;  4U9Y A;  1I21 A;  4RI1 A;  1YVO A;  3TTH A;  2PR1 A;  4YFJ A;  2Q7B A;  4HKF A;  3F0A A;  5HMN A;  4NSQ A;  4KVO E;  3NE7 A;  2ZW5 A;  4H6Z A;  1M44 A;  4MBU A;  2PRB A;  1I1D A;  2Q4V A;  4UWI A;  1Q2D A; 
#chains in the Genus database with same CATH topology
 4PK2 A;  4LQ6 A;  3V7Z A;  3RBU A;  4XPL A;  2O4H A;  2Q4Z A;  3R9E A;  5A27 A;  4P45 A;  2C6C A;  2FIA A;  4AG7 A;  3PFO A;  3BJ8 A;  4KLW A;  2Q43 A;  4HNY B;  1Z5R A;  2YGW A;  2WUU A;  3MGD A;  2B5G B;  4PXC A;  4C2Z A;  1NSA A;  4KLV A;  1VGY A;  1Z8L A;  4NGR A;  2GE3 A;  3F5B A;  4OID A;  3FBU A;  1S3Z A;  2PDO A;  2QEC A;  3D2P A;  3FH4 A;  4DUK A;  1S60 A;  3D7G A;  3JUW A;  3TCV A;  4AG9 A;  3K2K A;  5AG7 A;  4IHM A;  5J1Q A;  3KQZ A;  1L0C A;  2WZN A;  4B6Z A;  3RZA A;  4IAV A;  2CNS A;  1Y7E A;  1S7N A;  4EWT A;  3H8E A;  2G0B A;  4ZX8 A;  4TWE A;  2QIR A;  1J4J A;  3CZX A;  4M6H A;  3FEC A;  4ZY2 A;  4KOY A;  1ARM A;  2ZPA A;  1IOF A;  1VHO A;  1FNO A;  4PXE A;  4UCP A;  5IB0 A;  3G8W A;  3IWW A;  4Z65 A;  2WSA A;  4PSX A;  3FYN A;  3RNZ A;  3K9T A;  2I3C A;  3PFE A;  2PJ9 A;  5LYF A;  4ONW A;  3SJF A;  2O28 A;  2IMO A;  4F9V A;  4A37 A;  2FS5 A;  2CY2 A;  1XIX A;  2YNE A;  2XEI A;  2J8R A;  3FB3 A;  4MHP A;  4CRY B;  5DS0 A;  1XMB A;  3KL9 A;  1TF8 A;  3QB8 A;  3IC1 A;  3S9N A;  1PUA A;  5J8F A;  2XEG A;  4NGS A;  1Z4E A;  2AFX A;  2FIW A;  4IUS A;  4UEZ A;  3VAR A;  4B12 A;  4CAV A;  4FD5 A;  1CM0 A;  4Y49 C;  4PSW A;  3RYO A;  4B5P B;  5C88 A;  5EC4 A;  2DF5 A;  4BD9 A;  8CPA A;  1TKH A;  4H2K A;  3S9M A;  4ZGY B;  2CXA A;  2NSM A;  2RFH A;  3D4U A;  3FNC A;  1LOK A;  3KKW A;  1B87 A;  2PQ8 A;  4O23 A;  1S7K A;  1LAM A;  4R3K A;  5F47 A;  3K9U A;  2GRE A;  4MHD A;  4CYQ A;  3H5Z A;  4A30 A;  2QML A;  1DTD A;  4L8A A;  2PJ4 A;  4DYO A;  4MI4 A;  5LYL A;  5K8P A;  2XEJ A;  4YWY A;  3W6X A;  1Z4R A;  1QSR A;  2XEF A;  4IF5 A;  4MFJ A;  3TC8 A;  4OLL A;  1YVK A;  4Q7A A;  4R7M A;  1LFW A;  4JXQ A;  4QVT A;  2Z3L A;  2ZW7 A;  2D4P A;  3B35 A;  3VWD A;  4C2Y A;  4CAW A;  1YRE A;  3IU1 A;  3IO1 A;  3T8W A;  3B3T A;  1KWM A;  4KOV A;  2R98 A;  4A32 A;  3TFY A;  2ZEE A;  2IJZ A;  1Q7L A;  2OZH A;  3B7I A;  3FXT A;  4NJR A;  3TT2 A;  1XBU A;  1ELM P;  4NXY A;  2HC9 A;  1A2Z A;  1Y0Y A;  1YW4 A;  1ZLH A;  4F9U A;  3GYA A;  1M4G A;  2C6P A;  2YNC C;  3BXM A;  4UF4 A;  4A33 A;  4C7I A;  1HDQ A;  3IIB A;  4MRI A;  3EC4 A;  3WT4 A;  4GXH A;  4OAE A;  4CYN A;  2AFW A;  3D7D A;  4KSF A;  5F48 A;  3VWE A;  3MRU A;  5G21 A;  4MHY A;  4RS2 A;  5A28 A;  2HB6 A;  2KCW A;  1YSJ A;  3F8K A;  1H8L A;  3DR8 A;  3KZW A;  4BBH A;  4FWU A;  4CYO A;  2JDD A;  3R9G A;  1IYL A;  2AFZ A;  4GM5 A;  1HDU A;  4Y49 B;  3PRT A;  1X10 A;  1RXT A;  3D7F A;  3S6K A;  2IQ6 A;  1XOV A;  4KUA A;  4UIB A;  4P4E A;  1YX0 A;  3PP9 A;  2PE3 A;  4UCM A;  3NH4 A;  2OR4 A;  4CRZ B;  4AVB A;  1ZO0 A;  4I49 A;  4B11 A;  2AFM A;  4ZY1 A;  3DSB A;  4LQG A;  4OKO A;  3IEH A;  5IV0 A;  1AUG A;  2DXQ A;  2GIV A;  4CPA A;  2CNM A;  3KHX A;  5GCN A;  2G3A A;  4YRH A;  1ZG9 A;  3D66 A;  1YR0 A;  3QAH A;  4G1P A;  3V38 A;  1LAP A;  4UEE A;  4KOR A;  4E2A A;  2ANP A;  2OB0 A;  1YLO A;  2ZW4 A;  2PJ1 A;  2OZU A;  3DGV A;  3SXO A;  1RO5 A;  3GY9 A;  4FD4 A;  4WWV A;  2P6E A;  2Q04 A;  4R57 A;  4NGN A;  1CP6 A;  4NJQ A;  4R8F A;  5I4M A;  2FL4 A;  2G9D A;  4M6G A;  3W6S A;  3LAC A;  4P44 A;  2F8H A;  1CX8 A;  2DPS A;  5C82 A;  5JH9 A;  3ISX A;  4MCQ A;  2FE7 A;  3B8G A;  3GLJ A;  4KOX A;  4R87 A;  1JQG A;  2ZEL A;  3EY5 A;  2C6G A;  3D7H A;  5AG6 A;  2CTC A;  5EMI A;  3B3C A;  1XEB A;  1FY7 A;  1XF8 A;  5J8C A;  4PPZ A;  1KUY A;  2ARH A;  1ZG7 A;  1PU9 A;  2REE A;  1R57 A;  3OWC A;  5K8M A;  5ISV A;  1BAV A;  3SI0 A;  3T9Y A;  3WAB A;  4AB7 A;  2ZXV A;  4F6A A;  2ZOG A;  4FUU A;  2J8M A;  4K3N A;  4JXR A;  4LUA A;  4OIW A;  4F8Z A;  2ZEN A;  3KQX A;  2K5T A;  2VXK A;  1YW6 A;  4RUH A;  1S5K A;  4E0A A;  3S6F A;  2FVG A;  2CNT A;  3QNV A;  4H6U A;  1BLL E;  4CGL A;  2AFU A;  2GAN A;  3GKR A;  2PIZ A;  1UFH A;  3SXN A;  2ATR A;  3D67 A;  5F46 A;  4Q38 A;  4HPS A;  1XE4 A;  4CYP A;  1VIX A;  1Q2Y A;  4PK3 A;  5H86 A;  1KZF A;  3B2Y A;  2PCU A;  4A39 A;  5I0C A;  3DR6 A;  2PJ5 A;  4JD6 A;  3EFA A;  3G3S A;  1R43 A;  1WWZ A;  2O53 A;  2PJ7 A;  2V8D A;  4JZ0 A;  3PB4 X;  3TE4 A;  3S6H A;  3TOB A;  4UCN A;  3V8I A;  4A31 A;  4CAF A;  3QAY A;  2F7V A;  4KUB A;  4YGO A;  4NGT A;  4ONU A;  3KGQ A;  1CPS A;  4X2T A;  3KAS A;  3CPA A;  5ELY A;  4MHZ A;  2CTB A;  5H84 A;  4NGQ A;  4LX9 A;  1WK4 A;  3R9F A;  3P2F A;  4QB9 A;  1F2O A;  3T90 A;  2PJ8 A;  2VEZ A;  4M3S A;  3I1U A;  4W9Y A;  1JWQ A;  3FVL A;  4P4J A;  4UFW A;  3HUV A;  5FVJ A;  4NCZ A;  1NMT A;  3GUX A;  2P0W A;  2Q4Y A;  1PYT B;  1CBX A;  4NEX A;  4X5K A;  2P6F A;  3CT9 A;  4A95 A;  2CIJ A;  4EVY A;  4AVC A;  3H8F A;  1LCP A;  2VBQ A;  2Z3P A;  4OP4 A;  4WJB A;  3I3G A;  4UWJ A;  4UEF A;  3KHZ A;  4FBE A;  4ZYQ A;  2JDC A;  2RC4 A;  4U5Y A;  1P0H A;  3NFZ A;  4UBR A;  3EO4 A;  2B5G A;  3DNS A;  1ARL A;  4OC1 A;  1BO4 A;  5DWN A;  2QJ8 A;  4KZT A;  4E8O A;  1TXR A;  3SJE A;  3VH9 A;  3CPX A;  4JJX A;  3PB6 X;  5LRK A;  3PGP A;  1Y9K A;  4OC0 A;  3TOA A;  4OC5 A;  5D8N A;  3FMC A;  3FED A;  3LD2 A;  4R9M A;  1ZG8 A;  2EK9 A;  2OH1 A;  3BJ7 A;  4OME A;  4XPK A;  3PZJ A;  2Q7S A;  2J9A A;  4JLY A;  3JTK A;  5EBV A;  2BCO A;  2NMT A;  4MCP A;  1QQ9 A;  4L89 A;  4KOW A;  5KTC A;  4CS0 B;  3TO7 A;  3IFE A;  2Z3K A;  2EK8 A;  1KUX A;  2ZEF A;  3H8G A;  3CXQ A;  2ZOF A;  2B4D A;  1VHS A;  5CNP A;  2VQY A;  1V0C A;  3DDD A;  4TNU A;  3IJ3 A;  1AMP A;  1OZP A;  1QSO A;  3N7Z A;  6CPA A;  5HVF A;  3ZJ0 A;  5F09 A;  4ZBG A;  1U6M A;  2B3V A;  3MN8 A;  4QC6 A;  1ZLI A;  4KOT A;  2FT0 A;  1MK4 A;  1R3N A;  2B4B A;  2QYV A;  4J3G A;  1IYK A;  4ZX9 A;  1CPX A;  4DNC A;  3SI1 A;  5HVH A;  2Z10 A;  1YK3 A;  4KS9 A;  4MY3 A;  4NF1 A;  4F0Y A;  1TKF A;  2RB7 A;  4M85 A;  3KR5 A;  4MFP A;  3SJG A;  1Z8T A;  3WC7 A;  2V77 A;  2A4N A;  1AYE A;  4KOU A;  5LRJ A;  2VL1 A;  2ZEP A;  2JEV A;  2EO8 A;  1BOB A;  2AFS A;  2REF A;  4BMH A;  2H5M A;  4B5P A;  3B3W A;  3FEE A;  4UA3 A;  4HNW B;  3PB7 X;  2JLM A;  2Z3N A;  1MJA A;  4OAD A;  5CPA A;  2ZED A;  2BEI A;  1Y0R A;  2G3T A;  3BI1 A;  5AG4 A;  1Z2L A;  3ZZI A;  3UY5 A;  1RTQ A;  2J8N A;  1BPM A;  4MFK A;  1CP7 A;  2PJC A;  4P4I A;  2FCK A;  4P6Y A;  2HV2 A;  1Z8X A;  5JGF A;  3SI2 A;  4KOS A;  4NGM A;  3LMS A;  1Y9W A;  3RAM A;  4A2Z A;  3GIU A;  4UFV A;  5IB9 A;  1ELL P;  2GLJ A;  2OU2 A;  2PJ6 A;  2PR8 A;  4II9 A;  1S7L A;  3ISZ A;  4MFL A;  2AE6 A;  5G1Z A;  3W91 A;  1M4I A;  3IU2 A;  1I12 A;  2VI7 A;  4GS4 A;  1NE9 A;  4M6I A;  5LYD A;  3D2M A;  2Q51 A;  4ORF A;  3R95 A;  2JBK A;  2R8V A;  2VZZ A;  4B13 A;  4MY0 A;  3IWG A;  2V8H A;  4H89 A;  1PCA A;  5F49 A;  4AVA A;  3CXS A;  4P4D A;  3TO9 A;  2VZY A;  3WR7 A;  4MFQ A;  1IGB A;  2C27 A;  4NFR A;  1TKJ A;  3NE8 A;  1B6B A;  1TF9 A;  2BSW A;  2PJ3 A;  4OC2 A;  4PV6 A;  3PBE A;  4XPD C;  2V8V A;  1QMU A;  3WC6 A;  4KVX A;  4R6T A;  3B3S A;  2AJ6 A;  3C26 A;  2PRQ A;  5JPH A;  1MJB A;  3FRM A;  2WPW A;  2BO9 A;  2ZEH A;  3FF3 A;  1XRY A;  2FSR A;  2HQY A;  2EBJ A;  4YU9 A;  4CAE A;  1IID A;  5G20 A;  3D8P A;  3LOD A;  3WC5 A;  2R7H A;  1M4L A;  2OZG A;  2V8G A;  4MFZ A;  4KSA A;  1SQH A;  4AXV A;  2PC1 A;  4FD6 A;  5AGE A;  2BOA A;  2I00 A;  5AG5 A;  3BHX A;  3GB0 A;  2BUE A;  4JWP A;  4PXD A;  4R3L A;  3HLP A;  4HNX B;  1QST A;  2B4D B;  1YLE A;  2Z3O A;  1MJ9 A;  3S9L A;  1N71 A;  2PJB A;  3IGR A;  2PJA A;  2X7B A;  2EUI A;  4XNH C;  3BI0 A;  4OC4 A;  4F0X A;  1LRZ A;  2DEA A;  3N5F A;  5HH1 A;  4C2X A;  2D4O A;  2C1C A;  4CAX A;  4UIA A;  4QBJ A;  3BLN A;  2ZEO A;  4MMO A;  1VHE A;  1YGH A;  3D68 A;  3NA6 A;  4MCR A;  3TX8 A;  2Z3M A;  4DJL A;  3CXP A;  3LWU A;  1M1D A;  1YQE A;  5K8N A;  3SHP A;  4K30 A;  4FAI A;  3S6G A;  2YNC A;  2ZEG A;  3I9S A;  1Z8W A;  4IK2 A;  1S7F A;  2I79 A;  2JEW A;  1P4N A;  5THW A;  4ZY0 A;  3A9L A;  1M4D A;  4XPD B;  5D29 A;  2FXF A;  4BIN A;  1QSM A;  4QUS A;  3KR4 A;  4OC3 A;  2WYR A;  2B3U A;  2P6G A;  2QVP A;  4UFX A;  5IX3 A;  5KTD A;  1TIQ A;  4B14 A;  4X3R A;  5E96 A;  5JQ4 A;  2ZEM A;  3FX6 A;  2POK A;  3H4Q A;  4KVM E;  1XMT A;  5BWA B;  3FJU A;  4R76 A;  5CBM A;  2WPX A;  4U9Z A;  1IIC A;  3FIX A;  4MJ8 A;  3EXN A;  7CPA A;  2EVN A;  1DE4 C;  3VAT A;  2B58 A;  5LRG A;  4MXU A;  3RO0 A;  4ZI6 A;  1GYT A;  2EWB A;  1FT7 A;  1X12 A;  4CGN A;  4EFD A;  1HEE A;  4CGO A;  5JM6 A;  2GU2 A;  3D3S A;  1Q2C A;  2ABZ A;  4JYW A;  1XFO A;  4KSI A;  2F5I A;  2OOT A;  4RN7 A;  1EE3 P;  5HXD A;  1CJW A;  1GHE A;  1ON0 A;  3E0K A;  2JBJ A;  4XNH B;  5DWM A;  1QSN A;  1LAN A;  4CGM A;  3B3V A;  1NSL A;  4EME A;  3R1K A;  2Q44 A;  2PJ0 A;  2PVW A;  4B10 A;  4FD7 A;  5HVG A;  1IB1 E;  3R96 A;  3NH8 A;  1Z9U A;  1IOI A;  5K8O A;  4C7H A;  4A94 A;  2Y0M A;  1KUV A;  2HUZ A;  2Z0Z A;  3P2H A;  1F2P A;  4P10 A;  3L2N A;  3PB9 X;  2CF4 A;  2YND A;  3KI9 A;  2ODF A;  4P4F A;  1F57 A;  4C68 A;  3PBB A;  2PSW A;  1CG2 A;  3JRU A;  4B5O A;  2R1I A;  3NH5 A;  2BL1 A;  5KTA A;  2Q0Y A;  1BPN A;  4MCS A;  4PQA A;  2ZW6 A;  1K4J A;  2IL4 A;  1XJO A;  3TO6 A;  2Z11 A;  4Q36 A;  1VKC A;  1Y7R A;  4MHN A;  4CGP A;  3PB8 X;  5G22 A;  3JVN A;  4U9Y A;  1I21 A;  2GFQ A;  2PVV A;  1UWY A;  1YVO A;  4RI1 A;  5LYI A;  2PR1 A;  3TTH A;  4X8I A;  4NGP A;  2NYQ A;  2PIY A;  4YFJ A;  3SJX A;  3IWE A;  4HKF A;  2Q7B A;  3F0A A;  1YME A;  5HMN A;  4NSQ A;  1IY7 A;  4KVO E;  4P4B A;  3NE7 A;  1IU8 A;  2DPT A;  2GLF A;  3CDX A;  2AFO A;  3DLJ A;  1OBR A;  2ZW5 A;  4H6Z A;  1M44 A;  2PJ2 A;  4MBU A;  4PXB A;  4A38 A;  3PEI A;  2PRB A;  1I1D A;  2Q4V A;  4UWI A;  1Q2D A; 
#chains in the Genus database with same CATH homology
 4PK2 A;  4XPL A;  3R9E A;  5A27 A;  2FIA A;  4AG7 A;  3BJ8 A;  4KLW A;  4HNY B;  2YGW A;  2WUU A;  3MGD A;  2B5G B;  4C2Z A;  4KLV A;  2GE3 A;  3F5B A;  3FBU A;  1S3Z A;  2PDO A;  2QEC A;  3D2P A;  1S60 A;  3JUW A;  3TCV A;  4AG9 A;  5AG7 A;  1L0C A;  2CNS A;  1S7N A;  2G0B A;  2QIR A;  1J4J A;  4KOY A;  2ZPA A;  5IB0 A;  4UCP A;  3G8W A;  2WSA A;  4PSX A;  3FYN A;  2O28 A;  2FS5 A;  2CY2 A;  1XIX A;  2YNE A;  2J8R A;  3FB3 A;  4CRY B;  3QB8 A;  1PUA A;  5J8F A;  1Z4E A;  2FIW A;  4IUS A;  4B12 A;  4CAV A;  4FD5 A;  1CM0 A;  4Y49 C;  4PSW A;  3RYO A;  4B5P B;  5C88 A;  5EC4 A;  4ZGY B;  2CXA A;  3FNC A;  3KKW A;  1B87 A;  2PQ8 A;  1S7K A;  4R3K A;  5F47 A;  3K9U A;  4MHD A;  4CYQ A;  3H5Z A;  4A30 A;  2QML A;  4L8A A;  4MI4 A;  3W6X A;  1Z4R A;  1QSR A;  4IF5 A;  4MFJ A;  4OLL A;  1YVK A;  4JXQ A;  4QVT A;  2Z3L A;  2ZW7 A;  2D4P A;  3VWD A;  4C2Y A;  4CAW A;  1YRE A;  3IU1 A;  4KOV A;  2R98 A;  4A32 A;  3TFY A;  2OZH A;  3FXT A;  3TT2 A;  4NXY A;  3GYA A;  1M4G A;  2YNC C;  4C7I A;  4A33 A;  3EC4 A;  4OAE A;  4CYN A;  5F48 A;  4KSF A;  3VWE A;  5G21 A;  4RS2 A;  5A28 A;  2KCW A;  3F8K A;  3DR8 A;  4BBH A;  4CYO A;  2JDD A;  3R9G A;  1IYL A;  4Y49 B;  1RXT A;  3S6K A;  4KUA A;  1YX0 A;  3PP9 A;  4UCM A;  4CRZ B;  4AVB A;  1ZO0 A;  4I49 A;  4B11 A;  3DSB A;  5IV0 A;  2DXQ A;  2GIV A;  2CNM A;  5GCN A;  2G3A A;  4YRH A;  1YR0 A;  3QAH A;  4E2A A;  4KOR A;  2OB0 A;  2ZW4 A;  2OZU A;  3SXO A;  1RO5 A;  3GY9 A;  4FD4 A;  2P6E A;  2Q04 A;  4R57 A;  2FL4 A;  5C82 A;  3W6S A;  2DPS A;  2FE7 A;  3B8G A;  4KOX A;  4R87 A;  3EY5 A;  5AG6 A;  1XEB A;  1FY7 A;  1XF8 A;  5J8C A;  1KUY A;  2ARH A;  1PU9 A;  2REE A;  1R57 A;  3OWC A;  5ISV A;  3T9Y A;  4AB7 A;  2ZXV A;  4F6A A;  2J8M A;  4JXR A;  4LUA A;  2K5T A;  2VXK A;  1S5K A;  4E0A A;  3S6F A;  2CNT A;  4H6U A;  4CGL A;  2GAN A;  3GKR A;  1UFH A;  3SXN A;  2ATR A;  5F46 A;  4Q38 A;  4CYP A;  1XE4 A;  5H86 A;  1Q2Y A;  4PK3 A;  1KZF A;  5I0C A;  3DR6 A;  4JD6 A;  3EFA A;  3G3S A;  1WWZ A;  3TE4 A;  3S6H A;  3TOB A;  4UCN A;  3V8I A;  4A31 A;  4CAF A;  4KUB A;  4YGO A;  4ONU A;  5H84 A;  4LX9 A;  1WK4 A;  3R9F A;  3P2F A;  4QB9 A;  3T90 A;  2VEZ A;  4M3S A;  4UFW A;  5FVJ A;  4NCZ A;  1NMT A;  2P0W A;  2Q4Y A;  4A95 A;  4X5K A;  4NEX A;  2P6F A;  4EVY A;  4AVC A;  2VBQ A;  2Z3P A;  3I3G A;  4UWJ A;  2JDC A;  2RC4 A;  4U5Y A;  1P0H A;  4UBR A;  3EO4 A;  2B5G A;  3DNS A;  1BO4 A;  5DWN A;  4KZT A;  4E8O A;  4JJX A;  3PGP A;  1Y9K A;  3TOA A;  3LD2 A;  4R9M A;  2OH1 A;  3BJ7 A;  4XPK A;  3PZJ A;  4JLY A;  5EBV A;  3JTK A;  2NMT A;  4L89 A;  5KTC A;  4KOW A;  4CS0 B;  3TO7 A;  2Z3K A;  1KUX A;  3CXQ A;  2B4D A;  1VHS A;  5CNP A;  2VQY A;  1V0C A;  3DDD A;  1OZP A;  1QSO A;  3N7Z A;  3ZJ0 A;  4ZBG A;  1U6M A;  2B3V A;  4QC6 A;  4KOT A;  2FT0 A;  1MK4 A;  2B4B A;  4J3G A;  1IYK A;  4DNC A;  2Z10 A;  1YK3 A;  4KS9 A;  4MY3 A;  4NF1 A;  4F0Y A;  4M85 A;  4MFP A;  2A4N A;  4KOU A;  2JEV A;  1BOB A;  2REF A;  4BMH A;  2H5M A;  4B5P A;  4UA3 A;  4HNW B;  2JLM A;  2Z3N A;  1MJA A;  4OAD A;  2BEI A;  2G3T A;  5AG4 A;  3ZZI A;  3UY5 A;  2J8N A;  4MFK A;  2FCK A;  2HV2 A;  4KOS A;  1Y9W A;  4A2Z A;  4UFV A;  2OU2 A;  2PR8 A;  4II9 A;  1S7L A;  4MFL A;  2AE6 A;  5G1Z A;  3W91 A;  1M4I A;  3IU2 A;  1I12 A;  2VI7 A;  4GS4 A;  1NE9 A;  3D2M A;  4ORF A;  3R95 A;  2R8V A;  2VZZ A;  4B13 A;  4MY0 A;  3IWG A;  4H89 A;  5F49 A;  4AVA A;  3CXS A;  3TO9 A;  2VZY A;  3WR7 A;  4MFQ A;  2C27 A;  1B6B A;  2BSW A;  4PV6 A;  4XPD C;  4KVX A;  2AJ6 A;  3C26 A;  5JPH A;  1MJB A;  3FRM A;  2WPW A;  2FSR A;  2HQY A;  4CAE A;  1IID A;  5G20 A;  3D8P A;  3LOD A;  2R7H A;  2OZG A;  4MFZ A;  4KSA A;  1SQH A;  2PC1 A;  4FD6 A;  5AGE A;  2I00 A;  5AG5 A;  4JWP A;  2BUE A;  4R3L A;  4HNX B;  1QST A;  2B4D B;  1YLE A;  2Z3O A;  1MJ9 A;  1N71 A;  3IGR A;  2X7B A;  2EUI A;  4XNH C;  4F0X A;  1LRZ A;  5HH1 A;  4C2X A;  2D4O A;  4CAX A;  4QBJ A;  3BLN A;  1YGH A;  2Z3M A;  3CXP A;  1M1D A;  3SHP A;  4K30 A;  3S6G A;  2YNC A;  3I9S A;  1S7F A;  2I79 A;  1P4N A;  3A9L A;  1M4D A;  4XPD B;  2FXF A;  1QSM A;  4QUS A;  2B3U A;  2P6G A;  4UFX A;  5KTD A;  5IX3 A;  1TIQ A;  4B14 A;  5E96 A;  5JQ4 A;  3H4Q A;  4KVM E;  1XMT A;  5BWA B;  2WPX A;  4U9Z A;  1IIC A;  3FIX A;  4MJ8 A;  3EXN A;  2EVN A;  2B58 A;  4CGN A;  4CGO A;  3D3S A;  1Q2C A;  2F5I A;  1CJW A;  1GHE A;  1ON0 A;  3E0K A;  4XNH B;  5DWM A;  1QSN A;  4CGM A;  1NSL A;  3R1K A;  2Q44 A;  4B10 A;  4FD7 A;  1IB1 E;  3R96 A;  1Z9U A;  4C7H A;  2Y0M A;  1KUV A;  2HUZ A;  2Z0Z A;  3P2H A;  2YND A;  4C68 A;  2PSW A;  4B5O A;  2R1I A;  2BL1 A;  5KTA A;  2Q0Y A;  2ZW6 A;  1K4J A;  2IL4 A;  3TO6 A;  2Z11 A;  4Q36 A;  1VKC A;  1Y7R A;  4CGP A;  5G22 A;  3JVN A;  4U9Y A;  1I21 A;  4RI1 A;  1YVO A;  3TTH A;  2PR1 A;  4YFJ A;  3IWE A;  4HKF A;  2Q7B A;  3F0A A;  5HMN A;  4NSQ A;  4KVO E;  3NE7 A;  2DPT A;  2ZW5 A;  4H6Z A;  1M44 A;  4MBU A;  2PRB A;  1I1D A;  2Q4V A;  4UWI A;  1Q2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...