4QVTA

Crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
139
Chain Sequence
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase YpeA
publication title Crystal structure of predicted N-acyltransferase (ypeA) in complex with acetyl-CoA from Escherichia coli
rcsb
source organism Escherichia coli k-12
total genus 39
structure length 139
sequence length 139
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qvtA01
2I00A 4U5YA 2QIRA 5DWMA 1TIQA 2P6FA 5DWNA 2Q0YA 1BO4A 4XPKA 3ZJ0A 1MJBA 4XNHB 5F48A 3R9EA 1XIXA 3EC4A 3RYOA 4B5OA 3LODA 2PRBA 1UFHA 4KOXA 2G3TA 5ISVA 2VI7A 3S6GA 1V0CA 3P2HA 2VEZA 2ARHA 3FRMA 2Z10A 2BSWA 3W6XA 3PP9A 1QSOA 2X7BA 2FL4A 3WR7A 4AG9A 3G3SA 2GANA 4KVOE 3T9YA 3FYNA 4YGOA 3ZZIA 4JJXA 1YREA 3K9UA 4IF5A 4L8AA 3CXPA 4FD7A 3TCVA 2R1IA 4JWPA 3E0KA 4NF1A 3GYAA 1M4DA 2PR8A 3P2FA 1IYKA 3FIXA 2B3UA 3T90A 3D2PA 4ZBGA 3TOBA 3S6KA 2FS5A 5KTAA 5E96A 1MK4A 2PDOA 1WWZA 1Z9UA 2PQ8A 4HNXB 4MI4A 1PU9A 2FIAA 3V8IA 2Q44A 3TOAA 1QSRA 2CNMA 2R8VA 1S3ZA 3R1KA 4HNYB 1J4JA 1IIDA 4CAXA 4JXQA 3NE7A 3R9FA 2GIVA 2P6GA 5H86A 4CAWA 1B87A 2HQYA 3TE4A 4HNWB 3F8KA 4ORFA 3F5BA 3FBUA 3W91A 2B5GB 4AVAA 5GCNA 2FXFA 1IYLA 4KOYA 2REEA 3H4QA 5IV0A 4J3GA 3BJ7A 2CNTA 3I9SA 4KUAA 1YVOA 2G0BA 3EY5A 3B8GA 4L89A 5J8FA 2Y0MA 4PSWA 4MY0A 1XE4A 2G3AA 1S7LA 1PUAA 1CM0A 4KORA 4FD6A 2B4DB 1KUYA 2P0WA 1ON0A 5F46A 3S6HA 4R3LA 3R9GA 2OZGA 2HV2A 2ZXVA 1Z4EA 1QSMA 1Q2DA 2ZW6A 2R7HA 1XF8A 3S6FA 4YFJA 3D2MA 1CJWA 1Q2YA 4NSQA 3FB3A 1S7NA 1GHEA 4JXRA 4KOWA 4KOUA 1Z4RA 4U9ZA 3TFYA 4E0AA 3GKRA 1I21A 2NMTA 2WPXA 2OZUA 4B5PB 3N7ZA 2RC4A 5KTDA 3D3SA 4KZTA 5C88A 4GS4A 5KTCA 2JDCA 3DNSA 3G8WA 5C82A 3DSBA 5CNPA 4KLVA 3PGPA 4M3SA 4QB9A 1NMTA 2EUIA 3BLNA 4RS2A 2EVNA 4E2AA 2GE3A 2WPWA 4XPLA 2B4BA 1M4IA 4XNHC 2K5TA 1NSLA 1YX0A 4M85A 3IWGA 4F0YA 2BUEA 4OLLA 2DXQA 2JDDA 3OWCA 4R9MA 3GY9A 2PR1A 5H84A 2HUZA 5J8CA 2J8MA 1R57A 1S7FA 2Q7BA 2A4NA 2OZHA 3VWEA 2B5GA 2QMLA 1RXTA 5F49A 1XMTA 4MHDA 3EFAA 2ZPAA 4X5KA 4Y49C 3MGDA 4I49A 4AVCA 1M4GA 1YR0A 2REFA 4UWJA 3QB8A 3IGRA 5HH1A 3EXNA 4QUSA 1M44A 4FD4A 2Q04A 4DNCA 4CAVA 1MJ9A 2FE7A 2B3VA 2VZZA 5JPHA 2B4DA 4PK2A 1S7KA 3SXNA 3FNCA 1KUVA 5IX3A 1YVKA 4OADA 4XPDC 2VZYA 4JD6A 2FIWA 3EO4A 2BEIA 4PV6A 2VBQA 2FT0A 4R3KA 3TT2A 4LX9A 2F5IA 4NXYA 2JLMA 4NEXA 4QVTA 1M1DA 1LRZA 4QBJA 2D4OA 4UWIA 1SQHA 4AB7A 1QSNA 3TO6A 4HKFA 3D8PA 3UY5A 5HMNA 1WK4A 4PK3A 2JEVA 1KZFA 5I0CA 2R98A 1P4NA 4IUSA 4U9YA 4RI1A 1S5KA 2PSWA 1K4JA 2OB0A 3CXSA 2KCWA 3TTHA 3PZJA 4H6UA 4F6AA 3I3GA 4KOTA 4YRHA 4UBRA 2ZW7A 3SHPA 2BL1A 2OH1A 4R87A 1FY7A 1RO5A 5EC4A 1IICA 3R95A 2C27A 2CNSA 4KVXA 1I1DA 1MJAA 2AE6A 3R96A 4CS0B 5FVJA 1KUXA 4KVME 2I79A 2J8RA 4CRZB 1P0HA 4LUAA 2Q4YA 2B58A 3DR8A 1IB1E 1YK3A 3JUWA 2CY2A 4Y49B 3JVNA 1Q2CA 4QC6A 2Z0ZA 1Y9KA 1S60A 3FXTA 5EBVA 3F0AA 1XEBA 4AVBA 2D4PA 3SXOA 1L0CA 4R57A 2PC1A 2IL4A 4KOVA 2QECA 3DR6A 1N71A 4KUBA 3LD2A 1B6BA 2ATRA 2FCKA 3TO9A 2AJ6A 3BJ8A 1OZPA 4XPDB 2H5MA 4E8OA 2VXKA 3C26A 3CXQA 4KOSA 4H89A 2OU2A 4BMHA 2FSRA 1Y7RA 2ZW5A 2Q4VA 4K30A 4OAEA 1QSTA 4MY3A 1I12A 4MBUA 1BOBA 4FD5A 2J8NA 1YGHA 1Y9WA 2O28A 2VQYA 4EVYA 4MJ8A 4UA3A 4ONUA 2P6EA 1VKCA 1U6MA 3VWDA 2Z11A 5IB0A 4CRYB 3TO7A 1VHSA 4II9A 3W6SA 4B5PA 4H6ZA 4JLYA 2ZW4A 3KKWA 3QAHA 1YLEA 4NCZA 5F47A 1NE9A 4KLWA 4PSXA 3DDDA 4AG7A 5JQ4A
chains in the Genus database with same CATH superfamily
1LCPA 2I00A 4U5YA 2QIRA 3FF3A 2C6CA 4RUHA 3IJ3A 1DE4C 3IU1A 5DWMA 1TIQA 2P6FA 5DWNA 4TNUA 3SI2A 2PJBA 4B12A 2Q0YA 2DF5A 1BO4A 3KR4A 2Q43A 2QVPA 2PJ1A 4XPKA 3PB9X 3ZJ0A 1MJBA 1TF9A 4XNHB 2F7VA 2PJ7A 4IK2A 4Q7AA 3KGQA 5F48A 3R9EA 5A28A 1XIXA 3SJXA 3EC4A 3RYOA 4MHPA 4B5OA 3LODA 3PBEA 3SI0A 2PRBA 4UFVA 3FMCA 5D8NA 1UFHA 2O53A 4KOXA 2G3TA 5ISVA 2VI7A 4CPAA 2YGWA 3S6GA 1V0CA 2PIZA 5LRKA 1VGYA 3P2HA 1EE3P 2VEZA 2ARHA 3FRMA 3H8EA 2Z10A 2F8HA 2BSWA 3W6XA 3PP9A 3B3SA 1QSOA 4X3RA 1CP6A 4F9VA 2X7BA 4C2XA 3LMSA 2FL4A 4NJQA 3WR7A 2AFMA 2XEIA 2GANA 3G3SA 4AG9A 2PJ3A 4C7IA 4KVOE 4B10A 4C7HA 4A30A 3T9YA 3FYNA 4YGOA 3ZZIA 4JJXA 1AUGA 1TKHA 4P4BA 1YREA 2V77A 4PXBA 4MHYA 1ZLHA 3CPAA 1ZO0A 3K9UA 4IF5A 3KHZA 4L8AA 3CXPA 3S9LA 4FD7A 3IO1A 2PJ6A 3TCVA 3CPXA 2R1IA 2ZELA 4JWPA 3E0KA 4P45A 4A37A 2GU2A 4NF1A 3ISXA 3GYAA 1M4DA 2PR8A 3BHXA 4H2KA 1F2PA 2IJZA 3TC8A 3P2FA 4YU9A 2ABZA 1IYKA 2RB7A 3FIXA 2B3UA 1YQEA 2AFWA 2Z3LA 3T90A 4B11A 4ZY2A 4ZY1A 3D2PA 4ZBGA 3TOBA 4NGMA 3S6KA 2ODFA 2FS5A 4KSFA 5KTAA 3IC1A 2ZEFA 3PBBA 5AG7A 5E96A 1MK4A 2PDOA 1WWZA 4OIDA 5EMIA 2WZNA 1Z9UA 1IGBA 2PQ8A 3D68A 5D29A 4HNXB 1HEEA 4CGOA 2POKA 1Z8LA 4MI4A 1PU9A 5J1QA 2FIAA 1AMPA 2OOTA 3V8IA 2Q44A 3TOAA 3PEIA 1QSRA 2CNMA 2R8VA 2V8DA 4P4EA 1YMEA 1S3ZA 3R1KA 4HNYB 1J4JA 1IIDA 4CAXA 3H8GA 4JXQA 4MCRA 4CAEA 5CBMA 5G1ZA 3NE7A 1XBUA 3R9FA 2GFQA 5AG4A 2GIVA 2OR4A 5AG5A 4F0XA 3KQXA 4A2ZA 2Z3NA 2P6GA 4TWEA 5H86A 4CAWA 1B87A 2ZENA 2HQYA 3FEDA 3TE4A 4HNWB 4NGSA 2CXAA 3F8KA 4KSAA 4ORFA 3S9NA 5LYFA 2XEGA 3LACA 3F5BA 2AFOA 3FBUA 1UWYA 2AFSA 3IFEA 3W91A 2B5GB 4AVAA 5GCNA 2FXFA 3GB0A 1IYLA 4C2YA 1Q7LA 4KOYA 3KR5A 2REEA 3H4QA 2EO8A 5IV0A 5I4MA 1FNOA 4J3GA 5F09A 3BJ7A 2CNTA 3I9SA 1CP7A 4KUAA 2PJ0A 1YVOA 4ZX8A 1IY7A 2G0BA 4OC5A 4CAFA 1CBXA 1HDQA 3EY5A 3B8GA 1CPXA 3QNVA 4L89A 5J8FA 2Y0MA 1ZLIA 3D4UA 4IAVA 4PSWA 4UF4A 4MY0A 1XE4A 1YSJA 1ZG9A 2G3AA 2PVWA 3KZWA 4HPSA 2V8HA 5HVHA 4CGPA 1S7LA 1PUAA 2EWBA 1CM0A 4KORA 4G1PA 1CPSA 1PYTB 6CPAA 4FD6A 2B4DB 4A39A 1KUYA 2P0WA 1ON0A 5F46A 3S6HA 4R3LA 3JTKA 3R9GA 2OZGA 2HV2A 2ZXVA 2YNEA 1Z4EA 1QSMA 1Q2DA 4M6GA 4R8FA 2ZW6A 2BO9A 2EBJA 3PB4X 4B6ZA 2PJ5A 1TKJA 4ZYQA 2R7HA 1XF8A 1BPMA 3S6FA 3D2MA 4YFJA 1CJWA 1Q2YA 2IQ6A 3PB8X 3RBUA 3VARA 3ISZA 1ELLP 4NSQA 3FB3A 1S7NA 8CPAA 4UFXA 1GHEA 3B3VA 4JXRA 4KOWA 4KOUA 4W9YA 1Z4RA 3BXMA 5LYIA 4U9ZA 4YWYA 4E0AA 3TFYA 3BI0A 3GKRA 4CYOA 1I21A 2NMTA 3B35A 2QYVA 2PJ2A 5IB9A 2WPXA 3NE8A 2OZUA 3FX6A 4B5PB 5JGFA 2DEAA 3N7ZA 3KQZA 4LQGA 2RC4A 5KTDA 3D3SA 4KSIA 4MFPA 4A94A 3SJGA 4KZTA 4OC0A 2PE3A 5C88A 4GS4A 5KTCA 2JDCA 3DNSA 3G8WA 3RO0A 3WT4A 5HVFA 1Y7EA 3K9TA 5C82A 1CX8A 3DSBA 5CNPA 4MCSA 3QAYA 2Z3OA 4KLVA 3PGPA 3DLJA 4M3SA 3D67A 4O23A 4QB9A 1NMTA 2EUIA 3BLNA 4RS2A 2EVNA 2EK9A 1DTDA 2GE3A 1CG2A 2JBJA 2WPWA 4M6HA 4XPLA 2C6GA 4UCMA 4OMEA 5K8PA 2B4BA 4NGQA 1M4IA 3PB7X 4XNHC 3BI1A 4PXDA 2ZEMA 2K5TA 1NSLA 2YNCC 1YX0A 4M85A 1Z2LA 4A33A 3IWGA 2DPTA 4R7MA 3FVLA 4DJLA 4F0YA 4ZGYB 3H5ZA 2BUEA 2Z3PA 2Z3MA 3K2KA 4OC4A 4OLLA 2AFZA 4P4JA 2DXQA 3B3CA 4MXUA 1JWQA 3T8WA 2JDDA 3OWCA 4R9MA 4UFWA 3GY9A 1QMUA 2PR1A 2WUUA 5H84A 2HUZA 4A32A 4ZI6A 3HUVA 2J8MA 5J8CA 1YLOA 4P4FA 3GLJA 4BINA 1R57A 3DGVA 4A95A 1S7FA 2Q7BA 2PJCA 2A4NA 3GIUA 2OZHA 3VWEA 2B5GA 3HLPA 2ZEDA 1IU8A 1RTQA 4MFKA 2QMLA 1NSAA 1RXTA 5F49A 4NGTA 2QJ8A 1XMTA 4MHDA 3EFAA 2ZPAA 4X5KA 4Y49C 3MGDA 4I49A 4AVCA 1M4GA 1YR0A 3B3TA 3PRTA 2REFA 3N5FA 4Q38A 3IU2A 2O4HA 4P44A 1XFOA 4OC1A 3FEEA 2ZEGA 4UWJA 1XOVA 4P4IA 2PIYA 3QB8A 4EFDA 3IGRA 4MFZA 2GLFA 2HB6A 2PCUA 3IWWA 5DS0A 4MFQA 5HH1A 2YNDA 3EXNA 4QUSA 3GUXA 4A38A 4NGRA 3SJFA 1M44A 2Q51A 1LAMA 2C6PA 2V8GA 4FD4A 5ELYA 5JH9A 2Q04A 4UEEA 4AXVA 4NFRA 4DNCA 4CAVA 1LAPA 1MJ9A 2FE7A 2B3VA 2VZZA 3WC5A 5A27A 5JPHA 1ZG8A 2B4DA 3IIBA 4P10A 4F9UA 2XEFA 4X2TA 5K8OA 2PJ4A 4PK2A 1S7KA 2ZOGA 3SXNA 4FBEA 1TXRA 1VHOA 3S9MA 3FNCA 1KUVA 3FJUA 5LRJA 5IX3A 2G9DA 1YVKA 4OADA 4XPDC 2VZYA 4P6YA 4JD6A 2FIWA 4R76A 4WJBA 4BBHA 3EO4A 2BEIA 3B2YA 3JRUA 3NH5A 2VBQA 4PV6A 4WWVA 2FT0A 1IOFA 4R3KA 4E2AA 4JZ0A 3TT2A 1VIXA 4KS9A 4LX9A 4C2ZA 2F5IA 4NXYA 3SI1A 2J9AA 2JLMA 4CYPA 4DYOA 4NEXA 4GXHA 4PXEA 4MRIA 4QVTA 1M1DA 1TF8A 5LRGA 3D7FA 1LRZA 1QQ9A 4K3NA 4QBJA 2D4OA 4UWIA 1PCAA 1SQHA 5CPAA 4AB7A 1QSNA 2CTBA 4HKFA 3D8PA 2GREA 2PJ8A 3TO6A 5JM6A 2ZEEA 3UY5A 1ELMP 3NH4A 5HMNA 3KL9A 4NGPA 2ZEHA 1WK4A 4PK3A 2ZEOA 4UIAA 1H8LA 2JEVA 4MHNA 1Y0RA 1KZFA 5I0CA 2R98A 1P4NA 3A9LA 2BOAA 4IUSA 4U9YA 4OC2A 4RI1A 4Z65A 2VL1A 5G20A 1S5KA 1XMBA 1ARMA 1K4JA 2OB0A 2PSWA 3B7IA 3TX8A 3D7GA 3CXSA 2I3CA 2KCWA 3TTHA 2FVGA 1XRYA 3PZJA 4OP4A 4UCNA 1BLLE 4H6UA 4F6AA 1R3NA 4CGNA 3I3GA 4KOTA 4YRHA 1HDUA 2Q4ZA 4UBRA 2ZW7A 3SHPA 2NYQA 4CYQA 2BL1A 2OH1A 4R87A 4P4DA 1ARLA 3SJEA 3RNZA 1FY7A 1RO5A 2CTCA 7CPAA 5EC4A 1IICA 1FT7A 1M4LA 4UIBA 5LYDA 3R95A 3KI9A 3RZAA 2C27A 2CNSA 1BAVA 4KVXA 1MJAA 1I1DA 2C1CA 2AE6A 1LFWA 1IOIA 3RAMA 3R96A 4CS0B 3FECA 5BWAB 4MHZA 2JBKA 5FVJA 2EK8A 3WC7A 1KUXA 4MCQA 1Z8TA 1OBRA 2I79A 2J8RA 4KVME 4CRZB 3LWUA 1P0HA 1JQGA 2Q4YA 4LUAA 5HVGA 2B58A 4OC3A 4UCPA 4R6TA 3DR8A 1IB1E 2AFUA 4B14A 5LYLA 4ZX9A 3KHXA 3WABA 1YK3A 1F2OA 3JUWA 2CY2A 3CDXA 3D66A 4Y49B 2PRQA 1Q2CA 3JVNA 2Z0ZA 4QC6A 2GLJA 2WSAA 4EWTA 3FH4A 1R43A 1Y9KA 1S60A 2WYRA 3FXTA 1LANA 1A2ZA 1X10A 4FAIA 2CIJA 5EBVA 3MRUA 5G21A 4CGMA 4F8ZA 3F0AA 3H8FA 3V7ZA 1XEBA 4AVBA 2BCOA 2DPSA 2D4PA 5K8NA 4RN7A 3SXOA 4MFJA 1L0CA 4PQAA 4R57A 4B13A 2PC1A 2IL4A 2XEJA 4Q36A 4KOVA 3PB6X 4ZY0A 1Z8XA 1KWMA 2ANPA 3I1UA 2QECA 3VATA 3DR6A 4A31A 1N71A 4FUUA 4KUBA 2ZEPA 3LD2A 1B6BA 1Z5RA 4LQ6A 5K8MA 1XJOA 4OKOA 4UEFA 2ATRA 2FCKA 3TO9A 2AJ6A 3BJ8A 1OZPA 2HC9A 2H5MA 4XPDB 4MFLA 5AG6A 4DUKA 4E8OA 2V8VA 1Z8WA 4UEZA 2VXKA 3WC6A 3C26A 3CXQA 4KOSA 1BPNA 4H89A 2OU2A 4FWUA 4BMHA 2FSRA 1Y7RA 4JYWA 4BD9A 2ZW5A 2Q4VA 4ONWA 4K30A 3D7DA 4OAEA 4PPZA 2PVVA 4NGNA 3NFZA 3MN8A 1QSTA 3V38A 2CF4A 3B3WA 4MY3A 3VH9A 2PJAA 2Q7SA 5AGEA 1I12A 4MBUA 4X8IA 1BOBA 4FD5A 2NSMA 4EMEA 1TKFA 1Y0YA 2J8NA 2PJ9A 5HXDA 4NJRA 2JEWA 1YGHA 1Y9WA 2RFHA 5G22A 2IMOA 1AYEA 2O28A 2VQYA 3D7HA 4IHMA 4MJ8A 4EVYA 4UA3A 1VHEA 4PXCA 4ONUA 2P6EA 1VKCA 1U6MA 2AFXA 3VWDA 2Z11A 3CZXA 1GYTA 4GM5A 4CGLA 2ZOFA 5IB0A 4CRYB 3TO7A 3CT9A 1VHSA 4II9A 1X12A 3W6SA 4B5PA 3L2NA 3NA6A 5THWA 1YW6A 4H6ZA 4OIWA 3IWEA 3KASA 4CYNA 2YNCA 4JLYA 4M6IA 4MMOA 1YW4A 2ZW4A 1F57A 3KKWA 4MCPA 3QAHA 4C68A 3PFEA 1YLEA 4NCZA 1ZG7A 5F47A 1NE9A 3NH8A 4KLWA 3PFOA 4PSXA 1LOKA 3DDDA 2Z3KA 4AG7A 5JQ4A 3IEHA
chains in the Genus database with same CATH topology
2I00A 4U5YA 2QIRA 3IU1A 5DWMA 1TIQA 2P6FA 5DWNA 4B12A 2Q0YA 1BO4A 4XPKA 3ZJ0A 1MJBA 4XNHB 5F48A 3R9EA 5A28A 1XIXA 3EC4A 3RYOA 4B5OA 3LODA 2PRBA 4UFVA 1UFHA 4KOXA 2G3TA 5ISVA 2VI7A 2YGWA 3S6GA 1V0CA 3P2HA 2VEZA 2ARHA 3FRMA 2Z10A 2BSWA 3W6XA 3PP9A 1QSOA 2X7BA 4C2XA 2FL4A 3WR7A 4AG9A 3G3SA 2GANA 4C7IA 4KVOE 4B10A 4C7HA 4A30A 3T9YA 3FYNA 4YGOA 3ZZIA 4JJXA 1YREA 1ZO0A 3K9UA 4IF5A 4L8AA 3CXPA 4FD7A 3TCVA 2R1IA 4JWPA 3E0KA 4NF1A 3GYAA 1M4DA 2PR8A 3P2FA 1IYKA 3FIXA 2B3UA 2Z3LA 3T90A 4B11A 3D2PA 4ZBGA 3TOBA 3S6KA 2FS5A 4KSFA 5KTAA 5AG7A 5E96A 1MK4A 2PDOA 1WWZA 1Z9UA 2PQ8A 4HNXB 4CGOA 4MI4A 1PU9A 2FIAA 3V8IA 2Q44A 3TOAA 1QSRA 2CNMA 2R8VA 1S3ZA 3R1KA 4HNYB 1J4JA 1IIDA 4CAXA 4JXQA 4CAEA 5G1ZA 3NE7A 3R9FA 5AG4A 2GIVA 5AG5A 4F0XA 4A2ZA 2Z3NA 2P6GA 5H86A 4CAWA 1B87A 2HQYA 3TE4A 4HNWB 2CXAA 3F8KA 4KSAA 4ORFA 3F5BA 3FBUA 3W91A 2B5GB 4AVAA 5GCNA 2FXFA 1IYLA 4C2YA 4KOYA 2REEA 3H4QA 5IV0A 4J3GA 3BJ7A 2CNTA 3I9SA 4KUAA 1YVOA 2G0BA 4CAFA 3EY5A 3B8GA 4L89A 5J8FA 2Y0MA 4PSWA 4MY0A 1XE4A 2G3AA 4CGPA 1S7LA 1PUAA 1CM0A 4KORA 4FD6A 2B4DB 1KUYA 2P0WA 1ON0A 5F46A 3S6HA 4R3LA 3JTKA 3R9GA 2OZGA 2HV2A 2ZXVA 2YNEA 1Z4EA 1QSMA 1Q2DA 2ZW6A 2R7HA 1XF8A 3S6FA 4YFJA 3D2MA 1CJWA 1Q2YA 4NSQA 3FB3A 1S7NA 4UFXA 1GHEA 4JXRA 4KOWA 4KOUA 1Z4RA 4U9ZA 3TFYA 4E0AA 3GKRA 4CYOA 1I21A 2NMTA 2WPXA 2OZUA 4B5PB 3N7ZA 2RC4A 5KTDA 3D3SA 4MFPA 4KZTA 5C88A 4GS4A 5KTCA 2JDCA 3DNSA 3G8WA 5C82A 3DSBA 5CNPA 2Z3OA 4KLVA 3PGPA 4M3SA 4QB9A 1NMTA 2EUIA 3BLNA 4RS2A 2EVNA 4E2AA 2GE3A 2WPWA 4XPLA 4UCMA 2B4BA 1M4IA 4XNHC 2K5TA 1NSLA 2YNCC 1YX0A 4M85A 4A33A 3IWGA 2DPTA 4ZGYB 4F0YA 3H5ZA 2BUEA 2Z3PA 2Z3MA 4OLLA 2DXQA 2JDDA 3OWCA 4R9MA 4UFWA 3GY9A 2PR1A 2WUUA 5H84A 2HUZA 4A32A 5J8CA 2J8MA 1R57A 4A95A 1S7FA 2Q7BA 2A4NA 2OZHA 3VWEA 2B5GA 4MFKA 2QMLA 1RXTA 5F49A 1XMTA 4MHDA 3EFAA 2ZPAA 4X5KA 4Y49C 3MGDA 4I49A 4AVCA 1M4GA 1YR0A 2REFA 4Q38A 3IU2A 4UWJA 3QB8A 3IGRA 4MFZA 4MFQA 5HH1A 2YNDA 3EXNA 4QUSA 1M44A 4FD4A 2Q04A 4DNCA 4CAVA 1MJ9A 2FE7A 2B3VA 2VZZA 5A27A 5JPHA 2B4DA 4PK2A 1S7KA 3SXNA 3FNCA 1KUVA 5IX3A 1YVKA 4OADA 4XPDC 2VZYA 4JD6A 2FIWA 4BBHA 3EO4A 2BEIA 4PV6A 2VBQA 2FT0A 4R3KA 3TT2A 4KS9A 4LX9A 4C2ZA 2F5IA 4NXYA 4CYPA 2JLMA 4NEXA 4QVTA 1M1DA 1LRZA 4QBJA 2D4OA 4UWIA 1SQHA 4AB7A 1QSNA 3TO6A 4HKFA 3D8PA 3UY5A 5HMNA 1WK4A 4PK3A 2JEVA 1KZFA 5I0CA 2R98A 1P4NA 3A9LA 4IUSA 4U9YA 4RI1A 5G20A 1S5KA 2PSWA 1K4JA 2OB0A 3CXSA 2KCWA 3TTHA 3PZJA 4UCNA 4H6UA 4F6AA 4CGNA 3I3GA 4KOTA 4YRHA 4UBRA 2ZW7A 3SHPA 4CYQA 2BL1A 2OH1A 4R87A 1FY7A 1RO5A 5EC4A 1IICA 3R95A 2C27A 2CNSA 4KVXA 1I1DA 1MJAA 2AE6A 3R96A 4CS0B 5BWAB 5FVJA 1KUXA 4KVME 2I79A 2J8RA 4CRZB 1P0HA 4LUAA 2Q4YA 2B58A 4UCPA 3DR8A 1IB1E 4B14A 1YK3A 3JUWA 2CY2A 4Y49B 3JVNA 1Q2CA 4QC6A 2Z0ZA 2WSAA 1Y9KA 1S60A 3FXTA 5EBVA 5G21A 4CGMA 3F0AA 1XEBA 4AVBA 2DPSA 2D4PA 3SXOA 4MFJA 1L0CA 4R57A 4B13A 2PC1A 2IL4A 4Q36A 4KOVA 4A31A 2QECA 3DR6A 1N71A 4KUBA 3LD2A 1B6BA 2ATRA 2FCKA 3TO9A 2AJ6A 3BJ8A 1OZPA 4XPDB 2H5MA 5AG6A 4MFLA 4E8OA 2VXKA 3C26A 3CXQA 4KOSA 4H89A 2OU2A 4BMHA 2FSRA 1Y7RA 2ZW5A 2Q4VA 4K30A 4OAEA 1QSTA 4MY3A 5AGEA 1I12A 4MBUA 1BOBA 4FD5A 2J8NA 1YGHA 1Y9WA 5G22A 2O28A 2VQYA 4EVYA 4MJ8A 4UA3A 4ONUA 2P6EA 1VKCA 1U6MA 3VWDA 2Z11A 4CGLA 5IB0A 4CRYB 3TO7A 1VHSA 4II9A 3W6SA 4B5PA 4H6ZA 3IWEA 4CYNA 2YNCA 4JLYA 2ZW4A 3KKWA 3QAHA 4C68A 1YLEA 4NCZA 5F47A 1NE9A 4KLWA 4PSXA 3DDDA 2Z3KA 4AG7A 5JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  4U5Y A;  2QIR A;  5DWM A;  1TIQ A;  2P6F A;  5DWN A;  2Q0Y A;  1BO4 A;  4XPK A;  3ZJ0 A;  1MJB A;  4XNH B;  5F48 A;  3R9E A;  1XIX A;  3EC4 A;  3RYO A;  4B5O A;  3LOD A;  2PRB A;  1UFH A;  4KOX A;  2G3T A;  5ISV A;  2VI7 A;  3S6G A;  1V0C A;  3P2H A;  2VEZ A;  2ARH A;  3FRM A;  2Z10 A;  2BSW A;  3W6X A;  3PP9 A;  1QSO A;  2X7B A;  2FL4 A;  3WR7 A;  4AG9 A;  3G3S A;  2GAN A;  4KVO E;  3T9Y A;  3FYN A;  4YGO A;  3ZZI A;  4JJX A;  1YRE A;  3K9U A;  4IF5 A;  4L8A A;  3CXP A;  4FD7 A;  3TCV A;  2R1I A;  4JWP A;  3E0K A;  4NF1 A;  3GYA A;  1M4D A;  2PR8 A;  3P2F A;  1IYK A;  3FIX A;  2B3U A;  3T90 A;  3D2P A;  4ZBG A;  3TOB A;  3S6K A;  2FS5 A;  5KTA A;  5E96 A;  1MK4 A;  2PDO A;  1WWZ A;  1Z9U A;  2PQ8 A;  4HNX B;  4MI4 A;  1PU9 A;  2FIA A;  3V8I A;  2Q44 A;  3TOA A;  1QSR A;  2CNM A;  2R8V A;  1S3Z A;  3R1K A;  4HNY B;  1J4J A;  1IID A;  4CAX A;  4JXQ A;  3NE7 A;  3R9F A;  2GIV A;  2P6G A;  5H86 A;  4CAW A;  1B87 A;  2HQY A;  3TE4 A;  4HNW B;  3F8K A;  4ORF A;  3F5B A;  3FBU A;  3W91 A;  2B5G B;  4AVA A;  5GCN A;  2FXF A;  1IYL A;  4KOY A;  2REE A;  3H4Q A;  5IV0 A;  4J3G A;  3BJ7 A;  2CNT A;  3I9S A;  4KUA A;  1YVO A;  2G0B A;  3EY5 A;  3B8G A;  4L89 A;  5J8F A;  2Y0M A;  4PSW A;  4MY0 A;  1XE4 A;  2G3A A;  1S7L A;  1PUA A;  1CM0 A;  4KOR A;  4FD6 A;  2B4D B;  1KUY A;  2P0W A;  1ON0 A;  5F46 A;  3S6H A;  4R3L A;  3R9G A;  2OZG A;  2HV2 A;  2ZXV A;  1Z4E A;  1QSM A;  1Q2D A;  2ZW6 A;  2R7H A;  1XF8 A;  3S6F A;  4YFJ A;  3D2M A;  1CJW A;  1Q2Y A;  4NSQ A;  3FB3 A;  1S7N A;  1GHE A;  4JXR A;  4KOW A;  4KOU A;  1Z4R A;  4U9Z A;  3TFY A;  4E0A A;  3GKR A;  1I21 A;  2NMT A;  2WPX A;  2OZU A;  4B5P B;  3N7Z A;  2RC4 A;  5KTD A;  3D3S A;  4KZT A;  5C88 A;  4GS4 A;  5KTC A;  2JDC A;  3DNS A;  3G8W A;  5C82 A;  3DSB A;  5CNP A;  4KLV A;  3PGP A;  4M3S A;  4QB9 A;  1NMT A;  2EUI A;  3BLN A;  4RS2 A;  2EVN A;  4E2A A;  2GE3 A;  2WPW A;  4XPL A;  2B4B A;  1M4I A;  4XNH C;  2K5T A;  1NSL A;  1YX0 A;  4M85 A;  3IWG A;  4F0Y A;  2BUE A;  4OLL A;  2DXQ A;  2JDD A;  3OWC A;  4R9M A;  3GY9 A;  2PR1 A;  5H84 A;  2HUZ A;  5J8C A;  2J8M A;  1R57 A;  1S7F A;  2Q7B A;  2A4N A;  2OZH A;  3VWE A;  2B5G A;  2QML A;  1RXT A;  5F49 A;  1XMT A;  4MHD A;  3EFA A;  2ZPA A;  4X5K A;  4Y49 C;  3MGD A;  4I49 A;  4AVC A;  1M4G A;  1YR0 A;  2REF A;  4UWJ A;  3QB8 A;  3IGR A;  5HH1 A;  3EXN A;  4QUS A;  1M44 A;  4FD4 A;  2Q04 A;  4DNC A;  4CAV A;  1MJ9 A;  2FE7 A;  2B3V A;  2VZZ A;  5JPH A;  2B4D A;  4PK2 A;  1S7K A;  3SXN A;  3FNC A;  1KUV A;  5IX3 A;  1YVK A;  4OAD A;  4XPD C;  2VZY A;  4JD6 A;  2FIW A;  3EO4 A;  2BEI A;  4PV6 A;  2VBQ A;  2FT0 A;  4R3K A;  3TT2 A;  4LX9 A;  2F5I A;  4NXY A;  2JLM A;  4NEX A;  4QVT A;  1M1D A;  1LRZ A;  4QBJ A;  2D4O A;  4UWI A;  1SQH A;  4AB7 A;  1QSN A;  3TO6 A;  4HKF A;  3D8P A;  3UY5 A;  5HMN A;  1WK4 A;  4PK3 A;  2JEV A;  1KZF A;  5I0C A;  2R98 A;  1P4N A;  4IUS A;  4U9Y A;  4RI1 A;  1S5K A;  2PSW A;  1K4J A;  2OB0 A;  3CXS A;  2KCW A;  3TTH A;  3PZJ A;  4H6U A;  4F6A A;  3I3G A;  4KOT A;  4YRH A;  4UBR A;  2ZW7 A;  3SHP A;  2BL1 A;  2OH1 A;  4R87 A;  1FY7 A;  1RO5 A;  5EC4 A;  1IIC A;  3R95 A;  2C27 A;  2CNS A;  4KVX A;  1I1D A;  1MJA A;  2AE6 A;  3R96 A;  4CS0 B;  5FVJ A;  1KUX A;  4KVM E;  2I79 A;  2J8R A;  4CRZ B;  1P0H A;  4LUA A;  2Q4Y A;  2B58 A;  3DR8 A;  1IB1 E;  1YK3 A;  3JUW A;  2CY2 A;  4Y49 B;  3JVN A;  1Q2C A;  4QC6 A;  2Z0Z A;  1Y9K A;  1S60 A;  3FXT A;  5EBV A;  3F0A A;  1XEB A;  4AVB A;  2D4P A;  3SXO A;  1L0C A;  4R57 A;  2PC1 A;  2IL4 A;  4KOV A;  2QEC A;  3DR6 A;  1N71 A;  4KUB A;  3LD2 A;  1B6B A;  2ATR A;  2FCK A;  3TO9 A;  2AJ6 A;  3BJ8 A;  1OZP A;  4XPD B;  2H5M A;  4E8O A;  2VXK A;  3C26 A;  3CXQ A;  4KOS A;  4H89 A;  2OU2 A;  4BMH A;  2FSR A;  1Y7R A;  2ZW5 A;  2Q4V A;  4K30 A;  4OAE A;  1QST A;  4MY3 A;  1I12 A;  4MBU A;  1BOB A;  4FD5 A;  2J8N A;  1YGH A;  1Y9W A;  2O28 A;  2VQY A;  4EVY A;  4MJ8 A;  4UA3 A;  4ONU A;  2P6E A;  1VKC A;  1U6M A;  3VWD A;  2Z11 A;  5IB0 A;  4CRY B;  3TO7 A;  1VHS A;  4II9 A;  3W6S A;  4B5P A;  4H6Z A;  4JLY A;  2ZW4 A;  3KKW A;  3QAH A;  1YLE A;  4NCZ A;  5F47 A;  1NE9 A;  4KLW A;  4PSX A;  3DDD A;  4AG7 A;  5JQ4 A; 
#chains in the Genus database with same CATH topology
 1LCP A;  2I00 A;  4U5Y A;  2QIR A;  3FF3 A;  2C6C A;  4RUH A;  3IJ3 A;  1DE4 C;  3IU1 A;  5DWM A;  1TIQ A;  2P6F A;  5DWN A;  4TNU A;  3SI2 A;  2PJB A;  4B12 A;  2Q0Y A;  2DF5 A;  1BO4 A;  3KR4 A;  2Q43 A;  2QVP A;  2PJ1 A;  4XPK A;  3PB9 X;  3ZJ0 A;  1MJB A;  1TF9 A;  4XNH B;  2F7V A;  2PJ7 A;  4IK2 A;  4Q7A A;  3KGQ A;  5F48 A;  3R9E A;  5A28 A;  1XIX A;  3SJX A;  3EC4 A;  3RYO A;  4MHP A;  4B5O A;  3LOD A;  3PBE A;  3SI0 A;  2PRB A;  4UFV A;  3FMC A;  5D8N A;  1UFH A;  2O53 A;  4KOX A;  2G3T A;  5ISV A;  2VI7 A;  4CPA A;  2YGW A;  3S6G A;  1V0C A;  2PIZ A;  5LRK A;  1VGY A;  3P2H A;  1EE3 P;  2VEZ A;  2ARH A;  3FRM A;  3H8E A;  2Z10 A;  2F8H A;  2BSW A;  3W6X A;  3PP9 A;  3B3S A;  1QSO A;  4X3R A;  1CP6 A;  4F9V A;  2X7B A;  4C2X A;  3LMS A;  2FL4 A;  4NJQ A;  3WR7 A;  2AFM A;  2XEI A;  2GAN A;  3G3S A;  4AG9 A;  2PJ3 A;  4C7I A;  4KVO E;  4B10 A;  4C7H A;  4A30 A;  3T9Y A;  3FYN A;  4YGO A;  3ZZI A;  4JJX A;  1AUG A;  1TKH A;  4P4B A;  1YRE A;  2V77 A;  4PXB A;  4MHY A;  1ZLH A;  3CPA A;  1ZO0 A;  3K9U A;  4IF5 A;  3KHZ A;  4L8A A;  3CXP A;  3S9L A;  4FD7 A;  3IO1 A;  2PJ6 A;  3TCV A;  3CPX A;  2R1I A;  2ZEL A;  4JWP A;  3E0K A;  4P45 A;  4A37 A;  2GU2 A;  4NF1 A;  3ISX A;  3GYA A;  1M4D A;  2PR8 A;  3BHX A;  4H2K A;  1F2P A;  2IJZ A;  3TC8 A;  3P2F A;  4YU9 A;  2ABZ A;  1IYK A;  2RB7 A;  3FIX A;  2B3U A;  1YQE A;  2AFW A;  2Z3L A;  3T90 A;  4B11 A;  4ZY2 A;  4ZY1 A;  3D2P A;  4ZBG A;  3TOB A;  4NGM A;  3S6K A;  2ODF A;  2FS5 A;  4KSF A;  5KTA A;  3IC1 A;  2ZEF A;  3PBB A;  5AG7 A;  5E96 A;  1MK4 A;  2PDO A;  1WWZ A;  4OID A;  5EMI A;  2WZN A;  1Z9U A;  1IGB A;  2PQ8 A;  3D68 A;  5D29 A;  4HNX B;  1HEE A;  4CGO A;  2POK A;  1Z8L A;  4MI4 A;  1PU9 A;  5J1Q A;  2FIA A;  1AMP A;  2OOT A;  3V8I A;  2Q44 A;  3TOA A;  3PEI A;  1QSR A;  2CNM A;  2R8V A;  2V8D A;  4P4E A;  1YME A;  1S3Z A;  3R1K A;  4HNY B;  1J4J A;  1IID A;  4CAX A;  3H8G A;  4JXQ A;  4MCR A;  4CAE A;  5CBM A;  5G1Z A;  3NE7 A;  1XBU A;  3R9F A;  2GFQ A;  5AG4 A;  2GIV A;  2OR4 A;  5AG5 A;  4F0X A;  3KQX A;  4A2Z A;  2Z3N A;  2P6G A;  4TWE A;  5H86 A;  4CAW A;  1B87 A;  2ZEN A;  2HQY A;  3FED A;  3TE4 A;  4HNW B;  4NGS A;  2CXA A;  3F8K A;  4KSA A;  4ORF A;  3S9N A;  5LYF A;  2XEG A;  3LAC A;  3F5B A;  2AFO A;  3FBU A;  1UWY A;  2AFS A;  3IFE A;  3W91 A;  2B5G B;  4AVA A;  5GCN A;  2FXF A;  3GB0 A;  1IYL A;  4C2Y A;  1Q7L A;  4KOY A;  3KR5 A;  2REE A;  3H4Q A;  2EO8 A;  5IV0 A;  5I4M A;  1FNO A;  4J3G A;  5F09 A;  3BJ7 A;  2CNT A;  3I9S A;  1CP7 A;  4KUA A;  2PJ0 A;  1YVO A;  4ZX8 A;  1IY7 A;  2G0B A;  4OC5 A;  4CAF A;  1CBX A;  1HDQ A;  3EY5 A;  3B8G A;  1CPX A;  3QNV A;  4L89 A;  5J8F A;  2Y0M A;  1ZLI A;  3D4U A;  4IAV A;  4PSW A;  4UF4 A;  4MY0 A;  1XE4 A;  1YSJ A;  1ZG9 A;  2G3A A;  2PVW A;  3KZW A;  4HPS A;  2V8H A;  5HVH A;  4CGP A;  1S7L A;  1PUA A;  2EWB A;  1CM0 A;  4KOR A;  4G1P A;  1CPS A;  1PYT B;  6CPA A;  4FD6 A;  2B4D B;  4A39 A;  1KUY A;  2P0W A;  1ON0 A;  5F46 A;  3S6H A;  4R3L A;  3JTK A;  3R9G A;  2OZG A;  2HV2 A;  2ZXV A;  2YNE A;  1Z4E A;  1QSM A;  1Q2D A;  4M6G A;  4R8F A;  2ZW6 A;  2BO9 A;  2EBJ A;  3PB4 X;  4B6Z A;  2PJ5 A;  1TKJ A;  4ZYQ A;  2R7H A;  1XF8 A;  1BPM A;  3S6F A;  3D2M A;  4YFJ A;  1CJW A;  1Q2Y A;  2IQ6 A;  3PB8 X;  3RBU A;  3VAR A;  3ISZ A;  1ELL P;  4NSQ A;  3FB3 A;  1S7N A;  8CPA A;  4UFX A;  1GHE A;  3B3V A;  4JXR A;  4KOW A;  4KOU A;  4W9Y A;  1Z4R A;  3BXM A;  5LYI A;  4U9Z A;  4YWY A;  4E0A A;  3TFY A;  3BI0 A;  3GKR A;  4CYO A;  1I21 A;  2NMT A;  3B35 A;  2QYV A;  2PJ2 A;  5IB9 A;  2WPX A;  3NE8 A;  2OZU A;  3FX6 A;  4B5P B;  5JGF A;  2DEA A;  3N7Z A;  3KQZ A;  4LQG A;  2RC4 A;  5KTD A;  3D3S A;  4KSI A;  4MFP A;  4A94 A;  3SJG A;  4KZT A;  4OC0 A;  2PE3 A;  5C88 A;  4GS4 A;  5KTC A;  2JDC A;  3DNS A;  3G8W A;  3RO0 A;  3WT4 A;  5HVF A;  1Y7E A;  3K9T A;  5C82 A;  1CX8 A;  3DSB A;  5CNP A;  4MCS A;  3QAY A;  2Z3O A;  4KLV A;  3PGP A;  3DLJ A;  4M3S A;  3D67 A;  4O23 A;  4QB9 A;  1NMT A;  2EUI A;  3BLN A;  4RS2 A;  2EVN A;  2EK9 A;  1DTD A;  2GE3 A;  1CG2 A;  2JBJ A;  2WPW A;  4M6H A;  4XPL A;  2C6G A;  4UCM A;  4OME A;  5K8P A;  2B4B A;  4NGQ A;  1M4I A;  3PB7 X;  4XNH C;  3BI1 A;  4PXD A;  2ZEM A;  2K5T A;  1NSL A;  2YNC C;  1YX0 A;  4M85 A;  1Z2L A;  4A33 A;  3IWG A;  2DPT A;  4R7M A;  3FVL A;  4DJL A;  4F0Y A;  4ZGY B;  3H5Z A;  2BUE A;  2Z3P A;  2Z3M A;  3K2K A;  4OC4 A;  4OLL A;  2AFZ A;  4P4J A;  2DXQ A;  3B3C A;  4MXU A;  1JWQ A;  3T8W A;  2JDD A;  3OWC A;  4R9M A;  4UFW A;  3GY9 A;  1QMU A;  2PR1 A;  2WUU A;  5H84 A;  2HUZ A;  4A32 A;  4ZI6 A;  3HUV A;  2J8M A;  5J8C A;  1YLO A;  4P4F A;  3GLJ A;  4BIN A;  1R57 A;  3DGV A;  4A95 A;  1S7F A;  2Q7B A;  2PJC A;  2A4N A;  3GIU A;  2OZH A;  3VWE A;  2B5G A;  3HLP A;  2ZED A;  1IU8 A;  1RTQ A;  4MFK A;  2QML A;  1NSA A;  1RXT A;  5F49 A;  4NGT A;  2QJ8 A;  1XMT A;  4MHD A;  3EFA A;  2ZPA A;  4X5K A;  4Y49 C;  3MGD A;  4I49 A;  4AVC A;  1M4G A;  1YR0 A;  3B3T A;  3PRT A;  2REF A;  3N5F A;  4Q38 A;  3IU2 A;  2O4H A;  4P44 A;  1XFO A;  4OC1 A;  3FEE A;  2ZEG A;  4UWJ A;  1XOV A;  4P4I A;  2PIY A;  3QB8 A;  4EFD A;  3IGR A;  4MFZ A;  2GLF A;  2HB6 A;  2PCU A;  3IWW A;  5DS0 A;  4MFQ A;  5HH1 A;  2YND A;  3EXN A;  4QUS A;  3GUX A;  4A38 A;  4NGR A;  3SJF A;  1M44 A;  2Q51 A;  1LAM A;  2C6P A;  2V8G A;  4FD4 A;  5ELY A;  5JH9 A;  2Q04 A;  4UEE A;  4AXV A;  4NFR A;  4DNC A;  4CAV A;  1LAP A;  1MJ9 A;  2FE7 A;  2B3V A;  2VZZ A;  3WC5 A;  5A27 A;  5JPH A;  1ZG8 A;  2B4D A;  3IIB A;  4P10 A;  4F9U A;  2XEF A;  4X2T A;  5K8O A;  2PJ4 A;  4PK2 A;  1S7K A;  2ZOG A;  3SXN A;  4FBE A;  1TXR A;  1VHO A;  3S9M A;  3FNC A;  1KUV A;  3FJU A;  5LRJ A;  5IX3 A;  2G9D A;  1YVK A;  4OAD A;  4XPD C;  2VZY A;  4P6Y A;  4JD6 A;  2FIW A;  4R76 A;  4WJB A;  4BBH A;  3EO4 A;  2BEI A;  3B2Y A;  3JRU A;  3NH5 A;  2VBQ A;  4PV6 A;  4WWV A;  2FT0 A;  1IOF A;  4R3K A;  4E2A A;  4JZ0 A;  3TT2 A;  1VIX A;  4KS9 A;  4LX9 A;  4C2Z A;  2F5I A;  4NXY A;  3SI1 A;  2J9A A;  2JLM A;  4CYP A;  4DYO A;  4NEX A;  4GXH A;  4PXE A;  4MRI A;  4QVT A;  1M1D A;  1TF8 A;  5LRG A;  3D7F A;  1LRZ A;  1QQ9 A;  4K3N A;  4QBJ A;  2D4O A;  4UWI A;  1PCA A;  1SQH A;  5CPA A;  4AB7 A;  1QSN A;  2CTB A;  4HKF A;  3D8P A;  2GRE A;  2PJ8 A;  3TO6 A;  5JM6 A;  2ZEE A;  3UY5 A;  1ELM P;  3NH4 A;  5HMN A;  3KL9 A;  4NGP A;  2ZEH A;  1WK4 A;  4PK3 A;  2ZEO A;  4UIA A;  1H8L A;  2JEV A;  4MHN A;  1Y0R A;  1KZF A;  5I0C A;  2R98 A;  1P4N A;  3A9L A;  2BOA A;  4IUS A;  4U9Y A;  4OC2 A;  4RI1 A;  4Z65 A;  2VL1 A;  5G20 A;  1S5K A;  1XMB A;  1ARM A;  1K4J A;  2OB0 A;  2PSW A;  3B7I A;  3TX8 A;  3D7G A;  3CXS A;  2I3C A;  2KCW A;  3TTH A;  2FVG A;  1XRY A;  3PZJ A;  4OP4 A;  4UCN A;  1BLL E;  4H6U A;  4F6A A;  1R3N A;  4CGN A;  3I3G A;  4KOT A;  4YRH A;  1HDU A;  2Q4Z A;  4UBR A;  2ZW7 A;  3SHP A;  2NYQ A;  4CYQ A;  2BL1 A;  2OH1 A;  4R87 A;  4P4D A;  1ARL A;  3SJE A;  3RNZ A;  1FY7 A;  1RO5 A;  2CTC A;  7CPA A;  5EC4 A;  1IIC A;  1FT7 A;  1M4L A;  4UIB A;  5LYD A;  3R95 A;  3KI9 A;  3RZA A;  2C27 A;  2CNS A;  1BAV A;  4KVX A;  1MJA A;  1I1D A;  2C1C A;  2AE6 A;  1LFW A;  1IOI A;  3RAM A;  3R96 A;  4CS0 B;  3FEC A;  5BWA B;  4MHZ A;  2JBK A;  5FVJ A;  2EK8 A;  3WC7 A;  1KUX A;  4MCQ A;  1Z8T A;  1OBR A;  2I79 A;  2J8R A;  4KVM E;  4CRZ B;  3LWU A;  1P0H A;  1JQG A;  2Q4Y A;  4LUA A;  5HVG A;  2B58 A;  4OC3 A;  4UCP A;  4R6T A;  3DR8 A;  1IB1 E;  2AFU A;  4B14 A;  5LYL A;  4ZX9 A;  3KHX A;  3WAB A;  1YK3 A;  1F2O A;  3JUW A;  2CY2 A;  3CDX A;  3D66 A;  4Y49 B;  2PRQ A;  1Q2C A;  3JVN A;  2Z0Z A;  4QC6 A;  2GLJ A;  2WSA A;  4EWT A;  3FH4 A;  1R43 A;  1Y9K A;  1S60 A;  2WYR A;  3FXT A;  1LAN A;  1A2Z A;  1X10 A;  4FAI A;  2CIJ A;  5EBV A;  3MRU A;  5G21 A;  4CGM A;  4F8Z A;  3F0A A;  3H8F A;  3V7Z A;  1XEB A;  4AVB A;  2BCO A;  2DPS A;  2D4P A;  5K8N A;  4RN7 A;  3SXO A;  4MFJ A;  1L0C A;  4PQA A;  4R57 A;  4B13 A;  2PC1 A;  2IL4 A;  2XEJ A;  4Q36 A;  4KOV A;  3PB6 X;  4ZY0 A;  1Z8X A;  1KWM A;  2ANP A;  3I1U A;  2QEC A;  3VAT A;  3DR6 A;  4A31 A;  1N71 A;  4FUU A;  4KUB A;  2ZEP A;  3LD2 A;  1B6B A;  1Z5R A;  4LQ6 A;  5K8M A;  1XJO A;  4OKO A;  4UEF A;  2ATR A;  2FCK A;  3TO9 A;  2AJ6 A;  3BJ8 A;  1OZP A;  2HC9 A;  2H5M A;  4XPD B;  4MFL A;  5AG6 A;  4DUK A;  4E8O A;  2V8V A;  1Z8W A;  4UEZ A;  2VXK A;  3WC6 A;  3C26 A;  3CXQ A;  4KOS A;  1BPN A;  4H89 A;  2OU2 A;  4FWU A;  4BMH A;  2FSR A;  1Y7R A;  4JYW A;  4BD9 A;  2ZW5 A;  2Q4V A;  4ONW A;  4K30 A;  3D7D A;  4OAE A;  4PPZ A;  2PVV A;  4NGN A;  3NFZ A;  3MN8 A;  1QST A;  3V38 A;  2CF4 A;  3B3W A;  4MY3 A;  3VH9 A;  2PJA A;  2Q7S A;  5AGE A;  1I12 A;  4MBU A;  4X8I A;  1BOB A;  4FD5 A;  2NSM A;  4EME A;  1TKF A;  1Y0Y A;  2J8N A;  2PJ9 A;  5HXD A;  4NJR A;  2JEW A;  1YGH A;  1Y9W A;  2RFH A;  5G22 A;  2IMO A;  1AYE A;  2O28 A;  2VQY A;  3D7H A;  4IHM A;  4MJ8 A;  4EVY A;  4UA3 A;  1VHE A;  4PXC A;  4ONU A;  2P6E A;  1VKC A;  1U6M A;  2AFX A;  3VWD A;  2Z11 A;  3CZX A;  1GYT A;  4GM5 A;  4CGL A;  2ZOF A;  5IB0 A;  4CRY B;  3TO7 A;  3CT9 A;  1VHS A;  4II9 A;  1X12 A;  3W6S A;  4B5P A;  3L2N A;  3NA6 A;  5THW A;  1YW6 A;  4H6Z A;  4OIW A;  3IWE A;  3KAS A;  4CYN A;  2YNC A;  4JLY A;  4M6I A;  4MMO A;  1YW4 A;  2ZW4 A;  1F57 A;  3KKW A;  4MCP A;  3QAH A;  4C68 A;  3PFE A;  1YLE A;  4NCZ A;  1ZG7 A;  5F47 A;  1NE9 A;  3NH8 A;  4KLW A;  3PFO A;  4PSX A;  1LOK A;  3DDD A;  2Z3K A;  4AG7 A;  5JQ4 A;  3IEH A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4U5Y A;  2QIR A;  3IU1 A;  5DWM A;  1TIQ A;  2P6F A;  5DWN A;  4B12 A;  2Q0Y A;  1BO4 A;  4XPK A;  3ZJ0 A;  1MJB A;  4XNH B;  5F48 A;  3R9E A;  5A28 A;  1XIX A;  3EC4 A;  3RYO A;  4B5O A;  3LOD A;  2PRB A;  4UFV A;  1UFH A;  4KOX A;  2G3T A;  5ISV A;  2VI7 A;  2YGW A;  3S6G A;  1V0C A;  3P2H A;  2VEZ A;  2ARH A;  3FRM A;  2Z10 A;  2BSW A;  3W6X A;  3PP9 A;  1QSO A;  2X7B A;  4C2X A;  2FL4 A;  3WR7 A;  4AG9 A;  3G3S A;  2GAN A;  4C7I A;  4KVO E;  4B10 A;  4C7H A;  4A30 A;  3T9Y A;  3FYN A;  4YGO A;  3ZZI A;  4JJX A;  1YRE A;  1ZO0 A;  3K9U A;  4IF5 A;  4L8A A;  3CXP A;  4FD7 A;  3TCV A;  2R1I A;  4JWP A;  3E0K A;  4NF1 A;  3GYA A;  1M4D A;  2PR8 A;  3P2F A;  1IYK A;  3FIX A;  2B3U A;  2Z3L A;  3T90 A;  4B11 A;  3D2P A;  4ZBG A;  3TOB A;  3S6K A;  2FS5 A;  4KSF A;  5KTA A;  5AG7 A;  5E96 A;  1MK4 A;  2PDO A;  1WWZ A;  1Z9U A;  2PQ8 A;  4HNX B;  4CGO A;  4MI4 A;  1PU9 A;  2FIA A;  3V8I A;  2Q44 A;  3TOA A;  1QSR A;  2CNM A;  2R8V A;  1S3Z A;  3R1K A;  4HNY B;  1J4J A;  1IID A;  4CAX A;  4JXQ A;  4CAE A;  5G1Z A;  3NE7 A;  3R9F A;  5AG4 A;  2GIV A;  5AG5 A;  4F0X A;  4A2Z A;  2Z3N A;  2P6G A;  5H86 A;  4CAW A;  1B87 A;  2HQY A;  3TE4 A;  4HNW B;  2CXA A;  3F8K A;  4KSA A;  4ORF A;  3F5B A;  3FBU A;  3W91 A;  2B5G B;  4AVA A;  5GCN A;  2FXF A;  1IYL A;  4C2Y A;  4KOY A;  2REE A;  3H4Q A;  5IV0 A;  4J3G A;  3BJ7 A;  2CNT A;  3I9S A;  4KUA A;  1YVO A;  2G0B A;  4CAF A;  3EY5 A;  3B8G A;  4L89 A;  5J8F A;  2Y0M A;  4PSW A;  4MY0 A;  1XE4 A;  2G3A A;  4CGP A;  1S7L A;  1PUA A;  1CM0 A;  4KOR A;  4FD6 A;  2B4D B;  1KUY A;  2P0W A;  1ON0 A;  5F46 A;  3S6H A;  4R3L A;  3JTK A;  3R9G A;  2OZG A;  2HV2 A;  2ZXV A;  2YNE A;  1Z4E A;  1QSM A;  1Q2D A;  2ZW6 A;  2R7H A;  1XF8 A;  3S6F A;  4YFJ A;  3D2M A;  1CJW A;  1Q2Y A;  4NSQ A;  3FB3 A;  1S7N A;  4UFX A;  1GHE A;  4JXR A;  4KOW A;  4KOU A;  1Z4R A;  4U9Z A;  3TFY A;  4E0A A;  3GKR A;  4CYO A;  1I21 A;  2NMT A;  2WPX A;  2OZU A;  4B5P B;  3N7Z A;  2RC4 A;  5KTD A;  3D3S A;  4MFP A;  4KZT A;  5C88 A;  4GS4 A;  5KTC A;  2JDC A;  3DNS A;  3G8W A;  5C82 A;  3DSB A;  5CNP A;  2Z3O A;  4KLV A;  3PGP A;  4M3S A;  4QB9 A;  1NMT A;  2EUI A;  3BLN A;  4RS2 A;  2EVN A;  4E2A A;  2GE3 A;  2WPW A;  4XPL A;  4UCM A;  2B4B A;  1M4I A;  4XNH C;  2K5T A;  1NSL A;  2YNC C;  1YX0 A;  4M85 A;  4A33 A;  3IWG A;  2DPT A;  4ZGY B;  4F0Y A;  3H5Z A;  2BUE A;  2Z3P A;  2Z3M A;  4OLL A;  2DXQ A;  2JDD A;  3OWC A;  4R9M A;  4UFW A;  3GY9 A;  2PR1 A;  2WUU A;  5H84 A;  2HUZ A;  4A32 A;  5J8C A;  2J8M A;  1R57 A;  4A95 A;  1S7F A;  2Q7B A;  2A4N A;  2OZH A;  3VWE A;  2B5G A;  4MFK A;  2QML A;  1RXT A;  5F49 A;  1XMT A;  4MHD A;  3EFA A;  2ZPA A;  4X5K A;  4Y49 C;  3MGD A;  4I49 A;  4AVC A;  1M4G A;  1YR0 A;  2REF A;  4Q38 A;  3IU2 A;  4UWJ A;  3QB8 A;  3IGR A;  4MFZ A;  4MFQ A;  5HH1 A;  2YND A;  3EXN A;  4QUS A;  1M44 A;  4FD4 A;  2Q04 A;  4DNC A;  4CAV A;  1MJ9 A;  2FE7 A;  2B3V A;  2VZZ A;  5A27 A;  5JPH A;  2B4D A;  4PK2 A;  1S7K A;  3SXN A;  3FNC A;  1KUV A;  5IX3 A;  1YVK A;  4OAD A;  4XPD C;  2VZY A;  4JD6 A;  2FIW A;  4BBH A;  3EO4 A;  2BEI A;  4PV6 A;  2VBQ A;  2FT0 A;  4R3K A;  3TT2 A;  4KS9 A;  4LX9 A;  4C2Z A;  2F5I A;  4NXY A;  4CYP A;  2JLM A;  4NEX A;  4QVT A;  1M1D A;  1LRZ A;  4QBJ A;  2D4O A;  4UWI A;  1SQH A;  4AB7 A;  1QSN A;  3TO6 A;  4HKF A;  3D8P A;  3UY5 A;  5HMN A;  1WK4 A;  4PK3 A;  2JEV A;  1KZF A;  5I0C A;  2R98 A;  1P4N A;  3A9L A;  4IUS A;  4U9Y A;  4RI1 A;  5G20 A;  1S5K A;  2PSW A;  1K4J A;  2OB0 A;  3CXS A;  2KCW A;  3TTH A;  3PZJ A;  4UCN A;  4H6U A;  4F6A A;  4CGN A;  3I3G A;  4KOT A;  4YRH A;  4UBR A;  2ZW7 A;  3SHP A;  4CYQ A;  2BL1 A;  2OH1 A;  4R87 A;  1FY7 A;  1RO5 A;  5EC4 A;  1IIC A;  3R95 A;  2C27 A;  2CNS A;  4KVX A;  1I1D A;  1MJA A;  2AE6 A;  3R96 A;  4CS0 B;  5BWA B;  5FVJ A;  1KUX A;  4KVM E;  2I79 A;  2J8R A;  4CRZ B;  1P0H A;  4LUA A;  2Q4Y A;  2B58 A;  4UCP A;  3DR8 A;  1IB1 E;  4B14 A;  1YK3 A;  3JUW A;  2CY2 A;  4Y49 B;  3JVN A;  1Q2C A;  4QC6 A;  2Z0Z A;  2WSA A;  1Y9K A;  1S60 A;  3FXT A;  5EBV A;  5G21 A;  4CGM A;  3F0A A;  1XEB A;  4AVB A;  2DPS A;  2D4P A;  3SXO A;  4MFJ A;  1L0C A;  4R57 A;  4B13 A;  2PC1 A;  2IL4 A;  4Q36 A;  4KOV A;  4A31 A;  2QEC A;  3DR6 A;  1N71 A;  4KUB A;  3LD2 A;  1B6B A;  2ATR A;  2FCK A;  3TO9 A;  2AJ6 A;  3BJ8 A;  1OZP A;  4XPD B;  2H5M A;  5AG6 A;  4MFL A;  4E8O A;  2VXK A;  3C26 A;  3CXQ A;  4KOS A;  4H89 A;  2OU2 A;  4BMH A;  2FSR A;  1Y7R A;  2ZW5 A;  2Q4V A;  4K30 A;  4OAE A;  1QST A;  4MY3 A;  5AGE A;  1I12 A;  4MBU A;  1BOB A;  4FD5 A;  2J8N A;  1YGH A;  1Y9W A;  5G22 A;  2O28 A;  2VQY A;  4EVY A;  4MJ8 A;  4UA3 A;  4ONU A;  2P6E A;  1VKC A;  1U6M A;  3VWD A;  2Z11 A;  4CGL A;  5IB0 A;  4CRY B;  3TO7 A;  1VHS A;  4II9 A;  3W6S A;  4B5P A;  4H6Z A;  3IWE A;  4CYN A;  2YNC A;  4JLY A;  2ZW4 A;  3KKW A;  3QAH A;  4C68 A;  1YLE A;  4NCZ A;  5F47 A;  1NE9 A;  4KLW A;  4PSX A;  3DDD A;  2Z3K A;  4AG7 A;  5JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...