4E8OA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
147
structure length
147
Chain Sequence
b'GMNIMPISESQLSDWLALRCLLWPDHEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNGTQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKNIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aac(6')-Ih protein
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 34
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e8oA00
3KKWA 1MJBA 3F0AA 4JXQA 4U5YA 5IB0A 4L89A 2PSWA 2PR1A 2PDOA 2FCKA 5DWMA 3TOAA 1NE9A 2J8NA 4R3KA 1XF8A 1UFHA 1FY7A 1PUAA 1K4JA 3UY5A 1Q2YA 3C26A 1S7FA 2H5MA 3GKRA 3TCVA 3K9UA 3N7ZA 4GS4A 4QBJA 3CXPA 2BL1A 5F48A 2FIAA 4NSQA 4XPDC 4U9ZA 1YVKA 3JUWA 1NSLA 2GIVA 2PQ8A 4PSXA 1TIQA 1ON0A 5H86A 1XEBA 4MY0A 4CAVA 1QSTA 4R3LA 2NMTA 2ZXVA 4KOVA 4UBRA 3G8WA 3S6FA 2OZGA 4KORA 1B6BA 5H84A 2B5GB 3PP9A 2J8RA 2Q4VA 1NMTA 1B87A 5E96A 4F6AA 2HQYA 2REEA 4QC6A 4XNHC 5HMNA 3W6SA 1IIDA 2ZW7A 4L8AA 4NXYA 2VEZA 3PGPA 1KUVA 3FYNA 5IX3A 4KLWA 4H6UA 4HNXB 4I49A 2EVNA 4J3GA 3R9FA 4ORFA 3DDDA 4RS2A 1YGHA 1Y9KA 1QSOA 2Q44A 3G3SA 3SXOA 3DNSA 2P0WA 4QVTA 2FSRA 1P4NA 5KTAA 4M85A 2B58A 2Z10A 1Y7RA 4E0AA 2FIWA 4MJ8A 4CS0B 1Z9UA 2CNTA 1V0CA 1M4GA 4PSWA 1MK4A 2G0BA 3QB8A 4H6ZA 2KCWA 3FRMA 4HNYB 3V8IA 3TO7A 4NEXA 2VBQA 3TE4A 1IYLA 4BMHA 3TO9A 4MY3A 3TO6A 2RC4A 4Y49C 1WK4A 4KOSA 2PC1A 1KUYA 3R9GA 1GHEA 2FE7A 2Z11A 3VWDA 4EVYA 3R1KA 4H89A 1CJWA 2PR8A 3EC4A 2QIRA 5IV0A 4NCZA 2Q7BA 4XPLA 1I21A 4FD5A 3LD2A 4JJXA 4FD4A 4FD6A 2B5GA 3WR7A 2R98A 2J8MA 4B5OA 3TTHA 2I00A 2FL4A 4JWPA 1YLEA 2F5IA 3EO4A 4JLYA 3OWCA 4KVME 2BUEA 5JPHA 3IGRA 4R9MA 3W6XA 5EC4A 3F5BA 1I1DA 1Z4RA 2QMLA 4KZTA 3B8GA 4II9A 5DWNA 1S7KA 4R57A 3T90A 2BSWA 1XMTA 5KTDA 2ATRA 2IL4A 4AVBA 4JXRA 2EUIA 2P6GA 1P0HA 1R57A 3EY5A 2D4PA 5C88A 2Q0YA 2JEVA 4CAXA 2AJ6A 1QSNA 1U6MA 5EBVA 1VKCA 3BLNA 1Z4EA 4HKFA 5HH1A 4AG7A 1XIXA 3DR6A 4LX9A 1MJ9A 1LRZA 3EXNA 4PV6A 2B3UA 1QSMA 2GANA 3T9YA 3GY9A 4KUBA 2R1IA 4XPKA 1IICA 1L0CA 2K5TA 2G3AA 2QECA 2P6FA 3FXTA 4LUAA 4K30A 4DNCA 1S3ZA 4HNWB 4CAWA 2DXQA 2AE6A 1Q2DA 3R95A 1Q2CA 4XNHB 2O28A 2Z0ZA 4QB9A 2JLMA 3R96A 1XE4A 2JDCA 2ZPAA 2BEIA 1PU9A 1S60A 2FT0A 3I3GA 3FBUA 1QSRA 5F46A 4KVOE 4MBUA 1I12A 2B4DB 3D2PA 3D3SA 4KOWA 5ISVA 2ZW5A 3LODA 4AVAA 3QAHA 5J8CA 1M4DA 3E0KA 4X5KA 2ZW4A 2R7HA 4E8OA 4YRHA 2CNSA 1YR0A 1YX0A 1M4IA 4UWJA 2FXFA 3RYOA 1BOBA 3H4QA 4R87A 3TOBA 5I0CA 1M44A 1KUXA 4IUSA 3BJ7A 4MHDA 2HV2A 1WWZA 4UWIA 5FVJA 3TT2A 2OU2A 4AB7A 1IYKA 2VI7A 3PZJA 2VZZA 4IF5A 4M3SA 1BO4A 2P6EA 4CRZB 3CXSA 4KOTA 1Y9WA 3TFYA 5F47A 4B5PB 4JD6A 1S7NA 3P2HA 3F8KA 1YK3A 4KLVA 1KZFA 1S7LA 4XPDB 4AVCA 3GYAA 1YREA 2B3VA 4KOUA 1CM0A 2R8VA 3IWGA 3DSBA 2B4DA 5KTCA 4KOXA 2OZUA 4PK3A 1MJAA 3FNCA 2WPWA 4QUSA 5GCNA 3R9EA 2G3TA 4PK2A 2PRBA 2OZHA 2B4BA 4ZBGA 3S6HA 3ZZIA 1M1DA 2VXKA 5JQ4A 2WPXA 2REFA 2VZYA 4OLLA 1SQHA 3VWEA 1J4JA 3CXQA 3ZJ0A 3P2FA 3SHPA 2OH1A 3FIXA 5F49A 2CNMA 1IB1E 3D8PA 3EFAA 4E2AA 2JDDA 2GE3A 2C27A 5CNPA 1S5KA 4UA3A 3MGDA 3S6GA 2FS5A 2Q04A 4YFJA 2HUZA 4YGOA 3BJ8A 4NF1A 5J8FA 4OADA 2I79A 2Q4YA 1RXTA 1YVOA 2X7BA 2ARHA 4OAEA 2ZW6A 4F0YA 4B5PA 1RO5A 1N71A 2VQYA 3DR8A 5C82A 3I9SA 4FD7A 3NE7A 3SXNA 3D2MA 4ONUA 4AG9A 3JVNA 3FB3A 4KUAA 4CRYB 3W91A 4KVXA 4Y49B 3S6KA 2A4NA 4KOYA 2Y0MA 4RI1A 1OZPA 4U9YA 4MI4A 1VHSA 2OB0A 2D4OA 2CY2A
chains in the Genus database with same CATH superfamily
5G20A 3KKWA 5AG7A 1MJBA 3F0AA 4JXQA 4NFRA 4MFQA 4FAIA 1NSAA 4U5YA 4NGMA 3WC6A 4L89A 3PRTA 4FBEA 5IB0A 2NYQA 2PR1A 2PSWA 2PDOA 4PXCA 4OIWA 2FCKA 4P4EA 1FT7A 5DWMA 2BOAA 4NGNA 1AUGA 3TOAA 1NE9A 5J1QA 4UFXA 4AXVA 2J8NA 4R3KA 1XF8A 2YGWA 2PCUA 1UFHA 2DEAA 1LAPA 1FY7A 1PUAA 3DGVA 3ISZA 4PXEA 5JGFA 1K4JA 3UY5A 1Q2YA 5LRKA 2QJ8A 3KR5A 4Q38A 3C26A 1S7FA 2H5MA 3GKRA 3TCVA 3K9UA 4B11A 2ABZA 3N7ZA 4GS4A 5THWA 3CXPA 4QBJA 4NJQA 2BL1A 2YNCC 3B3CA 5AG5A 2FIAA 4NSQA 5F48A 4RUHA 3LMSA 4XPDC 4U9ZA 1CP7A 1YVKA 3JUWA 1NSLA 2GIVA 2EO8A 2PQ8A 4MFJA 4NJRA 3D4UA 4PSXA 4A31A 4CGMA 1TIQA 3KR4A 1ON0A 5H86A 1XEBA 4MHNA 2AFWA 2PIZA 4MY0A 4CAVA 4OC0A 2IMOA 1KWMA 1QSTA 3GUXA 5A28A 4R3LA 4UEFA 2NMTA 4CGNA 3B3TA 4MMOA 2C1CA 1CBXA 4DJLA 3NE8A 3LWUA 2ZEFA 5D29A 2ZXVA 3PEIA 4KOVA 4UBRA 3G8WA 3S6FA 2OZGA 2AFOA 4KORA 2PJ7A 1B6BA 2NSMA 2PRQA 2ZEPA 4UIAA 3PB4X 1HDUA 5H84A 4YU9A 2B5GB 3PP9A 2J8RA 4P4BA 5BWAB 1ZG7A 3NH8A 3B3VA 2Q4VA 1NMTA 3FH4A 1B87A 5E96A 4F6AA 2HQYA 2XEIA 4OC3A 4MCQA 3B3SA 2REEA 2ZEDA 4MCSA 4EFDA 4QC6A 4XNHC 5HMNA 2IJZA 3W6SA 4DUKA 1IIDA 2ZW7A 4L8AA 4NXYA 4A94A 2VEZA 2YNDA 4R6TA 4H2KA 5K8MA 3PGPA 1KUVA 4OKOA 4OC1A 3FYNA 3BI0A 2Z3PA 1HDQA 2O53A 4A2ZA 1TF9A 5IX3A 5AGEA 3S9LA 4KLWA 4O23A 4C68A 6CPAA 4H6UA 4HNXB 4I49A 2ZENA 2PJ4A 2PJBA 1R3NA 2EVNA 2CIJA 4UCPA 4J3GA 3R9FA 4ORFA 3DDDA 4X8IA 1VIXA 2ZEOA 2PJ0A 4RS2A 1YGHA 4M6IA 1Y9KA 4NGPA 1QSOA 4M6GA 2Q44A 3G3SA 3SXOA 3DNSA 2P0WA 4QVTA 4UEEA 4MFZA 1LAMA 2FSRA 3CT9A 1P4NA 4UIBA 4X3RA 8CPAA 4MHZA 5KTAA 4M85A 2F8HA 2B58A 3H8GA 2Z10A 1Y7RA 4E0AA 5A27A 2FIWA 5K8PA 3KI9A 4P45A 4MJ8A 4TWEA 2RB7A 2Q4ZA 2GREA 4CS0B 1Z9UA 4ZX9A 3V38A 5AG4A 2CNTA 3S9NA 1V0CA 1M4GA 4PSWA 1IOFA 1MK4A 1IOIA 2G0BA 3QB8A 1TKFA 4H6ZA 1M4LA 2AFSA 1RTQA 2KCWA 3FRMA 1Z5RA 4B12A 4HNYB 4C2YA 4CPAA 3V8IA 2PJ2A 3SJFA 3TO7A 4NEXA 2VBQA 2WZNA 5HVFA 3TE4A 1IYLA 4GXHA 4BMHA 3TO9A 3IU1A 4MY3A 4ZYQA 3TO6A 2PE3A 2RC4A 4Y49C 1WK4A 3H8FA 1YW4A 4KOSA 2PC1A 1KUYA 1F57A 2EK9A 3R9GA 1GHEA 2FE7A 2Z11A 3VWDA 3IO1A 3KQZA 2XEGA 4EVYA 3R1KA 1ZLHA 4H89A 3KQXA 1CJWA 2FVGA 1PYTB 3SI1A 2PR8A 3EC4A 4F9VA 2QIRA 2V8HA 5IV0A 4NCZA 2Q7BA 2GU2A 4XPLA 3SJXA 5HVHA 1I21A 4FD5A 3LD2A 4JJXA 2Q7SA 1BPMA 3IJ3A 3S9MA 4FD4A 4FD6A 2B5GA 1HEEA 4UFVA 1OBRA 4MXUA 1X12A 5G22A 3B7IA 3WR7A 2R98A 2J8MA 4B5OA 3TTHA 3ISXA 1TF8A 2I00A 1JQGA 5LRJA 3B3WA 2FL4A 1LANA 4OC2A 4IK2A 2JEWA 3NFZA 4JWPA 1IY7A 1YLEA 2F5IA 3EO4A 4JLYA 3K2KA 3PFEA 3OWCA 3WABA 4KVME 4PQAA 2BUEA 5JPHA 1BPNA 3GB0A 3IGRA 4R9MA 3W6XA 4B14A 3IWWA 5EC4A 3F5BA 2YNEA 1I1DA 1Z4RA 2QMLA 4KZTA 2GLFA 2J9AA 3B8GA 5DWNA 4II9A 4CGLA 4CAFA 1S7KA 4R57A 1ZG8A 3T90A 2AFZA 2BSWA 2PJCA 1XMTA 3PB7X 2ATRA 2IL4A 4UF4A 4AVBA 5KTDA 4JXRA 2EUIA 2BO9A 2P6GA 4A30A 1P0HA 2GLJA 1R57A 3EY5A 5G1ZA 2D4PA 5C88A 5EMIA 2Q0YA 2JEVA 3D7DA 1YSJA 4CAXA 2AJ6A 1QSNA 1U6MA 3IFEA 1Z8LA 2VL1A 2F7VA 2I3CA 5EBVA 4B13A 1VKCA 1Z8TA 2G9DA 3BLNA 3BHXA 3TX8A 1Y7EA 1Z4EA 5DS0A 2BCOA 3MRUA 4HKFA 5HH1A 4AG7A 1XIXA 3DR6A 3K9TA 4G1PA 1MJ9A 4LX9A 1LRZA 4ZI6A 3EXNA 4JYWA 4PV6A 2B3UA 2DPTA 2V8VA 3FEDA 1QSMA 2ZEGA 3FJUA 2Q51A 3NH4A 1CG2A 2Q43A 3FECA 3KHZA 3IU2A 3QAYA 3I1UA 2GANA 3T9YA 1VHEA 1YW6A 3GY9A 4YWYA 2PJ3A 5ELYA 2C6CA 3IIBA 2R1IA 2ODFA 4KUBA 4P4IA 4UEZA 4XPKA 1IICA 1IU8A 1L0CA 2K5TA 2G3AA 2CF4A 2GFQA 2QECA 4PXBA 2P6FA 3FXTA 3LACA 3RAMA 4PPZA 2ZEHA 2PJ5A 4LUAA 4K30A 4DNCA 1S3ZA 4HNWB 4CAWA 4BBHA 2DXQA 4CGPA 3B2YA 2AE6A 4IAVA 1Q2DA 1ZO0A 2AFMA 2PVWA 3R95A 1Q2CA 2C6PA 4XNHB 1H8LA 2O28A 1CPXA 4LQGA 3VARA 2Z0ZA 4NGQA 2ZOFA 4K3NA 1XJOA 3SI2A 3B35A 1Q7LA 4EWTA 1F2OA 1Z8XA 4QB9A 4R7MA 2JLMA 1YMEA 3GIUA 3R96A 4A33A 1XE4A 2JDCA 2ZPAA 2PJ1A 2Z3OA 2BEIA 1PU9A 3D66A 3WT4A 1S60A 3CZXA 4P44A 4CYPA 2FT0A 1TXRA 3T8WA 3I3GA 3FBUA 4B10A 1AYEA 3HUVA 5D8NA 1JWQA 4MHPA 1QSRA 2O4HA 3WC7A 1XFOA 4KVOE 5F46A 4Q36A 2JBJA 1Z2LA 3QNVA 4MBUA 1I12A 4P6YA 4BINA 2B4DB 2JBKA 3D2PA 4A39A 3D7HA 5CBMA 3D3SA 4KOWA 1Z8WA 2V8DA 5ISVA 2ZW5A 4MCPA 2V8GA 1TKHA 3LODA 3BI1A 1XBUA 4AVAA 3QAHA 5I4MA 2Z3KA 3NA6A 3D68A 5J8CA 1M4DA 3E0KA 5LYDA 4X5KA 1DE4C 2ZW4A 3SI0A 4RN7A 2AFXA 4BD9A 3CDXA 2R7HA 4UCNA 2YNCA 4CGOA 3KGQA 4R8FA 4E8OA 3CPXA 4YRHA 2CNSA 1YR0A 1YX0A 1M4IA 4A37A 1BLLE 1CX8A 2HC9A 2CXAA 4UWJA 2FXFA 3RYOA 1BOBA 2ZEEA 3H4QA 4R87A 2C6GA 3TOBA 5I0CA 3N5FA 2OR4A 2Z3NA 4P4DA 2PJ9A 5AG6A 1M44A 2DPSA 2IQ6A 2POKA 2PVVA 1KUXA 4P10A 4MFLA 4IUSA 5JM6A 3BJ7A 5LYIA 3PBBA 1IGBA 4MHDA 1F2PA 4C7IA 1ELLP 4MFKA 1EE3P 2HV2A 1WWZA 3HLPA 4UWIA 2CTCA 5FVJA 4R76A 3FX6A 3IC1A 4WWVA 2WSAA 3TT2A 2OU2A 2EBJA 5JH9A 1X10A 4AB7A 4F0XA 3RNZA 4C2XA 3JTKA 1IYKA 2VI7A 3PZJA 2VZZA 4LQ6A 4IF5A 4M3SA 1BO4A 2P6EA 2Z3LA 4CRZB 3D7FA 4MHYA 4OIDA 3CXSA 4KOTA 5F09A 5K8NA 1Y9WA 3TFYA 5F47A 3PFOA 4B5PB 1ZLIA 2HB6A 1BAVA 3NH5A 1S7NA 4JD6A 5G21A 3RO0A 4MRIA 4A95A 3A9LA 3P2HA 3F8KA 1YK3A 4KLVA 1KZFA 1XMBA 5LYLA 2QVPA 4MCRA 1ARMA 4X2TA 4CAEA 2RFHA 1S7LA 4XPDB 4A38A 1LCPA 4AVCA 3GYAA 2XEJA 1YREA 2B3VA 4JZ0A 3L2NA 2ZEMA 4P4JA 2QYVA 2OOTA 4KOUA 4NGRA 1VHOA 3MN8A 4OC5A 1CM0A 3VATA 4KS9A 5LYFA 2R8VA 3IWGA 4WJBA 7CPAA 3DSBA 5IB9A 2B4DA 5KTCA 4B6ZA 4OP4A 4KOXA 2OZUA 4ZGYB 4PK3A 1MJAA 3FNCA 2WPWA 4QUSA 5GCNA 3R9EA 5LRGA 2WUUA 3PB8X 1PCAA 2G3TA 4UCMA 4PK2A 4KSIA 2PRBA 2OZHA 1YQEA 4A32A 2B4BA 4ZBGA 2XEFA 4CYNA 1ZG9A 3S6HA 3H8EA 3ZZIA 4ZY2A 1M1DA 2VXKA 4EMEA 5JQ4A 1YLOA 1AMPA 2WPXA 1A2ZA 3FF3A 2REFA 2VZYA 3KZWA 4OLLA 2PIYA 4ZX8A 2V77A 1SQHA 3D67A 4W9YA 3VWEA 3FMCA 1J4JA 3CXQA 3JRUA 4GM5A 3P2FA 3ZJ0A 3SHPA 1UWYA 2EK8A 3PB6X 2OH1A 3FIXA 5F49A 1CP6A 3TC8A 4ZY1A 2CNMA 1IB1E 1QQ9A 3D8PA 1R43A 1ARLA 3EFAA 4UFWA 3V7ZA 1XOVA 4E2AA 2JDDA 4Z65A 2GE3A 3GLJA 4C2ZA 2C27A 5CNPA 1S5KA 3VH9A 5HVGA 1LOKA 4UA3A 4F8ZA 4DYOA 3MGDA 3S6GA 4FUUA 1XRYA 2FS5A 3PB9X 4CYQA 1Y0RA 2Q04A 3IWEA 4FWUA 4YFJA 2CTBA 2HUZA 1ELMP 4F9UA 3WC5A 3BXMA 4YGOA 3KASA 2PJ6A 3BJ8A 1CPSA 4NGSA 1FNOA 3D7GA 4NF1A 5J8FA 4P4FA 4OADA 2I79A 3CPAA 3IEHA 4PXDA 4HPSA 2Q4YA 1RXTA 1YVOA 2X7BA 2EWBA 4KSAA 4TNUA 3RBUA 2ARHA 1GYTA 4ONWA 2PJ8A 1Y0YA 4ZY0A 4OMEA 4OAEA 2DF5A 3KHXA 2ZW6A 1VGYA 1QMUA 3KL9A 5CPAA 4F0YA 4B5PA 1RO5A 3DLJA 5HXDA 5K8OA 1N71A 2VQYA 3DR8A 1TKJA 1DTDA 3H5ZA 4KSFA 4Q7AA 5C82A 3FEEA 4MFPA 3I9SA 4FD7A 3NE7A 3SXNA 3D2MA 3SJEA 4ONUA 4AG9A 3JVNA 2ZELA 3PBEA 4OC4A 2ANPA 3FB3A 4KUAA 3SJGA 3FVLA 4CRYB 2PJAA 2WYRA 1LFWA 4KVXA 4NGTA 2AFUA 4Y49B 3S6KA 2A4NA 4KOYA 4M6HA 3W91A 4C7HA 2ZOGA 3RZAA 2Y0MA 4RI1A 1OZPA 4U9YA 2Z3MA 4MI4A 1VHSA 4CYOA 2OB0A 4IHMA 2D4OA 2CY2A
chains in the Genus database with same CATH topology
5G20A 3KKWA 5AG7A 1MJBA 3F0AA 4JXQA 4MFQA 4U5YA 5IB0A 4L89A 2PSWA 2PR1A 2PDOA 2FCKA 5DWMA 3TOAA 1NE9A 4UFXA 2J8NA 4R3KA 1XF8A 2YGWA 1UFHA 1FY7A 1PUAA 1K4JA 3UY5A 1Q2YA 4Q38A 3C26A 1S7FA 2H5MA 3GKRA 3TCVA 3K9UA 4B11A 3N7ZA 4GS4A 4QBJA 3CXPA 2BL1A 2YNCC 5AG5A 5F48A 2FIAA 4NSQA 4XPDC 4U9ZA 1YVKA 3JUWA 1NSLA 2GIVA 2PQ8A 4MFJA 4PSXA 4A31A 4CGMA 1TIQA 1ON0A 5H86A 1XEBA 4MY0A 4CAVA 1QSTA 5A28A 4R3LA 2NMTA 4CGNA 2ZXVA 4KOVA 4UBRA 3G8WA 3S6FA 2OZGA 4KORA 1B6BA 5H84A 2B5GB 3PP9A 2J8RA 5BWAB 2Q4VA 1NMTA 1B87A 5E96A 4F6AA 2HQYA 2REEA 4QC6A 4XNHC 5HMNA 3W6SA 1IIDA 2ZW7A 4L8AA 4NXYA 2VEZA 2YNDA 3PGPA 1KUVA 3FYNA 2Z3PA 5IX3A 4A2ZA 5AGEA 4KLWA 4C68A 4H6UA 4HNXB 4I49A 2EVNA 4UCPA 4J3GA 3R9FA 4ORFA 3DDDA 4RS2A 1YGHA 1Y9KA 1QSOA 2Q44A 3G3SA 3SXOA 3DNSA 2P0WA 4QVTA 4MFZA 2FSRA 1P4NA 5KTAA 4M85A 2B58A 2Z10A 1Y7RA 4E0AA 5A27A 2FIWA 4MJ8A 4CS0B 1Z9UA 5AG4A 2CNTA 1V0CA 1M4GA 4PSWA 1MK4A 2G0BA 3QB8A 4H6ZA 4C2YA 2KCWA 3FRMA 4B12A 4HNYB 3V8IA 3TO7A 4NEXA 2VBQA 3TE4A 1IYLA 4BMHA 3TO9A 3IU1A 4MY3A 3TO6A 2RC4A 4Y49C 1WK4A 4KOSA 2PC1A 1KUYA 3R9GA 1GHEA 2FE7A 2Z11A 3VWDA 4EVYA 3R1KA 4H89A 1CJWA 2PR8A 3EC4A 2QIRA 5IV0A 4NCZA 2Q7BA 4XPLA 1I21A 4FD5A 3LD2A 4JJXA 4FD4A 4FD6A 2B5GA 4UFVA 5G22A 3WR7A 2R98A 2J8MA 4B5OA 3TTHA 2I00A 2FL4A 4JWPA 1YLEA 2F5IA 3EO4A 4JLYA 3OWCA 4KVME 2BUEA 5JPHA 3IGRA 4R9MA 3W6XA 4B14A 5EC4A 3F5BA 2YNEA 1I1DA 1Z4RA 2QMLA 4KZTA 3B8GA 4II9A 5DWNA 4CGLA 4CAFA 1S7KA 4R57A 3T90A 2BSWA 1XMTA 5KTDA 2ATRA 2IL4A 4AVBA 4JXRA 2EUIA 2P6GA 4A30A 1P0HA 1R57A 3EY5A 5G1ZA 2D4PA 5C88A 2Q0YA 2JEVA 4CAXA 2AJ6A 1QSNA 1U6MA 5EBVA 4B13A 1VKCA 3BLNA 1Z4EA 4HKFA 5HH1A 4AG7A 1XIXA 3DR6A 4LX9A 1MJ9A 1LRZA 3EXNA 4PV6A 2B3UA 2DPTA 1QSMA 3IU2A 2GANA 3T9YA 3GY9A 4KUBA 2R1IA 4XPKA 1IICA 1L0CA 2K5TA 2G3AA 2QECA 2P6FA 3FXTA 4LUAA 4K30A 4DNCA 1S3ZA 4HNWB 4CAWA 4BBHA 2DXQA 4CGPA 2AE6A 1Q2DA 1ZO0A 3R95A 1Q2CA 4XNHB 2O28A 2Z0ZA 4QB9A 2JLMA 3R96A 4A33A 1XE4A 2JDCA 2ZPAA 2Z3OA 2BEIA 1PU9A 4CYPA 1S60A 2FT0A 3I3GA 3FBUA 4B10A 1QSRA 5F46A 4KVOE 4Q36A 4MBUA 1I12A 2B4DB 3D2PA 3D3SA 4KOWA 5ISVA 2ZW5A 3LODA 4AVAA 3QAHA 2Z3KA 5J8CA 1M4DA 3E0KA 4X5KA 2ZW4A 4UCNA 2R7HA 2YNCA 4CGOA 4E8OA 4YRHA 2CNSA 1YR0A 1YX0A 1M4IA 2CXAA 4UWJA 2FXFA 3RYOA 1BOBA 3H4QA 4R87A 3TOBA 5I0CA 2Z3NA 5AG6A 1M44A 2DPSA 1KUXA 4MFLA 4IUSA 3BJ7A 4MHDA 4C7IA 4MFKA 2HV2A 1WWZA 4UWIA 5FVJA 2WSAA 3TT2A 2OU2A 4AB7A 4F0XA 4C2XA 3JTKA 1IYKA 2VI7A 3PZJA 2VZZA 4IF5A 4M3SA 1BO4A 2P6EA 2Z3LA 4CRZB 3CXSA 4KOTA 1Y9WA 3TFYA 5F47A 4B5PB 4JD6A 1S7NA 5G21A 4A95A 3A9LA 3P2HA 3F8KA 1YK3A 4KLVA 1KZFA 4CAEA 1S7LA 4XPDB 4AVCA 3GYAA 1YREA 2B3VA 4KOUA 1CM0A 4KS9A 2R8VA 3IWGA 3DSBA 2B4DA 5KTCA 4KOXA 2OZUA 4ZGYB 4PK3A 1MJAA 3FNCA 2WPWA 4QUSA 5GCNA 3R9EA 2WUUA 2G3TA 4UCMA 4PK2A 2PRBA 2OZHA 4A32A 2B4BA 4ZBGA 4CYNA 3S6HA 3ZZIA 1M1DA 2VXKA 5JQ4A 2WPXA 2REFA 2VZYA 4OLLA 1SQHA 3VWEA 1J4JA 3CXQA 3ZJ0A 3P2FA 3SHPA 2OH1A 3FIXA 5F49A 2CNMA 1IB1E 3D8PA 4UFWA 3EFAA 4E2AA 2JDDA 2GE3A 4C2ZA 2C27A 5CNPA 1S5KA 4UA3A 3MGDA 3S6GA 2FS5A 4CYQA 2Q04A 3IWEA 4YFJA 2HUZA 4YGOA 3BJ8A 4NF1A 5J8FA 4OADA 2I79A 2Q4YA 1RXTA 1YVOA 2X7BA 4KSAA 2ARHA 4OAEA 2ZW6A 4F0YA 4B5PA 1RO5A 1N71A 2VQYA 3DR8A 3H5ZA 4KSFA 5C82A 4MFPA 3I9SA 4FD7A 3NE7A 3SXNA 3D2MA 4ONUA 4AG9A 3JVNA 3FB3A 4KUAA 4CRYB 3W91A 4KVXA 4Y49B 3S6KA 2A4NA 4KOYA 4C7HA 2Y0MA 4RI1A 1OZPA 4U9YA 2Z3MA 4MI4A 1VHSA 4CYOA 2OB0A 2D4OA 2CY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKW A;  1MJB A;  3F0A A;  4JXQ A;  4U5Y A;  5IB0 A;  4L89 A;  2PSW A;  2PR1 A;  2PDO A;  2FCK A;  5DWM A;  3TOA A;  1NE9 A;  2J8N A;  4R3K A;  1XF8 A;  1UFH A;  1FY7 A;  1PUA A;  1K4J A;  3UY5 A;  1Q2Y A;  3C26 A;  1S7F A;  2H5M A;  3GKR A;  3TCV A;  3K9U A;  3N7Z A;  4GS4 A;  4QBJ A;  3CXP A;  2BL1 A;  5F48 A;  2FIA A;  4NSQ A;  4XPD C;  4U9Z A;  1YVK A;  3JUW A;  1NSL A;  2GIV A;  2PQ8 A;  4PSX A;  1TIQ A;  1ON0 A;  5H86 A;  1XEB A;  4MY0 A;  4CAV A;  1QST A;  4R3L A;  2NMT A;  2ZXV A;  4KOV A;  4UBR A;  3G8W A;  3S6F A;  2OZG A;  4KOR A;  1B6B A;  5H84 A;  2B5G B;  3PP9 A;  2J8R A;  2Q4V A;  1NMT A;  1B87 A;  5E96 A;  4F6A A;  2HQY A;  2REE A;  4QC6 A;  4XNH C;  5HMN A;  3W6S A;  1IID A;  2ZW7 A;  4L8A A;  4NXY A;  2VEZ A;  3PGP A;  1KUV A;  3FYN A;  5IX3 A;  4KLW A;  4H6U A;  4HNX B;  4I49 A;  2EVN A;  4J3G A;  3R9F A;  4ORF A;  3DDD A;  4RS2 A;  1YGH A;  1Y9K A;  1QSO A;  2Q44 A;  3G3S A;  3SXO A;  3DNS A;  2P0W A;  4QVT A;  2FSR A;  1P4N A;  5KTA A;  4M85 A;  2B58 A;  2Z10 A;  1Y7R A;  4E0A A;  2FIW A;  4MJ8 A;  4CS0 B;  1Z9U A;  2CNT A;  1V0C A;  1M4G A;  4PSW A;  1MK4 A;  2G0B A;  3QB8 A;  4H6Z A;  2KCW A;  3FRM A;  4HNY B;  3V8I A;  3TO7 A;  4NEX A;  2VBQ A;  3TE4 A;  1IYL A;  4BMH A;  3TO9 A;  4MY3 A;  3TO6 A;  2RC4 A;  4Y49 C;  1WK4 A;  4KOS A;  2PC1 A;  1KUY A;  3R9G A;  1GHE A;  2FE7 A;  2Z11 A;  3VWD A;  4EVY A;  3R1K A;  4H89 A;  1CJW A;  2PR8 A;  3EC4 A;  2QIR A;  5IV0 A;  4NCZ A;  2Q7B A;  4XPL A;  1I21 A;  4FD5 A;  3LD2 A;  4JJX A;  4FD4 A;  4FD6 A;  2B5G A;  3WR7 A;  2R98 A;  2J8M A;  4B5O A;  3TTH A;  2I00 A;  2FL4 A;  4JWP A;  1YLE A;  2F5I A;  3EO4 A;  4JLY A;  3OWC A;  4KVM E;  2BUE A;  5JPH A;  3IGR A;  4R9M A;  3W6X A;  5EC4 A;  3F5B A;  1I1D A;  1Z4R A;  2QML A;  4KZT A;  3B8G A;  4II9 A;  5DWN A;  1S7K A;  4R57 A;  3T90 A;  2BSW A;  1XMT A;  5KTD A;  2ATR A;  2IL4 A;  4AVB A;  4JXR A;  2EUI A;  2P6G A;  1P0H A;  1R57 A;  3EY5 A;  2D4P A;  5C88 A;  2Q0Y A;  2JEV A;  4CAX A;  2AJ6 A;  1QSN A;  1U6M A;  5EBV A;  1VKC A;  3BLN A;  1Z4E A;  4HKF A;  5HH1 A;  4AG7 A;  1XIX A;  3DR6 A;  4LX9 A;  1MJ9 A;  1LRZ A;  3EXN A;  4PV6 A;  2B3U A;  1QSM A;  2GAN A;  3T9Y A;  3GY9 A;  4KUB A;  2R1I A;  4XPK A;  1IIC A;  1L0C A;  2K5T A;  2G3A A;  2QEC A;  2P6F A;  3FXT A;  4LUA A;  4K30 A;  4DNC A;  1S3Z A;  4HNW B;  4CAW A;  2DXQ A;  2AE6 A;  1Q2D A;  3R95 A;  1Q2C A;  4XNH B;  2O28 A;  2Z0Z A;  4QB9 A;  2JLM A;  3R96 A;  1XE4 A;  2JDC A;  2ZPA A;  2BEI A;  1PU9 A;  1S60 A;  2FT0 A;  3I3G A;  3FBU A;  1QSR A;  5F46 A;  4KVO E;  4MBU A;  1I12 A;  2B4D B;  3D2P A;  3D3S A;  4KOW A;  5ISV A;  2ZW5 A;  3LOD A;  4AVA A;  3QAH A;  5J8C A;  1M4D A;  3E0K A;  4X5K A;  2ZW4 A;  2R7H A;  4E8O A;  4YRH A;  2CNS A;  1YR0 A;  1YX0 A;  1M4I A;  4UWJ A;  2FXF A;  3RYO A;  1BOB A;  3H4Q A;  4R87 A;  3TOB A;  5I0C A;  1M44 A;  1KUX A;  4IUS A;  3BJ7 A;  4MHD A;  2HV2 A;  1WWZ A;  4UWI A;  5FVJ A;  3TT2 A;  2OU2 A;  4AB7 A;  1IYK A;  2VI7 A;  3PZJ A;  2VZZ A;  4IF5 A;  4M3S A;  1BO4 A;  2P6E A;  4CRZ B;  3CXS A;  4KOT A;  1Y9W A;  3TFY A;  5F47 A;  4B5P B;  4JD6 A;  1S7N A;  3P2H A;  3F8K A;  1YK3 A;  4KLV A;  1KZF A;  1S7L A;  4XPD B;  4AVC A;  3GYA A;  1YRE A;  2B3V A;  4KOU A;  1CM0 A;  2R8V A;  3IWG A;  3DSB A;  2B4D A;  5KTC A;  4KOX A;  2OZU A;  4PK3 A;  1MJA A;  3FNC A;  2WPW A;  4QUS A;  5GCN A;  3R9E A;  2G3T A;  4PK2 A;  2PRB A;  2OZH A;  2B4B A;  4ZBG A;  3S6H A;  3ZZI A;  1M1D A;  2VXK A;  5JQ4 A;  2WPX A;  2REF A;  2VZY A;  4OLL A;  1SQH A;  3VWE A;  1J4J A;  3CXQ A;  3ZJ0 A;  3P2F A;  3SHP A;  2OH1 A;  3FIX A;  5F49 A;  2CNM A;  1IB1 E;  3D8P A;  3EFA A;  4E2A A;  2JDD A;  2GE3 A;  2C27 A;  5CNP A;  1S5K A;  4UA3 A;  3MGD A;  3S6G A;  2FS5 A;  2Q04 A;  4YFJ A;  2HUZ A;  4YGO A;  3BJ8 A;  4NF1 A;  5J8F A;  4OAD A;  2I79 A;  2Q4Y A;  1RXT A;  1YVO A;  2X7B A;  2ARH A;  4OAE A;  2ZW6 A;  4F0Y A;  4B5P A;  1RO5 A;  1N71 A;  2VQY A;  3DR8 A;  5C82 A;  3I9S A;  4FD7 A;  3NE7 A;  3SXN A;  3D2M A;  4ONU A;  4AG9 A;  3JVN A;  3FB3 A;  4KUA A;  4CRY B;  3W91 A;  4KVX A;  4Y49 B;  3S6K A;  2A4N A;  4KOY A;  2Y0M A;  4RI1 A;  1OZP A;  4U9Y A;  4MI4 A;  1VHS A;  2OB0 A;  2D4O A;  2CY2 A; 
#chains in the Genus database with same CATH topology
 5G20 A;  3KKW A;  5AG7 A;  1MJB A;  3F0A A;  4JXQ A;  4NFR A;  4MFQ A;  4FAI A;  1NSA A;  4U5Y A;  4NGM A;  3WC6 A;  4L89 A;  3PRT A;  4FBE A;  5IB0 A;  2NYQ A;  2PR1 A;  2PSW A;  2PDO A;  4PXC A;  4OIW A;  2FCK A;  4P4E A;  1FT7 A;  5DWM A;  2BOA A;  4NGN A;  1AUG A;  3TOA A;  1NE9 A;  5J1Q A;  4UFX A;  4AXV A;  2J8N A;  4R3K A;  1XF8 A;  2YGW A;  2PCU A;  1UFH A;  2DEA A;  1LAP A;  1FY7 A;  1PUA A;  3DGV A;  3ISZ A;  4PXE A;  5JGF A;  1K4J A;  3UY5 A;  1Q2Y A;  5LRK A;  2QJ8 A;  3KR5 A;  4Q38 A;  3C26 A;  1S7F A;  2H5M A;  3GKR A;  3TCV A;  3K9U A;  4B11 A;  2ABZ A;  3N7Z A;  4GS4 A;  5THW A;  3CXP A;  4QBJ A;  4NJQ A;  2BL1 A;  2YNC C;  3B3C A;  5AG5 A;  2FIA A;  4NSQ A;  5F48 A;  4RUH A;  3LMS A;  4XPD C;  4U9Z A;  1CP7 A;  1YVK A;  3JUW A;  1NSL A;  2GIV A;  2EO8 A;  2PQ8 A;  4MFJ A;  4NJR A;  3D4U A;  4PSX A;  4A31 A;  4CGM A;  1TIQ A;  3KR4 A;  1ON0 A;  5H86 A;  1XEB A;  4MHN A;  2AFW A;  2PIZ A;  4MY0 A;  4CAV A;  4OC0 A;  2IMO A;  1KWM A;  1QST A;  3GUX A;  5A28 A;  4R3L A;  4UEF A;  2NMT A;  4CGN A;  3B3T A;  4MMO A;  2C1C A;  1CBX A;  4DJL A;  3NE8 A;  3LWU A;  2ZEF A;  5D29 A;  2ZXV A;  3PEI A;  4KOV A;  4UBR A;  3G8W A;  3S6F A;  2OZG A;  2AFO A;  4KOR A;  2PJ7 A;  1B6B A;  2NSM A;  2PRQ A;  2ZEP A;  4UIA A;  3PB4 X;  1HDU A;  5H84 A;  4YU9 A;  2B5G B;  3PP9 A;  2J8R A;  4P4B A;  5BWA B;  1ZG7 A;  3NH8 A;  3B3V A;  2Q4V A;  1NMT A;  3FH4 A;  1B87 A;  5E96 A;  4F6A A;  2HQY A;  2XEI A;  4OC3 A;  4MCQ A;  3B3S A;  2REE A;  2ZED A;  4MCS A;  4EFD A;  4QC6 A;  4XNH C;  5HMN A;  2IJZ A;  3W6S A;  4DUK A;  1IID A;  2ZW7 A;  4L8A A;  4NXY A;  4A94 A;  2VEZ A;  2YND A;  4R6T A;  4H2K A;  5K8M A;  3PGP A;  1KUV A;  4OKO A;  4OC1 A;  3FYN A;  3BI0 A;  2Z3P A;  1HDQ A;  2O53 A;  4A2Z A;  1TF9 A;  5IX3 A;  5AGE A;  3S9L A;  4KLW A;  4O23 A;  4C68 A;  6CPA A;  4H6U A;  4HNX B;  4I49 A;  2ZEN A;  2PJ4 A;  2PJB A;  1R3N A;  2EVN A;  2CIJ A;  4UCP A;  4J3G A;  3R9F A;  4ORF A;  3DDD A;  4X8I A;  1VIX A;  2ZEO A;  2PJ0 A;  4RS2 A;  1YGH A;  4M6I A;  1Y9K A;  4NGP A;  1QSO A;  4M6G A;  2Q44 A;  3G3S A;  3SXO A;  3DNS A;  2P0W A;  4QVT A;  4UEE A;  4MFZ A;  1LAM A;  2FSR A;  3CT9 A;  1P4N A;  4UIB A;  4X3R A;  8CPA A;  4MHZ A;  5KTA A;  4M85 A;  2F8H A;  2B58 A;  3H8G A;  2Z10 A;  1Y7R A;  4E0A A;  5A27 A;  2FIW A;  5K8P A;  3KI9 A;  4P45 A;  4MJ8 A;  4TWE A;  2RB7 A;  2Q4Z A;  2GRE A;  4CS0 B;  1Z9U A;  4ZX9 A;  3V38 A;  5AG4 A;  2CNT A;  3S9N A;  1V0C A;  1M4G A;  4PSW A;  1IOF A;  1MK4 A;  1IOI A;  2G0B A;  3QB8 A;  1TKF A;  4H6Z A;  1M4L A;  2AFS A;  1RTQ A;  2KCW A;  3FRM A;  1Z5R A;  4B12 A;  4HNY B;  4C2Y A;  4CPA A;  3V8I A;  2PJ2 A;  3SJF A;  3TO7 A;  4NEX A;  2VBQ A;  2WZN A;  5HVF A;  3TE4 A;  1IYL A;  4GXH A;  4BMH A;  3TO9 A;  3IU1 A;  4MY3 A;  4ZYQ A;  3TO6 A;  2PE3 A;  2RC4 A;  4Y49 C;  1WK4 A;  3H8F A;  1YW4 A;  4KOS A;  2PC1 A;  1KUY A;  1F57 A;  2EK9 A;  3R9G A;  1GHE A;  2FE7 A;  2Z11 A;  3VWD A;  3IO1 A;  3KQZ A;  2XEG A;  4EVY A;  3R1K A;  1ZLH A;  4H89 A;  3KQX A;  1CJW A;  2FVG A;  1PYT B;  3SI1 A;  2PR8 A;  3EC4 A;  4F9V A;  2QIR A;  2V8H A;  5IV0 A;  4NCZ A;  2Q7B A;  2GU2 A;  4XPL A;  3SJX A;  5HVH A;  1I21 A;  4FD5 A;  3LD2 A;  4JJX A;  2Q7S A;  1BPM A;  3IJ3 A;  3S9M A;  4FD4 A;  4FD6 A;  2B5G A;  1HEE A;  4UFV A;  1OBR A;  4MXU A;  1X12 A;  5G22 A;  3B7I A;  3WR7 A;  2R98 A;  2J8M A;  4B5O A;  3TTH A;  3ISX A;  1TF8 A;  2I00 A;  1JQG A;  5LRJ A;  3B3W A;  2FL4 A;  1LAN A;  4OC2 A;  4IK2 A;  2JEW A;  3NFZ A;  4JWP A;  1IY7 A;  1YLE A;  2F5I A;  3EO4 A;  4JLY A;  3K2K A;  3PFE A;  3OWC A;  3WAB A;  4KVM E;  4PQA A;  2BUE A;  5JPH A;  1BPN A;  3GB0 A;  3IGR A;  4R9M A;  3W6X A;  4B14 A;  3IWW A;  5EC4 A;  3F5B A;  2YNE A;  1I1D A;  1Z4R A;  2QML A;  4KZT A;  2GLF A;  2J9A A;  3B8G A;  5DWN A;  4II9 A;  4CGL A;  4CAF A;  1S7K A;  4R57 A;  1ZG8 A;  3T90 A;  2AFZ A;  2BSW A;  2PJC A;  1XMT A;  3PB7 X;  2ATR A;  2IL4 A;  4UF4 A;  4AVB A;  5KTD A;  4JXR A;  2EUI A;  2BO9 A;  2P6G A;  4A30 A;  1P0H A;  2GLJ A;  1R57 A;  3EY5 A;  5G1Z A;  2D4P A;  5C88 A;  5EMI A;  2Q0Y A;  2JEV A;  3D7D A;  1YSJ A;  4CAX A;  2AJ6 A;  1QSN A;  1U6M A;  3IFE A;  1Z8L A;  2VL1 A;  2F7V A;  2I3C A;  5EBV A;  4B13 A;  1VKC A;  1Z8T A;  2G9D A;  3BLN A;  3BHX A;  3TX8 A;  1Y7E A;  1Z4E A;  5DS0 A;  2BCO A;  3MRU A;  4HKF A;  5HH1 A;  4AG7 A;  1XIX A;  3DR6 A;  3K9T A;  4G1P A;  1MJ9 A;  4LX9 A;  1LRZ A;  4ZI6 A;  3EXN A;  4JYW A;  4PV6 A;  2B3U A;  2DPT A;  2V8V A;  3FED A;  1QSM A;  2ZEG A;  3FJU A;  2Q51 A;  3NH4 A;  1CG2 A;  2Q43 A;  3FEC A;  3KHZ A;  3IU2 A;  3QAY A;  3I1U A;  2GAN A;  3T9Y A;  1VHE A;  1YW6 A;  3GY9 A;  4YWY A;  2PJ3 A;  5ELY A;  2C6C A;  3IIB A;  2R1I A;  2ODF A;  4KUB A;  4P4I A;  4UEZ A;  4XPK A;  1IIC A;  1IU8 A;  1L0C A;  2K5T A;  2G3A A;  2CF4 A;  2GFQ A;  2QEC A;  4PXB A;  2P6F A;  3FXT A;  3LAC A;  3RAM A;  4PPZ A;  2ZEH A;  2PJ5 A;  4LUA A;  4K30 A;  4DNC A;  1S3Z A;  4HNW B;  4CAW A;  4BBH A;  2DXQ A;  4CGP A;  3B2Y A;  2AE6 A;  4IAV A;  1Q2D A;  1ZO0 A;  2AFM A;  2PVW A;  3R95 A;  1Q2C A;  2C6P A;  4XNH B;  1H8L A;  2O28 A;  1CPX A;  4LQG A;  3VAR A;  2Z0Z A;  4NGQ A;  2ZOF A;  4K3N A;  1XJO A;  3SI2 A;  3B35 A;  1Q7L A;  4EWT A;  1F2O A;  1Z8X A;  4QB9 A;  4R7M A;  2JLM A;  1YME A;  3GIU A;  3R96 A;  4A33 A;  1XE4 A;  2JDC A;  2ZPA A;  2PJ1 A;  2Z3O A;  2BEI A;  1PU9 A;  3D66 A;  3WT4 A;  1S60 A;  3CZX A;  4P44 A;  4CYP A;  2FT0 A;  1TXR A;  3T8W A;  3I3G A;  3FBU A;  4B10 A;  1AYE A;  3HUV A;  5D8N A;  1JWQ A;  4MHP A;  1QSR A;  2O4H A;  3WC7 A;  1XFO A;  4KVO E;  5F46 A;  4Q36 A;  2JBJ A;  1Z2L A;  3QNV A;  4MBU A;  1I12 A;  4P6Y A;  4BIN A;  2B4D B;  2JBK A;  3D2P A;  4A39 A;  3D7H A;  5CBM A;  3D3S A;  4KOW A;  1Z8W A;  2V8D A;  5ISV A;  2ZW5 A;  4MCP A;  2V8G A;  1TKH A;  3LOD A;  3BI1 A;  1XBU A;  4AVA A;  3QAH A;  5I4M A;  2Z3K A;  3NA6 A;  3D68 A;  5J8C A;  1M4D A;  3E0K A;  5LYD A;  4X5K A;  1DE4 C;  2ZW4 A;  3SI0 A;  4RN7 A;  2AFX A;  4BD9 A;  3CDX A;  2R7H A;  4UCN A;  2YNC A;  4CGO A;  3KGQ A;  4R8F A;  4E8O A;  3CPX A;  4YRH A;  2CNS A;  1YR0 A;  1YX0 A;  1M4I A;  4A37 A;  1BLL E;  1CX8 A;  2HC9 A;  2CXA A;  4UWJ A;  2FXF A;  3RYO A;  1BOB A;  2ZEE A;  3H4Q A;  4R87 A;  2C6G A;  3TOB A;  5I0C A;  3N5F A;  2OR4 A;  2Z3N A;  4P4D A;  2PJ9 A;  5AG6 A;  1M44 A;  2DPS A;  2IQ6 A;  2POK A;  2PVV A;  1KUX A;  4P10 A;  4MFL A;  4IUS A;  5JM6 A;  3BJ7 A;  5LYI A;  3PBB A;  1IGB A;  4MHD A;  1F2P A;  4C7I A;  1ELL P;  4MFK A;  1EE3 P;  2HV2 A;  1WWZ A;  3HLP A;  4UWI A;  2CTC A;  5FVJ A;  4R76 A;  3FX6 A;  3IC1 A;  4WWV A;  2WSA A;  3TT2 A;  2OU2 A;  2EBJ A;  5JH9 A;  1X10 A;  4AB7 A;  4F0X A;  3RNZ A;  4C2X A;  3JTK A;  1IYK A;  2VI7 A;  3PZJ A;  2VZZ A;  4LQ6 A;  4IF5 A;  4M3S A;  1BO4 A;  2P6E A;  2Z3L A;  4CRZ B;  3D7F A;  4MHY A;  4OID A;  3CXS A;  4KOT A;  5F09 A;  5K8N A;  1Y9W A;  3TFY A;  5F47 A;  3PFO A;  4B5P B;  1ZLI A;  2HB6 A;  1BAV A;  3NH5 A;  1S7N A;  4JD6 A;  5G21 A;  3RO0 A;  4MRI A;  4A95 A;  3A9L A;  3P2H A;  3F8K A;  1YK3 A;  4KLV A;  1KZF A;  1XMB A;  5LYL A;  2QVP A;  4MCR A;  1ARM A;  4X2T A;  4CAE A;  2RFH A;  1S7L A;  4XPD B;  4A38 A;  1LCP A;  4AVC A;  3GYA A;  2XEJ A;  1YRE A;  2B3V A;  4JZ0 A;  3L2N A;  2ZEM A;  4P4J A;  2QYV A;  2OOT A;  4KOU A;  4NGR A;  1VHO A;  3MN8 A;  4OC5 A;  1CM0 A;  3VAT A;  4KS9 A;  5LYF A;  2R8V A;  3IWG A;  4WJB A;  7CPA A;  3DSB A;  5IB9 A;  2B4D A;  5KTC A;  4B6Z A;  4OP4 A;  4KOX A;  2OZU A;  4ZGY B;  4PK3 A;  1MJA A;  3FNC A;  2WPW A;  4QUS A;  5GCN A;  3R9E A;  5LRG A;  2WUU A;  3PB8 X;  1PCA A;  2G3T A;  4UCM A;  4PK2 A;  4KSI A;  2PRB A;  2OZH A;  1YQE A;  4A32 A;  2B4B A;  4ZBG A;  2XEF A;  4CYN A;  1ZG9 A;  3S6H A;  3H8E A;  3ZZI A;  4ZY2 A;  1M1D A;  2VXK A;  4EME A;  5JQ4 A;  1YLO A;  1AMP A;  2WPX A;  1A2Z A;  3FF3 A;  2REF A;  2VZY A;  3KZW A;  4OLL A;  2PIY A;  4ZX8 A;  2V77 A;  1SQH A;  3D67 A;  4W9Y A;  3VWE A;  3FMC A;  1J4J A;  3CXQ A;  3JRU A;  4GM5 A;  3P2F A;  3ZJ0 A;  3SHP A;  1UWY A;  2EK8 A;  3PB6 X;  2OH1 A;  3FIX A;  5F49 A;  1CP6 A;  3TC8 A;  4ZY1 A;  2CNM A;  1IB1 E;  1QQ9 A;  3D8P A;  1R43 A;  1ARL A;  3EFA A;  4UFW A;  3V7Z A;  1XOV A;  4E2A A;  2JDD A;  4Z65 A;  2GE3 A;  3GLJ A;  4C2Z A;  2C27 A;  5CNP A;  1S5K A;  3VH9 A;  5HVG A;  1LOK A;  4UA3 A;  4F8Z A;  4DYO A;  3MGD A;  3S6G A;  4FUU A;  1XRY A;  2FS5 A;  3PB9 X;  4CYQ A;  1Y0R A;  2Q04 A;  3IWE A;  4FWU A;  4YFJ A;  2CTB A;  2HUZ A;  1ELM P;  4F9U A;  3WC5 A;  3BXM A;  4YGO A;  3KAS A;  2PJ6 A;  3BJ8 A;  1CPS A;  4NGS A;  1FNO A;  3D7G A;  4NF1 A;  5J8F A;  4P4F A;  4OAD A;  2I79 A;  3CPA A;  3IEH A;  4PXD A;  4HPS A;  2Q4Y A;  1RXT A;  1YVO A;  2X7B A;  2EWB A;  4KSA A;  4TNU A;  3RBU A;  2ARH A;  1GYT A;  4ONW A;  2PJ8 A;  1Y0Y A;  4ZY0 A;  4OME A;  4OAE A;  2DF5 A;  3KHX A;  2ZW6 A;  1VGY A;  1QMU A;  3KL9 A;  5CPA A;  4F0Y A;  4B5P A;  1RO5 A;  3DLJ A;  5HXD A;  5K8O A;  1N71 A;  2VQY A;  3DR8 A;  1TKJ A;  1DTD A;  3H5Z A;  4KSF A;  4Q7A A;  5C82 A;  3FEE A;  4MFP A;  3I9S A;  4FD7 A;  3NE7 A;  3SXN A;  3D2M A;  3SJE A;  4ONU A;  4AG9 A;  3JVN A;  2ZEL A;  3PBE A;  4OC4 A;  2ANP A;  3FB3 A;  4KUA A;  3SJG A;  3FVL A;  4CRY B;  2PJA A;  2WYR A;  1LFW A;  4KVX A;  4NGT A;  2AFU A;  4Y49 B;  3S6K A;  2A4N A;  4KOY A;  4M6H A;  3W91 A;  4C7H A;  2ZOG A;  3RZA A;  2Y0M A;  4RI1 A;  1OZP A;  4U9Y A;  2Z3M A;  4MI4 A;  1VHS A;  4CYO A;  2OB0 A;  4IHM A;  2D4O A;  2CY2 A; 
#chains in the Genus database with same CATH homology
 5G20 A;  3KKW A;  5AG7 A;  1MJB A;  3F0A A;  4JXQ A;  4MFQ A;  4U5Y A;  5IB0 A;  4L89 A;  2PSW A;  2PR1 A;  2PDO A;  2FCK A;  5DWM A;  3TOA A;  1NE9 A;  4UFX A;  2J8N A;  4R3K A;  1XF8 A;  2YGW A;  1UFH A;  1FY7 A;  1PUA A;  1K4J A;  3UY5 A;  1Q2Y A;  4Q38 A;  3C26 A;  1S7F A;  2H5M A;  3GKR A;  3TCV A;  3K9U A;  4B11 A;  3N7Z A;  4GS4 A;  4QBJ A;  3CXP A;  2BL1 A;  2YNC C;  5AG5 A;  5F48 A;  2FIA A;  4NSQ A;  4XPD C;  4U9Z A;  1YVK A;  3JUW A;  1NSL A;  2GIV A;  2PQ8 A;  4MFJ A;  4PSX A;  4A31 A;  4CGM A;  1TIQ A;  1ON0 A;  5H86 A;  1XEB A;  4MY0 A;  4CAV A;  1QST A;  5A28 A;  4R3L A;  2NMT A;  4CGN A;  2ZXV A;  4KOV A;  4UBR A;  3G8W A;  3S6F A;  2OZG A;  4KOR A;  1B6B A;  5H84 A;  2B5G B;  3PP9 A;  2J8R A;  5BWA B;  2Q4V A;  1NMT A;  1B87 A;  5E96 A;  4F6A A;  2HQY A;  2REE A;  4QC6 A;  4XNH C;  5HMN A;  3W6S A;  1IID A;  2ZW7 A;  4L8A A;  4NXY A;  2VEZ A;  2YND A;  3PGP A;  1KUV A;  3FYN A;  2Z3P A;  5IX3 A;  4A2Z A;  5AGE A;  4KLW A;  4C68 A;  4H6U A;  4HNX B;  4I49 A;  2EVN A;  4UCP A;  4J3G A;  3R9F A;  4ORF A;  3DDD A;  4RS2 A;  1YGH A;  1Y9K A;  1QSO A;  2Q44 A;  3G3S A;  3SXO A;  3DNS A;  2P0W A;  4QVT A;  4MFZ A;  2FSR A;  1P4N A;  5KTA A;  4M85 A;  2B58 A;  2Z10 A;  1Y7R A;  4E0A A;  5A27 A;  2FIW A;  4MJ8 A;  4CS0 B;  1Z9U A;  5AG4 A;  2CNT A;  1V0C A;  1M4G A;  4PSW A;  1MK4 A;  2G0B A;  3QB8 A;  4H6Z A;  4C2Y A;  2KCW A;  3FRM A;  4B12 A;  4HNY B;  3V8I A;  3TO7 A;  4NEX A;  2VBQ A;  3TE4 A;  1IYL A;  4BMH A;  3TO9 A;  3IU1 A;  4MY3 A;  3TO6 A;  2RC4 A;  4Y49 C;  1WK4 A;  4KOS A;  2PC1 A;  1KUY A;  3R9G A;  1GHE A;  2FE7 A;  2Z11 A;  3VWD A;  4EVY A;  3R1K A;  4H89 A;  1CJW A;  2PR8 A;  3EC4 A;  2QIR A;  5IV0 A;  4NCZ A;  2Q7B A;  4XPL A;  1I21 A;  4FD5 A;  3LD2 A;  4JJX A;  4FD4 A;  4FD6 A;  2B5G A;  4UFV A;  5G22 A;  3WR7 A;  2R98 A;  2J8M A;  4B5O A;  3TTH A;  2I00 A;  2FL4 A;  4JWP A;  1YLE A;  2F5I A;  3EO4 A;  4JLY A;  3OWC A;  4KVM E;  2BUE A;  5JPH A;  3IGR A;  4R9M A;  3W6X A;  4B14 A;  5EC4 A;  3F5B A;  2YNE A;  1I1D A;  1Z4R A;  2QML A;  4KZT A;  3B8G A;  4II9 A;  5DWN A;  4CGL A;  4CAF A;  1S7K A;  4R57 A;  3T90 A;  2BSW A;  1XMT A;  5KTD A;  2ATR A;  2IL4 A;  4AVB A;  4JXR A;  2EUI A;  2P6G A;  4A30 A;  1P0H A;  1R57 A;  3EY5 A;  5G1Z A;  2D4P A;  5C88 A;  2Q0Y A;  2JEV A;  4CAX A;  2AJ6 A;  1QSN A;  1U6M A;  5EBV A;  4B13 A;  1VKC A;  3BLN A;  1Z4E A;  4HKF A;  5HH1 A;  4AG7 A;  1XIX A;  3DR6 A;  4LX9 A;  1MJ9 A;  1LRZ A;  3EXN A;  4PV6 A;  2B3U A;  2DPT A;  1QSM A;  3IU2 A;  2GAN A;  3T9Y A;  3GY9 A;  4KUB A;  2R1I A;  4XPK A;  1IIC A;  1L0C A;  2K5T A;  2G3A A;  2QEC A;  2P6F A;  3FXT A;  4LUA A;  4K30 A;  4DNC A;  1S3Z A;  4HNW B;  4CAW A;  4BBH A;  2DXQ A;  4CGP A;  2AE6 A;  1Q2D A;  1ZO0 A;  3R95 A;  1Q2C A;  4XNH B;  2O28 A;  2Z0Z A;  4QB9 A;  2JLM A;  3R96 A;  4A33 A;  1XE4 A;  2JDC A;  2ZPA A;  2Z3O A;  2BEI A;  1PU9 A;  4CYP A;  1S60 A;  2FT0 A;  3I3G A;  3FBU A;  4B10 A;  1QSR A;  5F46 A;  4KVO E;  4Q36 A;  4MBU A;  1I12 A;  2B4D B;  3D2P A;  3D3S A;  4KOW A;  5ISV A;  2ZW5 A;  3LOD A;  4AVA A;  3QAH A;  2Z3K A;  5J8C A;  1M4D A;  3E0K A;  4X5K A;  2ZW4 A;  4UCN A;  2R7H A;  2YNC A;  4CGO A;  4E8O A;  4YRH A;  2CNS A;  1YR0 A;  1YX0 A;  1M4I A;  2CXA A;  4UWJ A;  2FXF A;  3RYO A;  1BOB A;  3H4Q A;  4R87 A;  3TOB A;  5I0C A;  2Z3N A;  5AG6 A;  1M44 A;  2DPS A;  1KUX A;  4MFL A;  4IUS A;  3BJ7 A;  4MHD A;  4C7I A;  4MFK A;  2HV2 A;  1WWZ A;  4UWI A;  5FVJ A;  2WSA A;  3TT2 A;  2OU2 A;  4AB7 A;  4F0X A;  4C2X A;  3JTK A;  1IYK A;  2VI7 A;  3PZJ A;  2VZZ A;  4IF5 A;  4M3S A;  1BO4 A;  2P6E A;  2Z3L A;  4CRZ B;  3CXS A;  4KOT A;  1Y9W A;  3TFY A;  5F47 A;  4B5P B;  4JD6 A;  1S7N A;  5G21 A;  4A95 A;  3A9L A;  3P2H A;  3F8K A;  1YK3 A;  4KLV A;  1KZF A;  4CAE A;  1S7L A;  4XPD B;  4AVC A;  3GYA A;  1YRE A;  2B3V A;  4KOU A;  1CM0 A;  4KS9 A;  2R8V A;  3IWG A;  3DSB A;  2B4D A;  5KTC A;  4KOX A;  2OZU A;  4ZGY B;  4PK3 A;  1MJA A;  3FNC A;  2WPW A;  4QUS A;  5GCN A;  3R9E A;  2WUU A;  2G3T A;  4UCM A;  4PK2 A;  2PRB A;  2OZH A;  4A32 A;  2B4B A;  4ZBG A;  4CYN A;  3S6H A;  3ZZI A;  1M1D A;  2VXK A;  5JQ4 A;  2WPX A;  2REF A;  2VZY A;  4OLL A;  1SQH A;  3VWE A;  1J4J A;  3CXQ A;  3ZJ0 A;  3P2F A;  3SHP A;  2OH1 A;  3FIX A;  5F49 A;  2CNM A;  1IB1 E;  3D8P A;  4UFW A;  3EFA A;  4E2A A;  2JDD A;  2GE3 A;  4C2Z A;  2C27 A;  5CNP A;  1S5K A;  4UA3 A;  3MGD A;  3S6G A;  2FS5 A;  4CYQ A;  2Q04 A;  3IWE A;  4YFJ A;  2HUZ A;  4YGO A;  3BJ8 A;  4NF1 A;  5J8F A;  4OAD A;  2I79 A;  2Q4Y A;  1RXT A;  1YVO A;  2X7B A;  4KSA A;  2ARH A;  4OAE A;  2ZW6 A;  4F0Y A;  4B5P A;  1RO5 A;  1N71 A;  2VQY A;  3DR8 A;  3H5Z A;  4KSF A;  5C82 A;  4MFP A;  3I9S A;  4FD7 A;  3NE7 A;  3SXN A;  3D2M A;  4ONU A;  4AG9 A;  3JVN A;  3FB3 A;  4KUA A;  4CRY B;  3W91 A;  4KVX A;  4Y49 B;  3S6K A;  2A4N A;  4KOY A;  4C7H A;  2Y0M A;  4RI1 A;  1OZP A;  4U9Y A;  2Z3M A;  4MI4 A;  1VHS A;  4CYO A;  2OB0 A;  2D4O A;  2CY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...