4E8OA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ih from acinetobacter baumannii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
147
structure length
147
Chain Sequence
GMNIMPISESQLSDWLALRCLLWPDHEDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNGTQTSPVAFLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aac(6')-Ih protein
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 34
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4e8oA00
2NMTA 3LD2A 4U9ZA 2P6EA 4L8AA 4R9MA 3S6KA 4E8OA 4QB9A 1M44A 4KVME 1MJ9A 3IGRA 2Q4YA 5KTDA 2QECA 3FNCA 1S60A 5H84A 4NF1A 2B5GA 4CRZB 4MJ8A 3FXTA 3DNSA 1SQHA 2B4DB 3CXPA 1RO5A 4FD4A 4RS2A 2C27A 3FB3A 4Y49B 4QBJA 1NSLA 4KLVA 1OZPA 4CAXA 4AG9A 1XF8A 1S5KA 5FVJA 4OADA 3W6SA 1PU9A 3B8GA 3GY9A 1M1DA 2CY2A 3RYOA 4XPLA 4UBRA 4ZBGA 1YK3A 1VKCA 3S6FA 1IYLA 3NE7A 2FL4A 2X7BA 3W6XA 3I3GA 4KUAA 4AVCA 2Z0ZA 3FBUA 5GCNA 2O28A 3R9FA 3C26A 2WPWA 4EVYA 4IUSA 4B5OA 2Z11A 2VZZA 1MK4A 4B5PA 4NEXA 2K5TA 2B4BA 1FY7A 1CM0A 4MI4A 2A4NA 4YRHA 1YLEA 4Y49C 3W91A 3VWDA 2JLMA 4LUAA 5J8CA 2OZUA 1I12A 5KTAA 3F8KA 2GANA 3E0KA 5C82A 5F47A 1IIDA 2FIAA 1QSMA 2GIVA 1P4NA 1M4GA 2ZW4A 4JXQA 4RI1A 2H5MA 2QMLA 3SXOA 1M4IA 3R95A 3ZZIA 4K30A 4QUSA 4M85A 5ISVA 3QAHA 4KOXA 5EBVA 4HNWB 4XPDB 4E0AA 1S7FA 4ONUA 3TE4A 1IYKA 4KOSA 1BOBA 4KVXA 2Q04A 4JJXA 2ATRA 4UWJA 3WR7A 1CJWA 2FXFA 3D8PA 1KZFA 1WWZA 4X5KA 2JDCA 3EO4A 4KOVA 4PV6A 2QIRA 1YX0A 2P6FA 3DR8A 2HQYA 2PR8A 3F0AA 3JVNA 1MJAA 4QVTA 2D4PA 2WPXA 2FS5A 3S6HA 1YR0A 1BO4A 2D4OA 2G3TA 5KTCA 2CNMA 2J8NA 1YREA 3D2PA 2R98A 2DXQA 4NSQA 3R9GA 2ZXVA 2EVNA 3BJ7A 3TCVA 5CNPA 1XEBA 5J8FA 2PDOA 1LRZA 1Q2DA 2FIWA 2G3AA 4UA3A 5DWNA 2Q7BA 4JWPA 2PSWA 3D3SA 1Y9WA 3BLNA 4PK2A 5IX3A 2B3UA 4H6UA 2P0WA 2Z10A 1S3ZA 4FD6A 2HV2A 2B4DA 4KORA 3IWGA 3TO6A 1B87A 3GYAA 2VI7A 1XMTA 3FRMA 4KUBA 1UFHA 4R87A 2R7HA 2F5IA 2VBQA 4AVBA 3P2HA 4NCZA 3T90A 1Q2YA 2ZPAA 1R57A 2G0BA 3PZJA 2RC4A 2KCWA 1L0CA 4M3SA 2EUIA 4AB7A 5F46A 2OZGA 1YVKA 5IB0A 4H89A 4KOUA 2R8VA 2PQ8A 2VQYA 3R96A 4YGOA 4CRYB 3F5BA 4U9YA 1IICA 2B58A 1RXTA 1QSTA 3EC4A 3PGPA 5H86A 2AE6A 2ZW5A 1YGHA 3EFAA 4HKFA 1YVOA 2I79A 4YFJA 3TOBA 4L89A 5HH1A 1U6MA 4UWIA 3G3SA 2BSWA 2BEIA 4BMHA 3KKWA 1S7KA 3I9SA 1NE9A 3H4QA 1KUXA 1WK4A 3ZJ0A 2REFA 1B6BA 1KUYA 4KLWA 5HMNA 4NXYA 3UY5A 1QSRA 4II9A 1PUAA 2Q0YA 4MY3A 5F49A 4KOTA 4JXRA 4PSWA 4MY0A 5JPHA 4XPKA 4E2AA 3FYNA 4GS4A 4DNCA 1TIQA 2P6GA 4R3KA 3EXNA 4PSXA 4H6ZA 4J3GA 2AJ6A 2CNTA 2BL1A 3V8IA 4IF5A 3JUWA 2J8RA 4ORFA 2I00A 1GHEA 2FE7A 2B5GB 3N7ZA 1K4JA 3D2MA 4JLYA 3TT2A 1NMTA 4AG7A 2PRBA 4F0YA 3DSBA 4KOWA 3R1KA 1Z4RA 1KUVA 4XPDC 4MBUA 1Y9KA 4CAWA 4OLLA 4HNYB 2JEVA 1Y7RA 1Z9UA 2VEZA 4U5YA 1N71A 3OWCA 4HNXB 1QSOA 1XE4A 3K9UA 5IV0A 1I21A 4MHDA 2OH1A 2CNSA 1J4JA 1MJBA 2Y0MA 3PP9A 3BJ8A 1S7LA 3FIXA 1Q2CA 4R57A 2VZYA 4R3LA 1S7NA 2R1IA 3CXSA 5C88A 3DDDA 3TO9A 3TOAA 4FD7A 3S6GA 4QC6A 1M4DA 5EC4A 4B5PB 1V0CA 1VHSA 4KVOE 1Z4EA 3T9YA 3VWEA 3DR6A 4XNHB 2FT0A 2VXKA 2ARHA 2REEA 4I49A 3QB8A 4KOYA 2JDDA 1QSNA 3LODA 4CAVA 1XIXA 5E96A 2B3VA 2ZW7A 1ON0A 3P2FA 4FD5A 4F6AA 3SHPA 5I0CA 5F48A 5JQ4A 3R9EA 2PC1A 3MGDA 2BUEA 2FCKA 2GE3A 4OAEA 4LX9A 1IB1E 3TTHA 1I1DA 3GKRA 3TFYA 4PK3A 2OU2A 2Q44A 3SXNA 2PR1A 1P0HA 2J8MA 3EY5A 2Q4VA 3CXQA 5DWMA 4JD6A 2OB0A 4XNHC 2ZW6A 4AVAA 4KZTA 3TO7A 4CS0B 2OZHA 3G8WA 2FSRA 2HUZA 2IL4A
chains in the Genus database with same CATH superfamily
2NMTA 3LD2A 4U9ZA 4KS9A 2GLJA 2P6EA 4L8AA 2YNCC 4R9MA 3S6KA 4E8OA 4FAIA 3PEIA 2G9DA 3TC8A 3HUVA 4QB9A 1M44A 4KVME 3IJ3A 3SI1A 1MJ9A 3IGRA 2Q4YA 4A31A 5KTDA 4TWEA 3GUXA 2QECA 2EBJA 1F2PA 2PJBA 3FNCA 4EWTA 1S60A 1PYTB 3KR5A 4LQ6A 4P44A 4CGLA 1HDQA 5H84A 1Z8LA 1ARMA 4NF1A 4UFWA 5D29A 1ARLA 2B5GA 4MJ8A 4CRZB 4F8ZA 3FXTA 3DNSA 1SQHA 2B4DB 2AFMA 3D4UA 4F9VA 3CXPA 4M6HA 1RO5A 4FD4A 4RS2A 3B3SA 4BINA 1BAVA 2C27A 3FB3A 3GIUA 4Y49B 4QBJA 1NSLA 4C68A 4KLVA 4NGMA 1OZPA 4CAXA 4AG9A 4FBEA 1CPSA 1IU8A 1XF8A 3B3WA 4MFQA 2PVWA 1S5KA 1YQEA 2PCUA 1TF8A 1Z5RA 3PB4X 2PE3A 4MCQA 5FVJA 5LYDA 4OADA 2OOTA 3W6SA 4ZGYB 1PU9A 3B8GA 3GY9A 5F09A 3FF3A 1M1DA 2CY2A 5LRKA 3RYOA 4PXEA 3DGVA 4XPLA 2V8DA 4UBRA 3BI0A 1YK3A 3H5ZA 4ZBGA 5LYFA 1VKCA 1KWMA 4MFPA 4DJLA 3D7FA 3S6FA 1OBRA 4NGRA 1IYLA 3NE7A 2FL4A 4PXBA 2X7BA 4R8FA 3W6XA 4OC5A 3I3GA 4KUAA 4AVCA 2Z0ZA 3FBUA 2ODFA 4K3NA 4B11A 5G22A 5GCNA 1NSAA 2O28A 2PJ8A 2Q7SA 2QJ8A 5AG5A 3R9FA 3C26A 2WPWA 4UCPA 4EVYA 3PFEA 4IUSA 2PJ6A 4B5OA 1XBUA 2Z11A 2VZZA 1MK4A 2DEAA 3WC6A 1IY7A 4A32A 1EE3P 3D67A 1F2OA 2IJZA 4NEXA 2FVGA 4B5PA 2K5TA 2B4BA 1FY7A 1CM0A 4IAVA 2BOAA 4UIAA 1X10A 2ZEGA 4MI4A 1LAPA 2A4NA 2AFOA 4MFLA 4CGNA 4YRHA 3S9LA 4OC0A 2J9AA 2ZEHA 1YLEA 4Y49C 3W91A 3KASA 4KSAA 3VWDA 2JLMA 1CP6A 2EWBA 1Z2LA 4LUAA 3ISXA 5J8CA 2OZUA 1I12A 5KTAA 3F8KA 2GANA 3E0KA 4NFRA 5C82A 5F47A 2CTBA 1IIDA 4UFXA 2FIAA 3PB7X 1QSMA 4ZX8A 3CPAA 2GIVA 4AXVA 5HVHA 1JWQA 3H8EA 1P4NA 4UEFA 1YW6A 1M4GA 2ZW4A 4FUUA 4CYQA 2JBKA 4JXQA 4RI1A 2YNCA 5CPAA 2H5MA 3H8GA 2QMLA 3B3CA 4TNUA 3RAMA 3RZAA 3SXOA 4Z65A 1M4IA 3JRUA 3KR4A 2XEJA 2PJ4A 3R95A 4OMEA 3ZZIA 3S9MA 1RTQA 2GLFA 4K30A 4QUSA 5LYIA 3B7IA 4M85A 5ISVA 1TF9A 3QAHA 4KOXA 1Y0YA 3B35A 4MHYA 5EBVA 1IOIA 3PFOA 4HNWB 4XPDB 4E0AA 3SJGA 3PBBA 1S7FA 1BPNA 4ONUA 4C2XA 3TE4A 3CZXA 4BBHA 1IYKA 4KOSA 4P10A 1BOBA 1UWYA 2Q04A 4JJXA 2ATRA 4KVXA 4M6GA 4Q38A 1CJWA 2EO8A 3NE8A 2FXFA 4UWJA 3WT4A 3D8PA 1H8LA 1CX8A 5ELYA 5D8NA 4B10A 1KZFA 1WWZA 4X5KA 2JDCA 5K8PA 1TKHA 3EO4A 4KOVA 4PV6A 4X2TA 2QIRA 3IFEA 1YX0A 4PPZA 4KSIA 2P6FA 3DR8A 1AMPA 2HQYA 2PR8A 1PCAA 3B3VA 1ZG9A 2Z3KA 3NH8A 4IK2A 1LCPA 3F0AA 4P4DA 3JVNA 1MJAA 4CYOA 4QVTA 1F57A 1Z8TA 2D4PA 3QNVA 2WPXA 3PB6X 1Z8WA 4MXUA 1ELLP 2BCOA 4NGSA 1ZLIA 2CXAA 4MCPA 3BXMA 4A38A 2FS5A 3B3TA 3S6HA 1YR0A 1BO4A 2D4OA 2G3TA 5KTCA 1YMEA 2CNMA 2J8NA 1YREA 3IO1A 3SJEA 4F0XA 3D2PA 5HXDA 2R98A 2DXQA 4NSQA 3R9GA 2ZXVA 1QQ9A 2EVNA 3KHXA 4YWYA 3FECA 3BJ7A 3RO0A 4P4IA 5AG6A 3TCVA 4NGQA 1LOKA 1XFOA 1XEBA 5CNPA 5J8FA 2PDOA 1LRZA 4NGNA 4UEZA 3WR7A 2ABZA 3FVLA 1Q2DA 2FIWA 2G3AA 4KSFA 4UA3A 5DWNA 3TX8A 2Q7BA 4JWPA 2PSWA 3GB0A 3IU1A 3D3SA 5JGFA 2RFHA 1Y7EA 1Y9WA 4M6IA 1ZG7A 2XEGA 3BLNA 4OKOA 4PK2A 4MFZA 4B14A 5IB9A 5IX3A 4UFVA 2B3UA 4H6UA 2P0WA 2Z10A 1S3ZA 2PJAA 2HV2A 4FD6A 2B4DA 4KORA 3IWGA 3FH4A 3KQXA 4WJBA 3TO6A 1B87A 2WUUA 3GYAA 2VI7A 1XMTA 3FRMA 4C7HA 2AFWA 2ZEMA 2AFZA 3RNZA 4KUBA 3SJXA 1UFHA 5BWAB 1XJOA 4R87A 2R7HA 2F5IA 2AFXA 2Q51A 2VBQA 4DYOA 3KZWA 3A9LA 2GU2A 4C2YA 1YSJA 3CDXA 6CPAA 4AVBA 3P2HA 2HC9A 2QYVA 5G21A 4G1PA 4MCSA 1FT7A 1YLOA 4NCZA 3T90A 3V38A 1R43A 1Q2YA 3RBUA 3IIBA 1CP7A 2ZPAA 3I1UA 1R57A 4OC1A 5DS0A 3LWUA 2YGWA 2G0BA 3PZJA 2DPTA 2OR4A 4Q7AA 2F7VA 4P4JA 4CGPA 4A33A 3PB8X 2RC4A 2KCWA 1L0CA 1LANA 2EUIA 3KI9A 4M3SA 4AB7A 5F46A 2OZGA 4P4EA 1YVKA 2CF4A 1DE4C 4H89A 4KOUA 2R8VA 5IB0A 3B2YA 4YU9A 2PJ9A 2PQ8A 2VQYA 3BHXA 3R96A 4YGOA 4CRYB 3F5BA 4U9YA 1IICA 2B58A 3KHZA 2PRQA 1RXTA 5HVFA 4A30A 1QSTA 2RB7A 1IGBA 4OIDA 3V7ZA 5K8NA 3EC4A 3FMCA 3PGPA 5H86A 2AE6A 2ZW5A 4OIWA 1YGHA 3EFAA 4HKFA 1YVOA 2I79A 4YFJA 3DLJA 1DTDA 4FWUA 3TOBA 2VL1A 2AFSA 4L89A 5HH1A 4OC3A 1U6MA 4UWIA 2CIJA 3G3SA 2BSWA 5AG4A 5A27A 2BEIA 2YNDA 3IEHA 3PRTA 3T8WA 3NH5A 4BMHA 5HVGA 1XOVA 1R3NA 3K2KA 3KKWA 3KQZA 1S7KA 3CPXA 3VARA 4P45A 3I9SA 4MRIA 1NE9A 4RUHA 5JH9A 1Y0RA 3H4QA 3IWWA 1HDUA 1QMUA 1KUXA 1WK4A 3IWEA 2F8HA 3ZJ0A 2AFUA 2NSMA 2REFA 1B6BA 1KUYA 1VIXA 4KLWA 3VATA 1HEEA 5HMNA 4NXYA 3UY5A 1QSRA 4II9A 1M4LA 4CYPA 1PUAA 2Q0YA 4EFDA 4GXHA 4MY3A 4UEEA 5F49A 1CPXA 3FX6A 4KOTA 1TXRA 3N5FA 3SI0A 4JXRA 4PSWA 4MY0A 5JPHA 4UCMA 4XPKA 4E2AA 4ZI6A 5CBMA 3FYNA 2ZEEA 2IQ6A 5THWA 1Z8XA 4GS4A 4DNCA 1TIQA 2C6CA 4P4FA 2P6GA 3IU2A 4R3KA 3EXNA 4PSXA 3NA6A 1AYEA 1TKFA 1BPMA 4H6ZA 1YW4A 2Q4ZA 3VH9A 4J3GA 2AJ6A 3NH4A 3FEDA 2CNTA 2BL1A 3V8IA 1LAMA 2O4HA 2Z3NA 4CYNA 2PVVA 4IF5A 3JUWA 4ZX9A 2J8RA 5G20A 4ORFA 2I00A 2JBJA 1GHEA 3ISZA 5JM6A 3CT9A 2FE7A 3K9TA 2B5GB 1TKJA 2ZOFA 3IC1A 3PB9X 2IMOA 4HPSA 4LQGA 4NGPA 4UIBA 2PJ5A 3N7ZA 1ZLHA 3GLJA 1ELMP 1K4JA 3D2MA 4JLYA 3TT2A 3FJUA 1NMTA 4OC2A 4AG7A 2PRBA 4F0YA 4PXCA 4JYWA 3WABA 3DSBA 4KOWA 4A37A 3R1KA 1FNOA 1Z4RA 5K8OA 1KUVA 3PBEA 2BO9A 4XPDC 1VHOA 4MBUA 4CGOA 1Y9KA 2WYRA 2Q43A 3JTKA 4CAFA 4CAWA 8CPAA 4OLLA 3S9NA 5J1QA 2XEIA 4HNYB 2XEFA 3D68A 5AG7A 2DPSA 2JEVA 4JZ0A 5A28A 1Y7RA 1Z9UA 2VEZA 4ONWA 2ZEPA 1CG2A 4MMOA 4U5YA 1N71A 3OWCA 1QSOA 3LMSA 1XE4A 4HNXB 3FEEA 1Q7LA 4A2ZA 3K9UA 5IV0A 5G1ZA 2C1CA 4B13A 2EK9A 2V77A 1LFWA 1I21A 2V8GA 4MHDA 4MCRA 5LYLA 2OH1A 3D7GA 2CNSA 3KL9A 1VGYA 1J4JA 1MJBA 2Y0MA 2C6PA 2Z3PA 2PJ0A 2GFQA 3MN8A 3PP9A 3BJ8A 4CAEA 4R76A 1S7LA 2HB6A 3FIXA 1Q2CA 4GM5A 4R57A 2VZYA 2CTCA 4R3LA 4ZY2A 4CPAA 1S7NA 2I3CA 5I4MA 4X3RA 2R1IA 3CXSA 5C88A 4A94A 1CBXA 2JEWA 3DDDA 3TO9A 3TOAA 5K8MA 3MRUA 1VHEA 1A2ZA 4FD7A 4QC6A 3S6GA 3SI2A 1M4DA 4C2ZA 4BD9A 5EC4A 4C7IA 4B12A 4B5PB 2ZELA 4O23A 1IOFA 1V0CA 2PIZA 1GYTA 1VHSA 4KVOE 4UF4A 3KGQA 4MHPA 1Z4EA 3T9YA 4R7MA 2ZEDA 3VWEA 2Z3OA 4PQAA 2GREA 2QVPA 3DR6A 4XNHB 3BI1A 3SJFA 3D66A 2FT0A 2VXKA 2ARHA 2PJ1A 2REEA 4I49A 3QB8A 4ZYQA 2YNEA 3HLPA 4KOYA 2JDDA 4B6ZA 1X12A 1QSNA 2V8VA 3LODA 4OC4A 5AGEA 4CAVA 4ZY1A 1XIXA 5E96A 2B3VA 2NYQA 4MFKA 2ZW7A 2DF5A 1ON0A 4W9YA 3P2FA 4FD5A 2PJCA 4F6AA 3SHPA 4A39A 5I0CA 1XRYA 4OP4A 5F48A 4NJRA 5JQ4A 2Z3MA 3R9EA 4MHNA 1BLLE 4NJQA 2PC1A 2ZEOA 3D7DA 3MGDA 2ANPA 4CGMA 2BUEA 3LACA 2FCKA 2GE3A 4OAEA 2Z3LA 4LX9A 1IB1E 2PJ2A 1AUGA 4EMEA 3TTHA 4UCNA 1I1DA 1ZG8A 3GKRA 3TFYA 2POKA 4PK3A 2OU2A 3NFZA 2Q44A 3SXNA 4PXDA 2PR1A 1P0HA 2EK8A 1ZO0A 2J8MA 5LRJA 3EY5A 2Q4VA 4P6YA 7CPAA 3CXQA 3D7HA 5DWMA 4JD6A 5EMIA 4ZY0A 4F9UA 2WSAA 2OB0A 3QAYA 4Q36A 2PJ7A 4XNHC 4DUKA 4MFJA 2ZW6A 2PJ3A 4WWVA 3H8FA 1JQGA 4R6TA 4AVAA 2PIYA 2ZOGA 4KZTA 2ZEFA 4NGTA 4X8IA 2O53A 4RN7A 3WC5A 4H2KA 3TO7A 4IHMA 2WZNA 4A95A 4MHZA 3L2NA 4CS0B 2OZHA 3G8WA 2FSRA 3WC7A 5LRGA 1XMBA 2C6GA 2HUZA 4P4BA 2V8HA 2IL4A 2ZENA
chains in the Genus database with same CATH topology
2NMTA 3LD2A 4U9ZA 4KS9A 2P6EA 4L8AA 2YNCC 4R9MA 3S6KA 4E8OA 4QB9A 1M44A 4KVME 1MJ9A 3IGRA 2Q4YA 4A31A 5KTDA 2QECA 3FNCA 1S60A 4CGLA 5H84A 4NF1A 4UFWA 2B5GA 4CRZB 4MJ8A 3FXTA 3DNSA 1SQHA 2B4DB 3CXPA 1RO5A 4FD4A 4RS2A 2C27A 3FB3A 4Y49B 4QBJA 1NSLA 4C68A 4KLVA 1OZPA 4CAXA 4AG9A 1XF8A 4MFQA 1S5KA 5FVJA 4OADA 3W6SA 4ZGYB 1PU9A 3B8GA 3GY9A 1M1DA 2CY2A 3RYOA 4XPLA 4UBRA 4ZBGA 1YK3A 3H5ZA 1VKCA 4MFPA 3S6FA 1IYLA 3NE7A 2FL4A 2X7BA 3W6XA 3I3GA 4KUAA 4AVCA 2Z0ZA 3FBUA 4B11A 5G22A 5GCNA 2O28A 5AG5A 3R9FA 3C26A 2WPWA 4UCPA 4EVYA 4IUSA 4B5OA 2Z11A 2VZZA 1MK4A 4A32A 4B5PA 4NEXA 2K5TA 2B4BA 1FY7A 1CM0A 4MI4A 4CGNA 2A4NA 4MFLA 4YRHA 1YLEA 4Y49C 3W91A 4KSAA 3VWDA 2JLMA 4LUAA 5J8CA 2OZUA 1I12A 5KTAA 3F8KA 2GANA 3E0KA 5C82A 5F47A 1IIDA 4UFXA 2FIAA 1QSMA 2GIVA 1P4NA 1M4GA 2ZW4A 4CYQA 4JXQA 4RI1A 2YNCA 2H5MA 2QMLA 3SXOA 1M4IA 3R95A 3ZZIA 4K30A 4QUSA 4M85A 5ISVA 3QAHA 4KOXA 5EBVA 4HNWB 4XPDB 4E0AA 1S7FA 4ONUA 4C2XA 3TE4A 4BBHA 1IYKA 4KOSA 1BOBA 4KVXA 2Q04A 4JJXA 2ATRA 4Q38A 4UWJA 3WR7A 1CJWA 2FXFA 3D8PA 4B10A 1KZFA 1WWZA 4X5KA 2JDCA 3EO4A 4KOVA 4PV6A 2QIRA 1YX0A 2P6FA 3DR8A 2HQYA 2PR8A 2Z3KA 3F0AA 3JVNA 1MJAA 4CYOA 4QVTA 2D4PA 2WPXA 2CXAA 2FS5A 3S6HA 1YR0A 1BO4A 2D4OA 2G3TA 5KTCA 2CNMA 2J8NA 1YREA 4F0XA 3D2PA 2R98A 2DXQA 4NSQA 3R9GA 2ZXVA 2EVNA 3BJ7A 5AG6A 3TCVA 5CNPA 1XEBA 5J8FA 2PDOA 1LRZA 1Q2DA 2FIWA 2G3AA 4KSFA 4UA3A 5DWNA 2Q7BA 4JWPA 2PSWA 3IU1A 3D3SA 1Y9WA 4B14A 3BLNA 4PK2A 4MFZA 5IX3A 4UFVA 2B3UA 4H6UA 2P0WA 2Z10A 1S3ZA 4FD6A 2HV2A 2B4DA 4KORA 3IWGA 3TO6A 1B87A 3GYAA 2WUUA 2VI7A 1XMTA 3FRMA 4C7HA 4KUBA 1UFHA 5BWAB 4R87A 2R7HA 2F5IA 2VBQA 4C2YA 3A9LA 4AVBA 3P2HA 5G21A 4NCZA 3T90A 1Q2YA 2ZPAA 1R57A 2YGWA 2G0BA 3PZJA 2DPTA 4CGPA 4A33A 2RC4A 2KCWA 1L0CA 4M3SA 2EUIA 4AB7A 5F46A 2OZGA 1YVKA 5IB0A 4H89A 4KOUA 2R8VA 2PQ8A 2VQYA 3R96A 4YGOA 4CRYB 3F5BA 4U9YA 1IICA 2B58A 4A30A 1RXTA 1QSTA 3EC4A 3PGPA 5H86A 2AE6A 2ZW5A 1YGHA 3EFAA 4HKFA 1YVOA 2I79A 4YFJA 3TOBA 4L89A 5HH1A 1U6MA 4UWIA 5AG4A 3G3SA 2BSWA 5A27A 2BEIA 2YNDA 4BMHA 3KKWA 1S7KA 3I9SA 1NE9A 3H4QA 1KUXA 1WK4A 3IWEA 3ZJ0A 2REFA 1B6BA 1KUYA 4KLWA 5HMNA 4NXYA 3UY5A 1QSRA 4II9A 4CYPA 1PUAA 2Q0YA 4MY3A 5F49A 4KOTA 4JXRA 4PSWA 4MY0A 5JPHA 4UCMA 4XPKA 4E2AA 3FYNA 4GS4A 4DNCA 1TIQA 2P6GA 3IU2A 4R3KA 3EXNA 4PSXA 4H6ZA 4J3GA 2AJ6A 2CNTA 2BL1A 3V8IA 2Z3NA 4CYNA 4IF5A 3JUWA 2J8RA 5G20A 4ORFA 2I00A 1GHEA 2FE7A 2B5GB 3N7ZA 1K4JA 3D2MA 4JLYA 3TT2A 1NMTA 4AG7A 2PRBA 4F0YA 3DSBA 4KOWA 3R1KA 1Z4RA 1KUVA 4XPDC 4MBUA 4CGOA 1Y9KA 3JTKA 4CAFA 4CAWA 4OLLA 4HNYB 5AG7A 2DPSA 2JEVA 5A28A 1Y7RA 1Z9UA 2VEZA 4U5YA 1N71A 3OWCA 4HNXB 1QSOA 1XE4A 4A2ZA 3K9UA 5IV0A 5G1ZA 4B13A 1I21A 4MHDA 2OH1A 2CNSA 1J4JA 1MJBA 2Y0MA 2Z3PA 3PP9A 4CAEA 3BJ8A 1S7LA 3FIXA 1Q2CA 4R57A 2VZYA 4R3LA 1S7NA 2R1IA 3CXSA 5C88A 3DDDA 3TO9A 3TOAA 4FD7A 3S6GA 4QC6A 1M4DA 4C2ZA 5EC4A 4C7IA 4B12A 4B5PB 1V0CA 1VHSA 4KVOE 1Z4EA 3T9YA 3VWEA 2Z3OA 3DR6A 4XNHB 2FT0A 2VXKA 2ARHA 2REEA 4I49A 3QB8A 2YNEA 4KOYA 2JDDA 1QSNA 3LODA 5AGEA 4CAVA 1XIXA 5E96A 2B3VA 4MFKA 2ZW7A 1ON0A 3P2FA 4FD5A 4F6AA 3SHPA 5I0CA 5F48A 5JQ4A 2Z3MA 3R9EA 2PC1A 3MGDA 4CGMA 2BUEA 2FCKA 2GE3A 4OAEA 2Z3LA 4LX9A 1IB1E 3TTHA 4UCNA 1I1DA 3GKRA 3TFYA 4PK3A 2OU2A 2Q44A 3SXNA 2PR1A 1P0HA 1ZO0A 2J8MA 3EY5A 2Q4VA 3CXQA 5DWMA 4JD6A 2WSAA 2OB0A 4XNHC 4Q36A 4MFJA 2ZW6A 4AVAA 4KZTA 3TO7A 4A95A 4CS0B 2OZHA 3G8WA 2FSRA 2HUZA 2IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMT A;  3LD2 A;  4U9Z A;  2P6E A;  4L8A A;  4R9M A;  3S6K A;  4E8O A;  4QB9 A;  1M44 A;  4KVM E;  1MJ9 A;  3IGR A;  2Q4Y A;  5KTD A;  2QEC A;  3FNC A;  1S60 A;  5H84 A;  4NF1 A;  2B5G A;  4CRZ B;  4MJ8 A;  3FXT A;  3DNS A;  1SQH A;  2B4D B;  3CXP A;  1RO5 A;  4FD4 A;  4RS2 A;  2C27 A;  3FB3 A;  4Y49 B;  4QBJ A;  1NSL A;  4KLV A;  1OZP A;  4CAX A;  4AG9 A;  1XF8 A;  1S5K A;  5FVJ A;  4OAD A;  3W6S A;  1PU9 A;  3B8G A;  3GY9 A;  1M1D A;  2CY2 A;  3RYO A;  4XPL A;  4UBR A;  4ZBG A;  1YK3 A;  1VKC A;  3S6F A;  1IYL A;  3NE7 A;  2FL4 A;  2X7B A;  3W6X A;  3I3G A;  4KUA A;  4AVC A;  2Z0Z A;  3FBU A;  5GCN A;  2O28 A;  3R9F A;  3C26 A;  2WPW A;  4EVY A;  4IUS A;  4B5O A;  2Z11 A;  2VZZ A;  1MK4 A;  4B5P A;  4NEX A;  2K5T A;  2B4B A;  1FY7 A;  1CM0 A;  4MI4 A;  2A4N A;  4YRH A;  1YLE A;  4Y49 C;  3W91 A;  3VWD A;  2JLM A;  4LUA A;  5J8C A;  2OZU A;  1I12 A;  5KTA A;  3F8K A;  2GAN A;  3E0K A;  5C82 A;  5F47 A;  1IID A;  2FIA A;  1QSM A;  2GIV A;  1P4N A;  1M4G A;  2ZW4 A;  4JXQ A;  4RI1 A;  2H5M A;  2QML A;  3SXO A;  1M4I A;  3R95 A;  3ZZI A;  4K30 A;  4QUS A;  4M85 A;  5ISV A;  3QAH A;  4KOX A;  5EBV A;  4HNW B;  4XPD B;  4E0A A;  1S7F A;  4ONU A;  3TE4 A;  1IYK A;  4KOS A;  1BOB A;  4KVX A;  2Q04 A;  4JJX A;  2ATR A;  4UWJ A;  3WR7 A;  1CJW A;  2FXF A;  3D8P A;  1KZF A;  1WWZ A;  4X5K A;  2JDC A;  3EO4 A;  4KOV A;  4PV6 A;  2QIR A;  1YX0 A;  2P6F A;  3DR8 A;  2HQY A;  2PR8 A;  3F0A A;  3JVN A;  1MJA A;  4QVT A;  2D4P A;  2WPX A;  2FS5 A;  3S6H A;  1YR0 A;  1BO4 A;  2D4O A;  2G3T A;  5KTC A;  2CNM A;  2J8N A;  1YRE A;  3D2P A;  2R98 A;  2DXQ A;  4NSQ A;  3R9G A;  2ZXV A;  2EVN A;  3BJ7 A;  3TCV A;  5CNP A;  1XEB A;  5J8F A;  2PDO A;  1LRZ A;  1Q2D A;  2FIW A;  2G3A A;  4UA3 A;  5DWN A;  2Q7B A;  4JWP A;  2PSW A;  3D3S A;  1Y9W A;  3BLN A;  4PK2 A;  5IX3 A;  2B3U A;  4H6U A;  2P0W A;  2Z10 A;  1S3Z A;  4FD6 A;  2HV2 A;  2B4D A;  4KOR A;  3IWG A;  3TO6 A;  1B87 A;  3GYA A;  2VI7 A;  1XMT A;  3FRM A;  4KUB A;  1UFH A;  4R87 A;  2R7H A;  2F5I A;  2VBQ A;  4AVB A;  3P2H A;  4NCZ A;  3T90 A;  1Q2Y A;  2ZPA A;  1R57 A;  2G0B A;  3PZJ A;  2RC4 A;  2KCW A;  1L0C A;  4M3S A;  2EUI A;  4AB7 A;  5F46 A;  2OZG A;  1YVK A;  5IB0 A;  4H89 A;  4KOU A;  2R8V A;  2PQ8 A;  2VQY A;  3R96 A;  4YGO A;  4CRY B;  3F5B A;  4U9Y A;  1IIC A;  2B58 A;  1RXT A;  1QST A;  3EC4 A;  3PGP A;  5H86 A;  2AE6 A;  2ZW5 A;  1YGH A;  3EFA A;  4HKF A;  1YVO A;  2I79 A;  4YFJ A;  3TOB A;  4L89 A;  5HH1 A;  1U6M A;  4UWI A;  3G3S A;  2BSW A;  2BEI A;  4BMH A;  3KKW A;  1S7K A;  3I9S A;  1NE9 A;  3H4Q A;  1KUX A;  1WK4 A;  3ZJ0 A;  2REF A;  1B6B A;  1KUY A;  4KLW A;  5HMN A;  4NXY A;  3UY5 A;  1QSR A;  4II9 A;  1PUA A;  2Q0Y A;  4MY3 A;  5F49 A;  4KOT A;  4JXR A;  4PSW A;  4MY0 A;  5JPH A;  4XPK A;  4E2A A;  3FYN A;  4GS4 A;  4DNC A;  1TIQ A;  2P6G A;  4R3K A;  3EXN A;  4PSX A;  4H6Z A;  4J3G A;  2AJ6 A;  2CNT A;  2BL1 A;  3V8I A;  4IF5 A;  3JUW A;  2J8R A;  4ORF A;  2I00 A;  1GHE A;  2FE7 A;  2B5G B;  3N7Z A;  1K4J A;  3D2M A;  4JLY A;  3TT2 A;  1NMT A;  4AG7 A;  2PRB A;  4F0Y A;  3DSB A;  4KOW A;  3R1K A;  1Z4R A;  1KUV A;  4XPD C;  4MBU A;  1Y9K A;  4CAW A;  4OLL A;  4HNY B;  2JEV A;  1Y7R A;  1Z9U A;  2VEZ A;  4U5Y A;  1N71 A;  3OWC A;  4HNX B;  1QSO A;  1XE4 A;  3K9U A;  5IV0 A;  1I21 A;  4MHD A;  2OH1 A;  2CNS A;  1J4J A;  1MJB A;  2Y0M A;  3PP9 A;  3BJ8 A;  1S7L A;  3FIX A;  1Q2C A;  4R57 A;  2VZY A;  4R3L A;  1S7N A;  2R1I A;  3CXS A;  5C88 A;  3DDD A;  3TO9 A;  3TOA A;  4FD7 A;  3S6G A;  4QC6 A;  1M4D A;  5EC4 A;  4B5P B;  1V0C A;  1VHS A;  4KVO E;  1Z4E A;  3T9Y A;  3VWE A;  3DR6 A;  4XNH B;  2FT0 A;  2VXK A;  2ARH A;  2REE A;  4I49 A;  3QB8 A;  4KOY A;  2JDD A;  1QSN A;  3LOD A;  4CAV A;  1XIX A;  5E96 A;  2B3V A;  2ZW7 A;  1ON0 A;  3P2F A;  4FD5 A;  4F6A A;  3SHP A;  5I0C A;  5F48 A;  5JQ4 A;  3R9E A;  2PC1 A;  3MGD A;  2BUE A;  2FCK A;  2GE3 A;  4OAE A;  4LX9 A;  1IB1 E;  3TTH A;  1I1D A;  3GKR A;  3TFY A;  4PK3 A;  2OU2 A;  2Q44 A;  3SXN A;  2PR1 A;  1P0H A;  2J8M A;  3EY5 A;  2Q4V A;  3CXQ A;  5DWM A;  4JD6 A;  2OB0 A;  4XNH C;  2ZW6 A;  4AVA A;  4KZT A;  3TO7 A;  4CS0 B;  2OZH A;  3G8W A;  2FSR A;  2HUZ A;  2IL4 A; 
#chains in the Genus database with same CATH topology
 2NMT A;  3LD2 A;  4U9Z A;  4KS9 A;  2GLJ A;  2P6E A;  4L8A A;  2YNC C;  4R9M A;  3S6K A;  4E8O A;  4FAI A;  3PEI A;  2G9D A;  3TC8 A;  3HUV A;  4QB9 A;  1M44 A;  4KVM E;  3IJ3 A;  3SI1 A;  1MJ9 A;  3IGR A;  2Q4Y A;  4A31 A;  5KTD A;  4TWE A;  3GUX A;  2QEC A;  2EBJ A;  1F2P A;  2PJB A;  3FNC A;  4EWT A;  1S60 A;  1PYT B;  3KR5 A;  4LQ6 A;  4P44 A;  4CGL A;  1HDQ A;  5H84 A;  1Z8L A;  1ARM A;  4NF1 A;  4UFW A;  5D29 A;  1ARL A;  2B5G A;  4MJ8 A;  4CRZ B;  4F8Z A;  3FXT A;  3DNS A;  1SQH A;  2B4D B;  2AFM A;  3D4U A;  4F9V A;  3CXP A;  4M6H A;  1RO5 A;  4FD4 A;  4RS2 A;  3B3S A;  4BIN A;  1BAV A;  2C27 A;  3FB3 A;  3GIU A;  4Y49 B;  4QBJ A;  1NSL A;  4C68 A;  4KLV A;  4NGM A;  1OZP A;  4CAX A;  4AG9 A;  4FBE A;  1CPS A;  1IU8 A;  1XF8 A;  3B3W A;  4MFQ A;  2PVW A;  1S5K A;  1YQE A;  2PCU A;  1TF8 A;  1Z5R A;  3PB4 X;  2PE3 A;  4MCQ A;  5FVJ A;  5LYD A;  4OAD A;  2OOT A;  3W6S A;  4ZGY B;  1PU9 A;  3B8G A;  3GY9 A;  5F09 A;  3FF3 A;  1M1D A;  2CY2 A;  5LRK A;  3RYO A;  4PXE A;  3DGV A;  4XPL A;  2V8D A;  4UBR A;  3BI0 A;  1YK3 A;  3H5Z A;  4ZBG A;  5LYF A;  1VKC A;  1KWM A;  4MFP A;  4DJL A;  3D7F A;  3S6F A;  1OBR A;  4NGR A;  1IYL A;  3NE7 A;  2FL4 A;  4PXB A;  2X7B A;  4R8F A;  3W6X A;  4OC5 A;  3I3G A;  4KUA A;  4AVC A;  2Z0Z A;  3FBU A;  2ODF A;  4K3N A;  4B11 A;  5G22 A;  5GCN A;  1NSA A;  2O28 A;  2PJ8 A;  2Q7S A;  2QJ8 A;  5AG5 A;  3R9F A;  3C26 A;  2WPW A;  4UCP A;  4EVY A;  3PFE A;  4IUS A;  2PJ6 A;  4B5O A;  1XBU A;  2Z11 A;  2VZZ A;  1MK4 A;  2DEA A;  3WC6 A;  1IY7 A;  4A32 A;  1EE3 P;  3D67 A;  1F2O A;  2IJZ A;  4NEX A;  2FVG A;  4B5P A;  2K5T A;  2B4B A;  1FY7 A;  1CM0 A;  4IAV A;  2BOA A;  4UIA A;  1X10 A;  2ZEG A;  4MI4 A;  1LAP A;  2A4N A;  2AFO A;  4MFL A;  4CGN A;  4YRH A;  3S9L A;  4OC0 A;  2J9A A;  2ZEH A;  1YLE A;  4Y49 C;  3W91 A;  3KAS A;  4KSA A;  3VWD A;  2JLM A;  1CP6 A;  2EWB A;  1Z2L A;  4LUA A;  3ISX A;  5J8C A;  2OZU A;  1I12 A;  5KTA A;  3F8K A;  2GAN A;  3E0K A;  4NFR A;  5C82 A;  5F47 A;  2CTB A;  1IID A;  4UFX A;  2FIA A;  3PB7 X;  1QSM A;  4ZX8 A;  3CPA A;  2GIV A;  4AXV A;  5HVH A;  1JWQ A;  3H8E A;  1P4N A;  4UEF A;  1YW6 A;  1M4G A;  2ZW4 A;  4FUU A;  4CYQ A;  2JBK A;  4JXQ A;  4RI1 A;  2YNC A;  5CPA A;  2H5M A;  3H8G A;  2QML A;  3B3C A;  4TNU A;  3RAM A;  3RZA A;  3SXO A;  4Z65 A;  1M4I A;  3JRU A;  3KR4 A;  2XEJ A;  2PJ4 A;  3R95 A;  4OME A;  3ZZI A;  3S9M A;  1RTQ A;  2GLF A;  4K30 A;  4QUS A;  5LYI A;  3B7I A;  4M85 A;  5ISV A;  1TF9 A;  3QAH A;  4KOX A;  1Y0Y A;  3B35 A;  4MHY A;  5EBV A;  1IOI A;  3PFO A;  4HNW B;  4XPD B;  4E0A A;  3SJG A;  3PBB A;  1S7F A;  1BPN A;  4ONU A;  4C2X A;  3TE4 A;  3CZX A;  4BBH A;  1IYK A;  4KOS A;  4P10 A;  1BOB A;  1UWY A;  2Q04 A;  4JJX A;  2ATR A;  4KVX A;  4M6G A;  4Q38 A;  1CJW A;  2EO8 A;  3NE8 A;  2FXF A;  4UWJ A;  3WT4 A;  3D8P A;  1H8L A;  1CX8 A;  5ELY A;  5D8N A;  4B10 A;  1KZF A;  1WWZ A;  4X5K A;  2JDC A;  5K8P A;  1TKH A;  3EO4 A;  4KOV A;  4PV6 A;  4X2T A;  2QIR A;  3IFE A;  1YX0 A;  4PPZ A;  4KSI A;  2P6F A;  3DR8 A;  1AMP A;  2HQY A;  2PR8 A;  1PCA A;  3B3V A;  1ZG9 A;  2Z3K A;  3NH8 A;  4IK2 A;  1LCP A;  3F0A A;  4P4D A;  3JVN A;  1MJA A;  4CYO A;  4QVT A;  1F57 A;  1Z8T A;  2D4P A;  3QNV A;  2WPX A;  3PB6 X;  1Z8W A;  4MXU A;  1ELL P;  2BCO A;  4NGS A;  1ZLI A;  2CXA A;  4MCP A;  3BXM A;  4A38 A;  2FS5 A;  3B3T A;  3S6H A;  1YR0 A;  1BO4 A;  2D4O A;  2G3T A;  5KTC A;  1YME A;  2CNM A;  2J8N A;  1YRE A;  3IO1 A;  3SJE A;  4F0X A;  3D2P A;  5HXD A;  2R98 A;  2DXQ A;  4NSQ A;  3R9G A;  2ZXV A;  1QQ9 A;  2EVN A;  3KHX A;  4YWY A;  3FEC A;  3BJ7 A;  3RO0 A;  4P4I A;  5AG6 A;  3TCV A;  4NGQ A;  1LOK A;  1XFO A;  1XEB A;  5CNP A;  5J8F A;  2PDO A;  1LRZ A;  4NGN A;  4UEZ A;  3WR7 A;  2ABZ A;  3FVL A;  1Q2D A;  2FIW A;  2G3A A;  4KSF A;  4UA3 A;  5DWN A;  3TX8 A;  2Q7B A;  4JWP A;  2PSW A;  3GB0 A;  3IU1 A;  3D3S A;  5JGF A;  2RFH A;  1Y7E A;  1Y9W A;  4M6I A;  1ZG7 A;  2XEG A;  3BLN A;  4OKO A;  4PK2 A;  4MFZ A;  4B14 A;  5IB9 A;  5IX3 A;  4UFV A;  2B3U A;  4H6U A;  2P0W A;  2Z10 A;  1S3Z A;  2PJA A;  2HV2 A;  4FD6 A;  2B4D A;  4KOR A;  3IWG A;  3FH4 A;  3KQX A;  4WJB A;  3TO6 A;  1B87 A;  2WUU A;  3GYA A;  2VI7 A;  1XMT A;  3FRM A;  4C7H A;  2AFW A;  2ZEM A;  2AFZ A;  3RNZ A;  4KUB A;  3SJX A;  1UFH A;  5BWA B;  1XJO A;  4R87 A;  2R7H A;  2F5I A;  2AFX A;  2Q51 A;  2VBQ A;  4DYO A;  3KZW A;  3A9L A;  2GU2 A;  4C2Y A;  1YSJ A;  3CDX A;  6CPA A;  4AVB A;  3P2H A;  2HC9 A;  2QYV A;  5G21 A;  4G1P A;  4MCS A;  1FT7 A;  1YLO A;  4NCZ A;  3T90 A;  3V38 A;  1R43 A;  1Q2Y A;  3RBU A;  3IIB A;  1CP7 A;  2ZPA A;  3I1U A;  1R57 A;  4OC1 A;  5DS0 A;  3LWU A;  2YGW A;  2G0B A;  3PZJ A;  2DPT A;  2OR4 A;  4Q7A A;  2F7V A;  4P4J A;  4CGP A;  4A33 A;  3PB8 X;  2RC4 A;  2KCW A;  1L0C A;  1LAN A;  2EUI A;  3KI9 A;  4M3S A;  4AB7 A;  5F46 A;  2OZG A;  4P4E A;  1YVK A;  2CF4 A;  1DE4 C;  4H89 A;  4KOU A;  2R8V A;  5IB0 A;  3B2Y A;  4YU9 A;  2PJ9 A;  2PQ8 A;  2VQY A;  3BHX A;  3R96 A;  4YGO A;  4CRY B;  3F5B A;  4U9Y A;  1IIC A;  2B58 A;  3KHZ A;  2PRQ A;  1RXT A;  5HVF A;  4A30 A;  1QST A;  2RB7 A;  1IGB A;  4OID A;  3V7Z A;  5K8N A;  3EC4 A;  3FMC A;  3PGP A;  5H86 A;  2AE6 A;  2ZW5 A;  4OIW A;  1YGH A;  3EFA A;  4HKF A;  1YVO A;  2I79 A;  4YFJ A;  3DLJ A;  1DTD A;  4FWU A;  3TOB A;  2VL1 A;  2AFS A;  4L89 A;  5HH1 A;  4OC3 A;  1U6M A;  4UWI A;  2CIJ A;  3G3S A;  2BSW A;  5AG4 A;  5A27 A;  2BEI A;  2YND A;  3IEH A;  3PRT A;  3T8W A;  3NH5 A;  4BMH A;  5HVG A;  1XOV A;  1R3N A;  3K2K A;  3KKW A;  3KQZ A;  1S7K A;  3CPX A;  3VAR A;  4P45 A;  3I9S A;  4MRI A;  1NE9 A;  4RUH A;  5JH9 A;  1Y0R A;  3H4Q A;  3IWW A;  1HDU A;  1QMU A;  1KUX A;  1WK4 A;  3IWE A;  2F8H A;  3ZJ0 A;  2AFU A;  2NSM A;  2REF A;  1B6B A;  1KUY A;  1VIX A;  4KLW A;  3VAT A;  1HEE A;  5HMN A;  4NXY A;  3UY5 A;  1QSR A;  4II9 A;  1M4L A;  4CYP A;  1PUA A;  2Q0Y A;  4EFD A;  4GXH A;  4MY3 A;  4UEE A;  5F49 A;  1CPX A;  3FX6 A;  4KOT A;  1TXR A;  3N5F A;  3SI0 A;  4JXR A;  4PSW A;  4MY0 A;  5JPH A;  4UCM A;  4XPK A;  4E2A A;  4ZI6 A;  5CBM A;  3FYN A;  2ZEE A;  2IQ6 A;  5THW A;  1Z8X A;  4GS4 A;  4DNC A;  1TIQ A;  2C6C A;  4P4F A;  2P6G A;  3IU2 A;  4R3K A;  3EXN A;  4PSX A;  3NA6 A;  1AYE A;  1TKF A;  1BPM A;  4H6Z A;  1YW4 A;  2Q4Z A;  3VH9 A;  4J3G A;  2AJ6 A;  3NH4 A;  3FED A;  2CNT A;  2BL1 A;  3V8I A;  1LAM A;  2O4H A;  2Z3N A;  4CYN A;  2PVV A;  4IF5 A;  3JUW A;  4ZX9 A;  2J8R A;  5G20 A;  4ORF A;  2I00 A;  2JBJ A;  1GHE A;  3ISZ A;  5JM6 A;  3CT9 A;  2FE7 A;  3K9T A;  2B5G B;  1TKJ A;  2ZOF A;  3IC1 A;  3PB9 X;  2IMO A;  4HPS A;  4LQG A;  4NGP A;  4UIB A;  2PJ5 A;  3N7Z A;  1ZLH A;  3GLJ A;  1ELM P;  1K4J A;  3D2M A;  4JLY A;  3TT2 A;  3FJU A;  1NMT A;  4OC2 A;  4AG7 A;  2PRB A;  4F0Y A;  4PXC A;  4JYW A;  3WAB A;  3DSB A;  4KOW A;  4A37 A;  3R1K A;  1FNO A;  1Z4R A;  5K8O A;  1KUV A;  3PBE A;  2BO9 A;  4XPD C;  1VHO A;  4MBU A;  4CGO A;  1Y9K A;  2WYR A;  2Q43 A;  3JTK A;  4CAF A;  4CAW A;  8CPA A;  4OLL A;  3S9N A;  5J1Q A;  2XEI A;  4HNY B;  2XEF A;  3D68 A;  5AG7 A;  2DPS A;  2JEV A;  4JZ0 A;  5A28 A;  1Y7R A;  1Z9U A;  2VEZ A;  4ONW A;  2ZEP A;  1CG2 A;  4MMO A;  4U5Y A;  1N71 A;  3OWC A;  1QSO A;  3LMS A;  1XE4 A;  4HNX B;  3FEE A;  1Q7L A;  4A2Z A;  3K9U A;  5IV0 A;  5G1Z A;  2C1C A;  4B13 A;  2EK9 A;  2V77 A;  1LFW A;  1I21 A;  2V8G A;  4MHD A;  4MCR A;  5LYL A;  2OH1 A;  3D7G A;  2CNS A;  3KL9 A;  1VGY A;  1J4J A;  1MJB A;  2Y0M A;  2C6P A;  2Z3P A;  2PJ0 A;  2GFQ A;  3MN8 A;  3PP9 A;  3BJ8 A;  4CAE A;  4R76 A;  1S7L A;  2HB6 A;  3FIX A;  1Q2C A;  4GM5 A;  4R57 A;  2VZY A;  2CTC A;  4R3L A;  4ZY2 A;  4CPA A;  1S7N A;  2I3C A;  5I4M A;  4X3R A;  2R1I A;  3CXS A;  5C88 A;  4A94 A;  1CBX A;  2JEW A;  3DDD A;  3TO9 A;  3TOA A;  5K8M A;  3MRU A;  1VHE A;  1A2Z A;  4FD7 A;  4QC6 A;  3S6G A;  3SI2 A;  1M4D A;  4C2Z A;  4BD9 A;  5EC4 A;  4C7I A;  4B12 A;  4B5P B;  2ZEL A;  4O23 A;  1IOF A;  1V0C A;  2PIZ A;  1GYT A;  1VHS A;  4KVO E;  4UF4 A;  3KGQ A;  4MHP A;  1Z4E A;  3T9Y A;  4R7M A;  2ZED A;  3VWE A;  2Z3O A;  4PQA A;  2GRE A;  2QVP A;  3DR6 A;  4XNH B;  3BI1 A;  3SJF A;  3D66 A;  2FT0 A;  2VXK A;  2ARH A;  2PJ1 A;  2REE A;  4I49 A;  3QB8 A;  4ZYQ A;  2YNE A;  3HLP A;  4KOY A;  2JDD A;  4B6Z A;  1X12 A;  1QSN A;  2V8V A;  3LOD A;  4OC4 A;  5AGE A;  4CAV A;  4ZY1 A;  1XIX A;  5E96 A;  2B3V A;  2NYQ A;  4MFK A;  2ZW7 A;  2DF5 A;  1ON0 A;  4W9Y A;  3P2F A;  4FD5 A;  2PJC A;  4F6A A;  3SHP A;  4A39 A;  5I0C A;  1XRY A;  4OP4 A;  5F48 A;  4NJR A;  5JQ4 A;  2Z3M A;  3R9E A;  4MHN A;  1BLL E;  4NJQ A;  2PC1 A;  2ZEO A;  3D7D A;  3MGD A;  2ANP A;  4CGM A;  2BUE A;  3LAC A;  2FCK A;  2GE3 A;  4OAE A;  2Z3L A;  4LX9 A;  1IB1 E;  2PJ2 A;  1AUG A;  4EME A;  3TTH A;  4UCN A;  1I1D A;  1ZG8 A;  3GKR A;  3TFY A;  2POK A;  4PK3 A;  2OU2 A;  3NFZ A;  2Q44 A;  3SXN A;  4PXD A;  2PR1 A;  1P0H A;  2EK8 A;  1ZO0 A;  2J8M A;  5LRJ A;  3EY5 A;  2Q4V A;  4P6Y A;  7CPA A;  3CXQ A;  3D7H A;  5DWM A;  4JD6 A;  5EMI A;  4ZY0 A;  4F9U A;  2WSA A;  2OB0 A;  3QAY A;  4Q36 A;  2PJ7 A;  4XNH C;  4DUK A;  4MFJ A;  2ZW6 A;  2PJ3 A;  4WWV A;  3H8F A;  1JQG A;  4R6T A;  4AVA A;  2PIY A;  2ZOG A;  4KZT A;  2ZEF A;  4NGT A;  4X8I A;  2O53 A;  4RN7 A;  3WC5 A;  4H2K A;  3TO7 A;  4IHM A;  2WZN A;  4A95 A;  4MHZ A;  3L2N A;  4CS0 B;  2OZH A;  3G8W A;  2FSR A;  3WC7 A;  5LRG A;  1XMB A;  2C6G A;  2HUZ A;  4P4B A;  2V8H A;  2IL4 A;  2ZEN A; 
#chains in the Genus database with same CATH homology
 2NMT A;  3LD2 A;  4U9Z A;  4KS9 A;  2P6E A;  4L8A A;  2YNC C;  4R9M A;  3S6K A;  4E8O A;  4QB9 A;  1M44 A;  4KVM E;  1MJ9 A;  3IGR A;  2Q4Y A;  4A31 A;  5KTD A;  2QEC A;  3FNC A;  1S60 A;  4CGL A;  5H84 A;  4NF1 A;  4UFW A;  2B5G A;  4CRZ B;  4MJ8 A;  3FXT A;  3DNS A;  1SQH A;  2B4D B;  3CXP A;  1RO5 A;  4FD4 A;  4RS2 A;  2C27 A;  3FB3 A;  4Y49 B;  4QBJ A;  1NSL A;  4C68 A;  4KLV A;  1OZP A;  4CAX A;  4AG9 A;  1XF8 A;  4MFQ A;  1S5K A;  5FVJ A;  4OAD A;  3W6S A;  4ZGY B;  1PU9 A;  3B8G A;  3GY9 A;  1M1D A;  2CY2 A;  3RYO A;  4XPL A;  4UBR A;  4ZBG A;  1YK3 A;  3H5Z A;  1VKC A;  4MFP A;  3S6F A;  1IYL A;  3NE7 A;  2FL4 A;  2X7B A;  3W6X A;  3I3G A;  4KUA A;  4AVC A;  2Z0Z A;  3FBU A;  4B11 A;  5G22 A;  5GCN A;  2O28 A;  5AG5 A;  3R9F A;  3C26 A;  2WPW A;  4UCP A;  4EVY A;  4IUS A;  4B5O A;  2Z11 A;  2VZZ A;  1MK4 A;  4A32 A;  4B5P A;  4NEX A;  2K5T A;  2B4B A;  1FY7 A;  1CM0 A;  4MI4 A;  4CGN A;  2A4N A;  4MFL A;  4YRH A;  1YLE A;  4Y49 C;  3W91 A;  4KSA A;  3VWD A;  2JLM A;  4LUA A;  5J8C A;  2OZU A;  1I12 A;  5KTA A;  3F8K A;  2GAN A;  3E0K A;  5C82 A;  5F47 A;  1IID A;  4UFX A;  2FIA A;  1QSM A;  2GIV A;  1P4N A;  1M4G A;  2ZW4 A;  4CYQ A;  4JXQ A;  4RI1 A;  2YNC A;  2H5M A;  2QML A;  3SXO A;  1M4I A;  3R95 A;  3ZZI A;  4K30 A;  4QUS A;  4M85 A;  5ISV A;  3QAH A;  4KOX A;  5EBV A;  4HNW B;  4XPD B;  4E0A A;  1S7F A;  4ONU A;  4C2X A;  3TE4 A;  4BBH A;  1IYK A;  4KOS A;  1BOB A;  4KVX A;  2Q04 A;  4JJX A;  2ATR A;  4Q38 A;  4UWJ A;  3WR7 A;  1CJW A;  2FXF A;  3D8P A;  4B10 A;  1KZF A;  1WWZ A;  4X5K A;  2JDC A;  3EO4 A;  4KOV A;  4PV6 A;  2QIR A;  1YX0 A;  2P6F A;  3DR8 A;  2HQY A;  2PR8 A;  2Z3K A;  3F0A A;  3JVN A;  1MJA A;  4CYO A;  4QVT A;  2D4P A;  2WPX A;  2CXA A;  2FS5 A;  3S6H A;  1YR0 A;  1BO4 A;  2D4O A;  2G3T A;  5KTC A;  2CNM A;  2J8N A;  1YRE A;  4F0X A;  3D2P A;  2R98 A;  2DXQ A;  4NSQ A;  3R9G A;  2ZXV A;  2EVN A;  3BJ7 A;  5AG6 A;  3TCV A;  5CNP A;  1XEB A;  5J8F A;  2PDO A;  1LRZ A;  1Q2D A;  2FIW A;  2G3A A;  4KSF A;  4UA3 A;  5DWN A;  2Q7B A;  4JWP A;  2PSW A;  3IU1 A;  3D3S A;  1Y9W A;  4B14 A;  3BLN A;  4PK2 A;  4MFZ A;  5IX3 A;  4UFV A;  2B3U A;  4H6U A;  2P0W A;  2Z10 A;  1S3Z A;  4FD6 A;  2HV2 A;  2B4D A;  4KOR A;  3IWG A;  3TO6 A;  1B87 A;  3GYA A;  2WUU A;  2VI7 A;  1XMT A;  3FRM A;  4C7H A;  4KUB A;  1UFH A;  5BWA B;  4R87 A;  2R7H A;  2F5I A;  2VBQ A;  4C2Y A;  3A9L A;  4AVB A;  3P2H A;  5G21 A;  4NCZ A;  3T90 A;  1Q2Y A;  2ZPA A;  1R57 A;  2YGW A;  2G0B A;  3PZJ A;  2DPT A;  4CGP A;  4A33 A;  2RC4 A;  2KCW A;  1L0C A;  4M3S A;  2EUI A;  4AB7 A;  5F46 A;  2OZG A;  1YVK A;  5IB0 A;  4H89 A;  4KOU A;  2R8V A;  2PQ8 A;  2VQY A;  3R96 A;  4YGO A;  4CRY B;  3F5B A;  4U9Y A;  1IIC A;  2B58 A;  4A30 A;  1RXT A;  1QST A;  3EC4 A;  3PGP A;  5H86 A;  2AE6 A;  2ZW5 A;  1YGH A;  3EFA A;  4HKF A;  1YVO A;  2I79 A;  4YFJ A;  3TOB A;  4L89 A;  5HH1 A;  1U6M A;  4UWI A;  5AG4 A;  3G3S A;  2BSW A;  5A27 A;  2BEI A;  2YND A;  4BMH A;  3KKW A;  1S7K A;  3I9S A;  1NE9 A;  3H4Q A;  1KUX A;  1WK4 A;  3IWE A;  3ZJ0 A;  2REF A;  1B6B A;  1KUY A;  4KLW A;  5HMN A;  4NXY A;  3UY5 A;  1QSR A;  4II9 A;  4CYP A;  1PUA A;  2Q0Y A;  4MY3 A;  5F49 A;  4KOT A;  4JXR A;  4PSW A;  4MY0 A;  5JPH A;  4UCM A;  4XPK A;  4E2A A;  3FYN A;  4GS4 A;  4DNC A;  1TIQ A;  2P6G A;  3IU2 A;  4R3K A;  3EXN A;  4PSX A;  4H6Z A;  4J3G A;  2AJ6 A;  2CNT A;  2BL1 A;  3V8I A;  2Z3N A;  4CYN A;  4IF5 A;  3JUW A;  2J8R A;  5G20 A;  4ORF A;  2I00 A;  1GHE A;  2FE7 A;  2B5G B;  3N7Z A;  1K4J A;  3D2M A;  4JLY A;  3TT2 A;  1NMT A;  4AG7 A;  2PRB A;  4F0Y A;  3DSB A;  4KOW A;  3R1K A;  1Z4R A;  1KUV A;  4XPD C;  4MBU A;  4CGO A;  1Y9K A;  3JTK A;  4CAF A;  4CAW A;  4OLL A;  4HNY B;  5AG7 A;  2DPS A;  2JEV A;  5A28 A;  1Y7R A;  1Z9U A;  2VEZ A;  4U5Y A;  1N71 A;  3OWC A;  4HNX B;  1QSO A;  1XE4 A;  4A2Z A;  3K9U A;  5IV0 A;  5G1Z A;  4B13 A;  1I21 A;  4MHD A;  2OH1 A;  2CNS A;  1J4J A;  1MJB A;  2Y0M A;  2Z3P A;  3PP9 A;  4CAE A;  3BJ8 A;  1S7L A;  3FIX A;  1Q2C A;  4R57 A;  2VZY A;  4R3L A;  1S7N A;  2R1I A;  3CXS A;  5C88 A;  3DDD A;  3TO9 A;  3TOA A;  4FD7 A;  3S6G A;  4QC6 A;  1M4D A;  4C2Z A;  5EC4 A;  4C7I A;  4B12 A;  4B5P B;  1V0C A;  1VHS A;  4KVO E;  1Z4E A;  3T9Y A;  3VWE A;  2Z3O A;  3DR6 A;  4XNH B;  2FT0 A;  2VXK A;  2ARH A;  2REE A;  4I49 A;  3QB8 A;  2YNE A;  4KOY A;  2JDD A;  1QSN A;  3LOD A;  5AGE A;  4CAV A;  1XIX A;  5E96 A;  2B3V A;  4MFK A;  2ZW7 A;  1ON0 A;  3P2F A;  4FD5 A;  4F6A A;  3SHP A;  5I0C A;  5F48 A;  5JQ4 A;  2Z3M A;  3R9E A;  2PC1 A;  3MGD A;  4CGM A;  2BUE A;  2FCK A;  2GE3 A;  4OAE A;  2Z3L A;  4LX9 A;  1IB1 E;  3TTH A;  4UCN A;  1I1D A;  3GKR A;  3TFY A;  4PK3 A;  2OU2 A;  2Q44 A;  3SXN A;  2PR1 A;  1P0H A;  1ZO0 A;  2J8M A;  3EY5 A;  2Q4V A;  3CXQ A;  5DWM A;  4JD6 A;  2WSA A;  2OB0 A;  4XNH C;  4Q36 A;  4MFJ A;  2ZW6 A;  4AVA A;  4KZT A;  3TO7 A;  4A95 A;  4CS0 B;  2OZH A;  3G8W A;  2FSR A;  2HUZ A;  2IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...