1R57A

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 23
structure length 102
sequence length 102
ec nomenclature ec 2.3.1.-:
pdb deposition date 2003-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1r57A00
3EFAA 2QIRA 1Z4EA 2BUEA 3CXQA 3LD2A 4UWIA 3QB8A 4R3KA 2H5MA 2OH1A 1RXTA 5HH1A 2FL4A 2VQYA 1M4DA 2VZZA 1S7KA 2KCWA 2FXFA 3MGDA 1K4JA 1IIDA 4NXYA 4XPKA 3SXNA 4XNHB 3LODA 4ORFA 2G3TA 4JLYA 3N7ZA 1P0HA 3F0AA 2Q04A 4KLVA 4HNXB 3EC4A 2ATRA 2FIAA 2R1IA 4H6UA 2J8RA 2ZXVA 4MY3A 4H6ZA 1XIXA 2PDOA 1UFHA 2Z10A 2JDDA 2NMTA 1TIQA 4MJ8A 2ARHA 2REFA 1VHSA 1S7LA 2CNMA 3V8IA 3DSBA 2Q0YA 3R1KA 2GE3A 2FS5A 3E0KA 5EBVA 3S6KA 1IICA 2ZW7A 3CXSA 4AVCA 2ZW5A 1WWZA 1YX0A 3TTHA 4MBUA 1NSLA 2Q4VA 4UBRA 4KVOE 2B5GA 2DXQA 3TO7A 4RI1A 4KOSA 4PK2A 4KZTA 1Q2YA 3R9FA 2AJ6A 1I1DA 3BLNA 3FRMA 1XE4A 4QBJA 2P6GA 2WPWA 4NF1A 4U9YA 4RS2A 3UY5A 4CAXA 5FVJA 1I21A 2Q4YA 1NMTA 3BJ8A 4E2AA 1N71A 2ZPAA 4KUBA 3FXTA 1FY7A 1Y7RA 1WK4A 4LX9A 1S3ZA 1IYLA 2AE6A 2OZHA 4X5KA 4PSXA 2VEZA 4M3SA 1VKCA 1B6BA 2PR8A 4FD4A 3S6FA 4U9ZA 4KOVA 2QMLA 3TOAA 4QB9A 1OZPA 5DWMA 1CM0A 3S6HA 2QECA 3W91A 1M44A 3D8PA 1NE9A 3TFYA 1BO4A 4NEXA 3FB3A 3FYNA 3TO6A 4XPLA 1XF8A 3G3SA 1QSOA 4NSQA 2OZGA 3P2FA 3R9GA 1M4IA 4MHDA 3DNSA 4CRYB 4HKFA 2CY2A 3H4QA 1IB1E 3D2PA 4L89A 2X7BA 2WPXA 5EC4A 3VWEA 3T90A 4MI4A 4Y49B 1I12A 4R87A 1YREA 2JEVA 1U6MA 4JWPA 4M85A 2B3UA 5F48A 4R9MA 1YLEA 2K5TA 4E8OA 4K30A 4LUAA 3R95A 5JQ4A 2REEA 4XPDB 3IWGA 2D4OA 3C26A 3TE4A 4JD6A 2ZW6A 3EY5A 1KUYA 2PQ8A 2GANA 3TT2A 3PZJA 1S60A 1B87A 1IYKA 1Q2DA 2FCKA 4JJXA 1Z4RA 2PSWA 3DDDA 4FD6A 3KKWA 3GKRA 1YR0A 3DR6A 1S5KA 3GYAA 2B58A 3TOBA 3TO9A 3VWDA 3RYOA 3ZJ0A 1GHEA 1L0CA 4PK3A 3D2MA 3CXPA 4AVBA 2JDCA 4I49A 1XMTA 3R96A 1KUVA 4JXRA 1CJWA 4F0YA 5KTCA 2BEIA 1MK4A 2A4NA 2R98A 3F5BA 5DWNA 2P0WA 4YRHA 2B4DB 5H86A 5IB0A 2VZYA 2HUZA 3EO4A 4IF5A 1Y9WA 2EVNA 2HQYA 2Q7BA 2I00A 4KLWA 1QSRA 5ISVA 2HV2A 4KVME 1Y9KA 3PGPA 2R8VA 1XEBA 2I79A 4H89A 2ZW4A 2PRBA 1Z9UA 4YFJA 4L8AA 5HMNA 4OAEA 1S7NA 5F47A 5H84A 5GCNA 1R57A 1Q2CA 2CNTA 3I9SA 1J4JA 2FSRA 1LRZA 4OADA 1MJ9A 2OU2A 2PC1A 4B5PB 4II9A 4Y49C 4XNHC 3QAHA 4R3LA 1P4NA 5KTDA 3OWCA 2CNSA 4KORA 2VBQA 4QUSA 4XPDC 4F6AA 1QSMA 3FIXA 1M4GA 4ONUA 2OB0A 4EVYA 4DNCA 2J8NA 4PV6A 5KTAA 4CAVA 1YK3A 3T9YA 1V0CA 2O28A 3JVNA 5IV0A 5J8FA 3FNCA 3WR7A 2Z0ZA 2B3VA 2Y0MA 2FIWA 3IGRA 3W6SA 2B4BA 1YVKA 1YVOA 4J3GA 5C82A 4AG7A 5J8CA 1S7FA 2F5IA 1QSNA 3F8KA 5C88A 3ZZIA 1RO5A 3NE7A 2FT0A 4AB7A 3I3GA 1YGHA 2IL4A 5CNPA 4UA3A 2BSWA 3S6GA 3K9UA 2P6FA 4KVXA 3P2HA 4MY0A 2VXKA 2FE7A 4CAWA 4E0AA 3PP9A 2GIVA 3W6XA 3R9EA 2Q44A 3TCVA 4BMHA 1MJBA 4OLLA 2G3AA 2VI7A 4KUAA 3EXNA 1BOBA 4NCZA 4AVAA 2B4DA 4ZBGA 3G8WA 1ON0A 1KUXA 2JLMA 3D3SA 4FD7A 4KOWA 4IUSA 2D4PA 1M1DA 2B5GB 5F49A 1QSTA 1PU9A 3FBUA 4CS0B 2EUIA 4KOYA 1PUAA 2PR1A 4HNWB 4QVTA 2OZUA 2C27A 4GS4A 2BL1A 2R7HA 4UWJA 5F46A 4PSWA 4B5OA 1SQHA 4KOTA 4QC6A 4YGOA 4FD5A 5IX3A 4KOXA 3SHPA 4B5PA 4CRZB 2J8MA 2Z11A 5JPHA 2RC4A 3B8GA 4U5YA 5I0CA 5E96A 1KZFA 3BJ7A 4JXQA 2G0BA 3GY9A 4HNYB 3SXOA 4R57A 2P6EA 1MJAA 4AG9A 4KOUA 3JUWA 3DR8A
chains in the Genus database with same CATH superfamily
3GUXA 3SI0A 3EFAA 1JWQA 2AFMA 4R7MA 3NE8A 2QIRA 1Z4EA 2BUEA 4CGOA 3CXQA 1VGYA 3LD2A 4UWIA 3QB8A 2V8VA 3GIUA 4OC0A 4R3KA 4X2TA 4NGSA 4OIDA 4MCSA 2H5MA 2OH1A 1RXTA 5HH1A 4C2ZA 2FL4A 2JBKA 2QJ8A 3NFZA 4ZI6A 2VQYA 1AYEA 4UIBA 1M4DA 2VZZA 1S7KA 2BO9A 2KCWA 1LANA 2FXFA 1QQ9A 3MGDA 1K4JA 1IIDA 4NXYA 4XPKA 3SXNA 2Q7SA 4XNHB 3FMCA 3LODA 3D7HA 3IC1A 4NGQA 4ORFA 2GFQA 2G3TA 3H8EA 4JLYA 4CYQA 5A27A 1LFWA 3N7ZA 1M4LA 1P0HA 2QVPA 3F0AA 2Q04A 4KLVA 4HNXB 3EC4A 2ATRA 2FIAA 2R1IA 1TKJA 5HVFA 4C2YA 1IGBA 4NGTA 4EWTA 1F2OA 3NH4A 3SI2A 1BPNA 1PCAA 4H6UA 3BXMA 2J8RA 3B3SA 4UCMA 2ZXVA 4MY3A 4H6ZA 1XIXA 3FEEA 2PDOA 1UFHA 4JZ0A 4MFJA 4CGNA 2Z10A 2JDDA 2NMTA 1TIQA 2AFSA 4MJ8A 2PJ0A 2ARHA 2REFA 4KSIA 1VHSA 2POKA 1R3NA 1S7LA 4B10A 4MFQA 4YWYA 3HUVA 2CNMA 4YU9A 4UFXA 3V8IA 2NSMA 3B35A 3NH8A 3DSBA 2Q0YA 3R1KA 1UWYA 2GE3A 2XEFA 4C68A 2Q43A 2FS5A 3E0KA 5EBVA 4ZY2A 1LOKA 3JTKA 3S6KA 1IICA 2ZW7A 3CXSA 1LAPA 4F0XA 4NGRA 4AVCA 2ZW5A 1WWZA 1Z5RA 1YX0A 3KHXA 5CPAA 3TTHA 4MBUA 1NSLA 4MFKA 2Q4VA 3SI1A 3LMSA 4UBRA 4OKOA 4KVOE 3IU1A 3VH9A 2B5GA 4PXCA 4CYPA 3D4UA 4AXVA 2ABZA 2DXQA 3TO7A 3IWWA 4RI1A 4DUKA 1IOFA 1XJOA 2OR4A 3DGVA 3HLPA 4KOSA 4PK2A 4B11A 4KZTA 2HB6A 4OC3A 1Q2YA 3R9FA 4CGMA 2AJ6A 1RTQA 1I1DA 3PBEA 2Q51A 4NGPA 5AG6A 4AG9A 3BLNA 3FRMA 2PJCA 1XE4A 3KASA 4QBJA 4MHNA 3TX8A 2P6GA 3SJGA 4CYOA 2WPWA 3GB0A 2WZNA 2YGWA 4NF1A 2ZEGA 5K8MA 4U9YA 3PB8X 4RS2A 3UY5A 4CAXA 5FVJA 4Q7AA 1Y0RA 1Z8LA 1F2PA 2NYQA 4Q38A 1I21A 1PYTB 2Q4YA 1NMTA 3FVLA 3BJ8A 1YQEA 2FVGA 1N71A 4LQ6A 5G22A 2ZPAA 3D7DA 4E2AA 2RB7A 1TKHA 4KUBA 1FY7A 2YNCA 3FXTA 3V38A 1Y7RA 1FNOA 1WK4A 4H2KA 4JYWA 4LX9A 2V8GA 1S3ZA 4R76A 1IYLA 2AE6A 4RN7A 1TF9A 4PQAA 2OZHA 4X5KA 4PSXA 2VEZA 4M3SA 1VKCA 1BLLE 2PJAA 4P6YA 4UF4A 1B6BA 3FECA 2PR8A 3LACA 4FD4A 3S6FA 4U9ZA 4KOVA 5CBMA 2QMLA 3B2YA 5HVGA 3TOAA 4QB9A 5THWA 1IOIA 1OZPA 5DWMA 1CM0A 1VHEA 1Y0YA 2BOAA 2G9DA 2QECA 3S6HA 3W91A 1M44A 3D8PA 4OP4A 4A32A 1NE9A 4ZX8A 3TFYA 5AGEA 3BI1A 3N5FA 1BO4A 4NEXA 4KSAA 3FB3A 3FYNA 3TO6A 4XPLA 3WC6A 1YLOA 4M6IA 1XF8A 4OMEA 3G3SA 4CAEA 5J1QA 4X3RA 1QSOA 3NH5A 1OBRA 4NSQA 2OZGA 3P2FA 3I1UA 3R9GA 5K8NA 1M4IA 2DPTA 4MHDA 4CYNA 3B3WA 4CPAA 2GREA 2I3CA 3DNSA 4CRYB 1ELLP 2ANPA 4HKFA 2CY2A 3H4QA 1R43A 1IB1E 3D2PA 4M6GA 1TXRA 2PJ4A 4L89A 2X7BA 2WPXA 5EC4A 3VWEA 1ELMP 2AFWA 4B12A 1H8LA 5LYFA 2GLFA 3T90A 4MI4A 4Y49B 1CG2A 1I12A 1QMUA 3WT4A 4A95A 2Z3KA 3KHZA 2ZELA 4W9YA 4R87A 1YREA 2RFHA 5D8NA 2JEVA 3WABA 4ZY1A 1U6MA 4JWPA 4M85A 1HDUA 2B3UA 4M6HA 1X12A 4OC5A 4R9MA 1YLEA 2K5TA 3PEIA 4P4BA 5F48A 2YNDA 5G21A 2PJ2A 2ZEHA 3D68A 1ZG9A 2XEIA 3D67A 4MHYA 4K30A 4A94A 4C7IA 4P4FA 4LUAA 3R95A 5JQ4A 2REEA 4XPDB 4ZY0A 3IWGA 2D4OA 4MFPA 4P10A 1IU8A 1Z8WA 3C26A 3LWUA 3TE4A 4JD6A 2ZW6A 4K3NA 3EY5A 1KUYA 2PQ8A 2GANA 4B14A 4DJLA 5K8OA 4OIWA 3TT2A 1CBXA 2CIJA 3B3CA 3K2KA 3PZJA 1S60A 3IIBA 3B3VA 1B87A 3BI0A 1IYKA 1Q2DA 4MFZA 2VL1A 2FCKA 4JJXA 1Z4RA 4B13A 2ODFA 2PSWA 3DDDA 4FD6A 4A31A 4A38A 4F8ZA 3KKWA 4F9VA 3GKRA 1YR0A 3DR6A 1S5KA 1X10A 1ZG7A 1DTDA 2JEWA 2C6CA 3GYAA 2B58A 3TOBA 3TO9A 3VWDA 3RYOA 4C2XA 2O4HA 3WC5A 3ZJ0A 1GHEA 1L0CA 3PFEA 4PK3A 3D2MA 2IQ6A 1ZO0A 3CXPA 2JDCA 3KQXA 4I49A 1XMTA 3R96A 1KUVA 4A39A 3PFOA 4JXRA 1CJWA 4P4IA 4F0YA 2DPSA 3KL9A 2WYRA 4A33A 5KTCA 2BEIA 1MK4A 4Z65A 2A4NA 2R98A 4MMOA 3F5BA 4R8FA 2AFUA 4RUHA 1XFOA 5DWNA 2P0WA 2YNCC 4UEZA 4YRHA 4FAIA 2YNEA 3CDXA 2PIYA 4MCPA 2B4DB 5H86A 5IB0A 2VZYA 2HUZA 5LYIA 1ZLHA 2PJ7A 2PJ8A 3EO4A 4IF5A 5A28A 3WC7A 2PIZA 1Y9WA 2EVNA 3S9MA 5LRGA 1EE3P 3K9TA 2HQYA 4UFWA 1VHOA 2Q7BA 2ZEOA 4A37A 2I00A 4KLWA 1CPSA 3D7GA 4FWUA 1QSRA 4NJQA 5ISVA 2HV2A 4KVME 1Y9KA 3PGPA 1ARLA 2R8VA 2CF4A 5F09A 2Q4ZA 5G20A 1XEBA 1LCPA 4MCRA 1Q7LA 2I79A 4H89A 5AG5A 2PVWA 2ZW4A 2PRBA 3PRTA 4IAVA 3SJEA 4G1PA 1Z9UA 4MXUA 4YFJA 4L8AA 5HMNA 4TWEA 4F9UA 4OAEA 2DF5A 3DLJA 1S7NA 3NA6A 5F47A 5H84A 3VATA 5GCNA 1YW6A 1TF8A 3PBBA 1R57A 1Q2CA 2V8HA 2CNTA 3I9SA 1J4JA 2FSRA 4MCQA 1A2ZA 1LRZA 4OADA 1MJ9A 1IY7A 1JQGA 1XRYA 4NGMA 4UIAA 5G1ZA 2OU2A 2PC1A 4PXDA 4B5PB 1XMBA 4II9A 2EBJA 4IHMA 4Y49C 1FT7A 1Y7EA 4XNHC 3FH4A 2AFOA 3QAHA 4CGPA 4R3LA 1P4NA 5KTDA 3OWCA 2CNSA 2ZOFA 2ZEFA 2BCOA 5AG4A 4KORA 4UCNA 2VBQA 1KWMA 2JBJA 4QUSA 3FX6A 3IJ3A 3D7FA 3V7ZA 4Q36A 3PB7X 1CP6A 4DYOA 5HXDA 4XPDC 4F6AA 1QSMA 2PCUA 3FIXA 2PE3A 1M4GA 3CPXA 4ONUA 3D66A 2OB0A 1CPXA 4A30A 4EVYA 3RAMA 3MN8A 4DNCA 2J8NA 3VARA 4PV6A 2J9AA 5KTAA 3PB4X 4CAVA 1YK3A 3A9LA 1V0CA 3IU2A 3H8GA 3T9YA 2O28A 2AFXA 4PPZA 2EK8A 3JVNA 1VIXA 5IV0A 1AUGA 2AFZA 5J8FA 3GLJA 3FNCA 3WR7A 2Z0ZA 2B3VA 2DEAA 1CX8A 2CXAA 2PRQA 2Y0MA 3CPAA 2FIWA 4P4EA 3IGRA 4NJRA 3W6SA 2CTCA 2B4BA 1YVKA 2XEJA 2WUUA 1YVOA 3T8WA 4J3GA 4OC4A 5C82A 1XOVA 4AG7A 5J8CA 5ELYA 1S7FA 5K8PA 1YSJA 2F5IA 3S9LA 1QSNA 4X8IA 3IWEA 4GXHA 3F8KA 5C88A 1DE4C 1RO5A 2ZEDA 4UFVA 3ZZIA 4BBHA 2C6PA 2PJ3A 1ZG8A 3NE7A 5LRJA 4KSFA 3KQZA 8CPAA 2FT0A 4AB7A 3SJXA 4FBEA 3RZAA 3I3GA 1YGHA 2IL4A 5CNPA 2OOTA 2PJ9A 2BSWA 1F57A 4UA3A 4R6TA 3S6GA 3H5ZA 4O23A 4UEEA 4WJBA 4EFDA 2O53A 2C1CA 1BAVA 2ZEEA 2Z3NA 3IEHA 3K9UA 4A2ZA 2P6FA 4KVXA 3P2HA 4MY0A 2VXKA 2FE7A 4P44A 1BPMA 3MRUA 4CAWA 4E0AA 4ZGYB 3KR5A 4MHPA 1CP7A 2PJBA 3PP9A 2GIVA 3PB9X 4MFLA 4NGNA 4ONWA 4UEFA 3W6XA 3BHXA 4NFRA 3SJFA 3R9EA 2Q44A 3TCVA 1ARMA 4P4DA 4BMHA 1MJBA 4OLLA 2V77A 3KGQA 2G3AA 4CGLA 3L2NA 2VI7A 4KUAA 3KR4A 2C6GA 3EXNA 5LRKA 1BOBA 5AG7A 4NCZA 4AVAA 5BWAB 5LYLA 2PJ1A 2F8HA 2B4DA 1YMEA 4ZBGA 3S9NA 5JH9A 5DS0A 3FJUA 1ON0A 3G8WA 1KUXA 3B3TA 4IK2A 4C7HA 5HVHA 2JLMA 3D3SA 4FD7A 2F7VA 4KOWA 2IJZA 4IUSA 4OC1A 4EMEA 3RO0A 2GU2A 3IO1A 2D4PA 1M1DA 4LQGA 1GYTA 1HEEA 2B5GB 3FF3A 4OC2A 3KZWA 2XEGA 4PXEA 5F49A 4BINA 4P45A 2EWBA 6CPAA 1QSTA 1PU9A 3FBUA 3IFEA 3RNZA 4CS0B 2V8DA 2IMOA 2EUIA 4KOYA 1PUAA 2ZOGA 4ZX9A 2PR1A 3KI9A 4HNWB 3CT9A 5JM6A 3JRUA 7CPAA 4QVTA 1LAMA 2OZUA 4AVBA 2EK9A 1ZLIA 1TKFA 2C27A 2PJ5A 4GS4A 3RBUA 2BL1A 2R7HA 4TNUA 4FUUA 1Z8XA 3ISZA 4PXBA 3QNVA 4UWJA 4WWVA 2Z3OA 4BD9A 5F46A 3ISXA 2GLJA 1YW4A 2Z3PA 2PVVA 2HC9A 1HDQA 2ZENA 4PSWA 5LYDA 1Z2LA 1Z8TA 4KS9A 4B5OA 2EO8A 2Z3MA 2WSAA 1SQHA 4KOTA 5EMIA 4QC6A 4YGOA 1XBUA 4UCPA 4FD5A 2CTBA 1AMPA 5IX3A 4KOXA 3SHPA 4B5PA 4CRZB 4B6ZA 1NSAA 2J8MA 2QYVA 2ZEPA 5D29A 2Z11A 3PB6X 5JPHA 2RC4A 4E8OA 3B8GA 3B7IA 5JGFA 4HPSA 4U5YA 4ZYQA 5I0CA 2ZEMA 2PJ6A 5I4MA 4GM5A 5E96A 1KZFA 2Z3LA 3BJ7A 3FEDA 4JXQA 3H8FA 2G0BA 4MHZA 4P4JA 3GY9A 5IB9A 4HNYB 4CAFA 3QAYA 3SXOA 4MRIA 4R57A 2P6EA 1MJAA 3TC8A 3CZXA 4KOUA 3JUWA 3DR8A
chains in the Genus database with same CATH topology
3EFAA 2QIRA 1Z4EA 2BUEA 4CGOA 3CXQA 3LD2A 4UWIA 3QB8A 4R3KA 2H5MA 2OH1A 1RXTA 5HH1A 4C2ZA 2FL4A 2VQYA 1M4DA 2VZZA 1S7KA 2KCWA 2FXFA 3MGDA 1K4JA 1IIDA 4NXYA 4XPKA 3SXNA 4XNHB 3LODA 4ORFA 4CYQA 2G3TA 5A27A 4JLYA 3N7ZA 1P0HA 3F0AA 2Q04A 4KLVA 4HNXB 3EC4A 2ATRA 2FIAA 2R1IA 4C2YA 4H6UA 2J8RA 4UCMA 2ZXVA 4MY3A 4H6ZA 1XIXA 4MFJA 2PDOA 1UFHA 4CGNA 2Z10A 2JDDA 2NMTA 1TIQA 4MJ8A 2ARHA 2REFA 1VHSA 4B10A 1S7LA 4MFQA 2CNMA 4UFXA 3V8IA 3DSBA 2Q0YA 3R1KA 2GE3A 4C68A 2FS5A 3E0KA 5EBVA 3JTKA 3S6KA 1IICA 2ZW7A 3CXSA 4F0XA 4AVCA 2ZW5A 1WWZA 1YX0A 3TTHA 4MBUA 1NSLA 4MFKA 2Q4VA 4UBRA 4KVOE 3IU1A 2B5GA 4CYPA 2DXQA 3TO7A 4RI1A 4KOSA 4PK2A 4B11A 4KZTA 1Q2YA 3R9FA 4CGMA 2AJ6A 1I1DA 5AG6A 3BLNA 3FRMA 1XE4A 4QBJA 2P6GA 4CYOA 2WPWA 2YGWA 4NF1A 4U9YA 4RS2A 3UY5A 4CAXA 5FVJA 4Q38A 1I21A 2Q4YA 1NMTA 5G22A 3BJ8A 4E2AA 1N71A 2ZPAA 4KUBA 3FXTA 2YNCA 1FY7A 1Y7RA 1WK4A 4LX9A 1S3ZA 1IYLA 2AE6A 2OZHA 4X5KA 4PSXA 2VEZA 4M3SA 1VKCA 1B6BA 2PR8A 4FD4A 3S6FA 4U9ZA 4KOVA 2QMLA 3TOAA 4QB9A 1OZPA 5DWMA 1CM0A 3S6HA 2QECA 3W91A 1M44A 3D8PA 4A32A 1NE9A 3TFYA 5AGEA 1BO4A 4NEXA 4KSAA 3FB3A 3FYNA 3TO6A 4XPLA 1XF8A 3G3SA 4CAEA 1QSOA 4NSQA 2OZGA 3P2FA 3R9GA 1M4IA 2DPTA 4MHDA 4CYNA 3DNSA 4CRYB 4HKFA 2CY2A 3H4QA 1IB1E 3D2PA 4L89A 2X7BA 2WPXA 5EC4A 3VWEA 4B12A 3T90A 4MI4A 4Y49B 1I12A 4A95A 2Z3KA 4R87A 1YREA 2JEVA 1U6MA 4JWPA 4M85A 2B3UA 5F48A 4R9MA 1YLEA 2K5TA 4E8OA 2YNDA 5G21A 4C7IA 4K30A 4LUAA 3R95A 5JQ4A 2REEA 4XPDB 3IWGA 2D4OA 4MFPA 3C26A 3TE4A 4JD6A 2ZW6A 3EY5A 1KUYA 2PQ8A 2GANA 4B14A 3TT2A 3PZJA 1S60A 1B87A 1IYKA 1Q2DA 4MFZA 2FCKA 4JJXA 1Z4RA 4B13A 2PSWA 3DDDA 4A31A 4FD6A 3KKWA 3GKRA 1YR0A 3DR6A 1S5KA 3GYAA 2B58A 3TOBA 3TO9A 3VWDA 3RYOA 4C2XA 3ZJ0A 1GHEA 1L0CA 4PK3A 3D2MA 3CXPA 1ZO0A 4AVBA 2JDCA 4I49A 1XMTA 3R96A 1KUVA 4JXRA 1CJWA 4F0YA 2DPSA 4A33A 5KTCA 2BEIA 1MK4A 2A4NA 2R98A 3F5BA 5DWNA 2P0WA 2YNCC 4YRHA 2YNEA 2B4DB 5H86A 5IB0A 2VZYA 2HUZA 3EO4A 4IF5A 5A28A 1Y9WA 2EVNA 4UFWA 2HQYA 2Q7BA 2I00A 4KLWA 1QSRA 5ISVA 2HV2A 4KVME 1Y9KA 3PGPA 2R8VA 5G20A 1XEBA 2I79A 4H89A 5AG5A 2ZW4A 2PRBA 1Z9UA 4YFJA 4L8AA 5HMNA 4OAEA 1S7NA 5F47A 5H84A 5GCNA 1R57A 1Q2CA 2CNTA 3I9SA 1J4JA 2FSRA 1LRZA 4OADA 1MJ9A 5G1ZA 2OU2A 2PC1A 4B5PB 4II9A 4Y49C 4XNHC 3QAHA 4CGPA 4R3LA 1P4NA 5KTDA 3OWCA 2CNSA 5AG4A 4KORA 4UCNA 2VBQA 4QUSA 4Q36A 4XPDC 4F6AA 1QSMA 3FIXA 1M4GA 4ONUA 2OB0A 4A30A 4EVYA 4DNCA 2J8NA 4PV6A 5KTAA 4CAVA 1YK3A 3A9LA 1V0CA 3IU2A 3T9YA 2O28A 3JVNA 5IV0A 5J8FA 3FNCA 3WR7A 2Z0ZA 2B3VA 2CXAA 2Y0MA 2FIWA 3IGRA 3W6SA 2B4BA 1YVKA 2WUUA 1YVOA 4J3GA 5C82A 4AG7A 5J8CA 1S7FA 2F5IA 1QSNA 3IWEA 3F8KA 5C88A 4UFVA 1RO5A 3ZZIA 4BBHA 3NE7A 4KSFA 2FT0A 4AB7A 3I3GA 1YGHA 2IL4A 5CNPA 4UA3A 2BSWA 3S6GA 3H5ZA 2Z3NA 3K9UA 4A2ZA 2P6FA 4KVXA 3P2HA 4MY0A 2VXKA 2FE7A 4CAWA 4E0AA 4ZGYB 3PP9A 2GIVA 4MFLA 3W6XA 3R9EA 2Q44A 3TCVA 4BMHA 1MJBA 4OLLA 2G3AA 4CGLA 2VI7A 4KUAA 3EXNA 1BOBA 5AG7A 4NCZA 4AVAA 5BWAB 2B4DA 4ZBGA 3G8WA 1ON0A 1KUXA 4C7HA 2JLMA 3D3SA 4FD7A 4KOWA 4IUSA 2D4PA 1M1DA 2B5GB 5F49A 1QSTA 1PU9A 3FBUA 4CS0B 2EUIA 4KOYA 1PUAA 2PR1A 4HNWB 4QVTA 2OZUA 2C27A 4GS4A 2BL1A 2R7HA 4UWJA 2Z3OA 5F46A 2Z3PA 4PSWA 4KS9A 4B5OA 2Z3MA 2WSAA 1SQHA 4KOTA 4QC6A 4YGOA 4UCPA 4FD5A 5IX3A 4KOXA 3SHPA 4B5PA 4CRZB 2J8MA 2Z11A 5JPHA 2RC4A 3B8GA 4U5YA 5I0CA 5E96A 1KZFA 2Z3LA 3BJ7A 4JXQA 2G0BA 3GY9A 4HNYB 4CAFA 3SXOA 4R57A 2P6EA 1MJAA 4AG9A 4KOUA 3JUWA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFA A;  2QIR A;  1Z4E A;  2BUE A;  3CXQ A;  3LD2 A;  4UWI A;  3QB8 A;  4R3K A;  2H5M A;  2OH1 A;  1RXT A;  5HH1 A;  2FL4 A;  2VQY A;  1M4D A;  2VZZ A;  1S7K A;  2KCW A;  2FXF A;  3MGD A;  1K4J A;  1IID A;  4NXY A;  4XPK A;  3SXN A;  4XNH B;  3LOD A;  4ORF A;  2G3T A;  4JLY A;  3N7Z A;  1P0H A;  3F0A A;  2Q04 A;  4KLV A;  4HNX B;  3EC4 A;  2ATR A;  2FIA A;  2R1I A;  4H6U A;  2J8R A;  2ZXV A;  4MY3 A;  4H6Z A;  1XIX A;  2PDO A;  1UFH A;  2Z10 A;  2JDD A;  2NMT A;  1TIQ A;  4MJ8 A;  2ARH A;  2REF A;  1VHS A;  1S7L A;  2CNM A;  3V8I A;  3DSB A;  2Q0Y A;  3R1K A;  2GE3 A;  2FS5 A;  3E0K A;  5EBV A;  3S6K A;  1IIC A;  2ZW7 A;  3CXS A;  4AVC A;  2ZW5 A;  1WWZ A;  1YX0 A;  3TTH A;  4MBU A;  1NSL A;  2Q4V A;  4UBR A;  4KVO E;  2B5G A;  2DXQ A;  3TO7 A;  4RI1 A;  4KOS A;  4PK2 A;  4KZT A;  1Q2Y A;  3R9F A;  2AJ6 A;  1I1D A;  3BLN A;  3FRM A;  1XE4 A;  4QBJ A;  2P6G A;  2WPW A;  4NF1 A;  4U9Y A;  4RS2 A;  3UY5 A;  4CAX A;  5FVJ A;  1I21 A;  2Q4Y A;  1NMT A;  3BJ8 A;  4E2A A;  1N71 A;  2ZPA A;  4KUB A;  3FXT A;  1FY7 A;  1Y7R A;  1WK4 A;  4LX9 A;  1S3Z A;  1IYL A;  2AE6 A;  2OZH A;  4X5K A;  4PSX A;  2VEZ A;  4M3S A;  1VKC A;  1B6B A;  2PR8 A;  4FD4 A;  3S6F A;  4U9Z A;  4KOV A;  2QML A;  3TOA A;  4QB9 A;  1OZP A;  5DWM A;  1CM0 A;  3S6H A;  2QEC A;  3W91 A;  1M44 A;  3D8P A;  1NE9 A;  3TFY A;  1BO4 A;  4NEX A;  3FB3 A;  3FYN A;  3TO6 A;  4XPL A;  1XF8 A;  3G3S A;  1QSO A;  4NSQ A;  2OZG A;  3P2F A;  3R9G A;  1M4I A;  4MHD A;  3DNS A;  4CRY B;  4HKF A;  2CY2 A;  3H4Q A;  1IB1 E;  3D2P A;  4L89 A;  2X7B A;  2WPX A;  5EC4 A;  3VWE A;  3T90 A;  4MI4 A;  4Y49 B;  1I12 A;  4R87 A;  1YRE A;  2JEV A;  1U6M A;  4JWP A;  4M85 A;  2B3U A;  5F48 A;  4R9M A;  1YLE A;  2K5T A;  4E8O A;  4K30 A;  4LUA A;  3R95 A;  5JQ4 A;  2REE A;  4XPD B;  3IWG A;  2D4O A;  3C26 A;  3TE4 A;  4JD6 A;  2ZW6 A;  3EY5 A;  1KUY A;  2PQ8 A;  2GAN A;  3TT2 A;  3PZJ A;  1S60 A;  1B87 A;  1IYK A;  1Q2D A;  2FCK A;  4JJX A;  1Z4R A;  2PSW A;  3DDD A;  4FD6 A;  3KKW A;  3GKR A;  1YR0 A;  3DR6 A;  1S5K A;  3GYA A;  2B58 A;  3TOB A;  3TO9 A;  3VWD A;  3RYO A;  3ZJ0 A;  1GHE A;  1L0C A;  4PK3 A;  3D2M A;  3CXP A;  4AVB A;  2JDC A;  4I49 A;  1XMT A;  3R96 A;  1KUV A;  4JXR A;  1CJW A;  4F0Y A;  5KTC A;  2BEI A;  1MK4 A;  2A4N A;  2R98 A;  3F5B A;  5DWN A;  2P0W A;  4YRH A;  2B4D B;  5H86 A;  5IB0 A;  2VZY A;  2HUZ A;  3EO4 A;  4IF5 A;  1Y9W A;  2EVN A;  2HQY A;  2Q7B A;  2I00 A;  4KLW A;  1QSR A;  5ISV A;  2HV2 A;  4KVM E;  1Y9K A;  3PGP A;  2R8V A;  1XEB A;  2I79 A;  4H89 A;  2ZW4 A;  2PRB A;  1Z9U A;  4YFJ A;  4L8A A;  5HMN A;  4OAE A;  1S7N A;  5F47 A;  5H84 A;  5GCN A;  1R57 A;  1Q2C A;  2CNT A;  3I9S A;  1J4J A;  2FSR A;  1LRZ A;  4OAD A;  1MJ9 A;  2OU2 A;  2PC1 A;  4B5P B;  4II9 A;  4Y49 C;  4XNH C;  3QAH A;  4R3L A;  1P4N A;  5KTD A;  3OWC A;  2CNS A;  4KOR A;  2VBQ A;  4QUS A;  4XPD C;  4F6A A;  1QSM A;  3FIX A;  1M4G A;  4ONU A;  2OB0 A;  4EVY A;  4DNC A;  2J8N A;  4PV6 A;  5KTA A;  4CAV A;  1YK3 A;  3T9Y A;  1V0C A;  2O28 A;  3JVN A;  5IV0 A;  5J8F A;  3FNC A;  3WR7 A;  2Z0Z A;  2B3V A;  2Y0M A;  2FIW A;  3IGR A;  3W6S A;  2B4B A;  1YVK A;  1YVO A;  4J3G A;  5C82 A;  4AG7 A;  5J8C A;  1S7F A;  2F5I A;  1QSN A;  3F8K A;  5C88 A;  3ZZI A;  1RO5 A;  3NE7 A;  2FT0 A;  4AB7 A;  3I3G A;  1YGH A;  2IL4 A;  5CNP A;  4UA3 A;  2BSW A;  3S6G A;  3K9U A;  2P6F A;  4KVX A;  3P2H A;  4MY0 A;  2VXK A;  2FE7 A;  4CAW A;  4E0A A;  3PP9 A;  2GIV A;  3W6X A;  3R9E A;  2Q44 A;  3TCV A;  4BMH A;  1MJB A;  4OLL A;  2G3A A;  2VI7 A;  4KUA A;  3EXN A;  1BOB A;  4NCZ A;  4AVA A;  2B4D A;  4ZBG A;  3G8W A;  1ON0 A;  1KUX A;  2JLM A;  3D3S A;  4FD7 A;  4KOW A;  4IUS A;  2D4P A;  1M1D A;  2B5G B;  5F49 A;  1QST A;  1PU9 A;  3FBU A;  4CS0 B;  2EUI A;  4KOY A;  1PUA A;  2PR1 A;  4HNW B;  4QVT A;  2OZU A;  2C27 A;  4GS4 A;  2BL1 A;  2R7H A;  4UWJ A;  5F46 A;  4PSW A;  4B5O A;  1SQH A;  4KOT A;  4QC6 A;  4YGO A;  4FD5 A;  5IX3 A;  4KOX A;  3SHP A;  4B5P A;  4CRZ B;  2J8M A;  2Z11 A;  5JPH A;  2RC4 A;  3B8G A;  4U5Y A;  5I0C A;  5E96 A;  1KZF A;  3BJ7 A;  4JXQ A;  2G0B A;  3GY9 A;  4HNY B;  3SXO A;  4R57 A;  2P6E A;  1MJA A;  4AG9 A;  4KOU A;  3JUW A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 3GUX A;  3SI0 A;  3EFA A;  1JWQ A;  2AFM A;  4R7M A;  3NE8 A;  2QIR A;  1Z4E A;  2BUE A;  4CGO A;  3CXQ A;  1VGY A;  3LD2 A;  4UWI A;  3QB8 A;  2V8V A;  3GIU A;  4OC0 A;  4R3K A;  4X2T A;  4NGS A;  4OID A;  4MCS A;  2H5M A;  2OH1 A;  1RXT A;  5HH1 A;  4C2Z A;  2FL4 A;  2JBK A;  2QJ8 A;  3NFZ A;  4ZI6 A;  2VQY A;  1AYE A;  4UIB A;  1M4D A;  2VZZ A;  1S7K A;  2BO9 A;  2KCW A;  1LAN A;  2FXF A;  1QQ9 A;  3MGD A;  1K4J A;  1IID A;  4NXY A;  4XPK A;  3SXN A;  2Q7S A;  4XNH B;  3FMC A;  3LOD A;  3D7H A;  3IC1 A;  4NGQ A;  4ORF A;  2GFQ A;  2G3T A;  3H8E A;  4JLY A;  4CYQ A;  5A27 A;  1LFW A;  3N7Z A;  1M4L A;  1P0H A;  2QVP A;  3F0A A;  2Q04 A;  4KLV A;  4HNX B;  3EC4 A;  2ATR A;  2FIA A;  2R1I A;  1TKJ A;  5HVF A;  4C2Y A;  1IGB A;  4NGT A;  4EWT A;  1F2O A;  3NH4 A;  3SI2 A;  1BPN A;  1PCA A;  4H6U A;  3BXM A;  2J8R A;  3B3S A;  4UCM A;  2ZXV A;  4MY3 A;  4H6Z A;  1XIX A;  3FEE A;  2PDO A;  1UFH A;  4JZ0 A;  4MFJ A;  4CGN A;  2Z10 A;  2JDD A;  2NMT A;  1TIQ A;  2AFS A;  4MJ8 A;  2PJ0 A;  2ARH A;  2REF A;  4KSI A;  1VHS A;  2POK A;  1R3N A;  1S7L A;  4B10 A;  4MFQ A;  4YWY A;  3HUV A;  2CNM A;  4YU9 A;  4UFX A;  3V8I A;  2NSM A;  3B35 A;  3NH8 A;  3DSB A;  2Q0Y A;  3R1K A;  1UWY A;  2GE3 A;  2XEF A;  4C68 A;  2Q43 A;  2FS5 A;  3E0K A;  5EBV A;  4ZY2 A;  1LOK A;  3JTK A;  3S6K A;  1IIC A;  2ZW7 A;  3CXS A;  1LAP A;  4F0X A;  4NGR A;  4AVC A;  2ZW5 A;  1WWZ A;  1Z5R A;  1YX0 A;  3KHX A;  5CPA A;  3TTH A;  4MBU A;  1NSL A;  4MFK A;  2Q4V A;  3SI1 A;  3LMS A;  4UBR A;  4OKO A;  4KVO E;  3IU1 A;  3VH9 A;  2B5G A;  4PXC A;  4CYP A;  3D4U A;  4AXV A;  2ABZ A;  2DXQ A;  3TO7 A;  3IWW A;  4RI1 A;  4DUK A;  1IOF A;  1XJO A;  2OR4 A;  3DGV A;  3HLP A;  4KOS A;  4PK2 A;  4B11 A;  4KZT A;  2HB6 A;  4OC3 A;  1Q2Y A;  3R9F A;  4CGM A;  2AJ6 A;  1RTQ A;  1I1D A;  3PBE A;  2Q51 A;  4NGP A;  5AG6 A;  4AG9 A;  3BLN A;  3FRM A;  2PJC A;  1XE4 A;  3KAS A;  4QBJ A;  4MHN A;  3TX8 A;  2P6G A;  3SJG A;  4CYO A;  2WPW A;  3GB0 A;  2WZN A;  2YGW A;  4NF1 A;  2ZEG A;  5K8M A;  4U9Y A;  3PB8 X;  4RS2 A;  3UY5 A;  4CAX A;  5FVJ A;  4Q7A A;  1Y0R A;  1Z8L A;  1F2P A;  2NYQ A;  4Q38 A;  1I21 A;  1PYT B;  2Q4Y A;  1NMT A;  3FVL A;  3BJ8 A;  1YQE A;  2FVG A;  1N71 A;  4LQ6 A;  5G22 A;  2ZPA A;  3D7D A;  4E2A A;  2RB7 A;  1TKH A;  4KUB A;  1FY7 A;  2YNC A;  3FXT A;  3V38 A;  1Y7R A;  1FNO A;  1WK4 A;  4H2K A;  4JYW A;  4LX9 A;  2V8G A;  1S3Z A;  4R76 A;  1IYL A;  2AE6 A;  4RN7 A;  1TF9 A;  4PQA A;  2OZH A;  4X5K A;  4PSX A;  2VEZ A;  4M3S A;  1VKC A;  1BLL E;  2PJA A;  4P6Y A;  4UF4 A;  1B6B A;  3FEC A;  2PR8 A;  3LAC A;  4FD4 A;  3S6F A;  4U9Z A;  4KOV A;  5CBM A;  2QML A;  3B2Y A;  5HVG A;  3TOA A;  4QB9 A;  5THW A;  1IOI A;  1OZP A;  5DWM A;  1CM0 A;  1VHE A;  1Y0Y A;  2BOA A;  2G9D A;  2QEC A;  3S6H A;  3W91 A;  1M44 A;  3D8P A;  4OP4 A;  4A32 A;  1NE9 A;  4ZX8 A;  3TFY A;  5AGE A;  3BI1 A;  3N5F A;  1BO4 A;  4NEX A;  4KSA A;  3FB3 A;  3FYN A;  3TO6 A;  4XPL A;  3WC6 A;  1YLO A;  4M6I A;  1XF8 A;  4OME A;  3G3S A;  4CAE A;  5J1Q A;  4X3R A;  1QSO A;  3NH5 A;  1OBR A;  4NSQ A;  2OZG A;  3P2F A;  3I1U A;  3R9G A;  5K8N A;  1M4I A;  2DPT A;  4MHD A;  4CYN A;  3B3W A;  4CPA A;  2GRE A;  2I3C A;  3DNS A;  4CRY B;  1ELL P;  2ANP A;  4HKF A;  2CY2 A;  3H4Q A;  1R43 A;  1IB1 E;  3D2P A;  4M6G A;  1TXR A;  2PJ4 A;  4L89 A;  2X7B A;  2WPX A;  5EC4 A;  3VWE A;  1ELM P;  2AFW A;  4B12 A;  1H8L A;  5LYF A;  2GLF A;  3T90 A;  4MI4 A;  4Y49 B;  1CG2 A;  1I12 A;  1QMU A;  3WT4 A;  4A95 A;  2Z3K A;  3KHZ A;  2ZEL A;  4W9Y A;  4R87 A;  1YRE A;  2RFH A;  5D8N A;  2JEV A;  3WAB A;  4ZY1 A;  1U6M A;  4JWP A;  4M85 A;  1HDU A;  2B3U A;  4M6H A;  1X12 A;  4OC5 A;  4R9M A;  1YLE A;  2K5T A;  3PEI A;  4P4B A;  5F48 A;  2YND A;  5G21 A;  2PJ2 A;  2ZEH A;  3D68 A;  1ZG9 A;  2XEI A;  3D67 A;  4MHY A;  4K30 A;  4A94 A;  4C7I A;  4P4F A;  4LUA A;  3R95 A;  5JQ4 A;  2REE A;  4XPD B;  4ZY0 A;  3IWG A;  2D4O A;  4MFP A;  4P10 A;  1IU8 A;  1Z8W A;  3C26 A;  3LWU A;  3TE4 A;  4JD6 A;  2ZW6 A;  4K3N A;  3EY5 A;  1KUY A;  2PQ8 A;  2GAN A;  4B14 A;  4DJL A;  5K8O A;  4OIW A;  3TT2 A;  1CBX A;  2CIJ A;  3B3C A;  3K2K A;  3PZJ A;  1S60 A;  3IIB A;  3B3V A;  1B87 A;  3BI0 A;  1IYK A;  1Q2D A;  4MFZ A;  2VL1 A;  2FCK A;  4JJX A;  1Z4R A;  4B13 A;  2ODF A;  2PSW A;  3DDD A;  4FD6 A;  4A31 A;  4A38 A;  4F8Z A;  3KKW A;  4F9V A;  3GKR A;  1YR0 A;  3DR6 A;  1S5K A;  1X10 A;  1ZG7 A;  1DTD A;  2JEW A;  2C6C A;  3GYA A;  2B58 A;  3TOB A;  3TO9 A;  3VWD A;  3RYO A;  4C2X A;  2O4H A;  3WC5 A;  3ZJ0 A;  1GHE A;  1L0C A;  3PFE A;  4PK3 A;  3D2M A;  2IQ6 A;  1ZO0 A;  3CXP A;  2JDC A;  3KQX A;  4I49 A;  1XMT A;  3R96 A;  1KUV A;  4A39 A;  3PFO A;  4JXR A;  1CJW A;  4P4I A;  4F0Y A;  2DPS A;  3KL9 A;  2WYR A;  4A33 A;  5KTC A;  2BEI A;  1MK4 A;  4Z65 A;  2A4N A;  2R98 A;  4MMO A;  3F5B A;  4R8F A;  2AFU A;  4RUH A;  1XFO A;  5DWN A;  2P0W A;  2YNC C;  4UEZ A;  4YRH A;  4FAI A;  2YNE A;  3CDX A;  2PIY A;  4MCP A;  2B4D B;  5H86 A;  5IB0 A;  2VZY A;  2HUZ A;  5LYI A;  1ZLH A;  2PJ7 A;  2PJ8 A;  3EO4 A;  4IF5 A;  5A28 A;  3WC7 A;  2PIZ A;  1Y9W A;  2EVN A;  3S9M A;  5LRG A;  1EE3 P;  3K9T A;  2HQY A;  4UFW A;  1VHO A;  2Q7B A;  2ZEO A;  4A37 A;  2I00 A;  4KLW A;  1CPS A;  3D7G A;  4FWU A;  1QSR A;  4NJQ A;  5ISV A;  2HV2 A;  4KVM E;  1Y9K A;  3PGP A;  1ARL A;  2R8V A;  2CF4 A;  5F09 A;  2Q4Z A;  5G20 A;  1XEB A;  1LCP A;  4MCR A;  1Q7L A;  2I79 A;  4H89 A;  5AG5 A;  2PVW A;  2ZW4 A;  2PRB A;  3PRT A;  4IAV A;  3SJE A;  4G1P A;  1Z9U A;  4MXU A;  4YFJ A;  4L8A A;  5HMN A;  4TWE A;  4F9U A;  4OAE A;  2DF5 A;  3DLJ A;  1S7N A;  3NA6 A;  5F47 A;  5H84 A;  3VAT A;  5GCN A;  1YW6 A;  1TF8 A;  3PBB A;  1R57 A;  1Q2C A;  2V8H A;  2CNT A;  3I9S A;  1J4J A;  2FSR A;  4MCQ A;  1A2Z A;  1LRZ A;  4OAD A;  1MJ9 A;  1IY7 A;  1JQG A;  1XRY A;  4NGM A;  4UIA A;  5G1Z A;  2OU2 A;  2PC1 A;  4PXD A;  4B5P B;  1XMB A;  4II9 A;  2EBJ A;  4IHM A;  4Y49 C;  1FT7 A;  1Y7E A;  4XNH C;  3FH4 A;  2AFO A;  3QAH A;  4CGP A;  4R3L A;  1P4N A;  5KTD A;  3OWC A;  2CNS A;  2ZOF A;  2ZEF A;  2BCO A;  5AG4 A;  4KOR A;  4UCN A;  2VBQ A;  1KWM A;  2JBJ A;  4QUS A;  3FX6 A;  3IJ3 A;  3D7F A;  3V7Z A;  4Q36 A;  3PB7 X;  1CP6 A;  4DYO A;  5HXD A;  4XPD C;  4F6A A;  1QSM A;  2PCU A;  3FIX A;  2PE3 A;  1M4G A;  3CPX A;  4ONU A;  3D66 A;  2OB0 A;  1CPX A;  4A30 A;  4EVY A;  3RAM A;  3MN8 A;  4DNC A;  2J8N A;  3VAR A;  4PV6 A;  2J9A A;  5KTA A;  3PB4 X;  4CAV A;  1YK3 A;  3A9L A;  1V0C A;  3IU2 A;  3H8G A;  3T9Y A;  2O28 A;  2AFX A;  4PPZ A;  2EK8 A;  3JVN A;  1VIX A;  5IV0 A;  1AUG A;  2AFZ A;  5J8F A;  3GLJ A;  3FNC A;  3WR7 A;  2Z0Z A;  2B3V A;  2DEA A;  1CX8 A;  2CXA A;  2PRQ A;  2Y0M A;  3CPA A;  2FIW A;  4P4E A;  3IGR A;  4NJR A;  3W6S A;  2CTC A;  2B4B A;  1YVK A;  2XEJ A;  2WUU A;  1YVO A;  3T8W A;  4J3G A;  4OC4 A;  5C82 A;  1XOV A;  4AG7 A;  5J8C A;  5ELY A;  1S7F A;  5K8P A;  1YSJ A;  2F5I A;  3S9L A;  1QSN A;  4X8I A;  3IWE A;  4GXH A;  3F8K A;  5C88 A;  1DE4 C;  1RO5 A;  2ZED A;  4UFV A;  3ZZI A;  4BBH A;  2C6P A;  2PJ3 A;  1ZG8 A;  3NE7 A;  5LRJ A;  4KSF A;  3KQZ A;  8CPA A;  2FT0 A;  4AB7 A;  3SJX A;  4FBE A;  3RZA A;  3I3G A;  1YGH A;  2IL4 A;  5CNP A;  2OOT A;  2PJ9 A;  2BSW A;  1F57 A;  4UA3 A;  4R6T A;  3S6G A;  3H5Z A;  4O23 A;  4UEE A;  4WJB A;  4EFD A;  2O53 A;  2C1C A;  1BAV A;  2ZEE A;  2Z3N A;  3IEH A;  3K9U A;  4A2Z A;  2P6F A;  4KVX A;  3P2H A;  4MY0 A;  2VXK A;  2FE7 A;  4P44 A;  1BPM A;  3MRU A;  4CAW A;  4E0A A;  4ZGY B;  3KR5 A;  4MHP A;  1CP7 A;  2PJB A;  3PP9 A;  2GIV A;  3PB9 X;  4MFL A;  4NGN A;  4ONW A;  4UEF A;  3W6X A;  3BHX A;  4NFR A;  3SJF A;  3R9E A;  2Q44 A;  3TCV A;  1ARM A;  4P4D A;  4BMH A;  1MJB A;  4OLL A;  2V77 A;  3KGQ A;  2G3A A;  4CGL A;  3L2N A;  2VI7 A;  4KUA A;  3KR4 A;  2C6G A;  3EXN A;  5LRK A;  1BOB A;  5AG7 A;  4NCZ A;  4AVA A;  5BWA B;  5LYL A;  2PJ1 A;  2F8H A;  2B4D A;  1YME A;  4ZBG A;  3S9N A;  5JH9 A;  5DS0 A;  3FJU A;  1ON0 A;  3G8W A;  1KUX A;  3B3T A;  4IK2 A;  4C7H A;  5HVH A;  2JLM A;  3D3S A;  4FD7 A;  2F7V A;  4KOW A;  2IJZ A;  4IUS A;  4OC1 A;  4EME A;  3RO0 A;  2GU2 A;  3IO1 A;  2D4P A;  1M1D A;  4LQG A;  1GYT A;  1HEE A;  2B5G B;  3FF3 A;  4OC2 A;  3KZW A;  2XEG A;  4PXE A;  5F49 A;  4BIN A;  4P45 A;  2EWB A;  6CPA A;  1QST A;  1PU9 A;  3FBU A;  3IFE A;  3RNZ A;  4CS0 B;  2V8D A;  2IMO A;  2EUI A;  4KOY A;  1PUA A;  2ZOG A;  4ZX9 A;  2PR1 A;  3KI9 A;  4HNW B;  3CT9 A;  5JM6 A;  3JRU A;  7CPA A;  4QVT A;  1LAM A;  2OZU A;  4AVB A;  2EK9 A;  1ZLI A;  1TKF A;  2C27 A;  2PJ5 A;  4GS4 A;  3RBU A;  2BL1 A;  2R7H A;  4TNU A;  4FUU A;  1Z8X A;  3ISZ A;  4PXB A;  3QNV A;  4UWJ A;  4WWV A;  2Z3O A;  4BD9 A;  5F46 A;  3ISX A;  2GLJ A;  1YW4 A;  2Z3P A;  2PVV A;  2HC9 A;  1HDQ A;  2ZEN A;  4PSW A;  5LYD A;  1Z2L A;  1Z8T A;  4KS9 A;  4B5O A;  2EO8 A;  2Z3M A;  2WSA A;  1SQH A;  4KOT A;  5EMI A;  4QC6 A;  4YGO A;  1XBU A;  4UCP A;  4FD5 A;  2CTB A;  1AMP A;  5IX3 A;  4KOX A;  3SHP A;  4B5P A;  4CRZ B;  4B6Z A;  1NSA A;  2J8M A;  2QYV A;  2ZEP A;  5D29 A;  2Z11 A;  3PB6 X;  5JPH A;  2RC4 A;  4E8O A;  3B8G A;  3B7I A;  5JGF A;  4HPS A;  4U5Y A;  4ZYQ A;  5I0C A;  2ZEM A;  2PJ6 A;  5I4M A;  4GM5 A;  5E96 A;  1KZF A;  2Z3L A;  3BJ7 A;  3FED A;  4JXQ A;  3H8F A;  2G0B A;  4MHZ A;  4P4J A;  3GY9 A;  5IB9 A;  4HNY B;  4CAF A;  3QAY A;  3SXO A;  4MRI A;  4R57 A;  2P6E A;  1MJA A;  3TC8 A;  3CZX A;  4KOU A;  3JUW A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 3EFA A;  2QIR A;  1Z4E A;  2BUE A;  4CGO A;  3CXQ A;  3LD2 A;  4UWI A;  3QB8 A;  4R3K A;  2H5M A;  2OH1 A;  1RXT A;  5HH1 A;  4C2Z A;  2FL4 A;  2VQY A;  1M4D A;  2VZZ A;  1S7K A;  2KCW A;  2FXF A;  3MGD A;  1K4J A;  1IID A;  4NXY A;  4XPK A;  3SXN A;  4XNH B;  3LOD A;  4ORF A;  4CYQ A;  2G3T A;  5A27 A;  4JLY A;  3N7Z A;  1P0H A;  3F0A A;  2Q04 A;  4KLV A;  4HNX B;  3EC4 A;  2ATR A;  2FIA A;  2R1I A;  4C2Y A;  4H6U A;  2J8R A;  4UCM A;  2ZXV A;  4MY3 A;  4H6Z A;  1XIX A;  4MFJ A;  2PDO A;  1UFH A;  4CGN A;  2Z10 A;  2JDD A;  2NMT A;  1TIQ A;  4MJ8 A;  2ARH A;  2REF A;  1VHS A;  4B10 A;  1S7L A;  4MFQ A;  2CNM A;  4UFX A;  3V8I A;  3DSB A;  2Q0Y A;  3R1K A;  2GE3 A;  4C68 A;  2FS5 A;  3E0K A;  5EBV A;  3JTK A;  3S6K A;  1IIC A;  2ZW7 A;  3CXS A;  4F0X A;  4AVC A;  2ZW5 A;  1WWZ A;  1YX0 A;  3TTH A;  4MBU A;  1NSL A;  4MFK A;  2Q4V A;  4UBR A;  4KVO E;  3IU1 A;  2B5G A;  4CYP A;  2DXQ A;  3TO7 A;  4RI1 A;  4KOS A;  4PK2 A;  4B11 A;  4KZT A;  1Q2Y A;  3R9F A;  4CGM A;  2AJ6 A;  1I1D A;  5AG6 A;  3BLN A;  3FRM A;  1XE4 A;  4QBJ A;  2P6G A;  4CYO A;  2WPW A;  2YGW A;  4NF1 A;  4U9Y A;  4RS2 A;  3UY5 A;  4CAX A;  5FVJ A;  4Q38 A;  1I21 A;  2Q4Y A;  1NMT A;  5G22 A;  3BJ8 A;  4E2A A;  1N71 A;  2ZPA A;  4KUB A;  3FXT A;  2YNC A;  1FY7 A;  1Y7R A;  1WK4 A;  4LX9 A;  1S3Z A;  1IYL A;  2AE6 A;  2OZH A;  4X5K A;  4PSX A;  2VEZ A;  4M3S A;  1VKC A;  1B6B A;  2PR8 A;  4FD4 A;  3S6F A;  4U9Z A;  4KOV A;  2QML A;  3TOA A;  4QB9 A;  1OZP A;  5DWM A;  1CM0 A;  3S6H A;  2QEC A;  3W91 A;  1M44 A;  3D8P A;  4A32 A;  1NE9 A;  3TFY A;  5AGE A;  1BO4 A;  4NEX A;  4KSA A;  3FB3 A;  3FYN A;  3TO6 A;  4XPL A;  1XF8 A;  3G3S A;  4CAE A;  1QSO A;  4NSQ A;  2OZG A;  3P2F A;  3R9G A;  1M4I A;  2DPT A;  4MHD A;  4CYN A;  3DNS A;  4CRY B;  4HKF A;  2CY2 A;  3H4Q A;  1IB1 E;  3D2P A;  4L89 A;  2X7B A;  2WPX A;  5EC4 A;  3VWE A;  4B12 A;  3T90 A;  4MI4 A;  4Y49 B;  1I12 A;  4A95 A;  2Z3K A;  4R87 A;  1YRE A;  2JEV A;  1U6M A;  4JWP A;  4M85 A;  2B3U A;  5F48 A;  4R9M A;  1YLE A;  2K5T A;  4E8O A;  2YND A;  5G21 A;  4C7I A;  4K30 A;  4LUA A;  3R95 A;  5JQ4 A;  2REE A;  4XPD B;  3IWG A;  2D4O A;  4MFP A;  3C26 A;  3TE4 A;  4JD6 A;  2ZW6 A;  3EY5 A;  1KUY A;  2PQ8 A;  2GAN A;  4B14 A;  3TT2 A;  3PZJ A;  1S60 A;  1B87 A;  1IYK A;  1Q2D A;  4MFZ A;  2FCK A;  4JJX A;  1Z4R A;  4B13 A;  2PSW A;  3DDD A;  4A31 A;  4FD6 A;  3KKW A;  3GKR A;  1YR0 A;  3DR6 A;  1S5K A;  3GYA A;  2B58 A;  3TOB A;  3TO9 A;  3VWD A;  3RYO A;  4C2X A;  3ZJ0 A;  1GHE A;  1L0C A;  4PK3 A;  3D2M A;  3CXP A;  1ZO0 A;  4AVB A;  2JDC A;  4I49 A;  1XMT A;  3R96 A;  1KUV A;  4JXR A;  1CJW A;  4F0Y A;  2DPS A;  4A33 A;  5KTC A;  2BEI A;  1MK4 A;  2A4N A;  2R98 A;  3F5B A;  5DWN A;  2P0W A;  2YNC C;  4YRH A;  2YNE A;  2B4D B;  5H86 A;  5IB0 A;  2VZY A;  2HUZ A;  3EO4 A;  4IF5 A;  5A28 A;  1Y9W A;  2EVN A;  4UFW A;  2HQY A;  2Q7B A;  2I00 A;  4KLW A;  1QSR A;  5ISV A;  2HV2 A;  4KVM E;  1Y9K A;  3PGP A;  2R8V A;  5G20 A;  1XEB A;  2I79 A;  4H89 A;  5AG5 A;  2ZW4 A;  2PRB A;  1Z9U A;  4YFJ A;  4L8A A;  5HMN A;  4OAE A;  1S7N A;  5F47 A;  5H84 A;  5GCN A;  1R57 A;  1Q2C A;  2CNT A;  3I9S A;  1J4J A;  2FSR A;  1LRZ A;  4OAD A;  1MJ9 A;  5G1Z A;  2OU2 A;  2PC1 A;  4B5P B;  4II9 A;  4Y49 C;  4XNH C;  3QAH A;  4CGP A;  4R3L A;  1P4N A;  5KTD A;  3OWC A;  2CNS A;  5AG4 A;  4KOR A;  4UCN A;  2VBQ A;  4QUS A;  4Q36 A;  4XPD C;  4F6A A;  1QSM A;  3FIX A;  1M4G A;  4ONU A;  2OB0 A;  4A30 A;  4EVY A;  4DNC A;  2J8N A;  4PV6 A;  5KTA A;  4CAV A;  1YK3 A;  3A9L A;  1V0C A;  3IU2 A;  3T9Y A;  2O28 A;  3JVN A;  5IV0 A;  5J8F A;  3FNC A;  3WR7 A;  2Z0Z A;  2B3V A;  2CXA A;  2Y0M A;  2FIW A;  3IGR A;  3W6S A;  2B4B A;  1YVK A;  2WUU A;  1YVO A;  4J3G A;  5C82 A;  4AG7 A;  5J8C A;  1S7F A;  2F5I A;  1QSN A;  3IWE A;  3F8K A;  5C88 A;  4UFV A;  1RO5 A;  3ZZI A;  4BBH A;  3NE7 A;  4KSF A;  2FT0 A;  4AB7 A;  3I3G A;  1YGH A;  2IL4 A;  5CNP A;  4UA3 A;  2BSW A;  3S6G A;  3H5Z A;  2Z3N A;  3K9U A;  4A2Z A;  2P6F A;  4KVX A;  3P2H A;  4MY0 A;  2VXK A;  2FE7 A;  4CAW A;  4E0A A;  4ZGY B;  3PP9 A;  2GIV A;  4MFL A;  3W6X A;  3R9E A;  2Q44 A;  3TCV A;  4BMH A;  1MJB A;  4OLL A;  2G3A A;  4CGL A;  2VI7 A;  4KUA A;  3EXN A;  1BOB A;  5AG7 A;  4NCZ A;  4AVA A;  5BWA B;  2B4D A;  4ZBG A;  3G8W A;  1ON0 A;  1KUX A;  4C7H A;  2JLM A;  3D3S A;  4FD7 A;  4KOW A;  4IUS A;  2D4P A;  1M1D A;  2B5G B;  5F49 A;  1QST A;  1PU9 A;  3FBU A;  4CS0 B;  2EUI A;  4KOY A;  1PUA A;  2PR1 A;  4HNW B;  4QVT A;  2OZU A;  2C27 A;  4GS4 A;  2BL1 A;  2R7H A;  4UWJ A;  2Z3O A;  5F46 A;  2Z3P A;  4PSW A;  4KS9 A;  4B5O A;  2Z3M A;  2WSA A;  1SQH A;  4KOT A;  4QC6 A;  4YGO A;  4UCP A;  4FD5 A;  5IX3 A;  4KOX A;  3SHP A;  4B5P A;  4CRZ B;  2J8M A;  2Z11 A;  5JPH A;  2RC4 A;  3B8G A;  4U5Y A;  5I0C A;  5E96 A;  1KZF A;  2Z3L A;  3BJ7 A;  4JXQ A;  2G0B A;  3GY9 A;  4HNY B;  4CAF A;  3SXO A;  4R57 A;  2P6E A;  1MJA A;  4AG9 A;  4KOU A;  3JUW A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...