4AG9A

C. elegans glucosamine-6-phosphate n-acetyltransferase (gna1): ternary complex with coenzyme a and glcnac
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
SHIFDASVLAPHIPSNLPDNFKVRPLAKDDFSKGYVDLLSQLTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSRGRVEDVVVDTEMRRQKLGAVLLKTLVSLGKSLGVYKISLECVPELLPFYSQFGFQDDCNFMTQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of a Trapped Coenzyme a Adduct of Caenorhabditis Elegans Glucosamine-6-Phosphate N-Acetyltransferase 1.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords GLUCOSAMINE-6-PHOSPHATE N-ACETYLTRANSFERASE
total genus 40
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ag9A01
4KOUA 2I00A 4NCZA 4MHDA 4FD4A 4KORA 1KUYA 3JUWA 2A4NA 2FT0A 4J3GA 2R98A 3FBUA 1M4DA 2JDDA 2CNTA 3CXPA 4PK2A 4CRYB 2FS5A 5IV0A 5JPHA 1P4NA 2Z11A 3K9UA 1YVOA 1V0CA 2Q0YA 2AE6A 3S6HA 2PSWA 5EBVA 3QAHA 3TO9A 4AB7A 2PDOA 4JJXA 5H84A 3FNCA 1M4GA 2VZYA 3DNSA 3H4QA 4HNWB 2OZHA 1S7LA 1WWZA 1IYLA 1I12A 2HV2A 1KZFA 3MGDA 3PZJA 4KOYA 5IB0A 1IB1E 3TO6A 3DSBA 3R9EA 1KUVA 2FL4A 3T90A 3P2HA 2B3UA 3EY5A 4RI1A 2Z10A 2P6FA 5EC4A 1YGHA 4LX9A 3EO4A 4RS2A 2B3VA 1Y7RA 1NE9A 2GANA 4BMHA 4QC6A 4KOTA 2B5GB 2B4BA 4IUSA 3LD2A 4AVBA 3TTHA 1MJAA 2REEA 3EFAA 4NF1A 2RC4A 2D4OA 4I49A 3R9GA 2QECA 1Q2CA 4R57A 3F5BA 4R87A 1S5KA 4Y49C 5F47A 2G3TA 2R8VA 4L89A 1S7KA 4YRHA 1IIDA 2G0BA 3SXOA 4ONUA 2F5IA 4KOXA 1Z4RA 2Q04A 3N7ZA 2PC1A 5JQ4A 1LRZA 4DNCA 1YK3A 3CXSA 4JXRA 4MY3A 4XNHC 1I21A 3I9SA 2JDCA 1MJ9A 2BSWA 4KLWA 1P0HA 5DWNA 2D4PA 5HMNA 5CNPA 1Z9UA 2J8RA 4R3KA 4B5OA 2J8NA 2NMTA 4CAVA 4EVYA 1UFHA 1RXTA 2JEVA 4HNYB 4B5PA 4CAWA 3OWCA 4KLVA 2JLMA 2ZXVA 4U9YA 4MY0A 4XPLA 3T9YA 4IF5A 4XPKA 2CNSA 1BOBA 3TOBA 4JXQA 1Q2DA 4PSXA 4KVXA 1M44A 1PU9A 1YX0A 3QB8A 3GY9A 4M85A 4UWIA 4Y49B 1CM0A 3R95A 4ORFA 3D2PA 3TT2A 2X7BA 2VQYA 2PR8A 3PGPA 4QB9A 1QSRA 5GCNA 2C27A 4OLLA 2Q44A 4QUSA 4JLYA 2QIRA 1VHSA 1XMTA 2OH1A 2BUEA 3FB3A 4JWPA 3C26A 4E0AA 3DR6A 4FD5A 4B5PB 3TFYA 4U5YA 2PRBA 1R57A 3W91A 1YR0A 4KOWA 5I0CA 4UWJA 1S60A 3TE4A 2Y0MA 4H6UA 2P6GA 4YGOA 4KOVA 4OADA 3G8WA 3TO7A 1YVKA 1XEBA 1Y9WA 1B6BA 3JVNA 5C82A 5ISVA 3W6SA 4MBUA 3EC4A 4HKFA 3DDDA 1S3ZA 3FIXA 1M1DA 2K5TA 3IGRA 2G3AA 2GE3A 2ZW7A 3ZZIA 4AG9A 2ZW4A 1QSTA 1QSMA 2BL1A 3RYOA 4E8OA 2PR1A 4II9A 2FIAA 4MI4A 1MK4A 5KTDA 3R9FA 4R9MA 5KTAA 1XE4A 1Z4EA 1NSLA 4CS0B 2VZZA 3LODA 2REFA 1S7FA 1N71A 4NXYA 4L8AA 2OZUA 4AVCA 1OZPA 3S6GA 3E0KA 2ZW6A 4OAEA 2O28A 4YFJA 3WR7A 3V8IA 1J4JA 5J8FA 1L0CA 2Q4VA 1FY7A 3SHPA 2R1IA 2ARHA 5F49A 2CNMA 4UA3A 4M3SA 3R1KA 4U9ZA 1XIXA 3FXTA 4CRZB 2DXQA 2WPXA 4KVME 2FXFA 2P0WA 2VI7A 1GHEA 1TIQA 2OZGA 5HH1A 3PP9A 3CXQA 1NMTA 4NEXA 2PQ8A 4K30A 4KOSA 1VKCA 1KUXA 1MJBA 4NSQA 3SXNA 3KKWA 3EXNA 2H5MA 2B58A 4CAXA 5F46A 2R7HA 4JD6A 2HUZA 1B87A 2AJ6A 4PV6A 2ZW5A 1YREA 2OB0A 4AG7A 3TOAA 4X5KA 3D3SA 4QBJA 3GYAA 2ZPAA 2BEIA 4XNHB 1QSOA 2KCWA 2Q7BA 2EUIA 4UBRA 1PUAA 5IX3A 3BJ7A 2OU2A 4HNXB 5KTCA 2J8MA 3ZJ0A 2B4DA 1QSNA 4PSWA 1Y9KA 2I79A 4LUAA 2B5GA 4QVTA 2VXKA 4F0YA 1Q2YA 2Q4YA 3DR8A 3G3SA 1XF8A 3D8PA 3FYNA 3GKRA 1IICA 4KUBA 4KVOE 3S6KA 3W6XA 1IYKA 3D2MA 4XPDB 3F8KA 2FIWA 1K4JA 5FVJA 2P6EA 4H6ZA 3BJ8A 2IL4A 2FE7A 5DWMA 1YLEA 1CJWA 2FSRA 5H86A 4XPDC 5E96A 3R96A 3VWDA 5C88A 4KUAA 2QMLA 1RO5A 2VBQA 4AVAA 3P2FA 2VEZA 5J8CA 4R3LA 3TCVA 4E2AA 3IWGA 4F6AA 3BLNA 3VWEA 2FCKA 4KZTA 3B8GA 3NE7A 4FD6A 1ON0A 1I1DA 1M4IA 1WK4A 3UY5A 3F0AA 2HQYA 3FRMA 1SQHA 4MJ8A 1BO4A 4ZBGA 4FD7A 2GIVA 2Z0ZA 4H89A 3S6FA 1U6MA 2B4DB 1S7NA 3I3GA 2WPWA 5F48A 2EVNA 4GS4A 2ATRA 4PK3A 2CY2A
chains in the Genus database with same CATH superfamily
4KOUA 4LQGA 2I00A 4NCZA 1CP6A 1IOFA 3FEEA 2PIZA 4FD4A 2AFOA 4KORA 1KUYA 2HB6A 4MHDA 3JUWA 1F2PA 4ZX8A 4Q38A 2A4NA 2FT0A 4J3GA 2QJ8A 4NGPA 2R98A 4KSFA 3FBUA 1M4DA 2JDDA 3D66A 2CNTA 5F09A 1AMPA 4OKOA 3FEDA 3CXPA 3KR4A 4PK2A 4CRYB 4RUHA 2FS5A 5IV0A 5JPHA 1P4NA 1H8LA 2Z11A 4NJRA 2Z3PA 4MXUA 3K9UA 1YVOA 3CPAA 3NH5A 3LMSA 1V0CA 2PJAA 5EMIA 2PJ6A 2Q0YA 2YNCC 2AE6A 4MFKA 3S6HA 2PSWA 5BWAB 3V7ZA 5CBMA 5EBVA 3QAHA 4NGSA 2JBJA 3FX6A 5C82A 3IFEA 3H5ZA 1LOKA 3GUXA 3TO9A 4AB7A 4FAIA 2Z3OA 1XBUA 1XFOA 4CGPA 2CTCA 2PDOA 3CDXA 3D7HA 3ISXA 3PB6X 1CP7A 4JJXA 4B11A 2DPSA 5HVFA 3KR5A 5H84A 5K8PA 4FBEA 3D67A 4IHMA 3FNCA 1YQEA 2EO8A 1M4GA 4P4BA 2VZYA 3DNSA 1AUGA 5HVGA 2Q4ZA 3H4QA 4HNWB 2OZHA 1S7LA 2PIYA 1WWZA 1IYLA 2PJ1A 1YW6A 2PJBA 2V8DA 3LWUA 1I12A 1ZG8A 4MFJA 2HV2A 1KZFA 3MGDA 3PZJA 4KOYA 4OC0A 5IB0A 1M4LA 3FJUA 1IB1E 4MCQA 3FF3A 2ZEMA 3DSBA 3KZWA 3MRUA 3TO6A 4DJLA 3R9EA 1KUVA 1LFWA 2XEIA 1LCPA 2FL4A 4BINA 4NGQA 3T90A 1R43A 3P2HA 2V77A 2B3UA 3FMCA 3EY5A 4RI1A 3RAMA 3VATA 2GFQA 1DTDA 3IWEA 3WC6A 4YWYA 1YW4A 5AG5A 2Z10A 2ZEFA 4P44A 5G20A 2V8VA 1BPMA 3I1UA 3SI2A 2P6FA 1AYEA 7CPAA 5EC4A 4ZYQA 3QNVA 5K8MA 2RFHA 1YGHA 3D68A 3EO4A 4LX9A 5JM6A 4CYNA 4RS2A 3D4UA 4CYPA 3NFZA 2B3VA 1Y7RA 4B10A 1NE9A 2O53A 2GANA 4BMHA 2QYVA 4KOTA 4QC6A 2B5GB 4Z65A 3KHZA 2B4BA 3PB7X 4IUSA 5G22A 3S9LA 4GM5A 3RO0A 1FNOA 2PVVA 3LD2A 4AVBA 3TTHA 1MJAA 2REEA 1VGYA 4C68A 3KQXA 4CPAA 4F9VA 3EFAA 3BXMA 4NF1A 1HEEA 2RC4A 4MMOA 2D4OA 4I49A 3R9GA 3KASA 2QECA 4Q36A 3A9LA 2YNCA 1Q2CA 2IMOA 3HUVA 3F5BA 3JRUA 4R57A 4R87A 1S5KA 4UF4A 3IEHA 1Z2LA 4Y49C 3B3VA 3BI1A 3GB0A 5F47A 2G3TA 2R8VA 3PBBA 1IY7A 4C7HA 4L89A 1S7KA 4YRHA 5LRKA 1IIDA 2G0BA 3WC5A 3SXOA 2CF4A 4ONUA 2F5IA 4KOXA 1Z4RA 2Q04A 2WUUA 3N7ZA 2EWBA 2PC1A 4P4FA 5JQ4A 1LRZA 4TNUA 3WT4A 4DNCA 1YK3A 3FECA 2Q51A 3CXSA 4JXRA 4MY3A 4PPZA 4XNHC 1I21A 3I9SA 2ABZA 2JDCA 1MJ9A 2BSWA 4KLWA 1P0HA 4PXEA 1X12A 4OC5A 2D4PA 5DWNA 4C7IA 4A33A 3K2KA 4HPSA 5HMNA 4UEEA 5CNPA 1Z9UA 2J8RA 2PRQA 4R3KA 4R7MA 2AFXA 2J8NA 4B5OA 4MHNA 3IO1A 1FT7A 2HC9A 2NMTA 4CAVA 4EVYA 1UFHA 1RXTA 2JEVA 4HNYB 2ZOFA 3B2YA 4B5PA 4CAWA 4NGNA 1TXRA 3OWCA 1IGBA 4KLVA 4GXHA 4CGMA 2JLMA 1TKJA 2ZXVA 2DF5A 2I3CA 2XEGA 4F0XA 4U9YA 4MY0A 2DEAA 1QQ9A 4XPLA 3T9YA 8CPAA 1UWYA 4FUUA 4IF5A 1TF8A 3TX8A 1ELLP 2XEFA 1BAVA 4XPKA 2CNSA 4UIAA 1BOBA 3TOBA 4A94A 4JXQA 1Q2DA 3B3WA 4MCPA 4PSXA 4ZY1A 4KVXA 1HDUA 1M44A 1VHEA 4ZX9A 1PU9A 2PJCA 5J1QA 1YX0A 3QB8A 3RZAA 3GY9A 2C6CA 4UCPA 4M85A 2WZNA 1XMBA 2Z3NA 4UWIA 4Y49B 5HXDA 4MHPA 3B3TA 2PJ5A 1CM0A 4F8ZA 2POKA 3R95A 3H8EA 4ORFA 2Z3LA 1YSJA 3D2PA 3TT2A 1ZG9A 2X7BA 2OOTA 2VQYA 3FH4A 4P4EA 3TC8A 2AFUA 2PR8A 3PGPA 4QB9A 2ZEDA 1QSRA 2VL1A 5GCNA 2AFMA 2C27A 4OLLA 1VIXA 2Q44A 4QUSA 4JLYA 2QIRA 1ZLIA 4BD9A 4M6IA 1VHSA 3B3CA 1XMTA 1Z8WA 4OC1A 2OH1A 4UCMA 4NGTA 5IB9A 2BUEA 2PVWA 3FB3A 3KI9A 4JWPA 4JZ0A 3IU2A 4A32A 1GYTA 4WJBA 4P4IA 5JGFA 3C26A 1LANA 3NH4A 4E0AA 3S9NA 5HVHA 3H8GA 4NFRA 2PJ2A 3DR6A 1ELMP 4FD5A 4B5PB 3PFOA 4U5YA 3TFYA 4A38A 3KQZA 2PRBA 4M6GA 1R57A 4OC2A 5G1ZA 3W91A 3BI0A 1YR0A 2WYRA 4UFXA 4KOWA 5I0CA 4UWJA 1S60A 2YNDA 3TE4A 1LAPA 2IJZA 3KGQA 1TF9A 1ZLHA 2Y0MA 4H6UA 2P6GA 4LQ6A 2ZEOA 3PBEA 4YGOA 4KOVA 4OADA 3G8WA 3D7DA 3D7GA 2V8HA 3TO7A 1YVKA 1XEBA 1Y9WA 1B6BA 2PCUA 2DPTA 3CPXA 1JWQA 3JVNA 3NE8A 4UEFA 3SI1A 4ZY2A 3SI0A 4BBHA 5ISVA 3W6SA 1F57A 4MBUA 3EC4A 4HKFA 3DDDA 1S3ZA 3FIXA 3WABA 3WC7A 3B7IA 5AG4A 4P45A 1M1DA 2K5TA 5D29A 3IGRA 2G3AA 2GE3A 2ZW7A 4OIWA 4MHYA 3H8FA 3ZZIA 2ZW4A 1QSTA 4AG9A 1QSMA 2BL1A 3RYOA 1Z8LA 3PEIA 4E8OA 2PR1A 2ZEPA 5LYIA 2ZELA 4II9A 3MN8A 4H2KA 2FIAA 2CTBA 4OC3A 2PE3A 4MI4A 3GLJA 1QMUA 4Q7AA 1MK4A 5KTDA 1TKFA 3R9FA 4B12A 5AG7A 4R9MA 5KTCA 1ZO0A 2GREA 2AFWA 5KTAA 1XE4A 1A2ZA 3IJ3A 3KHXA 1Z4EA 2AFSA 1NSLA 4K3NA 4CS0B 1VHOA 4CGNA 2F8HA 3HLPA 3JTKA 4P10A 2PJ7A 2VZZA 3FVLA 3LODA 4MFLA 4MCSA 2REFA 1S7FA 2Q43A 3DGVA 1N71A 3IU1A 4NXYA 1DE4C 2EK8A 4L8AA 2OZUA 4C2YA 4C2XA 4AVCA 2PJ9A 4PQAA 3PRTA 1CG2A 1OZPA 3E0KA 4OIDA 2Z3MA 3S6GA 2ZW6A 4OAEA 2O28A 2XEJA 1HDQA 4G1PA 1J4JA 2PJ0A 3V8IA 3WR7A 4YFJA 1L0CA 3D7FA 5J8FA 2Q4VA 5JH9A 3PB9X 1FY7A 3SHPA 2R1IA 4RN7A 2ARHA 3NH8A 3IC1A 4X3RA 1JQGA 1PYTB 3IWWA 4WWVA 2ZENA 5F49A 4R76A 4NJQA 2NYQA 2CNMA 4MFZA 4UA3A 4A39A 4MCRA 5CPAA 4M3SA 2FVGA 3R1KA 4U9ZA 1XIXA 5AGEA 4EMEA 4A95A 2Z3KA 2C1CA 4ZGYB 3FXTA 2ZEGA 3QAYA 4CRZB 1TKHA 4IK2A 2AFZA 2DXQA 2WPXA 3RBUA 4KSIA 1Y0RA 2FXFA 4KVME 2P0WA 4B13A 4B6ZA 2VI7A 5LYLA 1GHEA 1IU8A 1TIQA 2OZGA 5HH1A 3VH9A 3PP9A 2IQ6A 3CXQA 2C6PA 1NMTA 4NEXA 2PQ8A 2OR4A 2ZEEA 3IIBA 4K30A 4KOSA 4X2TA 1OBRA 1VKCA 1KUXA 1MJBA 4NSQA 3SXNA 2ODFA 2WSAA 3KKWA 3EXNA 2H5MA 2B58A 2V8GA 2G9DA 3S9MA 4CAXA 4UFWA 5F46A 1RTQA 2R7HA 4JD6A 2HUZA 3L2NA 4UEZA 1B87A 2AJ6A 4PV6A 3PFEA 3SJXA 3PB4X 4AXVA 2ZW5A 1XRYA 1YREA 2OB0A 3BHXA 3TOAA 4AG7A 3NA6A 5K8NA 1Y0YA 4OMEA 3D3SA 4X5KA 4QBJA 3GYAA 4O23A 2ZPAA 2BEIA 4XNHB 1QSOA 2KCWA 4NGRA 2Q7BA 1R3NA 2EUIA 4UBRA 1PUAA 5IX3A 3BJ7A 2OU2A 4HNXB 5I4MA 2RB7A 4A2ZA 2J8MA 2PJ4A 4OP4A 3ZJ0A 1CPXA 4JYWA 4P4DA 2B4DA 1QSNA 2EBJA 4PSWA 4CGOA 5A27A 4IAVA 1Y9KA 2I79A 5ELYA 4LUAA 3SJFA 2B5GA 4ONWA 4QVTA 2VXKA 4X8IA 1BPNA 4F0YA 5LYFA 1F2OA 1PCAA 1Q2YA 2Q4YA 2Q7SA 1KWMA 3DR8A 3G3SA 1XF8A 3N5FA 3D8PA 3FYNA 3GKRA 1IICA 4KUBA 4TWEA 1YMEA 4CGLA 1CPSA 4KVOE 4MFPA 5THWA 4P4JA 3RNZA 3S6KA 4F9UA 3GIUA 4KS9A 3DLJA 2GU2A 3VARA 1IYKA 3W6XA 3D2MA 4XPDB 3F8KA 4PXDA 2PJ3A 2FIWA 5LYDA 1K4JA 5FVJA 2O4HA 2CIJA 2P6EA 4ZY0A 1BLLE 1Y7EA 4H6ZA 4A37A 3BJ8A 3CZXA 2IL4A 4FWUA 2FE7A 1XOVA 4OC4A 5DWMA 1YLEA 1CJWA 2FSRA 2BCOA 5H86A 4XPDC 5E96A 4EWTA 3R96A 2ZOGA 2NSMA 3V38A 4UFVA 3VWDA 5C88A 4KUAA 2F7VA 1LAMA 2QMLA 3SJGA 3T8WA 4NGMA 1RO5A 2C6GA 2VBQA 4PXCA 4AVAA 3P2FA 4KSAA 1Z5RA 2VEZA 5DS0A 4PXBA 4B14A 5G21A 4P6YA 3SJEA 5J8CA 2JEWA 4MFQA 4DYOA 4R3LA 5K8OA 2CXAA 3TCVA 2ZEHA 3KL9A 4E2AA 1Z8XA 2QVPA 3ISZA 3K9TA 3IWGA 4UCNA 4EFDA 4F6AA 1ARLA 1Z8TA 2GLJA 2FCKA 3BLNA 1XJOA 4KZTA 5LRGA 3VWEA 3B8GA 4YU9A 3NE7A 4FD6A 1ARMA 1ON0A 6CPAA 1I1DA 1M4IA 1WK4A 3UY5A 4A30A 3F0AA 2HQYA 3FRMA 4CYQA 4C2ZA 1NSAA 1SQHA 4MHZA 4R8FA 2JBKA 4ZI6A 2GLFA 4MJ8A 1YLOA 1BO4A 4ZBGA 4A31A 2YNEA 4FD7A 2GIVA 2Z0ZA 1IOIA 4W9YA 4H89A 3B35A 4UIBA 3S6FA 5AG6A 4CYOA 5D8NA 4DUKA 1U6MA 4CAEA 4R6TA 1EE3P 3B3SA 1X10A 5A28A 2B4DB 4M6HA 4CAFA 1S7NA 3I3GA 2J9AA 3CT9A 2WPWA 2ANPA 2EK9A 2PJ8A 3PB8X 5F48A 1CX8A 2BOAA 4MRIA 2YGWA 1CBXA 2EVNA 1ZG7A 4GS4A 3LACA 5LRJA 2ATRA 4PK3A 2CY2A 2BO9A 1Q7LA
chains in the Genus database with same CATH topology
4KOUA 2I00A 4NCZA 4MHDA 4FD4A 4KORA 1KUYA 3JUWA 4Q38A 2A4NA 2FT0A 4J3GA 2R98A 4KSFA 3FBUA 1M4DA 2JDDA 2CNTA 3CXPA 4PK2A 4CRYB 2FS5A 5IV0A 5JPHA 1P4NA 2Z11A 2Z3PA 3K9UA 1YVOA 1V0CA 2Q0YA 2YNCC 2AE6A 4MFKA 3S6HA 2PSWA 5BWAB 5EBVA 3QAHA 3H5ZA 3TO9A 4AB7A 2Z3OA 4CGPA 2PDOA 4JJXA 4B11A 2DPSA 5H84A 3FNCA 1M4GA 2VZYA 3DNSA 3H4QA 4HNWB 2OZHA 1S7LA 1WWZA 1IYLA 4MFJA 1I12A 2HV2A 1KZFA 3MGDA 3PZJA 4KOYA 5IB0A 1IB1E 3TO6A 3DSBA 3R9EA 1KUVA 2FL4A 3T90A 3P2HA 2B3UA 3EY5A 4RI1A 3IWEA 5AG5A 2Z10A 5G20A 2P6FA 5EC4A 1YGHA 4LX9A 3EO4A 4CYNA 4RS2A 4CYPA 2B3VA 1Y7RA 4B10A 1NE9A 2GANA 4BMHA 4QC6A 4KOTA 2B5GB 2B4BA 4IUSA 5G22A 3LD2A 4AVBA 3TTHA 1MJAA 2REEA 4C68A 3EFAA 4NF1A 2RC4A 2D4OA 4I49A 3R9GA 2QECA 4Q36A 3A9LA 2YNCA 1Q2CA 4R57A 3F5BA 4R87A 1S5KA 4Y49C 5F47A 2G3TA 2R8VA 4C7HA 4L89A 1S7KA 4YRHA 1IIDA 2G0BA 3SXOA 4ONUA 2F5IA 4KOXA 1Z4RA 2Q04A 2WUUA 3N7ZA 2PC1A 5JQ4A 1LRZA 4DNCA 1YK3A 3CXSA 4JXRA 4MY3A 4XNHC 1I21A 3I9SA 2JDCA 1MJ9A 2BSWA 4KLWA 1P0HA 5DWNA 4C7IA 2D4PA 4A33A 5HMNA 5CNPA 1Z9UA 2J8RA 4R3KA 4B5OA 2J8NA 2NMTA 4CAVA 4EVYA 1UFHA 1RXTA 2JEVA 4HNYB 4B5PA 4CAWA 3OWCA 4KLVA 4CGMA 2JLMA 2ZXVA 4F0XA 4U9YA 4MY0A 4XPLA 3T9YA 4IF5A 4XPKA 2CNSA 1BOBA 3TOBA 4JXQA 1Q2DA 4PSXA 4KVXA 1M44A 1PU9A 1YX0A 3QB8A 3GY9A 4UCPA 4M85A 2Z3NA 4UWIA 4Y49B 1CM0A 3R95A 4ORFA 2Z3LA 3D2PA 3TT2A 2X7BA 2VQYA 2PR8A 3PGPA 4QB9A 1QSRA 5GCNA 2C27A 4OLLA 2Q44A 4QUSA 4JLYA 2QIRA 1VHSA 1XMTA 4UCMA 2OH1A 2BUEA 3FB3A 4JWPA 3IU2A 4A32A 3C26A 4E0AA 3DR6A 4FD5A 4B5PB 3TFYA 4U5YA 2PRBA 1R57A 5G1ZA 3W91A 1YR0A 4UFXA 4KOWA 5I0CA 4UWJA 1S60A 2YNDA 3TE4A 2Y0MA 4H6UA 2P6GA 4YGOA 4KOVA 4OADA 3G8WA 3TO7A 1YVKA 1XEBA 1Y9WA 1B6BA 3JVNA 2DPTA 4BBHA 4CAFA 5C82A 5ISVA 3W6SA 4MBUA 3EC4A 4HKFA 3DDDA 1S3ZA 3FIXA 5AG4A 1M1DA 2K5TA 3IGRA 2G3AA 2GE3A 2ZW7A 3ZZIA 4AG9A 2ZW4A 1QSTA 1QSMA 2BL1A 3RYOA 4E8OA 2PR1A 4II9A 2FIAA 4MI4A 1MK4A 5KTDA 3R9FA 4B12A 5AG7A 4R9MA 1ZO0A 5KTAA 1XE4A 1Z4EA 1NSLA 4CS0B 4CGNA 3JTKA 2VZZA 4MFLA 3LODA 2REFA 1S7FA 1N71A 3IU1A 4NXYA 4L8AA 2OZUA 4C2YA 4C2XA 4AVCA 1OZPA 3S6GA 3E0KA 2Z3MA 2ZW6A 4OAEA 2O28A 4YFJA 3WR7A 3V8IA 1J4JA 5J8FA 1L0CA 2Q4VA 1FY7A 3SHPA 2R1IA 2ARHA 5F49A 2CNMA 4MFZA 4UA3A 4M3SA 3R1KA 4U9ZA 1XIXA 5AGEA 4A95A 2Z3KA 4ZGYB 3FXTA 4CRZB 2DXQA 2WPXA 4KVME 2FXFA 4B13A 2P0WA 2VI7A 1GHEA 1TIQA 2OZGA 5HH1A 3PP9A 3CXQA 1NMTA 4NEXA 2PQ8A 4K30A 4KOSA 1VKCA 1KUXA 1MJBA 4NSQA 3SXNA 2WSAA 3KKWA 3EXNA 2H5MA 2B58A 4CAXA 4UFWA 5F46A 2R7HA 4JD6A 2HUZA 1B87A 2AJ6A 4PV6A 2ZW5A 1YREA 2OB0A 4AG7A 3TOAA 4X5KA 3D3SA 4QBJA 3GYAA 2ZPAA 2BEIA 4XNHB 1QSOA 2KCWA 2Q7BA 2EUIA 4UBRA 1PUAA 5IX3A 3BJ7A 2OU2A 4HNXB 5KTCA 2J8MA 3ZJ0A 5A27A 2B4DA 1QSNA 4PSWA 4CGOA 1Y9KA 2I79A 4LUAA 2B5GA 4QVTA 2VXKA 4F0YA 1Q2YA 2Q4YA 3DR8A 3G3SA 1XF8A 3D8PA 3FYNA 3GKRA 1IICA 4KUBA 4CGLA 4KVOE 4MFPA 3S6KA 4KS9A 3W6XA 1IYKA 3D2MA 4XPDB 3F8KA 2FIWA 1K4JA 5FVJA 2P6EA 4H6ZA 3BJ8A 2IL4A 2FE7A 5DWMA 1YLEA 1CJWA 2FSRA 5H86A 4XPDC 5E96A 3R96A 4UFVA 3VWDA 5C88A 4KUAA 2QMLA 1RO5A 2VBQA 4AVAA 3P2FA 4KSAA 2VEZA 4B14A 5G21A 5J8CA 4MFQA 4R3LA 2CXAA 3TCVA 4E2AA 3IWGA 4UCNA 4F6AA 3BLNA 3VWEA 4A2ZA 2FCKA 4KZTA 3B8GA 3NE7A 4FD6A 1ON0A 1I1DA 1M4IA 1WK4A 3UY5A 4A30A 3F0AA 2HQYA 3FRMA 4CYQA 4C2ZA 1SQHA 4MJ8A 1BO4A 4ZBGA 4A31A 2YNEA 4FD7A 2GIVA 2Z0ZA 4H89A 3S6FA 5AG6A 4CYOA 1U6MA 4CAEA 5A28A 2B4DB 1S7NA 3I3GA 2WPWA 5F48A 2YGWA 2EVNA 4GS4A 2ATRA 4PK3A 2CY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOU A;  2I00 A;  4NCZ A;  4MHD A;  4FD4 A;  4KOR A;  1KUY A;  3JUW A;  2A4N A;  2FT0 A;  4J3G A;  2R98 A;  3FBU A;  1M4D A;  2JDD A;  2CNT A;  3CXP A;  4PK2 A;  4CRY B;  2FS5 A;  5IV0 A;  5JPH A;  1P4N A;  2Z11 A;  3K9U A;  1YVO A;  1V0C A;  2Q0Y A;  2AE6 A;  3S6H A;  2PSW A;  5EBV A;  3QAH A;  3TO9 A;  4AB7 A;  2PDO A;  4JJX A;  5H84 A;  3FNC A;  1M4G A;  2VZY A;  3DNS A;  3H4Q A;  4HNW B;  2OZH A;  1S7L A;  1WWZ A;  1IYL A;  1I12 A;  2HV2 A;  1KZF A;  3MGD A;  3PZJ A;  4KOY A;  5IB0 A;  1IB1 E;  3TO6 A;  3DSB A;  3R9E A;  1KUV A;  2FL4 A;  3T90 A;  3P2H A;  2B3U A;  3EY5 A;  4RI1 A;  2Z10 A;  2P6F A;  5EC4 A;  1YGH A;  4LX9 A;  3EO4 A;  4RS2 A;  2B3V A;  1Y7R A;  1NE9 A;  2GAN A;  4BMH A;  4QC6 A;  4KOT A;  2B5G B;  2B4B A;  4IUS A;  3LD2 A;  4AVB A;  3TTH A;  1MJA A;  2REE A;  3EFA A;  4NF1 A;  2RC4 A;  2D4O A;  4I49 A;  3R9G A;  2QEC A;  1Q2C A;  4R57 A;  3F5B A;  4R87 A;  1S5K A;  4Y49 C;  5F47 A;  2G3T A;  2R8V A;  4L89 A;  1S7K A;  4YRH A;  1IID A;  2G0B A;  3SXO A;  4ONU A;  2F5I A;  4KOX A;  1Z4R A;  2Q04 A;  3N7Z A;  2PC1 A;  5JQ4 A;  1LRZ A;  4DNC A;  1YK3 A;  3CXS A;  4JXR A;  4MY3 A;  4XNH C;  1I21 A;  3I9S A;  2JDC A;  1MJ9 A;  2BSW A;  4KLW A;  1P0H A;  5DWN A;  2D4P A;  5HMN A;  5CNP A;  1Z9U A;  2J8R A;  4R3K A;  4B5O A;  2J8N A;  2NMT A;  4CAV A;  4EVY A;  1UFH A;  1RXT A;  2JEV A;  4HNY B;  4B5P A;  4CAW A;  3OWC A;  4KLV A;  2JLM A;  2ZXV A;  4U9Y A;  4MY0 A;  4XPL A;  3T9Y A;  4IF5 A;  4XPK A;  2CNS A;  1BOB A;  3TOB A;  4JXQ A;  1Q2D A;  4PSX A;  4KVX A;  1M44 A;  1PU9 A;  1YX0 A;  3QB8 A;  3GY9 A;  4M85 A;  4UWI A;  4Y49 B;  1CM0 A;  3R95 A;  4ORF A;  3D2P A;  3TT2 A;  2X7B A;  2VQY A;  2PR8 A;  3PGP A;  4QB9 A;  1QSR A;  5GCN A;  2C27 A;  4OLL A;  2Q44 A;  4QUS A;  4JLY A;  2QIR A;  1VHS A;  1XMT A;  2OH1 A;  2BUE A;  3FB3 A;  4JWP A;  3C26 A;  4E0A A;  3DR6 A;  4FD5 A;  4B5P B;  3TFY A;  4U5Y A;  2PRB A;  1R57 A;  3W91 A;  1YR0 A;  4KOW A;  5I0C A;  4UWJ A;  1S60 A;  3TE4 A;  2Y0M A;  4H6U A;  2P6G A;  4YGO A;  4KOV A;  4OAD A;  3G8W A;  3TO7 A;  1YVK A;  1XEB A;  1Y9W A;  1B6B A;  3JVN A;  5C82 A;  5ISV A;  3W6S A;  4MBU A;  3EC4 A;  4HKF A;  3DDD A;  1S3Z A;  3FIX A;  1M1D A;  2K5T A;  3IGR A;  2G3A A;  2GE3 A;  2ZW7 A;  3ZZI A;  4AG9 A;  2ZW4 A;  1QST A;  1QSM A;  2BL1 A;  3RYO A;  4E8O A;  2PR1 A;  4II9 A;  2FIA A;  4MI4 A;  1MK4 A;  5KTD A;  3R9F A;  4R9M A;  5KTA A;  1XE4 A;  1Z4E A;  1NSL A;  4CS0 B;  2VZZ A;  3LOD A;  2REF A;  1S7F A;  1N71 A;  4NXY A;  4L8A A;  2OZU A;  4AVC A;  1OZP A;  3S6G A;  3E0K A;  2ZW6 A;  4OAE A;  2O28 A;  4YFJ A;  3WR7 A;  3V8I A;  1J4J A;  5J8F A;  1L0C A;  2Q4V A;  1FY7 A;  3SHP A;  2R1I A;  2ARH A;  5F49 A;  2CNM A;  4UA3 A;  4M3S A;  3R1K A;  4U9Z A;  1XIX A;  3FXT A;  4CRZ B;  2DXQ A;  2WPX A;  4KVM E;  2FXF A;  2P0W A;  2VI7 A;  1GHE A;  1TIQ A;  2OZG A;  5HH1 A;  3PP9 A;  3CXQ A;  1NMT A;  4NEX A;  2PQ8 A;  4K30 A;  4KOS A;  1VKC A;  1KUX A;  1MJB A;  4NSQ A;  3SXN A;  3KKW A;  3EXN A;  2H5M A;  2B58 A;  4CAX A;  5F46 A;  2R7H A;  4JD6 A;  2HUZ A;  1B87 A;  2AJ6 A;  4PV6 A;  2ZW5 A;  1YRE A;  2OB0 A;  4AG7 A;  3TOA A;  4X5K A;  3D3S A;  4QBJ A;  3GYA A;  2ZPA A;  2BEI A;  4XNH B;  1QSO A;  2KCW A;  2Q7B A;  2EUI A;  4UBR A;  1PUA A;  5IX3 A;  3BJ7 A;  2OU2 A;  4HNX B;  5KTC A;  2J8M A;  3ZJ0 A;  2B4D A;  1QSN A;  4PSW A;  1Y9K A;  2I79 A;  4LUA A;  2B5G A;  4QVT A;  2VXK A;  4F0Y A;  1Q2Y A;  2Q4Y A;  3DR8 A;  3G3S A;  1XF8 A;  3D8P A;  3FYN A;  3GKR A;  1IIC A;  4KUB A;  4KVO E;  3S6K A;  3W6X A;  1IYK A;  3D2M A;  4XPD B;  3F8K A;  2FIW A;  1K4J A;  5FVJ A;  2P6E A;  4H6Z A;  3BJ8 A;  2IL4 A;  2FE7 A;  5DWM A;  1YLE A;  1CJW A;  2FSR A;  5H86 A;  4XPD C;  5E96 A;  3R96 A;  3VWD A;  5C88 A;  4KUA A;  2QML A;  1RO5 A;  2VBQ A;  4AVA A;  3P2F A;  2VEZ A;  5J8C A;  4R3L A;  3TCV A;  4E2A A;  3IWG A;  4F6A A;  3BLN A;  3VWE A;  2FCK A;  4KZT A;  3B8G A;  3NE7 A;  4FD6 A;  1ON0 A;  1I1D A;  1M4I A;  1WK4 A;  3UY5 A;  3F0A A;  2HQY A;  3FRM A;  1SQH A;  4MJ8 A;  1BO4 A;  4ZBG A;  4FD7 A;  2GIV A;  2Z0Z A;  4H89 A;  3S6F A;  1U6M A;  2B4D B;  1S7N A;  3I3G A;  2WPW A;  5F48 A;  2EVN A;  4GS4 A;  2ATR A;  4PK3 A;  2CY2 A; 
#chains in the Genus database with same CATH topology
 4KOU A;  4LQG A;  2I00 A;  4NCZ A;  1CP6 A;  1IOF A;  3FEE A;  2PIZ A;  4FD4 A;  2AFO A;  4KOR A;  1KUY A;  2HB6 A;  4MHD A;  3JUW A;  1F2P A;  4ZX8 A;  4Q38 A;  2A4N A;  2FT0 A;  4J3G A;  2QJ8 A;  4NGP A;  2R98 A;  4KSF A;  3FBU A;  1M4D A;  2JDD A;  3D66 A;  2CNT A;  5F09 A;  1AMP A;  4OKO A;  3FED A;  3CXP A;  3KR4 A;  4PK2 A;  4CRY B;  4RUH A;  2FS5 A;  5IV0 A;  5JPH A;  1P4N A;  1H8L A;  2Z11 A;  4NJR A;  2Z3P A;  4MXU A;  3K9U A;  1YVO A;  3CPA A;  3NH5 A;  3LMS A;  1V0C A;  2PJA A;  5EMI A;  2PJ6 A;  2Q0Y A;  2YNC C;  2AE6 A;  4MFK A;  3S6H A;  2PSW A;  5BWA B;  3V7Z A;  5CBM A;  5EBV A;  3QAH A;  4NGS A;  2JBJ A;  3FX6 A;  5C82 A;  3IFE A;  3H5Z A;  1LOK A;  3GUX A;  3TO9 A;  4AB7 A;  4FAI A;  2Z3O A;  1XBU A;  1XFO A;  4CGP A;  2CTC A;  2PDO A;  3CDX A;  3D7H A;  3ISX A;  3PB6 X;  1CP7 A;  4JJX A;  4B11 A;  2DPS A;  5HVF A;  3KR5 A;  5H84 A;  5K8P A;  4FBE A;  3D67 A;  4IHM A;  3FNC A;  1YQE A;  2EO8 A;  1M4G A;  4P4B A;  2VZY A;  3DNS A;  1AUG A;  5HVG A;  2Q4Z A;  3H4Q A;  4HNW B;  2OZH A;  1S7L A;  2PIY A;  1WWZ A;  1IYL A;  2PJ1 A;  1YW6 A;  2PJB A;  2V8D A;  3LWU A;  1I12 A;  1ZG8 A;  4MFJ A;  2HV2 A;  1KZF A;  3MGD A;  3PZJ A;  4KOY A;  4OC0 A;  5IB0 A;  1M4L A;  3FJU A;  1IB1 E;  4MCQ A;  3FF3 A;  2ZEM A;  3DSB A;  3KZW A;  3MRU A;  3TO6 A;  4DJL A;  3R9E A;  1KUV A;  1LFW A;  2XEI A;  1LCP A;  2FL4 A;  4BIN A;  4NGQ A;  3T90 A;  1R43 A;  3P2H A;  2V77 A;  2B3U A;  3FMC A;  3EY5 A;  4RI1 A;  3RAM A;  3VAT A;  2GFQ A;  1DTD A;  3IWE A;  3WC6 A;  4YWY A;  1YW4 A;  5AG5 A;  2Z10 A;  2ZEF A;  4P44 A;  5G20 A;  2V8V A;  1BPM A;  3I1U A;  3SI2 A;  2P6F A;  1AYE A;  7CPA A;  5EC4 A;  4ZYQ A;  3QNV A;  5K8M A;  2RFH A;  1YGH A;  3D68 A;  3EO4 A;  4LX9 A;  5JM6 A;  4CYN A;  4RS2 A;  3D4U A;  4CYP A;  3NFZ A;  2B3V A;  1Y7R A;  4B10 A;  1NE9 A;  2O53 A;  2GAN A;  4BMH A;  2QYV A;  4KOT A;  4QC6 A;  2B5G B;  4Z65 A;  3KHZ A;  2B4B A;  3PB7 X;  4IUS A;  5G22 A;  3S9L A;  4GM5 A;  3RO0 A;  1FNO A;  2PVV A;  3LD2 A;  4AVB A;  3TTH A;  1MJA A;  2REE A;  1VGY A;  4C68 A;  3KQX A;  4CPA A;  4F9V A;  3EFA A;  3BXM A;  4NF1 A;  1HEE A;  2RC4 A;  4MMO A;  2D4O A;  4I49 A;  3R9G A;  3KAS A;  2QEC A;  4Q36 A;  3A9L A;  2YNC A;  1Q2C A;  2IMO A;  3HUV A;  3F5B A;  3JRU A;  4R57 A;  4R87 A;  1S5K A;  4UF4 A;  3IEH A;  1Z2L A;  4Y49 C;  3B3V A;  3BI1 A;  3GB0 A;  5F47 A;  2G3T A;  2R8V A;  3PBB A;  1IY7 A;  4C7H A;  4L89 A;  1S7K A;  4YRH A;  5LRK A;  1IID A;  2G0B A;  3WC5 A;  3SXO A;  2CF4 A;  4ONU A;  2F5I A;  4KOX A;  1Z4R A;  2Q04 A;  2WUU A;  3N7Z A;  2EWB A;  2PC1 A;  4P4F A;  5JQ4 A;  1LRZ A;  4TNU A;  3WT4 A;  4DNC A;  1YK3 A;  3FEC A;  2Q51 A;  3CXS A;  4JXR A;  4MY3 A;  4PPZ A;  4XNH C;  1I21 A;  3I9S A;  2ABZ A;  2JDC A;  1MJ9 A;  2BSW A;  4KLW A;  1P0H A;  4PXE A;  1X12 A;  4OC5 A;  2D4P A;  5DWN A;  4C7I A;  4A33 A;  3K2K A;  4HPS A;  5HMN A;  4UEE A;  5CNP A;  1Z9U A;  2J8R A;  2PRQ A;  4R3K A;  4R7M A;  2AFX A;  2J8N A;  4B5O A;  4MHN A;  3IO1 A;  1FT7 A;  2HC9 A;  2NMT A;  4CAV A;  4EVY A;  1UFH A;  1RXT A;  2JEV A;  4HNY B;  2ZOF A;  3B2Y A;  4B5P A;  4CAW A;  4NGN A;  1TXR A;  3OWC A;  1IGB A;  4KLV A;  4GXH A;  4CGM A;  2JLM A;  1TKJ A;  2ZXV A;  2DF5 A;  2I3C A;  2XEG A;  4F0X A;  4U9Y A;  4MY0 A;  2DEA A;  1QQ9 A;  4XPL A;  3T9Y A;  8CPA A;  1UWY A;  4FUU A;  4IF5 A;  1TF8 A;  3TX8 A;  1ELL P;  2XEF A;  1BAV A;  4XPK A;  2CNS A;  4UIA A;  1BOB A;  3TOB A;  4A94 A;  4JXQ A;  1Q2D A;  3B3W A;  4MCP A;  4PSX A;  4ZY1 A;  4KVX A;  1HDU A;  1M44 A;  1VHE A;  4ZX9 A;  1PU9 A;  2PJC A;  5J1Q A;  1YX0 A;  3QB8 A;  3RZA A;  3GY9 A;  2C6C A;  4UCP A;  4M85 A;  2WZN A;  1XMB A;  2Z3N A;  4UWI A;  4Y49 B;  5HXD A;  4MHP A;  3B3T A;  2PJ5 A;  1CM0 A;  4F8Z A;  2POK A;  3R95 A;  3H8E A;  4ORF A;  2Z3L A;  1YSJ A;  3D2P A;  3TT2 A;  1ZG9 A;  2X7B A;  2OOT A;  2VQY A;  3FH4 A;  4P4E A;  3TC8 A;  2AFU A;  2PR8 A;  3PGP A;  4QB9 A;  2ZED A;  1QSR A;  2VL1 A;  5GCN A;  2AFM A;  2C27 A;  4OLL A;  1VIX A;  2Q44 A;  4QUS A;  4JLY A;  2QIR A;  1ZLI A;  4BD9 A;  4M6I A;  1VHS A;  3B3C A;  1XMT A;  1Z8W A;  4OC1 A;  2OH1 A;  4UCM A;  4NGT A;  5IB9 A;  2BUE A;  2PVW A;  3FB3 A;  3KI9 A;  4JWP A;  4JZ0 A;  3IU2 A;  4A32 A;  1GYT A;  4WJB A;  4P4I A;  5JGF A;  3C26 A;  1LAN A;  3NH4 A;  4E0A A;  3S9N A;  5HVH A;  3H8G A;  4NFR A;  2PJ2 A;  3DR6 A;  1ELM P;  4FD5 A;  4B5P B;  3PFO A;  4U5Y A;  3TFY A;  4A38 A;  3KQZ A;  2PRB A;  4M6G A;  1R57 A;  4OC2 A;  5G1Z A;  3W91 A;  3BI0 A;  1YR0 A;  2WYR A;  4UFX A;  4KOW A;  5I0C A;  4UWJ A;  1S60 A;  2YND A;  3TE4 A;  1LAP A;  2IJZ A;  3KGQ A;  1TF9 A;  1ZLH A;  2Y0M A;  4H6U A;  2P6G A;  4LQ6 A;  2ZEO A;  3PBE A;  4YGO A;  4KOV A;  4OAD A;  3G8W A;  3D7D A;  3D7G A;  2V8H A;  3TO7 A;  1YVK A;  1XEB A;  1Y9W A;  1B6B A;  2PCU A;  2DPT A;  3CPX A;  1JWQ A;  3JVN A;  3NE8 A;  4UEF A;  3SI1 A;  4ZY2 A;  3SI0 A;  4BBH A;  5ISV A;  3W6S A;  1F57 A;  4MBU A;  3EC4 A;  4HKF A;  3DDD A;  1S3Z A;  3FIX A;  3WAB A;  3WC7 A;  3B7I A;  5AG4 A;  4P45 A;  1M1D A;  2K5T A;  5D29 A;  3IGR A;  2G3A A;  2GE3 A;  2ZW7 A;  4OIW A;  4MHY A;  3H8F A;  3ZZI A;  2ZW4 A;  1QST A;  4AG9 A;  1QSM A;  2BL1 A;  3RYO A;  1Z8L A;  3PEI A;  4E8O A;  2PR1 A;  2ZEP A;  5LYI A;  2ZEL A;  4II9 A;  3MN8 A;  4H2K A;  2FIA A;  2CTB A;  4OC3 A;  2PE3 A;  4MI4 A;  3GLJ A;  1QMU A;  4Q7A A;  1MK4 A;  5KTD A;  1TKF A;  3R9F A;  4B12 A;  5AG7 A;  4R9M A;  5KTC A;  1ZO0 A;  2GRE A;  2AFW A;  5KTA A;  1XE4 A;  1A2Z A;  3IJ3 A;  3KHX A;  1Z4E A;  2AFS A;  1NSL A;  4K3N A;  4CS0 B;  1VHO A;  4CGN A;  2F8H A;  3HLP A;  3JTK A;  4P10 A;  2PJ7 A;  2VZZ A;  3FVL A;  3LOD A;  4MFL A;  4MCS A;  2REF A;  1S7F A;  2Q43 A;  3DGV A;  1N71 A;  3IU1 A;  4NXY A;  1DE4 C;  2EK8 A;  4L8A A;  2OZU A;  4C2Y A;  4C2X A;  4AVC A;  2PJ9 A;  4PQA A;  3PRT A;  1CG2 A;  1OZP A;  3E0K A;  4OID A;  2Z3M A;  3S6G A;  2ZW6 A;  4OAE A;  2O28 A;  2XEJ A;  1HDQ A;  4G1P A;  1J4J A;  2PJ0 A;  3V8I A;  3WR7 A;  4YFJ A;  1L0C A;  3D7F A;  5J8F A;  2Q4V A;  5JH9 A;  3PB9 X;  1FY7 A;  3SHP A;  2R1I A;  4RN7 A;  2ARH A;  3NH8 A;  3IC1 A;  4X3R A;  1JQG A;  1PYT B;  3IWW A;  4WWV A;  2ZEN A;  5F49 A;  4R76 A;  4NJQ A;  2NYQ A;  2CNM A;  4MFZ A;  4UA3 A;  4A39 A;  4MCR A;  5CPA A;  4M3S A;  2FVG A;  3R1K A;  4U9Z A;  1XIX A;  5AGE A;  4EME A;  4A95 A;  2Z3K A;  2C1C A;  4ZGY B;  3FXT A;  2ZEG A;  3QAY A;  4CRZ B;  1TKH A;  4IK2 A;  2AFZ A;  2DXQ A;  2WPX A;  3RBU A;  4KSI A;  1Y0R A;  2FXF A;  4KVM E;  2P0W A;  4B13 A;  4B6Z A;  2VI7 A;  5LYL A;  1GHE A;  1IU8 A;  1TIQ A;  2OZG A;  5HH1 A;  3VH9 A;  3PP9 A;  2IQ6 A;  3CXQ A;  2C6P A;  1NMT A;  4NEX A;  2PQ8 A;  2OR4 A;  2ZEE A;  3IIB A;  4K30 A;  4KOS A;  4X2T A;  1OBR A;  1VKC A;  1KUX A;  1MJB A;  4NSQ A;  3SXN A;  2ODF A;  2WSA A;  3KKW A;  3EXN A;  2H5M A;  2B58 A;  2V8G A;  2G9D A;  3S9M A;  4CAX A;  4UFW A;  5F46 A;  1RTQ A;  2R7H A;  4JD6 A;  2HUZ A;  3L2N A;  4UEZ A;  1B87 A;  2AJ6 A;  4PV6 A;  3PFE A;  3SJX A;  3PB4 X;  4AXV A;  2ZW5 A;  1XRY A;  1YRE A;  2OB0 A;  3BHX A;  3TOA A;  4AG7 A;  3NA6 A;  5K8N A;  1Y0Y A;  4OME A;  3D3S A;  4X5K A;  4QBJ A;  3GYA A;  4O23 A;  2ZPA A;  2BEI A;  4XNH B;  1QSO A;  2KCW A;  4NGR A;  2Q7B A;  1R3N A;  2EUI A;  4UBR A;  1PUA A;  5IX3 A;  3BJ7 A;  2OU2 A;  4HNX B;  5I4M A;  2RB7 A;  4A2Z A;  2J8M A;  2PJ4 A;  4OP4 A;  3ZJ0 A;  1CPX A;  4JYW A;  4P4D A;  2B4D A;  1QSN A;  2EBJ A;  4PSW A;  4CGO A;  5A27 A;  4IAV A;  1Y9K A;  2I79 A;  5ELY A;  4LUA A;  3SJF A;  2B5G A;  4ONW A;  4QVT A;  2VXK A;  4X8I A;  1BPN A;  4F0Y A;  5LYF A;  1F2O A;  1PCA A;  1Q2Y A;  2Q4Y A;  2Q7S A;  1KWM A;  3DR8 A;  3G3S A;  1XF8 A;  3N5F A;  3D8P A;  3FYN A;  3GKR A;  1IIC A;  4KUB A;  4TWE A;  1YME A;  4CGL A;  1CPS A;  4KVO E;  4MFP A;  5THW A;  4P4J A;  3RNZ A;  3S6K A;  4F9U A;  3GIU A;  4KS9 A;  3DLJ A;  2GU2 A;  3VAR A;  1IYK A;  3W6X A;  3D2M A;  4XPD B;  3F8K A;  4PXD A;  2PJ3 A;  2FIW A;  5LYD A;  1K4J A;  5FVJ A;  2O4H A;  2CIJ A;  2P6E A;  4ZY0 A;  1BLL E;  1Y7E A;  4H6Z A;  4A37 A;  3BJ8 A;  3CZX A;  2IL4 A;  4FWU A;  2FE7 A;  1XOV A;  4OC4 A;  5DWM A;  1YLE A;  1CJW A;  2FSR A;  2BCO A;  5H86 A;  4XPD C;  5E96 A;  4EWT A;  3R96 A;  2ZOG A;  2NSM A;  3V38 A;  4UFV A;  3VWD A;  5C88 A;  4KUA A;  2F7V A;  1LAM A;  2QML A;  3SJG A;  3T8W A;  4NGM A;  1RO5 A;  2C6G A;  2VBQ A;  4PXC A;  4AVA A;  3P2F A;  4KSA A;  1Z5R A;  2VEZ A;  5DS0 A;  4PXB A;  4B14 A;  5G21 A;  4P6Y A;  3SJE A;  5J8C A;  2JEW A;  4MFQ A;  4DYO A;  4R3L A;  5K8O A;  2CXA A;  3TCV A;  2ZEH A;  3KL9 A;  4E2A A;  1Z8X A;  2QVP A;  3ISZ A;  3K9T A;  3IWG A;  4UCN A;  4EFD A;  4F6A A;  1ARL A;  1Z8T A;  2GLJ A;  2FCK A;  3BLN A;  1XJO A;  4KZT A;  5LRG A;  3VWE A;  3B8G A;  4YU9 A;  3NE7 A;  4FD6 A;  1ARM A;  1ON0 A;  6CPA A;  1I1D A;  1M4I A;  1WK4 A;  3UY5 A;  4A30 A;  3F0A A;  2HQY A;  3FRM A;  4CYQ A;  4C2Z A;  1NSA A;  1SQH A;  4MHZ A;  4R8F A;  2JBK A;  4ZI6 A;  2GLF A;  4MJ8 A;  1YLO A;  1BO4 A;  4ZBG A;  4A31 A;  2YNE A;  4FD7 A;  2GIV A;  2Z0Z A;  1IOI A;  4W9Y A;  4H89 A;  3B35 A;  4UIB A;  3S6F A;  5AG6 A;  4CYO A;  5D8N A;  4DUK A;  1U6M A;  4CAE A;  4R6T A;  1EE3 P;  3B3S A;  1X10 A;  5A28 A;  2B4D B;  4M6H A;  4CAF A;  1S7N A;  3I3G A;  2J9A A;  3CT9 A;  2WPW A;  2ANP A;  2EK9 A;  2PJ8 A;  3PB8 X;  5F48 A;  1CX8 A;  2BOA A;  4MRI A;  2YGW A;  1CBX A;  2EVN A;  1ZG7 A;  4GS4 A;  3LAC A;  5LRJ A;  2ATR A;  4PK3 A;  2CY2 A;  2BO9 A;  1Q7L A; 
#chains in the Genus database with same CATH homology
 4KOU A;  2I00 A;  4NCZ A;  4MHD A;  4FD4 A;  4KOR A;  1KUY A;  3JUW A;  4Q38 A;  2A4N A;  2FT0 A;  4J3G A;  2R98 A;  4KSF A;  3FBU A;  1M4D A;  2JDD A;  2CNT A;  3CXP A;  4PK2 A;  4CRY B;  2FS5 A;  5IV0 A;  5JPH A;  1P4N A;  2Z11 A;  2Z3P A;  3K9U A;  1YVO A;  1V0C A;  2Q0Y A;  2YNC C;  2AE6 A;  4MFK A;  3S6H A;  2PSW A;  5BWA B;  5EBV A;  3QAH A;  3H5Z A;  3TO9 A;  4AB7 A;  2Z3O A;  4CGP A;  2PDO A;  4JJX A;  4B11 A;  2DPS A;  5H84 A;  3FNC A;  1M4G A;  2VZY A;  3DNS A;  3H4Q A;  4HNW B;  2OZH A;  1S7L A;  1WWZ A;  1IYL A;  4MFJ A;  1I12 A;  2HV2 A;  1KZF A;  3MGD A;  3PZJ A;  4KOY A;  5IB0 A;  1IB1 E;  3TO6 A;  3DSB A;  3R9E A;  1KUV A;  2FL4 A;  3T90 A;  3P2H A;  2B3U A;  3EY5 A;  4RI1 A;  3IWE A;  5AG5 A;  2Z10 A;  5G20 A;  2P6F A;  5EC4 A;  1YGH A;  4LX9 A;  3EO4 A;  4CYN A;  4RS2 A;  4CYP A;  2B3V A;  1Y7R A;  4B10 A;  1NE9 A;  2GAN A;  4BMH A;  4QC6 A;  4KOT A;  2B5G B;  2B4B A;  4IUS A;  5G22 A;  3LD2 A;  4AVB A;  3TTH A;  1MJA A;  2REE A;  4C68 A;  3EFA A;  4NF1 A;  2RC4 A;  2D4O A;  4I49 A;  3R9G A;  2QEC A;  4Q36 A;  3A9L A;  2YNC A;  1Q2C A;  4R57 A;  3F5B A;  4R87 A;  1S5K A;  4Y49 C;  5F47 A;  2G3T A;  2R8V A;  4C7H A;  4L89 A;  1S7K A;  4YRH A;  1IID A;  2G0B A;  3SXO A;  4ONU A;  2F5I A;  4KOX A;  1Z4R A;  2Q04 A;  2WUU A;  3N7Z A;  2PC1 A;  5JQ4 A;  1LRZ A;  4DNC A;  1YK3 A;  3CXS A;  4JXR A;  4MY3 A;  4XNH C;  1I21 A;  3I9S A;  2JDC A;  1MJ9 A;  2BSW A;  4KLW A;  1P0H A;  5DWN A;  4C7I A;  2D4P A;  4A33 A;  5HMN A;  5CNP A;  1Z9U A;  2J8R A;  4R3K A;  4B5O A;  2J8N A;  2NMT A;  4CAV A;  4EVY A;  1UFH A;  1RXT A;  2JEV A;  4HNY B;  4B5P A;  4CAW A;  3OWC A;  4KLV A;  4CGM A;  2JLM A;  2ZXV A;  4F0X A;  4U9Y A;  4MY0 A;  4XPL A;  3T9Y A;  4IF5 A;  4XPK A;  2CNS A;  1BOB A;  3TOB A;  4JXQ A;  1Q2D A;  4PSX A;  4KVX A;  1M44 A;  1PU9 A;  1YX0 A;  3QB8 A;  3GY9 A;  4UCP A;  4M85 A;  2Z3N A;  4UWI A;  4Y49 B;  1CM0 A;  3R95 A;  4ORF A;  2Z3L A;  3D2P A;  3TT2 A;  2X7B A;  2VQY A;  2PR8 A;  3PGP A;  4QB9 A;  1QSR A;  5GCN A;  2C27 A;  4OLL A;  2Q44 A;  4QUS A;  4JLY A;  2QIR A;  1VHS A;  1XMT A;  4UCM A;  2OH1 A;  2BUE A;  3FB3 A;  4JWP A;  3IU2 A;  4A32 A;  3C26 A;  4E0A A;  3DR6 A;  4FD5 A;  4B5P B;  3TFY A;  4U5Y A;  2PRB A;  1R57 A;  5G1Z A;  3W91 A;  1YR0 A;  4UFX A;  4KOW A;  5I0C A;  4UWJ A;  1S60 A;  2YND A;  3TE4 A;  2Y0M A;  4H6U A;  2P6G A;  4YGO A;  4KOV A;  4OAD A;  3G8W A;  3TO7 A;  1YVK A;  1XEB A;  1Y9W A;  1B6B A;  3JVN A;  2DPT A;  4BBH A;  4CAF A;  5C82 A;  5ISV A;  3W6S A;  4MBU A;  3EC4 A;  4HKF A;  3DDD A;  1S3Z A;  3FIX A;  5AG4 A;  1M1D A;  2K5T A;  3IGR A;  2G3A A;  2GE3 A;  2ZW7 A;  3ZZI A;  4AG9 A;  2ZW4 A;  1QST A;  1QSM A;  2BL1 A;  3RYO A;  4E8O A;  2PR1 A;  4II9 A;  2FIA A;  4MI4 A;  1MK4 A;  5KTD A;  3R9F A;  4B12 A;  5AG7 A;  4R9M A;  1ZO0 A;  5KTA A;  1XE4 A;  1Z4E A;  1NSL A;  4CS0 B;  4CGN A;  3JTK A;  2VZZ A;  4MFL A;  3LOD A;  2REF A;  1S7F A;  1N71 A;  3IU1 A;  4NXY A;  4L8A A;  2OZU A;  4C2Y A;  4C2X A;  4AVC A;  1OZP A;  3S6G A;  3E0K A;  2Z3M A;  2ZW6 A;  4OAE A;  2O28 A;  4YFJ A;  3WR7 A;  3V8I A;  1J4J A;  5J8F A;  1L0C A;  2Q4V A;  1FY7 A;  3SHP A;  2R1I A;  2ARH A;  5F49 A;  2CNM A;  4MFZ A;  4UA3 A;  4M3S A;  3R1K A;  4U9Z A;  1XIX A;  5AGE A;  4A95 A;  2Z3K A;  4ZGY B;  3FXT A;  4CRZ B;  2DXQ A;  2WPX A;  4KVM E;  2FXF A;  4B13 A;  2P0W A;  2VI7 A;  1GHE A;  1TIQ A;  2OZG A;  5HH1 A;  3PP9 A;  3CXQ A;  1NMT A;  4NEX A;  2PQ8 A;  4K30 A;  4KOS A;  1VKC A;  1KUX A;  1MJB A;  4NSQ A;  3SXN A;  2WSA A;  3KKW A;  3EXN A;  2H5M A;  2B58 A;  4CAX A;  4UFW A;  5F46 A;  2R7H A;  4JD6 A;  2HUZ A;  1B87 A;  2AJ6 A;  4PV6 A;  2ZW5 A;  1YRE A;  2OB0 A;  4AG7 A;  3TOA A;  4X5K A;  3D3S A;  4QBJ A;  3GYA A;  2ZPA A;  2BEI A;  4XNH B;  1QSO A;  2KCW A;  2Q7B A;  2EUI A;  4UBR A;  1PUA A;  5IX3 A;  3BJ7 A;  2OU2 A;  4HNX B;  5KTC A;  2J8M A;  3ZJ0 A;  5A27 A;  2B4D A;  1QSN A;  4PSW A;  4CGO A;  1Y9K A;  2I79 A;  4LUA A;  2B5G A;  4QVT A;  2VXK A;  4F0Y A;  1Q2Y A;  2Q4Y A;  3DR8 A;  3G3S A;  1XF8 A;  3D8P A;  3FYN A;  3GKR A;  1IIC A;  4KUB A;  4CGL A;  4KVO E;  4MFP A;  3S6K A;  4KS9 A;  3W6X A;  1IYK A;  3D2M A;  4XPD B;  3F8K A;  2FIW A;  1K4J A;  5FVJ A;  2P6E A;  4H6Z A;  3BJ8 A;  2IL4 A;  2FE7 A;  5DWM A;  1YLE A;  1CJW A;  2FSR A;  5H86 A;  4XPD C;  5E96 A;  3R96 A;  4UFV A;  3VWD A;  5C88 A;  4KUA A;  2QML A;  1RO5 A;  2VBQ A;  4AVA A;  3P2F A;  4KSA A;  2VEZ A;  4B14 A;  5G21 A;  5J8C A;  4MFQ A;  4R3L A;  2CXA A;  3TCV A;  4E2A A;  3IWG A;  4UCN A;  4F6A A;  3BLN A;  3VWE A;  4A2Z A;  2FCK A;  4KZT A;  3B8G A;  3NE7 A;  4FD6 A;  1ON0 A;  1I1D A;  1M4I A;  1WK4 A;  3UY5 A;  4A30 A;  3F0A A;  2HQY A;  3FRM A;  4CYQ A;  4C2Z A;  1SQH A;  4MJ8 A;  1BO4 A;  4ZBG A;  4A31 A;  2YNE A;  4FD7 A;  2GIV A;  2Z0Z A;  4H89 A;  3S6F A;  5AG6 A;  4CYO A;  1U6M A;  4CAE A;  5A28 A;  2B4D B;  1S7N A;  3I3G A;  2WPW A;  5F48 A;  2YGW A;  2EVN A;  4GS4 A;  2ATR A;  4PK3 A;  2CY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...