1R57A

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
b'MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 23
structure length 102
sequence length 102
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1r57A00
1M4GA 4R3LA 2VI7A 1Q2CA 1PU9A 4AVCA 4R9MA 4FD6A 3WR7A 5F49A 3TO9A 4ZBGA 1Q2YA 4KOTA 2QECA 1MJAA 5KTDA 5GCNA 3TO7A 5E96A 2C27A 2OZHA 3BJ7A 1KUXA 3VWEA 1I21A 1P4NA 3FRMA 2JLMA 5H84A 2D4PA 3TO6A 2PR8A 2ZXVA 4AVBA 4J3GA 3TFYA 1YR0A 4KVME 2JEVA 4ONUA 1B87A 3FYNA 4NEXA 4GS4A 2R8VA 4KLVA 4R3KA 4UWJA 3T90A 4FD5A 1U6MA 1WK4A 3JVNA 3H4QA 1GHEA 3PGPA 3R9GA 1K4JA 3TOBA 4QVTA 3SXNA 2GIVA 4M3SA 2Z10A 2A4NA 4KVOE 3PP9A 3DNSA 1L0CA 1Q2DA 1YGHA 3NE7A 2BEIA 2FL4A 2PDOA 2D4OA 2BUEA 3G3SA 1QSMA 1M1DA 1NE9A 2VZZA 2Z11A 3KKWA 5F48A 4KUAA 1I12A 4H6ZA 4M85A 1CM0A 2P6GA 4NSQA 4CAVA 1LRZA 2BSWA 4XPKA 2Q0YA 1M4DA 3FNCA 4PK3A 1VKCA 1QSRA 1IICA 3K9UA 1S60A 5J8FA 1B6BA 4U9YA 4KOXA 2AE6A 1QSNA 3F8KA 2PRBA 4MBUA 1Y7RA 4JWPA 4KOVA 2FS5A 2CNTA 2EUIA 1MJ9A 4JD6A 4RS2A 3CXSA 3D2PA 2J8MA 1M44A 5H86A 3ZZIA 2ZW4A 3PZJA 4F0YA 2OU2A 1WWZA 4KOUA 2Q04A 3FB3A 4OADA 4FD4A 4NCZA 3R9EA 3IGRA 4CRZB 2VEZA 3EC4A 2X7BA 1YLEA 2Q4VA 3UY5A 1QSOA 4CS0B 4MHDA 1I1DA 4RI1A 3S6FA 4XPDB 1S7FA 5IB0A 3TCVA 2B4DB 4QC6A 4DNCA 4F6AA 1IB1E 4IUSA 4H6UA 4PSXA 3SXOA 4AG9A 2CNMA 3I3GA 4MJ8A 5ISVA 1R57A 4PK2A 4XNHC 3R96A 5J8CA 2FCKA 4KORA 4CAWA 2Z0ZA 3W6SA 2IL4A 3B8GA 2REFA 2ZW7A 4QUSA 2R1IA 1QSTA 3TOAA 2B3UA 4II9A 1S3ZA 3LD2A 2B5GA 2BL1A 1Z9UA 4ORFA 3G8WA 3GKRA 4UBRA 2JDCA 3F5BA 4U9ZA 1V0CA 3JUWA 3DR8A 4L8AA 2NMTA 3CXPA 2J8NA 4B5PB 5JPHA 3D2MA 2Y0MA 1S5KA 4KOYA 2Q4YA 5DWNA 3E0KA 1Z4RA 1FY7A 1CJWA 3R95A 1NSLA 5F46A 4FD7A 3TTHA 1S7LA 2F5IA 2B4DA 2OZGA 2P6EA 3I9SA 4YRHA 1YX0A 4MI4A 2H5MA 3LODA 1KZFA 2JDDA 4Y49C 4MY3A 2VQYA 4XNHB 4CAXA 2FT0A 4OAEA 5EBVA 1Y9WA 3EXNA 4I49A 1UFHA 4E2AA 3CXQA 2B3VA 4R57A 2ZW6A 4YFJA 2I00A 4OLLA 1MK4A 3SHPA 3EFAA 3P2HA 3T9YA 2J8RA 3W91A 4AG7A 2VZYA 4KVXA 1IYLA 4JLYA 3DDDA 1YVKA 5FVJA 1MJBA 3FBUA 1XMTA 1NMTA 2B58A 1SQHA 5KTAA 2QIRA 2VXKA 4KZTA 3C26A 4KOWA 4AVAA 2AJ6A 4XPLA 3RYOA 2B4BA 3GYAA 4B5OA 2FSRA 4PSWA 2OB0A 5CNPA 1J4JA 1VHSA 2RC4A 2REEA 2PR1A 2OZUA 4QB9A 4E0AA 2HUZA 2VBQA 4X5KA 3IWGA 5C82A 2O28A 4Y49B 5JQ4A 3W6XA 4JXRA 4YGOA 1BOBA 3S6GA 1S7NA 3VWDA 2G0BA 4HNYB 5EC4A 5I0CA 4NXYA 3DR6A 3EO4A 1KUYA 4HNXB 1IYKA 1N71A 1Y9KA 1XEBA 3S6KA 4AB7A 4JJXA 2ZW5A 2G3TA 4U5YA 4EVYA 4BMHA 4QBJA 3F0AA 2K5TA 5C88A 3GY9A 1XIXA 4HKFA 4CRYB 2ARHA 2PC1A 5F47A 2ATRA 1TIQA 2Q44A 4PV6A 2GANA 5HMNA 2R7HA 2FIWA 2PQ8A 1BO4A 3R1KA 2Q7BA 2P0WA 3ZJ0A 2FE7A 4HNWB 3BLNA 1RXTA 1Z4EA 1YREA 4E8OA 2OH1A 2HV2A 3D3SA 4H89A 2R98A 1RO5A 3R9FA 1IIDA 4NF1A 2QMLA 4MY0A 2CNSA 3D8PA 2WPWA 3MGDA 2FXFA 3EY5A 3OWCA 4L89A 4LUAA 3TE4A 1KUVA 1YK3A 5IV0A 5DWMA 4XPDC 1ON0A 5HH1A 3S6HA 5IX3A 2P6FA 2DXQA 3V8IA 5KTCA 2HQYA 1S7KA 1YVOA 4IF5A 3FXTA 2KCWA 3QAHA 4KLWA 1OZPA 2WPXA 2EVNA 4LX9A 2I79A 3TT2A 3DSBA 1PUAA 1M4IA 3P2FA 4JXQA 4UA3A 4UWIA 2ZPAA 2PSWA 2G3AA 3N7ZA 3BJ8A 2CY2A 1P0HA 4B5PA 2GE3A 4K30A 2FIAA 4R87A 4KUBA 3FIXA 2B5GB 1XE4A 4KOSA 3QB8A 1XF8A
chains in the Genus database with same CATH superfamily
1PCAA 1M4GA 4A32A 4AXVA 1EE3P 3KR5A 4OC1A 4CAFA 2Q4ZA 4R3LA 2VI7A 1BLLE 4MHNA 1Q2CA 2CXAA 5K8PA 1XRYA 1PU9A 4AVCA 1LOKA 4R9MA 4C68A 4FD6A 4NGRA 4YU9A 3RAMA 3WR7A 5F49A 3TO9A 3CZXA 3WC7A 4P4JA 4ZBGA 2PJ4A 4H2KA 4OMEA 2YGWA 2BCOA 1Q2YA 4KOTA 2PIZA 2AFMA 2QECA 3SI1A 2GREA 1MJAA 5KTDA 5GCNA 3SJXA 3KASA 2EK9A 3TO7A 3SI2A 5E96A 1DE4C 2C27A 2OZHA 4KSAA 2PJ7A 2XEIA 1HDUA 4X8IA 3BJ7A 1QQ9A 4ZYQA 1KUXA 3VWEA 1I21A 1P4NA 4EWTA 3FRMA 2JLMA 1LANA 2D4PA 5H84A 3RO0A 4FWUA 3TO6A 2PR8A 2ZXVA 2EO8A 4J3GA 5AG7A 1YR0A 4AVBA 2ZENA 4CYOA 4KVME 1R3NA 2AFUA 2PJ3A 2ANPA 2JEVA 2PRQA 2V8DA 3CPAA 3LWUA 4ONUA 5CPAA 4UF4A 1B87A 3FYNA 4NEXA 3IWEA 4GS4A 2I3CA 2R8VA 4KLVA 4R3KA 3KI9A 1IOFA 4UWJA 4K3NA 4P6YA 3IEHA 4B11A 2WYRA 3QAYA 3T90A 3HUVA 4FD5A 1ARMA 3JTKA 1U6MA 1Z8WA 1WK4A 3JVNA 4R6TA 3S9NA 3H4QA 2Z3OA 2V8VA 1LFWA 1GHEA 3B3CA 3FMCA 3PGPA 4OC2A 2PJ0A 1K4JA 2DF5A 3FEEA 3R9GA 3TOBA 2ZEGA 4C7IA 4QVTA 3SXNA 4KSFA 3HLPA 2GIVA 2WSAA 3B3WA 2Z3NA 3PB6X 1AYEA 5THWA 3D4UA 1RTQA 3B3VA 3DLJA 4M3SA 2Z10A 3LMSA 2A4NA 4Q36A 4ZY2A 1ZG7A 3D7FA 3PP9A 3DNSA 4KVOE 4PQAA 3SJEA 1L0CA 1ZLIA 1ARLA 1Q2DA 2JBJA 1YGHA 3IU2A 3NE7A 1Z8XA 2C6PA 5G22A 2BEIA 2FL4A 2PDOA 2CIJA 4OC3A 4NFRA 3NA6A 2D4OA 2BUEA 3G3SA 3D7HA 1YW4A 5BWAB 1M1DA 1BPNA 1NE9A 1QSMA 4IAVA 4A94A 2C6CA 2VZZA 2PJ8A 1Z8LA 2Z11A 3KKWA 4NJQA 4KUAA 5F48A 2ZOFA 3CPXA 1I12A 4UFVA 2IMOA 3D7DA 2AFSA 4H6ZA 4M85A 1CM0A 2P6GA 4NSQA 3RZAA 4CAVA 1DTDA 3IFEA 1LRZA 4IK2A 5G1ZA 2BSWA 4FBEA 5CBMA 4XPKA 2Q0YA 1M4DA 4NGPA 3FNCA 4PK3A 2GLJA 2PIYA 1VKCA 3WABA 4JYWA 1QSRA 1R43A 5J1QA 1IICA 3K9UA 1S60A 5J8FA 5JH9A 5G21A 1B6BA 4U9YA 4UCMA 5K8OA 2PJ6A 4MMOA 2ZEFA 4KOXA 2OOTA 2AE6A 1QSNA 1ELLP 3FEDA 3GUXA 3PEIA 1ZG9A 4C2ZA 3IU1A 3F8KA 2PRBA 1IY7A 4KSIA 1Y7RA 3NE8A 3PB8X 4MBUA 4JWPA 4PXEA 4CGMA 3KGQA 4KOVA 2FS5A 1IGBA 2CNTA 2EUIA 3VH9A 1MJ9A 4JD6A 1ELMP 4RS2A 3CXSA 3D2PA 1CPSA 4B13A 2YNCA 2J8MA 3BHXA 1HDQA 2PJAA 1VHOA 4RN7A 5HVHA 1M44A 1YQEA 3WC6A 2DEAA 5H86A 3FECA 1X12A 3ZZIA 4MHPA 2PE3A 1YLOA 4CYQA 2ZW4A 3PZJA 5D29A 3KHZA 2PJ9A 3GB0A 4CGLA 4F0YA 4MCPA 4RUHA 1Y7EA 2OU2A 3SJFA 5HXDA 1ZLHA 3I1UA 3LACA 1WWZA 1KWMA 4UIAA 3N5FA 2NSMA 4KOUA 2Q04A 1FT7A 2ZEOA 2HC9A 4UCPA 2QVPA 4UEFA 3FB3A 4OADA 4FD4A 1YW6A 2PCUA 4NCZA 3R9EA 3IGRA 4CRZB 2VEZA 2EK8A 3EC4A 1JQGA 2X7BA 4ZX8A 3ISXA 1YLEA 1ZG8A 2BO9A 2Q4VA 3GLJA 2F8HA 3BI0A 3UY5A 1QSOA 2QJ8A 4NJRA 4P10A 4MHDA 4CS0B 1I1DA 4RI1A 4OP4A 4ZX9A 4BINA 3S6FA 4XPDB 3S9MA 1S7FA 3S9LA 4LQ6A 2XEFA 5IB0A 3TCVA 2B4DB 1LAPA 4PXBA 5F09A 4QC6A 4DNCA 1M4LA 4F6AA 3GIUA 4ONWA 3FX6A 5A27A 1IB1E 4IUSA 3H5ZA 2AFXA 1LAMA 4MFZA 1ZO0A 4C2XA 4H6UA 4EFDA 4PSXA 3SXOA 4AG9A 1F2PA 2CNMA 3I3GA 3D7GA 4MJ8A 3PBEA 4OKOA 1QMUA 1X10A 1R57A 5ISVA 4PK2A 4XNHC 2BOAA 3R96A 2WZNA 5J8CA 2FCKA 4KORA 1Y0YA 4LQGA 4CAWA 4A38A 5IB9A 2G9DA 4WJBA 3B3TA 1TKHA 2Z0ZA 2ZELA 3NFZA 1CP6A 4HPSA 3W6SA 3KL9A 2IL4A 2V8HA 3B8GA 3VATA 4ZGYB 2REFA 2ZW7A 4QUSA 2R1IA 3RBUA 1QSTA 3KQXA 3TC8A 3MN8A 3TOAA 2B3UA 3CT9A 3K9TA 3MRUA 4II9A 4CPAA 1S3ZA 4F0XA 3LD2A 3D67A 2B5GA 2BL1A 2F7VA 1FNOA 1Z9UA 3L2NA 2RFHA 4ORFA 3FVLA 3G8WA 5LYLA 5LYDA 4F9UA 3GKRA 3H8EA 4UBRA 2JDCA 3F5BA 5I4MA 2XEJA 1HEEA 1Z8TA 4ZI6A 4U9ZA 1V0CA 3A9LA 3JUWA 4C7HA 3DR8A 4L8AA 3B7IA 2Z3MA 2NMTA 5G20A 3CXPA 1BAVA 2J8NA 4B5PB 5JPHA 3D2MA 2Y0MA 2PVWA 3B2YA 1S5KA 4KOYA 2Q4YA 4PXCA 1F2OA 5DWNA 3E0KA 5AG4A 1Z4RA 1FY7A 4P44A 4A30A 1CJWA 3R95A 1NSLA 5F46A 4FD7A 2Q7SA 3TTHA 1S7LA 4UIBA 4DUKA 2F5IA 1PYTB 3BI1A 3VARA 3KZWA 2B4DA 4UFWA 2OZGA 2P6EA 4A33A 3I9SA 4R76A 4YRHA 2PJ1A 1YX0A 4MI4A 4EMEA 4MFPA 8CPAA 4FUUA 4MCQA 5AGEA 2H5MA 4NGMA 3LODA 4Z65A 2YNDA 4A95A 2ABZA 1KZFA 2ZOGA 2ZEPA 2JDDA 4Y49C 4OC0A 4Q7AA 1TF9A 4MY3A 4P4FA 2VQYA 4XNHB 1TF8A 2IJZA 2GU2A 4CAXA 1CBXA 3IJ3A 4NGNA 2POKA 6CPAA 2EBJA 1BPMA 2FT0A 4OAEA 3V38A 5EBVA 1Y9WA 3EXNA 4I49A 1UFHA 4B6ZA 4E2AA 3CXQA 2ODFA 2B3VA 2PJ5A 3B3SA 4R57A 2ZW6A 2GLFA 2I00A 3KR4A 2ZEDA 4UEZA 3KQZA 5AG5A 4YFJA 1VIXA 4OLLA 4P4IA 1MK4A 3SHPA 3EFAA 3P2HA 3T9YA 2J8RA 3W91A 4CYPA 2PJ2A 4W9YA 4AG7A 2VZYA 4TWEA 4KVXA 4OIWA 1IYLA 4JLYA 3DDDA 1YVKA 5FVJA 2FVGA 4C2YA 2AFWA 3JRUA 1MJBA 2ZEEA 2O4HA 3RNZA 2WUUA 3FBUA 5D8NA 4A39A 2V77A 1AMPA 2YNCC 1XMTA 4MXUA 1NMTA 2B58A 1SQHA 3NH8A 2PJCA 4F8ZA 4NGQA 5KTAA 2GFQA 2QIRA 2VXKA 3D68A 2OR4A 4KZTA 4OIDA 2Q43A 3C26A 4P4EA 2PJBA 4KOWA 5HVFA 4UCNA 2JBKA 1IOIA 3NH5A 2AFZA 4AVAA 4G1PA 2AJ6A 4XPLA 2JEWA 4R7MA 4A37A 4BD9A 3RYOA 1XBUA 2O53A 2B4BA 3GYAA 4P45A 4TNUA 4B5OA 2FSRA 4PSWA 3WC5A 1XOVA 1H8LA 2OB0A 4P4DA 5CNPA 4BBHA 1J4JA 1VHSA 3PB9X 2RC4A 2REEA 3B35A 2YNEA 2PR1A 3IWWA 2OZUA 4QB9A 2AFOA 4M6IA 4P4BA 4E0AA 4DYOA 2HUZA 2VBQA 1YSJA 4X5KA 3IWGA 3K2KA 5C82A 4CGNA 2O28A 4Y49B 4CAEA 5JGFA 5JQ4A 4A31A 1NSAA 3W6XA 3PBBA 1XFOA 5LRGA 1CP7A 4JXRA 4YGOA 1XMBA 5A28A 2C1CA 2XEGA 4O23A 1CG2A 4OC4A 2CTCA 4YWYA 1BOBA 2C6GA 2PVVA 2V8GA 3S6GA 4B14A 1S7NA 3VWDA 1YMEA 2G0BA 4HNYB 2CTBA 5EC4A 5I0CA 4NXYA 3DR6A 4X3RA 4DJLA 3IC1A 3IO1A 3EO4A 4M6HA 1KUYA 4M6GA 4HNXB 1IYKA 1N71A 2HB6A 1Y9KA 4MFKA 1XEBA 3S6KA 4AB7A 4JJXA 2ZW5A 4NGTA 2G3TA 4U5YA 4EVYA 3SJGA 4NGSA 4BMHA 4QBJA 4MCRA 3F0AA 1JWQA 2K5TA 4PPZA 5C88A 3GY9A 1Q7LA 1GYTA 1XIXA 4HKFA 4CRYB 1CX8A 2ARHA 2PC1A 5F47A 2ATRA 3KHXA 2CF4A 3PFOA 3SI0A 1TIQA 2Q44A 4B12A 3PFEA 1IU8A 2VL1A 4PV6A 2GANA 5HMNA 2EWBA 2R7HA 2FIWA 4CGPA 2PQ8A 1BO4A 3R1KA 2Q7BA 2P0WA 3ZJ0A 3D66A 3CDXA 4UFXA 5LRJA 2FE7A 4HNWB 3PB7X 3BLNA 1RXTA 1Z4EA 4MFLA 4MHYA 4CGOA 1YREA 3QNVA 2ZEHA 1CPXA 4X2TA 3TFYA 5JM6A 4E8OA 4ZY1A 2OH1A 2HV2A 4MFJA 3D3SA 4H89A 2Q51A 1TXRA 2R98A 1RO5A 4OC5A 3R9FA 1IIDA 4NF1A 4A2ZA 3BXMA 4GXHA 2QMLA 4MY0A 2ZEMA 1Z2LA 2IQ6A 2CNSA 3PB4X 5DS0A 1VGYA 3D8PA 2WPWA 2J9AA 4B10A 5HVGA 3MGDA 2FXFA 3EY5A 5ELYA 3PRTA 3OWCA 4ZY0A 1A2ZA 4FAIA 4L89A 1TKJA 4LUAA 3H8GA 3TE4A 3T8WA 2QYVA 2RB7A 2DPSA 1KUVA 4MCSA 1YK3A 4F9VA 5IV0A 1LCPA 5DWMA 4XPDC 1ON0A 5LYFA 5HH1A 3S6HA 2Z3PA 5IX3A 3V7ZA 4PXDA 1Y0RA 2P6FA 4Q38A 2Z3LA 3FH4A 2DXQA 4MHZA 3V8IA 3WT4A 5KTCA 4KS9A 2HQYA 3ISZA 1S7KA 1YVOA 4JZ0A 4IF5A 3FXTA 2KCWA 4CYNA 1UWYA 1Z5RA 3QAHA 3NH4A 4KLWA 1AUGA 4MFQA 1OZPA 3FF3A 2WPXA 2EVNA 3IIBA 2DPTA 4LX9A 4UEEA 2I79A 3TT2A 7CPAA 3DSBA 1PUAA 1M4IA 2NYQA 5EMIA 3DGVA 3P2FA 5K8NA 4JXQA 5AG6A 4UA3A 3FJUA 1F57A 4UWIA 2ZPAA 1XJOA 2PSWA 4WWVA 3TX8A 5LRKA 2G3AA 5LYIA 3N7ZA 4GM5A 3BJ8A 2CY2A 2Z3KA 5K8MA 1P0HA 4B5PA 2GE3A 3H8FA 4IHMA 4K30A 1TKFA 2FIAA 4R87A 4KUBA 1VHEA 1OBRA 3FIXA 2B5GB 4R8FA 1XE4A 4KOSA 4MRIA 3QB8A 1XF8A
chains in the Genus database with same CATH topology
1M4GA 4A32A 4CAFA 4R3LA 2VI7A 1Q2CA 2CXAA 1PU9A 4AVCA 4R9MA 4C68A 4FD6A 3WR7A 5F49A 3TO9A 4ZBGA 2YGWA 1Q2YA 4KOTA 2QECA 1MJAA 5KTDA 5GCNA 3TO7A 5E96A 2C27A 2OZHA 4KSAA 3BJ7A 1KUXA 3VWEA 1I21A 1P4NA 3FRMA 2JLMA 5H84A 2D4PA 3TO6A 2PR8A 2ZXVA 4AVBA 4J3GA 5AG7A 1YR0A 4CYOA 3TFYA 4KVME 2JEVA 4ONUA 1B87A 3FYNA 4NEXA 3IWEA 4GS4A 2R8VA 4KLVA 4R3KA 4UWJA 4B11A 3T90A 4FD5A 3JTKA 1U6MA 1WK4A 3JVNA 3H4QA 2Z3OA 1GHEA 3PGPA 3R9GA 1K4JA 3TOBA 4C7IA 4QVTA 3SXNA 4KSFA 2GIVA 2WSAA 2Z3NA 4M3SA 2Z10A 4Q36A 2A4NA 4KVOE 3PP9A 3DNSA 1L0CA 1Q2DA 1YGHA 3NE7A 3IU2A 5G22A 2BEIA 2FL4A 2PDOA 2D4OA 2BUEA 3G3SA 5BWAB 1QSMA 1M1DA 1NE9A 2VZZA 2Z11A 3KKWA 5F48A 4KUAA 1I12A 4UFVA 4H6ZA 4M85A 1CM0A 2P6GA 4NSQA 4CAVA 1LRZA 5G1ZA 2BSWA 4XPKA 2Q0YA 1M4DA 3FNCA 4PK3A 1VKCA 1QSRA 1IICA 3K9UA 1S60A 5J8FA 5G21A 1B6BA 4U9YA 4UCMA 4KOXA 2AE6A 1QSNA 4C2ZA 3IU1A 3F8KA 2PRBA 4MBUA 1Y7RA 4JWPA 4CGMA 4KOVA 2FS5A 2CNTA 2EUIA 1MJ9A 4JD6A 4RS2A 3CXSA 3D2PA 4B13A 2YNCA 2J8MA 1M44A 5H86A 3ZZIA 4CYQA 2ZW4A 3PZJA 4CGLA 4F0YA 2OU2A 1WWZA 4KOUA 2Q04A 4UCPA 3FB3A 4OADA 4FD4A 4NCZA 3R9EA 3IGRA 4CRZB 2VEZA 3EC4A 2X7BA 1YLEA 2Q4VA 3UY5A 1QSOA 4CS0B 4MHDA 1I1DA 4RI1A 3S6FA 4XPDB 1S7FA 5IB0A 3TCVA 2B4DB 4QC6A 4DNCA 4F6AA 5A27A 1IB1E 4IUSA 3H5ZA 4MFZA 1ZO0A 4C2XA 4H6UA 4PSXA 3SXOA 4AG9A 2CNMA 3I3GA 4MJ8A 5ISVA 1R57A 4PK2A 4XNHC 3R96A 5J8CA 2FCKA 4KORA 4CAWA 2Z0ZA 3W6SA 2IL4A 3B8GA 4ZGYB 2REFA 2ZW7A 4QUSA 2R1IA 1QSTA 3TOAA 2B3UA 4II9A 4F0XA 1S3ZA 3LD2A 2B5GA 2BL1A 1Z9UA 4ORFA 3G8WA 3GKRA 4UBRA 2JDCA 3F5BA 4U9ZA 1V0CA 3A9LA 3JUWA 4C7HA 3DR8A 4L8AA 2Z3MA 2NMTA 5G20A 3CXPA 2J8NA 4B5PB 5JPHA 3D2MA 2Y0MA 1S5KA 4KOYA 2Q4YA 5DWNA 5AG4A 3E0KA 1Z4RA 1FY7A 4A30A 1CJWA 3R95A 1NSLA 5F46A 4FD7A 3TTHA 1S7LA 2F5IA 2B4DA 4UFWA 2OZGA 2P6EA 4A33A 3I9SA 4YRHA 1YX0A 4MI4A 4MFPA 5AGEA 2H5MA 3LODA 2YNDA 4A95A 1KZFA 2JDDA 4Y49C 4MY3A 2VQYA 4XNHB 4CAXA 2FT0A 4OAEA 5EBVA 1Y9WA 3EXNA 4I49A 1UFHA 4E2AA 3CXQA 2B3VA 4R57A 2ZW6A 4YFJA 2I00A 5AG5A 4OLLA 1MK4A 3SHPA 3EFAA 3P2HA 3T9YA 2J8RA 3W91A 4CYPA 4AG7A 2VZYA 4KVXA 1IYLA 4JLYA 3DDDA 1YVKA 5FVJA 4C2YA 1MJBA 2WUUA 3FBUA 2YNCC 1XMTA 1NMTA 2B58A 1SQHA 5KTAA 2QIRA 2VXKA 4KZTA 3C26A 4KOWA 4UCNA 4AVAA 2AJ6A 4XPLA 3RYOA 3GYAA 2B4BA 4B5OA 2FSRA 4PSWA 2OB0A 5CNPA 4BBHA 1J4JA 1VHSA 2RC4A 2REEA 2YNEA 2PR1A 2OZUA 4QB9A 4E0AA 2HUZA 2VBQA 4X5KA 3IWGA 5C82A 4CGNA 2O28A 4Y49B 4CAEA 5JQ4A 4A31A 3W6XA 4JXRA 4YGOA 5A28A 1BOBA 3S6GA 4B14A 1S7NA 3VWDA 2G0BA 4HNYB 5EC4A 5I0CA 4NXYA 3DR6A 3EO4A 1KUYA 4HNXB 1IYKA 1N71A 4MFKA 1Y9KA 1XEBA 3S6KA 4AB7A 4JJXA 2ZW5A 2G3TA 4U5YA 4EVYA 4BMHA 4QBJA 3F0AA 2K5TA 5C88A 3GY9A 1XIXA 4HKFA 4CRYB 2ARHA 2PC1A 5F47A 2ATRA 1TIQA 2Q44A 4B12A 4PV6A 2GANA 5HMNA 2R7HA 4CGPA 2FIWA 2PQ8A 1BO4A 3R1KA 2Q7BA 2P0WA 3ZJ0A 4UFXA 2FE7A 4HNWB 3BLNA 1RXTA 1Z4EA 4MFLA 4CGOA 1YREA 4E8OA 2OH1A 2HV2A 4MFJA 3D3SA 4H89A 2R98A 1RO5A 3R9FA 1IIDA 4NF1A 4A2ZA 2QMLA 4MY0A 2CNSA 3D8PA 2WPWA 4B10A 3MGDA 2FXFA 3EY5A 3OWCA 4L89A 4LUAA 3TE4A 2DPSA 1KUVA 1YK3A 5IV0A 5DWMA 4XPDC 1ON0A 5HH1A 3S6HA 2Z3PA 5IX3A 2P6FA 4Q38A 2Z3LA 2DXQA 3V8IA 5KTCA 4KS9A 2HQYA 1S7KA 1YVOA 4IF5A 3FXTA 2KCWA 4CYNA 3QAHA 4KLWA 4MFQA 1OZPA 2WPXA 2EVNA 4LX9A 2DPTA 2I79A 3TT2A 3DSBA 1PUAA 1M4IA 3P2FA 4JXQA 5AG6A 4UA3A 4UWIA 2ZPAA 2PSWA 2G3AA 3N7ZA 3BJ8A 2CY2A 2Z3KA 1P0HA 4B5PA 2GE3A 4K30A 2FIAA 4R87A 4KUBA 3FIXA 2B5GB 1XE4A 4KOSA 3QB8A 1XF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4G A;  4R3L A;  2VI7 A;  1Q2C A;  1PU9 A;  4AVC A;  4R9M A;  4FD6 A;  3WR7 A;  5F49 A;  3TO9 A;  4ZBG A;  1Q2Y A;  4KOT A;  2QEC A;  1MJA A;  5KTD A;  5GCN A;  3TO7 A;  5E96 A;  2C27 A;  2OZH A;  3BJ7 A;  1KUX A;  3VWE A;  1I21 A;  1P4N A;  3FRM A;  2JLM A;  5H84 A;  2D4P A;  3TO6 A;  2PR8 A;  2ZXV A;  4AVB A;  4J3G A;  3TFY A;  1YR0 A;  4KVM E;  2JEV A;  4ONU A;  1B87 A;  3FYN A;  4NEX A;  4GS4 A;  2R8V A;  4KLV A;  4R3K A;  4UWJ A;  3T90 A;  4FD5 A;  1U6M A;  1WK4 A;  3JVN A;  3H4Q A;  1GHE A;  3PGP A;  3R9G A;  1K4J A;  3TOB A;  4QVT A;  3SXN A;  2GIV A;  4M3S A;  2Z10 A;  2A4N A;  4KVO E;  3PP9 A;  3DNS A;  1L0C A;  1Q2D A;  1YGH A;  3NE7 A;  2BEI A;  2FL4 A;  2PDO A;  2D4O A;  2BUE A;  3G3S A;  1QSM A;  1M1D A;  1NE9 A;  2VZZ A;  2Z11 A;  3KKW A;  5F48 A;  4KUA A;  1I12 A;  4H6Z A;  4M85 A;  1CM0 A;  2P6G A;  4NSQ A;  4CAV A;  1LRZ A;  2BSW A;  4XPK A;  2Q0Y A;  1M4D A;  3FNC A;  4PK3 A;  1VKC A;  1QSR A;  1IIC A;  3K9U A;  1S60 A;  5J8F A;  1B6B A;  4U9Y A;  4KOX A;  2AE6 A;  1QSN A;  3F8K A;  2PRB A;  4MBU A;  1Y7R A;  4JWP A;  4KOV A;  2FS5 A;  2CNT A;  2EUI A;  1MJ9 A;  4JD6 A;  4RS2 A;  3CXS A;  3D2P A;  2J8M A;  1M44 A;  5H86 A;  3ZZI A;  2ZW4 A;  3PZJ A;  4F0Y A;  2OU2 A;  1WWZ A;  4KOU A;  2Q04 A;  3FB3 A;  4OAD A;  4FD4 A;  4NCZ A;  3R9E A;  3IGR A;  4CRZ B;  2VEZ A;  3EC4 A;  2X7B A;  1YLE A;  2Q4V A;  3UY5 A;  1QSO A;  4CS0 B;  4MHD A;  1I1D A;  4RI1 A;  3S6F A;  4XPD B;  1S7F A;  5IB0 A;  3TCV A;  2B4D B;  4QC6 A;  4DNC A;  4F6A A;  1IB1 E;  4IUS A;  4H6U A;  4PSX A;  3SXO A;  4AG9 A;  2CNM A;  3I3G A;  4MJ8 A;  5ISV A;  1R57 A;  4PK2 A;  4XNH C;  3R96 A;  5J8C A;  2FCK A;  4KOR A;  4CAW A;  2Z0Z A;  3W6S A;  2IL4 A;  3B8G A;  2REF A;  2ZW7 A;  4QUS A;  2R1I A;  1QST A;  3TOA A;  2B3U A;  4II9 A;  1S3Z A;  3LD2 A;  2B5G A;  2BL1 A;  1Z9U A;  4ORF A;  3G8W A;  3GKR A;  4UBR A;  2JDC A;  3F5B A;  4U9Z A;  1V0C A;  3JUW A;  3DR8 A;  4L8A A;  2NMT A;  3CXP A;  2J8N A;  4B5P B;  5JPH A;  3D2M A;  2Y0M A;  1S5K A;  4KOY A;  2Q4Y A;  5DWN A;  3E0K A;  1Z4R A;  1FY7 A;  1CJW A;  3R95 A;  1NSL A;  5F46 A;  4FD7 A;  3TTH A;  1S7L A;  2F5I A;  2B4D A;  2OZG A;  2P6E A;  3I9S A;  4YRH A;  1YX0 A;  4MI4 A;  2H5M A;  3LOD A;  1KZF A;  2JDD A;  4Y49 C;  4MY3 A;  2VQY A;  4XNH B;  4CAX A;  2FT0 A;  4OAE A;  5EBV A;  1Y9W A;  3EXN A;  4I49 A;  1UFH A;  4E2A A;  3CXQ A;  2B3V A;  4R57 A;  2ZW6 A;  4YFJ A;  2I00 A;  4OLL A;  1MK4 A;  3SHP A;  3EFA A;  3P2H A;  3T9Y A;  2J8R A;  3W91 A;  4AG7 A;  2VZY A;  4KVX A;  1IYL A;  4JLY A;  3DDD A;  1YVK A;  5FVJ A;  1MJB A;  3FBU A;  1XMT A;  1NMT A;  2B58 A;  1SQH A;  5KTA A;  2QIR A;  2VXK A;  4KZT A;  3C26 A;  4KOW A;  4AVA A;  2AJ6 A;  4XPL A;  3RYO A;  2B4B A;  3GYA A;  4B5O A;  2FSR A;  4PSW A;  2OB0 A;  5CNP A;  1J4J A;  1VHS A;  2RC4 A;  2REE A;  2PR1 A;  2OZU A;  4QB9 A;  4E0A A;  2HUZ A;  2VBQ A;  4X5K A;  3IWG A;  5C82 A;  2O28 A;  4Y49 B;  5JQ4 A;  3W6X A;  4JXR A;  4YGO A;  1BOB A;  3S6G A;  1S7N A;  3VWD A;  2G0B A;  4HNY B;  5EC4 A;  5I0C A;  4NXY A;  3DR6 A;  3EO4 A;  1KUY A;  4HNX B;  1IYK A;  1N71 A;  1Y9K A;  1XEB A;  3S6K A;  4AB7 A;  4JJX A;  2ZW5 A;  2G3T A;  4U5Y A;  4EVY A;  4BMH A;  4QBJ A;  3F0A A;  2K5T A;  5C88 A;  3GY9 A;  1XIX A;  4HKF A;  4CRY B;  2ARH A;  2PC1 A;  5F47 A;  2ATR A;  1TIQ A;  2Q44 A;  4PV6 A;  2GAN A;  5HMN A;  2R7H A;  2FIW A;  2PQ8 A;  1BO4 A;  3R1K A;  2Q7B A;  2P0W A;  3ZJ0 A;  2FE7 A;  4HNW B;  3BLN A;  1RXT A;  1Z4E A;  1YRE A;  4E8O A;  2OH1 A;  2HV2 A;  3D3S A;  4H89 A;  2R98 A;  1RO5 A;  3R9F A;  1IID A;  4NF1 A;  2QML A;  4MY0 A;  2CNS A;  3D8P A;  2WPW A;  3MGD A;  2FXF A;  3EY5 A;  3OWC A;  4L89 A;  4LUA A;  3TE4 A;  1KUV A;  1YK3 A;  5IV0 A;  5DWM A;  4XPD C;  1ON0 A;  5HH1 A;  3S6H A;  5IX3 A;  2P6F A;  2DXQ A;  3V8I A;  5KTC A;  2HQY A;  1S7K A;  1YVO A;  4IF5 A;  3FXT A;  2KCW A;  3QAH A;  4KLW A;  1OZP A;  2WPX A;  2EVN A;  4LX9 A;  2I79 A;  3TT2 A;  3DSB A;  1PUA A;  1M4I A;  3P2F A;  4JXQ A;  4UA3 A;  4UWI A;  2ZPA A;  2PSW A;  2G3A A;  3N7Z A;  3BJ8 A;  2CY2 A;  1P0H A;  4B5P A;  2GE3 A;  4K30 A;  2FIA A;  4R87 A;  4KUB A;  3FIX A;  2B5G B;  1XE4 A;  4KOS A;  3QB8 A;  1XF8 A; 
#chains in the Genus database with same CATH topology
 1PCA A;  1M4G A;  4A32 A;  4AXV A;  1EE3 P;  3KR5 A;  4OC1 A;  4CAF A;  2Q4Z A;  4R3L A;  2VI7 A;  1BLL E;  4MHN A;  1Q2C A;  2CXA A;  5K8P A;  1XRY A;  1PU9 A;  4AVC A;  1LOK A;  4R9M A;  4C68 A;  4FD6 A;  4NGR A;  4YU9 A;  3RAM A;  3WR7 A;  5F49 A;  3TO9 A;  3CZX A;  3WC7 A;  4P4J A;  4ZBG A;  2PJ4 A;  4H2K A;  4OME A;  2YGW A;  2BCO A;  1Q2Y A;  4KOT A;  2PIZ A;  2AFM A;  2QEC A;  3SI1 A;  2GRE A;  1MJA A;  5KTD A;  5GCN A;  3SJX A;  3KAS A;  2EK9 A;  3TO7 A;  3SI2 A;  5E96 A;  1DE4 C;  2C27 A;  2OZH A;  4KSA A;  2PJ7 A;  2XEI A;  1HDU A;  4X8I A;  3BJ7 A;  1QQ9 A;  4ZYQ A;  1KUX A;  3VWE A;  1I21 A;  1P4N A;  4EWT A;  3FRM A;  2JLM A;  1LAN A;  2D4P A;  5H84 A;  3RO0 A;  4FWU A;  3TO6 A;  2PR8 A;  2ZXV A;  2EO8 A;  4J3G A;  5AG7 A;  1YR0 A;  4AVB A;  2ZEN A;  4CYO A;  4KVM E;  1R3N A;  2AFU A;  2PJ3 A;  2ANP A;  2JEV A;  2PRQ A;  2V8D A;  3CPA A;  3LWU A;  4ONU A;  5CPA A;  4UF4 A;  1B87 A;  3FYN A;  4NEX A;  3IWE A;  4GS4 A;  2I3C A;  2R8V A;  4KLV A;  4R3K A;  3KI9 A;  1IOF A;  4UWJ A;  4K3N A;  4P6Y A;  3IEH A;  4B11 A;  2WYR A;  3QAY A;  3T90 A;  3HUV A;  4FD5 A;  1ARM A;  3JTK A;  1U6M A;  1Z8W A;  1WK4 A;  3JVN A;  4R6T A;  3S9N A;  3H4Q A;  2Z3O A;  2V8V A;  1LFW A;  1GHE A;  3B3C A;  3FMC A;  3PGP A;  4OC2 A;  2PJ0 A;  1K4J A;  2DF5 A;  3FEE A;  3R9G A;  3TOB A;  2ZEG A;  4C7I A;  4QVT A;  3SXN A;  4KSF A;  3HLP A;  2GIV A;  2WSA A;  3B3W A;  2Z3N A;  3PB6 X;  1AYE A;  5THW A;  3D4U A;  1RTQ A;  3B3V A;  3DLJ A;  4M3S A;  2Z10 A;  3LMS A;  2A4N A;  4Q36 A;  4ZY2 A;  1ZG7 A;  3D7F A;  3PP9 A;  3DNS A;  4KVO E;  4PQA A;  3SJE A;  1L0C A;  1ZLI A;  1ARL A;  1Q2D A;  2JBJ A;  1YGH A;  3IU2 A;  3NE7 A;  1Z8X A;  2C6P A;  5G22 A;  2BEI A;  2FL4 A;  2PDO A;  2CIJ A;  4OC3 A;  4NFR A;  3NA6 A;  2D4O A;  2BUE A;  3G3S A;  3D7H A;  1YW4 A;  5BWA B;  1M1D A;  1BPN A;  1NE9 A;  1QSM A;  4IAV A;  4A94 A;  2C6C A;  2VZZ A;  2PJ8 A;  1Z8L A;  2Z11 A;  3KKW A;  4NJQ A;  4KUA A;  5F48 A;  2ZOF A;  3CPX A;  1I12 A;  4UFV A;  2IMO A;  3D7D A;  2AFS A;  4H6Z A;  4M85 A;  1CM0 A;  2P6G A;  4NSQ A;  3RZA A;  4CAV A;  1DTD A;  3IFE A;  1LRZ A;  4IK2 A;  5G1Z A;  2BSW A;  4FBE A;  5CBM A;  4XPK A;  2Q0Y A;  1M4D A;  4NGP A;  3FNC A;  4PK3 A;  2GLJ A;  2PIY A;  1VKC A;  3WAB A;  4JYW A;  1QSR A;  1R43 A;  5J1Q A;  1IIC A;  3K9U A;  1S60 A;  5J8F A;  5JH9 A;  5G21 A;  1B6B A;  4U9Y A;  4UCM A;  5K8O A;  2PJ6 A;  4MMO A;  2ZEF A;  4KOX A;  2OOT A;  2AE6 A;  1QSN A;  1ELL P;  3FED A;  3GUX A;  3PEI A;  1ZG9 A;  4C2Z A;  3IU1 A;  3F8K A;  2PRB A;  1IY7 A;  4KSI A;  1Y7R A;  3NE8 A;  3PB8 X;  4MBU A;  4JWP A;  4PXE A;  4CGM A;  3KGQ A;  4KOV A;  2FS5 A;  1IGB A;  2CNT A;  2EUI A;  3VH9 A;  1MJ9 A;  4JD6 A;  1ELM P;  4RS2 A;  3CXS A;  3D2P A;  1CPS A;  4B13 A;  2YNC A;  2J8M A;  3BHX A;  1HDQ A;  2PJA A;  1VHO A;  4RN7 A;  5HVH A;  1M44 A;  1YQE A;  3WC6 A;  2DEA A;  5H86 A;  3FEC A;  1X12 A;  3ZZI A;  4MHP A;  2PE3 A;  1YLO A;  4CYQ A;  2ZW4 A;  3PZJ A;  5D29 A;  3KHZ A;  2PJ9 A;  3GB0 A;  4CGL A;  4F0Y A;  4MCP A;  4RUH A;  1Y7E A;  2OU2 A;  3SJF A;  5HXD A;  1ZLH A;  3I1U A;  3LAC A;  1WWZ A;  1KWM A;  4UIA A;  3N5F A;  2NSM A;  4KOU A;  2Q04 A;  1FT7 A;  2ZEO A;  2HC9 A;  4UCP A;  2QVP A;  4UEF A;  3FB3 A;  4OAD A;  4FD4 A;  1YW6 A;  2PCU A;  4NCZ A;  3R9E A;  3IGR A;  4CRZ B;  2VEZ A;  2EK8 A;  3EC4 A;  1JQG A;  2X7B A;  4ZX8 A;  3ISX A;  1YLE A;  1ZG8 A;  2BO9 A;  2Q4V A;  3GLJ A;  2F8H A;  3BI0 A;  3UY5 A;  1QSO A;  2QJ8 A;  4NJR A;  4P10 A;  4MHD A;  4CS0 B;  1I1D A;  4RI1 A;  4OP4 A;  4ZX9 A;  4BIN A;  3S6F A;  4XPD B;  3S9M A;  1S7F A;  3S9L A;  4LQ6 A;  2XEF A;  5IB0 A;  3TCV A;  2B4D B;  1LAP A;  4PXB A;  5F09 A;  4QC6 A;  4DNC A;  1M4L A;  4F6A A;  3GIU A;  4ONW A;  3FX6 A;  5A27 A;  1IB1 E;  4IUS A;  3H5Z A;  2AFX A;  1LAM A;  4MFZ A;  1ZO0 A;  4C2X A;  4H6U A;  4EFD A;  4PSX A;  3SXO A;  4AG9 A;  1F2P A;  2CNM A;  3I3G A;  3D7G A;  4MJ8 A;  3PBE A;  4OKO A;  1QMU A;  1X10 A;  1R57 A;  5ISV A;  4PK2 A;  4XNH C;  2BOA A;  3R96 A;  2WZN A;  5J8C A;  2FCK A;  4KOR A;  1Y0Y A;  4LQG A;  4CAW A;  4A38 A;  5IB9 A;  2G9D A;  4WJB A;  3B3T A;  1TKH A;  2Z0Z A;  2ZEL A;  3NFZ A;  1CP6 A;  4HPS A;  3W6S A;  3KL9 A;  2IL4 A;  2V8H A;  3B8G A;  3VAT A;  4ZGY B;  2REF A;  2ZW7 A;  4QUS A;  2R1I A;  3RBU A;  1QST A;  3KQX A;  3TC8 A;  3MN8 A;  3TOA A;  2B3U A;  3CT9 A;  3K9T A;  3MRU A;  4II9 A;  4CPA A;  1S3Z A;  4F0X A;  3LD2 A;  3D67 A;  2B5G A;  2BL1 A;  2F7V A;  1FNO A;  1Z9U A;  3L2N A;  2RFH A;  4ORF A;  3FVL A;  3G8W A;  5LYL A;  5LYD A;  4F9U A;  3GKR A;  3H8E A;  4UBR A;  2JDC A;  3F5B A;  5I4M A;  2XEJ A;  1HEE A;  1Z8T A;  4ZI6 A;  4U9Z A;  1V0C A;  3A9L A;  3JUW A;  4C7H A;  3DR8 A;  4L8A A;  3B7I A;  2Z3M A;  2NMT A;  5G20 A;  3CXP A;  1BAV A;  2J8N A;  4B5P B;  5JPH A;  3D2M A;  2Y0M A;  2PVW A;  3B2Y A;  1S5K A;  4KOY A;  2Q4Y A;  4PXC A;  1F2O A;  5DWN A;  3E0K A;  5AG4 A;  1Z4R A;  1FY7 A;  4P44 A;  4A30 A;  1CJW A;  3R95 A;  1NSL A;  5F46 A;  4FD7 A;  2Q7S A;  3TTH A;  1S7L A;  4UIB A;  4DUK A;  2F5I A;  1PYT B;  3BI1 A;  3VAR A;  3KZW A;  2B4D A;  4UFW A;  2OZG A;  2P6E A;  4A33 A;  3I9S A;  4R76 A;  4YRH A;  2PJ1 A;  1YX0 A;  4MI4 A;  4EME A;  4MFP A;  8CPA A;  4FUU A;  4MCQ A;  5AGE A;  2H5M A;  4NGM A;  3LOD A;  4Z65 A;  2YND A;  4A95 A;  2ABZ A;  1KZF A;  2ZOG A;  2ZEP A;  2JDD A;  4Y49 C;  4OC0 A;  4Q7A A;  1TF9 A;  4MY3 A;  4P4F A;  2VQY A;  4XNH B;  1TF8 A;  2IJZ A;  2GU2 A;  4CAX A;  1CBX A;  3IJ3 A;  4NGN A;  2POK A;  6CPA A;  2EBJ A;  1BPM A;  2FT0 A;  4OAE A;  3V38 A;  5EBV A;  1Y9W A;  3EXN A;  4I49 A;  1UFH A;  4B6Z A;  4E2A A;  3CXQ A;  2ODF A;  2B3V A;  2PJ5 A;  3B3S A;  4R57 A;  2ZW6 A;  2GLF A;  2I00 A;  3KR4 A;  2ZED A;  4UEZ A;  3KQZ A;  5AG5 A;  4YFJ A;  1VIX A;  4OLL A;  4P4I A;  1MK4 A;  3SHP A;  3EFA A;  3P2H A;  3T9Y A;  2J8R A;  3W91 A;  4CYP A;  2PJ2 A;  4W9Y A;  4AG7 A;  2VZY A;  4TWE A;  4KVX A;  4OIW A;  1IYL A;  4JLY A;  3DDD A;  1YVK A;  5FVJ A;  2FVG A;  4C2Y A;  2AFW A;  3JRU A;  1MJB A;  2ZEE A;  2O4H A;  3RNZ A;  2WUU A;  3FBU A;  5D8N A;  4A39 A;  2V77 A;  1AMP A;  2YNC C;  1XMT A;  4MXU A;  1NMT A;  2B58 A;  1SQH A;  3NH8 A;  2PJC A;  4F8Z A;  4NGQ A;  5KTA A;  2GFQ A;  2QIR A;  2VXK A;  3D68 A;  2OR4 A;  4KZT A;  4OID A;  2Q43 A;  3C26 A;  4P4E A;  2PJB A;  4KOW A;  5HVF A;  4UCN A;  2JBK A;  1IOI A;  3NH5 A;  2AFZ A;  4AVA A;  4G1P A;  2AJ6 A;  4XPL A;  2JEW A;  4R7M A;  4A37 A;  4BD9 A;  3RYO A;  1XBU A;  2O53 A;  2B4B A;  3GYA A;  4P45 A;  4TNU A;  4B5O A;  2FSR A;  4PSW A;  3WC5 A;  1XOV A;  1H8L A;  2OB0 A;  4P4D A;  5CNP A;  4BBH A;  1J4J A;  1VHS A;  3PB9 X;  2RC4 A;  2REE A;  3B35 A;  2YNE A;  2PR1 A;  3IWW A;  2OZU A;  4QB9 A;  2AFO A;  4M6I A;  4P4B A;  4E0A A;  4DYO A;  2HUZ A;  2VBQ A;  1YSJ A;  4X5K A;  3IWG A;  3K2K A;  5C82 A;  4CGN A;  2O28 A;  4Y49 B;  4CAE A;  5JGF A;  5JQ4 A;  4A31 A;  1NSA A;  3W6X A;  3PBB A;  1XFO A;  5LRG A;  1CP7 A;  4JXR A;  4YGO A;  1XMB A;  5A28 A;  2C1C A;  2XEG A;  4O23 A;  1CG2 A;  4OC4 A;  2CTC A;  4YWY A;  1BOB A;  2C6G A;  2PVV A;  2V8G A;  3S6G A;  4B14 A;  1S7N A;  3VWD A;  1YME A;  2G0B A;  4HNY B;  2CTB A;  5EC4 A;  5I0C A;  4NXY A;  3DR6 A;  4X3R A;  4DJL A;  3IC1 A;  3IO1 A;  3EO4 A;  4M6H A;  1KUY A;  4M6G A;  4HNX B;  1IYK A;  1N71 A;  2HB6 A;  1Y9K A;  4MFK A;  1XEB A;  3S6K A;  4AB7 A;  4JJX A;  2ZW5 A;  4NGT A;  2G3T A;  4U5Y A;  4EVY A;  3SJG A;  4NGS A;  4BMH A;  4QBJ A;  4MCR A;  3F0A A;  1JWQ A;  2K5T A;  4PPZ A;  5C88 A;  3GY9 A;  1Q7L A;  1GYT A;  1XIX A;  4HKF A;  4CRY B;  1CX8 A;  2ARH A;  2PC1 A;  5F47 A;  2ATR A;  3KHX A;  2CF4 A;  3PFO A;  3SI0 A;  1TIQ A;  2Q44 A;  4B12 A;  3PFE A;  1IU8 A;  2VL1 A;  4PV6 A;  2GAN A;  5HMN A;  2EWB A;  2R7H A;  2FIW A;  4CGP A;  2PQ8 A;  1BO4 A;  3R1K A;  2Q7B A;  2P0W A;  3ZJ0 A;  3D66 A;  3CDX A;  4UFX A;  5LRJ A;  2FE7 A;  4HNW B;  3PB7 X;  3BLN A;  1RXT A;  1Z4E A;  4MFL A;  4MHY A;  4CGO A;  1YRE A;  3QNV A;  2ZEH A;  1CPX A;  4X2T A;  3TFY A;  5JM6 A;  4E8O A;  4ZY1 A;  2OH1 A;  2HV2 A;  4MFJ A;  3D3S A;  4H89 A;  2Q51 A;  1TXR A;  2R98 A;  1RO5 A;  4OC5 A;  3R9F A;  1IID A;  4NF1 A;  4A2Z A;  3BXM A;  4GXH A;  2QML A;  4MY0 A;  2ZEM A;  1Z2L A;  2IQ6 A;  2CNS A;  3PB4 X;  5DS0 A;  1VGY A;  3D8P A;  2WPW A;  2J9A A;  4B10 A;  5HVG A;  3MGD A;  2FXF A;  3EY5 A;  5ELY A;  3PRT A;  3OWC A;  4ZY0 A;  1A2Z A;  4FAI A;  4L89 A;  1TKJ A;  4LUA A;  3H8G A;  3TE4 A;  3T8W A;  2QYV A;  2RB7 A;  2DPS A;  1KUV A;  4MCS A;  1YK3 A;  4F9V A;  5IV0 A;  1LCP A;  5DWM A;  4XPD C;  1ON0 A;  5LYF A;  5HH1 A;  3S6H A;  2Z3P A;  5IX3 A;  3V7Z A;  4PXD A;  1Y0R A;  2P6F A;  4Q38 A;  2Z3L A;  3FH4 A;  2DXQ A;  4MHZ A;  3V8I A;  3WT4 A;  5KTC A;  4KS9 A;  2HQY A;  3ISZ A;  1S7K A;  1YVO A;  4JZ0 A;  4IF5 A;  3FXT A;  2KCW A;  4CYN A;  1UWY A;  1Z5R A;  3QAH A;  3NH4 A;  4KLW A;  1AUG A;  4MFQ A;  1OZP A;  3FF3 A;  2WPX A;  2EVN A;  3IIB A;  2DPT A;  4LX9 A;  4UEE A;  2I79 A;  3TT2 A;  7CPA A;  3DSB A;  1PUA A;  1M4I A;  2NYQ A;  5EMI A;  3DGV A;  3P2F A;  5K8N A;  4JXQ A;  5AG6 A;  4UA3 A;  3FJU A;  1F57 A;  4UWI A;  2ZPA A;  1XJO A;  2PSW A;  4WWV A;  3TX8 A;  5LRK A;  2G3A A;  5LYI A;  3N7Z A;  4GM5 A;  3BJ8 A;  2CY2 A;  2Z3K A;  5K8M A;  1P0H A;  4B5P A;  2GE3 A;  3H8F A;  4IHM A;  4K30 A;  1TKF A;  2FIA A;  4R87 A;  4KUB A;  1VHE A;  1OBR A;  3FIX A;  2B5G B;  4R8F A;  1XE4 A;  4KOS A;  4MRI A;  3QB8 A;  1XF8 A; 
#chains in the Genus database with same CATH homology
 1M4G A;  4A32 A;  4CAF A;  4R3L A;  2VI7 A;  1Q2C A;  2CXA A;  1PU9 A;  4AVC A;  4R9M A;  4C68 A;  4FD6 A;  3WR7 A;  5F49 A;  3TO9 A;  4ZBG A;  2YGW A;  1Q2Y A;  4KOT A;  2QEC A;  1MJA A;  5KTD A;  5GCN A;  3TO7 A;  5E96 A;  2C27 A;  2OZH A;  4KSA A;  3BJ7 A;  1KUX A;  3VWE A;  1I21 A;  1P4N A;  3FRM A;  2JLM A;  5H84 A;  2D4P A;  3TO6 A;  2PR8 A;  2ZXV A;  4AVB A;  4J3G A;  5AG7 A;  1YR0 A;  4CYO A;  3TFY A;  4KVM E;  2JEV A;  4ONU A;  1B87 A;  3FYN A;  4NEX A;  3IWE A;  4GS4 A;  2R8V A;  4KLV A;  4R3K A;  4UWJ A;  4B11 A;  3T90 A;  4FD5 A;  3JTK A;  1U6M A;  1WK4 A;  3JVN A;  3H4Q A;  2Z3O A;  1GHE A;  3PGP A;  3R9G A;  1K4J A;  3TOB A;  4C7I A;  4QVT A;  3SXN A;  4KSF A;  2GIV A;  2WSA A;  2Z3N A;  4M3S A;  2Z10 A;  4Q36 A;  2A4N A;  4KVO E;  3PP9 A;  3DNS A;  1L0C A;  1Q2D A;  1YGH A;  3NE7 A;  3IU2 A;  5G22 A;  2BEI A;  2FL4 A;  2PDO A;  2D4O A;  2BUE A;  3G3S A;  5BWA B;  1QSM A;  1M1D A;  1NE9 A;  2VZZ A;  2Z11 A;  3KKW A;  5F48 A;  4KUA A;  1I12 A;  4UFV A;  4H6Z A;  4M85 A;  1CM0 A;  2P6G A;  4NSQ A;  4CAV A;  1LRZ A;  5G1Z A;  2BSW A;  4XPK A;  2Q0Y A;  1M4D A;  3FNC A;  4PK3 A;  1VKC A;  1QSR A;  1IIC A;  3K9U A;  1S60 A;  5J8F A;  5G21 A;  1B6B A;  4U9Y A;  4UCM A;  4KOX A;  2AE6 A;  1QSN A;  4C2Z A;  3IU1 A;  3F8K A;  2PRB A;  4MBU A;  1Y7R A;  4JWP A;  4CGM A;  4KOV A;  2FS5 A;  2CNT A;  2EUI A;  1MJ9 A;  4JD6 A;  4RS2 A;  3CXS A;  3D2P A;  4B13 A;  2YNC A;  2J8M A;  1M44 A;  5H86 A;  3ZZI A;  4CYQ A;  2ZW4 A;  3PZJ A;  4CGL A;  4F0Y A;  2OU2 A;  1WWZ A;  4KOU A;  2Q04 A;  4UCP A;  3FB3 A;  4OAD A;  4FD4 A;  4NCZ A;  3R9E A;  3IGR A;  4CRZ B;  2VEZ A;  3EC4 A;  2X7B A;  1YLE A;  2Q4V A;  3UY5 A;  1QSO A;  4CS0 B;  4MHD A;  1I1D A;  4RI1 A;  3S6F A;  4XPD B;  1S7F A;  5IB0 A;  3TCV A;  2B4D B;  4QC6 A;  4DNC A;  4F6A A;  5A27 A;  1IB1 E;  4IUS A;  3H5Z A;  4MFZ A;  1ZO0 A;  4C2X A;  4H6U A;  4PSX A;  3SXO A;  4AG9 A;  2CNM A;  3I3G A;  4MJ8 A;  5ISV A;  1R57 A;  4PK2 A;  4XNH C;  3R96 A;  5J8C A;  2FCK A;  4KOR A;  4CAW A;  2Z0Z A;  3W6S A;  2IL4 A;  3B8G A;  4ZGY B;  2REF A;  2ZW7 A;  4QUS A;  2R1I A;  1QST A;  3TOA A;  2B3U A;  4II9 A;  4F0X A;  1S3Z A;  3LD2 A;  2B5G A;  2BL1 A;  1Z9U A;  4ORF A;  3G8W A;  3GKR A;  4UBR A;  2JDC A;  3F5B A;  4U9Z A;  1V0C A;  3A9L A;  3JUW A;  4C7H A;  3DR8 A;  4L8A A;  2Z3M A;  2NMT A;  5G20 A;  3CXP A;  2J8N A;  4B5P B;  5JPH A;  3D2M A;  2Y0M A;  1S5K A;  4KOY A;  2Q4Y A;  5DWN A;  5AG4 A;  3E0K A;  1Z4R A;  1FY7 A;  4A30 A;  1CJW A;  3R95 A;  1NSL A;  5F46 A;  4FD7 A;  3TTH A;  1S7L A;  2F5I A;  2B4D A;  4UFW A;  2OZG A;  2P6E A;  4A33 A;  3I9S A;  4YRH A;  1YX0 A;  4MI4 A;  4MFP A;  5AGE A;  2H5M A;  3LOD A;  2YND A;  4A95 A;  1KZF A;  2JDD A;  4Y49 C;  4MY3 A;  2VQY A;  4XNH B;  4CAX A;  2FT0 A;  4OAE A;  5EBV A;  1Y9W A;  3EXN A;  4I49 A;  1UFH A;  4E2A A;  3CXQ A;  2B3V A;  4R57 A;  2ZW6 A;  4YFJ A;  2I00 A;  5AG5 A;  4OLL A;  1MK4 A;  3SHP A;  3EFA A;  3P2H A;  3T9Y A;  2J8R A;  3W91 A;  4CYP A;  4AG7 A;  2VZY A;  4KVX A;  1IYL A;  4JLY A;  3DDD A;  1YVK A;  5FVJ A;  4C2Y A;  1MJB A;  2WUU A;  3FBU A;  2YNC C;  1XMT A;  1NMT A;  2B58 A;  1SQH A;  5KTA A;  2QIR A;  2VXK A;  4KZT A;  3C26 A;  4KOW A;  4UCN A;  4AVA A;  2AJ6 A;  4XPL A;  3RYO A;  3GYA A;  2B4B A;  4B5O A;  2FSR A;  4PSW A;  2OB0 A;  5CNP A;  4BBH A;  1J4J A;  1VHS A;  2RC4 A;  2REE A;  2YNE A;  2PR1 A;  2OZU A;  4QB9 A;  4E0A A;  2HUZ A;  2VBQ A;  4X5K A;  3IWG A;  5C82 A;  4CGN A;  2O28 A;  4Y49 B;  4CAE A;  5JQ4 A;  4A31 A;  3W6X A;  4JXR A;  4YGO A;  5A28 A;  1BOB A;  3S6G A;  4B14 A;  1S7N A;  3VWD A;  2G0B A;  4HNY B;  5EC4 A;  5I0C A;  4NXY A;  3DR6 A;  3EO4 A;  1KUY A;  4HNX B;  1IYK A;  1N71 A;  4MFK A;  1Y9K A;  1XEB A;  3S6K A;  4AB7 A;  4JJX A;  2ZW5 A;  2G3T A;  4U5Y A;  4EVY A;  4BMH A;  4QBJ A;  3F0A A;  2K5T A;  5C88 A;  3GY9 A;  1XIX A;  4HKF A;  4CRY B;  2ARH A;  2PC1 A;  5F47 A;  2ATR A;  1TIQ A;  2Q44 A;  4B12 A;  4PV6 A;  2GAN A;  5HMN A;  2R7H A;  4CGP A;  2FIW A;  2PQ8 A;  1BO4 A;  3R1K A;  2Q7B A;  2P0W A;  3ZJ0 A;  4UFX A;  2FE7 A;  4HNW B;  3BLN A;  1RXT A;  1Z4E A;  4MFL A;  4CGO A;  1YRE A;  4E8O A;  2OH1 A;  2HV2 A;  4MFJ A;  3D3S A;  4H89 A;  2R98 A;  1RO5 A;  3R9F A;  1IID A;  4NF1 A;  4A2Z A;  2QML A;  4MY0 A;  2CNS A;  3D8P A;  2WPW A;  4B10 A;  3MGD A;  2FXF A;  3EY5 A;  3OWC A;  4L89 A;  4LUA A;  3TE4 A;  2DPS A;  1KUV A;  1YK3 A;  5IV0 A;  5DWM A;  4XPD C;  1ON0 A;  5HH1 A;  3S6H A;  2Z3P A;  5IX3 A;  2P6F A;  4Q38 A;  2Z3L A;  2DXQ A;  3V8I A;  5KTC A;  4KS9 A;  2HQY A;  1S7K A;  1YVO A;  4IF5 A;  3FXT A;  2KCW A;  4CYN A;  3QAH A;  4KLW A;  4MFQ A;  1OZP A;  2WPX A;  2EVN A;  4LX9 A;  2DPT A;  2I79 A;  3TT2 A;  3DSB A;  1PUA A;  1M4I A;  3P2F A;  4JXQ A;  5AG6 A;  4UA3 A;  4UWI A;  2ZPA A;  2PSW A;  2G3A A;  3N7Z A;  3BJ8 A;  2CY2 A;  2Z3K A;  1P0H A;  4B5P A;  2GE3 A;  4K30 A;  2FIA A;  4R87 A;  4KUB A;  3FIX A;  2B5G B;  1XE4 A;  4KOS A;  3QB8 A;  1XF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...