4QVTA

Crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
b'MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase YpeA
molecule tags Transferase
source organism Escherichia coli k-12
publication title Crystal structure of predicted N-acyltransferase (ypeA) in complex with acetyl-CoA from Escherichia coli
rcsb
total genus 39
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qvtA01
3EY5A 2PRBA 3I9SA 4R87A 4UA3A 2CNTA 2DXQA 5CNPA 1Q2DA 4IUSA 4KLVA 3F5BA 1M4IA 5H86A 1V0CA 1XEBA 1VKCA 2G3TA 2R1IA 3EO4A 1YVKA 3ZZIA 3ZJ0A 4B5OA 4H89A 4Y49C 1IICA 4BMHA 2GIVA 2OH1A 3FYNA 3S6FA 3W6XA 2JLMA 2O28A 3UY5A 4U9ZA 4PSXA 2P0WA 3EFAA 4KOVA 3PGPA 4GS4A 4KOUA 2B58A 2Z0ZA 3MGDA 3D8PA 2PSWA 2JEVA 2J8RA 5FVJA 4KVME 4LUAA 3DSBA 4XNHC 3W91A 2B5GA 4E8OA 2J8MA 1S5KA 3P2FA 3LD2A 3FXTA 2PR8A 2ZW4A 4YGOA 1IB1E 2ATRA 4YRHA 3GYAA 1XF8A 2EUIA 2PQ8A 1Z4EA 5IV0A 4MHDA 3FRMA 1P4NA 5DWNA 2K5TA 4XPDC 3CXQA 3N7ZA 1S7FA 5C88A 1NMTA 1YGHA 2BUEA 4QB9A 4PK2A 1Q2YA 2BSWA 1MJAA 1NSLA 1U6MA 4QBJA 3CXPA 2REEA 4IF5A 3R9GA 2Q0YA 3G3SA 4K30A 1QSOA 3G8WA 1XIXA 4NF1A 3RYOA 2BEIA 3FNCA 2FSRA 4UWIA 5F48A 1Z9UA 3TOAA 1I1DA 3D3SA 5F46A 2AJ6A 1KUVA 4FD5A 3SHPA 3WR7A 4R3LA 3GY9A 4AG9A 3KKWA 4KZTA 4DNCA 4L8AA 2OZGA 3JVNA 1VHSA 3W6SA 3SXOA 2R98A 1B87A 2FE7A 1WWZA 3EC4A 4H6UA 4QC6A 1IYLA 1M4GA 2Q4VA 4HNYB 2FCKA 2Q4YA 4MI4A 4KUAA 4KUBA 3TCVA 4JXQA 2GANA 1YLEA 3GKRA 3C26A 2Q04A 1XE4A 4XPKA 5KTDA 4KOTA 4H6ZA 1FY7A 1Y9WA 3H4QA 4HNXB 2R8VA 1S60A 4JLYA 5F47A 3S6KA 4F6AA 1Y7RA 2HUZA 1CM0A 3S6GA 1S7NA 1MJBA 4PSWA 1XMTA 2I00A 3CXSA 2AE6A 2FS5A 2JDCA 2ARHA 3R9FA 2VI7A 1S3ZA 2ZPAA 5DWMA 5KTCA 1P0HA 3TO6A 3V8IA 2G3AA 2Q44A 3D2MA 2QMLA 1BOBA 1PU9A 4ORFA 4U9YA 1TIQA 2H5MA 4E0AA 1KUXA 2B3VA 3TO9A 2KCWA 5HMNA 4M3SA 2CNSA 2ZXVA 3OWCA 2FIAA 4JD6A 3TT2A 5IX3A 5HH1A 2NMTA 4MBUA 4KVXA 1OZPA 1N71A 1Y9KA 2P6GA 2B4DB 3DR8A 3PZJA 3B8GA 3JUWA 5EC4A 3VWEA 4ZBGA 1KZFA 3TE4A 2D4PA 1I21A 4NSQA 2OZHA 4CAVA 2VZYA 2P6FA 2REFA 3BJ8A 4HNWB 2EVNA 4FD7A 4JJXA 1IYKA 2J8NA 4R3KA 3FBUA 3EXNA 1LRZA 4X5KA 4JWPA 4U5YA 1M4DA 5JPHA 4KOYA 5KTAA 4NXYA 5C82A 3R96A 1BO4A 1IIDA 4E2AA 2ZW5A 2Z10A 2ZW6A 3T9YA 2Z11A 2G0BA 4AVBA 1YX0A 2Y0MA 4KOSA 2OU2A 3TOBA 4B5PA 4Y49B 3NE7A 4II9A 1S7LA 2OZUA 4AVAA 2R7HA 1B6BA 2B3UA 2VXKA 3R1KA 1R57A 1L0CA 3D2PA 2FXFA 4CAXA 4XNHB 4NEXA 5J8FA 1WK4A 4AB7A 1GHEA 2FT0A 5EBVA 1SQHA 3R9EA 2I79A 1NE9A 4FD6A 1M44A 4JXRA 2B4DA 5GCNA 4CRZB 4KLWA 3TO7A 2BL1A 3QB8A 4PV6A 2QIRA 2F5IA 1UFHA 4MY3A 4L89A 1Q2CA 3VWDA 4EVYA 3R95A 4M85A 4KOWA 1YREA 1KUYA 2VEZA 3K9UA 4XPLA 2FIWA 5E96A 5I0CA 2WPXA 5F49A 4AG7A 5J8CA 4HKFA 2HQYA 2GE3A 2CY2A 4KVOE 4MY0A 1S7KA 1YK3A 2WPWA 1ON0A 3DDDA 4NCZA 4R9MA 3E0KA 4XPDB 1I12A 4QUSA 2B4BA 1QSNA 4KOXA 5H84A 3BJ7A 2B5GB 3F0AA 4LX9A 1RXTA 2QECA 2VZZA 3F8KA 4AVCA 2JDDA 2VQYA 3SXNA 3S6HA 2A4NA 1QSMA 4OLLA 3FIXA 4RS2A 3DR6A 3QAHA 3PP9A 1YR0A 3I3GA 4CRYB 4CAWA 2P6EA 2ZW7A 1CJWA 2C27A 4RI1A 4UWJA 2HV2A 1YVOA 2PDOA 3TFYA 3T90A 4PK3A 1MK4A 3BLNA 4ONUA 1QSRA 3DNSA 4KORA 3IGRA 4J3GA 4F0YA 5JQ4A 4R57A 1RO5A 3P2HA 1M1DA 4I49A 4FD4A 4OAEA 5IB0A 1Z4RA 3FB3A 4MJ8A 3LODA 2FL4A 1K4JA 2CNMA 1J4JA 4UBRA 4OADA 2IL4A 2RC4A 2OB0A 5ISVA 1PUAA 2D4OA 3TTHA 4CS0B 1MJ9A 2VBQA 2X7BA 4QVTA 4B5PB 1QSTA 4YFJA 2PC1A 2Q7BA 2PR1A 3IWGA
chains in the Genus database with same CATH superfamily
3VH9A 2O4HA 3EY5A 5K8NA 2V8DA 4R76A 2PRBA 3I9SA 1ZG8A 3PFEA 2WZNA 2CNTA 2DXQA 3D7GA 4KSAA 4R87A 4UA3A 5CNPA 4C7HA 1Q2DA 4ZY1A 2CIJA 4IAVA 4IUSA 4OC5A 4KLVA 5AG7A 3F5BA 1M4IA 5H86A 5HXDA 4MFZA 2PCUA 2PJ6A 1V0CA 4CGPA 3IU1A 1XEBA 2J9AA 1VKCA 2G3TA 2R1IA 4NGRA 3EO4A 4Q38A 2Q51A 1EE3P 1YVKA 3KASA 4LQ6A 4M6IA 4NGPA 3ZZIA 1Q7LA 3ZJ0A 1AMPA 5IB9A 4B5OA 4H89A 2YNCA 2EWBA 3NH8A 2HB6A 4Y49C 4Q36A 4PXEA 1IICA 2AFUA 4BMHA 2GIVA 2OH1A 3FYNA 1RTQA 2GLJA 3PB9X 3S6FA 2ODFA 2JLMA 2O28A 3SI2A 3UY5A 3W6XA 4U9ZA 2ZOFA 5JM6A 4B6ZA 1ZLHA 4PSXA 1IY7A 1XBUA 4GM5A 3RNZA 2P0WA 2PJ8A 3EFAA 3PGPA 4GS4A 4KOVA 4KOUA 4UF4A 2B58A 4ZX9A 1Y7EA 1IU8A 2Z0ZA 3B3SA 1BPNA 3MGDA 4O23A 4NGMA 4P4JA 1TF8A 4Q7AA 1PYTB 2V77A 5I4MA 2WUUA 3K9TA 5G20A 4A32A 4DYOA 3D66A 3D8PA 2PSWA 2I3CA 3NA6A 3QAYA 2JEVA 2Z3MA 3PB6X 2J8RA 5FVJA 4MCSA 1ELMP 3KL9A 4KVME 4A95A 4LUAA 3IWEA 3DSBA 4XNHC 4B11A 4B12A 2YNEA 5LRJA 4CAFA 4ONWA 3D4UA 4IHMA 4UEFA 1YQEA 3W91A 4NJQA 2B5GA 4NGTA 4PPZA 4E8OA 2G9DA 3KI9A 4G1PA 4MFLA 2J8MA 1S5KA 2C6PA 3P2FA 3LD2A 3NFZA 4JYWA 3FXTA 5THWA 2PR8A 2ZW4A 4YGOA 4UCMA 1IB1E 4M6GA 2AFZA 5G22A 2ATRA 2WSAA 2PJ0A 1M4LA 1XF8A 3GYAA 4YRHA 2PJ4A 2EUIA 5A28A 3D7HA 4P4EA 2PQ8A 2RB7A 4B10A 3GB0A 1Z4EA 5IV0A 4MFJA 3A9LA 3FRMA 4MHDA 1P4NA 5DWNA 3HLPA 2V8VA 2K5TA 4OC2A 3SI1A 4F9VA 4XPDC 3CXQA 3N7ZA 1S7FA 5C88A 1NMTA 1YGHA 4OKOA 2BUEA 2GU2A 1F2OA 4QB9A 4PK2A 1IGBA 3B7IA 1F57A 1Q2YA 2BSWA 1MJAA 1NSLA 1U6MA 4CYQA 4QBJA 1IOIA 3CXPA 1IOFA 2JBJA 2REEA 4NFRA 4EWTA 4IF5A 3R9GA 3KR4A 4NJRA 5ELYA 3D67A 4F9UA 1TXRA 2VL1A 1VGYA 2Q0YA 3G3SA 3IFEA 1QSOA 1ZG7A 1XIXA 2JEWA 3BHXA 3D7DA 3G8WA 4K30A 4NF1A 3RYOA 2PE3A 3SI0A 2BEIA 3FNCA 4ZYQA 4KS9A 2FSRA 4UWIA 3LWUA 3WABA 5F48A 1Z9UA 2BO9A 3S9MA 2YNCC 3S9NA 3TOAA 4RUHA 2PIZA 5EMIA 3RZAA 1I1DA 2PIYA 3D3SA 5F46A 2AJ6A 1KUVA 5F09A 3FJUA 4EMEA 5CPAA 4FD5A 2NYQA 3SJEA 3MRUA 3SHPA 3WR7A 3B2YA 1HDQA 3GY9A 4R3LA 3KKWA 4KZTA 4AG9A 4B14A 4L8AA 4KSFA 2OZGA 4DNCA 3JVNA 1VHSA 3W6SA 3SXOA 2PJ7A 2R98A 4OMEA 3L2NA 4A31A 1B87A 1Z2LA 2FE7A 2ZEHA 1WWZA 5LYIA 3EC4A 4H6UA 4QC6A 4ZX8A 1IYLA 1M4GA 2Q4VA 3B3TA 4HNYB 5D29A 2EO8A 4UIAA 2FCKA 2Q4YA 2PJCA 1LANA 4MI4A 4KUAA 4KUBA 3TCVA 4IK2A 4JXQA 2GANA 4PXBA 1YLEA 4YWYA 3GKRA 2Q43A 3CPXA 3C26A 4C2ZA 2Q04A 4CGLA 1XE4A 4XPKA 2AFWA 1KWMA 4C2YA 5KTDA 3KR5A 3PB7X 1Y0YA 4KOTA 4H6ZA 4PXCA 4YU9A 1FY7A 1Y9WA 3CPAA 3H4QA 4HNXB 1YW4A 1TF9A 2EBJA 2R8VA 3CZXA 1S60A 4JLYA 4ZY0A 2AFSA 2PJAA 4R7MA 6CPAA 3KZWA 5F47A 3S6KA 7CPAA 4F6AA 4FUUA 1Y7RA 2HUZA 1CM0A 4FWUA 2ZOGA 3S6GA 4TWEA 4CGMA 5K8OA 3ISXA 1S7NA 1MJBA 3WC6A 1YSJA 4PSWA 1XMTA 3JTKA 2Z3KA 4UIBA 3IJ3A 2I00A 3CXSA 4P4DA 4MHZA 2AE6A 2FS5A 2JDCA 2ARHA 4UFVA 1TKFA 2HC9A 3R9FA 3S9LA 4OIWA 2JBKA 2YGWA 2ZEFA 1XMBA 3TC8A 2VI7A 2PJ1A 4OP4A 4P4IA 1S3ZA 2ZPAA 5DWMA 4MFPA 5KTCA 1P0HA 3TO6A 3V8IA 2G3AA 4MHPA 5J1QA 2Q44A 5DS0A 3D2MA 3VARA 2QMLA 1BOBA 1PU9A 4ORFA 4PQAA 4U9YA 1TIQA 2AFXA 2H5MA 1KUXA 4CAEA 4E0AA 1JWQA 2ZENA 3PBEA 2B3VA 3TO9A 1CPSA 2KCWA 1GYTA 2IQ6A 5HMNA 3VATA 4M3SA 2ZEMA 3FF3A 3BI0A 3PEIA 4A2ZA 2CNSA 1ZG9A 2NSMA 2ZXVA 3OWCA 2FIAA 4JD6A 3TT2A 2DF5A 5IX3A 5HH1A 2NMTA 4WJBA 4MBUA 2IMOA 1JQGA 3PRTA 4KVXA 2PJ9A 1OZPA 3KHXA 2OOTA 1BLLE 1BPMA 1N71A 4JZ0A 2WYRA 1Z5RA 1Y9KA 2P6GA 4RN7A 2B4DB 3DR8A 3H8FA 3PZJA 4C68A 4C7IA 4OIDA 3B8GA 3IIBA 3JUWA 5EC4A 4K3NA 3VWEA 3LMSA 4ZBGA 4P6YA 3WC7A 1KZFA 3H8GA 3TE4A 3FMCA 5HVGA 2EK9A 4P4FA 2QVPA 3DGVA 2D4PA 1I21A 4NSQA 3B35A 2DEAA 2OZHA 4W9YA 4CAVA 1LAMA 3KQXA 2VZYA 2P6FA 2PVWA 2REFA 5LYFA 4A33A 3BJ8A 4HNWB 2EVNA 3B3WA 4FD7A 4JJXA 4HPSA 1Y0RA 4NGSA 1QQ9A 1FNOA 3FECA 1IYKA 2J8NA 4R3KA 5G21A 3RO0A 3FBUA 2CF4A 3EXNA 4OC4A 1LRZA 2AFOA 1ARMA 2Z3OA 2YNDA 4P4BA 5JGFA 2Z3PA 4R8FA 3CDXA 4X5KA 5BWAB 4JWPA 4U5YA 4F8ZA 1M4DA 2QJ8A 2QYVA 4ZGYB 4CYNA 5JPHA 4KOYA 5KTAA 2CTCA 4NXYA 5C82A 3R96A 1BO4A 1IIDA 4E2AA 2ZW5A 2Z10A 2ZW6A 3T9YA 4CPAA 3B3CA 4MHNA 4UFWA 4MXUA 2Z11A 1PCAA 2G0BA 3NH5A 1UWYA 4AVBA 3FEDA 2PRQA 4OC3A 1YX0A 3WC5A 4UCNA 1Z8XA 3IO1A 2XEFA 2Y0MA 4KOSA 3MN8A 4KSIA 3IC1A 1X10A 3PB4X 2OU2A 3TOBA 4B5PA 1NSAA 4Y49B 4FBEA 3NE7A 8CPAA 4II9A 1X12A 1CP7A 1S7LA 2OZUA 4AVAA 3TX8A 1CP6A 2R7HA 5AG4A 3FH4A 1B6BA 5AGEA 2B3UA 3FEEA 5HVFA 4DUKA 2VXKA 1Z8TA 3R1KA 4PXDA 1R57A 1L0CA 3IEHA 2DPTA 4MFQA 3D2PA 2FXFA 4UEEA 5LYDA 4CAXA 4XNHB 4DJLA 4NEXA 5J8FA 1CPXA 3N5FA 1WK4A 4CYOA 2Q7SA 4AB7A 1GHEA 2FT0A 3H5ZA 4BBHA 5K8MA 5EBVA 1SQHA 4H2KA 2PJ3A 2I79A 3KHZA 3R9EA 1NE9A 2GREA 2XEGA 1TKJA 2ANPA 3LACA 4FD6A 1M44A 4JXRA 2B4DA 3PFOA 5GCNA 3JRUA 4CRZB 1ZO0A 4KLWA 3TO7A 2BL1A 3QB8A 1VHEA 4PV6A 2QIRA 3FX6A 1LFWA 1UFHA 2F5IA 4MCPA 4MY3A 4UEZA 4L89A 1Q2CA 5LRGA 3CT9A 4MFKA 3KQZA 3VWDA 4EVYA 1QMUA 4NGQA 3R95A 4M85A 4KOWA 1YREA 1KUYA 2GFQA 2VEZA 4MMOA 3V7ZA 3WT4A 1AUGA 2POKA 2Q4ZA 3K9UA 2FIWA 4XPLA 4P10A 4CGOA 5E96A 1R3NA 4TNUA 4A38A 3FVLA 3GIUA 5I0CA 4A37A 4C2XA 2WPXA 5F49A 2BCOA 4AG7A 1VIXA 4AXVA 5J8CA 1XFOA 2Z3LA 4HKFA 4LQGA 2HQYA 2GE3A 1HEEA 4M6HA 2CY2A 4UCPA 4KVOE 4MY0A 1S7KA 1YK3A 2WPWA 1ON0A 2XEIA 3DDDA 4NCZA 1ELLP 4R9MA 3E0KA 3IU2A 1Z8LA 5G1ZA 4XPDB 4X3RA 2DPSA 3ISZA 1I12A 2Z3NA 5CBMA 1XJOA 4QUSA 5JH9A 2B4BA 4R6TA 1QSNA 4KOXA 4WWVA 2EK8A 5H84A 3BJ7A 4P44A 4ZY2A 2FVGA 1TKHA 2IJZA 4X8IA 2B5GB 3F0AA 4LX9A 1RXTA 2QECA 2VZZA 3F8KA 2ZEPA 4MRIA 4AVCA 2JDDA 2VQYA 4CYPA 4UFXA 3SXNA 3D7FA 4GXHA 3S6HA 2A4NA 4NGNA 1QSMA 2ZEGA 4OLLA 1YLOA 3FIXA 4RS2A 3DR6A 5D8NA 1LCPA 1XRYA 4ZI6A 5LRKA 5HVHA 4B13A 1H8LA 4BINA 2RFHA 3QAHA 1F2PA 3NE8A 3PP9A 3PBBA 1YR0A 1BAVA 2PJ5A 3I3GA 2F8HA 4CRYB 4CAWA 4F0XA 2C6GA 5AG5A 2P6EA 2GLFA 2ZW7A 4CGNA 3RAMA 4OC0A 3PB8X 1CJWA 1ARLA 4A30A 3GUXA 3H8EA 1R43A 2C27A 4RI1A 1DTDA 4UWJA 2HV2A 1AYEA 1HDUA 1YMEA 1YVOA 3IWWA 2PDOA 3SJXA 3TFYA 1Z8WA 1CG2A 1OBRA 3T90A 2V8HA 3QNVA 2OR4A 4A39A 3BI1A 4FAIA 1DE4C 4PK3A 2CXAA 1MK4A 3BLNA 4ONUA 5A27A 1QSRA 3DNSA 2BOAA 1LOKA 5AG6A 4KORA 3IGRA 4J3GA 2PJBA 2XEJA 3KGQA 4F0YA 5JQ4A 4R57A 5LYLA 1ZLIA 1RO5A 2F7VA 3P2HA 2V8GA 4MHYA 3BXMA 1M1DA 4I49A 4FD4A 4X2TA 4MCRA 4OAEA 2C1CA 4A94A 5IB0A 4OC1A 1Z4RA 2ABZA 3B3VA 3FB3A 4MJ8A 2PJ2A 3LODA 2FL4A 3HUVA 1CX8A 1K4JA 3NH4A 1FT7A 3SJGA 2ZELA 2CNMA 2ZEEA 3I1UA 1J4JA 3T8WA 4UBRA 3K2KA 3GLJA 4OADA 2IL4A 2CTBA 2RC4A 3RBUA 2OB0A 2ZEOA 3V38A 5ISVA 4EFDA 1YW6A 3D68A 1PUAA 1XOVA 2D4OA 3TTHA 3SJFA 1A2ZA 4CS0B 1MJ9A 1LAPA 2O53A 4P45A 3DLJA 5K8PA 1VHOA 2VBQA 4Z65A 4BD9A 2AFMA 2X7BA 2PVVA 4QVTA 4B5PB 2ZEDA 1QSTA 4YFJA 1CBXA 2PC1A 2Q7BA 2PR1A 4MCQA 3IWGA 2C6CA
chains in the Genus database with same CATH topology
3EY5A 2PRBA 3I9SA 4R87A 4UA3A 2CNTA 2DXQA 4C7HA 4KSAA 5CNPA 1Q2DA 4IUSA 5AG7A 4KLVA 3F5BA 1M4IA 5H86A 4MFZA 1V0CA 4CGPA 3IU1A 1XEBA 1VKCA 2G3TA 2R1IA 3EO4A 4Q38A 1YVKA 3ZZIA 3ZJ0A 4B5OA 4H89A 2YNCA 4Y49C 4Q36A 1IICA 4BMHA 2GIVA 2OH1A 3FYNA 3S6FA 3W6XA 2JLMA 2O28A 3UY5A 4U9ZA 4PSXA 2P0WA 3EFAA 4KOVA 3PGPA 4GS4A 4KOUA 2B58A 2Z0ZA 3MGDA 2WUUA 4A32A 5G20A 3D8PA 2PSWA 2JEVA 2Z3MA 2J8RA 5FVJA 4KVME 4A95A 4LUAA 3IWEA 3DSBA 4XNHC 4B11A 4B12A 2YNEA 4CAFA 3W91A 2B5GA 4E8OA 4MFLA 2J8MA 1S5KA 3P2FA 3LD2A 3FXTA 2PR8A 2ZW4A 4YGOA 4UCMA 1IB1E 5G22A 2ATRA 2WSAA 3GYAA 1XF8A 4YRHA 2EUIA 5A28A 2PQ8A 4B10A 1Z4EA 5IV0A 4MFJA 3A9LA 3FRMA 4MHDA 1P4NA 5DWNA 2K5TA 4XPDC 3CXQA 3N7ZA 1S7FA 5C88A 1NMTA 1YGHA 2BUEA 4QB9A 4PK2A 1Q2YA 2BSWA 1MJAA 1NSLA 1U6MA 4CYQA 4QBJA 3CXPA 2REEA 4IF5A 3R9GA 2Q0YA 3G3SA 4K30A 1QSOA 3G8WA 1XIXA 4NF1A 3RYOA 2BEIA 3FNCA 4KS9A 2FSRA 4UWIA 5F48A 1Z9UA 2YNCC 3TOAA 1I1DA 3D3SA 5F46A 2AJ6A 1KUVA 4FD5A 3SHPA 3WR7A 4R3LA 3GY9A 4AG9A 3KKWA 4KZTA 4B14A 4DNCA 4L8AA 4KSFA 2OZGA 3JVNA 1VHSA 3W6SA 3SXOA 2R98A 4A31A 1B87A 2FE7A 1WWZA 3EC4A 4H6UA 4QC6A 1IYLA 1M4GA 2Q4VA 4HNYB 2FCKA 2Q4YA 4MI4A 4KUAA 4KUBA 3TCVA 4JXQA 2GANA 1YLEA 3GKRA 3C26A 4C2ZA 2Q04A 4CGLA 1XE4A 4XPKA 5KTDA 4C2YA 4KOTA 4H6ZA 1FY7A 1Y9WA 3H4QA 4HNXB 2R8VA 1S60A 4JLYA 5F47A 3S6KA 4F6AA 1Y7RA 2HUZA 1CM0A 3S6GA 4CGMA 1S7NA 1MJBA 4PSWA 1XMTA 3JTKA 2Z3KA 2I00A 3CXSA 2AE6A 2FS5A 2JDCA 2ARHA 4UFVA 3R9FA 2YGWA 2VI7A 1S3ZA 2ZPAA 5DWMA 4MFPA 5KTCA 1P0HA 3TO6A 3V8IA 2G3AA 2Q44A 3D2MA 2QMLA 1BOBA 1PU9A 4ORFA 4U9YA 4CAEA 1TIQA 2H5MA 4E0AA 1KUXA 2B3VA 3TO9A 2KCWA 5HMNA 4M3SA 4A2ZA 2CNSA 2ZXVA 3OWCA 2FIAA 4JD6A 3TT2A 5IX3A 5HH1A 2NMTA 4MBUA 4KVXA 1OZPA 1N71A 1Y9KA 2P6GA 4C68A 2B4DB 3DR8A 3PZJA 4C7IA 3B8GA 3JUWA 5EC4A 3VWEA 4ZBGA 1KZFA 3TE4A 2D4PA 1I21A 4NSQA 2OZHA 4CAVA 2VZYA 2P6FA 2REFA 4A33A 3BJ8A 4HNWB 2EVNA 4FD7A 4JJXA 5G21A 1IYKA 2J8NA 4R3KA 3FBUA 3EXNA 1LRZA 2Z3OA 2YNDA 2Z3PA 4X5KA 5BWAB 4JWPA 4U5YA 1M4DA 4ZGYB 4CYNA 5JPHA 4KOYA 5KTAA 4NXYA 5C82A 3R96A 1BO4A 1IIDA 4E2AA 2ZW5A 2Z10A 2ZW6A 3T9YA 4UFWA 2Z11A 2G0BA 4AVBA 1YX0A 4UCNA 2Y0MA 4KOSA 2OU2A 3TOBA 4B5PA 4Y49B 3NE7A 4II9A 1S7LA 2OZUA 4AVAA 2R7HA 5AG4A 1B6BA 5AGEA 2B3UA 2VXKA 3R1KA 1R57A 1L0CA 2DPTA 4MFQA 3D2PA 2FXFA 4CAXA 4XNHB 4NEXA 5J8FA 1WK4A 4CYOA 4AB7A 1GHEA 2FT0A 3H5ZA 4BBHA 5EBVA 1SQHA 3R9EA 2I79A 1NE9A 4FD6A 1M44A 4JXRA 2B4DA 5GCNA 4CRZB 1ZO0A 4KLWA 3TO7A 2BL1A 3QB8A 4PV6A 2QIRA 2F5IA 1UFHA 4MY3A 4L89A 1Q2CA 4MFKA 3VWDA 4EVYA 3R95A 4M85A 4KOWA 1YREA 1KUYA 2VEZA 3K9UA 4XPLA 2FIWA 4CGOA 5E96A 5I0CA 4C2XA 2WPXA 5F49A 4AG7A 5J8CA 2Z3LA 4HKFA 2HQYA 2GE3A 2CY2A 4UCPA 4KVOE 4MY0A 1S7KA 1YK3A 2WPWA 1ON0A 3DDDA 4NCZA 4R9MA 3E0KA 3IU2A 5G1ZA 4XPDB 2DPSA 1I12A 2Z3NA 4QUSA 2B4BA 1QSNA 4KOXA 5H84A 3BJ7A 2B5GB 3F0AA 4LX9A 1RXTA 2QECA 2VZZA 3F8KA 4AVCA 2JDDA 2VQYA 4CYPA 4UFXA 3SXNA 3S6HA 2A4NA 1QSMA 4OLLA 3FIXA 4RS2A 3DR6A 4B13A 3QAHA 3PP9A 1YR0A 3I3GA 4CRYB 4CAWA 4F0XA 5AG5A 2P6EA 2ZW7A 4CGNA 1CJWA 4A30A 2C27A 4RI1A 4UWJA 2HV2A 1YVOA 2PDOA 3TFYA 3T90A 4PK3A 2CXAA 1MK4A 3BLNA 4ONUA 5A27A 1QSRA 3DNSA 5AG6A 4KORA 3IGRA 4J3GA 4F0YA 5JQ4A 4R57A 1RO5A 3P2HA 1M1DA 4I49A 4FD4A 4OAEA 5IB0A 1Z4RA 3FB3A 4MJ8A 3LODA 2FL4A 1K4JA 2CNMA 1J4JA 4UBRA 4OADA 2IL4A 2RC4A 2OB0A 5ISVA 1PUAA 2D4OA 3TTHA 4CS0B 1MJ9A 2VBQA 2X7BA 4QVTA 4B5PB 1QSTA 4YFJA 2PC1A 2Q7BA 2PR1A 3IWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  2PRB A;  3I9S A;  4R87 A;  4UA3 A;  2CNT A;  2DXQ A;  5CNP A;  1Q2D A;  4IUS A;  4KLV A;  3F5B A;  1M4I A;  5H86 A;  1V0C A;  1XEB A;  1VKC A;  2G3T A;  2R1I A;  3EO4 A;  1YVK A;  3ZZI A;  3ZJ0 A;  4B5O A;  4H89 A;  4Y49 C;  1IIC A;  4BMH A;  2GIV A;  2OH1 A;  3FYN A;  3S6F A;  3W6X A;  2JLM A;  2O28 A;  3UY5 A;  4U9Z A;  4PSX A;  2P0W A;  3EFA A;  4KOV A;  3PGP A;  4GS4 A;  4KOU A;  2B58 A;  2Z0Z A;  3MGD A;  3D8P A;  2PSW A;  2JEV A;  2J8R A;  5FVJ A;  4KVM E;  4LUA A;  3DSB A;  4XNH C;  3W91 A;  2B5G A;  4E8O A;  2J8M A;  1S5K A;  3P2F A;  3LD2 A;  3FXT A;  2PR8 A;  2ZW4 A;  4YGO A;  1IB1 E;  2ATR A;  4YRH A;  3GYA A;  1XF8 A;  2EUI A;  2PQ8 A;  1Z4E A;  5IV0 A;  4MHD A;  3FRM A;  1P4N A;  5DWN A;  2K5T A;  4XPD C;  3CXQ A;  3N7Z A;  1S7F A;  5C88 A;  1NMT A;  1YGH A;  2BUE A;  4QB9 A;  4PK2 A;  1Q2Y A;  2BSW A;  1MJA A;  1NSL A;  1U6M A;  4QBJ A;  3CXP A;  2REE A;  4IF5 A;  3R9G A;  2Q0Y A;  3G3S A;  4K30 A;  1QSO A;  3G8W A;  1XIX A;  4NF1 A;  3RYO A;  2BEI A;  3FNC A;  2FSR A;  4UWI A;  5F48 A;  1Z9U A;  3TOA A;  1I1D A;  3D3S A;  5F46 A;  2AJ6 A;  1KUV A;  4FD5 A;  3SHP A;  3WR7 A;  4R3L A;  3GY9 A;  4AG9 A;  3KKW A;  4KZT A;  4DNC A;  4L8A A;  2OZG A;  3JVN A;  1VHS A;  3W6S A;  3SXO A;  2R98 A;  1B87 A;  2FE7 A;  1WWZ A;  3EC4 A;  4H6U A;  4QC6 A;  1IYL A;  1M4G A;  2Q4V A;  4HNY B;  2FCK A;  2Q4Y A;  4MI4 A;  4KUA A;  4KUB A;  3TCV A;  4JXQ A;  2GAN A;  1YLE A;  3GKR A;  3C26 A;  2Q04 A;  1XE4 A;  4XPK A;  5KTD A;  4KOT A;  4H6Z A;  1FY7 A;  1Y9W A;  3H4Q A;  4HNX B;  2R8V A;  1S60 A;  4JLY A;  5F47 A;  3S6K A;  4F6A A;  1Y7R A;  2HUZ A;  1CM0 A;  3S6G A;  1S7N A;  1MJB A;  4PSW A;  1XMT A;  2I00 A;  3CXS A;  2AE6 A;  2FS5 A;  2JDC A;  2ARH A;  3R9F A;  2VI7 A;  1S3Z A;  2ZPA A;  5DWM A;  5KTC A;  1P0H A;  3TO6 A;  3V8I A;  2G3A A;  2Q44 A;  3D2M A;  2QML A;  1BOB A;  1PU9 A;  4ORF A;  4U9Y A;  1TIQ A;  2H5M A;  4E0A A;  1KUX A;  2B3V A;  3TO9 A;  2KCW A;  5HMN A;  4M3S A;  2CNS A;  2ZXV A;  3OWC A;  2FIA A;  4JD6 A;  3TT2 A;  5IX3 A;  5HH1 A;  2NMT A;  4MBU A;  4KVX A;  1OZP A;  1N71 A;  1Y9K A;  2P6G A;  2B4D B;  3DR8 A;  3PZJ A;  3B8G A;  3JUW A;  5EC4 A;  3VWE A;  4ZBG A;  1KZF A;  3TE4 A;  2D4P A;  1I21 A;  4NSQ A;  2OZH A;  4CAV A;  2VZY A;  2P6F A;  2REF A;  3BJ8 A;  4HNW B;  2EVN A;  4FD7 A;  4JJX A;  1IYK A;  2J8N A;  4R3K A;  3FBU A;  3EXN A;  1LRZ A;  4X5K A;  4JWP A;  4U5Y A;  1M4D A;  5JPH A;  4KOY A;  5KTA A;  4NXY A;  5C82 A;  3R96 A;  1BO4 A;  1IID A;  4E2A A;  2ZW5 A;  2Z10 A;  2ZW6 A;  3T9Y A;  2Z11 A;  2G0B A;  4AVB A;  1YX0 A;  2Y0M A;  4KOS A;  2OU2 A;  3TOB A;  4B5P A;  4Y49 B;  3NE7 A;  4II9 A;  1S7L A;  2OZU A;  4AVA A;  2R7H A;  1B6B A;  2B3U A;  2VXK A;  3R1K A;  1R57 A;  1L0C A;  3D2P A;  2FXF A;  4CAX A;  4XNH B;  4NEX A;  5J8F A;  1WK4 A;  4AB7 A;  1GHE A;  2FT0 A;  5EBV A;  1SQH A;  3R9E A;  2I79 A;  1NE9 A;  4FD6 A;  1M44 A;  4JXR A;  2B4D A;  5GCN A;  4CRZ B;  4KLW A;  3TO7 A;  2BL1 A;  3QB8 A;  4PV6 A;  2QIR A;  2F5I A;  1UFH A;  4MY3 A;  4L89 A;  1Q2C A;  3VWD A;  4EVY A;  3R95 A;  4M85 A;  4KOW A;  1YRE A;  1KUY A;  2VEZ A;  3K9U A;  4XPL A;  2FIW A;  5E96 A;  5I0C A;  2WPX A;  5F49 A;  4AG7 A;  5J8C A;  4HKF A;  2HQY A;  2GE3 A;  2CY2 A;  4KVO E;  4MY0 A;  1S7K A;  1YK3 A;  2WPW A;  1ON0 A;  3DDD A;  4NCZ A;  4R9M A;  3E0K A;  4XPD B;  1I12 A;  4QUS A;  2B4B A;  1QSN A;  4KOX A;  5H84 A;  3BJ7 A;  2B5G B;  3F0A A;  4LX9 A;  1RXT A;  2QEC A;  2VZZ A;  3F8K A;  4AVC A;  2JDD A;  2VQY A;  3SXN A;  3S6H A;  2A4N A;  1QSM A;  4OLL A;  3FIX A;  4RS2 A;  3DR6 A;  3QAH A;  3PP9 A;  1YR0 A;  3I3G A;  4CRY B;  4CAW A;  2P6E A;  2ZW7 A;  1CJW A;  2C27 A;  4RI1 A;  4UWJ A;  2HV2 A;  1YVO A;  2PDO A;  3TFY A;  3T90 A;  4PK3 A;  1MK4 A;  3BLN A;  4ONU A;  1QSR A;  3DNS A;  4KOR A;  3IGR A;  4J3G A;  4F0Y A;  5JQ4 A;  4R57 A;  1RO5 A;  3P2H A;  1M1D A;  4I49 A;  4FD4 A;  4OAE A;  5IB0 A;  1Z4R A;  3FB3 A;  4MJ8 A;  3LOD A;  2FL4 A;  1K4J A;  2CNM A;  1J4J A;  4UBR A;  4OAD A;  2IL4 A;  2RC4 A;  2OB0 A;  5ISV A;  1PUA A;  2D4O A;  3TTH A;  4CS0 B;  1MJ9 A;  2VBQ A;  2X7B A;  4QVT A;  4B5P B;  1QST A;  4YFJ A;  2PC1 A;  2Q7B A;  2PR1 A;  3IWG A; 
#chains in the Genus database with same CATH topology
 3VH9 A;  2O4H A;  3EY5 A;  5K8N A;  2V8D A;  4R76 A;  2PRB A;  3I9S A;  1ZG8 A;  3PFE A;  2WZN A;  2CNT A;  2DXQ A;  3D7G A;  4KSA A;  4R87 A;  4UA3 A;  5CNP A;  4C7H A;  1Q2D A;  4ZY1 A;  2CIJ A;  4IAV A;  4IUS A;  4OC5 A;  4KLV A;  5AG7 A;  3F5B A;  1M4I A;  5H86 A;  5HXD A;  4MFZ A;  2PCU A;  2PJ6 A;  1V0C A;  4CGP A;  3IU1 A;  1XEB A;  2J9A A;  1VKC A;  2G3T A;  2R1I A;  4NGR A;  3EO4 A;  4Q38 A;  2Q51 A;  1EE3 P;  1YVK A;  3KAS A;  4LQ6 A;  4M6I A;  4NGP A;  3ZZI A;  1Q7L A;  3ZJ0 A;  1AMP A;  5IB9 A;  4B5O A;  4H89 A;  2YNC A;  2EWB A;  3NH8 A;  2HB6 A;  4Y49 C;  4Q36 A;  4PXE A;  1IIC A;  2AFU A;  4BMH A;  2GIV A;  2OH1 A;  3FYN A;  1RTQ A;  2GLJ A;  3PB9 X;  3S6F A;  2ODF A;  2JLM A;  2O28 A;  3SI2 A;  3UY5 A;  3W6X A;  4U9Z A;  2ZOF A;  5JM6 A;  4B6Z A;  1ZLH A;  4PSX A;  1IY7 A;  1XBU A;  4GM5 A;  3RNZ A;  2P0W A;  2PJ8 A;  3EFA A;  3PGP A;  4GS4 A;  4KOV A;  4KOU A;  4UF4 A;  2B58 A;  4ZX9 A;  1Y7E A;  1IU8 A;  2Z0Z A;  3B3S A;  1BPN A;  3MGD A;  4O23 A;  4NGM A;  4P4J A;  1TF8 A;  4Q7A A;  1PYT B;  2V77 A;  5I4M A;  2WUU A;  3K9T A;  5G20 A;  4A32 A;  4DYO A;  3D66 A;  3D8P A;  2PSW A;  2I3C A;  3NA6 A;  3QAY A;  2JEV A;  2Z3M A;  3PB6 X;  2J8R A;  5FVJ A;  4MCS A;  1ELM P;  3KL9 A;  4KVM E;  4A95 A;  4LUA A;  3IWE A;  3DSB A;  4XNH C;  4B11 A;  4B12 A;  2YNE A;  5LRJ A;  4CAF A;  4ONW A;  3D4U A;  4IHM A;  4UEF A;  1YQE A;  3W91 A;  4NJQ A;  2B5G A;  4NGT A;  4PPZ A;  4E8O A;  2G9D A;  3KI9 A;  4G1P A;  4MFL A;  2J8M A;  1S5K A;  2C6P A;  3P2F A;  3LD2 A;  3NFZ A;  4JYW A;  3FXT A;  5THW A;  2PR8 A;  2ZW4 A;  4YGO A;  4UCM A;  1IB1 E;  4M6G A;  2AFZ A;  5G22 A;  2ATR A;  2WSA A;  2PJ0 A;  1M4L A;  1XF8 A;  3GYA A;  4YRH A;  2PJ4 A;  2EUI A;  5A28 A;  3D7H A;  4P4E A;  2PQ8 A;  2RB7 A;  4B10 A;  3GB0 A;  1Z4E A;  5IV0 A;  4MFJ A;  3A9L A;  3FRM A;  4MHD A;  1P4N A;  5DWN A;  3HLP A;  2V8V A;  2K5T A;  4OC2 A;  3SI1 A;  4F9V A;  4XPD C;  3CXQ A;  3N7Z A;  1S7F A;  5C88 A;  1NMT A;  1YGH A;  4OKO A;  2BUE A;  2GU2 A;  1F2O A;  4QB9 A;  4PK2 A;  1IGB A;  3B7I A;  1F57 A;  1Q2Y A;  2BSW A;  1MJA A;  1NSL A;  1U6M A;  4CYQ A;  4QBJ A;  1IOI A;  3CXP A;  1IOF A;  2JBJ A;  2REE A;  4NFR A;  4EWT A;  4IF5 A;  3R9G A;  3KR4 A;  4NJR A;  5ELY A;  3D67 A;  4F9U A;  1TXR A;  2VL1 A;  1VGY A;  2Q0Y A;  3G3S A;  3IFE A;  1QSO A;  1ZG7 A;  1XIX A;  2JEW A;  3BHX A;  3D7D A;  3G8W A;  4K30 A;  4NF1 A;  3RYO A;  2PE3 A;  3SI0 A;  2BEI A;  3FNC A;  4ZYQ A;  4KS9 A;  2FSR A;  4UWI A;  3LWU A;  3WAB A;  5F48 A;  1Z9U A;  2BO9 A;  3S9M A;  2YNC C;  3S9N A;  3TOA A;  4RUH A;  2PIZ A;  5EMI A;  3RZA A;  1I1D A;  2PIY A;  3D3S A;  5F46 A;  2AJ6 A;  1KUV A;  5F09 A;  3FJU A;  4EME A;  5CPA A;  4FD5 A;  2NYQ A;  3SJE A;  3MRU A;  3SHP A;  3WR7 A;  3B2Y A;  1HDQ A;  3GY9 A;  4R3L A;  3KKW A;  4KZT A;  4AG9 A;  4B14 A;  4L8A A;  4KSF A;  2OZG A;  4DNC A;  3JVN A;  1VHS A;  3W6S A;  3SXO A;  2PJ7 A;  2R98 A;  4OME A;  3L2N A;  4A31 A;  1B87 A;  1Z2L A;  2FE7 A;  2ZEH A;  1WWZ A;  5LYI A;  3EC4 A;  4H6U A;  4QC6 A;  4ZX8 A;  1IYL A;  1M4G A;  2Q4V A;  3B3T A;  4HNY B;  5D29 A;  2EO8 A;  4UIA A;  2FCK A;  2Q4Y A;  2PJC A;  1LAN A;  4MI4 A;  4KUA A;  4KUB A;  3TCV A;  4IK2 A;  4JXQ A;  2GAN A;  4PXB A;  1YLE A;  4YWY A;  3GKR A;  2Q43 A;  3CPX A;  3C26 A;  4C2Z A;  2Q04 A;  4CGL A;  1XE4 A;  4XPK A;  2AFW A;  1KWM A;  4C2Y A;  5KTD A;  3KR5 A;  3PB7 X;  1Y0Y A;  4KOT A;  4H6Z A;  4PXC A;  4YU9 A;  1FY7 A;  1Y9W A;  3CPA A;  3H4Q A;  4HNX B;  1YW4 A;  1TF9 A;  2EBJ A;  2R8V A;  3CZX A;  1S60 A;  4JLY A;  4ZY0 A;  2AFS A;  2PJA A;  4R7M A;  6CPA A;  3KZW A;  5F47 A;  3S6K A;  7CPA A;  4F6A A;  4FUU A;  1Y7R A;  2HUZ A;  1CM0 A;  4FWU A;  2ZOG A;  3S6G A;  4TWE A;  4CGM A;  5K8O A;  3ISX A;  1S7N A;  1MJB A;  3WC6 A;  1YSJ A;  4PSW A;  1XMT A;  3JTK A;  2Z3K A;  4UIB A;  3IJ3 A;  2I00 A;  3CXS A;  4P4D A;  4MHZ A;  2AE6 A;  2FS5 A;  2JDC A;  2ARH A;  4UFV A;  1TKF A;  2HC9 A;  3R9F A;  3S9L A;  4OIW A;  2JBK A;  2YGW A;  2ZEF A;  1XMB A;  3TC8 A;  2VI7 A;  2PJ1 A;  4OP4 A;  4P4I A;  1S3Z A;  2ZPA A;  5DWM A;  4MFP A;  5KTC A;  1P0H A;  3TO6 A;  3V8I A;  2G3A A;  4MHP A;  5J1Q A;  2Q44 A;  5DS0 A;  3D2M A;  3VAR A;  2QML A;  1BOB A;  1PU9 A;  4ORF A;  4PQA A;  4U9Y A;  1TIQ A;  2AFX A;  2H5M A;  1KUX A;  4CAE A;  4E0A A;  1JWQ A;  2ZEN A;  3PBE A;  2B3V A;  3TO9 A;  1CPS A;  2KCW A;  1GYT A;  2IQ6 A;  5HMN A;  3VAT A;  4M3S A;  2ZEM A;  3FF3 A;  3BI0 A;  3PEI A;  4A2Z A;  2CNS A;  1ZG9 A;  2NSM A;  2ZXV A;  3OWC A;  2FIA A;  4JD6 A;  3TT2 A;  2DF5 A;  5IX3 A;  5HH1 A;  2NMT A;  4WJB A;  4MBU A;  2IMO A;  1JQG A;  3PRT A;  4KVX A;  2PJ9 A;  1OZP A;  3KHX A;  2OOT A;  1BLL E;  1BPM A;  1N71 A;  4JZ0 A;  2WYR A;  1Z5R A;  1Y9K A;  2P6G A;  4RN7 A;  2B4D B;  3DR8 A;  3H8F A;  3PZJ A;  4C68 A;  4C7I A;  4OID A;  3B8G A;  3IIB A;  3JUW A;  5EC4 A;  4K3N A;  3VWE A;  3LMS A;  4ZBG A;  4P6Y A;  3WC7 A;  1KZF A;  3H8G A;  3TE4 A;  3FMC A;  5HVG A;  2EK9 A;  4P4F A;  2QVP A;  3DGV A;  2D4P A;  1I21 A;  4NSQ A;  3B35 A;  2DEA A;  2OZH A;  4W9Y A;  4CAV A;  1LAM A;  3KQX A;  2VZY A;  2P6F A;  2PVW A;  2REF A;  5LYF A;  4A33 A;  3BJ8 A;  4HNW B;  2EVN A;  3B3W A;  4FD7 A;  4JJX A;  4HPS A;  1Y0R A;  4NGS A;  1QQ9 A;  1FNO A;  3FEC A;  1IYK A;  2J8N A;  4R3K A;  5G21 A;  3RO0 A;  3FBU A;  2CF4 A;  3EXN A;  4OC4 A;  1LRZ A;  2AFO A;  1ARM A;  2Z3O A;  2YND A;  4P4B A;  5JGF A;  2Z3P A;  4R8F A;  3CDX A;  4X5K A;  5BWA B;  4JWP A;  4U5Y A;  4F8Z A;  1M4D A;  2QJ8 A;  2QYV A;  4ZGY B;  4CYN A;  5JPH A;  4KOY A;  5KTA A;  2CTC A;  4NXY A;  5C82 A;  3R96 A;  1BO4 A;  1IID A;  4E2A A;  2ZW5 A;  2Z10 A;  2ZW6 A;  3T9Y A;  4CPA A;  3B3C A;  4MHN A;  4UFW A;  4MXU A;  2Z11 A;  1PCA A;  2G0B A;  3NH5 A;  1UWY A;  4AVB A;  3FED A;  2PRQ A;  4OC3 A;  1YX0 A;  3WC5 A;  4UCN A;  1Z8X A;  3IO1 A;  2XEF A;  2Y0M A;  4KOS A;  3MN8 A;  4KSI A;  3IC1 A;  1X10 A;  3PB4 X;  2OU2 A;  3TOB A;  4B5P A;  1NSA A;  4Y49 B;  4FBE A;  3NE7 A;  8CPA A;  4II9 A;  1X12 A;  1CP7 A;  1S7L A;  2OZU A;  4AVA A;  3TX8 A;  1CP6 A;  2R7H A;  5AG4 A;  3FH4 A;  1B6B A;  5AGE A;  2B3U A;  3FEE A;  5HVF A;  4DUK A;  2VXK A;  1Z8T A;  3R1K A;  4PXD A;  1R57 A;  1L0C A;  3IEH A;  2DPT A;  4MFQ A;  3D2P A;  2FXF A;  4UEE A;  5LYD A;  4CAX A;  4XNH B;  4DJL A;  4NEX A;  5J8F A;  1CPX A;  3N5F A;  1WK4 A;  4CYO A;  2Q7S A;  4AB7 A;  1GHE A;  2FT0 A;  3H5Z A;  4BBH A;  5K8M A;  5EBV A;  1SQH A;  4H2K A;  2PJ3 A;  2I79 A;  3KHZ A;  3R9E A;  1NE9 A;  2GRE A;  2XEG A;  1TKJ A;  2ANP A;  3LAC A;  4FD6 A;  1M44 A;  4JXR A;  2B4D A;  3PFO A;  5GCN A;  3JRU A;  4CRZ B;  1ZO0 A;  4KLW A;  3TO7 A;  2BL1 A;  3QB8 A;  1VHE A;  4PV6 A;  2QIR A;  3FX6 A;  1LFW A;  1UFH A;  2F5I A;  4MCP A;  4MY3 A;  4UEZ A;  4L89 A;  1Q2C A;  5LRG A;  3CT9 A;  4MFK A;  3KQZ A;  3VWD A;  4EVY A;  1QMU A;  4NGQ A;  3R95 A;  4M85 A;  4KOW A;  1YRE A;  1KUY A;  2GFQ A;  2VEZ A;  4MMO A;  3V7Z A;  3WT4 A;  1AUG A;  2POK A;  2Q4Z A;  3K9U A;  2FIW A;  4XPL A;  4P10 A;  4CGO A;  5E96 A;  1R3N A;  4TNU A;  4A38 A;  3FVL A;  3GIU A;  5I0C A;  4A37 A;  4C2X A;  2WPX A;  5F49 A;  2BCO A;  4AG7 A;  1VIX A;  4AXV A;  5J8C A;  1XFO A;  2Z3L A;  4HKF A;  4LQG A;  2HQY A;  2GE3 A;  1HEE A;  4M6H A;  2CY2 A;  4UCP A;  4KVO E;  4MY0 A;  1S7K A;  1YK3 A;  2WPW A;  1ON0 A;  2XEI A;  3DDD A;  4NCZ A;  1ELL P;  4R9M A;  3E0K A;  3IU2 A;  1Z8L A;  5G1Z A;  4XPD B;  4X3R A;  2DPS A;  3ISZ A;  1I12 A;  2Z3N A;  5CBM A;  1XJO A;  4QUS A;  5JH9 A;  2B4B A;  4R6T A;  1QSN A;  4KOX A;  4WWV A;  2EK8 A;  5H84 A;  3BJ7 A;  4P44 A;  4ZY2 A;  2FVG A;  1TKH A;  2IJZ A;  4X8I A;  2B5G B;  3F0A A;  4LX9 A;  1RXT A;  2QEC A;  2VZZ A;  3F8K A;  2ZEP A;  4MRI A;  4AVC A;  2JDD A;  2VQY A;  4CYP A;  4UFX A;  3SXN A;  3D7F A;  4GXH A;  3S6H A;  2A4N A;  4NGN A;  1QSM A;  2ZEG A;  4OLL A;  1YLO A;  3FIX A;  4RS2 A;  3DR6 A;  5D8N A;  1LCP A;  1XRY A;  4ZI6 A;  5LRK A;  5HVH A;  4B13 A;  1H8L A;  4BIN A;  2RFH A;  3QAH A;  1F2P A;  3NE8 A;  3PP9 A;  3PBB A;  1YR0 A;  1BAV A;  2PJ5 A;  3I3G A;  2F8H A;  4CRY B;  4CAW A;  4F0X A;  2C6G A;  5AG5 A;  2P6E A;  2GLF A;  2ZW7 A;  4CGN A;  3RAM A;  4OC0 A;  3PB8 X;  1CJW A;  1ARL A;  4A30 A;  3GUX A;  3H8E A;  1R43 A;  2C27 A;  4RI1 A;  1DTD A;  4UWJ A;  2HV2 A;  1AYE A;  1HDU A;  1YME A;  1YVO A;  3IWW A;  2PDO A;  3SJX A;  3TFY A;  1Z8W A;  1CG2 A;  1OBR A;  3T90 A;  2V8H A;  3QNV A;  2OR4 A;  4A39 A;  3BI1 A;  4FAI A;  1DE4 C;  4PK3 A;  2CXA A;  1MK4 A;  3BLN A;  4ONU A;  5A27 A;  1QSR A;  3DNS A;  2BOA A;  1LOK A;  5AG6 A;  4KOR A;  3IGR A;  4J3G A;  2PJB A;  2XEJ A;  3KGQ A;  4F0Y A;  5JQ4 A;  4R57 A;  5LYL A;  1ZLI A;  1RO5 A;  2F7V A;  3P2H A;  2V8G A;  4MHY A;  3BXM A;  1M1D A;  4I49 A;  4FD4 A;  4X2T A;  4MCR A;  4OAE A;  2C1C A;  4A94 A;  5IB0 A;  4OC1 A;  1Z4R A;  2ABZ A;  3B3V A;  3FB3 A;  4MJ8 A;  2PJ2 A;  3LOD A;  2FL4 A;  3HUV A;  1CX8 A;  1K4J A;  3NH4 A;  1FT7 A;  3SJG A;  2ZEL A;  2CNM A;  2ZEE A;  3I1U A;  1J4J A;  3T8W A;  4UBR A;  3K2K A;  3GLJ A;  4OAD A;  2IL4 A;  2CTB A;  2RC4 A;  3RBU A;  2OB0 A;  2ZEO A;  3V38 A;  5ISV A;  4EFD A;  1YW6 A;  3D68 A;  1PUA A;  1XOV A;  2D4O A;  3TTH A;  3SJF A;  1A2Z A;  4CS0 B;  1MJ9 A;  1LAP A;  2O53 A;  4P45 A;  3DLJ A;  5K8P A;  1VHO A;  2VBQ A;  4Z65 A;  4BD9 A;  2AFM A;  2X7B A;  2PVV A;  4QVT A;  4B5P B;  2ZED A;  1QST A;  4YFJ A;  1CBX A;  2PC1 A;  2Q7B A;  2PR1 A;  4MCQ A;  3IWG A;  2C6C A; 
#chains in the Genus database with same CATH homology
 3EY5 A;  2PRB A;  3I9S A;  4R87 A;  4UA3 A;  2CNT A;  2DXQ A;  4C7H A;  4KSA A;  5CNP A;  1Q2D A;  4IUS A;  5AG7 A;  4KLV A;  3F5B A;  1M4I A;  5H86 A;  4MFZ A;  1V0C A;  4CGP A;  3IU1 A;  1XEB A;  1VKC A;  2G3T A;  2R1I A;  3EO4 A;  4Q38 A;  1YVK A;  3ZZI A;  3ZJ0 A;  4B5O A;  4H89 A;  2YNC A;  4Y49 C;  4Q36 A;  1IIC A;  4BMH A;  2GIV A;  2OH1 A;  3FYN A;  3S6F A;  3W6X A;  2JLM A;  2O28 A;  3UY5 A;  4U9Z A;  4PSX A;  2P0W A;  3EFA A;  4KOV A;  3PGP A;  4GS4 A;  4KOU A;  2B58 A;  2Z0Z A;  3MGD A;  2WUU A;  4A32 A;  5G20 A;  3D8P A;  2PSW A;  2JEV A;  2Z3M A;  2J8R A;  5FVJ A;  4KVM E;  4A95 A;  4LUA A;  3IWE A;  3DSB A;  4XNH C;  4B11 A;  4B12 A;  2YNE A;  4CAF A;  3W91 A;  2B5G A;  4E8O A;  4MFL A;  2J8M A;  1S5K A;  3P2F A;  3LD2 A;  3FXT A;  2PR8 A;  2ZW4 A;  4YGO A;  4UCM A;  1IB1 E;  5G22 A;  2ATR A;  2WSA A;  3GYA A;  1XF8 A;  4YRH A;  2EUI A;  5A28 A;  2PQ8 A;  4B10 A;  1Z4E A;  5IV0 A;  4MFJ A;  3A9L A;  3FRM A;  4MHD A;  1P4N A;  5DWN A;  2K5T A;  4XPD C;  3CXQ A;  3N7Z A;  1S7F A;  5C88 A;  1NMT A;  1YGH A;  2BUE A;  4QB9 A;  4PK2 A;  1Q2Y A;  2BSW A;  1MJA A;  1NSL A;  1U6M A;  4CYQ A;  4QBJ A;  3CXP A;  2REE A;  4IF5 A;  3R9G A;  2Q0Y A;  3G3S A;  4K30 A;  1QSO A;  3G8W A;  1XIX A;  4NF1 A;  3RYO A;  2BEI A;  3FNC A;  4KS9 A;  2FSR A;  4UWI A;  5F48 A;  1Z9U A;  2YNC C;  3TOA A;  1I1D A;  3D3S A;  5F46 A;  2AJ6 A;  1KUV A;  4FD5 A;  3SHP A;  3WR7 A;  4R3L A;  3GY9 A;  4AG9 A;  3KKW A;  4KZT A;  4B14 A;  4DNC A;  4L8A A;  4KSF A;  2OZG A;  3JVN A;  1VHS A;  3W6S A;  3SXO A;  2R98 A;  4A31 A;  1B87 A;  2FE7 A;  1WWZ A;  3EC4 A;  4H6U A;  4QC6 A;  1IYL A;  1M4G A;  2Q4V A;  4HNY B;  2FCK A;  2Q4Y A;  4MI4 A;  4KUA A;  4KUB A;  3TCV A;  4JXQ A;  2GAN A;  1YLE A;  3GKR A;  3C26 A;  4C2Z A;  2Q04 A;  4CGL A;  1XE4 A;  4XPK A;  5KTD A;  4C2Y A;  4KOT A;  4H6Z A;  1FY7 A;  1Y9W A;  3H4Q A;  4HNX B;  2R8V A;  1S60 A;  4JLY A;  5F47 A;  3S6K A;  4F6A A;  1Y7R A;  2HUZ A;  1CM0 A;  3S6G A;  4CGM A;  1S7N A;  1MJB A;  4PSW A;  1XMT A;  3JTK A;  2Z3K A;  2I00 A;  3CXS A;  2AE6 A;  2FS5 A;  2JDC A;  2ARH A;  4UFV A;  3R9F A;  2YGW A;  2VI7 A;  1S3Z A;  2ZPA A;  5DWM A;  4MFP A;  5KTC A;  1P0H A;  3TO6 A;  3V8I A;  2G3A A;  2Q44 A;  3D2M A;  2QML A;  1BOB A;  1PU9 A;  4ORF A;  4U9Y A;  4CAE A;  1TIQ A;  2H5M A;  4E0A A;  1KUX A;  2B3V A;  3TO9 A;  2KCW A;  5HMN A;  4M3S A;  4A2Z A;  2CNS A;  2ZXV A;  3OWC A;  2FIA A;  4JD6 A;  3TT2 A;  5IX3 A;  5HH1 A;  2NMT A;  4MBU A;  4KVX A;  1OZP A;  1N71 A;  1Y9K A;  2P6G A;  4C68 A;  2B4D B;  3DR8 A;  3PZJ A;  4C7I A;  3B8G A;  3JUW A;  5EC4 A;  3VWE A;  4ZBG A;  1KZF A;  3TE4 A;  2D4P A;  1I21 A;  4NSQ A;  2OZH A;  4CAV A;  2VZY A;  2P6F A;  2REF A;  4A33 A;  3BJ8 A;  4HNW B;  2EVN A;  4FD7 A;  4JJX A;  5G21 A;  1IYK A;  2J8N A;  4R3K A;  3FBU A;  3EXN A;  1LRZ A;  2Z3O A;  2YND A;  2Z3P A;  4X5K A;  5BWA B;  4JWP A;  4U5Y A;  1M4D A;  4ZGY B;  4CYN A;  5JPH A;  4KOY A;  5KTA A;  4NXY A;  5C82 A;  3R96 A;  1BO4 A;  1IID A;  4E2A A;  2ZW5 A;  2Z10 A;  2ZW6 A;  3T9Y A;  4UFW A;  2Z11 A;  2G0B A;  4AVB A;  1YX0 A;  4UCN A;  2Y0M A;  4KOS A;  2OU2 A;  3TOB A;  4B5P A;  4Y49 B;  3NE7 A;  4II9 A;  1S7L A;  2OZU A;  4AVA A;  2R7H A;  5AG4 A;  1B6B A;  5AGE A;  2B3U A;  2VXK A;  3R1K A;  1R57 A;  1L0C A;  2DPT A;  4MFQ A;  3D2P A;  2FXF A;  4CAX A;  4XNH B;  4NEX A;  5J8F A;  1WK4 A;  4CYO A;  4AB7 A;  1GHE A;  2FT0 A;  3H5Z A;  4BBH A;  5EBV A;  1SQH A;  3R9E A;  2I79 A;  1NE9 A;  4FD6 A;  1M44 A;  4JXR A;  2B4D A;  5GCN A;  4CRZ B;  1ZO0 A;  4KLW A;  3TO7 A;  2BL1 A;  3QB8 A;  4PV6 A;  2QIR A;  2F5I A;  1UFH A;  4MY3 A;  4L89 A;  1Q2C A;  4MFK A;  3VWD A;  4EVY A;  3R95 A;  4M85 A;  4KOW A;  1YRE A;  1KUY A;  2VEZ A;  3K9U A;  4XPL A;  2FIW A;  4CGO A;  5E96 A;  5I0C A;  4C2X A;  2WPX A;  5F49 A;  4AG7 A;  5J8C A;  2Z3L A;  4HKF A;  2HQY A;  2GE3 A;  2CY2 A;  4UCP A;  4KVO E;  4MY0 A;  1S7K A;  1YK3 A;  2WPW A;  1ON0 A;  3DDD A;  4NCZ A;  4R9M A;  3E0K A;  3IU2 A;  5G1Z A;  4XPD B;  2DPS A;  1I12 A;  2Z3N A;  4QUS A;  2B4B A;  1QSN A;  4KOX A;  5H84 A;  3BJ7 A;  2B5G B;  3F0A A;  4LX9 A;  1RXT A;  2QEC A;  2VZZ A;  3F8K A;  4AVC A;  2JDD A;  2VQY A;  4CYP A;  4UFX A;  3SXN A;  3S6H A;  2A4N A;  1QSM A;  4OLL A;  3FIX A;  4RS2 A;  3DR6 A;  4B13 A;  3QAH A;  3PP9 A;  1YR0 A;  3I3G A;  4CRY B;  4CAW A;  4F0X A;  5AG5 A;  2P6E A;  2ZW7 A;  4CGN A;  1CJW A;  4A30 A;  2C27 A;  4RI1 A;  4UWJ A;  2HV2 A;  1YVO A;  2PDO A;  3TFY A;  3T90 A;  4PK3 A;  2CXA A;  1MK4 A;  3BLN A;  4ONU A;  5A27 A;  1QSR A;  3DNS A;  5AG6 A;  4KOR A;  3IGR A;  4J3G A;  4F0Y A;  5JQ4 A;  4R57 A;  1RO5 A;  3P2H A;  1M1D A;  4I49 A;  4FD4 A;  4OAE A;  5IB0 A;  1Z4R A;  3FB3 A;  4MJ8 A;  3LOD A;  2FL4 A;  1K4J A;  2CNM A;  1J4J A;  4UBR A;  4OAD A;  2IL4 A;  2RC4 A;  2OB0 A;  5ISV A;  1PUA A;  2D4O A;  3TTH A;  4CS0 B;  1MJ9 A;  2VBQ A;  2X7B A;  4QVT A;  4B5P B;  1QST A;  4YFJ A;  2PC1 A;  2Q7B A;  2PR1 A;  3IWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...