3PGPA

Crystal structure of pa4794 - gnat superfamily protein in complex with accoa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein PA4794
publication title Structural, functional, and inhibition studies of a Gcn5-related N-acetyltransferase (GNAT) superfamily protein PA4794: a new C-terminal lysine protein acetyltransferase from pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 44
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2010-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pgpA00
3V8IA 2FE7A 4FD7A 4JJXA 1XMTA 2OU2A 1Q2DA 1Z4EA 2RC4A 4NXYA 4R57A 5EBVA 1MK4A 3IWGA 5ISVA 1Y7RA 2R1IA 2P6GA 5IV0A 1Y9WA 2VBQA 3R9EA 3JVNA 1NSLA 1S3ZA 3R9GA 5F49A 2BSWA 1KUXA 1PUAA 1MJAA 1KUYA 2OH1A 3TO7A 4KVXA 2FXFA 4K30A 4AG9A 3TE4A 2Q04A 1Q2CA 4B5PA 1ON0A 4MJ8A 2C27A 1PU9A 4UWJA 3NE7A 2Z10A 4I49A 4E2AA 2EUIA 2REEA 3RYOA 3PGPA 5J8FA 2Y0MA 2B5GB 5CNPA 4PK3A 4U9ZA 2FL4A 2X7BA 4FD4A 4QC6A 4YGOA 2D4PA 2OZGA 4KUBA 4JLYA 2Q44A 1M1DA 4QVTA 4JWPA 2H5MA 4R3LA 1KZFA 4KLWA 4CAVA 5IX3A 2BUEA 2HV2A 1TIQA 2Q7BA 5DWNA 2PQ8A 2B4DB 2REFA 3EXNA 1S7KA 2G3AA 1S7FA 1VHSA 4RI1A 4DNCA 2FIAA 1MJBA 2PR1A 2OZHA 4IUSA 3QAHA 1QSTA 4NCZA 4IF5A 1YLEA 4LUAA 1QSMA 2QIRA 1IB1E 1SQHA 3G3SA 4AVAA 3GY9A 5F47A 2AJ6A 2Q4YA 3TCVA 4MY0A 4NF1A 3P2FA 3F5BA 5I0CA 4CAWA 2P0WA 3D3SA 4OADA 4BMHA 5KTAA 1P0HA 4AVBA 4R3KA 5DWMA 5F46A 1QSOA 1XF8A 3C26A 4MI4A 5F48A 2Q4VA 1CJWA 1GHEA 5C82A 3TO9A 2R7HA 4KORA 2WPXA 3W6SA 3DR8A 3GYAA 2JEVA 5KTCA 1N71A 3FNCA 2B3VA 1XE4A 2ARHA 4II9A 2PSWA 3S6KA 2HUZA 2VQYA 2JLMA 1YGHA 4FD5A 4AB7A 4KOSA 4UBRA 3W91A 2FSRA 1IYLA 4Y49C 2PC1A 1IIDA 2G0BA 4KOYA 2A4NA 5J8CA 4KVOE 4J3GA 2B58A 3PP9A 3TFYA 2Z0ZA 2R98A 2CNTA 3FB3A 4XPDB 1YK3A 5GCNA 2VI7A 3FIXA 3K9UA 1R57A 1V0CA 4NEXA 3FRMA 3SHPA 5E96A 4F6AA 3WR7A 4ZBGA 3DSBA 1B6BA 3TOAA 2JDCA 2DXQA 1I21A 2BEIA 4UA3A 3VWEA 4FD6A 4E8OA 2HQYA 2P6FA 3CXPA 3SXOA 4KVME 2VZYA 1QSRA 3G8WA 2PR8A 1K4JA 1Q2YA 4X5KA 1CM0A 4KLVA 2GE3A 3I3GA 2O28A 2J8MA 4XNHB 2Z11A 3OWCA 1J4JA 3T90A 1S60A 4YFJA 1XEBA 4E0AA 3SXNA 5KTDA 4CS0B 4M3SA 2FT0A 1S7NA 4QB9A 4MY3A 3I9SA 4LX9A 1LRZA 2B4BA 4HNWB 1B87A 4H89A 3R1KA 1I1DA 2I00A 2WPWA 2CNSA 4YRHA 1U6MA 5HMNA 1M4DA 4OLLA 4PSXA 4B5PB 4KZTA 1NE9A 4XPKA 2B5GA 3N7ZA 3D2PA 2VEZA 2NMTA 1I12A 4NSQA 1M44A 3BLNA 2B3UA 4R9MA 1Z4RA 1RO5A 3TT2A 4PK2A 4RS2A 3D2MA 2J8RA 3LD2A 3FYNA 3TOBA 1VKCA 4PV6A 3R9FA 3BJ8A 2P6EA 4KOXA 1Y9KA 1WK4A 2K5TA 4GS4A 1KUVA 4UWIA 3ZJ0A 5HH1A 2OZUA 3S6FA 4EVYA 2B4DA 2FCKA 3TTHA 3W6XA 1BO4A 3CXSA 3EY5A 4HKFA 4KOUA 1YX0A 4Y49B 2CY2A 3E0KA 2BL1A 4ORFA 1S7LA 4L89A 4HNYB 2CNMA 4JXQA 5FVJA 3B8GA 1YVKA 1BOBA 3PZJA 2QECA 4KOTA 2D4OA 4MBUA 3IGRA 2QMLA 3EC4A 4JXRA 4QBJA 3UY5A 2EVNA 5JQ4A 2ZXVA 1YREA 3DR6A 5H84A 4R87A 1FY7A 1YR0A 3T9YA 1MJ9A 2PRBA 4XPDC 2Q0YA 2VZZA 4U5YA 4B5OA 2AE6A 4KUAA 2KCWA 3D8PA 3EFAA 5H86A 3FBUA 3MGDA 4ONUA 4F0YA 3S6HA 3R96A 4AVCA 4H6ZA 1Z9UA 4CRYB 3F8KA 1QSNA 1S5KA 1NMTA 2G3TA 2IL4A 2ZW5A 3R95A 2R8VA 2PDOA 4CAXA 1IYKA 3P2HA 1OZPA 4JD6A 4PSWA 3KKWA 3QB8A 4OAEA 5C88A 5IB0A 2GANA 3VWDA 4KOWA 3S6GA 2ZW7A 4XNHC 3BJ7A 2ZPAA 3DNSA 1YVOA 1M4GA 4U9YA 2GIVA 5EC4A 2ZW6A 3ZZIA 3EO4A 2I79A 1XIXA 3CXQA 2FS5A 4HNXB 3DDDA 1M4IA 5JPHA 1WWZA 1RXTA 4KOVA 1IICA 1UFHA 4AG7A 3F0AA 2JDDA 4QUSA 2OB0A 2ZW4A 3LODA 2ATRA 2FIWA 4XPLA 4M85A 4L8AA 4MHDA 4H6UA 3TO6A 2VXKA 1P4NA 3H4QA 2J8NA 3FXTA 3JUWA 4CRZB 3GKRA 1L0CA 2F5IA
chains in the Genus database with same CATH superfamily
3V8IA 2FE7A 4FD7A 5I4MA 5HVGA 3ISXA 4OIWA 4JJXA 2PJ6A 3IO1A 3KZWA 4RUHA 1XMTA 1XOVA 3KHXA 2OU2A 1Q2DA 1ARMA 1Z4EA 1TKFA 2RC4A 4NXYA 2Z3LA 4LQ6A 4IAVA 4R57A 1MK4A 3FX6A 3IWGA 5EBVA 5ISVA 4M6GA 1Y7RA 2R1IA 2P6GA 4UCNA 5IV0A 1Y9WA 1EE3P 3SJXA 2VBQA 3ISZA 2ANPA 3IIBA 4OC5A 2CIJA 1IOIA 3R9EA 1ZG7A 2YNEA 1HEEA 4UFXA 3JVNA 4Z65A 5LYLA 1Z5RA 1PCAA 1NSLA 3PB9X 2J9AA 1S3ZA 2C6GA 1CP7A 5F49A 3R9GA 3K2KA 2BSWA 1KUXA 1PUAA 1MJAA 2Q7SA 2AFMA 2ZEMA 5AGEA 4DYOA 4A30A 5F09A 2RB7A 1KUYA 4A38A 1XRYA 1YW4A 2DPTA 1AUGA 2OH1A 4P4DA 4W9YA 3TO7A 2JEWA 3WC5A 4P4FA 3TX8A 3B3WA 4KVXA 3PFOA 3IU2A 3B3SA 2IJZA 4UF4A 1BLLE 2FXFA 4K30A 4RN7A 4C68A 2V8HA 2ZEOA 5AG7A 4MCQA 4AG9A 4B11A 3FF3A 3TE4A 1XMBA 1Q2CA 2Q04A 2IQ6A 4B5PA 1ON0A 2PJ2A 4FUUA 2Z3KA 4MJ8A 3D68A 2C27A 3KR4A 2ODFA 4MXUA 1PU9A 2Q4ZA 3NE7A 4UWJA 2Z10A 4I49A 4E2AA 2EUIA 2REEA 3RYOA 3PGPA 5J8FA 2PJAA 4NGPA 4CGMA 4UCPA 2JBJA 2Y0MA 4X2TA 2B5GB 4M6IA 5CNPA 4PK3A 5ELYA 3NH8A 4U9ZA 1VGYA 2FL4A 2X7BA 2DPSA 4FD4A 2PJ0A 4QC6A 4YGOA 1Y0RA 2D4PA 2OZGA 4KUBA 4JLYA 2Q44A 1M1DA 3SI2A 3CZXA 4MHZA 4QVTA 4JWPA 2H5MA 4R3LA 1KZFA 4KLWA 3FEDA 3QNVA 4ZI6A 3PB7X 4A95A 4CAVA 3D7GA 5IX3A 5J1QA 4BD9A 4IHMA 1Y7EA 2BUEA 1IGBA 1L0CA 3B7IA 3KQZA 4NGSA 3WC7A 4ZGYB 4O23A 1A2ZA 2HV2A 1TIQA 2Q7BA 4MHPA 5DWNA 1YQEA 2QJ8A 4BBHA 1X12A 2PQ8A 2B4DB 2REFA 3D7FA 3EXNA 1S7KA 2G3AA 4P4JA 5K8MA 1S7FA 1VHSA 2PIZA 1F2PA 2VL1A 3B2YA 2PVWA 4RI1A 2CXAA 4DNCA 4CGNA 2FIAA 3RNZA 3LMSA 3MRUA 4UFWA 1MJBA 1UWYA 4GXHA 1CPXA 2PR1A 4KS9A 3FJUA 6CPAA 1HDUA 2OZHA 4MFKA 4JZ0A 3BI0A 4WJBA 5CPAA 4UEEA 4IUSA 3QAHA 1QSTA 1AYEA 4NCZA 4IF5A 3RBUA 4NGRA 1YLEA 4LUAA 1QSMA 1H8LA 2QIRA 2Z3PA 2CTCA 1IB1E 5AG5A 1SQHA 4ZY0A 3G3SA 3H8GA 4AVAA 3GY9A 3VARA 5F47A 2AJ6A 3SJGA 4NGQA 2Q4YA 4EMEA 3TCVA 4MY0A 4NF1A 4NJQA 4KSFA 3P2FA 1VIXA 3F5BA 5I0CA 2FVGA 4R6TA 4CAWA 3FVLA 4GM5A 4MCPA 1HDQA 4MHNA 2P0WA 3D3SA 4OADA 4BMHA 3PFEA 5KTAA 1P0HA 2V8DA 2Q43A 4R3KA 5DWMA 4AVBA 3S9LA 3DLJA 5F46A 1QSOA 1XF8A 3C26A 1CPSA 4MI4A 5F48A 2Q4VA 1JWQA 1CJWA 2Z3NA 1GHEA 5K8PA 4HPSA 5C82A 4A94A 2O53A 3TO9A 2R7HA 4KORA 2WPXA 3W6SA 4F8ZA 3DR8A 4OIDA 2YGWA 3GYAA 1TF8A 2JEVA 2ZEFA 5KTCA 1N71A 2C6CA 4A33A 4B6ZA 3D66A 3FNCA 2B3VA 1XE4A 1Z8LA 2ARHA 2PSWA 3S6KA 4II9A 2NYQA 4DJLA 2HUZA 4BINA 4CPAA 2VQYA 5HXDA 2JLMA 1YGHA 4FD5A 1BAVA 4AB7A 4KOSA 4UBRA 3W91A 2WUUA 2FSRA 1IYLA 1JQGA 1LOKA 3T8WA 4NFRA 4UEFA 2ZELA 3PBBA 2PJ4A 4MFJA 4Y49C 3S9MA 2PC1A 4C7IA 4PQAA 1IIDA 2G0BA 4R7MA 4KOYA 2A4NA 3KR5A 3MN8A 5J8CA 2C6PA 4OC1A 5JM6A 3CDXA 4KVOE 3GB0A 3I1UA 4OC0A 3S9NA 3D67A 4J3GA 3VATA 2B58A 1LAPA 3A9LA 4LQGA 1GYTA 1IU8A 3NH4A 3PP9A 2PJ9A 2Z0ZA 4ZX9A 3TFYA 4TWEA 3L2NA 2R98A 2CNTA 5BWAB 2HB6A 3FB3A 4XPDB 2AFOA 1YK3A 3B35A 3DGVA 5GCNA 2VI7A 3FIXA 1CX8A 3K9UA 5D29A 2ZOGA 4A32A 1R57A 1V0CA 4NEXA 3H5ZA 2F7VA 3FRMA 2PJ1A 3N5FA 5E96A 3SHPA 4B13A 1ELLP 4KSAA 2CF4A 2WSAA 2WYRA 4F6AA 3PB6X 8CPAA 3WR7A 4ZBGA 2O4HA 3DSBA 1B6BA 3TOAA 1ARLA 2JDCA 3KHZA 2DXQA 1I21A 2BEIA 4CGLA 4UA3A 1YW6A 3VWEA 1DE4C 4OC4A 4FD6A 4E8OA 7CPAA 2HQYA 2P6FA 3CXPA 3VH9A 3SXOA 4KVME 3GLJA 2VZYA 4CYQA 1QSRA 4PXCA 3FECA 4F0XA 1R43A 1RTQA 4JYWA 4FWUA 2QVPA 5IB9A 4YWYA 3G8WA 5LRJA 2PR8A 4C7HA 1K4JA 4CYPA 1Q2YA 4K3NA 1QQ9A 2YNDA 4X5KA 4AXVA 4OMEA 2AFSA 2AFXA 1CM0A 4KLVA 2GE3A 2QYVA 2PRQA 5LYFA 3I3GA 3JTKA 2O28A 1TKJA 2J8MA 4XNHB 1ZLHA 2Z11A 3OWCA 1J4JA 4G1PA 1IOFA 4FAIA 3T90A 3B3CA 1S60A 1ZG9A 5DS0A 4YFJA 4Q7AA 1M4LA 5G21A 3B3VA 1XEBA 5HVFA 4R76A 3KI9A 3PB4X 4E0AA 2PJBA 3SXNA 3IWWA 5KTDA 4Q38A 4CS0B 4M3SA 2FT0A 1S7NA 4R8FA 4NGNA 2GLJA 4QB9A 4MY3A 4TNUA 3I9SA 4LX9A 1LRZA 1CBXA 1LFWA 2B4BA 5THWA 4HNWB 1B87A 4H89A 1I1DA 3R1KA 2POKA 2I00A 2WPWA 5K8OA 2CNSA 2PJ5A 4YRHA 1U6MA 3PRTA 5HMNA 1M4DA 4OLLA 3NA6A 4PSXA 4NGMA 4B5PB 1VHEA 4KZTA 1NE9A 3GUXA 2XEJA 2Z3OA 3H8FA 4XPKA 2B5GA 2ZEDA 2ZEEA 3N7ZA 3D2PA 2V8VA 5CBMA 2VEZA 4C2ZA 2PVVA 2NMTA 1I12A 5LYIA 1LANA 4NSQA 1M44A 3BLNA 2GFQA 1YMEA 2B3UA 4PXDA 2PIYA 3LWUA 1Z8XA 5K8NA 4R9MA 1Z4RA 3CPAA 1RO5A 3TT2A 4PK2A 4RS2A 3D2MA 2J8RA 3LD2A 1R3NA 4P45A 3FYNA 4MCSA 4B10A 4MFQA 4PXEA 1VKCA 4P10A 3HLPA 3TOBA 4PV6A 2GU2A 3R9FA 4B12A 4MFPA 3IU1A 3BJ8A 2P6EA 4KOXA 4PXBA 2OOTA 1AMPA 1Y9KA 2Z3MA 1WK4A 2K5TA 3LACA 4GS4A 4UIAA 4YU9A 1KUVA 4UWIA 3ZJ0A 1ZO0A 5HH1A 3IFEA 4EWTA 2ZENA 2XEIA 4CGOA 2OZUA 1ZG8A 2AFUA 3IEHA 3S6FA 4EVYA 2B4DA 2PE3A 3H8EA 2FCKA 4UIBA 3TTHA 3W6XA 4P44A 1BO4A 1YSJA 3CXSA 3KGQA 3SJEA 3EY5A 2EO8A 4HKFA 1YX0A 4KOUA 4Y49B 3SI1A 2CY2A 1DTDA 3E0KA 3JRUA 2BL1A 2RFHA 4KSIA 4OKOA 4ORFA 2PJ7A 3BI1A 3D4UA 1YLOA 1ELMP 1S7LA 4ONWA 4L89A 1BPMA 1XJOA 1Z8TA 3HUVA 4HNYB 2CNMA 3SJFA 4ZYQA 2CTBA 4JXQA 4CYOA 4FBEA 5FVJA 2ZEPA 3B8GA 1YVKA 3V7ZA 1BOBA 1XFOA 3PZJA 4P6YA 2QECA 4ZY2A 5HVHA 4MHYA 4KOTA 3IJ3A 5AG4A 2D4OA 3WABA 1FT7A 4MBUA 4CAEA 5EMIA 2HC9A 3IGRA 2QMLA 4OC3A 2F8HA 3EC4A 4JXRA 4QBJA 3UY5A 2EVNA 4M6HA 4NGTA 5JQ4A 1PYTB 2OR4A 2ZXVA 1ZLIA 1YREA 3DR6A 5G20A 4R87A 5H84A 3NH5A 1FY7A 4ZY1A 1YR0A 3T9YA 2BOAA 4UEZA 1MJ9A 5LYDA 2PRBA 1F2OA 4XPDC 2PCUA 1Q7LA 3RZAA 4A37A 4WWVA 1FNOA 2Q0YA 2VZZA 5AG6A 4U5YA 4B5OA 2AE6A 2ZEHA 3QAYA 4KUAA 2YNCC 2KCWA 3FEEA 4P4EA 5G1ZA 4EFDA 1TF9A 3D8PA 3D7HA 3EFAA 5H86A 2GLFA 3FBUA 2XEGA 5JH9A 3MGDA 1KWMA 4ONUA 4C2YA 4CGPA 5LRKA 4F0YA 3KQXA 3RAMA 3S6HA 2ABZA 1OBRA 3NE8A 3R96A 3V38A 4AVCA 4UCMA 4H6ZA 4F9VA 2C1CA 1Z9UA 4CRYB 2DEAA 3F8KA 4A39A 4UFVA 2AFWA 1QSNA 4H2KA 1CP6A 5A27A 1S5KA 2AFZA 1NMTA 2G3TA 5G22A 1X10A 4ZX8A 2EWBA 4PPZA 5LRGA 2IL4A 2ZW5A 3R95A 1Z2LA 2ZOFA 4P4BA 2WZNA 3SI0A 2R8VA 2PDOA 3D7DA 3KL9A 1IYKA 1LCPA 3P2HA 4B14A 1OZPA 3PBEA 4CAXA 2PJ3A 1QMUA 4JD6A 4PSWA 3KKWA 3IWEA 3QB8A 2G9DA 3B3TA 4OAEA 4C2XA 5C88A 5IB0A 2GANA 3CT9A 3IC1A 3VWDA 4KOWA 4DUKA 3S6GA 1VHOA 2BCOA 2GREA 2ZW7A 4X3RA 3FH4A 1BPNA 4XNHC 3BJ7A 3PEIA 2ZPAA 4NJRA 2V8GA 4IK2A 3DNSA 1YVOA 5D8NA 1M4GA 4OP4A 4U9YA 2GIVA 2EBJA 3CPXA 3KASA 2ZW6A 5EC4A 3ZZIA 4CAFA 3EO4A 1Y0YA 2I79A 2NSMA 1XIXA 3NFZA 4MFLA 1IY7A 3CXQA 2FS5A 4MRIA 1Z8WA 3WT4A 4HNXB 2EK9A 2YNCA 3BXMA 4P4IA 5JGFA 3RO0A 1NSAA 4MCRA 1F57A 2BO9A 3DDDA 4MMOA 3TC8A 2PJCA 2ZEGA 1M4IA 1XBUA 1WWZA 4F9UA 5JPHA 1CG2A 2XEFA 1TXRA 3BHXA 1RXTA 2Q51A 4KOVA 4OC2A 4A31A 1IICA 1UFHA 1TKHA 4X8IA 3WC6A 2JDDA 3F0AA 1LAMA 4AG7A 3FMCA 4QUSA 2DF5A 2OB0A 2IMOA 2ZW4A 2JBKA 3LODA 2ATRA 2FIWA 4XPLA 2V77A 4L8AA 4M85A 4MHDA 4H6UA 3TO6A 2VXKA 3GIUA 1P4NA 4Q36A 3H4QA 4A2ZA 2J8NA 2PJ8A 4CYNA 3PB8X 3FXTA 3JUWA 4MFZA 4CRZB 3K9TA 3GKRA 2I3CA 5A28A 2EK8A 2F5IA
chains in the Genus database with same CATH topology
3V8IA 2FE7A 4FD7A 4JJXA 1XMTA 2OU2A 1Q2DA 1Z4EA 2RC4A 4NXYA 2Z3LA 4R57A 5EBVA 1MK4A 3IWGA 5ISVA 1Y7RA 2R1IA 2P6GA 4UCNA 5IV0A 1Y9WA 2VBQA 3R9EA 2YNEA 4UFXA 3JVNA 1NSLA 1S3ZA 3R9GA 5F49A 2BSWA 1KUXA 1PUAA 1MJAA 5AGEA 4A30A 1KUYA 2DPTA 2OH1A 3TO7A 4KVXA 3IU2A 4C68A 2FXFA 4K30A 4AG9A 5AG7A 4B11A 3TE4A 2Q04A 1Q2CA 4B5PA 1ON0A 2Z3KA 4MJ8A 2C27A 1PU9A 4UWJA 3NE7A 2Z10A 4I49A 4E2AA 2EUIA 2REEA 3RYOA 3PGPA 5J8FA 4CGMA 4UCPA 2Y0MA 2B5GB 5CNPA 4PK3A 4U9ZA 2FL4A 2X7BA 2DPSA 4FD4A 4QC6A 4YGOA 2D4PA 2OZGA 4KUBA 4JLYA 2Q44A 1M1DA 4QVTA 4JWPA 2H5MA 4R3LA 1KZFA 4KLWA 4A95A 4CAVA 5IX3A 2BUEA 4ZGYB 2HV2A 1TIQA 2Q7BA 5DWNA 4BBHA 2PQ8A 2B4DB 2REFA 3EXNA 1S7KA 2G3AA 1S7FA 1VHSA 4RI1A 2CXAA 4DNCA 4CGNA 2FIAA 4UFWA 1MJBA 2PR1A 4KS9A 2OZHA 4MFKA 4IUSA 3QAHA 1QSTA 4NCZA 4IF5A 1YLEA 4LUAA 1QSMA 2QIRA 5AG5A 2Z3PA 1IB1E 1SQHA 3G3SA 4AVAA 3GY9A 5F47A 2AJ6A 2Q4YA 3TCVA 4MY0A 4NF1A 4KSFA 3P2FA 3F5BA 5I0CA 4CAWA 2P0WA 3D3SA 4OADA 4BMHA 5KTAA 1P0HA 4AVBA 4R3KA 5DWMA 5F46A 1QSOA 1XF8A 3C26A 4MI4A 5F48A 2Q4VA 1CJWA 2Z3NA 1GHEA 5C82A 3TO9A 2R7HA 4KORA 2WPXA 3W6SA 3DR8A 2YGWA 3GYAA 2JEVA 5KTCA 1N71A 4A33A 3FNCA 2B3VA 1XE4A 2ARHA 4II9A 2PSWA 3S6KA 2HUZA 2VQYA 2JLMA 1YGHA 4FD5A 4AB7A 4KOSA 4UBRA 3W91A 2WUUA 2FSRA 1IYLA 4B12A 4C2XA 4Y49C 4MFJA 2PC1A 4C7IA 1IIDA 2G0BA 4KOYA 2A4NA 5J8CA 4KVOE 4J3GA 2B58A 3A9LA 3PP9A 3TFYA 2Z0ZA 2R98A 2CNTA 5BWAB 3FB3A 4XPDB 1YK3A 5GCNA 2VI7A 3FIXA 3K9UA 4A32A 1R57A 1V0CA 4NEXA 3H5ZA 3FRMA 3SHPA 5E96A 4B13A 4KSAA 2WSAA 4F6AA 3WR7A 4ZBGA 3DSBA 1B6BA 3TOAA 2JDCA 2DXQA 1I21A 2BEIA 4CGLA 4UA3A 3VWEA 4FD6A 4E8OA 2HQYA 2P6FA 3CXPA 3SXOA 4KVME 2VZYA 4CYQA 1QSRA 4F0XA 3G8WA 2PR8A 4C7HA 1K4JA 4CYPA 1Q2YA 2YNDA 4X5KA 1CM0A 4KLVA 2GE3A 3I3GA 3JTKA 2O28A 2J8MA 4XNHB 2Z11A 3OWCA 1J4JA 3T90A 1S60A 4YFJA 5G21A 1XEBA 4E0AA 3SXNA 5KTDA 4Q38A 4CS0B 4M3SA 2FT0A 1S7NA 4QB9A 4MY3A 3I9SA 4LX9A 1LRZA 2B4BA 4HNWB 1B87A 4H89A 3R1KA 1I1DA 2I00A 2WPWA 2CNSA 4YRHA 1U6MA 5HMNA 1M4DA 4OLLA 4PSXA 4B5PB 4KZTA 1NE9A 4XPKA 2Z3OA 2B5GA 3N7ZA 3D2PA 2VEZA 4C2ZA 2NMTA 1I12A 4NSQA 1M44A 3BLNA 2B3UA 4R9MA 1Z4RA 1RO5A 3TT2A 4PK2A 4RS2A 3D2MA 2J8RA 3LD2A 3FYNA 4B10A 4MFQA 3TOBA 1VKCA 4PV6A 3R9FA 4MFPA 3IU1A 3BJ8A 2P6EA 4KOXA 1Y9KA 2Z3MA 1WK4A 2K5TA 4GS4A 1KUVA 4UWIA 3ZJ0A 1ZO0A 5HH1A 4CGOA 2OZUA 3S6FA 4EVYA 2B4DA 2FCKA 3TTHA 3W6XA 1BO4A 3CXSA 3EY5A 4HKFA 4KOUA 1YX0A 4Y49B 2CY2A 3E0KA 2BL1A 4ORFA 1S7LA 4L89A 4HNYB 2CNMA 4JXQA 4CYOA 5FVJA 3B8GA 1YVKA 1BOBA 3PZJA 2QECA 4KOTA 5AG4A 2D4OA 4MBUA 4CAEA 3IGRA 2QMLA 3EC4A 4JXRA 4QBJA 3UY5A 2EVNA 5JQ4A 2ZXVA 1YREA 3DR6A 5G20A 4R87A 5H84A 1FY7A 1YR0A 3T9YA 1MJ9A 2PRBA 4XPDC 4A31A 5AG6A 2Q0YA 2VZZA 4U5YA 4B5OA 2AE6A 4KUAA 2YNCC 2KCWA 5G1ZA 3D8PA 3EFAA 5H86A 3FBUA 3MGDA 4ONUA 4C2YA 4CGPA 4F0YA 3S6HA 3R96A 4AVCA 4UCMA 4H6ZA 1Z9UA 4CRYB 3F8KA 4UFVA 1QSNA 5A27A 1S5KA 1NMTA 2G3TA 5G22A 2IL4A 2ZW5A 3R95A 2R8VA 2PDOA 4CAXA 1IYKA 3P2HA 4B14A 1OZPA 4JD6A 4PSWA 3KKWA 3IWEA 3QB8A 4OAEA 5C88A 5IB0A 2GANA 3VWDA 4KOWA 3S6GA 2ZW7A 4XNHC 3BJ7A 2ZPAA 3DNSA 1YVOA 1M4GA 4U9YA 2GIVA 5EC4A 2ZW6A 3ZZIA 4CAFA 3EO4A 2I79A 1XIXA 4MFLA 3CXQA 2FS5A 4HNXB 2YNCA 3DDDA 1M4IA 5JPHA 1WWZA 1RXTA 4KOVA 1IICA 1UFHA 4AG7A 3F0AA 2JDDA 4QUSA 2OB0A 2ZW4A 3LODA 2ATRA 2FIWA 4XPLA 4M85A 4L8AA 4MHDA 4H6UA 3TO6A 2VXKA 1P4NA 4Q36A 3H4QA 4A2ZA 2J8NA 4CYNA 3FXTA 3JUWA 4MFZA 4CRZB 3GKRA 1L0CA 5A28A 2F5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8I A;  2FE7 A;  4FD7 A;  4JJX A;  1XMT A;  2OU2 A;  1Q2D A;  1Z4E A;  2RC4 A;  4NXY A;  4R57 A;  5EBV A;  1MK4 A;  3IWG A;  5ISV A;  1Y7R A;  2R1I A;  2P6G A;  5IV0 A;  1Y9W A;  2VBQ A;  3R9E A;  3JVN A;  1NSL A;  1S3Z A;  3R9G A;  5F49 A;  2BSW A;  1KUX A;  1PUA A;  1MJA A;  1KUY A;  2OH1 A;  3TO7 A;  4KVX A;  2FXF A;  4K30 A;  4AG9 A;  3TE4 A;  2Q04 A;  1Q2C A;  4B5P A;  1ON0 A;  4MJ8 A;  2C27 A;  1PU9 A;  4UWJ A;  3NE7 A;  2Z10 A;  4I49 A;  4E2A A;  2EUI A;  2REE A;  3RYO A;  3PGP A;  5J8F A;  2Y0M A;  2B5G B;  5CNP A;  4PK3 A;  4U9Z A;  2FL4 A;  2X7B A;  4FD4 A;  4QC6 A;  4YGO A;  2D4P A;  2OZG A;  4KUB A;  4JLY A;  2Q44 A;  1M1D A;  4QVT A;  4JWP A;  2H5M A;  4R3L A;  1KZF A;  4KLW A;  4CAV A;  5IX3 A;  2BUE A;  2HV2 A;  1TIQ A;  2Q7B A;  5DWN A;  2PQ8 A;  2B4D B;  2REF A;  3EXN A;  1S7K A;  2G3A A;  1S7F A;  1VHS A;  4RI1 A;  4DNC A;  2FIA A;  1MJB A;  2PR1 A;  2OZH A;  4IUS A;  3QAH A;  1QST A;  4NCZ A;  4IF5 A;  1YLE A;  4LUA A;  1QSM A;  2QIR A;  1IB1 E;  1SQH A;  3G3S A;  4AVA A;  3GY9 A;  5F47 A;  2AJ6 A;  2Q4Y A;  3TCV A;  4MY0 A;  4NF1 A;  3P2F A;  3F5B A;  5I0C A;  4CAW A;  2P0W A;  3D3S A;  4OAD A;  4BMH A;  5KTA A;  1P0H A;  4AVB A;  4R3K A;  5DWM A;  5F46 A;  1QSO A;  1XF8 A;  3C26 A;  4MI4 A;  5F48 A;  2Q4V A;  1CJW A;  1GHE A;  5C82 A;  3TO9 A;  2R7H A;  4KOR A;  2WPX A;  3W6S A;  3DR8 A;  3GYA A;  2JEV A;  5KTC A;  1N71 A;  3FNC A;  2B3V A;  1XE4 A;  2ARH A;  4II9 A;  2PSW A;  3S6K A;  2HUZ A;  2VQY A;  2JLM A;  1YGH A;  4FD5 A;  4AB7 A;  4KOS A;  4UBR A;  3W91 A;  2FSR A;  1IYL A;  4Y49 C;  2PC1 A;  1IID A;  2G0B A;  4KOY A;  2A4N A;  5J8C A;  4KVO E;  4J3G A;  2B58 A;  3PP9 A;  3TFY A;  2Z0Z A;  2R98 A;  2CNT A;  3FB3 A;  4XPD B;  1YK3 A;  5GCN A;  2VI7 A;  3FIX A;  3K9U A;  1R57 A;  1V0C A;  4NEX A;  3FRM A;  3SHP A;  5E96 A;  4F6A A;  3WR7 A;  4ZBG A;  3DSB A;  1B6B A;  3TOA A;  2JDC A;  2DXQ A;  1I21 A;  2BEI A;  4UA3 A;  3VWE A;  4FD6 A;  4E8O A;  2HQY A;  2P6F A;  3CXP A;  3SXO A;  4KVM E;  2VZY A;  1QSR A;  3G8W A;  2PR8 A;  1K4J A;  1Q2Y A;  4X5K A;  1CM0 A;  4KLV A;  2GE3 A;  3I3G A;  2O28 A;  2J8M A;  4XNH B;  2Z11 A;  3OWC A;  1J4J A;  3T90 A;  1S60 A;  4YFJ A;  1XEB A;  4E0A A;  3SXN A;  5KTD A;  4CS0 B;  4M3S A;  2FT0 A;  1S7N A;  4QB9 A;  4MY3 A;  3I9S A;  4LX9 A;  1LRZ A;  2B4B A;  4HNW B;  1B87 A;  4H89 A;  3R1K A;  1I1D A;  2I00 A;  2WPW A;  2CNS A;  4YRH A;  1U6M A;  5HMN A;  1M4D A;  4OLL A;  4PSX A;  4B5P B;  4KZT A;  1NE9 A;  4XPK A;  2B5G A;  3N7Z A;  3D2P A;  2VEZ A;  2NMT A;  1I12 A;  4NSQ A;  1M44 A;  3BLN A;  2B3U A;  4R9M A;  1Z4R A;  1RO5 A;  3TT2 A;  4PK2 A;  4RS2 A;  3D2M A;  2J8R A;  3LD2 A;  3FYN A;  3TOB A;  1VKC A;  4PV6 A;  3R9F A;  3BJ8 A;  2P6E A;  4KOX A;  1Y9K A;  1WK4 A;  2K5T A;  4GS4 A;  1KUV A;  4UWI A;  3ZJ0 A;  5HH1 A;  2OZU A;  3S6F A;  4EVY A;  2B4D A;  2FCK A;  3TTH A;  3W6X A;  1BO4 A;  3CXS A;  3EY5 A;  4HKF A;  4KOU A;  1YX0 A;  4Y49 B;  2CY2 A;  3E0K A;  2BL1 A;  4ORF A;  1S7L A;  4L89 A;  4HNY B;  2CNM A;  4JXQ A;  5FVJ A;  3B8G A;  1YVK A;  1BOB A;  3PZJ A;  2QEC A;  4KOT A;  2D4O A;  4MBU A;  3IGR A;  2QML A;  3EC4 A;  4JXR A;  4QBJ A;  3UY5 A;  2EVN A;  5JQ4 A;  2ZXV A;  1YRE A;  3DR6 A;  5H84 A;  4R87 A;  1FY7 A;  1YR0 A;  3T9Y A;  1MJ9 A;  2PRB A;  4XPD C;  2Q0Y A;  2VZZ A;  4U5Y A;  4B5O A;  2AE6 A;  4KUA A;  2KCW A;  3D8P A;  3EFA A;  5H86 A;  3FBU A;  3MGD A;  4ONU A;  4F0Y A;  3S6H A;  3R96 A;  4AVC A;  4H6Z A;  1Z9U A;  4CRY B;  3F8K A;  1QSN A;  1S5K A;  1NMT A;  2G3T A;  2IL4 A;  2ZW5 A;  3R95 A;  2R8V A;  2PDO A;  4CAX A;  1IYK A;  3P2H A;  1OZP A;  4JD6 A;  4PSW A;  3KKW A;  3QB8 A;  4OAE A;  5C88 A;  5IB0 A;  2GAN A;  3VWD A;  4KOW A;  3S6G A;  2ZW7 A;  4XNH C;  3BJ7 A;  2ZPA A;  3DNS A;  1YVO A;  1M4G A;  4U9Y A;  2GIV A;  5EC4 A;  2ZW6 A;  3ZZI A;  3EO4 A;  2I79 A;  1XIX A;  3CXQ A;  2FS5 A;  4HNX B;  3DDD A;  1M4I A;  5JPH A;  1WWZ A;  1RXT A;  4KOV A;  1IIC A;  1UFH A;  4AG7 A;  3F0A A;  2JDD A;  4QUS A;  2OB0 A;  2ZW4 A;  3LOD A;  2ATR A;  2FIW A;  4XPL A;  4M85 A;  4L8A A;  4MHD A;  4H6U A;  3TO6 A;  2VXK A;  1P4N A;  3H4Q A;  2J8N A;  3FXT A;  3JUW A;  4CRZ B;  3GKR A;  1L0C A;  2F5I A; 
#chains in the Genus database with same CATH topology
 3V8I A;  2FE7 A;  4FD7 A;  5I4M A;  5HVG A;  3ISX A;  4OIW A;  4JJX A;  2PJ6 A;  3IO1 A;  3KZW A;  4RUH A;  1XMT A;  1XOV A;  3KHX A;  2OU2 A;  1Q2D A;  1ARM A;  1Z4E A;  1TKF A;  2RC4 A;  4NXY A;  2Z3L A;  4LQ6 A;  4IAV A;  4R57 A;  1MK4 A;  3FX6 A;  3IWG A;  5EBV A;  5ISV A;  4M6G A;  1Y7R A;  2R1I A;  2P6G A;  4UCN A;  5IV0 A;  1Y9W A;  1EE3 P;  3SJX A;  2VBQ A;  3ISZ A;  2ANP A;  3IIB A;  4OC5 A;  2CIJ A;  1IOI A;  3R9E A;  1ZG7 A;  2YNE A;  1HEE A;  4UFX A;  3JVN A;  4Z65 A;  5LYL A;  1Z5R A;  1PCA A;  1NSL A;  3PB9 X;  2J9A A;  1S3Z A;  2C6G A;  1CP7 A;  5F49 A;  3R9G A;  3K2K A;  2BSW A;  1KUX A;  1PUA A;  1MJA A;  2Q7S A;  2AFM A;  2ZEM A;  5AGE A;  4DYO A;  4A30 A;  5F09 A;  2RB7 A;  1KUY A;  4A38 A;  1XRY A;  1YW4 A;  2DPT A;  1AUG A;  2OH1 A;  4P4D A;  4W9Y A;  3TO7 A;  2JEW A;  3WC5 A;  4P4F A;  3TX8 A;  3B3W A;  4KVX A;  3PFO A;  3IU2 A;  3B3S A;  2IJZ A;  4UF4 A;  1BLL E;  2FXF A;  4K30 A;  4RN7 A;  4C68 A;  2V8H A;  2ZEO A;  5AG7 A;  4MCQ A;  4AG9 A;  4B11 A;  3FF3 A;  3TE4 A;  1XMB A;  1Q2C A;  2Q04 A;  2IQ6 A;  4B5P A;  1ON0 A;  2PJ2 A;  4FUU A;  2Z3K A;  4MJ8 A;  3D68 A;  2C27 A;  3KR4 A;  2ODF A;  4MXU A;  1PU9 A;  2Q4Z A;  3NE7 A;  4UWJ A;  2Z10 A;  4I49 A;  4E2A A;  2EUI A;  2REE A;  3RYO A;  3PGP A;  5J8F A;  2PJA A;  4NGP A;  4CGM A;  4UCP A;  2JBJ A;  2Y0M A;  4X2T A;  2B5G B;  4M6I A;  5CNP A;  4PK3 A;  5ELY A;  3NH8 A;  4U9Z A;  1VGY A;  2FL4 A;  2X7B A;  2DPS A;  4FD4 A;  2PJ0 A;  4QC6 A;  4YGO A;  1Y0R A;  2D4P A;  2OZG A;  4KUB A;  4JLY A;  2Q44 A;  1M1D A;  3SI2 A;  3CZX A;  4MHZ A;  4QVT A;  4JWP A;  2H5M A;  4R3L A;  1KZF A;  4KLW A;  3FED A;  3QNV A;  4ZI6 A;  3PB7 X;  4A95 A;  4CAV A;  3D7G A;  5IX3 A;  5J1Q A;  4BD9 A;  4IHM A;  1Y7E A;  2BUE A;  1IGB A;  1L0C A;  3B7I A;  3KQZ A;  4NGS A;  3WC7 A;  4ZGY B;  4O23 A;  1A2Z A;  2HV2 A;  1TIQ A;  2Q7B A;  4MHP A;  5DWN A;  1YQE A;  2QJ8 A;  4BBH A;  1X12 A;  2PQ8 A;  2B4D B;  2REF A;  3D7F A;  3EXN A;  1S7K A;  2G3A A;  4P4J A;  5K8M A;  1S7F A;  1VHS A;  2PIZ A;  1F2P A;  2VL1 A;  3B2Y A;  2PVW A;  4RI1 A;  2CXA A;  4DNC A;  4CGN A;  2FIA A;  3RNZ A;  3LMS A;  3MRU A;  4UFW A;  1MJB A;  1UWY A;  4GXH A;  1CPX A;  2PR1 A;  4KS9 A;  3FJU A;  6CPA A;  1HDU A;  2OZH A;  4MFK A;  4JZ0 A;  3BI0 A;  4WJB A;  5CPA A;  4UEE A;  4IUS A;  3QAH A;  1QST A;  1AYE A;  4NCZ A;  4IF5 A;  3RBU A;  4NGR A;  1YLE A;  4LUA A;  1QSM A;  1H8L A;  2QIR A;  2Z3P A;  2CTC A;  1IB1 E;  5AG5 A;  1SQH A;  4ZY0 A;  3G3S A;  3H8G A;  4AVA A;  3GY9 A;  3VAR A;  5F47 A;  2AJ6 A;  3SJG A;  4NGQ A;  2Q4Y A;  4EME A;  3TCV A;  4MY0 A;  4NF1 A;  4NJQ A;  4KSF A;  3P2F A;  1VIX A;  3F5B A;  5I0C A;  2FVG A;  4R6T A;  4CAW A;  3FVL A;  4GM5 A;  4MCP A;  1HDQ A;  4MHN A;  2P0W A;  3D3S A;  4OAD A;  4BMH A;  3PFE A;  5KTA A;  1P0H A;  2V8D A;  2Q43 A;  4R3K A;  5DWM A;  4AVB A;  3S9L A;  3DLJ A;  5F46 A;  1QSO A;  1XF8 A;  3C26 A;  1CPS A;  4MI4 A;  5F48 A;  2Q4V A;  1JWQ A;  1CJW A;  2Z3N A;  1GHE A;  5K8P A;  4HPS A;  5C82 A;  4A94 A;  2O53 A;  3TO9 A;  2R7H A;  4KOR A;  2WPX A;  3W6S A;  4F8Z A;  3DR8 A;  4OID A;  2YGW A;  3GYA A;  1TF8 A;  2JEV A;  2ZEF A;  5KTC A;  1N71 A;  2C6C A;  4A33 A;  4B6Z A;  3D66 A;  3FNC A;  2B3V A;  1XE4 A;  1Z8L A;  2ARH A;  2PSW A;  3S6K A;  4II9 A;  2NYQ A;  4DJL A;  2HUZ A;  4BIN A;  4CPA A;  2VQY A;  5HXD A;  2JLM A;  1YGH A;  4FD5 A;  1BAV A;  4AB7 A;  4KOS A;  4UBR A;  3W91 A;  2WUU A;  2FSR A;  1IYL A;  1JQG A;  1LOK A;  3T8W A;  4NFR A;  4UEF A;  2ZEL A;  3PBB A;  2PJ4 A;  4MFJ A;  4Y49 C;  3S9M A;  2PC1 A;  4C7I A;  4PQA A;  1IID A;  2G0B A;  4R7M A;  4KOY A;  2A4N A;  3KR5 A;  3MN8 A;  5J8C A;  2C6P A;  4OC1 A;  5JM6 A;  3CDX A;  4KVO E;  3GB0 A;  3I1U A;  4OC0 A;  3S9N A;  3D67 A;  4J3G A;  3VAT A;  2B58 A;  1LAP A;  3A9L A;  4LQG A;  1GYT A;  1IU8 A;  3NH4 A;  3PP9 A;  2PJ9 A;  2Z0Z A;  4ZX9 A;  3TFY A;  4TWE A;  3L2N A;  2R98 A;  2CNT A;  5BWA B;  2HB6 A;  3FB3 A;  4XPD B;  2AFO A;  1YK3 A;  3B35 A;  3DGV A;  5GCN A;  2VI7 A;  3FIX A;  1CX8 A;  3K9U A;  5D29 A;  2ZOG A;  4A32 A;  1R57 A;  1V0C A;  4NEX A;  3H5Z A;  2F7V A;  3FRM A;  2PJ1 A;  3N5F A;  5E96 A;  3SHP A;  4B13 A;  1ELL P;  4KSA A;  2CF4 A;  2WSA A;  2WYR A;  4F6A A;  3PB6 X;  8CPA A;  3WR7 A;  4ZBG A;  2O4H A;  3DSB A;  1B6B A;  3TOA A;  1ARL A;  2JDC A;  3KHZ A;  2DXQ A;  1I21 A;  2BEI A;  4CGL A;  4UA3 A;  1YW6 A;  3VWE A;  1DE4 C;  4OC4 A;  4FD6 A;  4E8O A;  7CPA A;  2HQY A;  2P6F A;  3CXP A;  3VH9 A;  3SXO A;  4KVM E;  3GLJ A;  2VZY A;  4CYQ A;  1QSR A;  4PXC A;  3FEC A;  4F0X A;  1R43 A;  1RTQ A;  4JYW A;  4FWU A;  2QVP A;  5IB9 A;  4YWY A;  3G8W A;  5LRJ A;  2PR8 A;  4C7H A;  1K4J A;  4CYP A;  1Q2Y A;  4K3N A;  1QQ9 A;  2YND A;  4X5K A;  4AXV A;  4OME A;  2AFS A;  2AFX A;  1CM0 A;  4KLV A;  2GE3 A;  2QYV A;  2PRQ A;  5LYF A;  3I3G A;  3JTK A;  2O28 A;  1TKJ A;  2J8M A;  4XNH B;  1ZLH A;  2Z11 A;  3OWC A;  1J4J A;  4G1P A;  1IOF A;  4FAI A;  3T90 A;  3B3C A;  1S60 A;  1ZG9 A;  5DS0 A;  4YFJ A;  4Q7A A;  1M4L A;  5G21 A;  3B3V A;  1XEB A;  5HVF A;  4R76 A;  3KI9 A;  3PB4 X;  4E0A A;  2PJB A;  3SXN A;  3IWW A;  5KTD A;  4Q38 A;  4CS0 B;  4M3S A;  2FT0 A;  1S7N A;  4R8F A;  4NGN A;  2GLJ A;  4QB9 A;  4MY3 A;  4TNU A;  3I9S A;  4LX9 A;  1LRZ A;  1CBX A;  1LFW A;  2B4B A;  5THW A;  4HNW B;  1B87 A;  4H89 A;  1I1D A;  3R1K A;  2POK A;  2I00 A;  2WPW A;  5K8O A;  2CNS A;  2PJ5 A;  4YRH A;  1U6M A;  3PRT A;  5HMN A;  1M4D A;  4OLL A;  3NA6 A;  4PSX A;  4NGM A;  4B5P B;  1VHE A;  4KZT A;  1NE9 A;  3GUX A;  2XEJ A;  2Z3O A;  3H8F A;  4XPK A;  2B5G A;  2ZED A;  2ZEE A;  3N7Z A;  3D2P A;  2V8V A;  5CBM A;  2VEZ A;  4C2Z A;  2PVV A;  2NMT A;  1I12 A;  5LYI A;  1LAN A;  4NSQ A;  1M44 A;  3BLN A;  2GFQ A;  1YME A;  2B3U A;  4PXD A;  2PIY A;  3LWU A;  1Z8X A;  5K8N A;  4R9M A;  1Z4R A;  3CPA A;  1RO5 A;  3TT2 A;  4PK2 A;  4RS2 A;  3D2M A;  2J8R A;  3LD2 A;  1R3N A;  4P45 A;  3FYN A;  4MCS A;  4B10 A;  4MFQ A;  4PXE A;  1VKC A;  4P10 A;  3HLP A;  3TOB A;  4PV6 A;  2GU2 A;  3R9F A;  4B12 A;  4MFP A;  3IU1 A;  3BJ8 A;  2P6E A;  4KOX A;  4PXB A;  2OOT A;  1AMP A;  1Y9K A;  2Z3M A;  1WK4 A;  2K5T A;  3LAC A;  4GS4 A;  4UIA A;  4YU9 A;  1KUV A;  4UWI A;  3ZJ0 A;  1ZO0 A;  5HH1 A;  3IFE A;  4EWT A;  2ZEN A;  2XEI A;  4CGO A;  2OZU A;  1ZG8 A;  2AFU A;  3IEH A;  3S6F A;  4EVY A;  2B4D A;  2PE3 A;  3H8E A;  2FCK A;  4UIB A;  3TTH A;  3W6X A;  4P44 A;  1BO4 A;  1YSJ A;  3CXS A;  3KGQ A;  3SJE A;  3EY5 A;  2EO8 A;  4HKF A;  1YX0 A;  4KOU A;  4Y49 B;  3SI1 A;  2CY2 A;  1DTD A;  3E0K A;  3JRU A;  2BL1 A;  2RFH A;  4KSI A;  4OKO A;  4ORF A;  2PJ7 A;  3BI1 A;  3D4U A;  1YLO A;  1ELM P;  1S7L A;  4ONW A;  4L89 A;  1BPM A;  1XJO A;  1Z8T A;  3HUV A;  4HNY B;  2CNM A;  3SJF A;  4ZYQ A;  2CTB A;  4JXQ A;  4CYO A;  4FBE A;  5FVJ A;  2ZEP A;  3B8G A;  1YVK A;  3V7Z A;  1BOB A;  1XFO A;  3PZJ A;  4P6Y A;  2QEC A;  4ZY2 A;  5HVH A;  4MHY A;  4KOT A;  3IJ3 A;  5AG4 A;  2D4O A;  3WAB A;  1FT7 A;  4MBU A;  4CAE A;  5EMI A;  2HC9 A;  3IGR A;  2QML A;  4OC3 A;  2F8H A;  3EC4 A;  4JXR A;  4QBJ A;  3UY5 A;  2EVN A;  4M6H A;  4NGT A;  5JQ4 A;  1PYT B;  2OR4 A;  2ZXV A;  1ZLI A;  1YRE A;  3DR6 A;  5G20 A;  4R87 A;  5H84 A;  3NH5 A;  1FY7 A;  4ZY1 A;  1YR0 A;  3T9Y A;  2BOA A;  4UEZ A;  1MJ9 A;  5LYD A;  2PRB A;  1F2O A;  4XPD C;  2PCU A;  1Q7L A;  3RZA A;  4A37 A;  4WWV A;  1FNO A;  2Q0Y A;  2VZZ A;  5AG6 A;  4U5Y A;  4B5O A;  2AE6 A;  2ZEH A;  3QAY A;  4KUA A;  2YNC C;  2KCW A;  3FEE A;  4P4E A;  5G1Z A;  4EFD A;  1TF9 A;  3D8P A;  3D7H A;  3EFA A;  5H86 A;  2GLF A;  3FBU A;  2XEG A;  5JH9 A;  3MGD A;  1KWM A;  4ONU A;  4C2Y A;  4CGP A;  5LRK A;  4F0Y A;  3KQX A;  3RAM A;  3S6H A;  2ABZ A;  1OBR A;  3NE8 A;  3R96 A;  3V38 A;  4AVC A;  4UCM A;  4H6Z A;  4F9V A;  2C1C A;  1Z9U A;  4CRY B;  2DEA A;  3F8K A;  4A39 A;  4UFV A;  2AFW A;  1QSN A;  4H2K A;  1CP6 A;  5A27 A;  1S5K A;  2AFZ A;  1NMT A;  2G3T A;  5G22 A;  1X10 A;  4ZX8 A;  2EWB A;  4PPZ A;  5LRG A;  2IL4 A;  2ZW5 A;  3R95 A;  1Z2L A;  2ZOF A;  4P4B A;  2WZN A;  3SI0 A;  2R8V A;  2PDO A;  3D7D A;  3KL9 A;  1IYK A;  1LCP A;  3P2H A;  4B14 A;  1OZP A;  3PBE A;  4CAX A;  2PJ3 A;  1QMU A;  4JD6 A;  4PSW A;  3KKW A;  3IWE A;  3QB8 A;  2G9D A;  3B3T A;  4OAE A;  4C2X A;  5C88 A;  5IB0 A;  2GAN A;  3CT9 A;  3IC1 A;  3VWD A;  4KOW A;  4DUK A;  3S6G A;  1VHO A;  2BCO A;  2GRE A;  2ZW7 A;  4X3R A;  3FH4 A;  1BPN A;  4XNH C;  3BJ7 A;  3PEI A;  2ZPA A;  4NJR A;  2V8G A;  4IK2 A;  3DNS A;  1YVO A;  5D8N A;  1M4G A;  4OP4 A;  4U9Y A;  2GIV A;  2EBJ A;  3CPX A;  3KAS A;  2ZW6 A;  5EC4 A;  3ZZI A;  4CAF A;  3EO4 A;  1Y0Y A;  2I79 A;  2NSM A;  1XIX A;  3NFZ A;  4MFL A;  1IY7 A;  3CXQ A;  2FS5 A;  4MRI A;  1Z8W A;  3WT4 A;  4HNX B;  2EK9 A;  2YNC A;  3BXM A;  4P4I A;  5JGF A;  3RO0 A;  1NSA A;  4MCR A;  1F57 A;  2BO9 A;  3DDD A;  4MMO A;  3TC8 A;  2PJC A;  2ZEG A;  1M4I A;  1XBU A;  1WWZ A;  4F9U A;  5JPH A;  1CG2 A;  2XEF A;  1TXR A;  3BHX A;  1RXT A;  2Q51 A;  4KOV A;  4OC2 A;  4A31 A;  1IIC A;  1UFH A;  1TKH A;  4X8I A;  3WC6 A;  2JDD A;  3F0A A;  1LAM A;  4AG7 A;  3FMC A;  4QUS A;  2DF5 A;  2OB0 A;  2IMO A;  2ZW4 A;  2JBK A;  3LOD A;  2ATR A;  2FIW A;  4XPL A;  2V77 A;  4L8A A;  4M85 A;  4MHD A;  4H6U A;  3TO6 A;  2VXK A;  3GIU A;  1P4N A;  4Q36 A;  3H4Q A;  4A2Z A;  2J8N A;  2PJ8 A;  4CYN A;  3PB8 X;  3FXT A;  3JUW A;  4MFZ A;  4CRZ B;  3K9T A;  3GKR A;  2I3C A;  5A28 A;  2EK8 A;  2F5I A; 
#chains in the Genus database with same CATH homology
 3V8I A;  2FE7 A;  4FD7 A;  4JJX A;  1XMT A;  2OU2 A;  1Q2D A;  1Z4E A;  2RC4 A;  4NXY A;  2Z3L A;  4R57 A;  5EBV A;  1MK4 A;  3IWG A;  5ISV A;  1Y7R A;  2R1I A;  2P6G A;  4UCN A;  5IV0 A;  1Y9W A;  2VBQ A;  3R9E A;  2YNE A;  4UFX A;  3JVN A;  1NSL A;  1S3Z A;  3R9G A;  5F49 A;  2BSW A;  1KUX A;  1PUA A;  1MJA A;  5AGE A;  4A30 A;  1KUY A;  2DPT A;  2OH1 A;  3TO7 A;  4KVX A;  3IU2 A;  4C68 A;  2FXF A;  4K30 A;  4AG9 A;  5AG7 A;  4B11 A;  3TE4 A;  2Q04 A;  1Q2C A;  4B5P A;  1ON0 A;  2Z3K A;  4MJ8 A;  2C27 A;  1PU9 A;  4UWJ A;  3NE7 A;  2Z10 A;  4I49 A;  4E2A A;  2EUI A;  2REE A;  3RYO A;  3PGP A;  5J8F A;  4CGM A;  4UCP A;  2Y0M A;  2B5G B;  5CNP A;  4PK3 A;  4U9Z A;  2FL4 A;  2X7B A;  2DPS A;  4FD4 A;  4QC6 A;  4YGO A;  2D4P A;  2OZG A;  4KUB A;  4JLY A;  2Q44 A;  1M1D A;  4QVT A;  4JWP A;  2H5M A;  4R3L A;  1KZF A;  4KLW A;  4A95 A;  4CAV A;  5IX3 A;  2BUE A;  4ZGY B;  2HV2 A;  1TIQ A;  2Q7B A;  5DWN A;  4BBH A;  2PQ8 A;  2B4D B;  2REF A;  3EXN A;  1S7K A;  2G3A A;  1S7F A;  1VHS A;  4RI1 A;  2CXA A;  4DNC A;  4CGN A;  2FIA A;  4UFW A;  1MJB A;  2PR1 A;  4KS9 A;  2OZH A;  4MFK A;  4IUS A;  3QAH A;  1QST A;  4NCZ A;  4IF5 A;  1YLE A;  4LUA A;  1QSM A;  2QIR A;  5AG5 A;  2Z3P A;  1IB1 E;  1SQH A;  3G3S A;  4AVA A;  3GY9 A;  5F47 A;  2AJ6 A;  2Q4Y A;  3TCV A;  4MY0 A;  4NF1 A;  4KSF A;  3P2F A;  3F5B A;  5I0C A;  4CAW A;  2P0W A;  3D3S A;  4OAD A;  4BMH A;  5KTA A;  1P0H A;  4AVB A;  4R3K A;  5DWM A;  5F46 A;  1QSO A;  1XF8 A;  3C26 A;  4MI4 A;  5F48 A;  2Q4V A;  1CJW A;  2Z3N A;  1GHE A;  5C82 A;  3TO9 A;  2R7H A;  4KOR A;  2WPX A;  3W6S A;  3DR8 A;  2YGW A;  3GYA A;  2JEV A;  5KTC A;  1N71 A;  4A33 A;  3FNC A;  2B3V A;  1XE4 A;  2ARH A;  4II9 A;  2PSW A;  3S6K A;  2HUZ A;  2VQY A;  2JLM A;  1YGH A;  4FD5 A;  4AB7 A;  4KOS A;  4UBR A;  3W91 A;  2WUU A;  2FSR A;  1IYL A;  4B12 A;  4C2X A;  4Y49 C;  4MFJ A;  2PC1 A;  4C7I A;  1IID A;  2G0B A;  4KOY A;  2A4N A;  5J8C A;  4KVO E;  4J3G A;  2B58 A;  3A9L A;  3PP9 A;  3TFY A;  2Z0Z A;  2R98 A;  2CNT A;  5BWA B;  3FB3 A;  4XPD B;  1YK3 A;  5GCN A;  2VI7 A;  3FIX A;  3K9U A;  4A32 A;  1R57 A;  1V0C A;  4NEX A;  3H5Z A;  3FRM A;  3SHP A;  5E96 A;  4B13 A;  4KSA A;  2WSA A;  4F6A A;  3WR7 A;  4ZBG A;  3DSB A;  1B6B A;  3TOA A;  2JDC A;  2DXQ A;  1I21 A;  2BEI A;  4CGL A;  4UA3 A;  3VWE A;  4FD6 A;  4E8O A;  2HQY A;  2P6F A;  3CXP A;  3SXO A;  4KVM E;  2VZY A;  4CYQ A;  1QSR A;  4F0X A;  3G8W A;  2PR8 A;  4C7H A;  1K4J A;  4CYP A;  1Q2Y A;  2YND A;  4X5K A;  1CM0 A;  4KLV A;  2GE3 A;  3I3G A;  3JTK A;  2O28 A;  2J8M A;  4XNH B;  2Z11 A;  3OWC A;  1J4J A;  3T90 A;  1S60 A;  4YFJ A;  5G21 A;  1XEB A;  4E0A A;  3SXN A;  5KTD A;  4Q38 A;  4CS0 B;  4M3S A;  2FT0 A;  1S7N A;  4QB9 A;  4MY3 A;  3I9S A;  4LX9 A;  1LRZ A;  2B4B A;  4HNW B;  1B87 A;  4H89 A;  3R1K A;  1I1D A;  2I00 A;  2WPW A;  2CNS A;  4YRH A;  1U6M A;  5HMN A;  1M4D A;  4OLL A;  4PSX A;  4B5P B;  4KZT A;  1NE9 A;  4XPK A;  2Z3O A;  2B5G A;  3N7Z A;  3D2P A;  2VEZ A;  4C2Z A;  2NMT A;  1I12 A;  4NSQ A;  1M44 A;  3BLN A;  2B3U A;  4R9M A;  1Z4R A;  1RO5 A;  3TT2 A;  4PK2 A;  4RS2 A;  3D2M A;  2J8R A;  3LD2 A;  3FYN A;  4B10 A;  4MFQ A;  3TOB A;  1VKC A;  4PV6 A;  3R9F A;  4MFP A;  3IU1 A;  3BJ8 A;  2P6E A;  4KOX A;  1Y9K A;  2Z3M A;  1WK4 A;  2K5T A;  4GS4 A;  1KUV A;  4UWI A;  3ZJ0 A;  1ZO0 A;  5HH1 A;  4CGO A;  2OZU A;  3S6F A;  4EVY A;  2B4D A;  2FCK A;  3TTH A;  3W6X A;  1BO4 A;  3CXS A;  3EY5 A;  4HKF A;  4KOU A;  1YX0 A;  4Y49 B;  2CY2 A;  3E0K A;  2BL1 A;  4ORF A;  1S7L A;  4L89 A;  4HNY B;  2CNM A;  4JXQ A;  4CYO A;  5FVJ A;  3B8G A;  1YVK A;  1BOB A;  3PZJ A;  2QEC A;  4KOT A;  5AG4 A;  2D4O A;  4MBU A;  4CAE A;  3IGR A;  2QML A;  3EC4 A;  4JXR A;  4QBJ A;  3UY5 A;  2EVN A;  5JQ4 A;  2ZXV A;  1YRE A;  3DR6 A;  5G20 A;  4R87 A;  5H84 A;  1FY7 A;  1YR0 A;  3T9Y A;  1MJ9 A;  2PRB A;  4XPD C;  4A31 A;  5AG6 A;  2Q0Y A;  2VZZ A;  4U5Y A;  4B5O A;  2AE6 A;  4KUA A;  2YNC C;  2KCW A;  5G1Z A;  3D8P A;  3EFA A;  5H86 A;  3FBU A;  3MGD A;  4ONU A;  4C2Y A;  4CGP A;  4F0Y A;  3S6H A;  3R96 A;  4AVC A;  4UCM A;  4H6Z A;  1Z9U A;  4CRY B;  3F8K A;  4UFV A;  1QSN A;  5A27 A;  1S5K A;  1NMT A;  2G3T A;  5G22 A;  2IL4 A;  2ZW5 A;  3R95 A;  2R8V A;  2PDO A;  4CAX A;  1IYK A;  3P2H A;  4B14 A;  1OZP A;  4JD6 A;  4PSW A;  3KKW A;  3IWE A;  3QB8 A;  4OAE A;  5C88 A;  5IB0 A;  2GAN A;  3VWD A;  4KOW A;  3S6G A;  2ZW7 A;  4XNH C;  3BJ7 A;  2ZPA A;  3DNS A;  1YVO A;  1M4G A;  4U9Y A;  2GIV A;  5EC4 A;  2ZW6 A;  3ZZI A;  4CAF A;  3EO4 A;  2I79 A;  1XIX A;  4MFL A;  3CXQ A;  2FS5 A;  4HNX B;  2YNC A;  3DDD A;  1M4I A;  5JPH A;  1WWZ A;  1RXT A;  4KOV A;  1IIC A;  1UFH A;  4AG7 A;  3F0A A;  2JDD A;  4QUS A;  2OB0 A;  2ZW4 A;  3LOD A;  2ATR A;  2FIW A;  4XPL A;  4M85 A;  4L8A A;  4MHD A;  4H6U A;  3TO6 A;  2VXK A;  1P4N A;  4Q36 A;  3H4Q A;  4A2Z A;  2J8N A;  4CYN A;  3FXT A;  3JUW A;  4MFZ A;  4CRZ B;  3GKR A;  1L0C A;  5A28 A;  2F5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...