4AG9A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): ternary complex with coenzyme a and glcnac
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
SHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 40
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag9A01
1N71A 4YGOA 3SXNA 1M44A 4FD7A 3W6XA 2G0BA 1XIXA 4MJ8A 3I3GA 2B3VA 1P4NA 1RXTA 5EC4A 4KOUA 2P6GA 3TOBA 4M85A 2I00A 1YK3A 4KOVA 2Z10A 2ZXVA 2VZZA 4E0AA 2FE7A 2FS5A 2VZYA 4AB7A 4IF5A 2ZPAA 2Q4VA 3TOAA 1QSTA 2ZW7A 2BL1A 1QSMA 3R95A 2RC4A 4QB9A 1S3ZA 3PP9A 3ZZIA 3R9GA 1UFHA 3R1KA 4PSWA 2PQ8A 1NMTA 3ZJ0A 3TE4A 1IYLA 4AVAA 1MJBA 4R9MA 2ZW5A 2REEA 2JLMA 4L8AA 4FD6A 1NSLA 2A4NA 4AVCA 2P0WA 2B5GA 2OB0A 4B5OA 4E2AA 4JXQA 3CXQA 3QB8A 5H84A 1VHSA 2D4OA 3E0KA 4R57A 1U6MA 1BOBA 4OADA 3D8PA 1Q2YA 5F46A 4HNWB 4MHDA 4KZTA 1IICA 2CNMA 2PR1A 2B3UA 1RO5A 2BSWA 2FIAA 2P6FA 2FSRA 4QBJA 5HH1A 5J8FA 1M4IA 3QAHA 1BO4A 3R9FA 1KUXA 2IL4A 2OH1A 4KLWA 2VBQA 3CXPA 3D2PA 3IWGA 3FRMA 3IGRA 3F5BA 4I49A 1I12A 3G3SA 3BLNA 4B5PA 2VXKA 3P2FA 3R9EA 1XE4A 2H5MA 4DNCA 2HUZA 2JDDA 2Q0YA 2OZUA 4F0YA 1S7LA 4KVME 2Q44A 5CNPA 2R1IA 4RI1A 4OLLA 2X7BA 4LUAA 2B4DB 4NCZA 2QIRA 1M4GA 4PSXA 4RS2A 1WWZA 2QMLA 4CAXA 1P0HA 4KOWA 2Q7BA 1YVKA 4YFJA 1J4JA 3FNCA 4UWJA 2F5IA 3F8KA 5DWNA 3P2HA 3S6HA 1VKCA 4GS4A 3S6KA 4KUAA 1V0CA 4U9ZA 3GY9A 4QUSA 3TO7A 4ORFA 3JVNA 3T9YA 4MY3A 2ATRA 4KOXA 1Q2CA 3PGPA 4H89A 2D4PA 1IB1E 4UWIA 3BJ7A 4PK3A 1YREA 1Z4EA 3D2MA 3FXTA 1ON0A 3T90A 2AE6A 2J8RA 3N7ZA 2J8NA 1I21A 4NXYA 3VWEA 2HQYA 4NEXA 4IUSA 1QSOA 4U9YA 1MJAA 1Q2DA 2FT0A 2GANA 3TT2A 5DWMA 3W6SA 4PK2A 5KTDA 1YLEA 4ZBGA 2OZGA 4UBRA 4II9A 1OZPA 2EVNA 3DR6A 1Y9KA 2G3AA 1YR0A 1PU9A 3EO4A 2AJ6A 4AG7A 2OU2A 4CRZB 4X5KA 2FL4A 5IB0A 2R98A 3EFAA 4R87A 2K5TA 3B8GA 3EXNA 2WPWA 3V8IA 3K9UA 4KVXA 1MJ9A 1XF8A 1XEBA 4CAVA 3I9SA 4QVTA 4H6ZA 2O28A 4L89A 2G3TA 3LODA 1FY7A 5F49A 2REFA 3PZJA 5J8CA 1TIQA 5GCNA 2Q04A 3FB3A 3FBUA 5JPHA 2Q4YA 1I1DA 2Z0ZA 3WR7A 2KCWA 2VI7A 1NE9A 2P6EA 4M3SA 3C26A 1S7FA 5C88A 4XPLA 3KKWA 5KTCA 1CM0A 3FYNA 2B5GB 3DDDA 2FCKA 4AG9A 2FIWA 1R57A 2J8MA 4OAEA 4XNHC 3F0AA 5I0CA 4MBUA 5HMNA 1QSRA 2PC1A 2GE3A 3RYOA 5IX3A 2OZHA 3S6GA 3SXOA 3H4QA 4JD6A 3VWDA 2ZW6A 1Z4RA 1GHEA 1CJWA 2JEVA 3TO6A 1Z9UA 4FD5A 5EBVA 2B58A 4R3LA 3D3SA 3SHPA 2PRBA 2VEZA 2Z11A 4J3GA 4PV6A 5IV0A 2DXQA 4QC6A 4R3KA 4KOYA 4NSQA 1KUVA 2QECA 5H86A 2JDCA 2I79A 1IYKA 3TTHA 3S6FA 4YRHA 4HKFA 5E96A 1M1DA 4B5PB 1M4DA 4EVYA 2R8VA 4MI4A 1SQHA 1LRZA 5JQ4A 3GYAA 2GIVA 3NE7A 3BJ8A 1B87A 1L0CA 3R96A 4Y49C 1YVOA 4CAWA 2CY2A 4XPDB 4AVBA 3MGDA 2ARHA 4CS0B 2Y0MA 3DNSA 4JXRA 3DR8A 2B4DA 4KLVA 4K30A 5FVJA 1XMTA 3EY5A 4E8OA 2C27A 2R7HA 2EUIA 4F6AA 2PDOA 2BEIA 4XNHB 4BMHA 3GKRA 4UA3A 1Y7RA 1KZFA 3G8WA 3TFYA 1Y9WA 4CRYB 1YGHA 2HV2A 3EC4A 1PUAA 3TO9A 4H6UA 1YX0A 4ONUA 2FXFA 1S7KA 5F48A 2B4BA 3W91A 2ZW4A 4KVOE 2WPXA 1S5KA 1IIDA 3FIXA 1B6BA 4XPDC 4XPKA 2CNSA 4MY0A 1KUYA 2CNTA 4JLYA 4JWPA 3TCVA 1S60A 5F47A 3OWCA 5KTAA 2BUEA 4HNYB 1WK4A 4HNXB 3CXSA 4NF1A 4JJXA 2PR8A 3JUWA 4U5YA 1MK4A 4KORA 3LD2A 3UY5A 1S7NA 5ISVA 1K4JA 4FD4A 2PSWA 4KOTA 4KUBA 3DSBA 1QSNA 2VQYA 4KOSA 5C82A 4LX9A 2NMTA 4Y49B
chains in the Genus database with same CATH superfamily
1N71A 1LAPA 3PB9X 4YGOA 3SXNA 4F8ZA 2Z3LA 4EFDA 4LX9A 1M44A 2IJZA 4FD7A 3ISZA 3W6XA 1LANA 4A31A 3CPAA 4X8IA 1YMEA 2G0BA 5D8NA 1XIXA 4MJ8A 2WZNA 3I3GA 2B3VA 1P4NA 1RXTA 5EC4A 4KOUA 2PJ4A 2P6GA 3KR4A 4M6IA 3TOBA 3TX8A 4P4DA 4M85A 2CIJA 1YK3A 2I00A 4KOVA 4NJQA 5K8PA 2BCOA 2V8DA 2Z10A 4LQ6A 4B14A 4CGNA 1YQEA 4P6YA 2ZXVA 2VZZA 2YNCA 4E0AA 3SI0A 2FE7A 2FS5A 4OIWA 2VZYA 1UWYA 2QYVA 3SJXA 4AB7A 5G21A 4IF5A 2ZPAA 3PEIA 2Q4VA 3TOAA 1QSTA 2ZW7A 2BL1A 3K2KA 1QSMA 1TXRA 2BO9A 3R95A 2RC4A 2ZENA 1YW6A 4QB9A 3FECA 2PJ3A 1S3ZA 3PP9A 4OP4A 3CPXA 3ZZIA 3R9GA 1XJOA 1XMBA 2I3CA 4Z65A 1UFHA 2PJ7A 3R1KA 4PSWA 2PQ8A 5LYLA 1NMTA 3ZJ0A 3B3WA 3TE4A 1IYLA 5LYFA 2ZEFA 4AVAA 3PB8X 4GM5A 1GYTA 4A32A 5HXDA 5DS0A 2PIYA 1YLOA 5ELYA 1YW4A 1MJBA 1RTQA 4R9MA 4OC2A 4C2YA 2ZW5A 2REEA 3D4UA 4UEEA 2JLMA 2POKA 4L8AA 4FD6A 4UFVA 3H8EA 1NSLA 1CG2A 2ZEMA 3FF3A 5THWA 2AFXA 2A4NA 4P4FA 3LWUA 4AVCA 2P0WA 2B5GA 4KS9A 4C7IA 4FAIA 1HEEA 2VL1A 3GB0A 2PVVA 2OB0A 2F8HA 2ODFA 4B5OA 4E2AA 4JXQA 3CXQA 3QB8A 5H84A 3JTKA 1VHSA 2D4OA 3E0KA 4R57A 1U6MA 2O4HA 1BOBA 1VGYA 3D8PA 4OADA 1Q2YA 4X2TA 3VH9A 4M6GA 3B3VA 4JYWA 5AGEA 5F46A 2Z3MA 3KGQA 4MCRA 5AG7A 4HNWB 4MHDA 4KZTA 1IICA 4X3RA 3RAMA 2CNMA 3FVLA 4A2ZA 2PR1A 3NH4A 2B3UA 1RO5A 2BSWA 2FIAA 2P6FA 3KHXA 3IJ3A 3K9TA 4JZ0A 4UFXA 2FSRA 4QBJA 2C6CA 2PJAA 5HH1A 4OC4A 3SI1A 1IY7A 4A95A 5J8FA 1ARLA 1M4IA 4IAVA 3QAHA 1BO4A 5HVFA 3R9FA 1LCPA 5LRGA 5K8OA 4KSIA 2V77A 1KUXA 5LYIA 3RNZA 2ZOFA 2IL4A 1IOFA 2V8VA 3LMSA 2YNDA 1CBXA 2OH1A 3NH5A 4KLWA 3D66A 1JWQA 2PJ2A 2BOAA 2VBQA 3CXPA 2PJ6A 3D7HA 2XEGA 3D2PA 3FRMA 3HLPA 3IGRA 3IWGA 2J9AA 3F5BA 4I49A 1I12A 3G3SA 2XEFA 3BLNA 4B5PA 2VXKA 2ZEPA 3RBUA 3B3SA 3P2FA 3V7ZA 1CX8A 3D68A 3N5FA 3WC7A 4DUKA 3R9EA 1XE4A 2H5MA 2WYRA 2DPSA 4A37A 2HUZA 4DNCA 2JDDA 1TKFA 2Q0YA 2OZUA 4F0YA 3H8FA 3KI9A 4IK2A 1AUGA 3MRUA 4NGTA 1S7LA 3CDXA 3NFZA 1X10A 3NE8A 4KVME 2G9DA 1PYTB 3BI1A 4A39A 2EO8A 4MCPA 1YSJA 2Q44A 4P45A 3IIBA 3KZWA 4R6TA 5CNPA 1X12A 2R1IA 4RI1A 4OLLA 5JM6A 3SJFA 2O53A 2X7BA 4LUAA 2B4DB 2AFOA 4LQGA 4EMEA 1ZO0A 4NCZA 2Q7SA 4MHYA 2QIRA 4NGPA 3VARA 1M4GA 4MHNA 1CPSA 4CYNA 4NGQA 2Z3OA 3HUVA 2AFUA 3SI2A 4PSXA 5G22A 5F09A 4RS2A 1WWZA 2QMLA 4DYOA 4CAXA 2AFWA 1P0HA 4KOWA 3IU2A 2Q7BA 1YVKA 4YFJA 1J4JA 2YNCC 3FNCA 3H8GA 2AFZA 2F5IA 3F8KA 3PBBA 4IHMA 4UWJA 3FEDA 5DWNA 4OC5A 3P2HA 4A33A 1BAVA 1Z2LA 2ZEHA 4ZX8A 2YGWA 2GLFA 3S6HA 3B3CA 4ZYQA 7CPAA 1VKCA 2JEWA 4GS4A 3S6KA 3PRTA 4BBHA 4KUAA 1BPNA 1V0CA 3B7IA 4P4EA 3PFOA 2NSMA 4U9ZA 4C68A 1ELMP 2AFMA 4RN7A 3GY9A 4QUSA 4CGOA 3CZXA 4CPAA 4FUUA 4ORFA 3TO7A 1PCAA 3JVNA 3T9YA 4MY3A 3S9LA 4F9VA 2ATRA 4KOXA 1Q2CA 4AXVA 3PGPA 4H89A 4A30A 2D4PA 4UCNA 1IB1E 4PXCA 4UWIA 3BJ7A 1QMUA 4PK3A 3WC5A 1YREA 1Z4EA 3D2MA 3FXTA 1ON0A 4NGSA 3S9NA 3T90A 2AE6A 2J8RA 3N7ZA 3JRUA 2J8NA 3KQZA 1I21A 4WWVA 1Z8TA 4KSFA 3QNVA 4CYPA 2QJ8A 4NXYA 3VWEA 2EWBA 2Z3PA 2HQYA 4UF4A 1Y7EA 3GIUA 3IEHA 4NEXA 4IUSA 1QSOA 4U9YA 4BINA 1MJAA 1ZLHA 1Q2DA 2FT0A 2GANA 3D7GA 4MFLA 5DWMA 3TT2A 2PJ1A 4CAEA 1QQ9A 3D7DA 3W6SA 5I4MA 4CGPA 1XOVA 4PK2A 5D29A 3FX6A 1YLEA 4B6ZA 5KTDA 1CP7A 4ZBGA 2OZGA 1F57A 3FMCA 4G1PA 4UBRA 4YWYA 3RZAA 5JH9A 3WABA 4FBEA 4B10A 4II9A 1OZPA 2EVNA 2Q4ZA 3DR6A 4O23A 1KWMA 2DEAA 1Y9KA 2G3AA 1YR0A 2ZEGA 1PU9A 3EO4A 3PB6X 2AJ6A 3KASA 4AG7A 4BD9A 2PJ9A 2ZOGA 2IQ6A 2RFHA 2OU2A 4CRZB 4X5KA 2FL4A 2DF5A 3WC6A 5IB0A 4B11A 2R98A 3EFAA 4R87A 4CYOA 2K5TA 3B8GA 3EXNA 4MCQA 1DE4C 1EE3P 4Q36A 2WPWA 2C6PA 3V8IA 2GFQA 3K9UA 4KVXA 1MJ9A 1IU8A 3V38A 1XF8A 4ZGYB 1XEBA 4CAVA 5CBMA 3IFEA 4ZY2A 3IC1A 3I9SA 2Z3NA 4QVTA 1Q7LA 4H6ZA 2O28A 4L89A 2PCUA 1CPXA 3NH8A 4MFJA 2G3TA 3LODA 1FY7A 2PJ5A 3B2YA 2PJCA 1ZG9A 5F49A 4K3NA 4C7HA 2REFA 4UCPA 3PZJA 3CT9A 5J8CA 1TIQA 3FEEA 5GCNA 4R7MA 2Q04A 1CP6A 3BI0A 3FB3A 1FNOA 3FBUA 3S9MA 3GLJA 2Q4YA 2ZEDA 4PPZA 1I1DA 5JPHA 4MRIA 2Z0ZA 4RUHA 3IWEA 3WR7A 2KCWA 2VI7A 2V8HA 4WJBA 1IOIA 1NE9A 3DLJA 2P6EA 4M3SA 2Z3KA 3C26A 3ISXA 2RB7A 1S7FA 1ELLP 5C88A 4XPLA 1VHEA 3KKWA 5G1ZA 5KTCA 1CM0A 3FYNA 4UEZA 2CXAA 4MFPA 2B5GB 4P44A 5J1QA 3DDDA 2XEJA 2CTBA 2FCKA 3SJEA 4MCSA 4AG9A 1AMPA 3B3TA 2FIWA 1R57A 2J8MA 3D67A 4MFZA 1Z5RA 4Q7AA 1DTDA 2WUUA 3VATA 3KQXA 4OAEA 4XNHC 3F0AA 5I0CA 4MBUA 1Z8XA 5HMNA 1QSRA 2PC1A 1VIXA 3RO0A 2GE3A 3RYOA 5G20A 3SJGA 5IX3A 2OZHA 3S6GA 3SXOA 3PB4X 2GREA 4H2KA 3H4QA 4JD6A 1LOKA 4NGRA 4PQAA 3VWDA 1R3NA 4GXHA 2ZW6A 1Z4RA 1GHEA 2WSAA 1CJWA 1TKHA 3PB7X 4HPSA 4MMOA 2OOTA 2JEVA 3TO6A 1Z9UA 3D7FA 1Z8WA 4FD5A 5EBVA 2JBJA 4F0XA 4M6HA 2YNEA 4MXUA 2B58A 4MFKA 4R3LA 3D3SA 3SHPA 2PRBA 2VEZA 4A38A 4TNUA 2CF4A 5LRKA 4ZY0A 2Z11A 4J3GA 4P4BA 3PBEA 4P4JA 4PV6A 4NGMA 5IV0A 2DXQA 4QC6A 3BXMA 2DPTA 4R3KA 4KOYA 2NYQA 4NSQA 1KUVA 2QECA 5H86A 5BWAB 2JDCA 2JBKA 4UFWA 2PJ8A 2I79A 3B35A 1IYKA 3GUXA 3TTHA 1NSAA 2ZELA 3S6FA 4YRHA 4HKFA 5E96A 5EMIA 1M1DA 3MN8A 1M4DA 4B5PB 4EVYA 3PFEA 1ZLIA 4OMEA 3FJUA 2R8VA 4MI4A 2PE3A 4EWTA 1SQHA 3NA6A 2HB6A 4UCMA 3T8WA 1LRZA 2EK8A 2ABZA 5JQ4A 2OR4A 8CPAA 1AYEA 3I1UA 3GYAA 2GIVA 5AG5A 4B12A 3NE7A 3BJ8A 1B87A 1L0CA 3R96A 4Y49C 1YVOA 4TWEA 4UIAA 2XEIA 4CAWA 2CY2A 1IGBA 4XPDB 4AVBA 1LAMA 4MHPA 4KSAA 4OC0A 4DJLA 4MFQA 3MGDA 2QVPA 2ANPA 3KL9A 4MHZA 2CTCA 1Z8LA 2FVGA 3A9LA 5A27A 2ARHA 1HDQA 2Y0MA 3DNSA 4CS0B 2GU2A 2ZEEA 1H8LA 3DR8A 4JXRA 2B4DA 4KLVA 4ZX9A 4K30A 5FVJA 1XMTA 2EK9A 1JQGA 4B13A 3DGVA 3EY5A 4E8OA 2C27A 2R7HA 4ONWA 2EUIA 4W9YA 4F6AA 2PRQA 2PDOA 1TF9A 2BEIA 1ZG8A 2AFSA 3KR5A 4XNHB 4BMHA 3IU1A 2GLJA 4CYQA 3GKRA 2Q43A 4UA3A 1Y7RA 1KZFA 2C6GA 3G8WA 4C2XA 4UEFA 4P4IA 4CAFA 5A28A 3L2NA 3TFYA 1Y9WA 2PIZA 4P10A 4C2ZA 4CRYB 1YGHA 2HV2A 1A2ZA 1M4LA 4CGMA 1TKJA 3EC4A 2V8GA 4UIBA 1PUAA 4R76A 4YU9A 3TO9A 4H6UA 1YX0A 3LACA 4ONUA 4PXDA 5K8MA 1XBUA 1XFOA 2FXFA 3IWWA 1S7KA 2ZEOA 1F2PA 1HDUA 5F48A 5CPAA 2B4BA 2HC9A 4OC1A 3W91A 2ZW4A 4KVOE 2WPXA 1VHOA 1S5KA 1IIDA 3FIXA 1B6BA 3KHZA 5LRJA 1R43A 4ZY1A 4F9UA 4XPDC 4PXBA 4XPKA 2CNSA 3QAYA 3FH4A 4MY0A 5LYDA 1KUYA 2CNTA 4NGNA 4JLYA 4JWPA 2PVWA 3TCVA 5JGFA 1S60A 5F47A 3OWCA 5KTAA 2BUEA 3IO1A 4HNYB 1WK4A 4HNXB 4PXEA 4A94A 1TF8A 3CXSA 3TC8A 4NF1A 4OIDA 3BHXA 4ZI6A 4JJXA 2PJBA 2PR8A 3JUWA 4CGLA 2Q51A 5AG6A 2PJ0A 1BLLE 1Y0YA 4OC3A 1MK4A 4U5YA 3WT4A 3LD2A 4KORA 3UY5A 1S7NA 5AG4A 1F2OA 1ARMA 6CPAA 5HVGA 1K4JA 5IB9A 3H5ZA 4FD4A 4NJRA 4OKOA 5ISVA 2EBJA 2IMOA 1BPMA 1Y0RA 2PSWA 4Q38A 5HVHA 1LFWA 4KOTA 4KUBA 2F7VA 3DSBA 4R8FA 1OBRA 2C1CA 1XRYA 1QSNA 1FT7A 1ZG7A 5K8NA 2VQYA 4KOSA 4NFRA 5C82A 4FWUA 2NMTA 4Y49B
chains in the Genus database with same CATH topology
1N71A 4YGOA 3SXNA 2Z3LA 1M44A 4FD7A 3W6XA 4A31A 2G0BA 1XIXA 4MJ8A 3I3GA 2B3VA 1P4NA 1RXTA 5EC4A 4KOUA 2P6GA 3TOBA 4M85A 2I00A 1YK3A 4KOVA 2Z10A 4B14A 4CGNA 2ZXVA 2VZZA 2YNCA 4E0AA 2FE7A 2FS5A 2VZYA 4AB7A 5G21A 4IF5A 2ZPAA 2Q4VA 3TOAA 1QSTA 2ZW7A 2BL1A 1QSMA 3R95A 2RC4A 4QB9A 1S3ZA 3PP9A 3ZZIA 3R9GA 1UFHA 3R1KA 4PSWA 2PQ8A 1NMTA 3ZJ0A 3TE4A 1IYLA 4AVAA 4A32A 1MJBA 4C2YA 4R9MA 2ZW5A 2REEA 2JLMA 4L8AA 4FD6A 4UFVA 1NSLA 2A4NA 4AVCA 2P0WA 2B5GA 4KS9A 4C7IA 2OB0A 4B5OA 4E2AA 4JXQA 3CXQA 3QB8A 5H84A 3JTKA 1VHSA 2D4OA 3E0KA 4R57A 1U6MA 1BOBA 4OADA 3D8PA 1Q2YA 5AGEA 5F46A 2Z3MA 5AG7A 4HNWB 4MHDA 4KZTA 1IICA 2CNMA 4A2ZA 2PR1A 2B3UA 1RO5A 2BSWA 2FIAA 2P6FA 4UFXA 2FSRA 4QBJA 5HH1A 5J8FA 4A95A 1M4IA 3QAHA 1BO4A 3R9FA 1KUXA 2IL4A 2YNDA 2OH1A 4KLWA 2VBQA 3CXPA 3D2PA 3IWGA 3FRMA 3IGRA 3F5BA 4I49A 1I12A 3G3SA 3BLNA 4B5PA 2VXKA 3P2FA 3R9EA 1XE4A 2H5MA 4DNCA 2DPSA 2HUZA 2JDDA 2Q0YA 2OZUA 4F0YA 1S7LA 4KVME 2Q44A 5CNPA 2R1IA 4RI1A 4OLLA 2X7BA 4LUAA 2B4DB 1ZO0A 4NCZA 4CYNA 2QIRA 1M4GA 2Z3OA 4PSXA 5G22A 4RS2A 1WWZA 2QMLA 4CAXA 1P0HA 4KOWA 3IU2A 2Q7BA 1YVKA 4YFJA 1J4JA 2YNCC 3FNCA 4UWJA 2F5IA 3F8KA 5DWNA 3P2HA 4A33A 2YGWA 3S6HA 1VKCA 4GS4A 3S6KA 4BBHA 4KUAA 1V0CA 4U9ZA 4C68A 3GY9A 4QUSA 4CGOA 3TO7A 4ORFA 3JVNA 3T9YA 4MY3A 2ATRA 4KOXA 1Q2CA 3PGPA 4H89A 4A30A 2D4PA 4UCNA 1IB1E 4UWIA 3BJ7A 4PK3A 1YREA 1Z4EA 3D2MA 3FXTA 1ON0A 3T90A 2AE6A 2J8RA 3N7ZA 2J8NA 1I21A 4KSFA 4CYPA 4NXYA 3VWEA 2Z3PA 2HQYA 4NEXA 4IUSA 1QSOA 4U9YA 1MJAA 1Q2DA 2FT0A 2GANA 4MFLA 3TT2A 5DWMA 4CAEA 3W6SA 4CGPA 4PK2A 5KTDA 1YLEA 4ZBGA 2OZGA 4UBRA 4B10A 4II9A 1OZPA 2EVNA 3DR6A 1Y9KA 2G3AA 1YR0A 1PU9A 3EO4A 2AJ6A 4AG7A 2OU2A 4CRZB 4X5KA 2FL4A 5IB0A 4B11A 2R98A 3EFAA 4R87A 4CYOA 2K5TA 3B8GA 3EXNA 4Q36A 2WPWA 3V8IA 3K9UA 4KVXA 1MJ9A 1XF8A 4ZGYB 1XEBA 4CAVA 3I9SA 2Z3NA 4QVTA 4H6ZA 2O28A 4L89A 4MFJA 2G3TA 3LODA 1FY7A 5F49A 4C7HA 2REFA 4UCPA 3PZJA 5J8CA 1TIQA 5GCNA 2Q04A 3FB3A 3FBUA 5JPHA 2Q4YA 1I1DA 2Z0ZA 3IWEA 3WR7A 2KCWA 2VI7A 1NE9A 2P6EA 4M3SA 2Z3KA 3C26A 1S7FA 5C88A 4XPLA 3KKWA 5G1ZA 5KTCA 1CM0A 3FYNA 2CXAA 4MFPA 2B5GB 3DDDA 2FCKA 4AG9A 2FIWA 1R57A 2J8MA 4MFZA 2WUUA 4OAEA 4XNHC 3F0AA 5I0CA 4MBUA 5HMNA 1QSRA 2PC1A 2GE3A 3RYOA 5G20A 5IX3A 2OZHA 3S6GA 3SXOA 3H4QA 4JD6A 3VWDA 2ZW6A 1Z4RA 1GHEA 2WSAA 1CJWA 2JEVA 3TO6A 1Z9UA 4FD5A 5EBVA 4F0XA 2YNEA 2B58A 4MFKA 4R3LA 3D3SA 3SHPA 2PRBA 2VEZA 2Z11A 4J3GA 4PV6A 5IV0A 2DXQA 4QC6A 2DPTA 4R3KA 4KOYA 4NSQA 1KUVA 2QECA 5H86A 5BWAB 2JDCA 4UFWA 2I79A 1IYKA 3TTHA 3S6FA 4YRHA 4HKFA 5E96A 1M1DA 4B5PB 1M4DA 4EVYA 2R8VA 4MI4A 1SQHA 4UCMA 1LRZA 5JQ4A 3GYAA 2GIVA 5AG5A 4B12A 3NE7A 3BJ8A 1B87A 1L0CA 3R96A 4Y49C 1YVOA 4CAWA 2CY2A 4XPDB 4AVBA 4KSAA 4MFQA 3MGDA 3A9LA 5A27A 2ARHA 4CS0B 2Y0MA 3DNSA 4JXRA 3DR8A 2B4DA 4KLVA 4K30A 5FVJA 1XMTA 4B13A 3EY5A 4E8OA 2C27A 2R7HA 2EUIA 4F6AA 2PDOA 2BEIA 4XNHB 4BMHA 3IU1A 4CYQA 3GKRA 4UA3A 4C2XA 1Y7RA 1KZFA 3G8WA 4CAFA 5A28A 3TFYA 1Y9WA 4C2ZA 4CRYB 1YGHA 2HV2A 4CGMA 3EC4A 1PUAA 3TO9A 4H6UA 1YX0A 4ONUA 2FXFA 1S7KA 5F48A 2B4BA 3W91A 2ZW4A 4KVOE 2WPXA 1S5KA 1IIDA 3FIXA 1B6BA 4XPDC 4XPKA 2CNSA 4MY0A 1KUYA 2CNTA 4JLYA 4JWPA 3TCVA 1S60A 5F47A 3OWCA 5KTAA 2BUEA 4HNYB 1WK4A 4HNXB 3CXSA 4NF1A 4JJXA 2PR8A 3JUWA 4CGLA 5AG6A 4U5YA 1MK4A 5AG4A 3LD2A 4KORA 3UY5A 1S7NA 5ISVA 1K4JA 3H5ZA 4FD4A 2PSWA 4Q38A 4KOTA 4KUBA 3DSBA 1QSNA 2VQYA 4KOSA 5C82A 4LX9A 2NMTA 4Y49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N71 A;  4YGO A;  3SXN A;  1M44 A;  4FD7 A;  3W6X A;  2G0B A;  1XIX A;  4MJ8 A;  3I3G A;  2B3V A;  1P4N A;  1RXT A;  5EC4 A;  4KOU A;  2P6G A;  3TOB A;  4M85 A;  2I00 A;  1YK3 A;  4KOV A;  2Z10 A;  2ZXV A;  2VZZ A;  4E0A A;  2FE7 A;  2FS5 A;  2VZY A;  4AB7 A;  4IF5 A;  2ZPA A;  2Q4V A;  3TOA A;  1QST A;  2ZW7 A;  2BL1 A;  1QSM A;  3R95 A;  2RC4 A;  4QB9 A;  1S3Z A;  3PP9 A;  3ZZI A;  3R9G A;  1UFH A;  3R1K A;  4PSW A;  2PQ8 A;  1NMT A;  3ZJ0 A;  3TE4 A;  1IYL A;  4AVA A;  1MJB A;  4R9M A;  2ZW5 A;  2REE A;  2JLM A;  4L8A A;  4FD6 A;  1NSL A;  2A4N A;  4AVC A;  2P0W A;  2B5G A;  2OB0 A;  4B5O A;  4E2A A;  4JXQ A;  3CXQ A;  3QB8 A;  5H84 A;  1VHS A;  2D4O A;  3E0K A;  4R57 A;  1U6M A;  1BOB A;  4OAD A;  3D8P A;  1Q2Y A;  5F46 A;  4HNW B;  4MHD A;  4KZT A;  1IIC A;  2CNM A;  2PR1 A;  2B3U A;  1RO5 A;  2BSW A;  2FIA A;  2P6F A;  2FSR A;  4QBJ A;  5HH1 A;  5J8F A;  1M4I A;  3QAH A;  1BO4 A;  3R9F A;  1KUX A;  2IL4 A;  2OH1 A;  4KLW A;  2VBQ A;  3CXP A;  3D2P A;  3IWG A;  3FRM A;  3IGR A;  3F5B A;  4I49 A;  1I12 A;  3G3S A;  3BLN A;  4B5P A;  2VXK A;  3P2F A;  3R9E A;  1XE4 A;  2H5M A;  4DNC A;  2HUZ A;  2JDD A;  2Q0Y A;  2OZU A;  4F0Y A;  1S7L A;  4KVM E;  2Q44 A;  5CNP A;  2R1I A;  4RI1 A;  4OLL A;  2X7B A;  4LUA A;  2B4D B;  4NCZ A;  2QIR A;  1M4G A;  4PSX A;  4RS2 A;  1WWZ A;  2QML A;  4CAX A;  1P0H A;  4KOW A;  2Q7B A;  1YVK A;  4YFJ A;  1J4J A;  3FNC A;  4UWJ A;  2F5I A;  3F8K A;  5DWN A;  3P2H A;  3S6H A;  1VKC A;  4GS4 A;  3S6K A;  4KUA A;  1V0C A;  4U9Z A;  3GY9 A;  4QUS A;  3TO7 A;  4ORF A;  3JVN A;  3T9Y A;  4MY3 A;  2ATR A;  4KOX A;  1Q2C A;  3PGP A;  4H89 A;  2D4P A;  1IB1 E;  4UWI A;  3BJ7 A;  4PK3 A;  1YRE A;  1Z4E A;  3D2M A;  3FXT A;  1ON0 A;  3T90 A;  2AE6 A;  2J8R A;  3N7Z A;  2J8N A;  1I21 A;  4NXY A;  3VWE A;  2HQY A;  4NEX A;  4IUS A;  1QSO A;  4U9Y A;  1MJA A;  1Q2D A;  2FT0 A;  2GAN A;  3TT2 A;  5DWM A;  3W6S A;  4PK2 A;  5KTD A;  1YLE A;  4ZBG A;  2OZG A;  4UBR A;  4II9 A;  1OZP A;  2EVN A;  3DR6 A;  1Y9K A;  2G3A A;  1YR0 A;  1PU9 A;  3EO4 A;  2AJ6 A;  4AG7 A;  2OU2 A;  4CRZ B;  4X5K A;  2FL4 A;  5IB0 A;  2R98 A;  3EFA A;  4R87 A;  2K5T A;  3B8G A;  3EXN A;  2WPW A;  3V8I A;  3K9U A;  4KVX A;  1MJ9 A;  1XF8 A;  1XEB A;  4CAV A;  3I9S A;  4QVT A;  4H6Z A;  2O28 A;  4L89 A;  2G3T A;  3LOD A;  1FY7 A;  5F49 A;  2REF A;  3PZJ A;  5J8C A;  1TIQ A;  5GCN A;  2Q04 A;  3FB3 A;  3FBU A;  5JPH A;  2Q4Y A;  1I1D A;  2Z0Z A;  3WR7 A;  2KCW A;  2VI7 A;  1NE9 A;  2P6E A;  4M3S A;  3C26 A;  1S7F A;  5C88 A;  4XPL A;  3KKW A;  5KTC A;  1CM0 A;  3FYN A;  2B5G B;  3DDD A;  2FCK A;  4AG9 A;  2FIW A;  1R57 A;  2J8M A;  4OAE A;  4XNH C;  3F0A A;  5I0C A;  4MBU A;  5HMN A;  1QSR A;  2PC1 A;  2GE3 A;  3RYO A;  5IX3 A;  2OZH A;  3S6G A;  3SXO A;  3H4Q A;  4JD6 A;  3VWD A;  2ZW6 A;  1Z4R A;  1GHE A;  1CJW A;  2JEV A;  3TO6 A;  1Z9U A;  4FD5 A;  5EBV A;  2B58 A;  4R3L A;  3D3S A;  3SHP A;  2PRB A;  2VEZ A;  2Z11 A;  4J3G A;  4PV6 A;  5IV0 A;  2DXQ A;  4QC6 A;  4R3K A;  4KOY A;  4NSQ A;  1KUV A;  2QEC A;  5H86 A;  2JDC A;  2I79 A;  1IYK A;  3TTH A;  3S6F A;  4YRH A;  4HKF A;  5E96 A;  1M1D A;  4B5P B;  1M4D A;  4EVY A;  2R8V A;  4MI4 A;  1SQH A;  1LRZ A;  5JQ4 A;  3GYA A;  2GIV A;  3NE7 A;  3BJ8 A;  1B87 A;  1L0C A;  3R96 A;  4Y49 C;  1YVO A;  4CAW A;  2CY2 A;  4XPD B;  4AVB A;  3MGD A;  2ARH A;  4CS0 B;  2Y0M A;  3DNS A;  4JXR A;  3DR8 A;  2B4D A;  4KLV A;  4K30 A;  5FVJ A;  1XMT A;  3EY5 A;  4E8O A;  2C27 A;  2R7H A;  2EUI A;  4F6A A;  2PDO A;  2BEI A;  4XNH B;  4BMH A;  3GKR A;  4UA3 A;  1Y7R A;  1KZF A;  3G8W A;  3TFY A;  1Y9W A;  4CRY B;  1YGH A;  2HV2 A;  3EC4 A;  1PUA A;  3TO9 A;  4H6U A;  1YX0 A;  4ONU A;  2FXF A;  1S7K A;  5F48 A;  2B4B A;  3W91 A;  2ZW4 A;  4KVO E;  2WPX A;  1S5K A;  1IID A;  3FIX A;  1B6B A;  4XPD C;  4XPK A;  2CNS A;  4MY0 A;  1KUY A;  2CNT A;  4JLY A;  4JWP A;  3TCV A;  1S60 A;  5F47 A;  3OWC A;  5KTA A;  2BUE A;  4HNY B;  1WK4 A;  4HNX B;  3CXS A;  4NF1 A;  4JJX A;  2PR8 A;  3JUW A;  4U5Y A;  1MK4 A;  4KOR A;  3LD2 A;  3UY5 A;  1S7N A;  5ISV A;  1K4J A;  4FD4 A;  2PSW A;  4KOT A;  4KUB A;  3DSB A;  1QSN A;  2VQY A;  4KOS A;  5C82 A;  4LX9 A;  2NMT A;  4Y49 B; 
#chains in the Genus database with same CATH topology
 1N71 A;  1LAP A;  3PB9 X;  4YGO A;  3SXN A;  4F8Z A;  2Z3L A;  4EFD A;  4LX9 A;  1M44 A;  2IJZ A;  4FD7 A;  3ISZ A;  3W6X A;  1LAN A;  4A31 A;  3CPA A;  4X8I A;  1YME A;  2G0B A;  5D8N A;  1XIX A;  4MJ8 A;  2WZN A;  3I3G A;  2B3V A;  1P4N A;  1RXT A;  5EC4 A;  4KOU A;  2PJ4 A;  2P6G A;  3KR4 A;  4M6I A;  3TOB A;  3TX8 A;  4P4D A;  4M85 A;  2CIJ A;  1YK3 A;  2I00 A;  4KOV A;  4NJQ A;  5K8P A;  2BCO A;  2V8D A;  2Z10 A;  4LQ6 A;  4B14 A;  4CGN A;  1YQE A;  4P6Y A;  2ZXV A;  2VZZ A;  2YNC A;  4E0A A;  3SI0 A;  2FE7 A;  2FS5 A;  4OIW A;  2VZY A;  1UWY A;  2QYV A;  3SJX A;  4AB7 A;  5G21 A;  4IF5 A;  2ZPA A;  3PEI A;  2Q4V A;  3TOA A;  1QST A;  2ZW7 A;  2BL1 A;  3K2K A;  1QSM A;  1TXR A;  2BO9 A;  3R95 A;  2RC4 A;  2ZEN A;  1YW6 A;  4QB9 A;  3FEC A;  2PJ3 A;  1S3Z A;  3PP9 A;  4OP4 A;  3CPX A;  3ZZI A;  3R9G A;  1XJO A;  1XMB A;  2I3C A;  4Z65 A;  1UFH A;  2PJ7 A;  3R1K A;  4PSW A;  2PQ8 A;  5LYL A;  1NMT A;  3ZJ0 A;  3B3W A;  3TE4 A;  1IYL A;  5LYF A;  2ZEF A;  4AVA A;  3PB8 X;  4GM5 A;  1GYT A;  4A32 A;  5HXD A;  5DS0 A;  2PIY A;  1YLO A;  5ELY A;  1YW4 A;  1MJB A;  1RTQ A;  4R9M A;  4OC2 A;  4C2Y A;  2ZW5 A;  2REE A;  3D4U A;  4UEE A;  2JLM A;  2POK A;  4L8A A;  4FD6 A;  4UFV A;  3H8E A;  1NSL A;  1CG2 A;  2ZEM A;  3FF3 A;  5THW A;  2AFX A;  2A4N A;  4P4F A;  3LWU A;  4AVC A;  2P0W A;  2B5G A;  4KS9 A;  4C7I A;  4FAI A;  1HEE A;  2VL1 A;  3GB0 A;  2PVV A;  2OB0 A;  2F8H A;  2ODF A;  4B5O A;  4E2A A;  4JXQ A;  3CXQ A;  3QB8 A;  5H84 A;  3JTK A;  1VHS A;  2D4O A;  3E0K A;  4R57 A;  1U6M A;  2O4H A;  1BOB A;  1VGY A;  3D8P A;  4OAD A;  1Q2Y A;  4X2T A;  3VH9 A;  4M6G A;  3B3V A;  4JYW A;  5AGE A;  5F46 A;  2Z3M A;  3KGQ A;  4MCR A;  5AG7 A;  4HNW B;  4MHD A;  4KZT A;  1IIC A;  4X3R A;  3RAM A;  2CNM A;  3FVL A;  4A2Z A;  2PR1 A;  3NH4 A;  2B3U A;  1RO5 A;  2BSW A;  2FIA A;  2P6F A;  3KHX A;  3IJ3 A;  3K9T A;  4JZ0 A;  4UFX A;  2FSR A;  4QBJ A;  2C6C A;  2PJA A;  5HH1 A;  4OC4 A;  3SI1 A;  1IY7 A;  4A95 A;  5J8F A;  1ARL A;  1M4I A;  4IAV A;  3QAH A;  1BO4 A;  5HVF A;  3R9F A;  1LCP A;  5LRG A;  5K8O A;  4KSI A;  2V77 A;  1KUX A;  5LYI A;  3RNZ A;  2ZOF A;  2IL4 A;  1IOF A;  2V8V A;  3LMS A;  2YND A;  1CBX A;  2OH1 A;  3NH5 A;  4KLW A;  3D66 A;  1JWQ A;  2PJ2 A;  2BOA A;  2VBQ A;  3CXP A;  2PJ6 A;  3D7H A;  2XEG A;  3D2P A;  3FRM A;  3HLP A;  3IGR A;  3IWG A;  2J9A A;  3F5B A;  4I49 A;  1I12 A;  3G3S A;  2XEF A;  3BLN A;  4B5P A;  2VXK A;  2ZEP A;  3RBU A;  3B3S A;  3P2F A;  3V7Z A;  1CX8 A;  3D68 A;  3N5F A;  3WC7 A;  4DUK A;  3R9E A;  1XE4 A;  2H5M A;  2WYR A;  2DPS A;  4A37 A;  2HUZ A;  4DNC A;  2JDD A;  1TKF A;  2Q0Y A;  2OZU A;  4F0Y A;  3H8F A;  3KI9 A;  4IK2 A;  1AUG A;  3MRU A;  4NGT A;  1S7L A;  3CDX A;  3NFZ A;  1X10 A;  3NE8 A;  4KVM E;  2G9D A;  1PYT B;  3BI1 A;  4A39 A;  2EO8 A;  4MCP A;  1YSJ A;  2Q44 A;  4P45 A;  3IIB A;  3KZW A;  4R6T A;  5CNP A;  1X12 A;  2R1I A;  4RI1 A;  4OLL A;  5JM6 A;  3SJF A;  2O53 A;  2X7B A;  4LUA A;  2B4D B;  2AFO A;  4LQG A;  4EME A;  1ZO0 A;  4NCZ A;  2Q7S A;  4MHY A;  2QIR A;  4NGP A;  3VAR A;  1M4G A;  4MHN A;  1CPS A;  4CYN A;  4NGQ A;  2Z3O A;  3HUV A;  2AFU A;  3SI2 A;  4PSX A;  5G22 A;  5F09 A;  4RS2 A;  1WWZ A;  2QML A;  4DYO A;  4CAX A;  2AFW A;  1P0H A;  4KOW A;  3IU2 A;  2Q7B A;  1YVK A;  4YFJ A;  1J4J A;  2YNC C;  3FNC A;  3H8G A;  2AFZ A;  2F5I A;  3F8K A;  3PBB A;  4IHM A;  4UWJ A;  3FED A;  5DWN A;  4OC5 A;  3P2H A;  4A33 A;  1BAV A;  1Z2L A;  2ZEH A;  4ZX8 A;  2YGW A;  2GLF A;  3S6H A;  3B3C A;  4ZYQ A;  7CPA A;  1VKC A;  2JEW A;  4GS4 A;  3S6K A;  3PRT A;  4BBH A;  4KUA A;  1BPN A;  1V0C A;  3B7I A;  4P4E A;  3PFO A;  2NSM A;  4U9Z A;  4C68 A;  1ELM P;  2AFM A;  4RN7 A;  3GY9 A;  4QUS A;  4CGO A;  3CZX A;  4CPA A;  4FUU A;  4ORF A;  3TO7 A;  1PCA A;  3JVN A;  3T9Y A;  4MY3 A;  3S9L A;  4F9V A;  2ATR A;  4KOX A;  1Q2C A;  4AXV A;  3PGP A;  4H89 A;  4A30 A;  2D4P A;  4UCN A;  1IB1 E;  4PXC A;  4UWI A;  3BJ7 A;  1QMU A;  4PK3 A;  3WC5 A;  1YRE A;  1Z4E A;  3D2M A;  3FXT A;  1ON0 A;  4NGS A;  3S9N A;  3T90 A;  2AE6 A;  2J8R A;  3N7Z A;  3JRU A;  2J8N A;  3KQZ A;  1I21 A;  4WWV A;  1Z8T A;  4KSF A;  3QNV A;  4CYP A;  2QJ8 A;  4NXY A;  3VWE A;  2EWB A;  2Z3P A;  2HQY A;  4UF4 A;  1Y7E A;  3GIU A;  3IEH A;  4NEX A;  4IUS A;  1QSO A;  4U9Y A;  4BIN A;  1MJA A;  1ZLH A;  1Q2D A;  2FT0 A;  2GAN A;  3D7G A;  4MFL A;  5DWM A;  3TT2 A;  2PJ1 A;  4CAE A;  1QQ9 A;  3D7D A;  3W6S A;  5I4M A;  4CGP A;  1XOV A;  4PK2 A;  5D29 A;  3FX6 A;  1YLE A;  4B6Z A;  5KTD A;  1CP7 A;  4ZBG A;  2OZG A;  1F57 A;  3FMC A;  4G1P A;  4UBR A;  4YWY A;  3RZA A;  5JH9 A;  3WAB A;  4FBE A;  4B10 A;  4II9 A;  1OZP A;  2EVN A;  2Q4Z A;  3DR6 A;  4O23 A;  1KWM A;  2DEA A;  1Y9K A;  2G3A A;  1YR0 A;  2ZEG A;  1PU9 A;  3EO4 A;  3PB6 X;  2AJ6 A;  3KAS A;  4AG7 A;  4BD9 A;  2PJ9 A;  2ZOG A;  2IQ6 A;  2RFH A;  2OU2 A;  4CRZ B;  4X5K A;  2FL4 A;  2DF5 A;  3WC6 A;  5IB0 A;  4B11 A;  2R98 A;  3EFA A;  4R87 A;  4CYO A;  2K5T A;  3B8G A;  3EXN A;  4MCQ A;  1DE4 C;  1EE3 P;  4Q36 A;  2WPW A;  2C6P A;  3V8I A;  2GFQ A;  3K9U A;  4KVX A;  1MJ9 A;  1IU8 A;  3V38 A;  1XF8 A;  4ZGY B;  1XEB A;  4CAV A;  5CBM A;  3IFE A;  4ZY2 A;  3IC1 A;  3I9S A;  2Z3N A;  4QVT A;  1Q7L A;  4H6Z A;  2O28 A;  4L89 A;  2PCU A;  1CPX A;  3NH8 A;  4MFJ A;  2G3T A;  3LOD A;  1FY7 A;  2PJ5 A;  3B2Y A;  2PJC A;  1ZG9 A;  5F49 A;  4K3N A;  4C7H A;  2REF A;  4UCP A;  3PZJ A;  3CT9 A;  5J8C A;  1TIQ A;  3FEE A;  5GCN A;  4R7M A;  2Q04 A;  1CP6 A;  3BI0 A;  3FB3 A;  1FNO A;  3FBU A;  3S9M A;  3GLJ A;  2Q4Y A;  2ZED A;  4PPZ A;  1I1D A;  5JPH A;  4MRI A;  2Z0Z A;  4RUH A;  3IWE A;  3WR7 A;  2KCW A;  2VI7 A;  2V8H A;  4WJB A;  1IOI A;  1NE9 A;  3DLJ A;  2P6E A;  4M3S A;  2Z3K A;  3C26 A;  3ISX A;  2RB7 A;  1S7F A;  1ELL P;  5C88 A;  4XPL A;  1VHE A;  3KKW A;  5G1Z A;  5KTC A;  1CM0 A;  3FYN A;  4UEZ A;  2CXA A;  4MFP A;  2B5G B;  4P44 A;  5J1Q A;  3DDD A;  2XEJ A;  2CTB A;  2FCK A;  3SJE A;  4MCS A;  4AG9 A;  1AMP A;  3B3T A;  2FIW A;  1R57 A;  2J8M A;  3D67 A;  4MFZ A;  1Z5R A;  4Q7A A;  1DTD A;  2WUU A;  3VAT A;  3KQX A;  4OAE A;  4XNH C;  3F0A A;  5I0C A;  4MBU A;  1Z8X A;  5HMN A;  1QSR A;  2PC1 A;  1VIX A;  3RO0 A;  2GE3 A;  3RYO A;  5G20 A;  3SJG A;  5IX3 A;  2OZH A;  3S6G A;  3SXO A;  3PB4 X;  2GRE A;  4H2K A;  3H4Q A;  4JD6 A;  1LOK A;  4NGR A;  4PQA A;  3VWD A;  1R3N A;  4GXH A;  2ZW6 A;  1Z4R A;  1GHE A;  2WSA A;  1CJW A;  1TKH A;  3PB7 X;  4HPS A;  4MMO A;  2OOT A;  2JEV A;  3TO6 A;  1Z9U A;  3D7F A;  1Z8W A;  4FD5 A;  5EBV A;  2JBJ A;  4F0X A;  4M6H A;  2YNE A;  4MXU A;  2B58 A;  4MFK A;  4R3L A;  3D3S A;  3SHP A;  2PRB A;  2VEZ A;  4A38 A;  4TNU A;  2CF4 A;  5LRK A;  4ZY0 A;  2Z11 A;  4J3G A;  4P4B A;  3PBE A;  4P4J A;  4PV6 A;  4NGM A;  5IV0 A;  2DXQ A;  4QC6 A;  3BXM A;  2DPT A;  4R3K A;  4KOY A;  2NYQ A;  4NSQ A;  1KUV A;  2QEC A;  5H86 A;  5BWA B;  2JDC A;  2JBK A;  4UFW A;  2PJ8 A;  2I79 A;  3B35 A;  1IYK A;  3GUX A;  3TTH A;  1NSA A;  2ZEL A;  3S6F A;  4YRH A;  4HKF A;  5E96 A;  5EMI A;  1M1D A;  3MN8 A;  1M4D A;  4B5P B;  4EVY A;  3PFE A;  1ZLI A;  4OME A;  3FJU A;  2R8V A;  4MI4 A;  2PE3 A;  4EWT A;  1SQH A;  3NA6 A;  2HB6 A;  4UCM A;  3T8W A;  1LRZ A;  2EK8 A;  2ABZ A;  5JQ4 A;  2OR4 A;  8CPA A;  1AYE A;  3I1U A;  3GYA A;  2GIV A;  5AG5 A;  4B12 A;  3NE7 A;  3BJ8 A;  1B87 A;  1L0C A;  3R96 A;  4Y49 C;  1YVO A;  4TWE A;  4UIA A;  2XEI A;  4CAW A;  2CY2 A;  1IGB A;  4XPD B;  4AVB A;  1LAM A;  4MHP A;  4KSA A;  4OC0 A;  4DJL A;  4MFQ A;  3MGD A;  2QVP A;  2ANP A;  3KL9 A;  4MHZ A;  2CTC A;  1Z8L A;  2FVG A;  3A9L A;  5A27 A;  2ARH A;  1HDQ A;  2Y0M A;  3DNS A;  4CS0 B;  2GU2 A;  2ZEE A;  1H8L A;  3DR8 A;  4JXR A;  2B4D A;  4KLV A;  4ZX9 A;  4K30 A;  5FVJ A;  1XMT A;  2EK9 A;  1JQG A;  4B13 A;  3DGV A;  3EY5 A;  4E8O A;  2C27 A;  2R7H A;  4ONW A;  2EUI A;  4W9Y A;  4F6A A;  2PRQ A;  2PDO A;  1TF9 A;  2BEI A;  1ZG8 A;  2AFS A;  3KR5 A;  4XNH B;  4BMH A;  3IU1 A;  2GLJ A;  4CYQ A;  3GKR A;  2Q43 A;  4UA3 A;  1Y7R A;  1KZF A;  2C6G A;  3G8W A;  4C2X A;  4UEF A;  4P4I A;  4CAF A;  5A28 A;  3L2N A;  3TFY A;  1Y9W A;  2PIZ A;  4P10 A;  4C2Z A;  4CRY B;  1YGH A;  2HV2 A;  1A2Z A;  1M4L A;  4CGM A;  1TKJ A;  3EC4 A;  2V8G A;  4UIB A;  1PUA A;  4R76 A;  4YU9 A;  3TO9 A;  4H6U A;  1YX0 A;  3LAC A;  4ONU A;  4PXD A;  5K8M A;  1XBU A;  1XFO A;  2FXF A;  3IWW A;  1S7K A;  2ZEO A;  1F2P A;  1HDU A;  5F48 A;  5CPA A;  2B4B A;  2HC9 A;  4OC1 A;  3W91 A;  2ZW4 A;  4KVO E;  2WPX A;  1VHO A;  1S5K A;  1IID A;  3FIX A;  1B6B A;  3KHZ A;  5LRJ A;  1R43 A;  4ZY1 A;  4F9U A;  4XPD C;  4PXB A;  4XPK A;  2CNS A;  3QAY A;  3FH4 A;  4MY0 A;  5LYD A;  1KUY A;  2CNT A;  4NGN A;  4JLY A;  4JWP A;  2PVW A;  3TCV A;  5JGF A;  1S60 A;  5F47 A;  3OWC A;  5KTA A;  2BUE A;  3IO1 A;  4HNY B;  1WK4 A;  4HNX B;  4PXE A;  4A94 A;  1TF8 A;  3CXS A;  3TC8 A;  4NF1 A;  4OID A;  3BHX A;  4ZI6 A;  4JJX A;  2PJB A;  2PR8 A;  3JUW A;  4CGL A;  2Q51 A;  5AG6 A;  2PJ0 A;  1BLL E;  1Y0Y A;  4OC3 A;  1MK4 A;  4U5Y A;  3WT4 A;  3LD2 A;  4KOR A;  3UY5 A;  1S7N A;  5AG4 A;  1F2O A;  1ARM A;  6CPA A;  5HVG A;  1K4J A;  5IB9 A;  3H5Z A;  4FD4 A;  4NJR A;  4OKO A;  5ISV A;  2EBJ A;  2IMO A;  1BPM A;  1Y0R A;  2PSW A;  4Q38 A;  5HVH A;  1LFW A;  4KOT A;  4KUB A;  2F7V A;  3DSB A;  4R8F A;  1OBR A;  2C1C A;  1XRY A;  1QSN A;  1FT7 A;  1ZG7 A;  5K8N A;  2VQY A;  4KOS A;  4NFR A;  5C82 A;  4FWU A;  2NMT A;  4Y49 B; 
#chains in the Genus database with same CATH homology
 1N71 A;  4YGO A;  3SXN A;  2Z3L A;  1M44 A;  4FD7 A;  3W6X A;  4A31 A;  2G0B A;  1XIX A;  4MJ8 A;  3I3G A;  2B3V A;  1P4N A;  1RXT A;  5EC4 A;  4KOU A;  2P6G A;  3TOB A;  4M85 A;  2I00 A;  1YK3 A;  4KOV A;  2Z10 A;  4B14 A;  4CGN A;  2ZXV A;  2VZZ A;  2YNC A;  4E0A A;  2FE7 A;  2FS5 A;  2VZY A;  4AB7 A;  5G21 A;  4IF5 A;  2ZPA A;  2Q4V A;  3TOA A;  1QST A;  2ZW7 A;  2BL1 A;  1QSM A;  3R95 A;  2RC4 A;  4QB9 A;  1S3Z A;  3PP9 A;  3ZZI A;  3R9G A;  1UFH A;  3R1K A;  4PSW A;  2PQ8 A;  1NMT A;  3ZJ0 A;  3TE4 A;  1IYL A;  4AVA A;  4A32 A;  1MJB A;  4C2Y A;  4R9M A;  2ZW5 A;  2REE A;  2JLM A;  4L8A A;  4FD6 A;  4UFV A;  1NSL A;  2A4N A;  4AVC A;  2P0W A;  2B5G A;  4KS9 A;  4C7I A;  2OB0 A;  4B5O A;  4E2A A;  4JXQ A;  3CXQ A;  3QB8 A;  5H84 A;  3JTK A;  1VHS A;  2D4O A;  3E0K A;  4R57 A;  1U6M A;  1BOB A;  4OAD A;  3D8P A;  1Q2Y A;  5AGE A;  5F46 A;  2Z3M A;  5AG7 A;  4HNW B;  4MHD A;  4KZT A;  1IIC A;  2CNM A;  4A2Z A;  2PR1 A;  2B3U A;  1RO5 A;  2BSW A;  2FIA A;  2P6F A;  4UFX A;  2FSR A;  4QBJ A;  5HH1 A;  5J8F A;  4A95 A;  1M4I A;  3QAH A;  1BO4 A;  3R9F A;  1KUX A;  2IL4 A;  2YND A;  2OH1 A;  4KLW A;  2VBQ A;  3CXP A;  3D2P A;  3IWG A;  3FRM A;  3IGR A;  3F5B A;  4I49 A;  1I12 A;  3G3S A;  3BLN A;  4B5P A;  2VXK A;  3P2F A;  3R9E A;  1XE4 A;  2H5M A;  4DNC A;  2DPS A;  2HUZ A;  2JDD A;  2Q0Y A;  2OZU A;  4F0Y A;  1S7L A;  4KVM E;  2Q44 A;  5CNP A;  2R1I A;  4RI1 A;  4OLL A;  2X7B A;  4LUA A;  2B4D B;  1ZO0 A;  4NCZ A;  4CYN A;  2QIR A;  1M4G A;  2Z3O A;  4PSX A;  5G22 A;  4RS2 A;  1WWZ A;  2QML A;  4CAX A;  1P0H A;  4KOW A;  3IU2 A;  2Q7B A;  1YVK A;  4YFJ A;  1J4J A;  2YNC C;  3FNC A;  4UWJ A;  2F5I A;  3F8K A;  5DWN A;  3P2H A;  4A33 A;  2YGW A;  3S6H A;  1VKC A;  4GS4 A;  3S6K A;  4BBH A;  4KUA A;  1V0C A;  4U9Z A;  4C68 A;  3GY9 A;  4QUS A;  4CGO A;  3TO7 A;  4ORF A;  3JVN A;  3T9Y A;  4MY3 A;  2ATR A;  4KOX A;  1Q2C A;  3PGP A;  4H89 A;  4A30 A;  2D4P A;  4UCN A;  1IB1 E;  4UWI A;  3BJ7 A;  4PK3 A;  1YRE A;  1Z4E A;  3D2M A;  3FXT A;  1ON0 A;  3T90 A;  2AE6 A;  2J8R A;  3N7Z A;  2J8N A;  1I21 A;  4KSF A;  4CYP A;  4NXY A;  3VWE A;  2Z3P A;  2HQY A;  4NEX A;  4IUS A;  1QSO A;  4U9Y A;  1MJA A;  1Q2D A;  2FT0 A;  2GAN A;  4MFL A;  3TT2 A;  5DWM A;  4CAE A;  3W6S A;  4CGP A;  4PK2 A;  5KTD A;  1YLE A;  4ZBG A;  2OZG A;  4UBR A;  4B10 A;  4II9 A;  1OZP A;  2EVN A;  3DR6 A;  1Y9K A;  2G3A A;  1YR0 A;  1PU9 A;  3EO4 A;  2AJ6 A;  4AG7 A;  2OU2 A;  4CRZ B;  4X5K A;  2FL4 A;  5IB0 A;  4B11 A;  2R98 A;  3EFA A;  4R87 A;  4CYO A;  2K5T A;  3B8G A;  3EXN A;  4Q36 A;  2WPW A;  3V8I A;  3K9U A;  4KVX A;  1MJ9 A;  1XF8 A;  4ZGY B;  1XEB A;  4CAV A;  3I9S A;  2Z3N A;  4QVT A;  4H6Z A;  2O28 A;  4L89 A;  4MFJ A;  2G3T A;  3LOD A;  1FY7 A;  5F49 A;  4C7H A;  2REF A;  4UCP A;  3PZJ A;  5J8C A;  1TIQ A;  5GCN A;  2Q04 A;  3FB3 A;  3FBU A;  5JPH A;  2Q4Y A;  1I1D A;  2Z0Z A;  3IWE A;  3WR7 A;  2KCW A;  2VI7 A;  1NE9 A;  2P6E A;  4M3S A;  2Z3K A;  3C26 A;  1S7F A;  5C88 A;  4XPL A;  3KKW A;  5G1Z A;  5KTC A;  1CM0 A;  3FYN A;  2CXA A;  4MFP A;  2B5G B;  3DDD A;  2FCK A;  4AG9 A;  2FIW A;  1R57 A;  2J8M A;  4MFZ A;  2WUU A;  4OAE A;  4XNH C;  3F0A A;  5I0C A;  4MBU A;  5HMN A;  1QSR A;  2PC1 A;  2GE3 A;  3RYO A;  5G20 A;  5IX3 A;  2OZH A;  3S6G A;  3SXO A;  3H4Q A;  4JD6 A;  3VWD A;  2ZW6 A;  1Z4R A;  1GHE A;  2WSA A;  1CJW A;  2JEV A;  3TO6 A;  1Z9U A;  4FD5 A;  5EBV A;  4F0X A;  2YNE A;  2B58 A;  4MFK A;  4R3L A;  3D3S A;  3SHP A;  2PRB A;  2VEZ A;  2Z11 A;  4J3G A;  4PV6 A;  5IV0 A;  2DXQ A;  4QC6 A;  2DPT A;  4R3K A;  4KOY A;  4NSQ A;  1KUV A;  2QEC A;  5H86 A;  5BWA B;  2JDC A;  4UFW A;  2I79 A;  1IYK A;  3TTH A;  3S6F A;  4YRH A;  4HKF A;  5E96 A;  1M1D A;  4B5P B;  1M4D A;  4EVY A;  2R8V A;  4MI4 A;  1SQH A;  4UCM A;  1LRZ A;  5JQ4 A;  3GYA A;  2GIV A;  5AG5 A;  4B12 A;  3NE7 A;  3BJ8 A;  1B87 A;  1L0C A;  3R96 A;  4Y49 C;  1YVO A;  4CAW A;  2CY2 A;  4XPD B;  4AVB A;  4KSA A;  4MFQ A;  3MGD A;  3A9L A;  5A27 A;  2ARH A;  4CS0 B;  2Y0M A;  3DNS A;  4JXR A;  3DR8 A;  2B4D A;  4KLV A;  4K30 A;  5FVJ A;  1XMT A;  4B13 A;  3EY5 A;  4E8O A;  2C27 A;  2R7H A;  2EUI A;  4F6A A;  2PDO A;  2BEI A;  4XNH B;  4BMH A;  3IU1 A;  4CYQ A;  3GKR A;  4UA3 A;  4C2X A;  1Y7R A;  1KZF A;  3G8W A;  4CAF A;  5A28 A;  3TFY A;  1Y9W A;  4C2Z A;  4CRY B;  1YGH A;  2HV2 A;  4CGM A;  3EC4 A;  1PUA A;  3TO9 A;  4H6U A;  1YX0 A;  4ONU A;  2FXF A;  1S7K A;  5F48 A;  2B4B A;  3W91 A;  2ZW4 A;  4KVO E;  2WPX A;  1S5K A;  1IID A;  3FIX A;  1B6B A;  4XPD C;  4XPK A;  2CNS A;  4MY0 A;  1KUY A;  2CNT A;  4JLY A;  4JWP A;  3TCV A;  1S60 A;  5F47 A;  3OWC A;  5KTA A;  2BUE A;  4HNY B;  1WK4 A;  4HNX B;  3CXS A;  4NF1 A;  4JJX A;  2PR8 A;  3JUW A;  4CGL A;  5AG6 A;  4U5Y A;  1MK4 A;  5AG4 A;  3LD2 A;  4KOR A;  3UY5 A;  1S7N A;  5ISV A;  1K4J A;  3H5Z A;  4FD4 A;  2PSW A;  4Q38 A;  4KOT A;  4KUB A;  3DSB A;  1QSN A;  2VQY A;  4KOS A;  5C82 A;  4LX9 A;  2NMT A;  4Y49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...