1R57A

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 23
structure length 102
sequence length 102
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1r57A00
3EY5A 1YR0A 4MHDA 2B4DB 3T9YA 1S7KA 1V0CA 4XPDB 3ZJ0A 2QECA 2J8MA 3EFAA 2WPWA 1LRZA 4XNHB 1MK4A 3TOBA 4FD5A 2CY2A 4B5OA 3P2HA 3FBUA 3GY9A 4M85A 1QSRA 3R96A 2P6GA 3SHPA 2REFA 1QSTA 1TIQA 3TO7A 2R8VA 4CAXA 2QIRA 2Z0ZA 4JXQA 5DWMA 4L89A 3G3SA 4HNXB 4JJXA 3FRMA 4E8OA 2Q0YA 4PK3A 2FCKA 2FIAA 2AE6A 2RC4A 1R57A 3MGDA 4MI4A 1RXTA 2PRBA 1RO5A 2JDDA 2X7BA 2Z10A 3F5BA 3TFYA 2NMTA 2PC1A 1S3ZA 3QB8A 3H4QA 2CNTA 3W6SA 2PDOA 1IICA 1M1DA 4K30A 4NCZA 2R98A 4F6AA 3I3GA 3SXOA 3G8WA 3D2MA 4UWIA 4FD6A 2GE3A 3DR8A 5J8FA 4OLLA 4ORFA 4MY3A 1Y9WA 5C82A 5HMNA 2F5IA 1YREA 2VI7A 1P0HA 4KOYA 4NF1A 4R3LA 1Z9UA 1S60A 3E0KA 4MBUA 2OU2A 3GKRA 5JQ4A 2Q4YA 4JD6A 2I00A 4E0AA 2R1IA 3LD2A 2WPXA 5GCNA 2ZPAA 1FY7A 2O28A 4QVTA 3W6XA 2BSWA 2Q7BA 4XPLA 3FIXA 1IB1E 4KVOE 1XE4A 2ZW6A 4KOVA 4H6ZA 1L0CA 3R9GA 2P0WA 1GHEA 1KUVA 3DSBA 3P2FA 1YLEA 1Y7RA 4EVYA 4HNYB 4CRYB 2EVNA 3TT2A 2Z11A 3S6HA 1Q2YA 2VZYA 1IYLA 3I9SA 2Q4VA 4KLWA 3W91A 4B5PB 4CRZB 4UA3A 1OZPA 2REEA 2VXKA 4ONUA 5IB0A 2G3TA 2D4PA 2AJ6A 1I1DA 5JPHA 1Y9KA 2GIVA 1XF8A 4Y49C 4BMHA 3C26A 5ISVA 3WR7A 4AVAA 5F48A 4U9ZA 3BJ8A 1QSOA 1Q2CA 2PSWA 2PR1A 4KOUA 3FXTA 2FS5A 3EC4A 3FB3A 1PU9A 1MJBA 4KORA 2HUZA 3QAHA 2D4OA 5KTCA 1YX0A 4AG7A 1XEBA 1KZFA 1XIXA 4DNCA 3N7ZA 2G3AA 2BL1A 4AG9A 3TOAA 4MY0A 2VBQA 1M44A 2B3UA 2FT0A 2VEZA 1UFHA 2GANA 3CXPA 1QSMA 4MJ8A 2B5GA 4H89A 1KUXA 1S5KA 3R1KA 5H86A 4JXRA 1YK3A 4QBJA 3DDDA 4NEXA 3GYAA 4U5YA 1CM0A 4XPDC 2R7HA 2J8NA 5FVJA 4KOTA 1CJWA 4QC6A 1Z4RA 5KTAA 1KUYA 1B6BA 2HQYA 1SQHA 2FL4A 4XNHC 3F8KA 3DNSA 2CNSA 1M4GA 4UBRA 3D8PA 2PQ8A 3S6GA 4YGOA 4QB9A 3ZZIA 4M3SA 4PV6A 4AB7A 5J8CA 2B5GB 1B87A 2BUEA 2ZW4A 3S6KA 4IF5A 2B58A 2B4DA 3UY5A 3NE7A 2FXFA 2BEIA 1WWZA 3EO4A 1XMTA 3TE4A 4R9MA 4LUAA 4NSQA 3FNCA 2J8RA 5DWNA 5CNPA 1I12A 5EBVA 1Q2DA 2ZW5A 2G0BA 2KCWA 1IIDA 5H84A 2VQYA 5IV0A 4II9A 3VWDA 4HNWB 3JUWA 1IYKA 1P4NA 2HV2A 4HKFA 4AVCA 1NSLA 3PGPA 2A4NA 4KVXA 4GS4A 2PR8A 4H6UA 4JLYA 3K9UA 1J4JA 1BO4A 5F46A 4ZBGA 2ZXVA 3V8IA 4IUSA 4X5KA 2FSRA 1S7NA 3SXNA 2B3VA 4PK2A 2OZUA 4FD7A 4FD4A 3F0AA 2P6EA 1BOBA 4R57A 5KTDA 1VHSA 1NMTA 4RI1A 4OADA 1NE9A 4KLVA 3TTHA 1N71A 1YGHA 2QMLA 3CXQA 5HH1A 3TCVA 2Q44A 3RYOA 3LODA 2C27A 4UWJA 3R9EA 1Z4EA 1ON0A 4JWPA 2OH1A 4CAVA 2K5TA 3FYNA 1WK4A 1YVOA 3JVNA 2VZZA 1VKCA 2JLMA 5F47A 4F0YA 3DR6A 4R87A 4U9YA 2Y0MA 4CS0B 4KOSA 1S7FA 4KZTA 1YVKA 2CNMA 4PSWA 1MJAA 3D2PA 1QSNA 4QUSA 4YRHA 3VWEA 3PP9A 4OAEA 4RS2A 3BLNA 2OZGA 4E2AA 3CXSA 2OZHA 2EUIA 4KOWA 4AVBA 5I0CA 2FE7A 3D3SA 3OWCA 2I79A 2ARHA 4R3KA 4Y49B 4J3GA 4L8AA 4XPKA 5EC4A 4B5PA 2DXQA 5E96A 4YFJA 2JEVA 2H5MA 3S6FA 3B8GA 4PSXA 3TO9A 2B4BA 4KVME 1S7LA 1K4JA 5C88A 5IX3A 3T90A 1M4IA 4CAWA 1I21A 4KOXA 2FIWA 4NXYA 2OB0A 4KUAA 2JDCA 5F49A 3IGRA 3R9FA 3PZJA 2P6FA 2IL4A 1M4DA 2ATRA 3R95A 3EXNA 2ZW7A 3TO6A 3BJ7A 1MJ9A 3IWGA 4I49A 1U6MA 4LX9A 3KKWA 2Q04A 4KUBA 1PUAA
chains in the Genus database with same CATH superfamily
3SJEA 1GYTA 2I3CA 3VH9A 2V8VA 3EY5A 1ZG8A 4ONWA 3SJGA 1YR0A 2ZENA 4MHDA 2B4DB 1IGBA 5D8NA 2J9AA 3T9YA 5A27A 1S7KA 1V0CA 4XPDB 2XEGA 3ZJ0A 4OMEA 2QECA 2J8MA 4P4JA 3EFAA 3IIBA 4YWYA 3FX6A 2WPWA 4C7HA 5G1ZA 1FT7A 1LRZA 4CGOA 4XNHB 1MK4A 1DE4C 2V8DA 3BXMA 3GUXA 4MCRA 3TOBA 4FD5A 4KSAA 2CY2A 3SJXA 2PE3A 2QJ8A 2Z3LA 4B5OA 3CPXA 5AGEA 2EBJA 3P2HA 3FBUA 2AFOA 4OC1A 2Z3PA 3GY9A 1YSJA 4M85A 2F8HA 1QSRA 3QAYA 4WWVA 3R96A 5CBMA 1CP6A 3NFZA 2P6GA 3SHPA 2REFA 4MHPA 1QSTA 1TIQA 1ELMP 3TO7A 4PQAA 2R8VA 4FWUA 4OIDA 4LQ6A 4CAXA 2QIRA 4PXCA 2Z0ZA 4JXQA 5DWMA 2GREA 3DLJA 4L89A 4UF4A 1VIXA 3FJUA 4OC5A 1XBUA 3G3SA 3IFEA 3LACA 4HNXB 3D7GA 4JJXA 4OP4A 3FRMA 4E8OA 4PPZA 4GM5A 2Q0YA 4PK3A 1JWQA 3S9NA 2FCKA 3FH4A 2FIAA 2AE6A 2RC4A 3BI1A 4NJQA 2HB6A 1R57A 1LAPA 3MGDA 4MI4A 4P4EA 1RXTA 2PRBA 1RO5A 4P4FA 1ARLA 2JDDA 2X7BA 2Z10A 3F5BA 3WC7A 3B7IA 1A2ZA 3TFYA 2NMTA 2PC1A 1IY7A 1S3ZA 3QB8A 3H4QA 3TX8A 2CNTA 4CGNA 5HVGA 3W6SA 2PDOA 2PIYA 1CP7A 2Z3KA 1IICA 1M1DA 2IJZA 4K30A 5HVHA 2AFSA 4NCZA 1IOFA 2R98A 4F6AA 1ZG7A 3I3GA 2ZEEA 2V8GA 3SXOA 4Z65A 3G8WA 3D2MA 4UWIA 3KASA 4FD6A 2GE3A 4WJBA 3DR8A 1Z2LA 5J8FA 3PFOA 4OLLA 4ORFA 4MY3A 3N5FA 2PJ6A 3CPAA 1R43A 4DYOA 2RFHA 3H8EA 3PEIA 4F8ZA 1Y9WA 3MN8A 3CT9A 1X10A 1CPSA 3B3VA 5C82A 2F7VA 2EO8A 1HDQA 2F5IA 4NGPA 5HMNA 1YREA 1BAVA 2VI7A 4OKOA 1P0HA 3KR5A 4KOYA 4NF1A 4C68A 4A2ZA 4R3LA 4RUHA 1Z9UA 1S60A 3E0KA 4C2XA 4G1PA 4MBUA 1CG2A 2EWBA 2OU2A 4KUBA 4NGQA 3GKRA 3IEHA 4UCNA 5JQ4A 2Q4YA 4JD6A 4K3NA 2I00A 4E0AA 3NH8A 2R1IA 2O53A 3LD2A 4C7IA 2WPXA 5GCNA 4B11A 1Z8TA 5AG5A 2ZPAA 3FEDA 2BO9A 1LAMA 1FY7A 2DEAA 2O28A 3B3TA 2BSWA 3NH4A 3PFEA 4QVTA 2Q7BA 1YW4A 4XPLA 1F57A 3FIXA 1IB1E 4KVOE 5LYDA 1XE4A 4MHYA 4MCPA 4ZX9A 2ZW6A 4KOVA 4MCSA 3RO0A 1YW6A 1Z8LA 2ZEHA 4H6ZA 4OIWA 4R7MA 5D29A 1L0CA 2ZEMA 2ODFA 3BI0A 4MFKA 3R9GA 2XEJA 2P0WA 1GHEA 1KUVA 3GB0A 5THWA 3DSBA 2POKA 2Q4ZA 2BOAA 3P2FA 1YLEA 1Y7RA 4PXBA 4EVYA 4HNYB 4CRYB 2PJ9A 2EVNA 4NFRA 3TT2A 3D7DA 4A95A 2Z11A 1XMBA 3KL9A 3S6HA 1Q2YA 2VZYA 1Z8XA 1IYLA 4MHZA 3I9SA 4FBEA 3D68A 4NJRA 2Q4VA 4KLWA 3WC6A 1AYEA 3W91A 4B5PB 3D67A 3SI1A 4O23A 4CRZB 3PBEA 3LMSA 3CZXA 5G20A 4UA3A 3T8WA 1BLLE 1OZPA 1TKFA 2REEA 5K8MA 2VXKA 4ONUA 5IB0A 4BINA 2Z3MA 4IAVA 2G3TA 2D4PA 2AJ6A 2WZNA 4NGTA 1I1DA 1LCPA 4UEZA 4GXHA 5JPHA 1IOIA 4ZY1A 1Y9KA 2GIVA 1XF8A 3V7ZA 3VATA 4F9VA 4Y49C 2PJ4A 3IU1A 4ZYQA 4BMHA 3C26A 4P10A 3WR7A 4AVAA 5F48A 5ISVA 3S9MA 4PXDA 3BJ8A 4U9ZA 1QSOA 4HPSA 1Q2CA 2PSWA 5A28A 2PR1A 3WABA 4KOUA 4F9UA 2C6PA 2AFWA 2FS5A 2AFUA 3EC4A 3FXTA 3FB3A 4MFJA 4RN7A 4ZI6A 5JM6A 1PU9A 2NSMA 1MJBA 3FECA 4KORA 2HUZA 1TKHA 3QAHA 2D4OA 5KTCA 1YX0A 1Q7LA 1XEBA 2ZEDA 4AG7A 1KZFA 1OBRA 2G9DA 1XIXA 4A37A 4C2ZA 4DNCA 2RB7A 3N7ZA 4A31A 2G3AA 2BL1A 4JYWA 4A94A 4AG9A 4KS9A 3TOAA 4H2KA 4MY0A 4X2TA 2VBQA 2ANPA 1M44A 4Q38A 4Q36A 4P4IA 2CTCA 2Q7SA 5LRJA 2B3UA 2FT0A 4MHNA 1VHEA 2VEZA 3IWWA 2OOTA 1UFHA 4KSFA 4M6GA 1YLOA 2GANA 2V77A 3CXPA 1QSMA 2CXAA 4MJ8A 4CGPA 2B5GA 4H89A 1ELLP 4OC3A 4TNUA 5LYIA 1PYTB 1KUXA 3PB8X 2PVVA 1VHOA 4MFZA 1S5KA 2Z3NA 3R1KA 3NH5A 4KSIA 4C2YA 3B3WA 3D66A 5G21A 1XFOA 4B13A 2PJ3A 1Y0RA 4CAFA 5H86A 4JXRA 1YK3A 2JBKA 4QBJA 3H8GA 3DDDA 4PXEA 4NEXA 4CYOA 5LYFA 4UCMA 1M4LA 3GYAA 4U5YA 1CM0A 4XPDC 2R7HA 2J8NA 2IQ6A 5FVJA 1CPXA 2ZELA 4KOTA 1CJWA 4DJLA 4QC6A 4ZGYB 1Z4RA 3B2YA 3D7HA 1KUYA 1B6BA 2HQYA 3ISXA 5KTAA 5ELYA 1SQHA 2FL4A 1XJOA 4XNHC 3FVLA 5LRKA 1LFWA 3F8KA 3DNSA 5G22A 2CNSA 1M4GA 4UEEA 4BD9A 1BPNA 1DTDA 1HDUA 4UBRA 5AG6A 3D8PA 2AFMA 2AFZA 2PQ8A 3IO1A 3S6GA 4A30A 3K9TA 4YGOA 4JZ0A 4QB9A 3ZZIA 5K8PA 3H5ZA 4M3SA 4PV6A 4AB7A 5J8CA 2B5GB 1B87A 2BUEA 2CIJA 2PVWA 2ZW4A 1ZO0A 2GLFA 4IF5A 2B58A 2NYQA 4MXUA 2B4DA 3S6KA 3UY5A 3NE7A 4MCQA 2FXFA 2BEIA 1WWZA 2VL1A 2YGWA 3PB4X 3EO4A 1XMTA 3IJ3A 4OC4A 4YU9A 5F09A 3TE4A 2JBJA 5HVFA 3MRUA 4R9MA 4LUAA 3RBUA 3KR4A 4NSQA 5I4MA 3KZWA 2YNCC 3FNCA 4F0XA 4B10A 2J8RA 3SJFA 2EK9A 2ABZA 5DWNA 1H8LA 3QNVA 5CNPA 1I12A 3RZAA 5EBVA 4Q7AA 1IU8A 1Q2DA 2YNEA 2PJ5A 2ZW5A 4CAEA 2G0BA 2KCWA 1IIDA 2PJ1A 3GIUA 3H8FA 4NGMA 5H84A 1Z8WA 2DF5A 3GLJA 3JRUA 3B35A 2VQYA 4B6ZA 4DUKA 5IV0A 4II9A 3VWDA 3TC8A 4A33A 4FAIA 3HUVA 1CX8A 4FUUA 3JUWA 2Q43A 4HNWB 5EMIA 1IYKA 1P4NA 4EMEA 2HV2A 4HKFA 2ZOFA 1NSLA 4AVCA 6CPAA 3PGPA 3I1UA 3JTKA 2A4NA 2DPSA 4GS4A 4KVXA 2EK8A 1BPMA 3KHZA 2PR8A 5K8OA 4H6UA 4JLYA 2PRQA 1YMEA 3K9UA 1J4JA 2XEFA 3SI0A 1NSAA 1BO4A 4EFDA 5F46A 3K2KA 2YNCA 2HC9A 3PBBA 4R76A 4ZBGA 2ZXVA 3V8IA 4M6HA 2PCUA 1UWYA 3FMCA 4IUSA 2IMOA 3HLPA 3KQXA 1QMUA 4X5KA 2FSRA 2WSAA 1S7NA 1CBXA 3SXNA 3PB9X 2B3VA 4MMOA 4PK2A 4CYQA 2FVGA 5LYLA 2OZUA 2PJ0A 2DPTA 2ZEFA 4FD7A 4FD4A 4UFVA 3F0AA 2P6EA 1XOVA 3PRTA 1BOBA 4R57A 4NGSA 1ZLHA 2C6GA 2PJ8A 3ISZA 5KTDA 1VHSA 4CYPA 1NMTA 4M6IA 1PCAA 2Z3OA 4UIBA 4RI1A 2WYRA 5AG7A 3W6XA 3V38A 1TF9A 4B14A 1HEEA 2C1CA 4OADA 1NE9A 4KLVA 3TTHA 7CPAA 1N71A 1YGHA 3IU2A 5K8NA 2PJAA 2CTBA 2AFXA 4IHMA 2PIZA 3PB6X 5BWAB 2C6CA 2QMLA 3CXQA 5HH1A 3TCVA 4R6TA 2Q44A 3BHXA 3RYOA 3SI2A 4A39A 3LODA 1TF8A 5AG4A 2C27A 2GU2A 4UWJA 1XRYA 3R9EA 1Z4EA 1ON0A 1ZLIA 1F2PA 4CPAA 3FF3A 4ZY2A 4JWPA 4MFLA 1Y7EA 2OH1A 4CAVA 2K5TA 3S9LA 1TKJA 3FYNA 1WK4A 5DS0A 1YVOA 2GLJA 3DGVA 4EWTA 3JVNA 2VZZA 4OC2A 1VKCA 3CDXA 2OR4A 2JLMA 2ZOGA 5F47A 4ZX8A 4BBHA 1LANA 3RNZA 4A38A 4F0YA 1F2OA 3DR6A 1Y0YA 4R87A 4U9YA 2Y0MA 4B12A 5IB9A 1QQ9A 4CS0B 4UCPA 5CPAA 4KOSA 4P6YA 5JH9A 1S7FA 4KZTA 1YVKA 4UEFA 2QVPA 2V8HA 2CNMA 4PSWA 1MJAA 3D2PA 1EE3P 1QSNA 2ZEGA 1Z5RA 4QUSA 4W9YA 4YRHA 3VWEA 4UFXA 4LQGA 4CYNA 3PP9A 4OAEA 4RS2A 3BLNA 2YNDA 3VARA 2OZGA 4E2AA 3CXSA 2OZHA 3L2NA 2EUIA 4KOWA 5JGFA 4AVBA 5I0CA 4R8FA 2FE7A 3D3SA 1KWMA 3OWCA 4IK2A 1FNOA 2ARHA 2I79A 4R3KA 3LWUA 4Y49B 4ZY0A 1AMPA 4J3GA 3KI9A 4P44A 2Q51A 1YQEA 4L8AA 1AUGA 2WUUA 4AXVA 4XPKA 1ARMA 3WC5A 4X8IA 3NA6A 5EC4A 2ZEOA 1VGYA 4UIAA 3PB7X 4B5PA 2PJ2A 2ZEPA 3D7FA 2DXQA 8CPAA 4UFWA 5E96A 4YFJA 4CGLA 3B3SA 1X12A 2JEVA 3D4UA 2H5MA 3IC1A 3B3CA 3B8GA 4MRIA 4PSXA 2PJ7A 3S6FA 3TO9A 2B4BA 2QYVA 4P4BA 2O4HA 4KVME 1S7LA 1K4JA 5C88A 5IX3A 3T90A 4P4DA 1M4IA 3KQZA 4CAWA 1I21A 4KOXA 1LOKA 3NE8A 2FIWA 1RTQA 4NXYA 2OB0A 2GFQA 4KUAA 5HXDA 2JDCA 2JEWA 5F49A 2BCOA 3A9LA 1JQGA 3IWEA 4NGNA 3IGRA 3WT4A 4TWEA 3R9FA 4X3RA 3PZJA 4OC0A 2PJCA 2P6FA 2IL4A 4MFPA 1M4DA 2ATRA 1ZG9A 4MFQA 3R95A 3EXNA 4NGRA 4A32A 5LRGA 3FEEA 4CGMA 2PJBA 1TXRA 4P45A 2ZW7A 3RAMA 3TO6A 3KHXA 3BJ7A 5J1QA 1R3NA 2CF4A 3IWGA 1U6MA 4I49A 4LX9A 3KKWA 2Q04A 3KGQA 2XEIA 1MJ9A 1PUAA
chains in the Genus database with same CATH topology
3EY5A 1YR0A 4MHDA 2B4DB 3T9YA 5A27A 1S7KA 1V0CA 4XPDB 3ZJ0A 2QECA 2J8MA 3EFAA 2WPWA 4C7HA 5G1ZA 1LRZA 4CGOA 4XNHB 1MK4A 3TOBA 4FD5A 4KSAA 2CY2A 4B5OA 2Z3LA 5AGEA 3P2HA 3FBUA 2Z3PA 3GY9A 4M85A 1QSRA 3R96A 2P6GA 3SHPA 2REFA 1QSTA 1TIQA 3TO7A 2R8VA 4CAXA 2QIRA 2Z0ZA 4JXQA 5DWMA 4L89A 3G3SA 4HNXB 4JJXA 3FRMA 4E8OA 2Q0YA 4PK3A 2FCKA 2FIAA 2AE6A 2RC4A 1R57A 3MGDA 4MI4A 1RXTA 2PRBA 1RO5A 2JDDA 2X7BA 2Z10A 3F5BA 3TFYA 2NMTA 2PC1A 1S3ZA 3QB8A 3H4QA 2CNTA 4CGNA 3W6SA 2PDOA 2Z3KA 1IICA 1M1DA 4K30A 4NCZA 2R98A 4F6AA 3I3GA 3SXOA 3G8WA 3D2MA 4UWIA 4FD6A 2GE3A 3DR8A 5J8FA 4OLLA 4ORFA 4MY3A 1Y9WA 5C82A 5HMNA 2F5IA 1YREA 2VI7A 1P0HA 4KOYA 4NF1A 4C68A 4A2ZA 4R3LA 1Z9UA 1S60A 3E0KA 4C2XA 4MBUA 2OU2A 4KUBA 3GKRA 4UCNA 5JQ4A 2Q4YA 4JD6A 2I00A 4E0AA 2R1IA 3LD2A 4C7IA 2WPXA 5GCNA 4B11A 5AG5A 2ZPAA 1FY7A 2O28A 4QVTA 3W6XA 2BSWA 2Q7BA 4XPLA 3FIXA 1IB1E 4KVOE 1XE4A 2ZW6A 4KOVA 4H6ZA 1L0CA 3R9GA 4MFKA 2P0WA 1GHEA 1KUVA 3DSBA 3P2FA 1YLEA 1Y7RA 4EVYA 4HNYB 4CRYB 2EVNA 3TT2A 4A95A 2Z11A 3S6HA 1Q2YA 2VZYA 1IYLA 3I9SA 2Q4VA 4KLWA 3W91A 4B5PB 4CRZB 5G20A 4UA3A 1OZPA 2REEA 2VXKA 4ONUA 5IB0A 2Z3MA 2G3TA 2D4PA 2AJ6A 1I1DA 5JPHA 1Y9KA 2GIVA 1XF8A 4Y49C 3IU1A 4BMHA 3C26A 5ISVA 3WR7A 4AVAA 5F48A 4U9ZA 3BJ8A 1QSOA 1Q2CA 2PSWA 5A28A 2PR1A 4KOUA 3FXTA 2FS5A 3EC4A 4MFJA 3FB3A 1PU9A 1MJBA 4KORA 2HUZA 3QAHA 2D4OA 5KTCA 1YX0A 4AG7A 1XEBA 1KZFA 1XIXA 4C2ZA 4DNCA 3N7ZA 4A31A 2G3AA 2BL1A 4AG9A 4KS9A 3TOAA 4MY0A 2VBQA 1M44A 4Q38A 4Q36A 2B3UA 2FT0A 2VEZA 1UFHA 4KSFA 2GANA 3CXPA 1QSMA 2CXAA 4MJ8A 4CGPA 2B5GA 4H89A 1KUXA 4MFZA 1S5KA 2Z3NA 3R1KA 4C2YA 5G21A 4B13A 4CAFA 5H86A 4JXRA 1YK3A 4QBJA 4CYOA 3DDDA 4NEXA 4UCMA 3GYAA 4U5YA 1CM0A 4XPDC 2R7HA 2J8NA 5FVJA 4KOTA 1CJWA 4QC6A 4ZGYB 1Z4RA 5KTAA 1KUYA 1B6BA 2HQYA 1SQHA 2FL4A 4XNHC 3F8KA 3DNSA 5G22A 2CNSA 1M4GA 5AG6A 4UBRA 3D8PA 2PQ8A 3S6GA 4A30A 4YGOA 4QB9A 3ZZIA 3H5ZA 4M3SA 4PV6A 4AB7A 5J8CA 2B5GB 1B87A 2BUEA 2ZW4A 3S6KA 4IF5A 1ZO0A 2B58A 2B4DA 3UY5A 3NE7A 2FXFA 2BEIA 1WWZA 2YGWA 3EO4A 1XMTA 3TE4A 4R9MA 4LUAA 4NSQA 2YNCC 3FNCA 4F0XA 4B10A 2J8RA 5DWNA 5CNPA 1I12A 5EBVA 1Q2DA 2YNEA 2ZW5A 4CAEA 2G0BA 2KCWA 1IIDA 5H84A 2VQYA 5IV0A 4II9A 3VWDA 4A33A 4HNWB 3JUWA 1IYKA 1P4NA 2HV2A 4HKFA 4AVCA 1NSLA 3PGPA 3JTKA 2A4NA 2DPSA 4GS4A 4KVXA 2PR8A 4H6UA 4JLYA 3K9UA 1J4JA 1BO4A 5F46A 2YNCA 4ZBGA 2ZXVA 3V8IA 4IUSA 4X5KA 2FSRA 2WSAA 1S7NA 3SXNA 2B3VA 4PK2A 4CYQA 2OZUA 2DPTA 4FD7A 4FD4A 4UFVA 3F0AA 2P6EA 1BOBA 4R57A 5KTDA 1VHSA 4CYPA 1NMTA 2Z3OA 5AG7A 4RI1A 4B14A 4OADA 1NE9A 4KLVA 3TTHA 1N71A 1YGHA 3IU2A 5BWAB 2QMLA 3CXQA 5HH1A 3TCVA 2Q44A 3RYOA 3LODA 5AG4A 2C27A 4UWJA 3R9EA 1Z4EA 1ON0A 4JWPA 4MFLA 2OH1A 4CAVA 2K5TA 3FYNA 1WK4A 1YVOA 3JVNA 2VZZA 1VKCA 2JLMA 5F47A 4BBHA 4F0YA 3DR6A 4R87A 4U9YA 2Y0MA 4B12A 4CS0B 4UCPA 4KOSA 1S7FA 4KZTA 1YVKA 2CNMA 4PSWA 1MJAA 3D2PA 1QSNA 4QUSA 4YRHA 3VWEA 4UFXA 4CYNA 3PP9A 4OAEA 4RS2A 3BLNA 2YNDA 2OZGA 4E2AA 3CXSA 2OZHA 2EUIA 4KOWA 4AVBA 5I0CA 2FE7A 3D3SA 3OWCA 2I79A 2ARHA 4R3KA 4Y49B 4J3GA 4L8AA 2WUUA 4XPKA 5EC4A 4B5PA 2DXQA 4UFWA 5E96A 4YFJA 4CGLA 2JEVA 2H5MA 3S6FA 3B8GA 4PSXA 3TO9A 2B4BA 4KVME 1S7LA 1K4JA 5C88A 5IX3A 3T90A 1M4IA 4CAWA 1I21A 4KOXA 2FIWA 4NXYA 2OB0A 4KUAA 2JDCA 5F49A 3A9LA 3IWEA 3IGRA 3R9FA 3PZJA 2P6FA 2IL4A 4MFPA 1M4DA 2ATRA 4MFQA 3R95A 3EXNA 4A32A 4CGMA 2ZW7A 3TO6A 3BJ7A 3IWGA 4I49A 1U6MA 4LX9A 3KKWA 2Q04A 1MJ9A 1PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  1YR0 A;  4MHD A;  2B4D B;  3T9Y A;  1S7K A;  1V0C A;  4XPD B;  3ZJ0 A;  2QEC A;  2J8M A;  3EFA A;  2WPW A;  1LRZ A;  4XNH B;  1MK4 A;  3TOB A;  4FD5 A;  2CY2 A;  4B5O A;  3P2H A;  3FBU A;  3GY9 A;  4M85 A;  1QSR A;  3R96 A;  2P6G A;  3SHP A;  2REF A;  1QST A;  1TIQ A;  3TO7 A;  2R8V A;  4CAX A;  2QIR A;  2Z0Z A;  4JXQ A;  5DWM A;  4L89 A;  3G3S A;  4HNX B;  4JJX A;  3FRM A;  4E8O A;  2Q0Y A;  4PK3 A;  2FCK A;  2FIA A;  2AE6 A;  2RC4 A;  1R57 A;  3MGD A;  4MI4 A;  1RXT A;  2PRB A;  1RO5 A;  2JDD A;  2X7B A;  2Z10 A;  3F5B A;  3TFY A;  2NMT A;  2PC1 A;  1S3Z A;  3QB8 A;  3H4Q A;  2CNT A;  3W6S A;  2PDO A;  1IIC A;  1M1D A;  4K30 A;  4NCZ A;  2R98 A;  4F6A A;  3I3G A;  3SXO A;  3G8W A;  3D2M A;  4UWI A;  4FD6 A;  2GE3 A;  3DR8 A;  5J8F A;  4OLL A;  4ORF A;  4MY3 A;  1Y9W A;  5C82 A;  5HMN A;  2F5I A;  1YRE A;  2VI7 A;  1P0H A;  4KOY A;  4NF1 A;  4R3L A;  1Z9U A;  1S60 A;  3E0K A;  4MBU A;  2OU2 A;  3GKR A;  5JQ4 A;  2Q4Y A;  4JD6 A;  2I00 A;  4E0A A;  2R1I A;  3LD2 A;  2WPX A;  5GCN A;  2ZPA A;  1FY7 A;  2O28 A;  4QVT A;  3W6X A;  2BSW A;  2Q7B A;  4XPL A;  3FIX A;  1IB1 E;  4KVO E;  1XE4 A;  2ZW6 A;  4KOV A;  4H6Z A;  1L0C A;  3R9G A;  2P0W A;  1GHE A;  1KUV A;  3DSB A;  3P2F A;  1YLE A;  1Y7R A;  4EVY A;  4HNY B;  4CRY B;  2EVN A;  3TT2 A;  2Z11 A;  3S6H A;  1Q2Y A;  2VZY A;  1IYL A;  3I9S A;  2Q4V A;  4KLW A;  3W91 A;  4B5P B;  4CRZ B;  4UA3 A;  1OZP A;  2REE A;  2VXK A;  4ONU A;  5IB0 A;  2G3T A;  2D4P A;  2AJ6 A;  1I1D A;  5JPH A;  1Y9K A;  2GIV A;  1XF8 A;  4Y49 C;  4BMH A;  3C26 A;  5ISV A;  3WR7 A;  4AVA A;  5F48 A;  4U9Z A;  3BJ8 A;  1QSO A;  1Q2C A;  2PSW A;  2PR1 A;  4KOU A;  3FXT A;  2FS5 A;  3EC4 A;  3FB3 A;  1PU9 A;  1MJB A;  4KOR A;  2HUZ A;  3QAH A;  2D4O A;  5KTC A;  1YX0 A;  4AG7 A;  1XEB A;  1KZF A;  1XIX A;  4DNC A;  3N7Z A;  2G3A A;  2BL1 A;  4AG9 A;  3TOA A;  4MY0 A;  2VBQ A;  1M44 A;  2B3U A;  2FT0 A;  2VEZ A;  1UFH A;  2GAN A;  3CXP A;  1QSM A;  4MJ8 A;  2B5G A;  4H89 A;  1KUX A;  1S5K A;  3R1K A;  5H86 A;  4JXR A;  1YK3 A;  4QBJ A;  3DDD A;  4NEX A;  3GYA A;  4U5Y A;  1CM0 A;  4XPD C;  2R7H A;  2J8N A;  5FVJ A;  4KOT A;  1CJW A;  4QC6 A;  1Z4R A;  5KTA A;  1KUY A;  1B6B A;  2HQY A;  1SQH A;  2FL4 A;  4XNH C;  3F8K A;  3DNS A;  2CNS A;  1M4G A;  4UBR A;  3D8P A;  2PQ8 A;  3S6G A;  4YGO A;  4QB9 A;  3ZZI A;  4M3S A;  4PV6 A;  4AB7 A;  5J8C A;  2B5G B;  1B87 A;  2BUE A;  2ZW4 A;  3S6K A;  4IF5 A;  2B58 A;  2B4D A;  3UY5 A;  3NE7 A;  2FXF A;  2BEI A;  1WWZ A;  3EO4 A;  1XMT A;  3TE4 A;  4R9M A;  4LUA A;  4NSQ A;  3FNC A;  2J8R A;  5DWN A;  5CNP A;  1I12 A;  5EBV A;  1Q2D A;  2ZW5 A;  2G0B A;  2KCW A;  1IID A;  5H84 A;  2VQY A;  5IV0 A;  4II9 A;  3VWD A;  4HNW B;  3JUW A;  1IYK A;  1P4N A;  2HV2 A;  4HKF A;  4AVC A;  1NSL A;  3PGP A;  2A4N A;  4KVX A;  4GS4 A;  2PR8 A;  4H6U A;  4JLY A;  3K9U A;  1J4J A;  1BO4 A;  5F46 A;  4ZBG A;  2ZXV A;  3V8I A;  4IUS A;  4X5K A;  2FSR A;  1S7N A;  3SXN A;  2B3V A;  4PK2 A;  2OZU A;  4FD7 A;  4FD4 A;  3F0A A;  2P6E A;  1BOB A;  4R57 A;  5KTD A;  1VHS A;  1NMT A;  4RI1 A;  4OAD A;  1NE9 A;  4KLV A;  3TTH A;  1N71 A;  1YGH A;  2QML A;  3CXQ A;  5HH1 A;  3TCV A;  2Q44 A;  3RYO A;  3LOD A;  2C27 A;  4UWJ A;  3R9E A;  1Z4E A;  1ON0 A;  4JWP A;  2OH1 A;  4CAV A;  2K5T A;  3FYN A;  1WK4 A;  1YVO A;  3JVN A;  2VZZ A;  1VKC A;  2JLM A;  5F47 A;  4F0Y A;  3DR6 A;  4R87 A;  4U9Y A;  2Y0M A;  4CS0 B;  4KOS A;  1S7F A;  4KZT A;  1YVK A;  2CNM A;  4PSW A;  1MJA A;  3D2P A;  1QSN A;  4QUS A;  4YRH A;  3VWE A;  3PP9 A;  4OAE A;  4RS2 A;  3BLN A;  2OZG A;  4E2A A;  3CXS A;  2OZH A;  2EUI A;  4KOW A;  4AVB A;  5I0C A;  2FE7 A;  3D3S A;  3OWC A;  2I79 A;  2ARH A;  4R3K A;  4Y49 B;  4J3G A;  4L8A A;  4XPK A;  5EC4 A;  4B5P A;  2DXQ A;  5E96 A;  4YFJ A;  2JEV A;  2H5M A;  3S6F A;  3B8G A;  4PSX A;  3TO9 A;  2B4B A;  4KVM E;  1S7L A;  1K4J A;  5C88 A;  5IX3 A;  3T90 A;  1M4I A;  4CAW A;  1I21 A;  4KOX A;  2FIW A;  4NXY A;  2OB0 A;  4KUA A;  2JDC A;  5F49 A;  3IGR A;  3R9F A;  3PZJ A;  2P6F A;  2IL4 A;  1M4D A;  2ATR A;  3R95 A;  3EXN A;  2ZW7 A;  3TO6 A;  3BJ7 A;  1MJ9 A;  3IWG A;  4I49 A;  1U6M A;  4LX9 A;  3KKW A;  2Q04 A;  4KUB A;  1PUA A; 
#chains in the Genus database with same CATH topology
 3SJE A;  1GYT A;  2I3C A;  3VH9 A;  2V8V A;  3EY5 A;  1ZG8 A;  4ONW A;  3SJG A;  1YR0 A;  2ZEN A;  4MHD A;  2B4D B;  1IGB A;  5D8N A;  2J9A A;  3T9Y A;  5A27 A;  1S7K A;  1V0C A;  4XPD B;  2XEG A;  3ZJ0 A;  4OME A;  2QEC A;  2J8M A;  4P4J A;  3EFA A;  3IIB A;  4YWY A;  3FX6 A;  2WPW A;  4C7H A;  5G1Z A;  1FT7 A;  1LRZ A;  4CGO A;  4XNH B;  1MK4 A;  1DE4 C;  2V8D A;  3BXM A;  3GUX A;  4MCR A;  3TOB A;  4FD5 A;  4KSA A;  2CY2 A;  3SJX A;  2PE3 A;  2QJ8 A;  2Z3L A;  4B5O A;  3CPX A;  5AGE A;  2EBJ A;  3P2H A;  3FBU A;  2AFO A;  4OC1 A;  2Z3P A;  3GY9 A;  1YSJ A;  4M85 A;  2F8H A;  1QSR A;  3QAY A;  4WWV A;  3R96 A;  5CBM A;  1CP6 A;  3NFZ A;  2P6G A;  3SHP A;  2REF A;  4MHP A;  1QST A;  1TIQ A;  1ELM P;  3TO7 A;  4PQA A;  2R8V A;  4FWU A;  4OID A;  4LQ6 A;  4CAX A;  2QIR A;  4PXC A;  2Z0Z A;  4JXQ A;  5DWM A;  2GRE A;  3DLJ A;  4L89 A;  4UF4 A;  1VIX A;  3FJU A;  4OC5 A;  1XBU A;  3G3S A;  3IFE A;  3LAC A;  4HNX B;  3D7G A;  4JJX A;  4OP4 A;  3FRM A;  4E8O A;  4PPZ A;  4GM5 A;  2Q0Y A;  4PK3 A;  1JWQ A;  3S9N A;  2FCK A;  3FH4 A;  2FIA A;  2AE6 A;  2RC4 A;  3BI1 A;  4NJQ A;  2HB6 A;  1R57 A;  1LAP A;  3MGD A;  4MI4 A;  4P4E A;  1RXT A;  2PRB A;  1RO5 A;  4P4F A;  1ARL A;  2JDD A;  2X7B A;  2Z10 A;  3F5B A;  3WC7 A;  3B7I A;  1A2Z A;  3TFY A;  2NMT A;  2PC1 A;  1IY7 A;  1S3Z A;  3QB8 A;  3H4Q A;  3TX8 A;  2CNT A;  4CGN A;  5HVG A;  3W6S A;  2PDO A;  2PIY A;  1CP7 A;  2Z3K A;  1IIC A;  1M1D A;  2IJZ A;  4K30 A;  5HVH A;  2AFS A;  4NCZ A;  1IOF A;  2R98 A;  4F6A A;  1ZG7 A;  3I3G A;  2ZEE A;  2V8G A;  3SXO A;  4Z65 A;  3G8W A;  3D2M A;  4UWI A;  3KAS A;  4FD6 A;  2GE3 A;  4WJB A;  3DR8 A;  1Z2L A;  5J8F A;  3PFO A;  4OLL A;  4ORF A;  4MY3 A;  3N5F A;  2PJ6 A;  3CPA A;  1R43 A;  4DYO A;  2RFH A;  3H8E A;  3PEI A;  4F8Z A;  1Y9W A;  3MN8 A;  3CT9 A;  1X10 A;  1CPS A;  3B3V A;  5C82 A;  2F7V A;  2EO8 A;  1HDQ A;  2F5I A;  4NGP A;  5HMN A;  1YRE A;  1BAV A;  2VI7 A;  4OKO A;  1P0H A;  3KR5 A;  4KOY A;  4NF1 A;  4C68 A;  4A2Z A;  4R3L A;  4RUH A;  1Z9U A;  1S60 A;  3E0K A;  4C2X A;  4G1P A;  4MBU A;  1CG2 A;  2EWB A;  2OU2 A;  4KUB A;  4NGQ A;  3GKR A;  3IEH A;  4UCN A;  5JQ4 A;  2Q4Y A;  4JD6 A;  4K3N A;  2I00 A;  4E0A A;  3NH8 A;  2R1I A;  2O53 A;  3LD2 A;  4C7I A;  2WPX A;  5GCN A;  4B11 A;  1Z8T A;  5AG5 A;  2ZPA A;  3FED A;  2BO9 A;  1LAM A;  1FY7 A;  2DEA A;  2O28 A;  3B3T A;  2BSW A;  3NH4 A;  3PFE A;  4QVT A;  2Q7B A;  1YW4 A;  4XPL A;  1F57 A;  3FIX A;  1IB1 E;  4KVO E;  5LYD A;  1XE4 A;  4MHY A;  4MCP A;  4ZX9 A;  2ZW6 A;  4KOV A;  4MCS A;  3RO0 A;  1YW6 A;  1Z8L A;  2ZEH A;  4H6Z A;  4OIW A;  4R7M A;  5D29 A;  1L0C A;  2ZEM A;  2ODF A;  3BI0 A;  4MFK A;  3R9G A;  2XEJ A;  2P0W A;  1GHE A;  1KUV A;  3GB0 A;  5THW A;  3DSB A;  2POK A;  2Q4Z A;  2BOA A;  3P2F A;  1YLE A;  1Y7R A;  4PXB A;  4EVY A;  4HNY B;  4CRY B;  2PJ9 A;  2EVN A;  4NFR A;  3TT2 A;  3D7D A;  4A95 A;  2Z11 A;  1XMB A;  3KL9 A;  3S6H A;  1Q2Y A;  2VZY A;  1Z8X A;  1IYL A;  4MHZ A;  3I9S A;  4FBE A;  3D68 A;  4NJR A;  2Q4V A;  4KLW A;  3WC6 A;  1AYE A;  3W91 A;  4B5P B;  3D67 A;  3SI1 A;  4O23 A;  4CRZ B;  3PBE A;  3LMS A;  3CZX A;  5G20 A;  4UA3 A;  3T8W A;  1BLL E;  1OZP A;  1TKF A;  2REE A;  5K8M A;  2VXK A;  4ONU A;  5IB0 A;  4BIN A;  2Z3M A;  4IAV A;  2G3T A;  2D4P A;  2AJ6 A;  2WZN A;  4NGT A;  1I1D A;  1LCP A;  4UEZ A;  4GXH A;  5JPH A;  1IOI A;  4ZY1 A;  1Y9K A;  2GIV A;  1XF8 A;  3V7Z A;  3VAT A;  4F9V A;  4Y49 C;  2PJ4 A;  3IU1 A;  4ZYQ A;  4BMH A;  3C26 A;  4P10 A;  3WR7 A;  4AVA A;  5F48 A;  5ISV A;  3S9M A;  4PXD A;  3BJ8 A;  4U9Z A;  1QSO A;  4HPS A;  1Q2C A;  2PSW A;  5A28 A;  2PR1 A;  3WAB A;  4KOU A;  4F9U A;  2C6P A;  2AFW A;  2FS5 A;  2AFU A;  3EC4 A;  3FXT A;  3FB3 A;  4MFJ A;  4RN7 A;  4ZI6 A;  5JM6 A;  1PU9 A;  2NSM A;  1MJB A;  3FEC A;  4KOR A;  2HUZ A;  1TKH A;  3QAH A;  2D4O A;  5KTC A;  1YX0 A;  1Q7L A;  1XEB A;  2ZED A;  4AG7 A;  1KZF A;  1OBR A;  2G9D A;  1XIX A;  4A37 A;  4C2Z A;  4DNC A;  2RB7 A;  3N7Z A;  4A31 A;  2G3A A;  2BL1 A;  4JYW A;  4A94 A;  4AG9 A;  4KS9 A;  3TOA A;  4H2K A;  4MY0 A;  4X2T A;  2VBQ A;  2ANP A;  1M44 A;  4Q38 A;  4Q36 A;  4P4I A;  2CTC A;  2Q7S A;  5LRJ A;  2B3U A;  2FT0 A;  4MHN A;  1VHE A;  2VEZ A;  3IWW A;  2OOT A;  1UFH A;  4KSF A;  4M6G A;  1YLO A;  2GAN A;  2V77 A;  3CXP A;  1QSM A;  2CXA A;  4MJ8 A;  4CGP A;  2B5G A;  4H89 A;  1ELL P;  4OC3 A;  4TNU A;  5LYI A;  1PYT B;  1KUX A;  3PB8 X;  2PVV A;  1VHO A;  4MFZ A;  1S5K A;  2Z3N A;  3R1K A;  3NH5 A;  4KSI A;  4C2Y A;  3B3W A;  3D66 A;  5G21 A;  1XFO A;  4B13 A;  2PJ3 A;  1Y0R A;  4CAF A;  5H86 A;  4JXR A;  1YK3 A;  2JBK A;  4QBJ A;  3H8G A;  3DDD A;  4PXE A;  4NEX A;  4CYO A;  5LYF A;  4UCM A;  1M4L A;  3GYA A;  4U5Y A;  1CM0 A;  4XPD C;  2R7H A;  2J8N A;  2IQ6 A;  5FVJ A;  1CPX A;  2ZEL A;  4KOT A;  1CJW A;  4DJL A;  4QC6 A;  4ZGY B;  1Z4R A;  3B2Y A;  3D7H A;  1KUY A;  1B6B A;  2HQY A;  3ISX A;  5KTA A;  5ELY A;  1SQH A;  2FL4 A;  1XJO A;  4XNH C;  3FVL A;  5LRK A;  1LFW A;  3F8K A;  3DNS A;  5G22 A;  2CNS A;  1M4G A;  4UEE A;  4BD9 A;  1BPN A;  1DTD A;  1HDU A;  4UBR A;  5AG6 A;  3D8P A;  2AFM A;  2AFZ A;  2PQ8 A;  3IO1 A;  3S6G A;  4A30 A;  3K9T A;  4YGO A;  4JZ0 A;  4QB9 A;  3ZZI A;  5K8P A;  3H5Z A;  4M3S A;  4PV6 A;  4AB7 A;  5J8C A;  2B5G B;  1B87 A;  2BUE A;  2CIJ A;  2PVW A;  2ZW4 A;  1ZO0 A;  2GLF A;  4IF5 A;  2B58 A;  2NYQ A;  4MXU A;  2B4D A;  3S6K A;  3UY5 A;  3NE7 A;  4MCQ A;  2FXF A;  2BEI A;  1WWZ A;  2VL1 A;  2YGW A;  3PB4 X;  3EO4 A;  1XMT A;  3IJ3 A;  4OC4 A;  4YU9 A;  5F09 A;  3TE4 A;  2JBJ A;  5HVF A;  3MRU A;  4R9M A;  4LUA A;  3RBU A;  3KR4 A;  4NSQ A;  5I4M A;  3KZW A;  2YNC C;  3FNC A;  4F0X A;  4B10 A;  2J8R A;  3SJF A;  2EK9 A;  2ABZ A;  5DWN A;  1H8L A;  3QNV A;  5CNP A;  1I12 A;  3RZA A;  5EBV A;  4Q7A A;  1IU8 A;  1Q2D A;  2YNE A;  2PJ5 A;  2ZW5 A;  4CAE A;  2G0B A;  2KCW A;  1IID A;  2PJ1 A;  3GIU A;  3H8F A;  4NGM A;  5H84 A;  1Z8W A;  2DF5 A;  3GLJ A;  3JRU A;  3B35 A;  2VQY A;  4B6Z A;  4DUK A;  5IV0 A;  4II9 A;  3VWD A;  3TC8 A;  4A33 A;  4FAI A;  3HUV A;  1CX8 A;  4FUU A;  3JUW A;  2Q43 A;  4HNW B;  5EMI A;  1IYK A;  1P4N A;  4EME A;  2HV2 A;  4HKF A;  2ZOF A;  1NSL A;  4AVC A;  6CPA A;  3PGP A;  3I1U A;  3JTK A;  2A4N A;  2DPS A;  4GS4 A;  4KVX A;  2EK8 A;  1BPM A;  3KHZ A;  2PR8 A;  5K8O A;  4H6U A;  4JLY A;  2PRQ A;  1YME A;  3K9U A;  1J4J A;  2XEF A;  3SI0 A;  1NSA A;  1BO4 A;  4EFD A;  5F46 A;  3K2K A;  2YNC A;  2HC9 A;  3PBB A;  4R76 A;  4ZBG A;  2ZXV A;  3V8I A;  4M6H A;  2PCU A;  1UWY A;  3FMC A;  4IUS A;  2IMO A;  3HLP A;  3KQX A;  1QMU A;  4X5K A;  2FSR A;  2WSA A;  1S7N A;  1CBX A;  3SXN A;  3PB9 X;  2B3V A;  4MMO A;  4PK2 A;  4CYQ A;  2FVG A;  5LYL A;  2OZU A;  2PJ0 A;  2DPT A;  2ZEF A;  4FD7 A;  4FD4 A;  4UFV A;  3F0A A;  2P6E A;  1XOV A;  3PRT A;  1BOB A;  4R57 A;  4NGS A;  1ZLH A;  2C6G A;  2PJ8 A;  3ISZ A;  5KTD A;  1VHS A;  4CYP A;  1NMT A;  4M6I A;  1PCA A;  2Z3O A;  4UIB A;  4RI1 A;  2WYR A;  5AG7 A;  3W6X A;  3V38 A;  1TF9 A;  4B14 A;  1HEE A;  2C1C A;  4OAD A;  1NE9 A;  4KLV A;  3TTH A;  7CPA A;  1N71 A;  1YGH A;  3IU2 A;  5K8N A;  2PJA A;  2CTB A;  2AFX A;  4IHM A;  2PIZ A;  3PB6 X;  5BWA B;  2C6C A;  2QML A;  3CXQ A;  5HH1 A;  3TCV A;  4R6T A;  2Q44 A;  3BHX A;  3RYO A;  3SI2 A;  4A39 A;  3LOD A;  1TF8 A;  5AG4 A;  2C27 A;  2GU2 A;  4UWJ A;  1XRY A;  3R9E A;  1Z4E A;  1ON0 A;  1ZLI A;  1F2P A;  4CPA A;  3FF3 A;  4ZY2 A;  4JWP A;  4MFL A;  1Y7E A;  2OH1 A;  4CAV A;  2K5T A;  3S9L A;  1TKJ A;  3FYN A;  1WK4 A;  5DS0 A;  1YVO A;  2GLJ A;  3DGV A;  4EWT A;  3JVN A;  2VZZ A;  4OC2 A;  1VKC A;  3CDX A;  2OR4 A;  2JLM A;  2ZOG A;  5F47 A;  4ZX8 A;  4BBH A;  1LAN A;  3RNZ A;  4A38 A;  4F0Y A;  1F2O A;  3DR6 A;  1Y0Y A;  4R87 A;  4U9Y A;  2Y0M A;  4B12 A;  5IB9 A;  1QQ9 A;  4CS0 B;  4UCP A;  5CPA A;  4KOS A;  4P6Y A;  5JH9 A;  1S7F A;  4KZT A;  1YVK A;  4UEF A;  2QVP A;  2V8H A;  2CNM A;  4PSW A;  1MJA A;  3D2P A;  1EE3 P;  1QSN A;  2ZEG A;  1Z5R A;  4QUS A;  4W9Y A;  4YRH A;  3VWE A;  4UFX A;  4LQG A;  4CYN A;  3PP9 A;  4OAE A;  4RS2 A;  3BLN A;  2YND A;  3VAR A;  2OZG A;  4E2A A;  3CXS A;  2OZH A;  3L2N A;  2EUI A;  4KOW A;  5JGF A;  4AVB A;  5I0C A;  4R8F A;  2FE7 A;  3D3S A;  1KWM A;  3OWC A;  4IK2 A;  1FNO A;  2ARH A;  2I79 A;  4R3K A;  3LWU A;  4Y49 B;  4ZY0 A;  1AMP A;  4J3G A;  3KI9 A;  4P44 A;  2Q51 A;  1YQE A;  4L8A A;  1AUG A;  2WUU A;  4AXV A;  4XPK A;  1ARM A;  3WC5 A;  4X8I A;  3NA6 A;  5EC4 A;  2ZEO A;  1VGY A;  4UIA A;  3PB7 X;  4B5P A;  2PJ2 A;  2ZEP A;  3D7F A;  2DXQ A;  8CPA A;  4UFW A;  5E96 A;  4YFJ A;  4CGL A;  3B3S A;  1X12 A;  2JEV A;  3D4U A;  2H5M A;  3IC1 A;  3B3C A;  3B8G A;  4MRI A;  4PSX A;  2PJ7 A;  3S6F A;  3TO9 A;  2B4B A;  2QYV A;  4P4B A;  2O4H A;  4KVM E;  1S7L A;  1K4J A;  5C88 A;  5IX3 A;  3T90 A;  4P4D A;  1M4I A;  3KQZ A;  4CAW A;  1I21 A;  4KOX A;  1LOK A;  3NE8 A;  2FIW A;  1RTQ A;  4NXY A;  2OB0 A;  2GFQ A;  4KUA A;  5HXD A;  2JDC A;  2JEW A;  5F49 A;  2BCO A;  3A9L A;  1JQG A;  3IWE A;  4NGN A;  3IGR A;  3WT4 A;  4TWE A;  3R9F A;  4X3R A;  3PZJ A;  4OC0 A;  2PJC A;  2P6F A;  2IL4 A;  4MFP A;  1M4D A;  2ATR A;  1ZG9 A;  4MFQ A;  3R95 A;  3EXN A;  4NGR A;  4A32 A;  5LRG A;  3FEE A;  4CGM A;  2PJB A;  1TXR A;  4P45 A;  2ZW7 A;  3RAM A;  3TO6 A;  3KHX A;  3BJ7 A;  5J1Q A;  1R3N A;  2CF4 A;  3IWG A;  1U6M A;  4I49 A;  4LX9 A;  3KKW A;  2Q04 A;  3KGQ A;  2XEI A;  1MJ9 A;  1PUA A; 
#chains in the Genus database with same CATH homology
 3EY5 A;  1YR0 A;  4MHD A;  2B4D B;  3T9Y A;  5A27 A;  1S7K A;  1V0C A;  4XPD B;  3ZJ0 A;  2QEC A;  2J8M A;  3EFA A;  2WPW A;  4C7H A;  5G1Z A;  1LRZ A;  4CGO A;  4XNH B;  1MK4 A;  3TOB A;  4FD5 A;  4KSA A;  2CY2 A;  4B5O A;  2Z3L A;  5AGE A;  3P2H A;  3FBU A;  2Z3P A;  3GY9 A;  4M85 A;  1QSR A;  3R96 A;  2P6G A;  3SHP A;  2REF A;  1QST A;  1TIQ A;  3TO7 A;  2R8V A;  4CAX A;  2QIR A;  2Z0Z A;  4JXQ A;  5DWM A;  4L89 A;  3G3S A;  4HNX B;  4JJX A;  3FRM A;  4E8O A;  2Q0Y A;  4PK3 A;  2FCK A;  2FIA A;  2AE6 A;  2RC4 A;  1R57 A;  3MGD A;  4MI4 A;  1RXT A;  2PRB A;  1RO5 A;  2JDD A;  2X7B A;  2Z10 A;  3F5B A;  3TFY A;  2NMT A;  2PC1 A;  1S3Z A;  3QB8 A;  3H4Q A;  2CNT A;  4CGN A;  3W6S A;  2PDO A;  2Z3K A;  1IIC A;  1M1D A;  4K30 A;  4NCZ A;  2R98 A;  4F6A A;  3I3G A;  3SXO A;  3G8W A;  3D2M A;  4UWI A;  4FD6 A;  2GE3 A;  3DR8 A;  5J8F A;  4OLL A;  4ORF A;  4MY3 A;  1Y9W A;  5C82 A;  5HMN A;  2F5I A;  1YRE A;  2VI7 A;  1P0H A;  4KOY A;  4NF1 A;  4C68 A;  4A2Z A;  4R3L A;  1Z9U A;  1S60 A;  3E0K A;  4C2X A;  4MBU A;  2OU2 A;  4KUB A;  3GKR A;  4UCN A;  5JQ4 A;  2Q4Y A;  4JD6 A;  2I00 A;  4E0A A;  2R1I A;  3LD2 A;  4C7I A;  2WPX A;  5GCN A;  4B11 A;  5AG5 A;  2ZPA A;  1FY7 A;  2O28 A;  4QVT A;  3W6X A;  2BSW A;  2Q7B A;  4XPL A;  3FIX A;  1IB1 E;  4KVO E;  1XE4 A;  2ZW6 A;  4KOV A;  4H6Z A;  1L0C A;  3R9G A;  4MFK A;  2P0W A;  1GHE A;  1KUV A;  3DSB A;  3P2F A;  1YLE A;  1Y7R A;  4EVY A;  4HNY B;  4CRY B;  2EVN A;  3TT2 A;  4A95 A;  2Z11 A;  3S6H A;  1Q2Y A;  2VZY A;  1IYL A;  3I9S A;  2Q4V A;  4KLW A;  3W91 A;  4B5P B;  4CRZ B;  5G20 A;  4UA3 A;  1OZP A;  2REE A;  2VXK A;  4ONU A;  5IB0 A;  2Z3M A;  2G3T A;  2D4P A;  2AJ6 A;  1I1D A;  5JPH A;  1Y9K A;  2GIV A;  1XF8 A;  4Y49 C;  3IU1 A;  4BMH A;  3C26 A;  5ISV A;  3WR7 A;  4AVA A;  5F48 A;  4U9Z A;  3BJ8 A;  1QSO A;  1Q2C A;  2PSW A;  5A28 A;  2PR1 A;  4KOU A;  3FXT A;  2FS5 A;  3EC4 A;  4MFJ A;  3FB3 A;  1PU9 A;  1MJB A;  4KOR A;  2HUZ A;  3QAH A;  2D4O A;  5KTC A;  1YX0 A;  4AG7 A;  1XEB A;  1KZF A;  1XIX A;  4C2Z A;  4DNC A;  3N7Z A;  4A31 A;  2G3A A;  2BL1 A;  4AG9 A;  4KS9 A;  3TOA A;  4MY0 A;  2VBQ A;  1M44 A;  4Q38 A;  4Q36 A;  2B3U A;  2FT0 A;  2VEZ A;  1UFH A;  4KSF A;  2GAN A;  3CXP A;  1QSM A;  2CXA A;  4MJ8 A;  4CGP A;  2B5G A;  4H89 A;  1KUX A;  4MFZ A;  1S5K A;  2Z3N A;  3R1K A;  4C2Y A;  5G21 A;  4B13 A;  4CAF A;  5H86 A;  4JXR A;  1YK3 A;  4QBJ A;  4CYO A;  3DDD A;  4NEX A;  4UCM A;  3GYA A;  4U5Y A;  1CM0 A;  4XPD C;  2R7H A;  2J8N A;  5FVJ A;  4KOT A;  1CJW A;  4QC6 A;  4ZGY B;  1Z4R A;  5KTA A;  1KUY A;  1B6B A;  2HQY A;  1SQH A;  2FL4 A;  4XNH C;  3F8K A;  3DNS A;  5G22 A;  2CNS A;  1M4G A;  5AG6 A;  4UBR A;  3D8P A;  2PQ8 A;  3S6G A;  4A30 A;  4YGO A;  4QB9 A;  3ZZI A;  3H5Z A;  4M3S A;  4PV6 A;  4AB7 A;  5J8C A;  2B5G B;  1B87 A;  2BUE A;  2ZW4 A;  3S6K A;  4IF5 A;  1ZO0 A;  2B58 A;  2B4D A;  3UY5 A;  3NE7 A;  2FXF A;  2BEI A;  1WWZ A;  2YGW A;  3EO4 A;  1XMT A;  3TE4 A;  4R9M A;  4LUA A;  4NSQ A;  2YNC C;  3FNC A;  4F0X A;  4B10 A;  2J8R A;  5DWN A;  5CNP A;  1I12 A;  5EBV A;  1Q2D A;  2YNE A;  2ZW5 A;  4CAE A;  2G0B A;  2KCW A;  1IID A;  5H84 A;  2VQY A;  5IV0 A;  4II9 A;  3VWD A;  4A33 A;  4HNW B;  3JUW A;  1IYK A;  1P4N A;  2HV2 A;  4HKF A;  4AVC A;  1NSL A;  3PGP A;  3JTK A;  2A4N A;  2DPS A;  4GS4 A;  4KVX A;  2PR8 A;  4H6U A;  4JLY A;  3K9U A;  1J4J A;  1BO4 A;  5F46 A;  2YNC A;  4ZBG A;  2ZXV A;  3V8I A;  4IUS A;  4X5K A;  2FSR A;  2WSA A;  1S7N A;  3SXN A;  2B3V A;  4PK2 A;  4CYQ A;  2OZU A;  2DPT A;  4FD7 A;  4FD4 A;  4UFV A;  3F0A A;  2P6E A;  1BOB A;  4R57 A;  5KTD A;  1VHS A;  4CYP A;  1NMT A;  2Z3O A;  5AG7 A;  4RI1 A;  4B14 A;  4OAD A;  1NE9 A;  4KLV A;  3TTH A;  1N71 A;  1YGH A;  3IU2 A;  5BWA B;  2QML A;  3CXQ A;  5HH1 A;  3TCV A;  2Q44 A;  3RYO A;  3LOD A;  5AG4 A;  2C27 A;  4UWJ A;  3R9E A;  1Z4E A;  1ON0 A;  4JWP A;  4MFL A;  2OH1 A;  4CAV A;  2K5T A;  3FYN A;  1WK4 A;  1YVO A;  3JVN A;  2VZZ A;  1VKC A;  2JLM A;  5F47 A;  4BBH A;  4F0Y A;  3DR6 A;  4R87 A;  4U9Y A;  2Y0M A;  4B12 A;  4CS0 B;  4UCP A;  4KOS A;  1S7F A;  4KZT A;  1YVK A;  2CNM A;  4PSW A;  1MJA A;  3D2P A;  1QSN A;  4QUS A;  4YRH A;  3VWE A;  4UFX A;  4CYN A;  3PP9 A;  4OAE A;  4RS2 A;  3BLN A;  2YND A;  2OZG A;  4E2A A;  3CXS A;  2OZH A;  2EUI A;  4KOW A;  4AVB A;  5I0C A;  2FE7 A;  3D3S A;  3OWC A;  2I79 A;  2ARH A;  4R3K A;  4Y49 B;  4J3G A;  4L8A A;  2WUU A;  4XPK A;  5EC4 A;  4B5P A;  2DXQ A;  4UFW A;  5E96 A;  4YFJ A;  4CGL A;  2JEV A;  2H5M A;  3S6F A;  3B8G A;  4PSX A;  3TO9 A;  2B4B A;  4KVM E;  1S7L A;  1K4J A;  5C88 A;  5IX3 A;  3T90 A;  1M4I A;  4CAW A;  1I21 A;  4KOX A;  2FIW A;  4NXY A;  2OB0 A;  4KUA A;  2JDC A;  5F49 A;  3A9L A;  3IWE A;  3IGR A;  3R9F A;  3PZJ A;  2P6F A;  2IL4 A;  4MFP A;  1M4D A;  2ATR A;  4MFQ A;  3R95 A;  3EXN A;  4A32 A;  4CGM A;  2ZW7 A;  3TO6 A;  3BJ7 A;  3IWG A;  4I49 A;  1U6M A;  4LX9 A;  3KKW A;  2Q04 A;  1MJ9 A;  1PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...