4AG9A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): ternary complex with coenzyme a and glcnac
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
SHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 40
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag9A01
2FIWA 1M4GA 2BUEA 5HMNA 5IB0A 5H86A 5F47A 3TO6A 1LRZA 2F5IA 1I21A 2G3AA 4NCZA 5F49A 4KOSA 3OWCA 1M4IA 2PDOA 2VI7A 1BOBA 4KOXA 2HV2A 4AG7A 3PP9A 3S6HA 4CRZB 4JJXA 1UFHA 3P2HA 1NE9A 2B4DA 3F5BA 4UWIA 2PR8A 4I49A 4YRHA 2D4PA 3F0AA 4R3LA 2HQYA 2B4BA 5J8CA 2FL4A 3FXTA 2D4OA 1OZPA 4F0YA 5KTDA 2FXFA 2B4DB 1BO4A 3D3SA 2FCKA 3TCVA 3IGRA 4NF1A 4FD4A 4FD6A 2Q7BA 2GANA 4LUAA 3DNSA 3TOAA 2Z0ZA 4HNYB 2ZW4A 4E2AA 3CXPA 1M44A 3R95A 4NEXA 2CNTA 4XPDB 5J8FA 4L89A 2H5MA 1YX0A 4OLLA 4F6AA 4KOUA 1S7NA 4QUSA 3FBUA 3E0KA 5I0CA 5F46A 1NMTA 2REEA 3C26A 4QVTA 4ORFA 5F48A 4U9ZA 3R9EA 2P6FA 5GCNA 1S60A 4XNHC 2R1IA 1CJWA 4KOWA 5DWNA 2OH1A 2VZYA 4R87A 4Y49B 4KUAA 3H4QA 1IYKA 3MGDA 5ISVA 2G0BA 3D2MA 4PK3A 1IYLA 4FD7A 1RO5A 3DDDA 4JXQA 4CS0B 5CNPA 3FNCA 1U6MA 1IIDA 4MY0A 2Q4VA 3KKWA 3TOBA 3G3SA 1Y9KA 3FRMA 2BSWA 2KCWA 4PK2A 3V8IA 2B3VA 2P6GA 3I9SA 4PV6A 1Z9UA 1YVKA 3G8WA 3UY5A 1B6BA 1PUAA 1SQHA 1TIQA 2AJ6A 4MY3A 5EC4A 1RXTA 5C88A 3CXQA 2NMTA 2Q04A 4E0AA 3QAHA 1XF8A 3JVNA 4MI4A 1P4NA 4UWJA 4KOTA 3SXNA 2PR1A 4CAWA 4B5OA 2I00A 2RC4A 3CXSA 5E96A 1L0CA 4MBUA 3S6FA 2Z10A 4E8OA 5KTAA 2PRBA 1S3ZA 1KUYA 4XPDC 1VHSA 1Z4RA 3EXNA 5FVJA 1N71A 2O28A 4RI1A 4L8AA 3WR7A 1YR0A 1XEBA 4KUBA 4CRYB 1QSOA 4XPKA 1QSMA 2VXKA 3R9FA 1S7KA 2OZUA 4H6UA 1P0HA 1Y9WA 2B58A 1CM0A 1PU9A 4YFJA 4KVME 4CAVA 3GKRA 3NE7A 2R7HA 3D2PA 2BL1A 2JEVA 3T90A 2HUZA 1R57A 2QMLA 4JD6A 3VWDA 3FYNA 3LODA 2B5GA 1MJAA 2QIRA 5DWMA 4B5PA 1MJ9A 2VBQA 4JLYA 3TTHA 5EBVA 1GHEA 3TO9A 3TT2A 2FIAA 1KUVA 2DXQA 1V0CA 1YREA 2FT0A 4J3GA 1I12A 1Q2CA 3VWEA 4X5KA 5C82A 1ON0A 3DSBA 2OZHA 4H6ZA 3D8PA 3ZZIA 2FS5A 1S5KA 2CNSA 4M3SA 3S6KA 4PSXA 4JXRA 2Z11A 2BEIA 1I1DA 2OB0A 1YLEA 4NSQA 2GIVA 4UA3A 3FB3A 3TFYA 4HNXB 4U5YA 4ZBGA 2VZZA 4YGOA 2R8VA 3P2FA 2JDDA 2ATRA 2AE6A 1S7LA 3LD2A 4EVYA 1YGHA 2B3UA 3IWGA 3SHPA 3T9YA 2J8MA 2Q4YA 2VQYA 4ONUA 3GY9A 2PSWA 2QECA 4KLVA 3SXOA 2FE7A 2VEZA 1K4JA 1XIXA 2EVNA 4IF5A 3W6SA 1KUXA 3EFAA 3EY5A 2JDCA 2ZPAA 2K5TA 3N7ZA 4R57A 1VKCA 5JQ4A 4NXYA 1Q2YA 2ZW5A 4IUSA 3R96A 1Y7RA 4KOVA 4KVOE 1NSLA 3ZJ0A 1M1DA 4MJ8A 4HNWB 4PSWA 4JWPA 1YVOA 2FSRA 4KZTA 2REFA 4M85A 2I79A 3W91A 2J8NA 4FD5A 3RYOA 4KVXA 1MK4A 4BMHA 1FY7A 4XPLA 4AVBA 3S6GA 2ZW7A 1S7FA 4HKFA 4Y49C 1J4JA 1IICA 3R9GA 4RS2A 2Q0YA 2JLMA 5HH1A 5KTCA 4UBRA 3I3GA 5IV0A 4LX9A 1B87A 2P6EA 2ARHA 5JPHA 1QSTA 3GYAA 3K9UA 2IL4A 2J8RA 4CAXA 3EO4A 4R9MA 4R3KA 4OAEA 2GE3A 4KORA 4MHDA 3DR8A 4GS4A 1QSNA 1WK4A 1XMTA 2B5GB 4K30A 4OADA 1Q2DA 3W6XA 2EUIA 4B5PB 2G3TA 3EC4A 2A4NA 1M4DA 3FIXA 4QB9A 4U9YA 3PGPA 4AVAA 5IX3A 3R1KA 2CY2A 4H89A 3BJ8A 4AVCA 3BJ7A 3TE4A 2PQ8A 1YK3A 2Q44A 1Z4EA 2PC1A 2P0WA 2OU2A 2WPXA 1XE4A 4KLWA 2R98A 2X7BA 1IB1E 3TO7A 4DNCA 2OZGA 1WWZA 3PZJA 4QC6A 3DR6A 2CNMA 2Y0MA 3BLNA 2ZW6A 4QBJA 4XNHB 4AG9A 4II9A 2ZXVA 5H84A 3F8KA 4KOYA 2C27A 2WPWA 3JUWA 1QSRA 1MJBA 3B8GA 3QB8A 1KZFA 4AB7A
chains in the Genus database with same CATH superfamily
2FIWA 1M4GA 2YNCC 4KSFA 2BUEA 5HMNA 5IB0A 5H86A 4OC3A 5F47A 1Z8WA 1OBRA 2XEIA 3IIBA 3TO6A 1LRZA 2F5IA 1I21A 4M6HA 4ZYQA 2V77A 3VATA 2G3AA 4NCZA 5F49A 1Z8TA 4KOSA 4MHPA 3OWCA 2Q7SA 2C1CA 1M4IA 2PDOA 2VI7A 3FEDA 3GIUA 1BOBA 4OC5A 2BOAA 1Z8XA 2ZENA 5D29A 4A33A 1ARLA 1TKFA 4KOXA 2HV2A 4AG7A 1HDQA 3PP9A 3CPXA 3S6HA 1FNOA 4TWEA 4CRZB 4JJXA 2OR4A 1UFHA 3P2HA 1NE9A 2IJZA 5F09A 1BLLE 2AFZA 2B4DA 3WC6A 4EFDA 3F5BA 4UWIA 5A27A 3GLJA 2PR8A 2ZOFA 4I49A 4YRHA 1BAVA 2D4PA 3F0AA 4C7IA 1CP7A 2C6GA 4R3LA 2HQYA 2B4BA 5J8CA 2YNCA 2FL4A 3FXTA 1Z8LA 2D4OA 4R6TA 4CYQA 4P4EA 5JGFA 1RTQA 2PVVA 1OZPA 4F0YA 5KTDA 2FXFA 2HC9A 2B4DB 2CXAA 1BO4A 3D3SA 5A28A 2FCKA 3FMCA 3TCVA 5BWAB 3IGRA 4NGNA 4NF1A 4EWTA 1YMEA 2BCOA 3CT9A 3DGVA 4WWVA 4FD4A 2PJ7A 4UCNA 4UFXA 4MRIA 1LOKA 2VL1A 4NJQA 2FVGA 4FD6A 2PJ6A 4P4DA 2Q7BA 3SJFA 2EO8A 2GANA 4LUAA 2PJ5A 3DNSA 2Z0ZA 3TOAA 4MHZA 5EMIA 4HNYB 2ZW4A 4OC1A 5AG5A 4CAEA 4E2AA 3CXPA 4CYPA 1M44A 4A31A 2PIYA 3R95A 4NEXA 1A2ZA 2CNTA 1IU8A 4XPDB 4F8ZA 4L89A 5J8FA 4PPZA 2H5MA 1YX0A 2ZEFA 4OLLA 4F6AA 4KOUA 4B10A 2XEFA 4NGSA 4BINA 1Z2LA 1S7NA 4YWYA 2NSMA 4QUSA 3FBUA 4CAFA 3WT4A 3E0KA 1PYTB 5I0CA 1DTDA 1LCPA 4CYOA 5F46A 1NMTA 2AFSA 3ISZA 5IB9A 2REEA 3C26A 4QVTA 4ORFA 4TNUA 5F48A 4U9ZA 3R9EA 1VHEA 2P6FA 3NH8A 5GCNA 1S60A 4XNHC 2R1IA 2Z3OA 1XJOA 2DF5A 2XEGA 1JQGA 2IQ6A 3BI0A 1CJWA 4KOWA 5DWNA 2IMOA 5AG4A 2OH1A 4DUKA 2VZYA 2ZEMA 4R87A 4Y49B 4KUAA 4P4IA 2WYRA 3H4QA 2QJ8A 1IYKA 2ANPA 3B2YA 3FH4A 4CYNA 4C2YA 3MGDA 1AUGA 5ISVA 1NSAA 2G0BA 3D2MA 4IAVA 4NFRA 4PK3A 1Y0RA 5THWA 1VHOA 1IYLA 1M4LA 4FD7A 1RO5A 3B35A 1VGYA 1UWYA 2XEJA 4UCPA 4A39A 3IO1A 3DDDA 4JXQA 4CS0B 4OIDA 5CNPA 3FNCA 1U6MA 1IIDA 4ZY1A 2WZNA 2NYQA 3D7FA 3PFOA 2ZEGA 4MY0A 5LRJA 2Q4VA 1KWMA 2EBJA 5DS0A 3KKWA 3B3CA 8CPAA 2AFMA 3IWWA 4UCMA 4A2ZA 4DYOA 3K9TA 3A9LA 3CZXA 1FT7A 2PIZA 3TOBA 4H2KA 3G3SA 5LRKA 1Y9KA 4IK2A 1LANA 3FRMA 3SI2A 3JTKA 3KHXA 2BSWA 2KCWA 5K8MA 3WC7A 4C2XA 4PK2A 3RAMA 3V8IA 2B3VA 3PB8X 3V7ZA 1LAMA 1ZG8A 3IFEA 2ZEPA 4A30A 2P6GA 3I9SA 3H8EA 2PCUA 3QAYA 4NGTA 1QQ9A 4PV6A 1Z9UA 3D68A 1YVKA 3D7GA 3G8WA 4P44A 1B6BA 1BPMA 1PUAA 1SQHA 3UY5A 4IHMA 3K2KA 1TIQA 3V38A 4OC2A 4UIAA 2AJ6A 3KL9A 4MY3A 2GLFA 2Q4ZA 3IEHA 5EC4A 1TKHA 1RXTA 5C88A 3CDXA 2Z3PA 4A37A 3CXQA 5AG7A 2NMTA 2Q04A 4E0AA 4F0XA 3QAHA 1XF8A 2Z3NA 3JVNA 4MI4A 1P4NA 4NGRA 2EWBA 4UWJA 4A94A 4KOTA 2BO9A 3WABA 1PCAA 1R3NA 3SXNA 1IGBA 2PR1A 1YW6A 4B5OA 4CAWA 3NA6A 2I00A 2AFUA 2RC4A 3IWEA 3WC5A 3CXSA 5E96A 1L0CA 4MBUA 4NGQA 2CF4A 4UEZA 3S6FA 3PFEA 1Z5RA 4FWUA 2F7VA 2Z10A 3NFZA 4E8OA 5KTAA 2PRBA 4FBEA 1S3ZA 1KUYA 4XPDC 4LQGA 3SI0A 4PXDA 1VHSA 3TC8A 4WJBA 2EK9A 2GREA 1Z4RA 5G20A 3SJXA 2DPSA 3EXNA 1YQEA 1XRYA 1N71A 2ZOGA 2O28A 4RI1A 5FVJA 4L8AA 3WR7A 1IY7A 1VIXA 3IU1A 1YR0A 3PB6X 2V8DA 3FVLA 4CGOA 1XEBA 4KUBA 4CRYB 3BHXA 1XBUA 1QSOA 4CGLA 4XPKA 1QSMA 6CPAA 2VXKA 4GM5A 4CGPA 3KHZA 3R9FA 1S7KA 2Z3MA 2OZUA 3IJ3A 1P0HA 3NH4A 4H6UA 1Y9WA 2V8HA 2DEAA 5ELYA 2B58A 4ZY0A 4BD9A 1CM0A 1PU9A 4Q7AA 4YFJA 4KVME 2J9AA 4CAVA 4X3RA 5G1ZA 3GKRA 2QYVA 2RB7A 3NE7A 5LYIA 2R7HA 3D2PA 4CGMA 4ZX8A 2BL1A 2JEVA 3LMSA 2HUZA 3T90A 3QNVA 1R57A 4O23A 4F9UA 1ZLHA 2QMLA 3H5ZA 3KZWA 4JD6A 4X8IA 5LRGA 1F2PA 2Z3KA 3FYNA 2Q43A 3VWDA 5CPAA 2PJ8A 3LODA 2HB6A 5I4MA 2B5GA 3FX6A 3MRUA 4EMEA 4R76A 1TXRA 4B12A 1MJAA 2QIRA 1BPNA 5DWMA 3S9LA 1ZG7A 4A38A 4B11A 2CTBA 4B5PA 1MJ9A 2PJ4A 2VBQA 4JLYA 3B7IA 4LQ6A 4GXHA 2PJ2A 4UEEA 3TTHA 4P4BA 3LWUA 1GHEA 5AG6A 5EBVA 3TO9A 3MN8A 3TT2A 2ZELA 3PBEA 2FIAA 3B3VA 1KUVA 2DXQA 4OC4A 1V0CA 4ZY2A 1YREA 2FT0A 4J3GA 1I12A 1IOFA 4MMOA 1Q2CA 3VWEA 4MFQA 4B13A 4X5KA 3PEIA 5C82A 1ON0A 3DSBA 4MFKA 1YSJA 2OZHA 4H6ZA 2Q51A 3D8PA 3VH9A 1GYTA 1CPXA 2FS5A 1S5KA 1Q7LA 4NJRA 2CNSA 3ZZIA 4M3SA 3S6KA 5LYFA 3PRTA 2CIJA 1AMPA 2Z11A 4JXRA 3D7DA 4PSXA 1CBXA 2BEIA 1I1DA 4NGMA 2OB0A 1YLEA 4NSQA 2GIVA 4UA3A 3SI1A 3FB3A 4RN7A 1LAPA 3TFYA 4HNXB 1DE4C 2PJ0A 4U5YA 4ZBGA 2VZZA 1IOIA 3I1UA 2G9DA 4YGOA 2POKA 2OOTA 4G1PA 1H8LA 2R8VA 3P2FA 3IC1A 4JYWA 2JDDA 3BXMA 2ATRA 2AE6A 1TKJA 1S7LA 2AFXA 2WUUA 3LD2A 2GFQA 2JEWA 2PJBA 4EVYA 2C6CA 1YGHA 3B3WA 2B3UA 3IU2A 3IWGA 3SHPA 3T9YA 2J8MA 2Q4YA 2VQYA 4ONUA 1QMUA 4AB7A 2JBJA 4AXVA 4P45A 4MCRA 1ELLP 3GY9A 4YU9A 2PJAA 4UIBA 2PSWA 2QECA 1JWQA 3KGQA 4KLVA 2FE7A 4UEFA 3SXOA 4DJLA 2VEZA 1K4JA 1XIXA 1F2OA 2EVNA 4R8FA 4IF5A 3W6SA 1KUXA 2ZEHA 4MFZA 3EFAA 3EY5A 5LYDA 2JDCA 2ZPAA 2K5TA 3N7ZA 5CBMA 4R57A 1YW4A 4A32A 1VKCA 5JQ4A 4NXYA 1Q2YA 1Y0YA 2ZW5A 4IUSA 1EE3P 3R96A 1Y7RA 2ABZA 4KOVA 4KVOE 2GU2A 1NSLA 3PB4X 3ZJ0A 1M1DA 4MJ8A 1ZLIA 4HNWB 4PSWA 3KQXA 3RZAA 4JWPA 1YVOA 4MHNA 3HUVA 4OMEA 4F9VA 2FSRA 4ZI6A 1AYEA 4OP4A 3GB0A 4FAIA 1HDUA 1TF8A 4KZTA 1ZO0A 4UFWA 2WSAA 2REFA 1TF9A 3KASA 4M85A 4UF4A 5K8PA 4P4FA 4A95A 2I79A 3PB9X 3W91A 3TX8A 2AFWA 2J8NA 2YNEA 4MXUA 3D4UA 3S9NA 2O4HA 2PJ9A 3FF3A 4KS9A 4FD5A 3RYOA 5HXDA 4KVXA 1MK4A 2DPTA 4MFLA 4JZ0A 4MCSA 1CX8A 4BMHA 1FY7A 5LYLA 4OIWA 4P10A 3HLPA 2C6PA 3D7HA 4B6ZA 4XPLA 4AVBA 1ELMP 4CPAA 2O53A 3S6GA 1CP6A 1X10A 2ZW7A 1LFWA 1S7FA 3PB7X 2PJ1A 3H8FA 3RO0A 4HKFA 4Y49C 1J4JA 1IICA 3GUXA 4NGPA 3R9GA 1R43A 4MCQA 3ISXA 4RS2A 2Q0YA 2JLMA 5HH1A 4RUHA 5KTCA 4UBRA 4ZGYB 3I3GA 5IV0A 4LX9A 1B87A 4M6GA 2P6EA 3B3TA 2ARHA 5JPHA 1HEEA 1QSTA 2ODFA 3KR4A 3GYAA 3FJUA 3FECA 4CGNA 2ZEEA 3K9UA 2IL4A 2J8RA 2QVPA 4OC0A 4CAXA 3EO4A 4P6YA 4R9MA 4R3KA 4OAEA 4PXBA 3DLJA 2GE3A 3QB8A 3B3SA 3FEEA 4KORA 4MFJA 5G22A 1CG2A 3BI1A 4MHDA 3DR8A 4GS4A 2RFHA 1QSNA 5JM6A 2JBKA 4Q36A 1WK4A 3JRUA 2ZEDA 3VARA 1XMTA 2B5GB 3D67A 4P4JA 4K30A 2EK8A 4OADA 2PVWA 1Q2DA 3W6XA 2EUIA 2V8VA 2PE3A 4B5PB 2G3TA 5HVHA 3EC4A 4OKOA 3N5FA 4K3NA 4Q38A 4X2TA 1CPSA 5G21A 2A4NA 1M4DA 4FUUA 4B14A 4M6IA 1X12A 3FIXA 4QB9A 2GLJA 4KSAA 4U9YA 3PGPA 4PQAA 1ARMA 4AVAA 3SJGA 5IX3A 3R1KA 4C68A 5K8NA 2CY2A 4H89A 4Z65A 3BJ8A 2YNDA 4AVCA 4C2ZA 3BJ7A 3TE4A 2PQ8A 2PRQA 1YK3A 2Q44A 1Z4EA 2PC1A 2P0WA 3H8GA 3NE8A 7CPAA 4KSIA 4UFVA 1Y7EA 2CTCA 2OU2A 2PJCA 1XE4A 2WPXA 4KLWA 4PXEA 2R98A 2X7BA 1IB1E 3PBBA 5K8OA 3TO7A 4DNCA 2OZGA 1WWZA 3PZJA 4MCPA 4QC6A 3RBUA 3DR6A 2CNMA 2Y0MA 4MHYA 4ZX9A 1YLOA 3LACA 3NH5A 3BLNA 2ZW6A 5HVFA 2AFOA 4QBJA 5HVGA 1F57A 1XMBA 1ZG9A 2PJ3A 2ZEOA 4HPSA 4MFPA 4XNHB 2YGWA 5J1QA 4AG9A 4C7HA 4PXCA 2V8GA 3T8WA 3RNZA 4W9YA 4BBHA 4ONWA 4II9A 2I3CA 2ZXVA 4R7MA 5H84A 1XFOA 3F8KA 3KQZA 5JH9A 3KI9A 2Z3LA 3SJEA 4KOYA 2F8HA 2C27A 2WPWA 3JUWA 1QSRA 1XOVA 3KR5A 1MJBA 3L2NA 3S9MA 3B8GA 5D8NA 3D66A 3CPAA 1KZFA 5AGEA
chains in the Genus database with same CATH topology
2FIWA 1M4GA 2YNCC 4KSFA 2BUEA 5HMNA 5IB0A 5H86A 5F47A 3TO6A 1LRZA 2F5IA 1I21A 2G3AA 4NCZA 5F49A 4KOSA 3OWCA 1M4IA 2PDOA 2VI7A 1BOBA 4A33A 4KOXA 2HV2A 4AG7A 3PP9A 3S6HA 4CRZB 4JJXA 1UFHA 3P2HA 1NE9A 2B4DA 3F5BA 4UWIA 5A27A 2PR8A 4I49A 4YRHA 2D4PA 3F0AA 4C7IA 4R3LA 2HQYA 2B4BA 5J8CA 2YNCA 2FL4A 3FXTA 2D4OA 4CYQA 1OZPA 4F0YA 5KTDA 2FXFA 2B4DB 2CXAA 1BO4A 3D3SA 5A28A 2FCKA 3TCVA 5BWAB 3IGRA 4NF1A 4FD4A 4UCNA 4UFXA 4FD6A 2Q7BA 2GANA 4LUAA 3DNSA 3TOAA 2Z0ZA 4HNYB 2ZW4A 5AG5A 4CAEA 4E2AA 3CXPA 4CYPA 1M44A 4A31A 3R95A 4NEXA 2CNTA 4XPDB 5J8FA 4L89A 2H5MA 1YX0A 4OLLA 4F6AA 4KOUA 4B10A 1S7NA 4QUSA 3FBUA 4CAFA 3E0KA 5I0CA 4CYOA 5F46A 1NMTA 2REEA 3C26A 4QVTA 4ORFA 5F48A 4U9ZA 3R9EA 2P6FA 5GCNA 1S60A 4XNHC 2R1IA 2Z3OA 1CJWA 4KOWA 5DWNA 5AG4A 2OH1A 2VZYA 4R87A 4Y49B 4KUAA 3H4QA 1IYKA 4CYNA 4C2YA 3MGDA 5ISVA 2G0BA 3D2MA 4PK3A 1IYLA 4FD7A 1RO5A 4UCPA 3DDDA 4JXQA 4CS0B 5CNPA 3FNCA 1U6MA 1IIDA 4MY0A 2Q4VA 3KKWA 4UCMA 4A2ZA 3A9LA 3TOBA 3G3SA 1Y9KA 3FRMA 3JTKA 2BSWA 2KCWA 4C2XA 4PK2A 3V8IA 2B3VA 4A30A 2P6GA 3I9SA 4PV6A 1Z9UA 1YVKA 3G8WA 3UY5A 1B6BA 1PUAA 1SQHA 1TIQA 2AJ6A 4MY3A 5EC4A 1RXTA 5C88A 2Z3PA 3CXQA 5AG7A 2NMTA 2Q04A 4E0AA 4F0XA 3QAHA 1XF8A 2Z3NA 3JVNA 4MI4A 1P4NA 4UWJA 4KOTA 3SXNA 2PR1A 4CAWA 4B5OA 2I00A 2RC4A 3IWEA 3CXSA 5E96A 1L0CA 4MBUA 3S6FA 2Z10A 4E8OA 5KTAA 2PRBA 1S3ZA 1KUYA 4XPDC 1VHSA 1Z4RA 5G20A 2DPSA 3EXNA 5FVJA 1N71A 2O28A 4RI1A 4L8AA 3WR7A 3IU1A 1YR0A 4CGOA 1XEBA 4KUBA 4CRYB 1QSOA 4CGLA 4XPKA 1QSMA 2VXKA 4CGPA 3R9FA 1S7KA 2Z3MA 2OZUA 4H6UA 1P0HA 1Y9WA 2B58A 1CM0A 1PU9A 4YFJA 4KVME 4CAVA 5G1ZA 3GKRA 3NE7A 2R7HA 3D2PA 4CGMA 2BL1A 2JEVA 3T90A 2HUZA 1R57A 2QMLA 3H5ZA 4JD6A 3VWDA 2Z3KA 3FYNA 3LODA 2B5GA 4B12A 1MJAA 2QIRA 5DWMA 4B11A 4B5PA 1MJ9A 2VBQA 4JLYA 3TTHA 5AG6A 1GHEA 5EBVA 3TO9A 3TT2A 2FIAA 1KUVA 2DXQA 1V0CA 1YREA 2FT0A 4J3GA 1I12A 1Q2CA 3VWEA 4MFQA 4B13A 4X5KA 5C82A 1ON0A 3DSBA 4MFKA 2OZHA 4H6ZA 3D8PA 3ZZIA 2FS5A 1S5KA 2CNSA 4M3SA 3S6KA 4PSXA 4JXRA 2Z11A 2BEIA 1I1DA 2OB0A 1YLEA 4NSQA 2GIVA 4UA3A 3FB3A 3TFYA 4HNXB 4U5YA 4ZBGA 2VZZA 4YGOA 2R8VA 3P2FA 2JDDA 2ATRA 2AE6A 1S7LA 2WUUA 3LD2A 4EVYA 1YGHA 3IU2A 2B3UA 3IWGA 3SHPA 3T9YA 2J8MA 2Q4YA 2VQYA 4ONUA 4AB7A 3GY9A 2PSWA 2QECA 4KLVA 3SXOA 2FE7A 2VEZA 1K4JA 1XIXA 2EVNA 4IF5A 3W6SA 1KUXA 4MFZA 3EFAA 3EY5A 2JDCA 2ZPAA 2K5TA 3N7ZA 4R57A 4A32A 1VKCA 5JQ4A 4NXYA 1Q2YA 2ZW5A 4IUSA 3R96A 1Y7RA 4KOVA 4KVOE 1NSLA 3ZJ0A 1M1DA 4MJ8A 4HNWB 4PSWA 4JWPA 1YVOA 2FSRA 4KZTA 1ZO0A 4UFWA 2WSAA 2REFA 4M85A 4A95A 2I79A 3W91A 2J8NA 2YNEA 4KS9A 4FD5A 3RYOA 4KVXA 1MK4A 2DPTA 4MFLA 4BMHA 1FY7A 4XPLA 4AVBA 3S6GA 2ZW7A 1S7FA 4HKFA 4Y49C 1J4JA 1IICA 3R9GA 4RS2A 2Q0YA 2JLMA 5HH1A 5KTCA 4UBRA 4ZGYB 3I3GA 5IV0A 4LX9A 1B87A 2P6EA 2ARHA 5JPHA 1QSTA 3GYAA 4CGNA 3K9UA 2IL4A 2J8RA 4CAXA 3EO4A 4R9MA 4R3KA 4OAEA 2GE3A 4KORA 5G22A 4MFJA 4MHDA 3DR8A 4GS4A 1QSNA 4Q36A 1WK4A 1XMTA 2B5GB 4K30A 4OADA 1Q2DA 3W6XA 2EUIA 4B5PB 2G3TA 3EC4A 4Q38A 5G21A 2A4NA 1M4DA 4B14A 3FIXA 4QB9A 4U9YA 4KSAA 3PGPA 4AVAA 5IX3A 3R1KA 4C68A 2CY2A 4H89A 3BJ8A 2YNDA 4AVCA 4C2ZA 3BJ7A 3TE4A 2PQ8A 1YK3A 2Q44A 1Z4EA 2PC1A 2P0WA 4UFVA 2OU2A 2WPXA 1XE4A 4KLWA 2R98A 2X7BA 1IB1E 3TO7A 4DNCA 2OZGA 1WWZA 3PZJA 4QC6A 3DR6A 2CNMA 2Y0MA 3BLNA 2ZW6A 4QBJA 4MFPA 4XNHB 2YGWA 4AG9A 4C7HA 4BBHA 4II9A 2ZXVA 5H84A 3F8KA 2Z3LA 4KOYA 2C27A 2WPWA 3JUWA 1QSRA 1MJBA 3B8GA 3QB8A 1KZFA 5AGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIW A;  1M4G A;  2BUE A;  5HMN A;  5IB0 A;  5H86 A;  5F47 A;  3TO6 A;  1LRZ A;  2F5I A;  1I21 A;  2G3A A;  4NCZ A;  5F49 A;  4KOS A;  3OWC A;  1M4I A;  2PDO A;  2VI7 A;  1BOB A;  4KOX A;  2HV2 A;  4AG7 A;  3PP9 A;  3S6H A;  4CRZ B;  4JJX A;  1UFH A;  3P2H A;  1NE9 A;  2B4D A;  3F5B A;  4UWI A;  2PR8 A;  4I49 A;  4YRH A;  2D4P A;  3F0A A;  4R3L A;  2HQY A;  2B4B A;  5J8C A;  2FL4 A;  3FXT A;  2D4O A;  1OZP A;  4F0Y A;  5KTD A;  2FXF A;  2B4D B;  1BO4 A;  3D3S A;  2FCK A;  3TCV A;  3IGR A;  4NF1 A;  4FD4 A;  4FD6 A;  2Q7B A;  2GAN A;  4LUA A;  3DNS A;  3TOA A;  2Z0Z A;  4HNY B;  2ZW4 A;  4E2A A;  3CXP A;  1M44 A;  3R95 A;  4NEX A;  2CNT A;  4XPD B;  5J8F A;  4L89 A;  2H5M A;  1YX0 A;  4OLL A;  4F6A A;  4KOU A;  1S7N A;  4QUS A;  3FBU A;  3E0K A;  5I0C A;  5F46 A;  1NMT A;  2REE A;  3C26 A;  4QVT A;  4ORF A;  5F48 A;  4U9Z A;  3R9E A;  2P6F A;  5GCN A;  1S60 A;  4XNH C;  2R1I A;  1CJW A;  4KOW A;  5DWN A;  2OH1 A;  2VZY A;  4R87 A;  4Y49 B;  4KUA A;  3H4Q A;  1IYK A;  3MGD A;  5ISV A;  2G0B A;  3D2M A;  4PK3 A;  1IYL A;  4FD7 A;  1RO5 A;  3DDD A;  4JXQ A;  4CS0 B;  5CNP A;  3FNC A;  1U6M A;  1IID A;  4MY0 A;  2Q4V A;  3KKW A;  3TOB A;  3G3S A;  1Y9K A;  3FRM A;  2BSW A;  2KCW A;  4PK2 A;  3V8I A;  2B3V A;  2P6G A;  3I9S A;  4PV6 A;  1Z9U A;  1YVK A;  3G8W A;  3UY5 A;  1B6B A;  1PUA A;  1SQH A;  1TIQ A;  2AJ6 A;  4MY3 A;  5EC4 A;  1RXT A;  5C88 A;  3CXQ A;  2NMT A;  2Q04 A;  4E0A A;  3QAH A;  1XF8 A;  3JVN A;  4MI4 A;  1P4N A;  4UWJ A;  4KOT A;  3SXN A;  2PR1 A;  4CAW A;  4B5O A;  2I00 A;  2RC4 A;  3CXS A;  5E96 A;  1L0C A;  4MBU A;  3S6F A;  2Z10 A;  4E8O A;  5KTA A;  2PRB A;  1S3Z A;  1KUY A;  4XPD C;  1VHS A;  1Z4R A;  3EXN A;  5FVJ A;  1N71 A;  2O28 A;  4RI1 A;  4L8A A;  3WR7 A;  1YR0 A;  1XEB A;  4KUB A;  4CRY B;  1QSO A;  4XPK A;  1QSM A;  2VXK A;  3R9F A;  1S7K A;  2OZU A;  4H6U A;  1P0H A;  1Y9W A;  2B58 A;  1CM0 A;  1PU9 A;  4YFJ A;  4KVM E;  4CAV A;  3GKR A;  3NE7 A;  2R7H A;  3D2P A;  2BL1 A;  2JEV A;  3T90 A;  2HUZ A;  1R57 A;  2QML A;  4JD6 A;  3VWD A;  3FYN A;  3LOD A;  2B5G A;  1MJA A;  2QIR A;  5DWM A;  4B5P A;  1MJ9 A;  2VBQ A;  4JLY A;  3TTH A;  5EBV A;  1GHE A;  3TO9 A;  3TT2 A;  2FIA A;  1KUV A;  2DXQ A;  1V0C A;  1YRE A;  2FT0 A;  4J3G A;  1I12 A;  1Q2C A;  3VWE A;  4X5K A;  5C82 A;  1ON0 A;  3DSB A;  2OZH A;  4H6Z A;  3D8P A;  3ZZI A;  2FS5 A;  1S5K A;  2CNS A;  4M3S A;  3S6K A;  4PSX A;  4JXR A;  2Z11 A;  2BEI A;  1I1D A;  2OB0 A;  1YLE A;  4NSQ A;  2GIV A;  4UA3 A;  3FB3 A;  3TFY A;  4HNX B;  4U5Y A;  4ZBG A;  2VZZ A;  4YGO A;  2R8V A;  3P2F A;  2JDD A;  2ATR A;  2AE6 A;  1S7L A;  3LD2 A;  4EVY A;  1YGH A;  2B3U A;  3IWG A;  3SHP A;  3T9Y A;  2J8M A;  2Q4Y A;  2VQY A;  4ONU A;  3GY9 A;  2PSW A;  2QEC A;  4KLV A;  3SXO A;  2FE7 A;  2VEZ A;  1K4J A;  1XIX A;  2EVN A;  4IF5 A;  3W6S A;  1KUX A;  3EFA A;  3EY5 A;  2JDC A;  2ZPA A;  2K5T A;  3N7Z A;  4R57 A;  1VKC A;  5JQ4 A;  4NXY A;  1Q2Y A;  2ZW5 A;  4IUS A;  3R96 A;  1Y7R A;  4KOV A;  4KVO E;  1NSL A;  3ZJ0 A;  1M1D A;  4MJ8 A;  4HNW B;  4PSW A;  4JWP A;  1YVO A;  2FSR A;  4KZT A;  2REF A;  4M85 A;  2I79 A;  3W91 A;  2J8N A;  4FD5 A;  3RYO A;  4KVX A;  1MK4 A;  4BMH A;  1FY7 A;  4XPL A;  4AVB A;  3S6G A;  2ZW7 A;  1S7F A;  4HKF A;  4Y49 C;  1J4J A;  1IIC A;  3R9G A;  4RS2 A;  2Q0Y A;  2JLM A;  5HH1 A;  5KTC A;  4UBR A;  3I3G A;  5IV0 A;  4LX9 A;  1B87 A;  2P6E A;  2ARH A;  5JPH A;  1QST A;  3GYA A;  3K9U A;  2IL4 A;  2J8R A;  4CAX A;  3EO4 A;  4R9M A;  4R3K A;  4OAE A;  2GE3 A;  4KOR A;  4MHD A;  3DR8 A;  4GS4 A;  1QSN A;  1WK4 A;  1XMT A;  2B5G B;  4K30 A;  4OAD A;  1Q2D A;  3W6X A;  2EUI A;  4B5P B;  2G3T A;  3EC4 A;  2A4N A;  1M4D A;  3FIX A;  4QB9 A;  4U9Y A;  3PGP A;  4AVA A;  5IX3 A;  3R1K A;  2CY2 A;  4H89 A;  3BJ8 A;  4AVC A;  3BJ7 A;  3TE4 A;  2PQ8 A;  1YK3 A;  2Q44 A;  1Z4E A;  2PC1 A;  2P0W A;  2OU2 A;  2WPX A;  1XE4 A;  4KLW A;  2R98 A;  2X7B A;  1IB1 E;  3TO7 A;  4DNC A;  2OZG A;  1WWZ A;  3PZJ A;  4QC6 A;  3DR6 A;  2CNM A;  2Y0M A;  3BLN A;  2ZW6 A;  4QBJ A;  4XNH B;  4AG9 A;  4II9 A;  2ZXV A;  5H84 A;  3F8K A;  4KOY A;  2C27 A;  2WPW A;  3JUW A;  1QSR A;  1MJB A;  3B8G A;  3QB8 A;  1KZF A;  4AB7 A; 
#chains in the Genus database with same CATH topology
 2FIW A;  1M4G A;  2YNC C;  4KSF A;  2BUE A;  5HMN A;  5IB0 A;  5H86 A;  4OC3 A;  5F47 A;  1Z8W A;  1OBR A;  2XEI A;  3IIB A;  3TO6 A;  1LRZ A;  2F5I A;  1I21 A;  4M6H A;  4ZYQ A;  2V77 A;  3VAT A;  2G3A A;  4NCZ A;  5F49 A;  1Z8T A;  4KOS A;  4MHP A;  3OWC A;  2Q7S A;  2C1C A;  1M4I A;  2PDO A;  2VI7 A;  3FED A;  3GIU A;  1BOB A;  4OC5 A;  2BOA A;  1Z8X A;  2ZEN A;  5D29 A;  4A33 A;  1ARL A;  1TKF A;  4KOX A;  2HV2 A;  4AG7 A;  1HDQ A;  3PP9 A;  3CPX A;  3S6H A;  1FNO A;  4TWE A;  4CRZ B;  4JJX A;  2OR4 A;  1UFH A;  3P2H A;  1NE9 A;  2IJZ A;  5F09 A;  1BLL E;  2AFZ A;  2B4D A;  3WC6 A;  4EFD A;  3F5B A;  4UWI A;  5A27 A;  3GLJ A;  2PR8 A;  2ZOF A;  4I49 A;  4YRH A;  1BAV A;  2D4P A;  3F0A A;  4C7I A;  1CP7 A;  2C6G A;  4R3L A;  2HQY A;  2B4B A;  5J8C A;  2YNC A;  2FL4 A;  3FXT A;  1Z8L A;  2D4O A;  4R6T A;  4CYQ A;  4P4E A;  5JGF A;  1RTQ A;  2PVV A;  1OZP A;  4F0Y A;  5KTD A;  2FXF A;  2HC9 A;  2B4D B;  2CXA A;  1BO4 A;  3D3S A;  5A28 A;  2FCK A;  3FMC A;  3TCV A;  5BWA B;  3IGR A;  4NGN A;  4NF1 A;  4EWT A;  1YME A;  2BCO A;  3CT9 A;  3DGV A;  4WWV A;  4FD4 A;  2PJ7 A;  4UCN A;  4UFX A;  4MRI A;  1LOK A;  2VL1 A;  4NJQ A;  2FVG A;  4FD6 A;  2PJ6 A;  4P4D A;  2Q7B A;  3SJF A;  2EO8 A;  2GAN A;  4LUA A;  2PJ5 A;  3DNS A;  2Z0Z A;  3TOA A;  4MHZ A;  5EMI A;  4HNY B;  2ZW4 A;  4OC1 A;  5AG5 A;  4CAE A;  4E2A A;  3CXP A;  4CYP A;  1M44 A;  4A31 A;  2PIY A;  3R95 A;  4NEX A;  1A2Z A;  2CNT A;  1IU8 A;  4XPD B;  4F8Z A;  4L89 A;  5J8F A;  4PPZ A;  2H5M A;  1YX0 A;  2ZEF A;  4OLL A;  4F6A A;  4KOU A;  4B10 A;  2XEF A;  4NGS A;  4BIN A;  1Z2L A;  1S7N A;  4YWY A;  2NSM A;  4QUS A;  3FBU A;  4CAF A;  3WT4 A;  3E0K A;  1PYT B;  5I0C A;  1DTD A;  1LCP A;  4CYO A;  5F46 A;  1NMT A;  2AFS A;  3ISZ A;  5IB9 A;  2REE A;  3C26 A;  4QVT A;  4ORF A;  4TNU A;  5F48 A;  4U9Z A;  3R9E A;  1VHE A;  2P6F A;  3NH8 A;  5GCN A;  1S60 A;  4XNH C;  2R1I A;  2Z3O A;  1XJO A;  2DF5 A;  2XEG A;  1JQG A;  2IQ6 A;  3BI0 A;  1CJW A;  4KOW A;  5DWN A;  2IMO A;  5AG4 A;  2OH1 A;  4DUK A;  2VZY A;  2ZEM A;  4R87 A;  4Y49 B;  4KUA A;  4P4I A;  2WYR A;  3H4Q A;  2QJ8 A;  1IYK A;  2ANP A;  3B2Y A;  3FH4 A;  4CYN A;  4C2Y A;  3MGD A;  1AUG A;  5ISV A;  1NSA A;  2G0B A;  3D2M A;  4IAV A;  4NFR A;  4PK3 A;  1Y0R A;  5THW A;  1VHO A;  1IYL A;  1M4L A;  4FD7 A;  1RO5 A;  3B35 A;  1VGY A;  1UWY A;  2XEJ A;  4UCP A;  4A39 A;  3IO1 A;  3DDD A;  4JXQ A;  4CS0 B;  4OID A;  5CNP A;  3FNC A;  1U6M A;  1IID A;  4ZY1 A;  2WZN A;  2NYQ A;  3D7F A;  3PFO A;  2ZEG A;  4MY0 A;  5LRJ A;  2Q4V A;  1KWM A;  2EBJ A;  5DS0 A;  3KKW A;  3B3C A;  8CPA A;  2AFM A;  3IWW A;  4UCM A;  4A2Z A;  4DYO A;  3K9T A;  3A9L A;  3CZX A;  1FT7 A;  2PIZ A;  3TOB A;  4H2K A;  3G3S A;  5LRK A;  1Y9K A;  4IK2 A;  1LAN A;  3FRM A;  3SI2 A;  3JTK A;  3KHX A;  2BSW A;  2KCW A;  5K8M A;  3WC7 A;  4C2X A;  4PK2 A;  3RAM A;  3V8I A;  2B3V A;  3PB8 X;  3V7Z A;  1LAM A;  1ZG8 A;  3IFE A;  2ZEP A;  4A30 A;  2P6G A;  3I9S A;  3H8E A;  2PCU A;  3QAY A;  4NGT A;  1QQ9 A;  4PV6 A;  1Z9U A;  3D68 A;  1YVK A;  3D7G A;  3G8W A;  4P44 A;  1B6B A;  1BPM A;  1PUA A;  1SQH A;  3UY5 A;  4IHM A;  3K2K A;  1TIQ A;  3V38 A;  4OC2 A;  4UIA A;  2AJ6 A;  3KL9 A;  4MY3 A;  2GLF A;  2Q4Z A;  3IEH A;  5EC4 A;  1TKH A;  1RXT A;  5C88 A;  3CDX A;  2Z3P A;  4A37 A;  3CXQ A;  5AG7 A;  2NMT A;  2Q04 A;  4E0A A;  4F0X A;  3QAH A;  1XF8 A;  2Z3N A;  3JVN A;  4MI4 A;  1P4N A;  4NGR A;  2EWB A;  4UWJ A;  4A94 A;  4KOT A;  2BO9 A;  3WAB A;  1PCA A;  1R3N A;  3SXN A;  1IGB A;  2PR1 A;  1YW6 A;  4B5O A;  4CAW A;  3NA6 A;  2I00 A;  2AFU A;  2RC4 A;  3IWE A;  3WC5 A;  3CXS A;  5E96 A;  1L0C A;  4MBU A;  4NGQ A;  2CF4 A;  4UEZ A;  3S6F A;  3PFE A;  1Z5R A;  4FWU A;  2F7V A;  2Z10 A;  3NFZ A;  4E8O A;  5KTA A;  2PRB A;  4FBE A;  1S3Z A;  1KUY A;  4XPD C;  4LQG A;  3SI0 A;  4PXD A;  1VHS A;  3TC8 A;  4WJB A;  2EK9 A;  2GRE A;  1Z4R A;  5G20 A;  3SJX A;  2DPS A;  3EXN A;  1YQE A;  1XRY A;  1N71 A;  2ZOG A;  2O28 A;  4RI1 A;  5FVJ A;  4L8A A;  3WR7 A;  1IY7 A;  1VIX A;  3IU1 A;  1YR0 A;  3PB6 X;  2V8D A;  3FVL A;  4CGO A;  1XEB A;  4KUB A;  4CRY B;  3BHX A;  1XBU A;  1QSO A;  4CGL A;  4XPK A;  1QSM A;  6CPA A;  2VXK A;  4GM5 A;  4CGP A;  3KHZ A;  3R9F A;  1S7K A;  2Z3M A;  2OZU A;  3IJ3 A;  1P0H A;  3NH4 A;  4H6U A;  1Y9W A;  2V8H A;  2DEA A;  5ELY A;  2B58 A;  4ZY0 A;  4BD9 A;  1CM0 A;  1PU9 A;  4Q7A A;  4YFJ A;  4KVM E;  2J9A A;  4CAV A;  4X3R A;  5G1Z A;  3GKR A;  2QYV A;  2RB7 A;  3NE7 A;  5LYI A;  2R7H A;  3D2P A;  4CGM A;  4ZX8 A;  2BL1 A;  2JEV A;  3LMS A;  2HUZ A;  3T90 A;  3QNV A;  1R57 A;  4O23 A;  4F9U A;  1ZLH A;  2QML A;  3H5Z A;  3KZW A;  4JD6 A;  4X8I A;  5LRG A;  1F2P A;  2Z3K A;  3FYN A;  2Q43 A;  3VWD A;  5CPA A;  2PJ8 A;  3LOD A;  2HB6 A;  5I4M A;  2B5G A;  3FX6 A;  3MRU A;  4EME A;  4R76 A;  1TXR A;  4B12 A;  1MJA A;  2QIR A;  1BPN A;  5DWM A;  3S9L A;  1ZG7 A;  4A38 A;  4B11 A;  2CTB A;  4B5P A;  1MJ9 A;  2PJ4 A;  2VBQ A;  4JLY A;  3B7I A;  4LQ6 A;  4GXH A;  2PJ2 A;  4UEE A;  3TTH A;  4P4B A;  3LWU A;  1GHE A;  5AG6 A;  5EBV A;  3TO9 A;  3MN8 A;  3TT2 A;  2ZEL A;  3PBE A;  2FIA A;  3B3V A;  1KUV A;  2DXQ A;  4OC4 A;  1V0C A;  4ZY2 A;  1YRE A;  2FT0 A;  4J3G A;  1I12 A;  1IOF A;  4MMO A;  1Q2C A;  3VWE A;  4MFQ A;  4B13 A;  4X5K A;  3PEI A;  5C82 A;  1ON0 A;  3DSB A;  4MFK A;  1YSJ A;  2OZH A;  4H6Z A;  2Q51 A;  3D8P A;  3VH9 A;  1GYT A;  1CPX A;  2FS5 A;  1S5K A;  1Q7L A;  4NJR A;  2CNS A;  3ZZI A;  4M3S A;  3S6K A;  5LYF A;  3PRT A;  2CIJ A;  1AMP A;  2Z11 A;  4JXR A;  3D7D A;  4PSX A;  1CBX A;  2BEI A;  1I1D A;  4NGM A;  2OB0 A;  1YLE A;  4NSQ A;  2GIV A;  4UA3 A;  3SI1 A;  3FB3 A;  4RN7 A;  1LAP A;  3TFY A;  4HNX B;  1DE4 C;  2PJ0 A;  4U5Y A;  4ZBG A;  2VZZ A;  1IOI A;  3I1U A;  2G9D A;  4YGO A;  2POK A;  2OOT A;  4G1P A;  1H8L A;  2R8V A;  3P2F A;  3IC1 A;  4JYW A;  2JDD A;  3BXM A;  2ATR A;  2AE6 A;  1TKJ A;  1S7L A;  2AFX A;  2WUU A;  3LD2 A;  2GFQ A;  2JEW A;  2PJB A;  4EVY A;  2C6C A;  1YGH A;  3B3W A;  2B3U A;  3IU2 A;  3IWG A;  3SHP A;  3T9Y A;  2J8M A;  2Q4Y A;  2VQY A;  4ONU A;  1QMU A;  4AB7 A;  2JBJ A;  4AXV A;  4P45 A;  4MCR A;  1ELL P;  3GY9 A;  4YU9 A;  2PJA A;  4UIB A;  2PSW A;  2QEC A;  1JWQ A;  3KGQ A;  4KLV A;  2FE7 A;  4UEF A;  3SXO A;  4DJL A;  2VEZ A;  1K4J A;  1XIX A;  1F2O A;  2EVN A;  4R8F A;  4IF5 A;  3W6S A;  1KUX A;  2ZEH A;  4MFZ A;  3EFA A;  3EY5 A;  5LYD A;  2JDC A;  2ZPA A;  2K5T A;  3N7Z A;  5CBM A;  4R57 A;  1YW4 A;  4A32 A;  1VKC A;  5JQ4 A;  4NXY A;  1Q2Y A;  1Y0Y A;  2ZW5 A;  4IUS A;  1EE3 P;  3R96 A;  1Y7R A;  2ABZ A;  4KOV A;  4KVO E;  2GU2 A;  1NSL A;  3PB4 X;  3ZJ0 A;  1M1D A;  4MJ8 A;  1ZLI A;  4HNW B;  4PSW A;  3KQX A;  3RZA A;  4JWP A;  1YVO A;  4MHN A;  3HUV A;  4OME A;  4F9V A;  2FSR A;  4ZI6 A;  1AYE A;  4OP4 A;  3GB0 A;  4FAI A;  1HDU A;  1TF8 A;  4KZT A;  1ZO0 A;  4UFW A;  2WSA A;  2REF A;  1TF9 A;  3KAS A;  4M85 A;  4UF4 A;  5K8P A;  4P4F A;  4A95 A;  2I79 A;  3PB9 X;  3W91 A;  3TX8 A;  2AFW A;  2J8N A;  2YNE A;  4MXU A;  3D4U A;  3S9N A;  2O4H A;  2PJ9 A;  3FF3 A;  4KS9 A;  4FD5 A;  3RYO A;  5HXD A;  4KVX A;  1MK4 A;  2DPT A;  4MFL A;  4JZ0 A;  4MCS A;  1CX8 A;  4BMH A;  1FY7 A;  5LYL A;  4OIW A;  4P10 A;  3HLP A;  2C6P A;  3D7H A;  4B6Z A;  4XPL A;  4AVB A;  1ELM P;  4CPA A;  2O53 A;  3S6G A;  1CP6 A;  1X10 A;  2ZW7 A;  1LFW A;  1S7F A;  3PB7 X;  2PJ1 A;  3H8F A;  3RO0 A;  4HKF A;  4Y49 C;  1J4J A;  1IIC A;  3GUX A;  4NGP A;  3R9G A;  1R43 A;  4MCQ A;  3ISX A;  4RS2 A;  2Q0Y A;  2JLM A;  5HH1 A;  4RUH A;  5KTC A;  4UBR A;  4ZGY B;  3I3G A;  5IV0 A;  4LX9 A;  1B87 A;  4M6G A;  2P6E A;  3B3T A;  2ARH A;  5JPH A;  1HEE A;  1QST A;  2ODF A;  3KR4 A;  3GYA A;  3FJU A;  3FEC A;  4CGN A;  2ZEE A;  3K9U A;  2IL4 A;  2J8R A;  2QVP A;  4OC0 A;  4CAX A;  3EO4 A;  4P6Y A;  4R9M A;  4R3K A;  4OAE A;  4PXB A;  3DLJ A;  2GE3 A;  3QB8 A;  3B3S A;  3FEE A;  4KOR A;  4MFJ A;  5G22 A;  1CG2 A;  3BI1 A;  4MHD A;  3DR8 A;  4GS4 A;  2RFH A;  1QSN A;  5JM6 A;  2JBK A;  4Q36 A;  1WK4 A;  3JRU A;  2ZED A;  3VAR A;  1XMT A;  2B5G B;  3D67 A;  4P4J A;  4K30 A;  2EK8 A;  4OAD A;  2PVW A;  1Q2D A;  3W6X A;  2EUI A;  2V8V A;  2PE3 A;  4B5P B;  2G3T A;  5HVH A;  3EC4 A;  4OKO A;  3N5F A;  4K3N A;  4Q38 A;  4X2T A;  1CPS A;  5G21 A;  2A4N A;  1M4D A;  4FUU A;  4B14 A;  4M6I A;  1X12 A;  3FIX A;  4QB9 A;  2GLJ A;  4KSA A;  4U9Y A;  3PGP A;  4PQA A;  1ARM A;  4AVA A;  3SJG A;  5IX3 A;  3R1K A;  4C68 A;  5K8N A;  2CY2 A;  4H89 A;  4Z65 A;  3BJ8 A;  2YND A;  4AVC A;  4C2Z A;  3BJ7 A;  3TE4 A;  2PQ8 A;  2PRQ A;  1YK3 A;  2Q44 A;  1Z4E A;  2PC1 A;  2P0W A;  3H8G A;  3NE8 A;  7CPA A;  4KSI A;  4UFV A;  1Y7E A;  2CTC A;  2OU2 A;  2PJC A;  1XE4 A;  2WPX A;  4KLW A;  4PXE A;  2R98 A;  2X7B A;  1IB1 E;  3PBB A;  5K8O A;  3TO7 A;  4DNC A;  2OZG A;  1WWZ A;  3PZJ A;  4MCP A;  4QC6 A;  3RBU A;  3DR6 A;  2CNM A;  2Y0M A;  4MHY A;  4ZX9 A;  1YLO A;  3LAC A;  3NH5 A;  3BLN A;  2ZW6 A;  5HVF A;  2AFO A;  4QBJ A;  5HVG A;  1F57 A;  1XMB A;  1ZG9 A;  2PJ3 A;  2ZEO A;  4HPS A;  4MFP A;  4XNH B;  2YGW A;  5J1Q A;  4AG9 A;  4C7H A;  4PXC A;  2V8G A;  3T8W A;  3RNZ A;  4W9Y A;  4BBH A;  4ONW A;  4II9 A;  2I3C A;  2ZXV A;  4R7M A;  5H84 A;  1XFO A;  3F8K A;  3KQZ A;  5JH9 A;  3KI9 A;  2Z3L A;  3SJE A;  4KOY A;  2F8H A;  2C27 A;  2WPW A;  3JUW A;  1QSR A;  1XOV A;  3KR5 A;  1MJB A;  3L2N A;  3S9M A;  3B8G A;  5D8N A;  3D66 A;  3CPA A;  1KZF A;  5AGE A; 
#chains in the Genus database with same CATH homology
 2FIW A;  1M4G A;  2YNC C;  4KSF A;  2BUE A;  5HMN A;  5IB0 A;  5H86 A;  5F47 A;  3TO6 A;  1LRZ A;  2F5I A;  1I21 A;  2G3A A;  4NCZ A;  5F49 A;  4KOS A;  3OWC A;  1M4I A;  2PDO A;  2VI7 A;  1BOB A;  4A33 A;  4KOX A;  2HV2 A;  4AG7 A;  3PP9 A;  3S6H A;  4CRZ B;  4JJX A;  1UFH A;  3P2H A;  1NE9 A;  2B4D A;  3F5B A;  4UWI A;  5A27 A;  2PR8 A;  4I49 A;  4YRH A;  2D4P A;  3F0A A;  4C7I A;  4R3L A;  2HQY A;  2B4B A;  5J8C A;  2YNC A;  2FL4 A;  3FXT A;  2D4O A;  4CYQ A;  1OZP A;  4F0Y A;  5KTD A;  2FXF A;  2B4D B;  2CXA A;  1BO4 A;  3D3S A;  5A28 A;  2FCK A;  3TCV A;  5BWA B;  3IGR A;  4NF1 A;  4FD4 A;  4UCN A;  4UFX A;  4FD6 A;  2Q7B A;  2GAN A;  4LUA A;  3DNS A;  3TOA A;  2Z0Z A;  4HNY B;  2ZW4 A;  5AG5 A;  4CAE A;  4E2A A;  3CXP A;  4CYP A;  1M44 A;  4A31 A;  3R95 A;  4NEX A;  2CNT A;  4XPD B;  5J8F A;  4L89 A;  2H5M A;  1YX0 A;  4OLL A;  4F6A A;  4KOU A;  4B10 A;  1S7N A;  4QUS A;  3FBU A;  4CAF A;  3E0K A;  5I0C A;  4CYO A;  5F46 A;  1NMT A;  2REE A;  3C26 A;  4QVT A;  4ORF A;  5F48 A;  4U9Z A;  3R9E A;  2P6F A;  5GCN A;  1S60 A;  4XNH C;  2R1I A;  2Z3O A;  1CJW A;  4KOW A;  5DWN A;  5AG4 A;  2OH1 A;  2VZY A;  4R87 A;  4Y49 B;  4KUA A;  3H4Q A;  1IYK A;  4CYN A;  4C2Y A;  3MGD A;  5ISV A;  2G0B A;  3D2M A;  4PK3 A;  1IYL A;  4FD7 A;  1RO5 A;  4UCP A;  3DDD A;  4JXQ A;  4CS0 B;  5CNP A;  3FNC A;  1U6M A;  1IID A;  4MY0 A;  2Q4V A;  3KKW A;  4UCM A;  4A2Z A;  3A9L A;  3TOB A;  3G3S A;  1Y9K A;  3FRM A;  3JTK A;  2BSW A;  2KCW A;  4C2X A;  4PK2 A;  3V8I A;  2B3V A;  4A30 A;  2P6G A;  3I9S A;  4PV6 A;  1Z9U A;  1YVK A;  3G8W A;  3UY5 A;  1B6B A;  1PUA A;  1SQH A;  1TIQ A;  2AJ6 A;  4MY3 A;  5EC4 A;  1RXT A;  5C88 A;  2Z3P A;  3CXQ A;  5AG7 A;  2NMT A;  2Q04 A;  4E0A A;  4F0X A;  3QAH A;  1XF8 A;  2Z3N A;  3JVN A;  4MI4 A;  1P4N A;  4UWJ A;  4KOT A;  3SXN A;  2PR1 A;  4CAW A;  4B5O A;  2I00 A;  2RC4 A;  3IWE A;  3CXS A;  5E96 A;  1L0C A;  4MBU A;  3S6F A;  2Z10 A;  4E8O A;  5KTA A;  2PRB A;  1S3Z A;  1KUY A;  4XPD C;  1VHS A;  1Z4R A;  5G20 A;  2DPS A;  3EXN A;  5FVJ A;  1N71 A;  2O28 A;  4RI1 A;  4L8A A;  3WR7 A;  3IU1 A;  1YR0 A;  4CGO A;  1XEB A;  4KUB A;  4CRY B;  1QSO A;  4CGL A;  4XPK A;  1QSM A;  2VXK A;  4CGP A;  3R9F A;  1S7K A;  2Z3M A;  2OZU A;  4H6U A;  1P0H A;  1Y9W A;  2B58 A;  1CM0 A;  1PU9 A;  4YFJ A;  4KVM E;  4CAV A;  5G1Z A;  3GKR A;  3NE7 A;  2R7H A;  3D2P A;  4CGM A;  2BL1 A;  2JEV A;  3T90 A;  2HUZ A;  1R57 A;  2QML A;  3H5Z A;  4JD6 A;  3VWD A;  2Z3K A;  3FYN A;  3LOD A;  2B5G A;  4B12 A;  1MJA A;  2QIR A;  5DWM A;  4B11 A;  4B5P A;  1MJ9 A;  2VBQ A;  4JLY A;  3TTH A;  5AG6 A;  1GHE A;  5EBV A;  3TO9 A;  3TT2 A;  2FIA A;  1KUV A;  2DXQ A;  1V0C A;  1YRE A;  2FT0 A;  4J3G A;  1I12 A;  1Q2C A;  3VWE A;  4MFQ A;  4B13 A;  4X5K A;  5C82 A;  1ON0 A;  3DSB A;  4MFK A;  2OZH A;  4H6Z A;  3D8P A;  3ZZI A;  2FS5 A;  1S5K A;  2CNS A;  4M3S A;  3S6K A;  4PSX A;  4JXR A;  2Z11 A;  2BEI A;  1I1D A;  2OB0 A;  1YLE A;  4NSQ A;  2GIV A;  4UA3 A;  3FB3 A;  3TFY A;  4HNX B;  4U5Y A;  4ZBG A;  2VZZ A;  4YGO A;  2R8V A;  3P2F A;  2JDD A;  2ATR A;  2AE6 A;  1S7L A;  2WUU A;  3LD2 A;  4EVY A;  1YGH A;  3IU2 A;  2B3U A;  3IWG A;  3SHP A;  3T9Y A;  2J8M A;  2Q4Y A;  2VQY A;  4ONU A;  4AB7 A;  3GY9 A;  2PSW A;  2QEC A;  4KLV A;  3SXO A;  2FE7 A;  2VEZ A;  1K4J A;  1XIX A;  2EVN A;  4IF5 A;  3W6S A;  1KUX A;  4MFZ A;  3EFA A;  3EY5 A;  2JDC A;  2ZPA A;  2K5T A;  3N7Z A;  4R57 A;  4A32 A;  1VKC A;  5JQ4 A;  4NXY A;  1Q2Y A;  2ZW5 A;  4IUS A;  3R96 A;  1Y7R A;  4KOV A;  4KVO E;  1NSL A;  3ZJ0 A;  1M1D A;  4MJ8 A;  4HNW B;  4PSW A;  4JWP A;  1YVO A;  2FSR A;  4KZT A;  1ZO0 A;  4UFW A;  2WSA A;  2REF A;  4M85 A;  4A95 A;  2I79 A;  3W91 A;  2J8N A;  2YNE A;  4KS9 A;  4FD5 A;  3RYO A;  4KVX A;  1MK4 A;  2DPT A;  4MFL A;  4BMH A;  1FY7 A;  4XPL A;  4AVB A;  3S6G A;  2ZW7 A;  1S7F A;  4HKF A;  4Y49 C;  1J4J A;  1IIC A;  3R9G A;  4RS2 A;  2Q0Y A;  2JLM A;  5HH1 A;  5KTC A;  4UBR A;  4ZGY B;  3I3G A;  5IV0 A;  4LX9 A;  1B87 A;  2P6E A;  2ARH A;  5JPH A;  1QST A;  3GYA A;  4CGN A;  3K9U A;  2IL4 A;  2J8R A;  4CAX A;  3EO4 A;  4R9M A;  4R3K A;  4OAE A;  2GE3 A;  4KOR A;  5G22 A;  4MFJ A;  4MHD A;  3DR8 A;  4GS4 A;  1QSN A;  4Q36 A;  1WK4 A;  1XMT A;  2B5G B;  4K30 A;  4OAD A;  1Q2D A;  3W6X A;  2EUI A;  4B5P B;  2G3T A;  3EC4 A;  4Q38 A;  5G21 A;  2A4N A;  1M4D A;  4B14 A;  3FIX A;  4QB9 A;  4U9Y A;  4KSA A;  3PGP A;  4AVA A;  5IX3 A;  3R1K A;  4C68 A;  2CY2 A;  4H89 A;  3BJ8 A;  2YND A;  4AVC A;  4C2Z A;  3BJ7 A;  3TE4 A;  2PQ8 A;  1YK3 A;  2Q44 A;  1Z4E A;  2PC1 A;  2P0W A;  4UFV A;  2OU2 A;  2WPX A;  1XE4 A;  4KLW A;  2R98 A;  2X7B A;  1IB1 E;  3TO7 A;  4DNC A;  2OZG A;  1WWZ A;  3PZJ A;  4QC6 A;  3DR6 A;  2CNM A;  2Y0M A;  3BLN A;  2ZW6 A;  4QBJ A;  4MFP A;  4XNH B;  2YGW A;  4AG9 A;  4C7H A;  4BBH A;  4II9 A;  2ZXV A;  5H84 A;  3F8K A;  2Z3L A;  4KOY A;  2C27 A;  2WPW A;  3JUW A;  1QSR A;  1MJB A;  3B8G A;  3QB8 A;  1KZF A;  5AGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...