3PGPA

Crystal structure of pa4794 - gnat superfamily protein in complex with accoa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pgpA00
5F47A 2REFA 4NSQA 4HNWB 3FXTA 4AG9A 4FD7A 3C26A 4QVTA 4XPDB 1RXTA 5FVJA 2PQ8A 3S6KA 3WR7A 3SXOA 2Q44A 4J3GA 4CS0B 2B4DA 3SHPA 3JVNA 4PK2A 2R8VA 4MBUA 3TE4A 2WPXA 4MJ8A 2D4OA 3EC4A 2X7BA 4EVYA 2R1IA 2B5GA 2I79A 2A4NA 2B3VA 1XEBA 2ZPAA 2FSRA 5IV0A 4JD6A 5DWMA 1S60A 2Q4VA 4UA3A 3P2FA 3GYAA 3H4QA 3CXPA 1YR0A 2ZW5A 3S6HA 4KOYA 2HV2A 2REEA 1LRZA 4KOUA 4KVXA 4R57A 4KORA 4KLVA 4JWPA 3I3GA 5HH1A 3CXQA 2PR1A 1P0HA 1MJ9A 2K5TA 2ARHA 1P4NA 2G3TA 3TO6A 1IYLA 4AG7A 4H6UA 2VEZA 3D2MA 1YVOA 3LD2A 4YRHA 4XPDC 5KTDA 2VQYA 4KUBA 1S7LA 3FIXA 2CNSA 4GS4A 3R9FA 4NCZA 1KUYA 3DR6A 2GIVA 4KUAA 1QSMA 5F48A 3RYOA 2IL4A 3FBUA 5CNPA 1Z4RA 4R9MA 2VXKA 2KCWA 2JLMA 4ZBGA 3D8PA 1KUXA 4CAVA 2ZW7A 2DXQA 3TO9A 1XIXA 1M44A 5I0CA 4KLWA 2QECA 3GKRA 3P2HA 2C27A 3D3SA 4XNHB 4RI1A 2VZYA 2OH1A 4CRZB 4B5PB 3BJ8A 2J8NA 3R9EA 5F46A 4YGOA 2JDDA 2P6EA 3TCVA 5KTAA 4HNXB 3TO7A 2QIRA 1IB1E 1UFHA 4E0AA 3W6SA 2Q4YA 3R9GA 3F0AA 2B58A 4II9A 2FS5A 1B6BA 1MJAA 2BUEA 2QMLA 4YFJA 2FCKA 4NF1A 4U9ZA 1BOBA 4KOTA 4F6AA 5KTCA 3MGDA 4KVME 4QBJA 2BEIA 4AVBA 1YGHA 2FE7A 1VKCA 1TIQA 4UBRA 4CRYB 2OB0A 4FD5A 3PGPA 2P6FA 3FNCA 3QB8A 1CJWA 2I00A 4LX9A 3K9UA 3CXSA 4R3LA 3PZJA 3F5BA 3OWCA 4MHDA 1PUAA 4IF5A 2FL4A 2D4PA 2OZUA 2FIAA 1S7FA 2P0WA 3EXNA 3TOBA 2F5IA 1R57A 2WPWA 1Y9WA 5EBVA 4NXYA 4FD6A 3T90A 4B5PA 1Z9UA 2OZGA 2RC4A 2FIWA 4DNCA 4CAXA 1K4JA 4KOVA 4XNHC 5DWNA 4M3SA 3S6GA 5IB0A 4AVCA 1S7KA 1Q2YA 3F8KA 2B3UA 3SXNA 1U6MA 1RO5A 4CAWA 4AVAA 4X5KA 1QSTA 1NE9A 2NMTA 5EC4A 1ON0A 3IGRA 5ISVA 1IIDA 3FYNA 1MJBA 1YX0A 2CY2A 3IWGA 3FB3A 1NSLA 4I49A 2VZZA 4R3KA 3R96A 1Y9KA 1WWZA 1MK4A 1Z4EA 3DNSA 4M85A 3R1KA 4PSXA 1PU9A 4KOWA 3BLNA 4QUSA 4OLLA 2FXFA 3G8WA 4U9YA 4E8OA 4JJXA 4PV6A 2B5GB 3EY5A 4H89A 4Y49B 2HQYA 2CNMA 1L0CA 4K30A 2HUZA 3E0KA 3QAHA 2ZW6A 4JLYA 4PSWA 1VHSA 5C88A 3V8IA 2JEVA 3W91A 2G3AA 5H84A 2B4BA 3VWDA 4XPKA 4OAEA 3NE7A 4L89A 1N71A 2CNTA 2FT0A 2H5MA 4ONUA 4MI4A 2O28A 5HMNA 4H6ZA 2ZXVA 4KVOE 2R7HA 1WK4A 3JUWA 2R98A 3GY9A 4HNYB 5J8FA 2VBQA 4JXQA 3W6XA 4QC6A 2PC1A 2BSWA 4MY0A 5E96A 4R87A 1S5KA 1I12A 4AB7A 2PSWA 4PK3A 2J8RA 5H86A 1OZPA 1XE4A 4JXRA 5GCNA 2OU2A 2OZHA 1GHEA 3EFAA 1XF8A 3DSBA 2Q7BA 1YLEA 3EO4A 5JQ4A 1KUVA 3T9YA 1I1DA 3VWEA 2PR8A 4L8AA 4Y49C 4OADA 1QSNA 4XPLA 1YK3A 2ZW4A 3R95A 1FY7A 2PRBA 2Y0MA 1S3ZA 1M4DA 2EUIA 3DDDA 5J8CA 3B8GA 2P6GA 1IICA 4FD4A 4KOXA 2BL1A 1IYKA 1Q2CA 3UY5A 1S7NA 2Z11A 3D2PA 3LODA 4U5YA 1NMTA 1B87A 2ATRA 2Z10A 4KZTA 4HKFA 1QSRA 5F49A 2B4DB 1YREA 3ZJ0A 3BJ7A 2VI7A 2G0BA 1QSOA 1M4GA 1CM0A 4E2AA 2Q04A 2AE6A 4B5OA 5IX3A 1SQHA 2GE3A 4UWIA 3TOAA 2AJ6A 1I21A 4IUSA 2J8MA 4QB9A 3FRMA 4UWJA 5JPHA 2EVNA 1BO4A 1XMTA 3I9SA 4LUAA 1KZFA 4BMHA 4NEXA 3DR8A 1V0CA 3TFYA 1M4IA 1M1DA 3N7ZA 2JDCA 4MY3A 1J4JA 5C82A 3TTHA 1Y7RA 2Z0ZA 1Q2DA 2GANA 3TT2A 3KKWA 4KOSA 3S6FA 4F0YA 3ZZIA 3G3SA 4RS2A 4ORFA 3PP9A 2PDOA 2Q0YA 1YVKA
chains in the Genus database with same CATH superfamily
4A31A 4OMEA 4IHMA 4AXVA 3HUVA 4CPAA 4PPZA 2PVVA 2CIJA 5F47A 1FT7A 2C6PA 3PFEA 2REFA 5AG5A 5I4MA 4NSQA 2PRQA 4Z65A 4HNWB 3FXTA 1BAVA 4MXUA 4UEFA 5LYDA 2ZEOA 2Q51A 4FD7A 4AG9A 3HLPA 3TC8A 2ANPA 3C26A 4PXBA 1YMEA 3FEEA 4QVTA 4XPDB 4ZY2A 4OC2A 5A28A 2Z3PA 1RXTA 3RNZA 4UEEA 5FVJA 1KWMA 2PQ8A 3S6KA 3WR7A 3CT9A 4A2ZA 1OBRA 1YLOA 4P6YA 2ZEEA 3SXOA 2Q44A 4J3GA 3QAYA 3V38A 4R8FA 4CS0B 2B4DA 3D66A 1LOKA 3SHPA 2ZEDA 1R43A 1ARLA 3IIBA 3JVNA 2AFXA 4PK2A 2R8VA 2YNDA 4MBUA 5G22A 3TE4A 2WPXA 4UF4A 1GYTA 1TKHA 3FVLA 5IB9A 4C7IA 4MJ8A 2D4OA 3EC4A 4UFVA 3BI0A 2X7BA 4EVYA 2R1IA 1YW4A 1CBXA 2B5GA 3WC6A 2I79A 4B6ZA 2EWBA 2A4NA 2B3VA 1XEBA 2ZPAA 2FSRA 5IV0A 1X12A 3LMSA 4MRIA 2V77A 4JD6A 2PJ5A 2EBJA 5DWMA 1S60A 2Q4VA 2BOAA 2Q4ZA 4UA3A 3KL9A 2EK9A 3P2FA 4B13A 3LWUA 1Y0RA 3GYAA 4UCMA 3H4QA 1HEEA 4NGPA 3CXPA 1YR0A 3A9LA 3IWWA 2ZW5A 3S6HA 4KOYA 2HV2A 4ZX8A 4BINA 2PIZA 2REEA 1LRZA 3DGVA 4KOUA 4MCQA 4P4FA 4KVXA 4R57A 1XFOA 4KORA 4UEZA 3SI1A 4P4JA 3DLJA 4ZY1A 4PQAA 4KLVA 4X2TA 3RO0A 2J9AA 2XEFA 4JWPA 3I3GA 4WWVA 5HH1A 3CXQA 2NSMA 2PR1A 4MFLA 4X3RA 2BO9A 4NJQA 1P0HA 4CYOA 1MJ9A 2K5TA 2ARHA 4MHYA 1P4NA 2G3TA 3H8EA 4KSIA 3IU2A 3TO6A 1IYLA 4AG7A 3PBEA 4H6UA 2VEZA 2PJ4A 3D2MA 4P10A 1YVOA 2OOTA 4CAEA 3LD2A 4YRHA 4XPDC 5KTDA 2VQYA 3FEDA 4KUBA 4IK2A 3PFOA 4NGRA 5G21A 4B14A 4A32A 4B10A 1LAPA 1S7LA 2V8HA 1Z8LA 3FIXA 2CNSA 2O4HA 2Z3KA 3PB6X 4GS4A 2Z3LA 4NCZA 1KUYA 3R9FA 1XJOA 3DR6A 3FJUA 2GIVA 4MFJA 2AFWA 4KUAA 1QSMA 5F48A 2YGWA 2GLFA 4NGTA 2AFMA 3RYOA 2IL4A 2XEGA 3FBUA 4TNUA 5CNPA 4C2ZA 4C2YA 3SJEA 4X8IA 1Z4RA 3FX6A 2RB7A 1XMBA 3NE8A 4R9MA 1CX8A 5KTCA 2VXKA 3MRUA 1LCPA 2KCWA 5THWA 2JLMA 4ZBGA 3ISXA 3D8PA 1KUXA 4CAVA 2ZW7A 2DXQA 3TO9A 5K8NA 1XIXA 1M44A 4MCSA 5I0CA 4KLWA 1M4LA 4R7MA 4MCRA 4CRZB 4BBHA 2QECA 2YNCA 3GKRA 1ZO0A 3P2HA 4BD9A 4LQ6A 1XBUA 4DUKA 1Y0YA 1EE3P 2C27A 3D3SA 1PYTB 1CPXA 2O53A 2YNCC 2Q43A 1BLLE 2VZYA 2OH1A 4RI1A 4JZ0A 2V8VA 4XNHB 3BJ8A 4OIWA 4B5PB 4DYOA 2QYVA 2J8NA 2I3CA 3L2NA 1QQ9A 4MFKA 4MHZA 4TWEA 3R9EA 5F09A 5F46A 4YGOA 2GU2A 4NGSA 2JDDA 1VIXA 2P6EA 3TCVA 1TF8A 5KTAA 4HNXB 3TO7A 2QIRA 1IB1E 3NFZA 1UFHA 3D4UA 4E0AA 3W6SA 4CYQA 2EK8A 3JRUA 2Q4YA 1ELMP 3R9GA 4YWYA 2DF5A 3S9MA 1DTDA 3F0AA 2B58A 1BPNA 4II9A 3FH4A 2PJ3A 2FS5A 1B6BA 1MJAA 2BUEA 3RBUA 3B35A 2QMLA 4NGNA 2FCKA 4YFJA 1A2ZA 4NF1A 4U9ZA 4F8ZA 4MMOA 4A30A 1BOBA 4KOTA 3D7HA 4F6AA 3MGDA 2CF4A 3KQXA 4KVME 4QBJA 2BEIA 1BPMA 3FECA 1XRYA 4WJBA 5LRGA 4AVBA 4OC1A 1YGHA 2FE7A 3JTKA 1VKCA 1HDUA 1TIQA 4UBRA 5AG6A 4PXEA 4CRYB 4MFPA 2OB0A 2DEAA 5A27A 4FD5A 4OP4A 4PXCA 2PJBA 3SI0A 1NSAA 4A39A 3PGPA 2P6FA 2V8GA 3FNCA 3QB8A 3KASA 1CJWA 2I00A 4UFXA 4LX9A 1Z8WA 3IJ3A 3KR4A 4H2KA 2VL1A 3FMCA 3K9UA 3CXSA 3CPXA 3KI9A 3KZWA 4OC3A 3PZJA 3F5BA 3OWCA 4MHDA 4R3LA 5AG7A 1PCAA 4MFZA 1PUAA 4IF5A 2FL4A 5EMIA 5CBMA 4ZGYB 2D4PA 2OZUA 2FIAA 1S7FA 2P0WA 3EXNA 3TOBA 3NA6A 4CGLA 1YSJA 2F5IA 3H8FA 1CP7A 5CPAA 1CPSA 1R57A 3WC7A 3IU1A 2ZELA 1AYEA 2WPWA 4R6TA 3ISZA 1Y9WA 5EBVA 4NXYA 3RAMA 3N5FA 4FD6A 5LYFA 3CPAA 2C6CA 1TKJA 4KS9A 3T90A 4B5PA 1Z9UA 2OZGA 2RC4A 2ZEMA 2FIWA 4CGPA 4CGOA 3KHZA 4GXHA 4DNCA 4CAXA 2QJ8A 1K4JA 4KOVA 3RZAA 4XNHC 5AGEA 5DWNA 3B3VA 4JYWA 3D7DA 4M3SA 3PB9X 3QNVA 2CXAA 3BHXA 4R76A 3S6GA 4Q38A 4A94A 5IB0A 1F2OA 4AVCA 1S7KA 4P4EA 1Q2YA 3D7GA 2B3UA 2C1CA 2NYQA 2WZNA 1U6MA 3F8KA 3SXNA 1VHEA 4FBEA 1RO5A 2PJ1A 1CP6A 1XOVA 4CAWA 4AVAA 4KSFA 1QSTA 4X5KA 1NE9A 2NMTA 4A95A 5EC4A 3IEHA 1QMUA 4KSAA 2ABZA 1ON0A 3IGRA 3V7ZA 2JBKA 4F9VA 5ISVA 1IIDA 3FYNA 1MJBA 1YX0A 2CY2A 3IWGA 3FB3A 1NSLA 3PB8X 4I49A 4ZI6A 2JBJA 1JWQA 2VZZA 4R3KA 5K8PA 1Q7LA 4O23A 3R96A 5AG4A 1Y9KA 2QVPA 1WWZA 1MK4A 1Z4EA 2ZEHA 4EMEA 3DNSA 4M85A 1VGYA 3R1KA 2G9DA 4PSXA 3WT4A 1Z8XA 1PU9A 2YNEA 4KOWA 4OKOA 2GLJA 1Z8TA 3BLNA 4OIDA 4M6IA 4QUSA 4OLLA 4UFWA 4M6GA 2FXFA 3G8WA 4U9YA 1UWYA 2DPTA 3MN8A 4E8OA 4JJXA 4PV6A 1F2PA 2B5GB 4LQGA 3EY5A 3SJXA 2OR4A 4H89A 1AMPA 4Y49B 2HQYA 1ZG8A 2PJ7A 5D8NA 5K8OA 2CNMA 1L0CA 4K30A 1Z5RA 4RUHA 2HUZA 4ZY0A 3E0KA 3H5ZA 4CYPA 3QAHA 2ZW6A 2ODFA 1FNOA 4JLYA 4PSWA 4Q7AA 1VHSA 2ZEFA 5C88A 5K8MA 3PRTA 3V8IA 3B2YA 2JEVA 4NJRA 3W91A 2G3AA 2CTBA 5H84A 2B4BA 4NFRA 3KR5A 3BXMA 4OC5A 3VWDA 4XPKA 2HB6A 4NGQA 4OAEA 3NE7A 1YW6A 2CTCA 1DE4C 2PJ2A 3B3CA 4UCNA 1H8LA 2Z3OA 4L89A 5J1QA 1N71A 2CNTA 4ONWA 2FT0A 2H5MA 3CDXA 4ONUA 4C7HA 1ZG9A 1LANA 4MI4A 2O28A 3VH9A 1JQGA 1IGBA 3D7FA 4H6ZA 1X10A 2ZXVA 2PCUA 5HMNA 2BCOA 3GIUA 4KVOE 2R7HA 3SJGA 5LRKA 1WK4A 4A38A 3S9NA 3SJFA 3JUWA 2R98A 2GFQA 3GY9A 2IJZA 4HNYB 3WABA 2PVWA 3IO1A 2VBQA 5J8FA 4JXQA 3IC1A 3PBBA 3W6XA 4P4IA 4QC6A 1YQEA 3B7IA 4B11A 2PC1A 2EO8A 2BSWA 4MY0A 1ZLHA 5E96A 6CPAA 4R87A 1S5KA 4CGNA 2PJ9A 4YU9A 1I12A 5LYIA 2V8DA 5D29A 4AB7A 2PSWA 4PK3A 2ZEPA 3LACA 2J8RA 5H86A 1IU8A 1OZPA 4HPSA 7CPAA 1XE4A 4JXRA 1LAMA 4PXDA 5GCNA 2OU2A 4P45A 2OZHA 3B3WA 2RFHA 2PJ8A 5DS0A 4C2XA 1GHEA 3PB7X 2AFSA 2C6GA 3EFAA 3GB0A 3B3TA 2ZOFA 3IFEA 4ZYQA 1XF8A 3DSBA 4M6HA 2Q7BA 1YLEA 4RN7A 4CGMA 3EO4A 5JQ4A 1KUVA 3T9YA 1I1DA 3VWEA 2PR8A 4L8AA 4Y49C 4MHNA 5HVHA 2WYRA 1R3NA 2HC9A 4MFQA 4DJLA 2JEWA 5HVGA 8CPAA 4OADA 1QSNA 5JGFA 2WSAA 4XPLA 1YK3A 2AFZA 2ZW4A 3R95A 2F7VA 1TXRA 3K2KA 4FUUA 3K9TA 1FY7A 2PRBA 3WC5A 2Y0MA 1ZLIA 1S3ZA 2GREA 1TF9A 4GM5A 1M4DA 1ELLP 4UIAA 2EUIA 4CYNA 3DDDA 4EWTA 5J8CA 3B8GA 2P6GA 1IICA 2ZOGA 5JM6A 4F9UA 4FD4A 4KOXA 4B12A 2BL1A 3VARA 5HVFA 2WUUA 1IYKA 1Q2CA 2Z3NA 2ZENA 4MCPA 2AFUA 4CAFA 3UY5A 3B3SA 4A33A 5BWAB 2POKA 1Y7EA 1S7NA 3GUXA 3T8WA 2F8HA 2Z11A 3D2PA 3LODA 5ELYA 4U5YA 3S9LA 1NMTA 1B87A 2ATRA 2Z10A 4KZTA 3CZXA 4HKFA 5HXDA 1Z2LA 4F0XA 3SI2A 1QSRA 1TKFA 5F49A 2B4DB 1YREA 3GLJA 3PEIA 3BJ7A 2VI7A 2G0BA 3ZJ0A 5JH9A 4G1PA 1ARMA 1QSOA 1M4GA 4W9YA 1CM0A 4UIBA 2PJ6A 3NH8A 5G20A 2DPSA 4E2AA 4K3NA 2Q04A 2AE6A 1RTQA 3D67A 1IY7A 3KHXA 4B5OA 5IX3A 4EFDA 1SQHA 2GE3A 4P4DA 4P44A 1VHOA 3BI1A 4C68A 3VATA 4UWIA 4FAIA 3TOAA 1ZG7A 2AJ6A 1I21A 2Q7SA 4IUSA 2FVGA 2J8MA 1AUGA 3KGQA 3FRMA 4OC0A 4FWUA 4QB9A 4UWJA 5LRJA 2IMOA 2XEIA 2EVNA 1BO4A 5JPHA 1F57A 4A37A 1XMTA 3H8GA 5LYLA 2PIYA 2PJ0A 3I9SA 4LUAA 4UCPA 1KZFA 4BMHA 3FF3A 4NEXA 3DR8A 2AFOA 4ZX9A 1CG2A 1IOIA 1V0CA 3I1UA 3D68A 3PB4X 2PE3A 1M4IA 3TFYA 1M1DA 3N7ZA 5G1ZA 2JDCA 2PJCA 2Z3MA 4MY3A 1J4JA 4MHPA 3NH4A 4P4BA 5C82A 3TTHA 1Y7RA 2Z0ZA 1IOFA 1HDQA 4IAVA 1Q2DA 2GANA 3TX8A 4NGMA 3TT2A 3KKWA 3NH5A 4KOSA 3S6FA 4F0YA 2XEJA 3ZZIA 3G3SA 2IQ6A 4OC4A 3KQZA 4RS2A 4ORFA 1LFWA 3PP9A 2PDOA 2Q0YA 1YVKA 3IWEA 2PJAA 4Q36A 2ZEGA
chains in the Genus database with same CATH topology
4A31A 5F47A 2REFA 5AG5A 4NSQA 4HNWB 3FXTA 4AG9A 4FD7A 3C26A 4QVTA 4XPDB 5A28A 2Z3PA 1RXTA 5FVJA 2PQ8A 3S6KA 3WR7A 4A2ZA 3SXOA 2Q44A 4J3GA 4CS0B 2B4DA 3SHPA 3JVNA 4PK2A 2R8VA 2YNDA 4MBUA 5G22A 3TE4A 2WPXA 4C7IA 4MJ8A 2D4OA 3EC4A 4UFVA 2X7BA 4EVYA 2R1IA 2B5GA 2I79A 2A4NA 2B3VA 1XEBA 2ZPAA 2FSRA 5IV0A 4JD6A 5DWMA 1S60A 2Q4VA 4UA3A 3P2FA 4B13A 3GYAA 4UCMA 3H4QA 3CXPA 1YR0A 3A9LA 2ZW5A 3S6HA 4KOYA 2HV2A 2REEA 1LRZA 4KOUA 4KVXA 4R57A 4KORA 4KLVA 4JWPA 3I3GA 5HH1A 3CXQA 2PR1A 4MFLA 1P0HA 4CYOA 1MJ9A 2K5TA 2ARHA 1P4NA 2G3TA 3IU2A 3TO6A 1IYLA 4AG7A 4H6UA 2VEZA 3D2MA 1YVOA 4CAEA 3LD2A 4YRHA 4XPDC 5KTDA 2VQYA 4KUBA 5G21A 4B14A 4A32A 4B10A 1S7LA 3FIXA 2CNSA 2Z3KA 4GS4A 3R9FA 2Z3LA 4NCZA 1KUYA 3DR6A 2GIVA 4MFJA 4KUAA 1QSMA 5F48A 2YGWA 3RYOA 2IL4A 3FBUA 5CNPA 4C2ZA 4C2YA 1Z4RA 4R9MA 2VXKA 2KCWA 2JLMA 4ZBGA 3D8PA 1KUXA 4CAVA 2ZW7A 2DXQA 3TO9A 1XIXA 1M44A 5I0CA 4KLWA 4BBHA 2QECA 2YNCA 3GKRA 1ZO0A 3P2HA 2C27A 3D3SA 2YNCC 4XNHB 4RI1A 2VZYA 2OH1A 4CRZB 4B5PB 3BJ8A 2J8NA 4MFKA 3R9EA 5F46A 4YGOA 2JDDA 2P6EA 3TCVA 5KTAA 4HNXB 3TO7A 2QIRA 1IB1E 1UFHA 4E0AA 3W6SA 4CYQA 2Q4YA 3R9GA 3F0AA 2B58A 4II9A 2FS5A 1B6BA 1MJAA 2BUEA 2QMLA 4YFJA 2FCKA 4NF1A 4U9ZA 4A30A 1BOBA 4KOTA 4F6AA 5KTCA 3MGDA 4KVME 4QBJA 2BEIA 4AVBA 1YGHA 2FE7A 3JTKA 1VKCA 1TIQA 4UBRA 5AG6A 4CRYB 4MFPA 2OB0A 5A27A 4FD5A 3PGPA 2P6FA 3FNCA 3QB8A 1CJWA 2I00A 4UFXA 4LX9A 3K9UA 3CXSA 4R3LA 3PZJA 3F5BA 3OWCA 4MHDA 5AG7A 4MFZA 1PUAA 4IF5A 2FL4A 4ZGYB 2D4PA 2OZUA 2FIAA 1S7FA 2P0WA 3EXNA 3TOBA 4CGLA 2F5IA 1R57A 3IU1A 2WPWA 1Y9WA 5EBVA 4NXYA 4FD6A 4KS9A 3T90A 4B5PA 1Z9UA 2OZGA 2RC4A 2FIWA 4CGPA 4CGOA 4DNCA 4CAXA 1K4JA 4KOVA 4XNHC 5AGEA 5DWNA 4M3SA 2CXAA 3S6GA 4Q38A 5IB0A 4AVCA 1S7KA 1Q2YA 3F8KA 2B3UA 3SXNA 1U6MA 1RO5A 4CAWA 4AVAA 4KSFA 1QSTA 4X5KA 1NE9A 2NMTA 4A95A 5EC4A 4KSAA 1ON0A 3IGRA 5ISVA 1IIDA 3FYNA 1MJBA 1YX0A 2CY2A 3IWGA 3FB3A 1NSLA 4I49A 2VZZA 4R3KA 3R96A 5AG4A 1Y9KA 1WWZA 1MK4A 1Z4EA 3DNSA 4M85A 3R1KA 4PSXA 1PU9A 2YNEA 4KOWA 3BLNA 4QUSA 4OLLA 4UFWA 2FXFA 3G8WA 4U9YA 2DPTA 4E8OA 4JJXA 4PV6A 2B5GB 3EY5A 4H89A 4Y49B 2HQYA 2CNMA 1L0CA 4K30A 2HUZA 3E0KA 3H5ZA 4CYPA 3QAHA 2ZW6A 4JLYA 4PSWA 1VHSA 5C88A 3V8IA 2JEVA 3W91A 2G3AA 5H84A 2B4BA 3VWDA 4XPKA 4OAEA 3NE7A 4UCNA 2Z3OA 4L89A 1N71A 2CNTA 2FT0A 2H5MA 4C7HA 4ONUA 4MI4A 2O28A 5HMNA 4H6ZA 2ZXVA 4KVOE 2R7HA 1WK4A 3JUWA 2R98A 3GY9A 4HNYB 5J8FA 2VBQA 4JXQA 3W6XA 4QC6A 4B11A 2PC1A 2BSWA 4MY0A 5E96A 4R87A 1S5KA 4CGNA 1I12A 4AB7A 2PSWA 4PK3A 2J8RA 5H86A 1OZPA 1XE4A 4JXRA 5GCNA 2OU2A 2OZHA 4C2XA 1GHEA 3EFAA 1XF8A 3DSBA 2Q7BA 1YLEA 4CGMA 3EO4A 5JQ4A 1KUVA 3T9YA 1I1DA 3VWEA 2PR8A 4L8AA 4Y49C 4MFQA 4OADA 1QSNA 2WSAA 4XPLA 1YK3A 2ZW4A 3R95A 1FY7A 2PRBA 2Y0MA 1S3ZA 4CYNA 1M4DA 2EUIA 3DDDA 5J8CA 3B8GA 2P6GA 1IICA 4FD4A 4KOXA 4B12A 2BL1A 2WUUA 1IYKA 1Q2CA 2Z3NA 4CAFA 3UY5A 4A33A 5BWAB 1S7NA 2Z11A 3D2PA 3LODA 4U5YA 1NMTA 1B87A 2ATRA 2Z10A 4KZTA 4HKFA 4F0XA 1QSRA 5F49A 2B4DB 1YREA 3ZJ0A 3BJ7A 2VI7A 2G0BA 1QSOA 1M4GA 1CM0A 5G20A 2DPSA 4E2AA 2Q04A 2AE6A 4B5OA 5IX3A 1SQHA 2GE3A 4C68A 4UWIA 3TOAA 2AJ6A 1I21A 4IUSA 2J8MA 4QB9A 3FRMA 4UWJA 5JPHA 2EVNA 1BO4A 1XMTA 3I9SA 4LUAA 4UCPA 1KZFA 4BMHA 4NEXA 3DR8A 1V0CA 3TFYA 1M4IA 1M1DA 3N7ZA 5G1ZA 2JDCA 2Z3MA 4MY3A 1J4JA 5C82A 3TTHA 1Y7RA 2Z0ZA 1Q2DA 2GANA 3TT2A 3KKWA 4KOSA 3S6FA 4F0YA 3ZZIA 3G3SA 4RS2A 4ORFA 3PP9A 2PDOA 2Q0YA 1YVKA 3IWEA 4Q36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F47 A;  2REF A;  4NSQ A;  4HNW B;  3FXT A;  4AG9 A;  4FD7 A;  3C26 A;  4QVT A;  4XPD B;  1RXT A;  5FVJ A;  2PQ8 A;  3S6K A;  3WR7 A;  3SXO A;  2Q44 A;  4J3G A;  4CS0 B;  2B4D A;  3SHP A;  3JVN A;  4PK2 A;  2R8V A;  4MBU A;  3TE4 A;  2WPX A;  4MJ8 A;  2D4O A;  3EC4 A;  2X7B A;  4EVY A;  2R1I A;  2B5G A;  2I79 A;  2A4N A;  2B3V A;  1XEB A;  2ZPA A;  2FSR A;  5IV0 A;  4JD6 A;  5DWM A;  1S60 A;  2Q4V A;  4UA3 A;  3P2F A;  3GYA A;  3H4Q A;  3CXP A;  1YR0 A;  2ZW5 A;  3S6H A;  4KOY A;  2HV2 A;  2REE A;  1LRZ A;  4KOU A;  4KVX A;  4R57 A;  4KOR A;  4KLV A;  4JWP A;  3I3G A;  5HH1 A;  3CXQ A;  2PR1 A;  1P0H A;  1MJ9 A;  2K5T A;  2ARH A;  1P4N A;  2G3T A;  3TO6 A;  1IYL A;  4AG7 A;  4H6U A;  2VEZ A;  3D2M A;  1YVO A;  3LD2 A;  4YRH A;  4XPD C;  5KTD A;  2VQY A;  4KUB A;  1S7L A;  3FIX A;  2CNS A;  4GS4 A;  3R9F A;  4NCZ A;  1KUY A;  3DR6 A;  2GIV A;  4KUA A;  1QSM A;  5F48 A;  3RYO A;  2IL4 A;  3FBU A;  5CNP A;  1Z4R A;  4R9M A;  2VXK A;  2KCW A;  2JLM A;  4ZBG A;  3D8P A;  1KUX A;  4CAV A;  2ZW7 A;  2DXQ A;  3TO9 A;  1XIX A;  1M44 A;  5I0C A;  4KLW A;  2QEC A;  3GKR A;  3P2H A;  2C27 A;  3D3S A;  4XNH B;  4RI1 A;  2VZY A;  2OH1 A;  4CRZ B;  4B5P B;  3BJ8 A;  2J8N A;  3R9E A;  5F46 A;  4YGO A;  2JDD A;  2P6E A;  3TCV A;  5KTA A;  4HNX B;  3TO7 A;  2QIR A;  1IB1 E;  1UFH A;  4E0A A;  3W6S A;  2Q4Y A;  3R9G A;  3F0A A;  2B58 A;  4II9 A;  2FS5 A;  1B6B A;  1MJA A;  2BUE A;  2QML A;  4YFJ A;  2FCK A;  4NF1 A;  4U9Z A;  1BOB A;  4KOT A;  4F6A A;  5KTC A;  3MGD A;  4KVM E;  4QBJ A;  2BEI A;  4AVB A;  1YGH A;  2FE7 A;  1VKC A;  1TIQ A;  4UBR A;  4CRY B;  2OB0 A;  4FD5 A;  3PGP A;  2P6F A;  3FNC A;  3QB8 A;  1CJW A;  2I00 A;  4LX9 A;  3K9U A;  3CXS A;  4R3L A;  3PZJ A;  3F5B A;  3OWC A;  4MHD A;  1PUA A;  4IF5 A;  2FL4 A;  2D4P A;  2OZU A;  2FIA A;  1S7F A;  2P0W A;  3EXN A;  3TOB A;  2F5I A;  1R57 A;  2WPW A;  1Y9W A;  5EBV A;  4NXY A;  4FD6 A;  3T90 A;  4B5P A;  1Z9U A;  2OZG A;  2RC4 A;  2FIW A;  4DNC A;  4CAX A;  1K4J A;  4KOV A;  4XNH C;  5DWN A;  4M3S A;  3S6G A;  5IB0 A;  4AVC A;  1S7K A;  1Q2Y A;  3F8K A;  2B3U A;  3SXN A;  1U6M A;  1RO5 A;  4CAW A;  4AVA A;  4X5K A;  1QST A;  1NE9 A;  2NMT A;  5EC4 A;  1ON0 A;  3IGR A;  5ISV A;  1IID A;  3FYN A;  1MJB A;  1YX0 A;  2CY2 A;  3IWG A;  3FB3 A;  1NSL A;  4I49 A;  2VZZ A;  4R3K A;  3R96 A;  1Y9K A;  1WWZ A;  1MK4 A;  1Z4E A;  3DNS A;  4M85 A;  3R1K A;  4PSX A;  1PU9 A;  4KOW A;  3BLN A;  4QUS A;  4OLL A;  2FXF A;  3G8W A;  4U9Y A;  4E8O A;  4JJX A;  4PV6 A;  2B5G B;  3EY5 A;  4H89 A;  4Y49 B;  2HQY A;  2CNM A;  1L0C A;  4K30 A;  2HUZ A;  3E0K A;  3QAH A;  2ZW6 A;  4JLY A;  4PSW A;  1VHS A;  5C88 A;  3V8I A;  2JEV A;  3W91 A;  2G3A A;  5H84 A;  2B4B A;  3VWD A;  4XPK A;  4OAE A;  3NE7 A;  4L89 A;  1N71 A;  2CNT A;  2FT0 A;  2H5M A;  4ONU A;  4MI4 A;  2O28 A;  5HMN A;  4H6Z A;  2ZXV A;  4KVO E;  2R7H A;  1WK4 A;  3JUW A;  2R98 A;  3GY9 A;  4HNY B;  5J8F A;  2VBQ A;  4JXQ A;  3W6X A;  4QC6 A;  2PC1 A;  2BSW A;  4MY0 A;  5E96 A;  4R87 A;  1S5K A;  1I12 A;  4AB7 A;  2PSW A;  4PK3 A;  2J8R A;  5H86 A;  1OZP A;  1XE4 A;  4JXR A;  5GCN A;  2OU2 A;  2OZH A;  1GHE A;  3EFA A;  1XF8 A;  3DSB A;  2Q7B A;  1YLE A;  3EO4 A;  5JQ4 A;  1KUV A;  3T9Y A;  1I1D A;  3VWE A;  2PR8 A;  4L8A A;  4Y49 C;  4OAD A;  1QSN A;  4XPL A;  1YK3 A;  2ZW4 A;  3R95 A;  1FY7 A;  2PRB A;  2Y0M A;  1S3Z A;  1M4D A;  2EUI A;  3DDD A;  5J8C A;  3B8G A;  2P6G A;  1IIC A;  4FD4 A;  4KOX A;  2BL1 A;  1IYK A;  1Q2C A;  3UY5 A;  1S7N A;  2Z11 A;  3D2P A;  3LOD A;  4U5Y A;  1NMT A;  1B87 A;  2ATR A;  2Z10 A;  4KZT A;  4HKF A;  1QSR A;  5F49 A;  2B4D B;  1YRE A;  3ZJ0 A;  3BJ7 A;  2VI7 A;  2G0B A;  1QSO A;  1M4G A;  1CM0 A;  4E2A A;  2Q04 A;  2AE6 A;  4B5O A;  5IX3 A;  1SQH A;  2GE3 A;  4UWI A;  3TOA A;  2AJ6 A;  1I21 A;  4IUS A;  2J8M A;  4QB9 A;  3FRM A;  4UWJ A;  5JPH A;  2EVN A;  1BO4 A;  1XMT A;  3I9S A;  4LUA A;  1KZF A;  4BMH A;  4NEX A;  3DR8 A;  1V0C A;  3TFY A;  1M4I A;  1M1D A;  3N7Z A;  2JDC A;  4MY3 A;  1J4J A;  5C82 A;  3TTH A;  1Y7R A;  2Z0Z A;  1Q2D A;  2GAN A;  3TT2 A;  3KKW A;  4KOS A;  3S6F A;  4F0Y A;  3ZZI A;  3G3S A;  4RS2 A;  4ORF A;  3PP9 A;  2PDO A;  2Q0Y A;  1YVK A; 
#chains in the Genus database with same CATH topology
 4A31 A;  4OME A;  4IHM A;  4AXV A;  3HUV A;  4CPA A;  4PPZ A;  2PVV A;  2CIJ A;  5F47 A;  1FT7 A;  2C6P A;  3PFE A;  2REF A;  5AG5 A;  5I4M A;  4NSQ A;  2PRQ A;  4Z65 A;  4HNW B;  3FXT A;  1BAV A;  4MXU A;  4UEF A;  5LYD A;  2ZEO A;  2Q51 A;  4FD7 A;  4AG9 A;  3HLP A;  3TC8 A;  2ANP A;  3C26 A;  4PXB A;  1YME A;  3FEE A;  4QVT A;  4XPD B;  4ZY2 A;  4OC2 A;  5A28 A;  2Z3P A;  1RXT A;  3RNZ A;  4UEE A;  5FVJ A;  1KWM A;  2PQ8 A;  3S6K A;  3WR7 A;  3CT9 A;  4A2Z A;  1OBR A;  1YLO A;  4P6Y A;  2ZEE A;  3SXO A;  2Q44 A;  4J3G A;  3QAY A;  3V38 A;  4R8F A;  4CS0 B;  2B4D A;  3D66 A;  1LOK A;  3SHP A;  2ZED A;  1R43 A;  1ARL A;  3IIB A;  3JVN A;  2AFX A;  4PK2 A;  2R8V A;  2YND A;  4MBU A;  5G22 A;  3TE4 A;  2WPX A;  4UF4 A;  1GYT A;  1TKH A;  3FVL A;  5IB9 A;  4C7I A;  4MJ8 A;  2D4O A;  3EC4 A;  4UFV A;  3BI0 A;  2X7B A;  4EVY A;  2R1I A;  1YW4 A;  1CBX A;  2B5G A;  3WC6 A;  2I79 A;  4B6Z A;  2EWB A;  2A4N A;  2B3V A;  1XEB A;  2ZPA A;  2FSR A;  5IV0 A;  1X12 A;  3LMS A;  4MRI A;  2V77 A;  4JD6 A;  2PJ5 A;  2EBJ A;  5DWM A;  1S60 A;  2Q4V A;  2BOA A;  2Q4Z A;  4UA3 A;  3KL9 A;  2EK9 A;  3P2F A;  4B13 A;  3LWU A;  1Y0R A;  3GYA A;  4UCM A;  3H4Q A;  1HEE A;  4NGP A;  3CXP A;  1YR0 A;  3A9L A;  3IWW A;  2ZW5 A;  3S6H A;  4KOY A;  2HV2 A;  4ZX8 A;  4BIN A;  2PIZ A;  2REE A;  1LRZ A;  3DGV A;  4KOU A;  4MCQ A;  4P4F A;  4KVX A;  4R57 A;  1XFO A;  4KOR A;  4UEZ A;  3SI1 A;  4P4J A;  3DLJ A;  4ZY1 A;  4PQA A;  4KLV A;  4X2T A;  3RO0 A;  2J9A A;  2XEF A;  4JWP A;  3I3G A;  4WWV A;  5HH1 A;  3CXQ A;  2NSM A;  2PR1 A;  4MFL A;  4X3R A;  2BO9 A;  4NJQ A;  1P0H A;  4CYO A;  1MJ9 A;  2K5T A;  2ARH A;  4MHY A;  1P4N A;  2G3T A;  3H8E A;  4KSI A;  3IU2 A;  3TO6 A;  1IYL A;  4AG7 A;  3PBE A;  4H6U A;  2VEZ A;  2PJ4 A;  3D2M A;  4P10 A;  1YVO A;  2OOT A;  4CAE A;  3LD2 A;  4YRH A;  4XPD C;  5KTD A;  2VQY A;  3FED A;  4KUB A;  4IK2 A;  3PFO A;  4NGR A;  5G21 A;  4B14 A;  4A32 A;  4B10 A;  1LAP A;  1S7L A;  2V8H A;  1Z8L A;  3FIX A;  2CNS A;  2O4H A;  2Z3K A;  3PB6 X;  4GS4 A;  2Z3L A;  4NCZ A;  1KUY A;  3R9F A;  1XJO A;  3DR6 A;  3FJU A;  2GIV A;  4MFJ A;  2AFW A;  4KUA A;  1QSM A;  5F48 A;  2YGW A;  2GLF A;  4NGT A;  2AFM A;  3RYO A;  2IL4 A;  2XEG A;  3FBU A;  4TNU A;  5CNP A;  4C2Z A;  4C2Y A;  3SJE A;  4X8I A;  1Z4R A;  3FX6 A;  2RB7 A;  1XMB A;  3NE8 A;  4R9M A;  1CX8 A;  5KTC A;  2VXK A;  3MRU A;  1LCP A;  2KCW A;  5THW A;  2JLM A;  4ZBG A;  3ISX A;  3D8P A;  1KUX A;  4CAV A;  2ZW7 A;  2DXQ A;  3TO9 A;  5K8N A;  1XIX A;  1M44 A;  4MCS A;  5I0C A;  4KLW A;  1M4L A;  4R7M A;  4MCR A;  4CRZ B;  4BBH A;  2QEC A;  2YNC A;  3GKR A;  1ZO0 A;  3P2H A;  4BD9 A;  4LQ6 A;  1XBU A;  4DUK A;  1Y0Y A;  1EE3 P;  2C27 A;  3D3S A;  1PYT B;  1CPX A;  2O53 A;  2YNC C;  2Q43 A;  1BLL E;  2VZY A;  2OH1 A;  4RI1 A;  4JZ0 A;  2V8V A;  4XNH B;  3BJ8 A;  4OIW A;  4B5P B;  4DYO A;  2QYV A;  2J8N A;  2I3C A;  3L2N A;  1QQ9 A;  4MFK A;  4MHZ A;  4TWE A;  3R9E A;  5F09 A;  5F46 A;  4YGO A;  2GU2 A;  4NGS A;  2JDD A;  1VIX A;  2P6E A;  3TCV A;  1TF8 A;  5KTA A;  4HNX B;  3TO7 A;  2QIR A;  1IB1 E;  3NFZ A;  1UFH A;  3D4U A;  4E0A A;  3W6S A;  4CYQ A;  2EK8 A;  3JRU A;  2Q4Y A;  1ELM P;  3R9G A;  4YWY A;  2DF5 A;  3S9M A;  1DTD A;  3F0A A;  2B58 A;  1BPN A;  4II9 A;  3FH4 A;  2PJ3 A;  2FS5 A;  1B6B A;  1MJA A;  2BUE A;  3RBU A;  3B35 A;  2QML A;  4NGN A;  2FCK A;  4YFJ A;  1A2Z A;  4NF1 A;  4U9Z A;  4F8Z A;  4MMO A;  4A30 A;  1BOB A;  4KOT A;  3D7H A;  4F6A A;  3MGD A;  2CF4 A;  3KQX A;  4KVM E;  4QBJ A;  2BEI A;  1BPM A;  3FEC A;  1XRY A;  4WJB A;  5LRG A;  4AVB A;  4OC1 A;  1YGH A;  2FE7 A;  3JTK A;  1VKC A;  1HDU A;  1TIQ A;  4UBR A;  5AG6 A;  4PXE A;  4CRY B;  4MFP A;  2OB0 A;  2DEA A;  5A27 A;  4FD5 A;  4OP4 A;  4PXC A;  2PJB A;  3SI0 A;  1NSA A;  4A39 A;  3PGP A;  2P6F A;  2V8G A;  3FNC A;  3QB8 A;  3KAS A;  1CJW A;  2I00 A;  4UFX A;  4LX9 A;  1Z8W A;  3IJ3 A;  3KR4 A;  4H2K A;  2VL1 A;  3FMC A;  3K9U A;  3CXS A;  3CPX A;  3KI9 A;  3KZW A;  4OC3 A;  3PZJ A;  3F5B A;  3OWC A;  4MHD A;  4R3L A;  5AG7 A;  1PCA A;  4MFZ A;  1PUA A;  4IF5 A;  2FL4 A;  5EMI A;  5CBM A;  4ZGY B;  2D4P A;  2OZU A;  2FIA A;  1S7F A;  2P0W A;  3EXN A;  3TOB A;  3NA6 A;  4CGL A;  1YSJ A;  2F5I A;  3H8F A;  1CP7 A;  5CPA A;  1CPS A;  1R57 A;  3WC7 A;  3IU1 A;  2ZEL A;  1AYE A;  2WPW A;  4R6T A;  3ISZ A;  1Y9W A;  5EBV A;  4NXY A;  3RAM A;  3N5F A;  4FD6 A;  5LYF A;  3CPA A;  2C6C A;  1TKJ A;  4KS9 A;  3T90 A;  4B5P A;  1Z9U A;  2OZG A;  2RC4 A;  2ZEM A;  2FIW A;  4CGP A;  4CGO A;  3KHZ A;  4GXH A;  4DNC A;  4CAX A;  2QJ8 A;  1K4J A;  4KOV A;  3RZA A;  4XNH C;  5AGE A;  5DWN A;  3B3V A;  4JYW A;  3D7D A;  4M3S A;  3PB9 X;  3QNV A;  2CXA A;  3BHX A;  4R76 A;  3S6G A;  4Q38 A;  4A94 A;  5IB0 A;  1F2O A;  4AVC A;  1S7K A;  4P4E A;  1Q2Y A;  3D7G A;  2B3U A;  2C1C A;  2NYQ A;  2WZN A;  1U6M A;  3F8K A;  3SXN A;  1VHE A;  4FBE A;  1RO5 A;  2PJ1 A;  1CP6 A;  1XOV A;  4CAW A;  4AVA A;  4KSF A;  1QST A;  4X5K A;  1NE9 A;  2NMT A;  4A95 A;  5EC4 A;  3IEH A;  1QMU A;  4KSA A;  2ABZ A;  1ON0 A;  3IGR A;  3V7Z A;  2JBK A;  4F9V A;  5ISV A;  1IID A;  3FYN A;  1MJB A;  1YX0 A;  2CY2 A;  3IWG A;  3FB3 A;  1NSL A;  3PB8 X;  4I49 A;  4ZI6 A;  2JBJ A;  1JWQ A;  2VZZ A;  4R3K A;  5K8P A;  1Q7L A;  4O23 A;  3R96 A;  5AG4 A;  1Y9K A;  2QVP A;  1WWZ A;  1MK4 A;  1Z4E A;  2ZEH A;  4EME A;  3DNS A;  4M85 A;  1VGY A;  3R1K A;  2G9D A;  4PSX A;  3WT4 A;  1Z8X A;  1PU9 A;  2YNE A;  4KOW A;  4OKO A;  2GLJ A;  1Z8T A;  3BLN A;  4OID A;  4M6I A;  4QUS A;  4OLL A;  4UFW A;  4M6G A;  2FXF A;  3G8W A;  4U9Y A;  1UWY A;  2DPT A;  3MN8 A;  4E8O A;  4JJX A;  4PV6 A;  1F2P A;  2B5G B;  4LQG A;  3EY5 A;  3SJX A;  2OR4 A;  4H89 A;  1AMP A;  4Y49 B;  2HQY A;  1ZG8 A;  2PJ7 A;  5D8N A;  5K8O A;  2CNM A;  1L0C A;  4K30 A;  1Z5R A;  4RUH A;  2HUZ A;  4ZY0 A;  3E0K A;  3H5Z A;  4CYP A;  3QAH A;  2ZW6 A;  2ODF A;  1FNO A;  4JLY A;  4PSW A;  4Q7A A;  1VHS A;  2ZEF A;  5C88 A;  5K8M A;  3PRT A;  3V8I A;  3B2Y A;  2JEV A;  4NJR A;  3W91 A;  2G3A A;  2CTB A;  5H84 A;  2B4B A;  4NFR A;  3KR5 A;  3BXM A;  4OC5 A;  3VWD A;  4XPK A;  2HB6 A;  4NGQ A;  4OAE A;  3NE7 A;  1YW6 A;  2CTC A;  1DE4 C;  2PJ2 A;  3B3C A;  4UCN A;  1H8L A;  2Z3O A;  4L89 A;  5J1Q A;  1N71 A;  2CNT A;  4ONW A;  2FT0 A;  2H5M A;  3CDX A;  4ONU A;  4C7H A;  1ZG9 A;  1LAN A;  4MI4 A;  2O28 A;  3VH9 A;  1JQG A;  1IGB A;  3D7F A;  4H6Z A;  1X10 A;  2ZXV A;  2PCU A;  5HMN A;  2BCO A;  3GIU A;  4KVO E;  2R7H A;  3SJG A;  5LRK A;  1WK4 A;  4A38 A;  3S9N A;  3SJF A;  3JUW A;  2R98 A;  2GFQ A;  3GY9 A;  2IJZ A;  4HNY B;  3WAB A;  2PVW A;  3IO1 A;  2VBQ A;  5J8F A;  4JXQ A;  3IC1 A;  3PBB A;  3W6X A;  4P4I A;  4QC6 A;  1YQE A;  3B7I A;  4B11 A;  2PC1 A;  2EO8 A;  2BSW A;  4MY0 A;  1ZLH A;  5E96 A;  6CPA A;  4R87 A;  1S5K A;  4CGN A;  2PJ9 A;  4YU9 A;  1I12 A;  5LYI A;  2V8D A;  5D29 A;  4AB7 A;  2PSW A;  4PK3 A;  2ZEP A;  3LAC A;  2J8R A;  5H86 A;  1IU8 A;  1OZP A;  4HPS A;  7CPA A;  1XE4 A;  4JXR A;  1LAM A;  4PXD A;  5GCN A;  2OU2 A;  4P45 A;  2OZH A;  3B3W A;  2RFH A;  2PJ8 A;  5DS0 A;  4C2X A;  1GHE A;  3PB7 X;  2AFS A;  2C6G A;  3EFA A;  3GB0 A;  3B3T A;  2ZOF A;  3IFE A;  4ZYQ A;  1XF8 A;  3DSB A;  4M6H A;  2Q7B A;  1YLE A;  4RN7 A;  4CGM A;  3EO4 A;  5JQ4 A;  1KUV A;  3T9Y A;  1I1D A;  3VWE A;  2PR8 A;  4L8A A;  4Y49 C;  4MHN A;  5HVH A;  2WYR A;  1R3N A;  2HC9 A;  4MFQ A;  4DJL A;  2JEW A;  5HVG A;  8CPA A;  4OAD A;  1QSN A;  5JGF A;  2WSA A;  4XPL A;  1YK3 A;  2AFZ A;  2ZW4 A;  3R95 A;  2F7V A;  1TXR A;  3K2K A;  4FUU A;  3K9T A;  1FY7 A;  2PRB A;  3WC5 A;  2Y0M A;  1ZLI A;  1S3Z A;  2GRE A;  1TF9 A;  4GM5 A;  1M4D A;  1ELL P;  4UIA A;  2EUI A;  4CYN A;  3DDD A;  4EWT A;  5J8C A;  3B8G A;  2P6G A;  1IIC A;  2ZOG A;  5JM6 A;  4F9U A;  4FD4 A;  4KOX A;  4B12 A;  2BL1 A;  3VAR A;  5HVF A;  2WUU A;  1IYK A;  1Q2C A;  2Z3N A;  2ZEN A;  4MCP A;  2AFU A;  4CAF A;  3UY5 A;  3B3S A;  4A33 A;  5BWA B;  2POK A;  1Y7E A;  1S7N A;  3GUX A;  3T8W A;  2F8H A;  2Z11 A;  3D2P A;  3LOD A;  5ELY A;  4U5Y A;  3S9L A;  1NMT A;  1B87 A;  2ATR A;  2Z10 A;  4KZT A;  3CZX A;  4HKF A;  5HXD A;  1Z2L A;  4F0X A;  3SI2 A;  1QSR A;  1TKF A;  5F49 A;  2B4D B;  1YRE A;  3GLJ A;  3PEI A;  3BJ7 A;  2VI7 A;  2G0B A;  3ZJ0 A;  5JH9 A;  4G1P A;  1ARM A;  1QSO A;  1M4G A;  4W9Y A;  1CM0 A;  4UIB A;  2PJ6 A;  3NH8 A;  5G20 A;  2DPS A;  4E2A A;  4K3N A;  2Q04 A;  2AE6 A;  1RTQ A;  3D67 A;  1IY7 A;  3KHX A;  4B5O A;  5IX3 A;  4EFD A;  1SQH A;  2GE3 A;  4P4D A;  4P44 A;  1VHO A;  3BI1 A;  4C68 A;  3VAT A;  4UWI A;  4FAI A;  3TOA A;  1ZG7 A;  2AJ6 A;  1I21 A;  2Q7S A;  4IUS A;  2FVG A;  2J8M A;  1AUG A;  3KGQ A;  3FRM A;  4OC0 A;  4FWU A;  4QB9 A;  4UWJ A;  5LRJ A;  2IMO A;  2XEI A;  2EVN A;  1BO4 A;  5JPH A;  1F57 A;  4A37 A;  1XMT A;  3H8G A;  5LYL A;  2PIY A;  2PJ0 A;  3I9S A;  4LUA A;  4UCP A;  1KZF A;  4BMH A;  3FF3 A;  4NEX A;  3DR8 A;  2AFO A;  4ZX9 A;  1CG2 A;  1IOI A;  1V0C A;  3I1U A;  3D68 A;  3PB4 X;  2PE3 A;  1M4I A;  3TFY A;  1M1D A;  3N7Z A;  5G1Z A;  2JDC A;  2PJC A;  2Z3M A;  4MY3 A;  1J4J A;  4MHP A;  3NH4 A;  4P4B A;  5C82 A;  3TTH A;  1Y7R A;  2Z0Z A;  1IOF A;  1HDQ A;  4IAV A;  1Q2D A;  2GAN A;  3TX8 A;  4NGM A;  3TT2 A;  3KKW A;  3NH5 A;  4KOS A;  3S6F A;  4F0Y A;  2XEJ A;  3ZZI A;  3G3S A;  2IQ6 A;  4OC4 A;  3KQZ A;  4RS2 A;  4ORF A;  1LFW A;  3PP9 A;  2PDO A;  2Q0Y A;  1YVK A;  3IWE A;  2PJA A;  4Q36 A;  2ZEG A; 
#chains in the Genus database with same CATH homology
 4A31 A;  5F47 A;  2REF A;  5AG5 A;  4NSQ A;  4HNW B;  3FXT A;  4AG9 A;  4FD7 A;  3C26 A;  4QVT A;  4XPD B;  5A28 A;  2Z3P A;  1RXT A;  5FVJ A;  2PQ8 A;  3S6K A;  3WR7 A;  4A2Z A;  3SXO A;  2Q44 A;  4J3G A;  4CS0 B;  2B4D A;  3SHP A;  3JVN A;  4PK2 A;  2R8V A;  2YND A;  4MBU A;  5G22 A;  3TE4 A;  2WPX A;  4C7I A;  4MJ8 A;  2D4O A;  3EC4 A;  4UFV A;  2X7B A;  4EVY A;  2R1I A;  2B5G A;  2I79 A;  2A4N A;  2B3V A;  1XEB A;  2ZPA A;  2FSR A;  5IV0 A;  4JD6 A;  5DWM A;  1S60 A;  2Q4V A;  4UA3 A;  3P2F A;  4B13 A;  3GYA A;  4UCM A;  3H4Q A;  3CXP A;  1YR0 A;  3A9L A;  2ZW5 A;  3S6H A;  4KOY A;  2HV2 A;  2REE A;  1LRZ A;  4KOU A;  4KVX A;  4R57 A;  4KOR A;  4KLV A;  4JWP A;  3I3G A;  5HH1 A;  3CXQ A;  2PR1 A;  4MFL A;  1P0H A;  4CYO A;  1MJ9 A;  2K5T A;  2ARH A;  1P4N A;  2G3T A;  3IU2 A;  3TO6 A;  1IYL A;  4AG7 A;  4H6U A;  2VEZ A;  3D2M A;  1YVO A;  4CAE A;  3LD2 A;  4YRH A;  4XPD C;  5KTD A;  2VQY A;  4KUB A;  5G21 A;  4B14 A;  4A32 A;  4B10 A;  1S7L A;  3FIX A;  2CNS A;  2Z3K A;  4GS4 A;  3R9F A;  2Z3L A;  4NCZ A;  1KUY A;  3DR6 A;  2GIV A;  4MFJ A;  4KUA A;  1QSM A;  5F48 A;  2YGW A;  3RYO A;  2IL4 A;  3FBU A;  5CNP A;  4C2Z A;  4C2Y A;  1Z4R A;  4R9M A;  2VXK A;  2KCW A;  2JLM A;  4ZBG A;  3D8P A;  1KUX A;  4CAV A;  2ZW7 A;  2DXQ A;  3TO9 A;  1XIX A;  1M44 A;  5I0C A;  4KLW A;  4BBH A;  2QEC A;  2YNC A;  3GKR A;  1ZO0 A;  3P2H A;  2C27 A;  3D3S A;  2YNC C;  4XNH B;  4RI1 A;  2VZY A;  2OH1 A;  4CRZ B;  4B5P B;  3BJ8 A;  2J8N A;  4MFK A;  3R9E A;  5F46 A;  4YGO A;  2JDD A;  2P6E A;  3TCV A;  5KTA A;  4HNX B;  3TO7 A;  2QIR A;  1IB1 E;  1UFH A;  4E0A A;  3W6S A;  4CYQ A;  2Q4Y A;  3R9G A;  3F0A A;  2B58 A;  4II9 A;  2FS5 A;  1B6B A;  1MJA A;  2BUE A;  2QML A;  4YFJ A;  2FCK A;  4NF1 A;  4U9Z A;  4A30 A;  1BOB A;  4KOT A;  4F6A A;  5KTC A;  3MGD A;  4KVM E;  4QBJ A;  2BEI A;  4AVB A;  1YGH A;  2FE7 A;  3JTK A;  1VKC A;  1TIQ A;  4UBR A;  5AG6 A;  4CRY B;  4MFP A;  2OB0 A;  5A27 A;  4FD5 A;  3PGP A;  2P6F A;  3FNC A;  3QB8 A;  1CJW A;  2I00 A;  4UFX A;  4LX9 A;  3K9U A;  3CXS A;  4R3L A;  3PZJ A;  3F5B A;  3OWC A;  4MHD A;  5AG7 A;  4MFZ A;  1PUA A;  4IF5 A;  2FL4 A;  4ZGY B;  2D4P A;  2OZU A;  2FIA A;  1S7F A;  2P0W A;  3EXN A;  3TOB A;  4CGL A;  2F5I A;  1R57 A;  3IU1 A;  2WPW A;  1Y9W A;  5EBV A;  4NXY A;  4FD6 A;  4KS9 A;  3T90 A;  4B5P A;  1Z9U A;  2OZG A;  2RC4 A;  2FIW A;  4CGP A;  4CGO A;  4DNC A;  4CAX A;  1K4J A;  4KOV A;  4XNH C;  5AGE A;  5DWN A;  4M3S A;  2CXA A;  3S6G A;  4Q38 A;  5IB0 A;  4AVC A;  1S7K A;  1Q2Y A;  3F8K A;  2B3U A;  3SXN A;  1U6M A;  1RO5 A;  4CAW A;  4AVA A;  4KSF A;  1QST A;  4X5K A;  1NE9 A;  2NMT A;  4A95 A;  5EC4 A;  4KSA A;  1ON0 A;  3IGR A;  5ISV A;  1IID A;  3FYN A;  1MJB A;  1YX0 A;  2CY2 A;  3IWG A;  3FB3 A;  1NSL A;  4I49 A;  2VZZ A;  4R3K A;  3R96 A;  5AG4 A;  1Y9K A;  1WWZ A;  1MK4 A;  1Z4E A;  3DNS A;  4M85 A;  3R1K A;  4PSX A;  1PU9 A;  2YNE A;  4KOW A;  3BLN A;  4QUS A;  4OLL A;  4UFW A;  2FXF A;  3G8W A;  4U9Y A;  2DPT A;  4E8O A;  4JJX A;  4PV6 A;  2B5G B;  3EY5 A;  4H89 A;  4Y49 B;  2HQY A;  2CNM A;  1L0C A;  4K30 A;  2HUZ A;  3E0K A;  3H5Z A;  4CYP A;  3QAH A;  2ZW6 A;  4JLY A;  4PSW A;  1VHS A;  5C88 A;  3V8I A;  2JEV A;  3W91 A;  2G3A A;  5H84 A;  2B4B A;  3VWD A;  4XPK A;  4OAE A;  3NE7 A;  4UCN A;  2Z3O A;  4L89 A;  1N71 A;  2CNT A;  2FT0 A;  2H5M A;  4C7H A;  4ONU A;  4MI4 A;  2O28 A;  5HMN A;  4H6Z A;  2ZXV A;  4KVO E;  2R7H A;  1WK4 A;  3JUW A;  2R98 A;  3GY9 A;  4HNY B;  5J8F A;  2VBQ A;  4JXQ A;  3W6X A;  4QC6 A;  4B11 A;  2PC1 A;  2BSW A;  4MY0 A;  5E96 A;  4R87 A;  1S5K A;  4CGN A;  1I12 A;  4AB7 A;  2PSW A;  4PK3 A;  2J8R A;  5H86 A;  1OZP A;  1XE4 A;  4JXR A;  5GCN A;  2OU2 A;  2OZH A;  4C2X A;  1GHE A;  3EFA A;  1XF8 A;  3DSB A;  2Q7B A;  1YLE A;  4CGM A;  3EO4 A;  5JQ4 A;  1KUV A;  3T9Y A;  1I1D A;  3VWE A;  2PR8 A;  4L8A A;  4Y49 C;  4MFQ A;  4OAD A;  1QSN A;  2WSA A;  4XPL A;  1YK3 A;  2ZW4 A;  3R95 A;  1FY7 A;  2PRB A;  2Y0M A;  1S3Z A;  4CYN A;  1M4D A;  2EUI A;  3DDD A;  5J8C A;  3B8G A;  2P6G A;  1IIC A;  4FD4 A;  4KOX A;  4B12 A;  2BL1 A;  2WUU A;  1IYK A;  1Q2C A;  2Z3N A;  4CAF A;  3UY5 A;  4A33 A;  5BWA B;  1S7N A;  2Z11 A;  3D2P A;  3LOD A;  4U5Y A;  1NMT A;  1B87 A;  2ATR A;  2Z10 A;  4KZT A;  4HKF A;  4F0X A;  1QSR A;  5F49 A;  2B4D B;  1YRE A;  3ZJ0 A;  3BJ7 A;  2VI7 A;  2G0B A;  1QSO A;  1M4G A;  1CM0 A;  5G20 A;  2DPS A;  4E2A A;  2Q04 A;  2AE6 A;  4B5O A;  5IX3 A;  1SQH A;  2GE3 A;  4C68 A;  4UWI A;  3TOA A;  2AJ6 A;  1I21 A;  4IUS A;  2J8M A;  4QB9 A;  3FRM A;  4UWJ A;  5JPH A;  2EVN A;  1BO4 A;  1XMT A;  3I9S A;  4LUA A;  4UCP A;  1KZF A;  4BMH A;  4NEX A;  3DR8 A;  1V0C A;  3TFY A;  1M4I A;  1M1D A;  3N7Z A;  5G1Z A;  2JDC A;  2Z3M A;  4MY3 A;  1J4J A;  5C82 A;  3TTH A;  1Y7R A;  2Z0Z A;  1Q2D A;  2GAN A;  3TT2 A;  3KKW A;  4KOS A;  3S6F A;  4F0Y A;  3ZZI A;  3G3S A;  4RS2 A;  4ORF A;  3PP9 A;  2PDO A;  2Q0Y A;  1YVK A;  3IWE A;  4Q36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...