1R57A

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords conserved hypothetical protein
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 23
structure length 102
sequence length 102
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1r57A00
1VKCA 1WK4A 4U9ZA 2P6EA 5ISVA 2GANA 2VBQA 4KOVA 2FIWA 2ZW4A 2OU2A 1PU9A 2VEZA 4R57A 4JXRA 3TFYA 1VHSA 1YVOA 4KZTA 1KUXA 1TIQA 5I0CA 4NSQA 1XEBA 4H89A 1M1DA 2HUZA 2Y0MA 5DWMA 2PDOA 3TO6A 3BLNA 4UA3A 4K30A 2VXKA 3R9EA 2BUEA 4U5YA 3LODA 1YGHA 4JXQA 2D4OA 3P2HA 2GE3A 4OAEA 1BOBA 3P2FA 1MK4A 2AE6A 2I00A 3WR7A 4HNWB 3V8IA 3GYAA 3E0KA 4OADA 2P0WA 2FL4A 4NCZA 2J8RA 3TO9A 4E2AA 1B87A 3W91A 3R1KA 2IL4A 2R7HA 4PK2A 4KOSA 3W6SA 3BJ7A 2PR1A 1QSTA 2EVNA 3FRMA 3TTHA 2B4DA 1KUYA 3PP9A 2VI7A 1V0CA 1FY7A 3T9YA 2B58A 4HKFA 3IWGA 4XPLA 4MHDA 3CXSA 2KCWA 3TOAA 4F0YA 2REFA 1MJBA 4FD4A 1XIXA 2FSRA 5IB0A 2Z11A 1QSRA 4Y49C 3TE4A 2ATRA 2B3VA 4X5KA 3KKWA 1XF8A 2BEIA 4PK3A 2ARHA 1XE4A 4MJ8A 4PSXA 4E8OA 4HNXB 4H6ZA 1GHEA 4KOWA 2WPWA 4CS0B 2B5GA 2CNMA 2EUIA 4MY0A 1CJWA 1NSLA 2I79A 2FS5A 2K5TA 5F46A 3H4QA 1IB1E 4JLYA 3MGDA 3DR8A 2D4PA 3SXNA 4F6AA 3F5BA 4FD7A 4AVCA 3K9UA 3OWCA 5JQ4A 4ORFA 4AG7A 1BO4A 4II9A 2R1IA 4UBRA 2OZHA 4HNYB 3FNCA 3R95A 3TOBA 3FBUA 2VZZA 3FXTA 3F0AA 4FD6A 4RS2A 1S60A 3FB3A 3NE7A 2H5MA 2ZXVA 5JPHA 3EO4A 3UY5A 4KOTA 1S7FA 2BL1A 1S7NA 2HQYA 4KVOE 4H6UA 4QB9A 2QECA 5FVJA 2Q0YA 4EVYA 4XPKA 1Z4EA 4PSWA 1OZPA 2F5IA 3R9GA 4JWPA 2Q4VA 1MJAA 2HV2A 4YGOA 5KTAA 1P4NA 3D8PA 3I9SA 5J8CA 1CM0A 4YRHA 2FXFA 2PR8A 4CRYB 1YLEA 1RXTA 2NMTA 2JLMA 3QAHA 1I12A 4AVAA 5IV0A 3DSBA 3DR6A 4M85A 3G3SA 4FD5A 3C26A 4QBJA 4XNHC 2B4DB 1QSNA 4JJXA 4CAWA 4KUAA 3T90A 1LRZA 1M4GA 2ZPAA 2VQYA 2JDDA 5EC4A 4NF1A 2B3UA 2PC1A 1P0HA 2GIVA 5GCNA 4Y49B 2Q04A 1UFHA 5F49A 1YR0A 2FCKA 1R57A 1YX0A 4CAXA 4XPDC 1S3ZA 4ONUA 3S6HA 1Y9WA 3CXQA 4R3KA 4JD6A 4U9YA 4QVTA 4B5PA 5J8FA 5CNPA 5F48A 4ZBGA 2B5GB 2PSWA 3F8KA 5C82A 3JVNA 3W6XA 2G3AA 4KVME 5EBVA 3FIXA 1Y7RA 3BJ8A 5E96A 3JUWA 4CRZB 2Z0ZA 1M4IA 2CNTA 3R9FA 3TCVA 5C88A 2RC4A 2R8VA 4E0AA 2CNSA 2P6FA 1QSMA 2P6GA 4KORA 1WWZA 3GKRA 4B5OA 1PUAA 5KTCA 3SXOA 1NE9A 3GY9A 1YREA 3R96A 1MJ9A 4QC6A 2Q44A 2DXQA 2OZUA 3B8GA 2ZW5A 4MI4A 2O28A 2C27A 4J3GA 4M3SA 2QMLA 1Q2YA 3ZJ0A 2FT0A 1J4JA 2PQ8A 2VZYA 4LX9A 4KOUA 1ON0A 2ZW7A 1NMTA 3PZJA 4R9MA 1S7KA 4UWJA 4IF5A 1IYKA 1Y9KA 4L8AA 3LD2A 4QUSA 4MBUA 4KVXA 2Q4YA 1L0CA 3EY5A 4AVBA 1U6MA 1Q2DA 1IIDA 4UWIA 2REEA 2ZW6A 4XNHB 2Q7BA 2J8NA 2JDCA 5KTDA 2OZGA 2OH1A 3S6KA 5H84A 1IYLA 5F47A 3DNSA 4RI1A 2X7BA 1IICA 4KLWA 4KLVA 3EC4A 4IUSA 3N7ZA 1S5KA 3DDDA 3I3GA 5HH1A 2G3TA 1N71A 2A4NA 3VWEA 2FE7A 2OB0A 4XPDB 4OLLA 2WPXA 3RYOA 1KUVA 5IX3A 1Z9UA 3TT2A 2JEVA 3SHPA 3FYNA 1XMTA 4B5PB 5HMNA 5H86A 2PRBA 1K4JA 2BSWA 5DWNA 4YFJA 2B4BA 3D2PA 3TO7A 3S6GA 1I1DA 4MY3A 4BMHA 2AJ6A 1KZFA 4LUAA 1M4DA 4CAVA 1I21A 3ZZIA 1YVKA 1SQHA 4R87A 2J8MA 1Z4RA 4KOYA 3VWDA 2CY2A 4R3LA 4AB7A 4KOXA 3S6FA 4DNCA 3EXNA 2QIRA 1QSOA 3EFAA 1B6BA 3QB8A 1S7LA 3CXPA 3D2MA 4GS4A 2G0BA 2R98A 4NXYA 4I49A 4NEXA 4PV6A 1M44A 3IGRA 4L89A 3PGPA 4AG9A 1YK3A 3D3SA 1Q2CA 2Z10A 3G8WA 4KUBA 1RO5A 2FIAA
chains in the Genus database with same CATH superfamily
1HDUA 1VKCA 4ZY1A 4A94A 8CPAA 1WK4A 1AUGA 1ZG8A 4ZGYB 4U9ZA 4MCSA 2P6EA 5ISVA 2GANA 5F09A 3D7DA 1R43A 2VBQA 5ELYA 5HVHA 4KOVA 2FIWA 2ZW4A 4MHZA 5HXDA 2PJ6A 2OU2A 4UEEA 1ELLP 1PU9A 3IIBA 2VEZA 4M6GA 2PJBA 1A2ZA 4OC1A 4R57A 2Z3PA 4JXRA 4MXUA 3TFYA 1VHSA 1YVOA 2QJ8A 4KZTA 4MFLA 1KUXA 1TIQA 5I0CA 2Z3LA 2YNCA 1XEBA 4NSQA 4C2ZA 2YNCC 2YNDA 1YW4A 4WWVA 2Q7SA 4DYOA 4H89A 1EE3P 1M1DA 2HUZA 3H8FA 2Y0MA 5DWMA 2PDOA 1DTDA 3B2YA 4MFPA 2NSMA 3BLNA 3D66A 3G8WA 3PB6X 2VXKA 1IGBA 4K30A 4UA3A 2BUEA 4U5YA 3R9EA 3S9MA 1Y0YA 3LODA 5EMIA 1YGHA 4RN7A 4JXQA 2D4OA 3D68A 1JWQA 3ISZA 4WJBA 3P2HA 2GE3A 4OAEA 1BOBA 4UIAA 3P2FA 1MK4A 2AE6A 2I00A 3WR7A 1X10A 3BI0A 2ABZA 4HNWB 3CDXA 3V8IA 5IB9A 3GYAA 4KUBA 4AXVA 4OC3A 5K8PA 1TKHA 2C1CA 3E0KA 4OADA 2QYVA 3B3SA 1BAVA 1VHEA 2P0WA 2FL4A 4MHPA 4NCZA 3DGVA 4X3RA 4Q36A 2DPTA 2J8RA 3BHXA 3TO9A 5LRGA 4E2AA 4OC4A 1B87A 3W91A 4IK2A 5LYLA 3R1KA 3RNZA 1TKJA 2EK8A 5JGFA 5A28A 2IL4A 4NJQA 2R7HA 4PK2A 2CTBA 4P4IA 4KOSA 1YW6A 5LYIA 3FEDA 3W6SA 3BJ7A 2PR1A 1QSTA 2EVNA 2ZEEA 3FRMA 4MHNA 2WYRA 3H8GA 4LQ6A 3TTHA 5A27A 2B4DA 1KUYA 3PP9A 4KSIA 4CGMA 2VI7A 4F8ZA 3NH5A 2V8VA 1V0CA 3BI1A 4HPSA 1FY7A 4NGSA 4OKOA 3S9LA 1ZO0A 3T9YA 1QQ9A 2B58A 2ZEFA 4HKFA 4PQAA 2IQ6A 3IWGA 3WC5A 4FWUA 2O4HA 3WT4A 7CPAA 2PJ1A 4XPLA 3RZAA 4MHDA 4F0XA 2ZOFA 3CXSA 4K3NA 2PJ2A 4ZY0A 2KCWA 2PJ4A 3ISXA 3TOAA 4F0YA 2REFA 3FMCA 1MJBA 4FD4A 4CAEA 1OBRA 1XIXA 2FSRA 5G1ZA 2Z11A 5IB0A 1QSRA 1LCPA 2HB6A 3L2NA 4Y49C 3TE4A 3K9TA 3GLJA 2ATRA 2B3VA 2ZEOA 4X5KA 3KKWA 1XF8A 4MRIA 2V8DA 2BEIA 2EO8A 4OC0A 4PK3A 2ARHA 1HEEA 1X12A 1ARMA 1XE4A 1XRYA 4B12A 4P45A 4MJ8A 4RUHA 4PSXA 4X2TA 3SJGA 4MCQA 3TC8A 2POKA 4HNXB 1XFOA 4E8OA 4H6ZA 1ZLIA 4CYQA 1GHEA 3FF3A 2CTCA 4KOWA 3CPAA 2WPWA 4ZX8A 1ZG7A 1TF9A 2C6PA 4CS0B 4A95A 2B5GA 2CNMA 2EUIA 2BOAA 4MCRA 3K2KA 3SJEA 1KWMA 4F9UA 1UWYA 4MY0A 3FJUA 2C6CA 2WUUA 1CJWA 4ZX9A 1NSLA 2I79A 3GB0A 2AFOA 2FS5A 4R6TA 5AG4A 2K5TA 5F46A 3KASA 3LWUA 3H4QA 1IB1E 2WZNA 3MGDA 4JLYA 3DR8A 4EMEA 5D29A 2JEWA 3SXNA 1FT7A 3WC6A 4F6AA 3IU2A 3V38A 3F5BA 4A32A 4FD7A 3QNVA 4AVCA 3B3CA 4A31A 4UEFA 3K9UA 3OWCA 5G22A 1Z8LA 2Q51A 4ZI6A 5JQ4A 2PJ5A 4ORFA 4AG7A 4B14A 1BO4A 4II9A 2R1IA 2PJ7A 2OZHA 4UBRA 4HNYB 3D7GA 2PCUA 2JBJA 3FNCA 3H8EA 3VATA 4NGTA 3R95A 3TOBA 3FBUA 2VZZA 4UCMA 3FXTA 3F0AA 4FD6A 4RS2A 1S60A 3FB3A 3VH9A 1Z2LA 3NE7A 2H5MA 3D7FA 2ZXVA 3PB4X 5JPHA 3EO4A 3IU1A 3UY5A 5CBMA 2V77A 4KOTA 1CP7A 1S7FA 4B11A 2BL1A 2GU2A 2J9AA 1CX8A 2ZEMA 4FBEA 2CXAA 1S7NA 2YNEA 4A33A 1LAPA 4A37A 2HQYA 4KVOE 5LRKA 4ZYQA 4H6UA 4QB9A 2QECA 4CGNA 5FVJA 1BPNA 2Q0YA 2G9DA 4EVYA 4XPKA 1Z4EA 2I3CA 2ANPA 1YSJA 4PSWA 1OZPA 2F5IA 3R9GA 4JWPA 2Q4VA 1MJAA 2HV2A 4YGOA 3NFZA 4BBHA 2AFMA 3FEEA 3MRUA 3MN8A 4UFVA 5KTAA 2PVWA 1P4NA 4PXDA 2PIYA 3D8PA 3PB8X 3SJXA 3JTKA 3I9SA 5J8CA 1CM0A 4YRHA 1CP6A 2PJAA 2FXFA 2PR8A 5D8NA 4CRYB 1YLEA 4UF4A 4P10A 1RXTA 4CGLA 2NMTA 5LRJA 2JLMA 4EWTA 2ZEDA 3QAHA 1I12A 1RTQA 1Y0RA 4MCPA 2ZELA 4AVAA 4BD9A 3DSBA 5IV0A 1Z8TA 3DR6A 4NJRA 3B3WA 3VARA 4M85A 1XJOA 3G3SA 4FD5A 3C26A 4MHYA 4QBJA 4XNHC 2B4DB 1QSNA 2ODFA 2GFQA 3KGQA 4JJXA 4KUAA 4JYWA 4CAWA 3T90A 1LRZA 4C7HA 1M4GA 2V8GA 3IWEA 1PCAA 4R8FA 5AG6A 2V8HA 2ZPAA 4MFQA 3BXMA 3KQZA 3B3TA 2VQYA 2JDDA 2PE3A 5EC4A 4NF1A 4UFWA 4A38A 4IAVA 4GXHA 2B3UA 3QAYA 1DE4C 1VIXA 1AYEA 1YQEA 5CPAA 2PC1A 4MMOA 1CPSA 1P0HA 2GIVA 5GCNA 3PFOA 3KHZA 4Y49B 2Q04A 1UFHA 1LOKA 2DPSA 3FVLA 1YR0A 2FCKA 5F49A 1R57A 1YX0A 4CAXA 3PBEA 4XPDC 1R3NA 1PYTB 1S3ZA 4ONUA 4H2KA 4MFJA 4UIBA 1JQGA 5LYFA 3S6HA 1F57A 1Y9WA 2AFXA 1Y7EA 3CXQA 4R3KA 4G1PA 4NFRA 4NGMA 1CBXA 3KL9A 1Z8WA 4Q7AA 4JD6A 4GM5A 5DS0A 2Q4ZA 4U9YA 4QVTA 3A9LA 4P4FA 4B5PA 5J8FA 5CNPA 4NGQA 5F48A 3D4UA 2PJ3A 2IMOA 2OR4A 4ZBGA 2ZOGA 3NE8A 4UEZA 2B5GB 4O23A 2XEJA 2PSWA 3F8KA 5C82A 2Z3MA 3JVNA 1QMUA 2G3AA 3W6XA 4OC2A 3FH4A 4KVME 4B13A 3IJ3A 3NH4A 3FIXA 5EBVA 4NGPA 1Y7RA 1ZG9A 2O53A 4TNUA 4ZY2A 3BJ8A 2XEIA 4YU9A 3GUXA 1YLOA 5E96A 1LFWA 4MFZA 3JUWA 4CRZB 4CGPA 2PJCA 5HVGA 3SJFA 2Z0ZA 1M4IA 2GLJA 2CNTA 1LAMA 3R9FA 3TCVA 2ZEGA 4UFXA 5C88A 2ZEPA 4A2ZA 2RC4A 2R8VA 4E0AA 3PRTA 3IWWA 2CNSA 4JZ0A 2P6FA 3RBUA 2AFUA 3FECA 5LYDA 2DF5A 1QSMA 1CPXA 2P6GA 4KORA 1WWZA 2WSAA 4OIWA 3GKRA 2ZEHA 4B5OA 5AG7A 1PUAA 5KTCA 3IFEA 3SXOA 3D67A 2ZENA 4FAIA 1NE9A 5HVFA 2YGWA 3CZXA 3GY9A 3IEHA 1YREA 3IC1A 3R96A 4W9YA 1MJ9A 2HC9A 1XBUA 2Z3NA 3KQXA 1M4LA 2Q44A 4QC6A 1IOIA 2DXQA 2OZUA 3B8GA 3PBBA 1Q7LA 4ONWA 2ZW5A 4P4BA 4MI4A 3H5ZA 3SI0A 4A30A 2O28A 4F9VA 3PB9X 3IO1A 2Z3KA 4OP4A 4X8IA 3SI1A 2Q43A 2C27A 4IHMA 3GIUA 4J3GA 2QMLA 2Z3OA 4M3SA 1Q2YA 3ZJ0A 2FT0A 1J4JA 5JH9A 2PQ8A 1XOVA 2GREA 2VZYA 2EWBA 4LX9A 4KOUA 4KS9A 1ON0A 4KSAA 3KHXA 2ZW7A 1NMTA 3PZJA 6CPAA 4R9MA 4C68A 4OMEA 3N5FA 1S7KA 3DLJA 2CF4A 4UWJA 4IF5A 4YWYA 5JM6A 1IYKA 1Y9KA 3LMSA 4L8AA 4R76A 3LD2A 1HDQA 4QUSA 4CYPA 2VL1A 4MBUA 2BCOA 4KVXA 1VHOA 2Q4YA 5G20A 1L0CA 3EY5A 4AVBA 1U6MA 4PXBA 4C2XA 1Q2DA 1IIDA 4FUUA 4UWIA 5THWA 2REEA 2ZW6A 4XNHB 2Q7BA 2J8NA 2JDCA 4NGRA 5KTDA 2OZGA 2OH1A 2XEGA 3S6KA 1ELMP 3KZWA 1IY7A 5H84A 1IYLA 3JRUA 5F47A 3DNSA 3KR4A 2JBKA 4RI1A 4B6ZA 2X7BA 1IICA 3KI9A 4PXCA 1BPMA 2PRQA 4KLWA 3SI2A 1CG2A 4KLVA 3EC4A 3B7IA 2PJ8A 4IUSA 4NGNA 4P4EA 2RFHA 3CT9A 1S5KA 2PJ0A 3N7ZA 4TWEA 4CYNA 3DDDA 3I3GA 2RB7A 2F8HA 5HH1A 3V7ZA 1H8LA 2G3TA 2DEAA 1N71A 2A4NA 2PIZA 4B10A 3PB7X 3VWEA 3B35A 2FE7A 2OB0A 2PJ9A 4XPDB 4OLLA 2WPXA 3NA6A 4Q38A 2EBJA 3NH8A 3RYOA 1KUVA 4P4JA 5IX3A 1TF8A 3FX6A 1Z9UA 2F7VA 3PFEA 3TT2A 4BINA 4CPAA 2JEVA 3SHPA 5I4MA 2GLFA 1YMEA 4R7MA 3FYNA 1XMTA 4B5PB 3TX8A 5HMNA 5H86A 2PRBA 1K4JA 2BSWA 4Z65A 5DWNA 4YFJA 4CYOA 4C2YA 2B4BA 3D2PA 4A39A 4M6IA 1TKFA 3TO7A 2EK9A 3S6GA 1I1DA 1Z8XA 2QVPA 3KR5A 4KSFA 2PVVA 4MY3A 1TXRA 4EFDA 3LACA 1F2PA 4CAFA 4DJLA 4MFKA 3PEIA 4OC5A 1BLLE 4BMHA 2AJ6A 4PXEA 1KZFA 4UCNA 5AG5A 4LUAA 5K8MA 1M4DA 4CAVA 2OOTA 5BWAB 1I21A 3ZZIA 1VGYA 1IOFA 1YVKA 2CIJA 1SQHA 3D7HA 3HLPA 4R87A 1ARLA 4P6YA 2BO9A 2J8MA 2XEFA 2AFWA 1Z4RA 2AFZA 4KOYA 2CY2A 5AGEA 4M6HA 3VWDA 3I1UA 4R3LA 4AB7A 4KOXA 3S9NA 2C6GA 3S6FA 4DNCA 4CGOA 1ZLHA 1XMBA 3EXNA 1FNOA 5G21A 2QIRA 1AMPA 3WC7A 4LQGA 1QSOA 3EFAA 1B6BA 3HUVA 3QB8A 1S7LA 3CXPA 3D2MA 5K8NA 3CPXA 4GS4A 5K8OA 2FVGA 1Z5RA 1LANA 2AFSA 3RAMA 4DUKA 2G0BA 2R98A 4NXYA 2NYQA 4I49A 3T8WA 3TO6A 1F2OA 2IJZA 4NEXA 3RO0A 4C7IA 1GYTA 4PV6A 1M44A 3IGRA 3B3VA 3PGPA 4L89A 4PPZA 1YK3A 4AG9A 1NSAA 3D3SA 1Q2CA 3WABA 5J1QA 4UCPA 4OIDA 2Z10A 4P44A 1IU8A 2D4PA 1RO5A 2FIAA 4P4DA
chains in the Genus database with same CATH topology
1VKCA 1WK4A 4ZGYB 4U9ZA 2P6EA 5ISVA 2GANA 2VBQA 4KOVA 2FIWA 2ZW4A 2OU2A 1PU9A 2VEZA 4R57A 2Z3PA 4JXRA 3TFYA 1VHSA 1YVOA 4KZTA 4MFLA 1KUXA 1TIQA 5I0CA 2Z3LA 2YNCA 1XEBA 4NSQA 4C2ZA 2YNCC 2YNDA 4H89A 1M1DA 2HUZA 2Y0MA 5DWMA 2PDOA 4MFPA 3BLNA 3TO6A 4UA3A 4K30A 2VXKA 3R9EA 2BUEA 4U5YA 3LODA 1YGHA 4JXQA 2D4OA 3P2HA 2GE3A 4OAEA 1BOBA 3P2FA 1MK4A 2AE6A 2I00A 3WR7A 4HNWB 3V8IA 3GYAA 4KUBA 3E0KA 4OADA 2P0WA 2FL4A 4NCZA 4Q36A 2DPTA 2J8RA 3TO9A 4E2AA 1B87A 3W91A 3R1KA 5A28A 2IL4A 2R7HA 4PK2A 4KOSA 3W6SA 3BJ7A 2PR1A 1QSTA 2EVNA 3FRMA 3TTHA 5A27A 2B4DA 1KUYA 3PP9A 4CGMA 2VI7A 1V0CA 1FY7A 1ZO0A 3T9YA 2B58A 4HKFA 3IWGA 4XPLA 4F0XA 4MHDA 3CXSA 2KCWA 3TOAA 4F0YA 2REFA 1MJBA 4FD4A 4CAEA 1XIXA 2FSRA 5G1ZA 2Z11A 5IB0A 1QSRA 4Y49C 3TE4A 2ATRA 2B3VA 4X5KA 3KKWA 1XF8A 2BEIA 4PK3A 2ARHA 1XE4A 4B12A 4MJ8A 4PSXA 4E8OA 4HNXB 4H6ZA 4CYQA 1GHEA 4KOWA 2WPWA 4CS0B 4A95A 2B5GA 2CNMA 2EUIA 4MY0A 2WUUA 1CJWA 1NSLA 2I79A 5AG4A 2FS5A 2K5TA 5F46A 3H4QA 1IB1E 4JLYA 3MGDA 3DR8A 3SXNA 4F6AA 3IU2A 3F5BA 4A32A 4FD7A 4AVCA 4A31A 3K9UA 3OWCA 5G22A 5JQ4A 4ORFA 4AG7A 4B14A 1BO4A 4II9A 2R1IA 4UBRA 2OZHA 4HNYB 3FNCA 3R95A 3TOBA 3FBUA 2VZZA 4UCMA 3FXTA 3F0AA 4FD6A 4RS2A 1S60A 3FB3A 3NE7A 2H5MA 2ZXVA 5JPHA 3EO4A 3IU1A 3UY5A 4KOTA 1S7FA 4B11A 2BL1A 2CXAA 1S7NA 2YNEA 4A33A 2HQYA 4KVOE 4H6UA 4QB9A 2QECA 4CGNA 5FVJA 2Q0YA 4EVYA 4XPKA 1Z4EA 4PSWA 1OZPA 2F5IA 3R9GA 4JWPA 2Q4VA 1MJAA 2HV2A 4YGOA 4BBHA 4UFVA 5KTAA 1P4NA 3D8PA 3JTKA 3I9SA 5J8CA 1CM0A 4YRHA 2FXFA 2PR8A 4CRYB 1YLEA 1RXTA 4CGLA 2NMTA 2JLMA 3QAHA 1I12A 4AVAA 5IV0A 3DSBA 3DR6A 4M85A 3G3SA 4FD5A 3C26A 4QBJA 4XNHC 2B4DB 1QSNA 4JJXA 4CAWA 4KUAA 3T90A 1LRZA 4C7HA 1M4GA 3IWEA 5AG6A 2ZPAA 4MFQA 2VQYA 2JDDA 5EC4A 4NF1A 4UFWA 2B3UA 2PC1A 1P0HA 2GIVA 5GCNA 4Y49B 2Q04A 1UFHA 2DPSA 5F49A 1YR0A 2FCKA 1R57A 1YX0A 4CAXA 4XPDC 1S3ZA 4ONUA 4MFJA 3S6HA 1Y9WA 3CXQA 4R3KA 4JD6A 4U9YA 4QVTA 3A9LA 4B5PA 5J8FA 5CNPA 5F48A 4ZBGA 2B5GB 2PSWA 3F8KA 5C82A 2Z3MA 3JVNA 3W6XA 2G3AA 4B13A 4KVME 5EBVA 3FIXA 1Y7RA 3BJ8A 5E96A 4MFZA 3JUWA 4CRZB 4CGPA 2Z0ZA 1M4IA 2CNTA 3R9FA 3TCVA 4UFXA 5C88A 4A2ZA 2RC4A 2R8VA 4E0AA 2CNSA 2P6FA 1QSMA 2P6GA 4KORA 1WWZA 2WSAA 3GKRA 4B5OA 5AG7A 1PUAA 5KTCA 3SXOA 1NE9A 2YGWA 3GY9A 1YREA 3R96A 1MJ9A 2Z3NA 4QC6A 2Q44A 2DXQA 2OZUA 3B8GA 2ZW5A 4MI4A 3H5ZA 4A30A 2O28A 2Z3KA 2C27A 4J3GA 4M3SA 2QMLA 2Z3OA 1Q2YA 3ZJ0A 2FT0A 1J4JA 2PQ8A 2VZYA 4LX9A 4KOUA 4KS9A 1ON0A 4KSAA 2ZW7A 1NMTA 3PZJA 4R9MA 4C68A 1S7KA 4UWJA 4IF5A 1IYKA 1Y9KA 4L8AA 3LD2A 4QUSA 4CYPA 4MBUA 4KVXA 2Q4YA 5G20A 1L0CA 3EY5A 4AVBA 1U6MA 4C2XA 1Q2DA 1IIDA 4UWIA 2REEA 2ZW6A 4XNHB 2Q7BA 2J8NA 2JDCA 5KTDA 2OZGA 2OH1A 3S6KA 5H84A 1IYLA 5F47A 3DNSA 4RI1A 2X7BA 1IICA 4KLWA 4KLVA 3EC4A 4IUSA 3N7ZA 1S5KA 4CYNA 3DDDA 3I3GA 5HH1A 2G3TA 1N71A 2A4NA 4B10A 3VWEA 2FE7A 2OB0A 4XPDB 4OLLA 2WPXA 4Q38A 3RYOA 1KUVA 5IX3A 1Z9UA 3TT2A 2JEVA 3SHPA 3FYNA 1XMTA 4B5PB 5HMNA 5H86A 2PRBA 1K4JA 2BSWA 5DWNA 4YFJA 4CYOA 4C2YA 2B4BA 3D2PA 3TO7A 3S6GA 1I1DA 4KSFA 4MY3A 4CAFA 4MFKA 4BMHA 2AJ6A 1KZFA 4UCNA 5AG5A 4LUAA 1M4DA 4CAVA 5BWAB 1I21A 3ZZIA 1YVKA 1SQHA 4R87A 2J8MA 1Z4RA 4KOYA 5AGEA 2CY2A 3VWDA 4R3LA 4AB7A 4KOXA 3S6FA 4DNCA 4CGOA 3EXNA 5G21A 2QIRA 1QSOA 3EFAA 1B6BA 3QB8A 1S7LA 3CXPA 3D2MA 4GS4A 2G0BA 2R98A 4NXYA 4I49A 4NEXA 4C7IA 4PV6A 1M44A 3IGRA 4L89A 3PGPA 4AG9A 1YK3A 3D3SA 1Q2CA 4UCPA 2Z10A 3G8WA 2D4PA 1RO5A 2FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKC A;  1WK4 A;  4U9Z A;  2P6E A;  5ISV A;  2GAN A;  2VBQ A;  4KOV A;  2FIW A;  2ZW4 A;  2OU2 A;  1PU9 A;  2VEZ A;  4R57 A;  4JXR A;  3TFY A;  1VHS A;  1YVO A;  4KZT A;  1KUX A;  1TIQ A;  5I0C A;  4NSQ A;  1XEB A;  4H89 A;  1M1D A;  2HUZ A;  2Y0M A;  5DWM A;  2PDO A;  3TO6 A;  3BLN A;  4UA3 A;  4K30 A;  2VXK A;  3R9E A;  2BUE A;  4U5Y A;  3LOD A;  1YGH A;  4JXQ A;  2D4O A;  3P2H A;  2GE3 A;  4OAE A;  1BOB A;  3P2F A;  1MK4 A;  2AE6 A;  2I00 A;  3WR7 A;  4HNW B;  3V8I A;  3GYA A;  3E0K A;  4OAD A;  2P0W A;  2FL4 A;  4NCZ A;  2J8R A;  3TO9 A;  4E2A A;  1B87 A;  3W91 A;  3R1K A;  2IL4 A;  2R7H A;  4PK2 A;  4KOS A;  3W6S A;  3BJ7 A;  2PR1 A;  1QST A;  2EVN A;  3FRM A;  3TTH A;  2B4D A;  1KUY A;  3PP9 A;  2VI7 A;  1V0C A;  1FY7 A;  3T9Y A;  2B58 A;  4HKF A;  3IWG A;  4XPL A;  4MHD A;  3CXS A;  2KCW A;  3TOA A;  4F0Y A;  2REF A;  1MJB A;  4FD4 A;  1XIX A;  2FSR A;  5IB0 A;  2Z11 A;  1QSR A;  4Y49 C;  3TE4 A;  2ATR A;  2B3V A;  4X5K A;  3KKW A;  1XF8 A;  2BEI A;  4PK3 A;  2ARH A;  1XE4 A;  4MJ8 A;  4PSX A;  4E8O A;  4HNX B;  4H6Z A;  1GHE A;  4KOW A;  2WPW A;  4CS0 B;  2B5G A;  2CNM A;  2EUI A;  4MY0 A;  1CJW A;  1NSL A;  2I79 A;  2FS5 A;  2K5T A;  5F46 A;  3H4Q A;  1IB1 E;  4JLY A;  3MGD A;  3DR8 A;  2D4P A;  3SXN A;  4F6A A;  3F5B A;  4FD7 A;  4AVC A;  3K9U A;  3OWC A;  5JQ4 A;  4ORF A;  4AG7 A;  1BO4 A;  4II9 A;  2R1I A;  4UBR A;  2OZH A;  4HNY B;  3FNC A;  3R95 A;  3TOB A;  3FBU A;  2VZZ A;  3FXT A;  3F0A A;  4FD6 A;  4RS2 A;  1S60 A;  3FB3 A;  3NE7 A;  2H5M A;  2ZXV A;  5JPH A;  3EO4 A;  3UY5 A;  4KOT A;  1S7F A;  2BL1 A;  1S7N A;  2HQY A;  4KVO E;  4H6U A;  4QB9 A;  2QEC A;  5FVJ A;  2Q0Y A;  4EVY A;  4XPK A;  1Z4E A;  4PSW A;  1OZP A;  2F5I A;  3R9G A;  4JWP A;  2Q4V A;  1MJA A;  2HV2 A;  4YGO A;  5KTA A;  1P4N A;  3D8P A;  3I9S A;  5J8C A;  1CM0 A;  4YRH A;  2FXF A;  2PR8 A;  4CRY B;  1YLE A;  1RXT A;  2NMT A;  2JLM A;  3QAH A;  1I12 A;  4AVA A;  5IV0 A;  3DSB A;  3DR6 A;  4M85 A;  3G3S A;  4FD5 A;  3C26 A;  4QBJ A;  4XNH C;  2B4D B;  1QSN A;  4JJX A;  4CAW A;  4KUA A;  3T90 A;  1LRZ A;  1M4G A;  2ZPA A;  2VQY A;  2JDD A;  5EC4 A;  4NF1 A;  2B3U A;  2PC1 A;  1P0H A;  2GIV A;  5GCN A;  4Y49 B;  2Q04 A;  1UFH A;  5F49 A;  1YR0 A;  2FCK A;  1R57 A;  1YX0 A;  4CAX A;  4XPD C;  1S3Z A;  4ONU A;  3S6H A;  1Y9W A;  3CXQ A;  4R3K A;  4JD6 A;  4U9Y A;  4QVT A;  4B5P A;  5J8F A;  5CNP A;  5F48 A;  4ZBG A;  2B5G B;  2PSW A;  3F8K A;  5C82 A;  3JVN A;  3W6X A;  2G3A A;  4KVM E;  5EBV A;  3FIX A;  1Y7R A;  3BJ8 A;  5E96 A;  3JUW A;  4CRZ B;  2Z0Z A;  1M4I A;  2CNT A;  3R9F A;  3TCV A;  5C88 A;  2RC4 A;  2R8V A;  4E0A A;  2CNS A;  2P6F A;  1QSM A;  2P6G A;  4KOR A;  1WWZ A;  3GKR A;  4B5O A;  1PUA A;  5KTC A;  3SXO A;  1NE9 A;  3GY9 A;  1YRE A;  3R96 A;  1MJ9 A;  4QC6 A;  2Q44 A;  2DXQ A;  2OZU A;  3B8G A;  2ZW5 A;  4MI4 A;  2O28 A;  2C27 A;  4J3G A;  4M3S A;  2QML A;  1Q2Y A;  3ZJ0 A;  2FT0 A;  1J4J A;  2PQ8 A;  2VZY A;  4LX9 A;  4KOU A;  1ON0 A;  2ZW7 A;  1NMT A;  3PZJ A;  4R9M A;  1S7K A;  4UWJ A;  4IF5 A;  1IYK A;  1Y9K A;  4L8A A;  3LD2 A;  4QUS A;  4MBU A;  4KVX A;  2Q4Y A;  1L0C A;  3EY5 A;  4AVB A;  1U6M A;  1Q2D A;  1IID A;  4UWI A;  2REE A;  2ZW6 A;  4XNH B;  2Q7B A;  2J8N A;  2JDC A;  5KTD A;  2OZG A;  2OH1 A;  3S6K A;  5H84 A;  1IYL A;  5F47 A;  3DNS A;  4RI1 A;  2X7B A;  1IIC A;  4KLW A;  4KLV A;  3EC4 A;  4IUS A;  3N7Z A;  1S5K A;  3DDD A;  3I3G A;  5HH1 A;  2G3T A;  1N71 A;  2A4N A;  3VWE A;  2FE7 A;  2OB0 A;  4XPD B;  4OLL A;  2WPX A;  3RYO A;  1KUV A;  5IX3 A;  1Z9U A;  3TT2 A;  2JEV A;  3SHP A;  3FYN A;  1XMT A;  4B5P B;  5HMN A;  5H86 A;  2PRB A;  1K4J A;  2BSW A;  5DWN A;  4YFJ A;  2B4B A;  3D2P A;  3TO7 A;  3S6G A;  1I1D A;  4MY3 A;  4BMH A;  2AJ6 A;  1KZF A;  4LUA A;  1M4D A;  4CAV A;  1I21 A;  3ZZI A;  1YVK A;  1SQH A;  4R87 A;  2J8M A;  1Z4R A;  4KOY A;  3VWD A;  2CY2 A;  4R3L A;  4AB7 A;  4KOX A;  3S6F A;  4DNC A;  3EXN A;  2QIR A;  1QSO A;  3EFA A;  1B6B A;  3QB8 A;  1S7L A;  3CXP A;  3D2M A;  4GS4 A;  2G0B A;  2R98 A;  4NXY A;  4I49 A;  4NEX A;  4PV6 A;  1M44 A;  3IGR A;  4L89 A;  3PGP A;  4AG9 A;  1YK3 A;  3D3S A;  1Q2C A;  2Z10 A;  3G8W A;  4KUB A;  1RO5 A;  2FIA A; 
#chains in the Genus database with same CATH topology
 1HDU A;  1VKC A;  4ZY1 A;  4A94 A;  8CPA A;  1WK4 A;  1AUG A;  1ZG8 A;  4ZGY B;  4U9Z A;  4MCS A;  2P6E A;  5ISV A;  2GAN A;  5F09 A;  3D7D A;  1R43 A;  2VBQ A;  5ELY A;  5HVH A;  4KOV A;  2FIW A;  2ZW4 A;  4MHZ A;  5HXD A;  2PJ6 A;  2OU2 A;  4UEE A;  1ELL P;  1PU9 A;  3IIB A;  2VEZ A;  4M6G A;  2PJB A;  1A2Z A;  4OC1 A;  4R57 A;  2Z3P A;  4JXR A;  4MXU A;  3TFY A;  1VHS A;  1YVO A;  2QJ8 A;  4KZT A;  4MFL A;  1KUX A;  1TIQ A;  5I0C A;  2Z3L A;  2YNC A;  1XEB A;  4NSQ A;  4C2Z A;  2YNC C;  2YND A;  1YW4 A;  4WWV A;  2Q7S A;  4DYO A;  4H89 A;  1EE3 P;  1M1D A;  2HUZ A;  3H8F A;  2Y0M A;  5DWM A;  2PDO A;  1DTD A;  3B2Y A;  4MFP A;  2NSM A;  3BLN A;  3D66 A;  3G8W A;  3PB6 X;  2VXK A;  1IGB A;  4K30 A;  4UA3 A;  2BUE A;  4U5Y A;  3R9E A;  3S9M A;  1Y0Y A;  3LOD A;  5EMI A;  1YGH A;  4RN7 A;  4JXQ A;  2D4O A;  3D68 A;  1JWQ A;  3ISZ A;  4WJB A;  3P2H A;  2GE3 A;  4OAE A;  1BOB A;  4UIA A;  3P2F A;  1MK4 A;  2AE6 A;  2I00 A;  3WR7 A;  1X10 A;  3BI0 A;  2ABZ A;  4HNW B;  3CDX A;  3V8I A;  5IB9 A;  3GYA A;  4KUB A;  4AXV A;  4OC3 A;  5K8P A;  1TKH A;  2C1C A;  3E0K A;  4OAD A;  2QYV A;  3B3S A;  1BAV A;  1VHE A;  2P0W A;  2FL4 A;  4MHP A;  4NCZ A;  3DGV A;  4X3R A;  4Q36 A;  2DPT A;  2J8R A;  3BHX A;  3TO9 A;  5LRG A;  4E2A A;  4OC4 A;  1B87 A;  3W91 A;  4IK2 A;  5LYL A;  3R1K A;  3RNZ A;  1TKJ A;  2EK8 A;  5JGF A;  5A28 A;  2IL4 A;  4NJQ A;  2R7H A;  4PK2 A;  2CTB A;  4P4I A;  4KOS A;  1YW6 A;  5LYI A;  3FED A;  3W6S A;  3BJ7 A;  2PR1 A;  1QST A;  2EVN A;  2ZEE A;  3FRM A;  4MHN A;  2WYR A;  3H8G A;  4LQ6 A;  3TTH A;  5A27 A;  2B4D A;  1KUY A;  3PP9 A;  4KSI A;  4CGM A;  2VI7 A;  4F8Z A;  3NH5 A;  2V8V A;  1V0C A;  3BI1 A;  4HPS A;  1FY7 A;  4NGS A;  4OKO A;  3S9L A;  1ZO0 A;  3T9Y A;  1QQ9 A;  2B58 A;  2ZEF A;  4HKF A;  4PQA A;  2IQ6 A;  3IWG A;  3WC5 A;  4FWU A;  2O4H A;  3WT4 A;  7CPA A;  2PJ1 A;  4XPL A;  3RZA A;  4MHD A;  4F0X A;  2ZOF A;  3CXS A;  4K3N A;  2PJ2 A;  4ZY0 A;  2KCW A;  2PJ4 A;  3ISX A;  3TOA A;  4F0Y A;  2REF A;  3FMC A;  1MJB A;  4FD4 A;  4CAE A;  1OBR A;  1XIX A;  2FSR A;  5G1Z A;  2Z11 A;  5IB0 A;  1QSR A;  1LCP A;  2HB6 A;  3L2N A;  4Y49 C;  3TE4 A;  3K9T A;  3GLJ A;  2ATR A;  2B3V A;  2ZEO A;  4X5K A;  3KKW A;  1XF8 A;  4MRI A;  2V8D A;  2BEI A;  2EO8 A;  4OC0 A;  4PK3 A;  2ARH A;  1HEE A;  1X12 A;  1ARM A;  1XE4 A;  1XRY A;  4B12 A;  4P45 A;  4MJ8 A;  4RUH A;  4PSX A;  4X2T A;  3SJG A;  4MCQ A;  3TC8 A;  2POK A;  4HNX B;  1XFO A;  4E8O A;  4H6Z A;  1ZLI A;  4CYQ A;  1GHE A;  3FF3 A;  2CTC A;  4KOW A;  3CPA A;  2WPW A;  4ZX8 A;  1ZG7 A;  1TF9 A;  2C6P A;  4CS0 B;  4A95 A;  2B5G A;  2CNM A;  2EUI A;  2BOA A;  4MCR A;  3K2K A;  3SJE A;  1KWM A;  4F9U A;  1UWY A;  4MY0 A;  3FJU A;  2C6C A;  2WUU A;  1CJW A;  4ZX9 A;  1NSL A;  2I79 A;  3GB0 A;  2AFO A;  2FS5 A;  4R6T A;  5AG4 A;  2K5T A;  5F46 A;  3KAS A;  3LWU A;  3H4Q A;  1IB1 E;  2WZN A;  3MGD A;  4JLY A;  3DR8 A;  4EME A;  5D29 A;  2JEW A;  3SXN A;  1FT7 A;  3WC6 A;  4F6A A;  3IU2 A;  3V38 A;  3F5B A;  4A32 A;  4FD7 A;  3QNV A;  4AVC A;  3B3C A;  4A31 A;  4UEF A;  3K9U A;  3OWC A;  5G22 A;  1Z8L A;  2Q51 A;  4ZI6 A;  5JQ4 A;  2PJ5 A;  4ORF A;  4AG7 A;  4B14 A;  1BO4 A;  4II9 A;  2R1I A;  2PJ7 A;  2OZH A;  4UBR A;  4HNY B;  3D7G A;  2PCU A;  2JBJ A;  3FNC A;  3H8E A;  3VAT A;  4NGT A;  3R95 A;  3TOB A;  3FBU A;  2VZZ A;  4UCM A;  3FXT A;  3F0A A;  4FD6 A;  4RS2 A;  1S60 A;  3FB3 A;  3VH9 A;  1Z2L A;  3NE7 A;  2H5M A;  3D7F A;  2ZXV A;  3PB4 X;  5JPH A;  3EO4 A;  3IU1 A;  3UY5 A;  5CBM A;  2V77 A;  4KOT A;  1CP7 A;  1S7F A;  4B11 A;  2BL1 A;  2GU2 A;  2J9A A;  1CX8 A;  2ZEM A;  4FBE A;  2CXA A;  1S7N A;  2YNE A;  4A33 A;  1LAP A;  4A37 A;  2HQY A;  4KVO E;  5LRK A;  4ZYQ A;  4H6U A;  4QB9 A;  2QEC A;  4CGN A;  5FVJ A;  1BPN A;  2Q0Y A;  2G9D A;  4EVY A;  4XPK A;  1Z4E A;  2I3C A;  2ANP A;  1YSJ A;  4PSW A;  1OZP A;  2F5I A;  3R9G A;  4JWP A;  2Q4V A;  1MJA A;  2HV2 A;  4YGO A;  3NFZ A;  4BBH A;  2AFM A;  3FEE A;  3MRU A;  3MN8 A;  4UFV A;  5KTA A;  2PVW A;  1P4N A;  4PXD A;  2PIY A;  3D8P A;  3PB8 X;  3SJX A;  3JTK A;  3I9S A;  5J8C A;  1CM0 A;  4YRH A;  1CP6 A;  2PJA A;  2FXF A;  2PR8 A;  5D8N A;  4CRY B;  1YLE A;  4UF4 A;  4P10 A;  1RXT A;  4CGL A;  2NMT A;  5LRJ A;  2JLM A;  4EWT A;  2ZED A;  3QAH A;  1I12 A;  1RTQ A;  1Y0R A;  4MCP A;  2ZEL A;  4AVA A;  4BD9 A;  3DSB A;  5IV0 A;  1Z8T A;  3DR6 A;  4NJR A;  3B3W A;  3VAR A;  4M85 A;  1XJO A;  3G3S A;  4FD5 A;  3C26 A;  4MHY A;  4QBJ A;  4XNH C;  2B4D B;  1QSN A;  2ODF A;  2GFQ A;  3KGQ A;  4JJX A;  4KUA A;  4JYW A;  4CAW A;  3T90 A;  1LRZ A;  4C7H A;  1M4G A;  2V8G A;  3IWE A;  1PCA A;  4R8F A;  5AG6 A;  2V8H A;  2ZPA A;  4MFQ A;  3BXM A;  3KQZ A;  3B3T A;  2VQY A;  2JDD A;  2PE3 A;  5EC4 A;  4NF1 A;  4UFW A;  4A38 A;  4IAV A;  4GXH A;  2B3U A;  3QAY A;  1DE4 C;  1VIX A;  1AYE A;  1YQE A;  5CPA A;  2PC1 A;  4MMO A;  1CPS A;  1P0H A;  2GIV A;  5GCN A;  3PFO A;  3KHZ A;  4Y49 B;  2Q04 A;  1UFH A;  1LOK A;  2DPS A;  3FVL A;  1YR0 A;  2FCK A;  5F49 A;  1R57 A;  1YX0 A;  4CAX A;  3PBE A;  4XPD C;  1R3N A;  1PYT B;  1S3Z A;  4ONU A;  4H2K A;  4MFJ A;  4UIB A;  1JQG A;  5LYF A;  3S6H A;  1F57 A;  1Y9W A;  2AFX A;  1Y7E A;  3CXQ A;  4R3K A;  4G1P A;  4NFR A;  4NGM A;  1CBX A;  3KL9 A;  1Z8W A;  4Q7A A;  4JD6 A;  4GM5 A;  5DS0 A;  2Q4Z A;  4U9Y A;  4QVT A;  3A9L A;  4P4F A;  4B5P A;  5J8F A;  5CNP A;  4NGQ A;  5F48 A;  3D4U A;  2PJ3 A;  2IMO A;  2OR4 A;  4ZBG A;  2ZOG A;  3NE8 A;  4UEZ A;  2B5G B;  4O23 A;  2XEJ A;  2PSW A;  3F8K A;  5C82 A;  2Z3M A;  3JVN A;  1QMU A;  2G3A A;  3W6X A;  4OC2 A;  3FH4 A;  4KVM E;  4B13 A;  3IJ3 A;  3NH4 A;  3FIX A;  5EBV A;  4NGP A;  1Y7R A;  1ZG9 A;  2O53 A;  4TNU A;  4ZY2 A;  3BJ8 A;  2XEI A;  4YU9 A;  3GUX A;  1YLO A;  5E96 A;  1LFW A;  4MFZ A;  3JUW A;  4CRZ B;  4CGP A;  2PJC A;  5HVG A;  3SJF A;  2Z0Z A;  1M4I A;  2GLJ A;  2CNT A;  1LAM A;  3R9F A;  3TCV A;  2ZEG A;  4UFX A;  5C88 A;  2ZEP A;  4A2Z A;  2RC4 A;  2R8V A;  4E0A A;  3PRT A;  3IWW A;  2CNS A;  4JZ0 A;  2P6F A;  3RBU A;  2AFU A;  3FEC A;  5LYD A;  2DF5 A;  1QSM A;  1CPX A;  2P6G A;  4KOR A;  1WWZ A;  2WSA A;  4OIW A;  3GKR A;  2ZEH A;  4B5O A;  5AG7 A;  1PUA A;  5KTC A;  3IFE A;  3SXO A;  3D67 A;  2ZEN A;  4FAI A;  1NE9 A;  5HVF A;  2YGW A;  3CZX A;  3GY9 A;  3IEH A;  1YRE A;  3IC1 A;  3R96 A;  4W9Y A;  1MJ9 A;  2HC9 A;  1XBU A;  2Z3N A;  3KQX A;  1M4L A;  2Q44 A;  4QC6 A;  1IOI A;  2DXQ A;  2OZU A;  3B8G A;  3PBB A;  1Q7L A;  4ONW A;  2ZW5 A;  4P4B A;  4MI4 A;  3H5Z A;  3SI0 A;  4A30 A;  2O28 A;  4F9V A;  3PB9 X;  3IO1 A;  2Z3K A;  4OP4 A;  4X8I A;  3SI1 A;  2Q43 A;  2C27 A;  4IHM A;  3GIU A;  4J3G A;  2QML A;  2Z3O A;  4M3S A;  1Q2Y A;  3ZJ0 A;  2FT0 A;  1J4J A;  5JH9 A;  2PQ8 A;  1XOV A;  2GRE A;  2VZY A;  2EWB A;  4LX9 A;  4KOU A;  4KS9 A;  1ON0 A;  4KSA A;  3KHX A;  2ZW7 A;  1NMT A;  3PZJ A;  6CPA A;  4R9M A;  4C68 A;  4OME A;  3N5F A;  1S7K A;  3DLJ A;  2CF4 A;  4UWJ A;  4IF5 A;  4YWY A;  5JM6 A;  1IYK A;  1Y9K A;  3LMS A;  4L8A A;  4R76 A;  3LD2 A;  1HDQ A;  4QUS A;  4CYP A;  2VL1 A;  4MBU A;  2BCO A;  4KVX A;  1VHO A;  2Q4Y A;  5G20 A;  1L0C A;  3EY5 A;  4AVB A;  1U6M A;  4PXB A;  4C2X A;  1Q2D A;  1IID A;  4FUU A;  4UWI A;  5THW A;  2REE A;  2ZW6 A;  4XNH B;  2Q7B A;  2J8N A;  2JDC A;  4NGR A;  5KTD A;  2OZG A;  2OH1 A;  2XEG A;  3S6K A;  1ELM P;  3KZW A;  1IY7 A;  5H84 A;  1IYL A;  3JRU A;  5F47 A;  3DNS A;  3KR4 A;  2JBK A;  4RI1 A;  4B6Z A;  2X7B A;  1IIC A;  3KI9 A;  4PXC A;  1BPM A;  2PRQ A;  4KLW A;  3SI2 A;  1CG2 A;  4KLV A;  3EC4 A;  3B7I A;  2PJ8 A;  4IUS A;  4NGN A;  4P4E A;  2RFH A;  3CT9 A;  1S5K A;  2PJ0 A;  3N7Z A;  4TWE A;  4CYN A;  3DDD A;  3I3G A;  2RB7 A;  2F8H A;  5HH1 A;  3V7Z A;  1H8L A;  2G3T A;  2DEA A;  1N71 A;  2A4N A;  2PIZ A;  4B10 A;  3PB7 X;  3VWE A;  3B35 A;  2FE7 A;  2OB0 A;  2PJ9 A;  4XPD B;  4OLL A;  2WPX A;  3NA6 A;  4Q38 A;  2EBJ A;  3NH8 A;  3RYO A;  1KUV A;  4P4J A;  5IX3 A;  1TF8 A;  3FX6 A;  1Z9U A;  2F7V A;  3PFE A;  3TT2 A;  4BIN A;  4CPA A;  2JEV A;  3SHP A;  5I4M A;  2GLF A;  1YME A;  4R7M A;  3FYN A;  1XMT A;  4B5P B;  3TX8 A;  5HMN A;  5H86 A;  2PRB A;  1K4J A;  2BSW A;  4Z65 A;  5DWN A;  4YFJ A;  4CYO A;  4C2Y A;  2B4B A;  3D2P A;  4A39 A;  4M6I A;  1TKF A;  3TO7 A;  2EK9 A;  3S6G A;  1I1D A;  1Z8X A;  2QVP A;  3KR5 A;  4KSF A;  2PVV A;  4MY3 A;  1TXR A;  4EFD A;  3LAC A;  1F2P A;  4CAF A;  4DJL A;  4MFK A;  3PEI A;  4OC5 A;  1BLL E;  4BMH A;  2AJ6 A;  4PXE A;  1KZF A;  4UCN A;  5AG5 A;  4LUA A;  5K8M A;  1M4D A;  4CAV A;  2OOT A;  5BWA B;  1I21 A;  3ZZI A;  1VGY A;  1IOF A;  1YVK A;  2CIJ A;  1SQH A;  3D7H A;  3HLP A;  4R87 A;  1ARL A;  4P6Y A;  2BO9 A;  2J8M A;  2XEF A;  2AFW A;  1Z4R A;  2AFZ A;  4KOY A;  2CY2 A;  5AGE A;  4M6H A;  3VWD A;  3I1U A;  4R3L A;  4AB7 A;  4KOX A;  3S9N A;  2C6G A;  3S6F A;  4DNC A;  4CGO A;  1ZLH A;  1XMB A;  3EXN A;  1FNO A;  5G21 A;  2QIR A;  1AMP A;  3WC7 A;  4LQG A;  1QSO A;  3EFA A;  1B6B A;  3HUV A;  3QB8 A;  1S7L A;  3CXP A;  3D2M A;  5K8N A;  3CPX A;  4GS4 A;  5K8O A;  2FVG A;  1Z5R A;  1LAN A;  2AFS A;  3RAM A;  4DUK A;  2G0B A;  2R98 A;  4NXY A;  2NYQ A;  4I49 A;  3T8W A;  3TO6 A;  1F2O A;  2IJZ A;  4NEX A;  3RO0 A;  4C7I A;  1GYT A;  4PV6 A;  1M44 A;  3IGR A;  3B3V A;  3PGP A;  4L89 A;  4PPZ A;  1YK3 A;  4AG9 A;  1NSA A;  3D3S A;  1Q2C A;  3WAB A;  5J1Q A;  4UCP A;  4OID A;  2Z10 A;  4P44 A;  1IU8 A;  2D4P A;  1RO5 A;  2FIA A;  4P4D A; 
#chains in the Genus database with same CATH homology
 1VKC A;  1WK4 A;  4ZGY B;  4U9Z A;  2P6E A;  5ISV A;  2GAN A;  2VBQ A;  4KOV A;  2FIW A;  2ZW4 A;  2OU2 A;  1PU9 A;  2VEZ A;  4R57 A;  2Z3P A;  4JXR A;  3TFY A;  1VHS A;  1YVO A;  4KZT A;  4MFL A;  1KUX A;  1TIQ A;  5I0C A;  2Z3L A;  2YNC A;  1XEB A;  4NSQ A;  4C2Z A;  2YNC C;  2YND A;  4H89 A;  1M1D A;  2HUZ A;  2Y0M A;  5DWM A;  2PDO A;  4MFP A;  3BLN A;  3TO6 A;  4UA3 A;  4K30 A;  2VXK A;  3R9E A;  2BUE A;  4U5Y A;  3LOD A;  1YGH A;  4JXQ A;  2D4O A;  3P2H A;  2GE3 A;  4OAE A;  1BOB A;  3P2F A;  1MK4 A;  2AE6 A;  2I00 A;  3WR7 A;  4HNW B;  3V8I A;  3GYA A;  4KUB A;  3E0K A;  4OAD A;  2P0W A;  2FL4 A;  4NCZ A;  4Q36 A;  2DPT A;  2J8R A;  3TO9 A;  4E2A A;  1B87 A;  3W91 A;  3R1K A;  5A28 A;  2IL4 A;  2R7H A;  4PK2 A;  4KOS A;  3W6S A;  3BJ7 A;  2PR1 A;  1QST A;  2EVN A;  3FRM A;  3TTH A;  5A27 A;  2B4D A;  1KUY A;  3PP9 A;  4CGM A;  2VI7 A;  1V0C A;  1FY7 A;  1ZO0 A;  3T9Y A;  2B58 A;  4HKF A;  3IWG A;  4XPL A;  4F0X A;  4MHD A;  3CXS A;  2KCW A;  3TOA A;  4F0Y A;  2REF A;  1MJB A;  4FD4 A;  4CAE A;  1XIX A;  2FSR A;  5G1Z A;  2Z11 A;  5IB0 A;  1QSR A;  4Y49 C;  3TE4 A;  2ATR A;  2B3V A;  4X5K A;  3KKW A;  1XF8 A;  2BEI A;  4PK3 A;  2ARH A;  1XE4 A;  4B12 A;  4MJ8 A;  4PSX A;  4E8O A;  4HNX B;  4H6Z A;  4CYQ A;  1GHE A;  4KOW A;  2WPW A;  4CS0 B;  4A95 A;  2B5G A;  2CNM A;  2EUI A;  4MY0 A;  2WUU A;  1CJW A;  1NSL A;  2I79 A;  5AG4 A;  2FS5 A;  2K5T A;  5F46 A;  3H4Q A;  1IB1 E;  4JLY A;  3MGD A;  3DR8 A;  3SXN A;  4F6A A;  3IU2 A;  3F5B A;  4A32 A;  4FD7 A;  4AVC A;  4A31 A;  3K9U A;  3OWC A;  5G22 A;  5JQ4 A;  4ORF A;  4AG7 A;  4B14 A;  1BO4 A;  4II9 A;  2R1I A;  4UBR A;  2OZH A;  4HNY B;  3FNC A;  3R95 A;  3TOB A;  3FBU A;  2VZZ A;  4UCM A;  3FXT A;  3F0A A;  4FD6 A;  4RS2 A;  1S60 A;  3FB3 A;  3NE7 A;  2H5M A;  2ZXV A;  5JPH A;  3EO4 A;  3IU1 A;  3UY5 A;  4KOT A;  1S7F A;  4B11 A;  2BL1 A;  2CXA A;  1S7N A;  2YNE A;  4A33 A;  2HQY A;  4KVO E;  4H6U A;  4QB9 A;  2QEC A;  4CGN A;  5FVJ A;  2Q0Y A;  4EVY A;  4XPK A;  1Z4E A;  4PSW A;  1OZP A;  2F5I A;  3R9G A;  4JWP A;  2Q4V A;  1MJA A;  2HV2 A;  4YGO A;  4BBH A;  4UFV A;  5KTA A;  1P4N A;  3D8P A;  3JTK A;  3I9S A;  5J8C A;  1CM0 A;  4YRH A;  2FXF A;  2PR8 A;  4CRY B;  1YLE A;  1RXT A;  4CGL A;  2NMT A;  2JLM A;  3QAH A;  1I12 A;  4AVA A;  5IV0 A;  3DSB A;  3DR6 A;  4M85 A;  3G3S A;  4FD5 A;  3C26 A;  4QBJ A;  4XNH C;  2B4D B;  1QSN A;  4JJX A;  4CAW A;  4KUA A;  3T90 A;  1LRZ A;  4C7H A;  1M4G A;  3IWE A;  5AG6 A;  2ZPA A;  4MFQ A;  2VQY A;  2JDD A;  5EC4 A;  4NF1 A;  4UFW A;  2B3U A;  2PC1 A;  1P0H A;  2GIV A;  5GCN A;  4Y49 B;  2Q04 A;  1UFH A;  2DPS A;  5F49 A;  1YR0 A;  2FCK A;  1R57 A;  1YX0 A;  4CAX A;  4XPD C;  1S3Z A;  4ONU A;  4MFJ A;  3S6H A;  1Y9W A;  3CXQ A;  4R3K A;  4JD6 A;  4U9Y A;  4QVT A;  3A9L A;  4B5P A;  5J8F A;  5CNP A;  5F48 A;  4ZBG A;  2B5G B;  2PSW A;  3F8K A;  5C82 A;  2Z3M A;  3JVN A;  3W6X A;  2G3A A;  4B13 A;  4KVM E;  5EBV A;  3FIX A;  1Y7R A;  3BJ8 A;  5E96 A;  4MFZ A;  3JUW A;  4CRZ B;  4CGP A;  2Z0Z A;  1M4I A;  2CNT A;  3R9F A;  3TCV A;  4UFX A;  5C88 A;  4A2Z A;  2RC4 A;  2R8V A;  4E0A A;  2CNS A;  2P6F A;  1QSM A;  2P6G A;  4KOR A;  1WWZ A;  2WSA A;  3GKR A;  4B5O A;  5AG7 A;  1PUA A;  5KTC A;  3SXO A;  1NE9 A;  2YGW A;  3GY9 A;  1YRE A;  3R96 A;  1MJ9 A;  2Z3N A;  4QC6 A;  2Q44 A;  2DXQ A;  2OZU A;  3B8G A;  2ZW5 A;  4MI4 A;  3H5Z A;  4A30 A;  2O28 A;  2Z3K A;  2C27 A;  4J3G A;  4M3S A;  2QML A;  2Z3O A;  1Q2Y A;  3ZJ0 A;  2FT0 A;  1J4J A;  2PQ8 A;  2VZY A;  4LX9 A;  4KOU A;  4KS9 A;  1ON0 A;  4KSA A;  2ZW7 A;  1NMT A;  3PZJ A;  4R9M A;  4C68 A;  1S7K A;  4UWJ A;  4IF5 A;  1IYK A;  1Y9K A;  4L8A A;  3LD2 A;  4QUS A;  4CYP A;  4MBU A;  4KVX A;  2Q4Y A;  5G20 A;  1L0C A;  3EY5 A;  4AVB A;  1U6M A;  4C2X A;  1Q2D A;  1IID A;  4UWI A;  2REE A;  2ZW6 A;  4XNH B;  2Q7B A;  2J8N A;  2JDC A;  5KTD A;  2OZG A;  2OH1 A;  3S6K A;  5H84 A;  1IYL A;  5F47 A;  3DNS A;  4RI1 A;  2X7B A;  1IIC A;  4KLW A;  4KLV A;  3EC4 A;  4IUS A;  3N7Z A;  1S5K A;  4CYN A;  3DDD A;  3I3G A;  5HH1 A;  2G3T A;  1N71 A;  2A4N A;  4B10 A;  3VWE A;  2FE7 A;  2OB0 A;  4XPD B;  4OLL A;  2WPX A;  4Q38 A;  3RYO A;  1KUV A;  5IX3 A;  1Z9U A;  3TT2 A;  2JEV A;  3SHP A;  3FYN A;  1XMT A;  4B5P B;  5HMN A;  5H86 A;  2PRB A;  1K4J A;  2BSW A;  5DWN A;  4YFJ A;  4CYO A;  4C2Y A;  2B4B A;  3D2P A;  3TO7 A;  3S6G A;  1I1D A;  4KSF A;  4MY3 A;  4CAF A;  4MFK A;  4BMH A;  2AJ6 A;  1KZF A;  4UCN A;  5AG5 A;  4LUA A;  1M4D A;  4CAV A;  5BWA B;  1I21 A;  3ZZI A;  1YVK A;  1SQH A;  4R87 A;  2J8M A;  1Z4R A;  4KOY A;  5AGE A;  2CY2 A;  3VWD A;  4R3L A;  4AB7 A;  4KOX A;  3S6F A;  4DNC A;  4CGO A;  3EXN A;  5G21 A;  2QIR A;  1QSO A;  3EFA A;  1B6B A;  3QB8 A;  1S7L A;  3CXP A;  3D2M A;  4GS4 A;  2G0B A;  2R98 A;  4NXY A;  4I49 A;  4NEX A;  4C7I A;  4PV6 A;  1M44 A;  3IGR A;  4L89 A;  3PGP A;  4AG9 A;  1YK3 A;  3D3S A;  1Q2C A;  4UCP A;  2Z10 A;  3G8W A;  2D4P A;  1RO5 A;  2FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...