4QVTA

Crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of predicted N-acyltransferase (ypeA) in complex with acetyl-CoA from Escherichia coli
rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords Acetyltransferase YpeA
total genus 39
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qvtA01
1I12A 2EUIA 3G3SA 4AG9A 1I1DA 1QSMA 5F48A 4QB9A 5ISVA 2J8MA 4HNWB 5F47A 5J8FA 1P4NA 2KCWA 3FYNA 2Q04A 4JJXA 3TOAA 4KOVA 2B5GA 4R87A 3TT2A 2BL1A 4NEXA 2J8NA 2ATRA 3T9YA 1YK3A 4B5PB 4XNHB 4CRYB 2D4PA 4H89A 3EC4A 2PR1A 4JXQA 3P2FA 3W6XA 3QB8A 3R9FA 4FD7A 3FXTA 1S7KA 2R98A 1WWZA 1FY7A 1R57A 1S5KA 3BJ7A 2VI7A 3ZJ0A 2OZUA 1PUAA 2Y0MA 3QAHA 3OWCA 5KTAA 1U6MA 3PZJA 3C26A 2AE6A 4DNCA 2B4DA 5HH1A 2JLMA 2Q7BA 2P6EA 1Q2CA 4XPKA 3TTHA 4FD5A 2VBQA 1NE9A 3R96A 4XPLA 3FBUA 4M85A 1Z4EA 4J3GA 2A4NA 2CNSA 3I9SA 4E2AA 4F6AA 1Q2YA 4MY0A 5H86A 4KORA 2R8VA 2VQYA 1QSTA 1Y9WA 4EVYA 2OH1A 3UY5A 5H84A 4UBRA 1RXTA 2OB0A 4CS0B 4MY3A 1J4JA 1M4IA 2OZHA 2C27A 4FD6A 3SHPA 4E8OA 3DNSA 3G8WA 2DXQA 2Q0YA 2K5TA 3R95A 4GS4A 4JWPA 4KOYA 5HMNA 2PC1A 4QVTA 3F8KA 3R9EA 3W91A 3TE4A 4H6UA 2OZGA 4NXYA 4KOTA 4NF1A 4KLWA 4KUAA 5JQ4A 2QIRA 2H5MA 3PGPA 1V0CA 4CAVA 2J8RA 2VEZA 4I49A 4U9ZA 5DWNA 1M44A 2F5IA 4QUSA 2FE7A 5EBVA 2B4DB 2Z0ZA 2ZXVA 1S60A 1K4JA 1KZFA 2BEIA 2EVNA 4LUAA 4R9MA 5FVJA 2AJ6A 1OZPA 3H4QA 2G3TA 2P0WA 2ZW7A 3TCVA 4YGOA 4ONUA 1M4DA 3MGDA 2FXFA 3D2PA 4OAEA 2JDCA 3K9UA 1Y9KA 3R1KA 4R3KA 2CNMA 4XPDB 2ZW5A 3FNCA 2WPXA 2B3VA 1LRZA 1XF8A 1YX0A 2GE3A 3FIXA 4UA3A 4KUBA 4BMHA 1Z9UA 3DR6A 2PQ8A 1P0HA 2NMTA 3TFYA 1MJ9A 4E0AA 4U9YA 2FT0A 1GHEA 3DDDA 5F49A 2FIAA 3DR8A 4H6ZA 3D3SA 1S7FA 2D4OA 3EY5A 3GKRA 4AB7A 4LX9A 1IB1E 1B87A 3V8IA 4Y49B 5JPHA 2I79A 4OADA 2P6GA 1XEBA 2Z10A 1YREA 3DSBA 4YFJA 2FS5A 2X7BA 3I3GA 3CXSA 4KOUA 1ON0A 3TO6A 3LODA 1Z4RA 3E0KA 4KVOE 3S6KA 4UWJA 5IX3A 1Y7RA 1S3ZA 5IB0A 3PP9A 1UFHA 1PU9A 4YRHA 1XE4A 4FD4A 2OU2A 1VKCA 4IF5A 1YLEA 1QSNA 4U5YA 1CJWA 1I21A 1IYLA 2Q4YA 4IUSA 4JXRA 4KVME 4PV6A 3VWDA 3IGRA 2Q4VA 4HNXB 3EXNA 4UWIA 2VZZA 1IICA 3TO7A 1KUVA 4F0YA 4CAXA 1IIDA 4NSQA 5KTDA 4JD6A 2B3UA 2R7HA 3D8PA 1YR0A 1TIQA 3FB3A 4B5PA 4KOXA 1QSOA 2Z11A 2VXKA 3F0AA 4MI4A 2Q44A 1MK4A 2PSWA 4OLLA 2R1IA 2PRBA 1XMTA 1M1DA 1KUYA 2PR8A 4HKFA 1XIXA 1BOBA 2PDOA 2ZW6A 1NSLA 4AVCA 2G0BA 5I0CA 1QSRA 5C88A 4MJ8A 4JLYA 4KOWA 3N7ZA 4R57A 3ZZIA 2FL4A 2ZW4A 4QC6A 1MJAA 4L8AA 2I00A 3GYAA 2HQYA 4AG7A 3SXNA 3VWEA 3T90A 3S6GA 2GANA 5J8CA 4XPDC 3NE7A 4Y49C 3TOBA 3JVNA 3P2HA 3BLNA 3SXOA 2ARHA 3W6SA 3S6FA 1S7LA 4AVBA 3EO4A 2B4BA 2CY2A 2FIWA 2GIVA 3KKWA 4II9A 3RYOA 1YVKA 4NCZA 3EFAA 1L0CA 4PSWA 1S7NA 4PK3A 1N71A 3F5BA 1YVOA 1IYKA 5EC4A 2JDDA 2IL4A 1M4GA 2REFA 2G3AA 1CM0A 3IWGA 5KTCA 4B5OA 4ZBGA 3FRMA 2B5GB 1KUXA 2O28A 4ORFA 2WPWA 2HUZA 4QBJA 3JUWA 1B6BA 5GCNA 3BJ8A 3LD2A 2QECA 4MBUA 2BSWA 4XNHC 2FCKA 2HV2A 3CXPA 4PK2A 4KOSA 4X5KA 3S6HA 1MJBA 5C82A 1VHSA 2VZYA 2B58A 3TO9A 2JEVA 2FSRA 2CNTA 3GY9A 1WK4A 3WR7A 4L89A 2RC4A 4HNYB 3B8GA 4CRZB 4CAWA 1YGHA 2P6FA 4KVXA 4KLVA 4RI1A 2BUEA 4RS2A 2REEA 3R9GA 5DWMA 4PSXA 4AVAA 2ZPAA 3D2MA 4MHDA 4M3SA 1Q2DA 4K30A 4R3LA 2QMLA 1SQHA 5F46A 1RO5A 4KZTA 3CXQA 5IV0A 1BO4A 5CNPA 1NMTA 5E96A
chains in the Genus database with same CATH superfamily
4X3RA 1I12A 2EUIA 3IEHA 1LAMA 4AXVA 2ZEGA 2Z3PA 1X10A 2ZEDA 3G3SA 4R6TA 5HVGA 3KR4A 4AG9A 1I1DA 2JBKA 2O4HA 4UFWA 2PJ9A 1QSMA 5F48A 2GLFA 4LQ6A 3MN8A 4QB9A 4WWVA 5HVFA 4B11A 5ISVA 2J8MA 2PJ1A 4HNWB 5F47A 1FT7A 5J8FA 1LOKA 1P4NA 2KCWA 2Q43A 4IK2A 3KASA 3FYNA 2EK9A 2Q04A 4JJXA 2YGWA 4KOVA 3KR5A 1YSJA 3FMCA 2V77A 3TOAA 5HVHA 4X8IA 3LWUA 3BI0A 2B5GA 4R87A 3TT2A 3KHXA 3V38A 5J1QA 2BL1A 4NEXA 2J8NA 1AYEA 2ATRA 3T9YA 1YK3A 1ZG9A 1F2PA 4XNHB 4B5PB 4CRYB 2PJBA 4YU9A 2D4PA 4H89A 3EC4A 5LYLA 2VL1A 4MCRA 4UF4A 2PR1A 4JXQA 3K2KA 2GU2A 2IJZA 3L2NA 1Z8XA 3P2FA 3W6XA 3WC7A 2XEIA 3H5ZA 3QB8A 3R9FA 2PJ5A 3PFOA 4B10A 1VGYA 4DJLA 5HXDA 1BLLE 4FD7A 4NJRA 2WZNA 2PJAA 3FXTA 4F8ZA 1S7KA 1YLOA 3HUVA 3IFEA 5LYDA 3IO1A 2R98A 1WWZA 4A95A 3T8WA 1FY7A 1R57A 3WC6A 1S5KA 2CXAA 3BJ7A 2VI7A 2V8VA 3NFZA 3ZJ0A 4A32A 5DS0A 3GLJA 4MFLA 5A28A 2OZUA 4Q7AA 4KSAA 1PUAA 2Z3MA 1AMPA 2Y0MA 3QAHA 4Q36A 4MCSA 2AFZA 1PYTB 3OWCA 4MFZA 4W9YA 5KTAA 1ARMA 1YMEA 3IU1A 1U6MA 3PZJA 3C26A 3SJXA 2AE6A 4DNCA 4K3NA 2B4DA 5HH1A 4NGQA 4UFVA 4NGSA 2JLMA 4P44A 2Q7BA 5D29A 4PQAA 2P6EA 1Q2CA 4XPKA 4MHPA 3TTHA 4FD5A 3S9NA 1Z8TA 4UFXA 1IOIA 2VBQA 3PB8X 1NE9A 3FEDA 4R7MA 3RO0A 3R96A 4P4DA 4XPLA 5LYIA 3FBUA 2PVWA 4M85A 1Z4EA 4HPSA 1XMBA 3SI0A 4P4FA 4M6HA 2EBJA 2RFHA 2A4NA 2CNSA 2YNCC 3I9SA 4J3GA 4FBEA 3K9TA 3ISZA 4NGPA 4E2AA 4F6AA 1Q2YA 4MY0A 2IQ6A 5H86A 4KORA 5K8NA 3ISXA 4ZX8A 3CPXA 2R8VA 2VQYA 1QSTA 1X12A 1Y9WA 4EVYA 4R8FA 2PJCA 3FJUA 4IAVA 5I4MA 4C2XA 3DLJA 4ZY1A 4PXCA 1NSAA 2OH1A 3UY5A 5H84A 4UBRA 2OB0A 1RXTA 3D4UA 4CS0B 4MY3A 1J4JA 3RZAA 1M4IA 2V8HA 2DF5A 2OZHA 2C27A 4FD6A 4OC2A 2QJ8A 3SHPA 4E8OA 4FWUA 4UEEA 3DNSA 3G8WA 2BCOA 2DXQA 1CP6A 2Q0YA 4P4IA 2K5TA 4NGMA 3R95A 2Z3NA 3NH5A 2PVVA 3PFEA 4GS4A 3QNVA 2BO9A 4UEZA 4M6IA 4JWPA 4KOYA 5HMNA 2J9AA 2PC1A 3NA6A 4QVTA 2POKA 1IY7A 3F8KA 2DPSA 3B7IA 1CG2A 3TX8A 1IU8A 3MRUA 3R9EA 3W91A 4GM5A 4OKOA 4TNUA 3TE4A 2PCUA 4NGTA 5IB9A 1Z8LA 3LACA 4H6UA 4EWTA 3FECA 2OZGA 4NXYA 5AGEA 4M6GA 3VARA 4KOTA 4NF1A 3BXMA 4KLWA 4KUAA 4MFJA 4MHYA 3SJFA 1UWYA 5JQ4A 2QIRA 2H5MA 4RN7A 1ARLA 4YWYA 3BI1A 3PGPA 3B35A 1V0CA 1IOFA 1FNOA 3H8FA 2EK8A 4CAVA 2J8RA 2VEZA 3KZWA 4I49A 2WUUA 4U9ZA 1F2OA 2Z3KA 5DWNA 5LRJA 1M44A 2F5IA 2ZELA 3S9MA 4C2ZA 4QUSA 4CYOA 2FE7A 4R76A 3JRUA 4MRIA 2B4DB 2Z0ZA 5EBVA 2ZXVA 1S60A 1K4JA 1KZFA 2BEIA 2EVNA 4LUAA 4R9MA 3KL9A 2PRQA 5CBMA 5FVJA 4CGNA 4CYNA 2AJ6A 1OZPA 4CGLA 4UIAA 4C2YA 5K8OA 2C1CA 4OIWA 5AG6A 2DPTA 2F7VA 3D7GA 2ZEMA 3H4QA 4F9UA 5G22A 4PXDA 3KGQA 2G3TA 2P0WA 1ZG7A 2ZW7A 2ZEEA 3TCVA 4A94A 4YGOA 3KHZA 4ONUA 3RNZA 1M4DA 3MGDA 4CGPA 2FXFA 2ODFA 2JDCA 1Y9KA 3D2PA 3K9UA 4OAEA 3R1KA 4R3KA 4TWEA 4EFDA 2CNMA 4H2KA 2ZW5A 3FNCA 4XPDB 2WPXA 2B3VA 1LRZA 1XF8A 2O53A 3B3SA 1YX0A 2GE3A 4PXBA 3FIXA 4A2ZA 1LAPA 4UA3A 2C6GA 4NGRA 2FVGA 4KUBA 4BMHA 1XFOA 1Z9UA 1OBRA 2AFWA 1P0HA 2NMTA 2PQ8A 2XEJA 3D7HA 3DR6A 4MHZA 5G1ZA 3SI2A 3TFYA 4P10A 3FVLA 1LCPA 3CT9A 5THWA 1MJ9A 2WYRA 4DYOA 3S9LA 4E0AA 4U9YA 2FT0A 1GHEA 3D66A 3DDDA 4Z65A 4UCNA 3WABA 5F49A 2FIAA 3DR8A 4H6ZA 4UIBA 4A31A 3D3SA 4BINA 1S7FA 2D4OA 3IJ3A 2NYQA 1QQ9A 3EY5A 3GKRA 4LX9A 4OC5A 2PJ4A 3LMSA 4AB7A 1ELMP 1IB1E 1YW4A 1B87A 1ZLIA 3V8IA 4Y49B 5JPHA 2I79A 4OADA 4P4BA 5JH9A 2P6GA 5LRGA 1XEBA 2JEWA 5JM6A 1Q7LA 4P4EA 2Z10A 1YREA 2ZOFA 3DSBA 1Y0YA 1TKHA 2F8HA 4NGNA 1JWQA 2YNEA 4YFJA 2FS5A 2Q4ZA 2X7BA 4ONWA 3I3GA 4JZ0A 3CXSA 4KOUA 1ON0A 2Z3OA 5CPAA 3LODA 4PXEA 3TO6A 4MCQA 1Z4RA 3E0KA 4KVOE 5K8MA 3S6KA 4UWJA 1LANA 5IX3A 4B14A 1Y7RA 2AFMA 4OC1A 1S3ZA 1DTDA 3PB4X 2CTCA 5IB0A 3I1UA 1HDUA 3PP9A 1UFHA 1ZLHA 1PU9A 4OP4A 4YRHA 1XE4A 3DGVA 4FD4A 2OU2A 1VKCA 4IF5A 1YLEA 1QSNA 2AFXA 4U5YA 1TF9A 1CJWA 2CIJA 2ZEPA 3B3VA 1I21A 3B3TA 1IYLA 2I3CA 2Q4YA 1GYTA 1DE4C 3KQZA 4IUSA 3GIUA 4JXRA 4KVME 4P45A 2IMOA 4PV6A 2QYVA 1H8LA 1HEEA 3VWDA 1JQGA 2GFQA 3IGRA 3IWEA 2Q4VA 3WT4A 4HNXB 4CGMA 3EXNA 4UWIA 4CGOA 2VZZA 2XEGA 1IICA 3TO7A 2Z3LA 1KUVA 4CYPA 2OR4A 4PPZA 4F0YA 1XBUA 3FEEA 4CAXA 4MHNA 1IIDA 2CF4A 4MFQA 4NSQA 5KTDA 1VHOA 2V8DA 4JD6A 4CYQA 2QVPA 2B3UA 3NE8A 2R7HA 2ZEOA 3D8PA 5ELYA 5BWAB 1YR0A 6CPAA 1TIQA 1VHEA 3FB3A 3B2YA 4UCPA 2PIYA 4B5PA 4KOXA 4DUKA 1R43A 1QSOA 2Z11A 1Y0RA 4B6ZA 3H8GA 2VXKA 3NH8A 3F0AA 3V7ZA 4A33A 4MI4A 3PBBA 2PJ2A 2Q44A 4FUUA 1MK4A 3RBUA 2ANPA 1CBXA 2PSWA 2EWBA 2PJ0A 2AFOA 4OLLA 2R1IA 2PRBA 1XMTA 2AFSA 2BOAA 1M1DA 3D7FA 3H8EA 1KUYA 4A37A 4C7HA 4GXHA 4CPAA 2PR8A 4HKFA 5LRKA 1XIXA 1BOBA 2PDOA 2ZW6A 1NSLA 3SJGA 4B12A 4AVCA 2GLJA 4KS9A 3PBEA 2G0BA 4OMEA 5I0CA 1QSRA 1TKFA 4O23A 5F09A 4ZGYB 2DEAA 1TF8A 1EE3P 3WC5A 5C88A 2GREA 2AFUA 3KQXA 4JLYA 4KOWA 4MJ8A 5A27A 3N7ZA 1XRYA 1BPNA 4R57A 3RAMA 2FL4A 2PE3A 2ZW4A 3ZZIA 4QC6A 1MJAA 1XJOA 4L8AA 4A39A 2I00A 1CP7A 3GYAA 3FH4A 1VIXA 2HQYA 2WSAA 3SXNA 5D8NA 3VWEA 4AG7A 3T90A 2OOTA 3S6GA 1YW6A 2GANA 3PB7X 4C7IA 5J8CA 4XPDC 4MFKA 4CAFA 3NE7A 3VATA 2ZEFA 4Y49C 3JTKA 2NSMA 1AUGA 4G1PA 1LFWA 4BBHA 1M4LA 3TOBA 1TXRA 4A38A 2C6PA 3FF3A 3JVNA 4ZI6A 3IU2A 3BLNA 3P2HA 4P4JA 2ARHA 3SXOA 3W6SA 1QMUA 4CAEA 3HLPA 2ZOGA 3S6FA 5JGFA 1S7LA 3NH4A 4AVBA 3EO4A 2B4BA 2CY2A 3CZXA 3IC1A 2FIWA 2GIVA 3IWWA 1Z2LA 4ZY0A 3KKWA 4C68A 2V8GA 2XEFA 5EMIA 1ZO0A 4II9A 4MFPA 3RYOA 3CDXA 2HC9A 4X2TA 1YVKA 4NCZA 1CPXA 3CPAA 3EFAA 1L0CA 2YNDA 4P6YA 4BD9A 4EMEA 4PSWA 1S7NA 4PK3A 4ZX9A 3VH9A 2PIZA 2ZENA 1Z5RA 5AG7A 1N71A 3F5BA 1YVOA 2Q7SA 4LQGA 1IYKA 1YQEA 3KI9A 1XOVA 4OC4A 5K8PA 5EC4A 2JDDA 3PEIA 4JYWA 2IL4A 3A9LA 4B13A 1M4GA 2REFA 2G3AA 1CM0A 3IWGA 5KTCA 1ELLP 4MCPA 4B5OA 4ZBGA 4F0XA 3IIBA 3FRMA 2B5GB 1HDQA 1KUXA 5G20A 2JBJA 2O28A 4NFRA 4ORFA 5AG5A 8CPAA 2EO8A 2WPWA 3FX6A 1BPMA 2ABZA 2HUZA 2ZEHA 2CTBA 4QBJA 7CPAA 2PJ6A 2YNCA 3JUWA 1B6BA 5GCNA 3BJ8A 3LD2A 2QECA 3D7DA 4MXUA 4Q38A 4OC0A 4MBUA 2BSWA 3GUXA 3B3CA 4XNHC 2FCKA 2C6CA 2HV2A 3D68A 3QAYA 4F9VA 1ZG8A 5LYFA 1CX8A 3CXPA 4PK2A 4KOSA 5G21A 4X5KA 4FAIA 3S6HA 1KWMA 1F57A 3PB9X 1MJBA 5C82A 1VHSA 3GB0A 4WJBA 2VZYA 2B58A 3TO9A 2JEVA 2FSRA 2CNTA 3GY9A 1WK4A 3WR7A 3SI1A 3N5FA 4ZYQA 1R3NA 2PJ3A 4L89A 2RC4A 4OIDA 4HNYB 3B8GA 4CRZB 4CAWA 1YGHA 2P6FA 3D67A 4KSIA 4KVXA 1Z8WA 4KLVA 1BAVA 4RI1A 1RTQA 2BUEA 3BHXA 4RS2A 2REEA 3R9GA 5DWMA 3B3WA 4PSXA 3SJEA 1TKJA 2PJ8A 4AVAA 2ZPAA 3D2MA 4KSFA 1IGBA 4M3SA 1Q2DA 4K30A 4MHDA 2QMLA 1SQHA 1Y7EA 2G9DA 4R3LA 4A30A 2RB7A 4RUHA 5F46A 4ZY2A 2PJ7A 4NJQA 1RO5A 4KZTA 3CXQA 4MMOA 4OC3A 3PRTA 4IHMA 2HB6A 4UCMA 1BO4A 4UEFA 5CNPA 5IV0A 1A2ZA 1NMTA 5AG4A 1CPSA 5E96A 3PB6X 1PCAA 3TC8A 2Q51A
chains in the Genus database with same CATH topology
1I12A 2EUIA 2Z3PA 3G3SA 4AG9A 1I1DA 4UFWA 1QSMA 5F48A 4QB9A 5ISVA 4B11A 2J8MA 4HNWB 5F47A 5J8FA 1P4NA 2KCWA 3FYNA 2Q04A 4JJXA 2YGWA 4KOVA 3TOAA 2B5GA 4R87A 3TT2A 2BL1A 4NEXA 2J8NA 2ATRA 3T9YA 1YK3A 4B5PB 4XNHB 4CRYB 2D4PA 4H89A 3EC4A 2PR1A 4JXQA 3P2FA 3W6XA 3H5ZA 3QB8A 3R9FA 4B10A 4FD7A 3FXTA 1S7KA 2R98A 1WWZA 4A95A 1FY7A 1R57A 1S5KA 2CXAA 3BJ7A 2VI7A 3ZJ0A 4A32A 4MFLA 5A28A 2OZUA 4KSAA 1PUAA 2Z3MA 2Y0MA 3QAHA 4Q36A 3OWCA 4MFZA 5KTAA 3IU1A 1U6MA 3PZJA 3C26A 2AE6A 4DNCA 2B4DA 5HH1A 4UFVA 2JLMA 2Q7BA 2P6EA 1Q2CA 4XPKA 3TTHA 4FD5A 4UFXA 2VBQA 1NE9A 3R96A 4XPLA 3FBUA 4M85A 1Z4EA 4J3GA 2A4NA 2CNSA 2YNCC 3I9SA 4E2AA 4F6AA 1Q2YA 4MY0A 5H86A 4KORA 2R8VA 2VQYA 1QSTA 1Y9WA 4EVYA 4C2XA 2OH1A 3UY5A 5H84A 4UBRA 1RXTA 2OB0A 4CS0B 4MY3A 1J4JA 1M4IA 2OZHA 2C27A 4FD6A 3SHPA 4E8OA 3DNSA 3G8WA 2DXQA 2Q0YA 2K5TA 3R95A 2Z3NA 4GS4A 4JWPA 4KOYA 5HMNA 2PC1A 4QVTA 3F8KA 2DPSA 3R9EA 3W91A 3TE4A 4H6UA 2OZGA 4NXYA 5AGEA 4KOTA 4NF1A 4KLWA 4KUAA 4MFJA 5JQ4A 2QIRA 2H5MA 3PGPA 1V0CA 4CAVA 2J8RA 2VEZA 4I49A 4U9ZA 2WUUA 2Z3KA 5DWNA 1M44A 2F5IA 4QUSA 4CYOA 2FE7A 5EBVA 2B4DB 2Z0ZA 2ZXVA 1S60A 1K4JA 1KZFA 4LUAA 2BEIA 2EVNA 4R9MA 5FVJA 4CGNA 4CYNA 2AJ6A 1OZPA 4CGLA 4C2YA 5AG6A 2DPTA 3H4QA 5G22A 2G3TA 2P0WA 2ZW7A 3TCVA 4YGOA 4ONUA 1M4DA 3MGDA 4CGPA 2FXFA 3D2PA 2JDCA 1Y9KA 3K9UA 4OAEA 3R1KA 4R3KA 2CNMA 4XPDB 2ZW5A 3FNCA 2WPXA 2B3VA 1LRZA 1XF8A 1YX0A 2GE3A 3FIXA 4A2ZA 4UA3A 4KUBA 4C2ZA 4BMHA 1Z9UA 3DR6A 2PQ8A 1P0HA 2NMTA 5G1ZA 3TFYA 1MJ9A 4E0AA 4U9YA 2FT0A 1GHEA 3DDDA 4UCNA 5F49A 2FIAA 3DR8A 4H6ZA 4A31A 3D3SA 1S7FA 2D4OA 3EY5A 3GKRA 4AB7A 4LX9A 1IB1E 1B87A 3V8IA 4Y49B 5JPHA 2I79A 4OADA 2P6GA 1XEBA 2Z10A 1YREA 3DSBA 2YNEA 4YFJA 2FS5A 2X7BA 3I3GA 3CXSA 4KOUA 1ON0A 2Z3OA 3TO6A 3LODA 1Z4RA 3E0KA 4KVOE 3S6KA 4UWJA 5IX3A 4B14A 1Y7RA 1S3ZA 5IB0A 3PP9A 1UFHA 1PU9A 4YRHA 1XE4A 4FD4A 2OU2A 1VKCA 4IF5A 1YLEA 1QSNA 4U5YA 1CJWA 1I21A 1IYLA 2Q4YA 4IUSA 4JXRA 4KVME 4PV6A 3VWDA 3IWEA 3IGRA 2Q4VA 4CGMA 4HNXB 4CGOA 3EXNA 4UWIA 2VZZA 1IICA 3TO7A 2Z3LA 1KUVA 4CYPA 4F0YA 4CAXA 1IIDA 4MFQA 4NSQA 5KTDA 4JD6A 4CYQA 2B3UA 5BWAB 2R7HA 3D8PA 1YR0A 1TIQA 3FB3A 4UCPA 4B5PA 4KOXA 1QSOA 2Z11A 2VXKA 3F0AA 4A33A 4MI4A 2Q44A 1MK4A 2PSWA 4OLLA 2R1IA 2PRBA 1XMTA 1M1DA 4C7HA 1KUYA 2PR8A 4HKFA 1XIXA 1BOBA 2PDOA 2ZW6A 1NSLA 4B12A 4AVCA 4KS9A 2G0BA 5I0CA 1QSRA 4ZGYB 5C88A 4MJ8A 5A27A 4JLYA 4KOWA 3N7ZA 4R57A 3ZZIA 2FL4A 2ZW4A 4QC6A 1MJAA 4L8AA 2I00A 3GYAA 2HQYA 2WSAA 3SXNA 3VWEA 4AG7A 3T90A 3S6GA 2GANA 4C7IA 5J8CA 4XPDC 4MFKA 4CAFA 3NE7A 4Y49C 3JTKA 4BBHA 3TOBA 3JVNA 3P2HA 3BLNA 3IU2A 3SXOA 2ARHA 3W6SA 4CAEA 3S6FA 1S7LA 4AVBA 3EO4A 2B4BA 2CY2A 2FIWA 2GIVA 3KKWA 4C68A 1ZO0A 4II9A 4MFPA 3RYOA 1YVKA 4NCZA 3EFAA 1L0CA 2YNDA 4PSWA 1S7NA 4PK3A 5AG7A 1N71A 3F5BA 1YVOA 1IYKA 5EC4A 2JDDA 2IL4A 3A9LA 4B13A 1M4GA 2REFA 2G3AA 1CM0A 3IWGA 5KTCA 4B5OA 4ZBGA 4F0XA 3FRMA 2B5GB 1KUXA 5G20A 2O28A 4ORFA 5AG5A 2WPWA 2HUZA 4QBJA 2YNCA 3JUWA 1B6BA 5GCNA 3BJ8A 3LD2A 2QECA 4Q38A 4MBUA 2BSWA 4XNHC 2FCKA 2HV2A 3CXPA 4PK2A 4KOSA 5G21A 4X5KA 3S6HA 1MJBA 5C82A 1VHSA 2VZYA 2B58A 3TO9A 2JEVA 2FSRA 2CNTA 3GY9A 1WK4A 3WR7A 4L89A 2RC4A 4HNYB 3B8GA 4CRZB 4CAWA 1YGHA 2P6FA 4KVXA 4KLVA 4RI1A 2BUEA 4RS2A 2REEA 3R9GA 5DWMA 4PSXA 4AVAA 2ZPAA 3D2MA 4KSFA 4MHDA 4M3SA 1Q2DA 4K30A 4R3LA 2QMLA 1SQHA 4A30A 5F46A 1RO5A 4KZTA 3CXQA 5IV0A 4UCMA 1BO4A 5CNPA 1NMTA 5AG4A 5E96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I12 A;  2EUI A;  3G3S A;  4AG9 A;  1I1D A;  1QSM A;  5F48 A;  4QB9 A;  5ISV A;  2J8M A;  4HNW B;  5F47 A;  5J8F A;  1P4N A;  2KCW A;  3FYN A;  2Q04 A;  4JJX A;  3TOA A;  4KOV A;  2B5G A;  4R87 A;  3TT2 A;  2BL1 A;  4NEX A;  2J8N A;  2ATR A;  3T9Y A;  1YK3 A;  4B5P B;  4XNH B;  4CRY B;  2D4P A;  4H89 A;  3EC4 A;  2PR1 A;  4JXQ A;  3P2F A;  3W6X A;  3QB8 A;  3R9F A;  4FD7 A;  3FXT A;  1S7K A;  2R98 A;  1WWZ A;  1FY7 A;  1R57 A;  1S5K A;  3BJ7 A;  2VI7 A;  3ZJ0 A;  2OZU A;  1PUA A;  2Y0M A;  3QAH A;  3OWC A;  5KTA A;  1U6M A;  3PZJ A;  3C26 A;  2AE6 A;  4DNC A;  2B4D A;  5HH1 A;  2JLM A;  2Q7B A;  2P6E A;  1Q2C A;  4XPK A;  3TTH A;  4FD5 A;  2VBQ A;  1NE9 A;  3R96 A;  4XPL A;  3FBU A;  4M85 A;  1Z4E A;  4J3G A;  2A4N A;  2CNS A;  3I9S A;  4E2A A;  4F6A A;  1Q2Y A;  4MY0 A;  5H86 A;  4KOR A;  2R8V A;  2VQY A;  1QST A;  1Y9W A;  4EVY A;  2OH1 A;  3UY5 A;  5H84 A;  4UBR A;  1RXT A;  2OB0 A;  4CS0 B;  4MY3 A;  1J4J A;  1M4I A;  2OZH A;  2C27 A;  4FD6 A;  3SHP A;  4E8O A;  3DNS A;  3G8W A;  2DXQ A;  2Q0Y A;  2K5T A;  3R95 A;  4GS4 A;  4JWP A;  4KOY A;  5HMN A;  2PC1 A;  4QVT A;  3F8K A;  3R9E A;  3W91 A;  3TE4 A;  4H6U A;  2OZG A;  4NXY A;  4KOT A;  4NF1 A;  4KLW A;  4KUA A;  5JQ4 A;  2QIR A;  2H5M A;  3PGP A;  1V0C A;  4CAV A;  2J8R A;  2VEZ A;  4I49 A;  4U9Z A;  5DWN A;  1M44 A;  2F5I A;  4QUS A;  2FE7 A;  5EBV A;  2B4D B;  2Z0Z A;  2ZXV A;  1S60 A;  1K4J A;  1KZF A;  2BEI A;  2EVN A;  4LUA A;  4R9M A;  5FVJ A;  2AJ6 A;  1OZP A;  3H4Q A;  2G3T A;  2P0W A;  2ZW7 A;  3TCV A;  4YGO A;  4ONU A;  1M4D A;  3MGD A;  2FXF A;  3D2P A;  4OAE A;  2JDC A;  3K9U A;  1Y9K A;  3R1K A;  4R3K A;  2CNM A;  4XPD B;  2ZW5 A;  3FNC A;  2WPX A;  2B3V A;  1LRZ A;  1XF8 A;  1YX0 A;  2GE3 A;  3FIX A;  4UA3 A;  4KUB A;  4BMH A;  1Z9U A;  3DR6 A;  2PQ8 A;  1P0H A;  2NMT A;  3TFY A;  1MJ9 A;  4E0A A;  4U9Y A;  2FT0 A;  1GHE A;  3DDD A;  5F49 A;  2FIA A;  3DR8 A;  4H6Z A;  3D3S A;  1S7F A;  2D4O A;  3EY5 A;  3GKR A;  4AB7 A;  4LX9 A;  1IB1 E;  1B87 A;  3V8I A;  4Y49 B;  5JPH A;  2I79 A;  4OAD A;  2P6G A;  1XEB A;  2Z10 A;  1YRE A;  3DSB A;  4YFJ A;  2FS5 A;  2X7B A;  3I3G A;  3CXS A;  4KOU A;  1ON0 A;  3TO6 A;  3LOD A;  1Z4R A;  3E0K A;  4KVO E;  3S6K A;  4UWJ A;  5IX3 A;  1Y7R A;  1S3Z A;  5IB0 A;  3PP9 A;  1UFH A;  1PU9 A;  4YRH A;  1XE4 A;  4FD4 A;  2OU2 A;  1VKC A;  4IF5 A;  1YLE A;  1QSN A;  4U5Y A;  1CJW A;  1I21 A;  1IYL A;  2Q4Y A;  4IUS A;  4JXR A;  4KVM E;  4PV6 A;  3VWD A;  3IGR A;  2Q4V A;  4HNX B;  3EXN A;  4UWI A;  2VZZ A;  1IIC A;  3TO7 A;  1KUV A;  4F0Y A;  4CAX A;  1IID A;  4NSQ A;  5KTD A;  4JD6 A;  2B3U A;  2R7H A;  3D8P A;  1YR0 A;  1TIQ A;  3FB3 A;  4B5P A;  4KOX A;  1QSO A;  2Z11 A;  2VXK A;  3F0A A;  4MI4 A;  2Q44 A;  1MK4 A;  2PSW A;  4OLL A;  2R1I A;  2PRB A;  1XMT A;  1M1D A;  1KUY A;  2PR8 A;  4HKF A;  1XIX A;  1BOB A;  2PDO A;  2ZW6 A;  1NSL A;  4AVC A;  2G0B A;  5I0C A;  1QSR A;  5C88 A;  4MJ8 A;  4JLY A;  4KOW A;  3N7Z A;  4R57 A;  3ZZI A;  2FL4 A;  2ZW4 A;  4QC6 A;  1MJA A;  4L8A A;  2I00 A;  3GYA A;  2HQY A;  4AG7 A;  3SXN A;  3VWE A;  3T90 A;  3S6G A;  2GAN A;  5J8C A;  4XPD C;  3NE7 A;  4Y49 C;  3TOB A;  3JVN A;  3P2H A;  3BLN A;  3SXO A;  2ARH A;  3W6S A;  3S6F A;  1S7L A;  4AVB A;  3EO4 A;  2B4B A;  2CY2 A;  2FIW A;  2GIV A;  3KKW A;  4II9 A;  3RYO A;  1YVK A;  4NCZ A;  3EFA A;  1L0C A;  4PSW A;  1S7N A;  4PK3 A;  1N71 A;  3F5B A;  1YVO A;  1IYK A;  5EC4 A;  2JDD A;  2IL4 A;  1M4G A;  2REF A;  2G3A A;  1CM0 A;  3IWG A;  5KTC A;  4B5O A;  4ZBG A;  3FRM A;  2B5G B;  1KUX A;  2O28 A;  4ORF A;  2WPW A;  2HUZ A;  4QBJ A;  3JUW A;  1B6B A;  5GCN A;  3BJ8 A;  3LD2 A;  2QEC A;  4MBU A;  2BSW A;  4XNH C;  2FCK A;  2HV2 A;  3CXP A;  4PK2 A;  4KOS A;  4X5K A;  3S6H A;  1MJB A;  5C82 A;  1VHS A;  2VZY A;  2B58 A;  3TO9 A;  2JEV A;  2FSR A;  2CNT A;  3GY9 A;  1WK4 A;  3WR7 A;  4L89 A;  2RC4 A;  4HNY B;  3B8G A;  4CRZ B;  4CAW A;  1YGH A;  2P6F A;  4KVX A;  4KLV A;  4RI1 A;  2BUE A;  4RS2 A;  2REE A;  3R9G A;  5DWM A;  4PSX A;  4AVA A;  2ZPA A;  3D2M A;  4MHD A;  4M3S A;  1Q2D A;  4K30 A;  4R3L A;  2QML A;  1SQH A;  5F46 A;  1RO5 A;  4KZT A;  3CXQ A;  5IV0 A;  1BO4 A;  5CNP A;  1NMT A;  5E96 A; 
#chains in the Genus database with same CATH topology
 4X3R A;  1I12 A;  2EUI A;  3IEH A;  1LAM A;  4AXV A;  2ZEG A;  2Z3P A;  1X10 A;  2ZED A;  3G3S A;  4R6T A;  5HVG A;  3KR4 A;  4AG9 A;  1I1D A;  2JBK A;  2O4H A;  4UFW A;  2PJ9 A;  1QSM A;  5F48 A;  2GLF A;  4LQ6 A;  3MN8 A;  4QB9 A;  4WWV A;  5HVF A;  4B11 A;  5ISV A;  2J8M A;  2PJ1 A;  4HNW B;  5F47 A;  1FT7 A;  5J8F A;  1LOK A;  1P4N A;  2KCW A;  2Q43 A;  4IK2 A;  3KAS A;  3FYN A;  2EK9 A;  2Q04 A;  4JJX A;  2YGW A;  4KOV A;  3KR5 A;  1YSJ A;  3FMC A;  2V77 A;  3TOA A;  5HVH A;  4X8I A;  3LWU A;  3BI0 A;  2B5G A;  4R87 A;  3TT2 A;  3KHX A;  3V38 A;  5J1Q A;  2BL1 A;  4NEX A;  2J8N A;  1AYE A;  2ATR A;  3T9Y A;  1YK3 A;  1ZG9 A;  1F2P A;  4XNH B;  4B5P B;  4CRY B;  2PJB A;  4YU9 A;  2D4P A;  4H89 A;  3EC4 A;  5LYL A;  2VL1 A;  4MCR A;  4UF4 A;  2PR1 A;  4JXQ A;  3K2K A;  2GU2 A;  2IJZ A;  3L2N A;  1Z8X A;  3P2F A;  3W6X A;  3WC7 A;  2XEI A;  3H5Z A;  3QB8 A;  3R9F A;  2PJ5 A;  3PFO A;  4B10 A;  1VGY A;  4DJL A;  5HXD A;  1BLL E;  4FD7 A;  4NJR A;  2WZN A;  2PJA A;  3FXT A;  4F8Z A;  1S7K A;  1YLO A;  3HUV A;  3IFE A;  5LYD A;  3IO1 A;  2R98 A;  1WWZ A;  4A95 A;  3T8W A;  1FY7 A;  1R57 A;  3WC6 A;  1S5K A;  2CXA A;  3BJ7 A;  2VI7 A;  2V8V A;  3NFZ A;  3ZJ0 A;  4A32 A;  5DS0 A;  3GLJ A;  4MFL A;  5A28 A;  2OZU A;  4Q7A A;  4KSA A;  1PUA A;  2Z3M A;  1AMP A;  2Y0M A;  3QAH A;  4Q36 A;  4MCS A;  2AFZ A;  1PYT B;  3OWC A;  4MFZ A;  4W9Y A;  5KTA A;  1ARM A;  1YME A;  3IU1 A;  1U6M A;  3PZJ A;  3C26 A;  3SJX A;  2AE6 A;  4DNC A;  4K3N A;  2B4D A;  5HH1 A;  4NGQ A;  4UFV A;  4NGS A;  2JLM A;  4P44 A;  2Q7B A;  5D29 A;  4PQA A;  2P6E A;  1Q2C A;  4XPK A;  4MHP A;  3TTH A;  4FD5 A;  3S9N A;  1Z8T A;  4UFX A;  1IOI A;  2VBQ A;  3PB8 X;  1NE9 A;  3FED A;  4R7M A;  3RO0 A;  3R96 A;  4P4D A;  4XPL A;  5LYI A;  3FBU A;  2PVW A;  4M85 A;  1Z4E A;  4HPS A;  1XMB A;  3SI0 A;  4P4F A;  4M6H A;  2EBJ A;  2RFH A;  2A4N A;  2CNS A;  2YNC C;  3I9S A;  4J3G A;  4FBE A;  3K9T A;  3ISZ A;  4NGP A;  4E2A A;  4F6A A;  1Q2Y A;  4MY0 A;  2IQ6 A;  5H86 A;  4KOR A;  5K8N A;  3ISX A;  4ZX8 A;  3CPX A;  2R8V A;  2VQY A;  1QST A;  1X12 A;  1Y9W A;  4EVY A;  4R8F A;  2PJC A;  3FJU A;  4IAV A;  5I4M A;  4C2X A;  3DLJ A;  4ZY1 A;  4PXC A;  1NSA A;  2OH1 A;  3UY5 A;  5H84 A;  4UBR A;  2OB0 A;  1RXT A;  3D4U A;  4CS0 B;  4MY3 A;  1J4J A;  3RZA A;  1M4I A;  2V8H A;  2DF5 A;  2OZH A;  2C27 A;  4FD6 A;  4OC2 A;  2QJ8 A;  3SHP A;  4E8O A;  4FWU A;  4UEE A;  3DNS A;  3G8W A;  2BCO A;  2DXQ A;  1CP6 A;  2Q0Y A;  4P4I A;  2K5T A;  4NGM A;  3R95 A;  2Z3N A;  3NH5 A;  2PVV A;  3PFE A;  4GS4 A;  3QNV A;  2BO9 A;  4UEZ A;  4M6I A;  4JWP A;  4KOY A;  5HMN A;  2J9A A;  2PC1 A;  3NA6 A;  4QVT A;  2POK A;  1IY7 A;  3F8K A;  2DPS A;  3B7I A;  1CG2 A;  3TX8 A;  1IU8 A;  3MRU A;  3R9E A;  3W91 A;  4GM5 A;  4OKO A;  4TNU A;  3TE4 A;  2PCU A;  4NGT A;  5IB9 A;  1Z8L A;  3LAC A;  4H6U A;  4EWT A;  3FEC A;  2OZG A;  4NXY A;  5AGE A;  4M6G A;  3VAR A;  4KOT A;  4NF1 A;  3BXM A;  4KLW A;  4KUA A;  4MFJ A;  4MHY A;  3SJF A;  1UWY A;  5JQ4 A;  2QIR A;  2H5M A;  4RN7 A;  1ARL A;  4YWY A;  3BI1 A;  3PGP A;  3B35 A;  1V0C A;  1IOF A;  1FNO A;  3H8F A;  2EK8 A;  4CAV A;  2J8R A;  2VEZ A;  3KZW A;  4I49 A;  2WUU A;  4U9Z A;  1F2O A;  2Z3K A;  5DWN A;  5LRJ A;  1M44 A;  2F5I A;  2ZEL A;  3S9M A;  4C2Z A;  4QUS A;  4CYO A;  2FE7 A;  4R76 A;  3JRU A;  4MRI A;  2B4D B;  2Z0Z A;  5EBV A;  2ZXV A;  1S60 A;  1K4J A;  1KZF A;  2BEI A;  2EVN A;  4LUA A;  4R9M A;  3KL9 A;  2PRQ A;  5CBM A;  5FVJ A;  4CGN A;  4CYN A;  2AJ6 A;  1OZP A;  4CGL A;  4UIA A;  4C2Y A;  5K8O A;  2C1C A;  4OIW A;  5AG6 A;  2DPT A;  2F7V A;  3D7G A;  2ZEM A;  3H4Q A;  4F9U A;  5G22 A;  4PXD A;  3KGQ A;  2G3T A;  2P0W A;  1ZG7 A;  2ZW7 A;  2ZEE A;  3TCV A;  4A94 A;  4YGO A;  3KHZ A;  4ONU A;  3RNZ A;  1M4D A;  3MGD A;  4CGP A;  2FXF A;  2ODF A;  2JDC A;  1Y9K A;  3D2P A;  3K9U A;  4OAE A;  3R1K A;  4R3K A;  4TWE A;  4EFD A;  2CNM A;  4H2K A;  2ZW5 A;  3FNC A;  4XPD B;  2WPX A;  2B3V A;  1LRZ A;  1XF8 A;  2O53 A;  3B3S A;  1YX0 A;  2GE3 A;  4PXB A;  3FIX A;  4A2Z A;  1LAP A;  4UA3 A;  2C6G A;  4NGR A;  2FVG A;  4KUB A;  4BMH A;  1XFO A;  1Z9U A;  1OBR A;  2AFW A;  1P0H A;  2NMT A;  2PQ8 A;  2XEJ A;  3D7H A;  3DR6 A;  4MHZ A;  5G1Z A;  3SI2 A;  3TFY A;  4P10 A;  3FVL A;  1LCP A;  3CT9 A;  5THW A;  1MJ9 A;  2WYR A;  4DYO A;  3S9L A;  4E0A A;  4U9Y A;  2FT0 A;  1GHE A;  3D66 A;  3DDD A;  4Z65 A;  4UCN A;  3WAB A;  5F49 A;  2FIA A;  3DR8 A;  4H6Z A;  4UIB A;  4A31 A;  3D3S A;  4BIN A;  1S7F A;  2D4O A;  3IJ3 A;  2NYQ A;  1QQ9 A;  3EY5 A;  3GKR A;  4LX9 A;  4OC5 A;  2PJ4 A;  3LMS A;  4AB7 A;  1ELM P;  1IB1 E;  1YW4 A;  1B87 A;  1ZLI A;  3V8I A;  4Y49 B;  5JPH A;  2I79 A;  4OAD A;  4P4B A;  5JH9 A;  2P6G A;  5LRG A;  1XEB A;  2JEW A;  5JM6 A;  1Q7L A;  4P4E A;  2Z10 A;  1YRE A;  2ZOF A;  3DSB A;  1Y0Y A;  1TKH A;  2F8H A;  4NGN A;  1JWQ A;  2YNE A;  4YFJ A;  2FS5 A;  2Q4Z A;  2X7B A;  4ONW A;  3I3G A;  4JZ0 A;  3CXS A;  4KOU A;  1ON0 A;  2Z3O A;  5CPA A;  3LOD A;  4PXE A;  3TO6 A;  4MCQ A;  1Z4R A;  3E0K A;  4KVO E;  5K8M A;  3S6K A;  4UWJ A;  1LAN A;  5IX3 A;  4B14 A;  1Y7R A;  2AFM A;  4OC1 A;  1S3Z A;  1DTD A;  3PB4 X;  2CTC A;  5IB0 A;  3I1U A;  1HDU A;  3PP9 A;  1UFH A;  1ZLH A;  1PU9 A;  4OP4 A;  4YRH A;  1XE4 A;  3DGV A;  4FD4 A;  2OU2 A;  1VKC A;  4IF5 A;  1YLE A;  1QSN A;  2AFX A;  4U5Y A;  1TF9 A;  1CJW A;  2CIJ A;  2ZEP A;  3B3V A;  1I21 A;  3B3T A;  1IYL A;  2I3C A;  2Q4Y A;  1GYT A;  1DE4 C;  3KQZ A;  4IUS A;  3GIU A;  4JXR A;  4KVM E;  4P45 A;  2IMO A;  4PV6 A;  2QYV A;  1H8L A;  1HEE A;  3VWD A;  1JQG A;  2GFQ A;  3IGR A;  3IWE A;  2Q4V A;  3WT4 A;  4HNX B;  4CGM A;  3EXN A;  4UWI A;  4CGO A;  2VZZ A;  2XEG A;  1IIC A;  3TO7 A;  2Z3L A;  1KUV A;  4CYP A;  2OR4 A;  4PPZ A;  4F0Y A;  1XBU A;  3FEE A;  4CAX A;  4MHN A;  1IID A;  2CF4 A;  4MFQ A;  4NSQ A;  5KTD A;  1VHO A;  2V8D A;  4JD6 A;  4CYQ A;  2QVP A;  2B3U A;  3NE8 A;  2R7H A;  2ZEO A;  3D8P A;  5ELY A;  5BWA B;  1YR0 A;  6CPA A;  1TIQ A;  1VHE A;  3FB3 A;  3B2Y A;  4UCP A;  2PIY A;  4B5P A;  4KOX A;  4DUK A;  1R43 A;  1QSO A;  2Z11 A;  1Y0R A;  4B6Z A;  3H8G A;  2VXK A;  3NH8 A;  3F0A A;  3V7Z A;  4A33 A;  4MI4 A;  3PBB A;  2PJ2 A;  2Q44 A;  4FUU A;  1MK4 A;  3RBU A;  2ANP A;  1CBX A;  2PSW A;  2EWB A;  2PJ0 A;  2AFO A;  4OLL A;  2R1I A;  2PRB A;  1XMT A;  2AFS A;  2BOA A;  1M1D A;  3D7F A;  3H8E A;  1KUY A;  4A37 A;  4C7H A;  4GXH A;  4CPA A;  2PR8 A;  4HKF A;  5LRK A;  1XIX A;  1BOB A;  2PDO A;  2ZW6 A;  1NSL A;  3SJG A;  4B12 A;  4AVC A;  2GLJ A;  4KS9 A;  3PBE A;  2G0B A;  4OME A;  5I0C A;  1QSR A;  1TKF A;  4O23 A;  5F09 A;  4ZGY B;  2DEA A;  1TF8 A;  1EE3 P;  3WC5 A;  5C88 A;  2GRE A;  2AFU A;  3KQX A;  4JLY A;  4KOW A;  4MJ8 A;  5A27 A;  3N7Z A;  1XRY A;  1BPN A;  4R57 A;  3RAM A;  2FL4 A;  2PE3 A;  2ZW4 A;  3ZZI A;  4QC6 A;  1MJA A;  1XJO A;  4L8A A;  4A39 A;  2I00 A;  1CP7 A;  3GYA A;  3FH4 A;  1VIX A;  2HQY A;  2WSA A;  3SXN A;  5D8N A;  3VWE A;  4AG7 A;  3T90 A;  2OOT A;  3S6G A;  1YW6 A;  2GAN A;  3PB7 X;  4C7I A;  5J8C A;  4XPD C;  4MFK A;  4CAF A;  3NE7 A;  3VAT A;  2ZEF A;  4Y49 C;  3JTK A;  2NSM A;  1AUG A;  4G1P A;  1LFW A;  4BBH A;  1M4L A;  3TOB A;  1TXR A;  4A38 A;  2C6P A;  3FF3 A;  3JVN A;  4ZI6 A;  3IU2 A;  3BLN A;  3P2H A;  4P4J A;  2ARH A;  3SXO A;  3W6S A;  1QMU A;  4CAE A;  3HLP A;  2ZOG A;  3S6F A;  5JGF A;  1S7L A;  3NH4 A;  4AVB A;  3EO4 A;  2B4B A;  2CY2 A;  3CZX A;  3IC1 A;  2FIW A;  2GIV A;  3IWW A;  1Z2L A;  4ZY0 A;  3KKW A;  4C68 A;  2V8G A;  2XEF A;  5EMI A;  1ZO0 A;  4II9 A;  4MFP A;  3RYO A;  3CDX A;  2HC9 A;  4X2T A;  1YVK A;  4NCZ A;  1CPX A;  3CPA A;  3EFA A;  1L0C A;  2YND A;  4P6Y A;  4BD9 A;  4EME A;  4PSW A;  1S7N A;  4PK3 A;  4ZX9 A;  3VH9 A;  2PIZ A;  2ZEN A;  1Z5R A;  5AG7 A;  1N71 A;  3F5B A;  1YVO A;  2Q7S A;  4LQG A;  1IYK A;  1YQE A;  3KI9 A;  1XOV A;  4OC4 A;  5K8P A;  5EC4 A;  2JDD A;  3PEI A;  4JYW A;  2IL4 A;  3A9L A;  4B13 A;  1M4G A;  2REF A;  2G3A A;  1CM0 A;  3IWG A;  5KTC A;  1ELL P;  4MCP A;  4B5O A;  4ZBG A;  4F0X A;  3IIB A;  3FRM A;  2B5G B;  1HDQ A;  1KUX A;  5G20 A;  2JBJ A;  2O28 A;  4NFR A;  4ORF A;  5AG5 A;  8CPA A;  2EO8 A;  2WPW A;  3FX6 A;  1BPM A;  2ABZ A;  2HUZ A;  2ZEH A;  2CTB A;  4QBJ A;  7CPA A;  2PJ6 A;  2YNC A;  3JUW A;  1B6B A;  5GCN A;  3BJ8 A;  3LD2 A;  2QEC A;  3D7D A;  4MXU A;  4Q38 A;  4OC0 A;  4MBU A;  2BSW A;  3GUX A;  3B3C A;  4XNH C;  2FCK A;  2C6C A;  2HV2 A;  3D68 A;  3QAY A;  4F9V A;  1ZG8 A;  5LYF A;  1CX8 A;  3CXP A;  4PK2 A;  4KOS A;  5G21 A;  4X5K A;  4FAI A;  3S6H A;  1KWM A;  1F57 A;  3PB9 X;  1MJB A;  5C82 A;  1VHS A;  3GB0 A;  4WJB A;  2VZY A;  2B58 A;  3TO9 A;  2JEV A;  2FSR A;  2CNT A;  3GY9 A;  1WK4 A;  3WR7 A;  3SI1 A;  3N5F A;  4ZYQ A;  1R3N A;  2PJ3 A;  4L89 A;  2RC4 A;  4OID A;  4HNY B;  3B8G A;  4CRZ B;  4CAW A;  1YGH A;  2P6F A;  3D67 A;  4KSI A;  4KVX A;  1Z8W A;  4KLV A;  1BAV A;  4RI1 A;  1RTQ A;  2BUE A;  3BHX A;  4RS2 A;  2REE A;  3R9G A;  5DWM A;  3B3W A;  4PSX A;  3SJE A;  1TKJ A;  2PJ8 A;  4AVA A;  2ZPA A;  3D2M A;  4KSF A;  1IGB A;  4M3S A;  1Q2D A;  4K30 A;  4MHD A;  2QML A;  1SQH A;  1Y7E A;  2G9D A;  4R3L A;  4A30 A;  2RB7 A;  4RUH A;  5F46 A;  4ZY2 A;  2PJ7 A;  4NJQ A;  1RO5 A;  4KZT A;  3CXQ A;  4MMO A;  4OC3 A;  3PRT A;  4IHM A;  2HB6 A;  4UCM A;  1BO4 A;  4UEF A;  5CNP A;  5IV0 A;  1A2Z A;  1NMT A;  5AG4 A;  1CPS A;  5E96 A;  3PB6 X;  1PCA A;  3TC8 A;  2Q51 A; 
#chains in the Genus database with same CATH homology
 1I12 A;  2EUI A;  2Z3P A;  3G3S A;  4AG9 A;  1I1D A;  4UFW A;  1QSM A;  5F48 A;  4QB9 A;  5ISV A;  4B11 A;  2J8M A;  4HNW B;  5F47 A;  5J8F A;  1P4N A;  2KCW A;  3FYN A;  2Q04 A;  4JJX A;  2YGW A;  4KOV A;  3TOA A;  2B5G A;  4R87 A;  3TT2 A;  2BL1 A;  4NEX A;  2J8N A;  2ATR A;  3T9Y A;  1YK3 A;  4B5P B;  4XNH B;  4CRY B;  2D4P A;  4H89 A;  3EC4 A;  2PR1 A;  4JXQ A;  3P2F A;  3W6X A;  3H5Z A;  3QB8 A;  3R9F A;  4B10 A;  4FD7 A;  3FXT A;  1S7K A;  2R98 A;  1WWZ A;  4A95 A;  1FY7 A;  1R57 A;  1S5K A;  2CXA A;  3BJ7 A;  2VI7 A;  3ZJ0 A;  4A32 A;  4MFL A;  5A28 A;  2OZU A;  4KSA A;  1PUA A;  2Z3M A;  2Y0M A;  3QAH A;  4Q36 A;  3OWC A;  4MFZ A;  5KTA A;  3IU1 A;  1U6M A;  3PZJ A;  3C26 A;  2AE6 A;  4DNC A;  2B4D A;  5HH1 A;  4UFV A;  2JLM A;  2Q7B A;  2P6E A;  1Q2C A;  4XPK A;  3TTH A;  4FD5 A;  4UFX A;  2VBQ A;  1NE9 A;  3R96 A;  4XPL A;  3FBU A;  4M85 A;  1Z4E A;  4J3G A;  2A4N A;  2CNS A;  2YNC C;  3I9S A;  4E2A A;  4F6A A;  1Q2Y A;  4MY0 A;  5H86 A;  4KOR A;  2R8V A;  2VQY A;  1QST A;  1Y9W A;  4EVY A;  4C2X A;  2OH1 A;  3UY5 A;  5H84 A;  4UBR A;  1RXT A;  2OB0 A;  4CS0 B;  4MY3 A;  1J4J A;  1M4I A;  2OZH A;  2C27 A;  4FD6 A;  3SHP A;  4E8O A;  3DNS A;  3G8W A;  2DXQ A;  2Q0Y A;  2K5T A;  3R95 A;  2Z3N A;  4GS4 A;  4JWP A;  4KOY A;  5HMN A;  2PC1 A;  4QVT A;  3F8K A;  2DPS A;  3R9E A;  3W91 A;  3TE4 A;  4H6U A;  2OZG A;  4NXY A;  5AGE A;  4KOT A;  4NF1 A;  4KLW A;  4KUA A;  4MFJ A;  5JQ4 A;  2QIR A;  2H5M A;  3PGP A;  1V0C A;  4CAV A;  2J8R A;  2VEZ A;  4I49 A;  4U9Z A;  2WUU A;  2Z3K A;  5DWN A;  1M44 A;  2F5I A;  4QUS A;  4CYO A;  2FE7 A;  5EBV A;  2B4D B;  2Z0Z A;  2ZXV A;  1S60 A;  1K4J A;  1KZF A;  4LUA A;  2BEI A;  2EVN A;  4R9M A;  5FVJ A;  4CGN A;  4CYN A;  2AJ6 A;  1OZP A;  4CGL A;  4C2Y A;  5AG6 A;  2DPT A;  3H4Q A;  5G22 A;  2G3T A;  2P0W A;  2ZW7 A;  3TCV A;  4YGO A;  4ONU A;  1M4D A;  3MGD A;  4CGP A;  2FXF A;  3D2P A;  2JDC A;  1Y9K A;  3K9U A;  4OAE A;  3R1K A;  4R3K A;  2CNM A;  4XPD B;  2ZW5 A;  3FNC A;  2WPX A;  2B3V A;  1LRZ A;  1XF8 A;  1YX0 A;  2GE3 A;  3FIX A;  4A2Z A;  4UA3 A;  4KUB A;  4C2Z A;  4BMH A;  1Z9U A;  3DR6 A;  2PQ8 A;  1P0H A;  2NMT A;  5G1Z A;  3TFY A;  1MJ9 A;  4E0A A;  4U9Y A;  2FT0 A;  1GHE A;  3DDD A;  4UCN A;  5F49 A;  2FIA A;  3DR8 A;  4H6Z A;  4A31 A;  3D3S A;  1S7F A;  2D4O A;  3EY5 A;  3GKR A;  4AB7 A;  4LX9 A;  1IB1 E;  1B87 A;  3V8I A;  4Y49 B;  5JPH A;  2I79 A;  4OAD A;  2P6G A;  1XEB A;  2Z10 A;  1YRE A;  3DSB A;  2YNE A;  4YFJ A;  2FS5 A;  2X7B A;  3I3G A;  3CXS A;  4KOU A;  1ON0 A;  2Z3O A;  3TO6 A;  3LOD A;  1Z4R A;  3E0K A;  4KVO E;  3S6K A;  4UWJ A;  5IX3 A;  4B14 A;  1Y7R A;  1S3Z A;  5IB0 A;  3PP9 A;  1UFH A;  1PU9 A;  4YRH A;  1XE4 A;  4FD4 A;  2OU2 A;  1VKC A;  4IF5 A;  1YLE A;  1QSN A;  4U5Y A;  1CJW A;  1I21 A;  1IYL A;  2Q4Y A;  4IUS A;  4JXR A;  4KVM E;  4PV6 A;  3VWD A;  3IWE A;  3IGR A;  2Q4V A;  4CGM A;  4HNX B;  4CGO A;  3EXN A;  4UWI A;  2VZZ A;  1IIC A;  3TO7 A;  2Z3L A;  1KUV A;  4CYP A;  4F0Y A;  4CAX A;  1IID A;  4MFQ A;  4NSQ A;  5KTD A;  4JD6 A;  4CYQ A;  2B3U A;  5BWA B;  2R7H A;  3D8P A;  1YR0 A;  1TIQ A;  3FB3 A;  4UCP A;  4B5P A;  4KOX A;  1QSO A;  2Z11 A;  2VXK A;  3F0A A;  4A33 A;  4MI4 A;  2Q44 A;  1MK4 A;  2PSW A;  4OLL A;  2R1I A;  2PRB A;  1XMT A;  1M1D A;  4C7H A;  1KUY A;  2PR8 A;  4HKF A;  1XIX A;  1BOB A;  2PDO A;  2ZW6 A;  1NSL A;  4B12 A;  4AVC A;  4KS9 A;  2G0B A;  5I0C A;  1QSR A;  4ZGY B;  5C88 A;  4MJ8 A;  5A27 A;  4JLY A;  4KOW A;  3N7Z A;  4R57 A;  3ZZI A;  2FL4 A;  2ZW4 A;  4QC6 A;  1MJA A;  4L8A A;  2I00 A;  3GYA A;  2HQY A;  2WSA A;  3SXN A;  3VWE A;  4AG7 A;  3T90 A;  3S6G A;  2GAN A;  4C7I A;  5J8C A;  4XPD C;  4MFK A;  4CAF A;  3NE7 A;  4Y49 C;  3JTK A;  4BBH A;  3TOB A;  3JVN A;  3P2H A;  3BLN A;  3IU2 A;  3SXO A;  2ARH A;  3W6S A;  4CAE A;  3S6F A;  1S7L A;  4AVB A;  3EO4 A;  2B4B A;  2CY2 A;  2FIW A;  2GIV A;  3KKW A;  4C68 A;  1ZO0 A;  4II9 A;  4MFP A;  3RYO A;  1YVK A;  4NCZ A;  3EFA A;  1L0C A;  2YND A;  4PSW A;  1S7N A;  4PK3 A;  5AG7 A;  1N71 A;  3F5B A;  1YVO A;  1IYK A;  5EC4 A;  2JDD A;  2IL4 A;  3A9L A;  4B13 A;  1M4G A;  2REF A;  2G3A A;  1CM0 A;  3IWG A;  5KTC A;  4B5O A;  4ZBG A;  4F0X A;  3FRM A;  2B5G B;  1KUX A;  5G20 A;  2O28 A;  4ORF A;  5AG5 A;  2WPW A;  2HUZ A;  4QBJ A;  2YNC A;  3JUW A;  1B6B A;  5GCN A;  3BJ8 A;  3LD2 A;  2QEC A;  4Q38 A;  4MBU A;  2BSW A;  4XNH C;  2FCK A;  2HV2 A;  3CXP A;  4PK2 A;  4KOS A;  5G21 A;  4X5K A;  3S6H A;  1MJB A;  5C82 A;  1VHS A;  2VZY A;  2B58 A;  3TO9 A;  2JEV A;  2FSR A;  2CNT A;  3GY9 A;  1WK4 A;  3WR7 A;  4L89 A;  2RC4 A;  4HNY B;  3B8G A;  4CRZ B;  4CAW A;  1YGH A;  2P6F A;  4KVX A;  4KLV A;  4RI1 A;  2BUE A;  4RS2 A;  2REE A;  3R9G A;  5DWM A;  4PSX A;  4AVA A;  2ZPA A;  3D2M A;  4KSF A;  4MHD A;  4M3S A;  1Q2D A;  4K30 A;  4R3L A;  2QML A;  1SQH A;  4A30 A;  5F46 A;  1RO5 A;  4KZT A;  3CXQ A;  5IV0 A;  4UCM A;  1BO4 A;  5CNP A;  1NMT A;  5AG4 A;  5E96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...