4A32A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 118
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a32A00
5AGEA 4UCNA 2WUUA 5AG7A 4CGNA 4UFWA 4CAFA 3H5ZA 4CYQA 4CYPA 5G22A 4UFXA 5AG5A 4B13A 4A95A 4UCMA 3IU2A 4UFVA 4C2XA 2YNEA 4C7IA 2YNDA 5G21A 4CAEA 4CYOA 3JTKA 4CGPA 5A28A 2YNCC 4B14A 4CGLA 4A33A 2YNCA 4A2ZA 4CGMA 4CGOA 5G1ZA 3IWEA 5G20A 4UCPA 4C7HA 4A31A 5A27A 4C2ZA 4A32A 4C68A 3IU1A 4B11A 4B10A 5AG6A 4C2YA 5AG4A 2WSAA 4A30A 4B12A 4BBHA 4CYNA
chains in the Genus database with same CATH superfamily
5KTDA 2Z11A 2PJBA 5D29A 1Z9UA 3B3CA 5AG7A 3RZAA 3D7FA 3VWEA 4B5PA 2ARHA 2RC4A 4P4EA 4WJBA 2ZEDA 3PB9X 3EXNA 2PJ8A 5AG5A 1XIXA 1Z8XA 2BOAA 2GLFA 2DPTA 2O4HA 3VH9A 3W91A 4CRZB 3H4QA 3BJ7A 3IO1A 3FECA 4RN7A 2PJ1A 2PR1A 1BLLE 5F48A 4CGPA 3B8GA 1KUVA 5F46A 1XMBA 4ZX8A 4CGOA 2QECA 2GIVA 2ZW7A 3DR6A 3D2MA 3IWWA 3F5BA 3RNZA 2Z0ZA 1WK4A 1ELMP 4FAIA 4NJRA 1CP7A 2F7VA 2Q7SA 4NF1A 4HNYB 3QAYA 2XEIA 4FD4A 4H6ZA 4E0AA 2FIWA 2REEA 3H5ZA 3I3GA 3NH5A 3PP9A 4A37A 2DEAA 3PB6X 2OR4A 3P2HA 3DNSA 2F8HA 2G0BA 4OIWA 4CRYB 5F09A 5KTAA 1YLEA 4L89A 1BAVA 1F2PA 5EMIA 4P4JA 2J8NA 3N7ZA 4BMHA 2CTCA 3CPAA 5G20A 5A27A 2HB6A 3B3TA 4MFQA 2EO8A 2NYQA 2J8MA 5K8OA 1HDQA 3NH4A 1MJBA 2QVPA 4UA3A 2DF5A 5J1QA 1LAPA 2ZOFA 4Z65A 2B3UA 2OZHA 1Y7RA 2EUIA 3GKRA 4M6GA 4MI4A 4PXDA 5C82A 1DE4C 4OC2A 4LX9A 2RFHA 1KZFA 1BPNA 3B3VA 4UEFA 5ISVA 4R6TA 4A95A 3D67A 3BHXA 4M3SA 2PJCA 4QC6A 1P0HA 1KWMA 2YNEA 2Q4ZA 1N71A 1MK4A 4KVOE 4P45A 3IIBA 3PFEA 2ANPA 4KOSA 2Q04A 2EWBA 4FD6A 5IB0A 4F0XA 1QSMA 4MFLA 4OC1A 4P44A 3FEDA 5F47A 4OC4A 2K5TA 5LRKA 1U6MA 1YX0A 3LWUA 2BO9A 1DTDA 1BOBA 2ZENA 5LYFA 1TKFA 3TT2A 1VKCA 4L8AA 3E0KA 3SXOA 5H86A 4PV6A 1PCAA 4IK2A 2R7HA 4UCNA 3P2FA 4I49A 4MFJA 1ZLIA 3FJUA 5LYIA 3GLJA 4PQAA 4JJXA 3H8GA 2ZW5A 2Q51A 4ZX9A 3F0AA 3JTKA 2CNTA 2PRBA 2AFMA 3KASA 4PXEA 4UIBA 4QBJA 4ZGYB 4LUAA 3SJGA 2CNMA 3RO0A 2FXFA 3ZJ0A 2B4BA 2PJ2A 4UCPA 3L2NA 3TE4A 3PZJA 1M4LA 3PBEA 3KKWA 1I1DA 4HKFA 1Z8TA 4KVME 4KOUA 1QSNA 1Y0RA 3NE8A 2CIJA 2WYRA 3HLPA 3KHZA 1X12A 2Q4YA 3B35A 1XEBA 4DNCA 5THWA 3SXNA 4BD9A 1YQEA 2ZEGA 3UY5A 4A94A 2WUUA 2ZEFA 1M4IA 2C27A 4OIDA 2Z3PA 3WT4A 4KZTA 4GS4A 4MHNA 4QUSA 8CPAA 3KQXA 2FSRA 4MFZA 1QSRA 4NGQA 2V77A 1UFHA 1YVOA 2GLJA 2R1IA 4UF4A 1M4GA 4R57A 2C6GA 3QNVA 2FT0A 4R8FA 5HVGA 1FNOA 3D2PA 1MJ9A 1AYEA 2Q44A 1F2OA 4B5OA 1Q2YA 3K9TA 3N5FA 4UIAA 5G1ZA 3VATA 1XOVA 4GXHA 3R95A 3RAMA 4C2ZA 3S6FA 4PXCA 1TF9A 3EC4A 4B11A 4A38A 5IV0A 3D66A 1BO4A 4E8OA 4F9UA 1CJWA 4XPLA 4B12A 4AG7A 3PB4X 2R98A 4KS9A 2NSMA 1ZLHA 5JQ4A 3GIUA 4X2TA 1IICA 5I4MA 1Z8LA 2AFXA 2FVGA 2ZXVA 4HNWB 5E96A 3R9FA 3TTHA 5K8PA 2BEIA 3S6KA 2AFZA 2WPWA 1XJOA 3PEIA 4PPZA 3IU2A 3RBUA 1ARMA 3PB7X 3FX6A 2GU2A 1P4NA 3G8WA 4OC3A 4NFRA 3WABA 1ON0A 4OMEA 2GANA 4NGRA 1CPSA 4MJ8A 4MFPA 4ONWA 3PB8X 3SJXA 3ISXA 3FNCA 2PIZA 2ZPAA 4J3GA 2HV2A 4KSIA 5HXDA 2F5IA 4YFJA 3V7ZA 3QB8A 5CNPA 2PJAA 2GFQA 4ZY0A 4JWPA 4PSWA 2J8RA 2V8VA 3D7GA 4YGOA 3LACA 4Q38A 3TO7A 3V8IA 2YGWA 2REFA 4B5PB 4CGNA 1S7KA 3T8WA 2PVWA 1VIXA 1AMPA 3IC1A 3MGDA 4JD6A 5HVFA 2J9AA 4XPKA 3BI0A 4ONUA 3TO9A 2AFWA 1VHSA 4F0YA 4AXVA 2WZNA 2ZW6A 4JZ0A 4C2XA 4ORFA 4C7IA 5JH9A 1LAMA 2ZEEA 3CXSA 1M4DA 1Y9KA 2PSWA 3FF3A 3PFOA 3T9YA 2R8VA 3SI0A 1A2ZA 1R3NA 3WR7A 4Q36A 4R3KA 5JGFA 1IB1E 3S9LA 3LODA 1ZG7A 4U9YA 3GUXA 1CP6A 4CAWA 3TOBA 2OOTA 2AFSA 4KOVA 3FRMA 4NGNA 4OC5A 1PUAA 2VBQA 3VARA 2IMOA 1B6BA 2D4PA 3JRUA 4MHYA 3SI1A 4OKOA 2Y0MA 5LRGA 1S5KA 1TKJA 4DYOA 4RI1A 2ZEOA 5J8CA 4O23A 3NA6A 2ZW4A 1OZPA 4MMOA 3VWDA 1XF8A 4X8IA 1Z2LA 3T90A 1XBUA 5K8NA 4CYOA 2B58A 4NGPA 5HMNA 3CDXA 4ZY1A 1XFOA 1IYKA 2G9DA 2JBJA 2VQYA 3TCVA 3IWEA 3DGVA 3SHPA 3TFYA 2X7BA 4IUSA 4WWVA 1KUYA 5AG6A 2V8DA 2PJ9A 4NJQA 1PYTB 4EVYA 2FCKA 1XMTA 1L0CA 3S6GA 2CNSA 4JXQA 2EBJA 2FS5A 3NFZA 4KOWA 4M6IA 2ZEMA 1CPXA 2P6EA 2FE7A 4PK3A 3FMCA 6CPAA 3B3SA 5LYLA 1NSLA 4MCQA 3D8PA 2YNDA 3PGPA 4HPSA 1TF8A 2JEWA 4P10A 1LANA 1Y9WA 2PE3A 2Z3OA 4FD5A 4B14A 1QQ9A 2ZELA 2AFUA 3PBBA 4JYWA 5ELYA 3EY5A 4MCRA 4C68A 2Z10A 3IU1A 5KTCA 1S60A 1IY7A 1Q7LA 4A30A 1IOIA 3NE7A 1KUXA 2PCUA 4X3RA 3S6HA 1SQHA 3B2YA 4P6YA 4TNUA 2WPXA 2Q0YA 4UFWA 3FVLA 2Q7BA 4NXYA 3TX8A 2FL4A 3GY9A 4RUHA 5LRJA 4MY0A 4R7MA 2B4DA 3ZZIA 4XNHC 2VL1A 2OH1A 2EK8A 2POKA 3FBUA 4KOTA 4MY3A 4P4DA 2YNCC 3JUWA 2H5MA 2IQ6A 4JXRA 4Q7AA 4A33A 4JLYA 3B3WA 3R1KA 4KSAA 4NSQA 1TKHA 4AG9A 5H84A 2XEFA 4PSXA 2B5GA 5C88A 2QJ8A 3D4UA 3DSBA 3KQZA 1Y7EA 1S7NA 4CS0B 3ISZA 3LMSA 4ZBGA 5GCNA 1LCPA 4A39A 4IHMA 1B87A 4FBEA 2VXKA 3QAHA 7CPAA 4OLLA 4EFDA 3W6SA 3CXPA 2P0WA 1EE3P 1FT7A 2BCOA 4CYPA 1YK3A 1YVKA 1YW4A 2I3CA 4R3LA 4UFVA 1PU9A 2BL1A 3BJ8A 3D7HA 4U9ZA 3R96A 3W6XA 2PJ7A 5A28A 4K30A 3FIXA 3WC7A 3R9GA 4A2ZA 1S3ZA 2JLMA 3K9UA 4ZI6A 4EWTA 2B5GB 2Z3NA 1UWYA 1XRYA 3IEHA 3KHXA 4CAVA 2Z3MA 1XE4A 4FUUA 2O53A 2ZEPA 3MN8A 4MXUA 3WC5A 1NMTA 4DUKA 1FY7A 5AGEA 1Q2CA 3DR8A 1QSTA 2O28A 2PJ5A 2DXQA 2I79A 3KI9A 1ZO0A 2BUEA 4CPAA 1AUGA 4KORA 4P4BA 4H2KA 4F8ZA 4UEEA 3H8EA 4R76A 2PIYA 5IX3A 4II9A 2QMLA 2GREA 4Y49C 1YMEA 2VZYA 3FEEA 3KZWA 4XPDC 4E2AA 2JDCA 2PC1A 2PVVA 1X10A 2CY2A 1I21A 1Y0YA 2OB0A 2PJ4A 4KVXA 2OZGA 1ELLP 2G3AA 4NCZA 2CXAA 2AJ6A 2PQ8A 3FB3A 4P4IA 4U5YA 5EC4A 4B10A 2P6FA 4C2YA 1LFWA 5I0CA 1IYLA 1IGBA 4K3NA 4YRHA 2ODFA 5DWNA 4EMEA 3MRUA 4NEXA 3KL9A 5D8NA 3I9SA 4PXBA 5JM6A 4KSFA 1VHEA 2B3VA 4CYQA 2PR8A 5G22A 3H8FA 4ZY2A 4QVTA 2IJZA 1RTQA 4IF5A 3I1UA 4OC0A 1CM0A 5HVHA 4CAEA 5BWAB 1HEEA 4F9VA 3D68A 3KR4A 2JEVA 3NH8A 1CX8A 2YNCA 2QIRA 3FXTA 4UBRA 4AVBA 3BLNA 3SJFA 1TXRA 1Z5RA 1I12A 3F8KA 2PJ3A 1TIQA 2FIAA 3FYNA 4MHPA 4A32A 5IB9A 5JPHA 4KOXA 2C6CA 3PRTA 5K8MA 1WWZA 1ARLA 2AE6A 2DPSA 4KLWA 1J4JA 1ZG9A 3FH4A 2D4OA 4BBHA 4M85A 4MRIA 3EO4A 4G1PA 4CYNA 5CBMA 3LD2A 1YLOA 4LQGA 3S9NA 1R57A 4AVCA 2JDDA 3TOAA 1BPMA 4MBUA 4MHDA 4CAXA 4UFXA 3DDDA 5HH1A 3IGRA 3IJ3A 1IU8A 2VI7A 4UCMA 1LOKA 3BI1A 2Q4VA 3CT9A 4QB9A 2KCWA 3KR5A 1YREA 4KUAA 4XNHB 1M44A 4R87A 4CGLA 3S9MA 2PJ6A 3CXQA 3EFAA 4C7HA 4A31A 4FWUA 3G3SA 4KUBA 2I00A 4UWIA 3GYAA 3HUVA 1F57A 1IIDA 1Z4EA 1Z8WA 2WSAA 4MCPA 4GM5A 1S7LA 1GHEA 4MFKA 3IFEA 1YW6A 2BSWA 4KLVA 2P6GA 2VEZA 2ZOGA 3D7DA 4TWEA 4CAFA 4PK2A 3SJEA 2PJ0A 2Q43A 1VHOA 2RB7A 4NGSA 1ZG8A 2NMTA 4OP4A 5G21A 2HQYA 3WC6A 1QMUA 1JWQA 2PRQA 4AVAA 2VZZA 3CPXA 2CTBA 3K2KA 4CGMA 1M1DA 4FD7A 4R9MA 4LQ6A 4KOYA 1K4JA 4NGMA 4RS2A 5CPAA 4YWYA 2ATRA 3GB0A 1CG2A 2AFOA 4HNXB 1MJAA 1GYTA 2G3TA 1QSOA 2GE3A 4IAVA 3TC8A 2CF4A 2OZUA 4OAEA 4MCSA 4OADA 2HUZA 4BINA 2EK9A 1HDUA 2Z3KA 3CZXA 2C6PA 2XEJA 3TO6A 3BXMA 3R9EA 4ZYQA 1YR0A 1R43A 1Q2DA 2C1CA 1S7FA 1YGHA 2V8GA 1RXTA 2ZEHA 4W9YA 4YU9A 4B6ZA 4H6UA 2V8HA 5LYDA 5J8FA 4B13A 3A9LA 1LRZA 4M6HA 5DS0A 2A4NA 2ABZA 1NSAA 1OBRA 2B4DB 3JVNA 1IOFA 4P4FA 4Y49B 4H89A 2HC9A 4X5KA 4XPDB 2QYVA 1NE9A 2JBKA 4MHZA 1RO5A 5DWMA 5F49A 4AB7A 3C26A 3IWGA 1VGYA 5EBVA 3SI2A 4NGTA 2PDOA 4DJLA 4F6AA 2Z3LA 1V0CA 5FVJA 3B7IA 2XEGA 1JQGA 2EVNA 3DLJA 3RYOA 3OWCA 5AG4A 1Z4RA 2IL4A 3D3SA 3KGQA 3V38A 1CBXA 1YSJA 4UEZA 4UWJA 1H8LA 2OU2A
chains in the Genus database with same CATH topology
5KTDA 2Z11A 1Z9UA 5AG7A 3VWEA 4B5PA 2ARHA 2RC4A 5AG5A 3EXNA 1XIXA 2DPTA 4CRZB 3W91A 3H4QA 3BJ7A 5F48A 4CGPA 2PR1A 3B8GA 1KUVA 5F46A 4CGOA 2QECA 2GIVA 2ZW7A 3DR6A 3D2MA 3F5BA 2Z0ZA 1WK4A 4NF1A 4HNYB 4H6ZA 4FD4A 4E0AA 2FIWA 2REEA 3H5ZA 3I3GA 3PP9A 3P2HA 3DNSA 2G0BA 4CRYB 5KTAA 1YLEA 4L89A 2J8NA 3N7ZA 4BMHA 5G20A 5A27A 4MFQA 2J8MA 1MJBA 4UA3A 2B3UA 2OZHA 1Y7RA 2EUIA 3GKRA 4MI4A 5C82A 4LX9A 5ISVA 1KZFA 4A95A 4M3SA 4QC6A 1P0HA 2YNEA 1N71A 1MK4A 4KVOE 4KOSA 2Q04A 4FD6A 5IB0A 4F0XA 1QSMA 4MFLA 5F47A 2K5TA 1U6MA 1YX0A 1BOBA 3TT2A 1VKCA 4L8AA 3E0KA 3SXOA 5H86A 4PV6A 2R7HA 4UCNA 3P2FA 4I49A 4MFJA 4JJXA 2ZW5A 3F0AA 3JTKA 2CNTA 2PRBA 4QBJA 4ZGYB 4LUAA 2CNMA 2FXFA 3ZJ0A 2B4BA 4UCPA 3TE4A 3PZJA 3KKWA 4HKFA 1I1DA 4KVME 4KOUA 1QSNA 2Q4YA 4DNCA 1XEBA 3SXNA 3UY5A 2WUUA 1M4IA 2C27A 2Z3PA 4KZTA 4GS4A 4QUSA 4MFZA 2FSRA 1QSRA 1UFHA 1YVOA 2R1IA 1M4GA 4R57A 2FT0A 3D2PA 1MJ9A 2Q44A 4B5OA 1Q2YA 5G1ZA 3R95A 4C2ZA 3S6FA 3EC4A 4B11A 5IV0A 1BO4A 4E8OA 1CJWA 4XPLA 4B12A 4AG7A 2R98A 4KS9A 5JQ4A 1IICA 5E96A 2ZXVA 4HNWB 3R9FA 3TTHA 2BEIA 3S6KA 2WPWA 3IU2A 1P4NA 3G8WA 1ON0A 2GANA 4MJ8A 4MFPA 3FNCA 2ZPAA 4J3GA 2HV2A 2F5IA 4YFJA 3QB8A 5CNPA 4JWPA 4PSWA 2J8RA 4YGOA 4Q38A 3TO7A 3V8IA 2YGWA 2REFA 4B5PB 4CGNA 1S7KA 4JD6A 3MGDA 4XPKA 4F0YA 4ONUA 3TO9A 1VHSA 2ZW6A 4C2XA 4ORFA 4C7IA 3CXSA 1M4DA 1Y9KA 2PSWA 3T9YA 2R8VA 3WR7A 4Q36A 4R3KA 1IB1E 3LODA 4U9YA 4CAWA 3TOBA 4KOVA 3FRMA 1PUAA 2VBQA 1B6BA 2D4PA 2Y0MA 1S5KA 4RI1A 5J8CA 2ZW4A 1OZPA 3VWDA 1XF8A 3T90A 4CYOA 2B58A 5HMNA 1IYKA 2VQYA 3TCVA 3IWEA 3SHPA 3TFYA 2X7BA 4IUSA 1KUYA 5AG6A 4EVYA 2FCKA 1XMTA 1L0CA 2CNSA 4JXQA 2FS5A 4KOWA 2P6EA 2FE7A 4PK3A 1NSLA 3D8PA 2YNDA 3PGPA 1Y9WA 2Z3OA 4B14A 4FD5A 3EY5A 4C68A 2Z10A 3IU1A 5KTCA 1S60A 4A30A 3NE7A 1KUXA 3S6HA 1SQHA 2WPXA 2Q0YA 4UFWA 2Q7BA 4NXYA 2FL4A 3GY9A 4MY0A 2B4DA 3ZZIA 4XNHC 2OH1A 4KOTA 4MY3A 3FBUA 2YNCC 3JUWA 2H5MA 4JXRA 4A33A 4JLYA 3R1KA 4KSAA 4NSQA 4AG9A 5H84A 4PSXA 2B5GA 5C88A 3DSBA 4CS0B 1S7NA 4ZBGA 5GCNA 1B87A 2VXKA 3QAHA 4OLLA 3W6SA 3CXPA 2P0WA 4CYPA 1YK3A 1YVKA 4R3LA 4UFVA 1PU9A 2BL1A 3BJ8A 4U9ZA 3R96A 3W6XA 5A28A 4K30A 3FIXA 3R9GA 4A2ZA 1S3ZA 2JLMA 3K9UA 2B5GB 2Z3NA 4CAVA 2Z3MA 1XE4A 1NMTA 1FY7A 5AGEA 1Q2CA 3DR8A 1QSTA 2O28A 2DXQA 2I79A 1ZO0A 2BUEA 4KORA 5IX3A 4II9A 2QMLA 4Y49C 2VZYA 4XPDC 4E2AA 2JDCA 2PC1A 2CY2A 1I21A 2OB0A 4KVXA 2OZGA 2G3AA 4NCZA 4U5YA 2CXAA 2AJ6A 2PQ8A 3FB3A 5EC4A 3S6GA 4B10A 4C2YA 2P6FA 5I0CA 1IYLA 4YRHA 5DWNA 4NEXA 3I9SA 4KSFA 2B3VA 4CYQA 2PR8A 5G22A 4QVTA 4IF5A 1CM0A 4CAEA 5BWAB 2JEVA 2YNCA 3FXTA 2QIRA 4UBRA 4AVBA 3BLNA 1I12A 3F8KA 1TIQA 2FIAA 3FYNA 4A32A 5JPHA 4KOXA 1WWZA 2AE6A 2DPSA 4KLWA 1J4JA 4BBHA 2D4OA 4M85A 3EO4A 4CYNA 3LD2A 1R57A 4AVCA 2JDDA 3TOAA 4MBUA 4MHDA 4CAXA 4UFXA 3DDDA 5HH1A 3IGRA 2VI7A 4UCMA 2Q4VA 4QB9A 2KCWA 4XNHB 1YREA 4KUAA 1M44A 4R87A 4CGLA 3EFAA 3CXQA 4C7HA 4A31A 3G3SA 4KUBA 2I00A 4UWIA 3GYAA 1IIDA 1Z4EA 2WSAA 1S7LA 1GHEA 4MFKA 2BSWA 4KLVA 2P6GA 2VEZA 4CAFA 4PK2A 2NMTA 5G21A 2HQYA 4AVAA 2VZZA 4CGMA 1M1DA 4FD7A 4R9MA 4KOYA 1K4JA 4RS2A 2ATRA 4HNXB 1MJAA 2GE3A 2G3TA 1QSOA 2OZUA 4OAEA 4OADA 2HUZA 2Z3KA 3TO6A 3R9EA 1YR0A 1Q2DA 1S7FA 1YGHA 1RXTA 4H6UA 5J8FA 4B13A 3A9LA 1LRZA 2A4NA 2B4DB 3JVNA 4Y49B 4H89A 4X5KA 4XPDB 1NE9A 1RO5A 5DWMA 5F49A 4AB7A 3C26A 3IWGA 5EBVA 2PDOA 4F6AA 2Z3LA 1V0CA 5FVJA 2EVNA 3RYOA 5AG4A 3OWCA 1Z4RA 2IL4A 3D3SA 4UWJA 2OU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGE A;  4UCN A;  2WUU A;  5AG7 A;  4CGN A;  4UFW A;  4CAF A;  3H5Z A;  4CYQ A;  4CYP A;  5G22 A;  4UFX A;  5AG5 A;  4B13 A;  4A95 A;  4UCM A;  3IU2 A;  4UFV A;  4C2X A;  2YNE A;  4C7I A;  2YND A;  5G21 A;  4CAE A;  4CYO A;  3JTK A;  4CGP A;  5A28 A;  2YNC C;  4B14 A;  4CGL A;  4A33 A;  2YNC A;  4A2Z A;  4CGM A;  4CGO A;  5G1Z A;  3IWE A;  5G20 A;  4UCP A;  4C7H A;  4A31 A;  5A27 A;  4C2Z A;  4A32 A;  4C68 A;  3IU1 A;  4B11 A;  4B10 A;  5AG6 A;  4C2Y A;  5AG4 A;  2WSA A;  4A30 A;  4B12 A;  4BBH A;  4CYN A; 
#chains in the Genus database with same CATH topology
 5KTD A;  2Z11 A;  2PJB A;  5D29 A;  1Z9U A;  3B3C A;  5AG7 A;  3RZA A;  3D7F A;  3VWE A;  4B5P A;  2ARH A;  2RC4 A;  4P4E A;  4WJB A;  2ZED A;  3PB9 X;  3EXN A;  2PJ8 A;  5AG5 A;  1XIX A;  1Z8X A;  2BOA A;  2GLF A;  2DPT A;  2O4H A;  3VH9 A;  3W91 A;  4CRZ B;  3H4Q A;  3BJ7 A;  3IO1 A;  3FEC A;  4RN7 A;  2PJ1 A;  2PR1 A;  1BLL E;  5F48 A;  4CGP A;  3B8G A;  1KUV A;  5F46 A;  1XMB A;  4ZX8 A;  4CGO A;  2QEC A;  2GIV A;  2ZW7 A;  3DR6 A;  3D2M A;  3IWW A;  3F5B A;  3RNZ A;  2Z0Z A;  1WK4 A;  1ELM P;  4FAI A;  4NJR A;  1CP7 A;  2F7V A;  2Q7S A;  4NF1 A;  4HNY B;  3QAY A;  2XEI A;  4FD4 A;  4H6Z A;  4E0A A;  2FIW A;  2REE A;  3H5Z A;  3I3G A;  3NH5 A;  3PP9 A;  4A37 A;  2DEA A;  3PB6 X;  2OR4 A;  3P2H A;  3DNS A;  2F8H A;  2G0B A;  4OIW A;  4CRY B;  5F09 A;  5KTA A;  1YLE A;  4L89 A;  1BAV A;  1F2P A;  5EMI A;  4P4J A;  2J8N A;  3N7Z A;  4BMH A;  2CTC A;  3CPA A;  5G20 A;  5A27 A;  2HB6 A;  3B3T A;  4MFQ A;  2EO8 A;  2NYQ A;  2J8M A;  5K8O A;  1HDQ A;  3NH4 A;  1MJB A;  2QVP A;  4UA3 A;  2DF5 A;  5J1Q A;  1LAP A;  2ZOF A;  4Z65 A;  2B3U A;  2OZH A;  1Y7R A;  2EUI A;  3GKR A;  4M6G A;  4MI4 A;  4PXD A;  5C82 A;  1DE4 C;  4OC2 A;  4LX9 A;  2RFH A;  1KZF A;  1BPN A;  3B3V A;  4UEF A;  5ISV A;  4R6T A;  4A95 A;  3D67 A;  3BHX A;  4M3S A;  2PJC A;  4QC6 A;  1P0H A;  1KWM A;  2YNE A;  2Q4Z A;  1N71 A;  1MK4 A;  4KVO E;  4P45 A;  3IIB A;  3PFE A;  2ANP A;  4KOS A;  2Q04 A;  2EWB A;  4FD6 A;  5IB0 A;  4F0X A;  1QSM A;  4MFL A;  4OC1 A;  4P44 A;  3FED A;  5F47 A;  4OC4 A;  2K5T A;  5LRK A;  1U6M A;  1YX0 A;  3LWU A;  2BO9 A;  1DTD A;  1BOB A;  2ZEN A;  5LYF A;  1TKF A;  3TT2 A;  1VKC A;  4L8A A;  3E0K A;  3SXO A;  5H86 A;  4PV6 A;  1PCA A;  4IK2 A;  2R7H A;  4UCN A;  3P2F A;  4I49 A;  4MFJ A;  1ZLI A;  3FJU A;  5LYI A;  3GLJ A;  4PQA A;  4JJX A;  3H8G A;  2ZW5 A;  2Q51 A;  4ZX9 A;  3F0A A;  3JTK A;  2CNT A;  2PRB A;  2AFM A;  3KAS A;  4PXE A;  4UIB A;  4QBJ A;  4ZGY B;  4LUA A;  3SJG A;  2CNM A;  3RO0 A;  2FXF A;  3ZJ0 A;  2B4B A;  2PJ2 A;  4UCP A;  3L2N A;  3TE4 A;  3PZJ A;  1M4L A;  3PBE A;  3KKW A;  1I1D A;  4HKF A;  1Z8T A;  4KVM E;  4KOU A;  1QSN A;  1Y0R A;  3NE8 A;  2CIJ A;  2WYR A;  3HLP A;  3KHZ A;  1X12 A;  2Q4Y A;  3B35 A;  1XEB A;  4DNC A;  5THW A;  3SXN A;  4BD9 A;  1YQE A;  2ZEG A;  3UY5 A;  4A94 A;  2WUU A;  2ZEF A;  1M4I A;  2C27 A;  4OID A;  2Z3P A;  3WT4 A;  4KZT A;  4GS4 A;  4MHN A;  4QUS A;  8CPA A;  3KQX A;  2FSR A;  4MFZ A;  1QSR A;  4NGQ A;  2V77 A;  1UFH A;  1YVO A;  2GLJ A;  2R1I A;  4UF4 A;  1M4G A;  4R57 A;  2C6G A;  3QNV A;  2FT0 A;  4R8F A;  5HVG A;  1FNO A;  3D2P A;  1MJ9 A;  1AYE A;  2Q44 A;  1F2O A;  4B5O A;  1Q2Y A;  3K9T A;  3N5F A;  4UIA A;  5G1Z A;  3VAT A;  1XOV A;  4GXH A;  3R95 A;  3RAM A;  4C2Z A;  3S6F A;  4PXC A;  1TF9 A;  3EC4 A;  4B11 A;  4A38 A;  5IV0 A;  3D66 A;  1BO4 A;  4E8O A;  4F9U A;  1CJW A;  4XPL A;  4B12 A;  4AG7 A;  3PB4 X;  2R98 A;  4KS9 A;  2NSM A;  1ZLH A;  5JQ4 A;  3GIU A;  4X2T A;  1IIC A;  5I4M A;  1Z8L A;  2AFX A;  2FVG A;  2ZXV A;  4HNW B;  5E96 A;  3R9F A;  3TTH A;  5K8P A;  2BEI A;  3S6K A;  2AFZ A;  2WPW A;  1XJO A;  3PEI A;  4PPZ A;  3IU2 A;  3RBU A;  1ARM A;  3PB7 X;  3FX6 A;  2GU2 A;  1P4N A;  3G8W A;  4OC3 A;  4NFR A;  3WAB A;  1ON0 A;  4OME A;  2GAN A;  4NGR A;  1CPS A;  4MJ8 A;  4MFP A;  4ONW A;  3PB8 X;  3SJX A;  3ISX A;  3FNC A;  2PIZ A;  2ZPA A;  4J3G A;  2HV2 A;  4KSI A;  5HXD A;  2F5I A;  4YFJ A;  3V7Z A;  3QB8 A;  5CNP A;  2PJA A;  2GFQ A;  4ZY0 A;  4JWP A;  4PSW A;  2J8R A;  2V8V A;  3D7G A;  4YGO A;  3LAC A;  4Q38 A;  3TO7 A;  3V8I A;  2YGW A;  2REF A;  4B5P B;  4CGN A;  1S7K A;  3T8W A;  2PVW A;  1VIX A;  1AMP A;  3IC1 A;  3MGD A;  4JD6 A;  5HVF A;  2J9A A;  4XPK A;  3BI0 A;  4ONU A;  3TO9 A;  2AFW A;  1VHS A;  4F0Y A;  4AXV A;  2WZN A;  2ZW6 A;  4JZ0 A;  4C2X A;  4ORF A;  4C7I A;  5JH9 A;  1LAM A;  2ZEE A;  3CXS A;  1M4D A;  1Y9K A;  2PSW A;  3FF3 A;  3PFO A;  3T9Y A;  2R8V A;  3SI0 A;  1A2Z A;  1R3N A;  3WR7 A;  4Q36 A;  4R3K A;  5JGF A;  1IB1 E;  3S9L A;  3LOD A;  1ZG7 A;  4U9Y A;  3GUX A;  1CP6 A;  4CAW A;  3TOB A;  2OOT A;  2AFS A;  4KOV A;  3FRM A;  4NGN A;  4OC5 A;  1PUA A;  2VBQ A;  3VAR A;  2IMO A;  1B6B A;  2D4P A;  3JRU A;  4MHY A;  3SI1 A;  4OKO A;  2Y0M A;  5LRG A;  1S5K A;  1TKJ A;  4DYO A;  4RI1 A;  2ZEO A;  5J8C A;  4O23 A;  3NA6 A;  2ZW4 A;  1OZP A;  4MMO A;  3VWD A;  1XF8 A;  4X8I A;  1Z2L A;  3T90 A;  1XBU A;  5K8N A;  4CYO A;  2B58 A;  4NGP A;  5HMN A;  3CDX A;  4ZY1 A;  1XFO A;  1IYK A;  2G9D A;  2JBJ A;  2VQY A;  3TCV A;  3IWE A;  3DGV A;  3SHP A;  3TFY A;  2X7B A;  4IUS A;  4WWV A;  1KUY A;  5AG6 A;  2V8D A;  2PJ9 A;  4NJQ A;  1PYT B;  4EVY A;  2FCK A;  1XMT A;  1L0C A;  3S6G A;  2CNS A;  4JXQ A;  2EBJ A;  2FS5 A;  3NFZ A;  4KOW A;  4M6I A;  2ZEM A;  1CPX A;  2P6E A;  2FE7 A;  4PK3 A;  3FMC A;  6CPA A;  3B3S A;  5LYL A;  1NSL A;  4MCQ A;  3D8P A;  2YND A;  3PGP A;  4HPS A;  1TF8 A;  2JEW A;  4P10 A;  1LAN A;  1Y9W A;  2PE3 A;  2Z3O A;  4FD5 A;  4B14 A;  1QQ9 A;  2ZEL A;  2AFU A;  3PBB A;  4JYW A;  5ELY A;  3EY5 A;  4MCR A;  4C68 A;  2Z10 A;  3IU1 A;  5KTC A;  1S60 A;  1IY7 A;  1Q7L A;  4A30 A;  1IOI A;  3NE7 A;  1KUX A;  2PCU A;  4X3R A;  3S6H A;  1SQH A;  3B2Y A;  4P6Y A;  4TNU A;  2WPX A;  2Q0Y A;  4UFW A;  3FVL A;  2Q7B A;  4NXY A;  3TX8 A;  2FL4 A;  3GY9 A;  4RUH A;  5LRJ A;  4MY0 A;  4R7M A;  2B4D A;  3ZZI A;  4XNH C;  2VL1 A;  2OH1 A;  2EK8 A;  2POK A;  3FBU A;  4KOT A;  4MY3 A;  4P4D A;  2YNC C;  3JUW A;  2H5M A;  2IQ6 A;  4JXR A;  4Q7A A;  4A33 A;  4JLY A;  3B3W A;  3R1K A;  4KSA A;  4NSQ A;  1TKH A;  4AG9 A;  5H84 A;  2XEF A;  4PSX A;  2B5G A;  5C88 A;  2QJ8 A;  3D4U A;  3DSB A;  3KQZ A;  1Y7E A;  1S7N A;  4CS0 B;  3ISZ A;  3LMS A;  4ZBG A;  5GCN A;  1LCP A;  4A39 A;  4IHM A;  1B87 A;  4FBE A;  2VXK A;  3QAH A;  7CPA A;  4OLL A;  4EFD A;  3W6S A;  3CXP A;  2P0W A;  1EE3 P;  1FT7 A;  2BCO A;  4CYP A;  1YK3 A;  1YVK A;  1YW4 A;  2I3C A;  4R3L A;  4UFV A;  1PU9 A;  2BL1 A;  3BJ8 A;  3D7H A;  4U9Z A;  3R96 A;  3W6X A;  2PJ7 A;  5A28 A;  4K30 A;  3FIX A;  3WC7 A;  3R9G A;  4A2Z A;  1S3Z A;  2JLM A;  3K9U A;  4ZI6 A;  4EWT A;  2B5G B;  2Z3N A;  1UWY A;  1XRY A;  3IEH A;  3KHX A;  4CAV A;  2Z3M A;  1XE4 A;  4FUU A;  2O53 A;  2ZEP A;  3MN8 A;  4MXU A;  3WC5 A;  1NMT A;  4DUK A;  1FY7 A;  5AGE A;  1Q2C A;  3DR8 A;  1QST A;  2O28 A;  2PJ5 A;  2DXQ A;  2I79 A;  3KI9 A;  1ZO0 A;  2BUE A;  4CPA A;  1AUG A;  4KOR A;  4P4B A;  4H2K A;  4F8Z A;  4UEE A;  3H8E A;  4R76 A;  2PIY A;  5IX3 A;  4II9 A;  2QML A;  2GRE A;  4Y49 C;  1YME A;  2VZY A;  3FEE A;  3KZW A;  4XPD C;  4E2A A;  2JDC A;  2PC1 A;  2PVV A;  1X10 A;  2CY2 A;  1I21 A;  1Y0Y A;  2OB0 A;  2PJ4 A;  4KVX A;  2OZG A;  1ELL P;  2G3A A;  4NCZ A;  2CXA A;  2AJ6 A;  2PQ8 A;  3FB3 A;  4P4I A;  4U5Y A;  5EC4 A;  4B10 A;  2P6F A;  4C2Y A;  1LFW A;  5I0C A;  1IYL A;  1IGB A;  4K3N A;  4YRH A;  2ODF A;  5DWN A;  4EME A;  3MRU A;  4NEX A;  3KL9 A;  5D8N A;  3I9S A;  4PXB A;  5JM6 A;  4KSF A;  1VHE A;  2B3V A;  4CYQ A;  2PR8 A;  5G22 A;  3H8F A;  4ZY2 A;  4QVT A;  2IJZ A;  1RTQ A;  4IF5 A;  3I1U A;  4OC0 A;  1CM0 A;  5HVH A;  4CAE A;  5BWA B;  1HEE A;  4F9V A;  3D68 A;  3KR4 A;  2JEV A;  3NH8 A;  1CX8 A;  2YNC A;  2QIR A;  3FXT A;  4UBR A;  4AVB A;  3BLN A;  3SJF A;  1TXR A;  1Z5R A;  1I12 A;  3F8K A;  2PJ3 A;  1TIQ A;  2FIA A;  3FYN A;  4MHP A;  4A32 A;  5IB9 A;  5JPH A;  4KOX A;  2C6C A;  3PRT A;  5K8M A;  1WWZ A;  1ARL A;  2AE6 A;  2DPS A;  4KLW A;  1J4J A;  1ZG9 A;  3FH4 A;  2D4O A;  4BBH A;  4M85 A;  4MRI A;  3EO4 A;  4G1P A;  4CYN A;  5CBM A;  3LD2 A;  1YLO A;  4LQG A;  3S9N A;  1R57 A;  4AVC A;  2JDD A;  3TOA A;  1BPM A;  4MBU A;  4MHD A;  4CAX A;  4UFX A;  3DDD A;  5HH1 A;  3IGR A;  3IJ3 A;  1IU8 A;  2VI7 A;  4UCM A;  1LOK A;  3BI1 A;  2Q4V A;  3CT9 A;  4QB9 A;  2KCW A;  3KR5 A;  1YRE A;  4KUA A;  4XNH B;  1M44 A;  4R87 A;  4CGL A;  3S9M A;  2PJ6 A;  3CXQ A;  3EFA A;  4C7H A;  4A31 A;  4FWU A;  3G3S A;  4KUB A;  2I00 A;  4UWI A;  3GYA A;  3HUV A;  1F57 A;  1IID A;  1Z4E A;  1Z8W A;  2WSA A;  4MCP A;  4GM5 A;  1S7L A;  1GHE A;  4MFK A;  3IFE A;  1YW6 A;  2BSW A;  4KLV A;  2P6G A;  2VEZ A;  2ZOG A;  3D7D A;  4TWE A;  4CAF A;  4PK2 A;  3SJE A;  2PJ0 A;  2Q43 A;  1VHO A;  2RB7 A;  4NGS A;  1ZG8 A;  2NMT A;  4OP4 A;  5G21 A;  2HQY A;  3WC6 A;  1QMU A;  1JWQ A;  2PRQ A;  4AVA A;  2VZZ A;  3CPX A;  2CTB A;  3K2K A;  4CGM A;  1M1D A;  4FD7 A;  4R9M A;  4LQ6 A;  4KOY A;  1K4J A;  4NGM A;  4RS2 A;  5CPA A;  4YWY A;  2ATR A;  3GB0 A;  1CG2 A;  2AFO A;  4HNX B;  1MJA A;  1GYT A;  2G3T A;  1QSO A;  2GE3 A;  4IAV A;  3TC8 A;  2CF4 A;  2OZU A;  4OAE A;  4MCS A;  4OAD A;  2HUZ A;  4BIN A;  2EK9 A;  1HDU A;  2Z3K A;  3CZX A;  2C6P A;  2XEJ A;  3TO6 A;  3BXM A;  3R9E A;  4ZYQ A;  1YR0 A;  1R43 A;  1Q2D A;  2C1C A;  1S7F A;  1YGH A;  2V8G A;  1RXT A;  2ZEH A;  4W9Y A;  4YU9 A;  4B6Z A;  4H6U A;  2V8H A;  5LYD A;  5J8F A;  4B13 A;  3A9L A;  1LRZ A;  4M6H A;  5DS0 A;  2A4N A;  2ABZ A;  1NSA A;  1OBR A;  2B4D B;  3JVN A;  1IOF A;  4P4F A;  4Y49 B;  4H89 A;  2HC9 A;  4X5K A;  4XPD B;  2QYV A;  1NE9 A;  2JBK A;  4MHZ A;  1RO5 A;  5DWM A;  5F49 A;  4AB7 A;  3C26 A;  3IWG A;  1VGY A;  5EBV A;  3SI2 A;  4NGT A;  2PDO A;  4DJL A;  4F6A A;  2Z3L A;  1V0C A;  5FVJ A;  3B7I A;  2XEG A;  1JQG A;  2EVN A;  3DLJ A;  3RYO A;  3OWC A;  5AG4 A;  1Z4R A;  2IL4 A;  3D3S A;  3KGQ A;  3V38 A;  1CBX A;  1YSJ A;  4UEZ A;  4UWJ A;  1H8L A;  2OU2 A; 
#chains in the Genus database with same CATH homology
 5KTD A;  2Z11 A;  1Z9U A;  5AG7 A;  3VWE A;  4B5P A;  2ARH A;  2RC4 A;  5AG5 A;  3EXN A;  1XIX A;  2DPT A;  4CRZ B;  3W91 A;  3H4Q A;  3BJ7 A;  5F48 A;  4CGP A;  2PR1 A;  3B8G A;  1KUV A;  5F46 A;  4CGO A;  2QEC A;  2GIV A;  2ZW7 A;  3DR6 A;  3D2M A;  3F5B A;  2Z0Z A;  1WK4 A;  4NF1 A;  4HNY B;  4H6Z A;  4FD4 A;  4E0A A;  2FIW A;  2REE A;  3H5Z A;  3I3G A;  3PP9 A;  3P2H A;  3DNS A;  2G0B A;  4CRY B;  5KTA A;  1YLE A;  4L89 A;  2J8N A;  3N7Z A;  4BMH A;  5G20 A;  5A27 A;  4MFQ A;  2J8M A;  1MJB A;  4UA3 A;  2B3U A;  2OZH A;  1Y7R A;  2EUI A;  3GKR A;  4MI4 A;  5C82 A;  4LX9 A;  5ISV A;  1KZF A;  4A95 A;  4M3S A;  4QC6 A;  1P0H A;  2YNE A;  1N71 A;  1MK4 A;  4KVO E;  4KOS A;  2Q04 A;  4FD6 A;  5IB0 A;  4F0X A;  1QSM A;  4MFL A;  5F47 A;  2K5T A;  1U6M A;  1YX0 A;  1BOB A;  3TT2 A;  1VKC A;  4L8A A;  3E0K A;  3SXO A;  5H86 A;  4PV6 A;  2R7H A;  4UCN A;  3P2F A;  4I49 A;  4MFJ A;  4JJX A;  2ZW5 A;  3F0A A;  3JTK A;  2CNT A;  2PRB A;  4QBJ A;  4ZGY B;  4LUA A;  2CNM A;  2FXF A;  3ZJ0 A;  2B4B A;  4UCP A;  3TE4 A;  3PZJ A;  3KKW A;  4HKF A;  1I1D A;  4KVM E;  4KOU A;  1QSN A;  2Q4Y A;  4DNC A;  1XEB A;  3SXN A;  3UY5 A;  2WUU A;  1M4I A;  2C27 A;  2Z3P A;  4KZT A;  4GS4 A;  4QUS A;  4MFZ A;  2FSR A;  1QSR A;  1UFH A;  1YVO A;  2R1I A;  1M4G A;  4R57 A;  2FT0 A;  3D2P A;  1MJ9 A;  2Q44 A;  4B5O A;  1Q2Y A;  5G1Z A;  3R95 A;  4C2Z A;  3S6F A;  3EC4 A;  4B11 A;  5IV0 A;  1BO4 A;  4E8O A;  1CJW A;  4XPL A;  4B12 A;  4AG7 A;  2R98 A;  4KS9 A;  5JQ4 A;  1IIC A;  5E96 A;  2ZXV A;  4HNW B;  3R9F A;  3TTH A;  2BEI A;  3S6K A;  2WPW A;  3IU2 A;  1P4N A;  3G8W A;  1ON0 A;  2GAN A;  4MJ8 A;  4MFP A;  3FNC A;  2ZPA A;  4J3G A;  2HV2 A;  2F5I A;  4YFJ A;  3QB8 A;  5CNP A;  4JWP A;  4PSW A;  2J8R A;  4YGO A;  4Q38 A;  3TO7 A;  3V8I A;  2YGW A;  2REF A;  4B5P B;  4CGN A;  1S7K A;  4JD6 A;  3MGD A;  4XPK A;  4F0Y A;  4ONU A;  3TO9 A;  1VHS A;  2ZW6 A;  4C2X A;  4ORF A;  4C7I A;  3CXS A;  1M4D A;  1Y9K A;  2PSW A;  3T9Y A;  2R8V A;  3WR7 A;  4Q36 A;  4R3K A;  1IB1 E;  3LOD A;  4U9Y A;  4CAW A;  3TOB A;  4KOV A;  3FRM A;  1PUA A;  2VBQ A;  1B6B A;  2D4P A;  2Y0M A;  1S5K A;  4RI1 A;  5J8C A;  2ZW4 A;  1OZP A;  3VWD A;  1XF8 A;  3T90 A;  4CYO A;  2B58 A;  5HMN A;  1IYK A;  2VQY A;  3TCV A;  3IWE A;  3SHP A;  3TFY A;  2X7B A;  4IUS A;  1KUY A;  5AG6 A;  4EVY A;  2FCK A;  1XMT A;  1L0C A;  2CNS A;  4JXQ A;  2FS5 A;  4KOW A;  2P6E A;  2FE7 A;  4PK3 A;  1NSL A;  3D8P A;  2YND A;  3PGP A;  1Y9W A;  2Z3O A;  4B14 A;  4FD5 A;  3EY5 A;  4C68 A;  2Z10 A;  3IU1 A;  5KTC A;  1S60 A;  4A30 A;  3NE7 A;  1KUX A;  3S6H A;  1SQH A;  2WPX A;  2Q0Y A;  4UFW A;  2Q7B A;  4NXY A;  2FL4 A;  3GY9 A;  4MY0 A;  2B4D A;  3ZZI A;  4XNH C;  2OH1 A;  4KOT A;  4MY3 A;  3FBU A;  2YNC C;  3JUW A;  2H5M A;  4JXR A;  4A33 A;  4JLY A;  3R1K A;  4KSA A;  4NSQ A;  4AG9 A;  5H84 A;  4PSX A;  2B5G A;  5C88 A;  3DSB A;  4CS0 B;  1S7N A;  4ZBG A;  5GCN A;  1B87 A;  2VXK A;  3QAH A;  4OLL A;  3W6S A;  3CXP A;  2P0W A;  4CYP A;  1YK3 A;  1YVK A;  4R3L A;  4UFV A;  1PU9 A;  2BL1 A;  3BJ8 A;  4U9Z A;  3R96 A;  3W6X A;  5A28 A;  4K30 A;  3FIX A;  3R9G A;  4A2Z A;  1S3Z A;  2JLM A;  3K9U A;  2B5G B;  2Z3N A;  4CAV A;  2Z3M A;  1XE4 A;  1NMT A;  1FY7 A;  5AGE A;  1Q2C A;  3DR8 A;  1QST A;  2O28 A;  2DXQ A;  2I79 A;  1ZO0 A;  2BUE A;  4KOR A;  5IX3 A;  4II9 A;  2QML A;  4Y49 C;  2VZY A;  4XPD C;  4E2A A;  2JDC A;  2PC1 A;  2CY2 A;  1I21 A;  2OB0 A;  4KVX A;  2OZG A;  2G3A A;  4NCZ A;  4U5Y A;  2CXA A;  2AJ6 A;  2PQ8 A;  3FB3 A;  5EC4 A;  3S6G A;  4B10 A;  4C2Y A;  2P6F A;  5I0C A;  1IYL A;  4YRH A;  5DWN A;  4NEX A;  3I9S A;  4KSF A;  2B3V A;  4CYQ A;  2PR8 A;  5G22 A;  4QVT A;  4IF5 A;  1CM0 A;  4CAE A;  5BWA B;  2JEV A;  2YNC A;  3FXT A;  2QIR A;  4UBR A;  4AVB A;  3BLN A;  1I12 A;  3F8K A;  1TIQ A;  2FIA A;  3FYN A;  4A32 A;  5JPH A;  4KOX A;  1WWZ A;  2AE6 A;  2DPS A;  4KLW A;  1J4J A;  4BBH A;  2D4O A;  4M85 A;  3EO4 A;  4CYN A;  3LD2 A;  1R57 A;  4AVC A;  2JDD A;  3TOA A;  4MBU A;  4MHD A;  4CAX A;  4UFX A;  3DDD A;  5HH1 A;  3IGR A;  2VI7 A;  4UCM A;  2Q4V A;  4QB9 A;  2KCW A;  4XNH B;  1YRE A;  4KUA A;  1M44 A;  4R87 A;  4CGL A;  3EFA A;  3CXQ A;  4C7H A;  4A31 A;  3G3S A;  4KUB A;  2I00 A;  4UWI A;  3GYA A;  1IID A;  1Z4E A;  2WSA A;  1S7L A;  1GHE A;  4MFK A;  2BSW A;  4KLV A;  2P6G A;  2VEZ A;  4CAF A;  4PK2 A;  2NMT A;  5G21 A;  2HQY A;  4AVA A;  2VZZ A;  4CGM A;  1M1D A;  4FD7 A;  4R9M A;  4KOY A;  1K4J A;  4RS2 A;  2ATR A;  4HNX B;  1MJA A;  2GE3 A;  2G3T A;  1QSO A;  2OZU A;  4OAE A;  4OAD A;  2HUZ A;  2Z3K A;  3TO6 A;  3R9E A;  1YR0 A;  1Q2D A;  1S7F A;  1YGH A;  1RXT A;  4H6U A;  5J8F A;  4B13 A;  3A9L A;  1LRZ A;  2A4N A;  2B4D B;  3JVN A;  4Y49 B;  4H89 A;  4X5K A;  4XPD B;  1NE9 A;  1RO5 A;  5DWM A;  5F49 A;  4AB7 A;  3C26 A;  3IWG A;  5EBV A;  2PDO A;  4F6A A;  2Z3L A;  1V0C A;  5FVJ A;  2EVN A;  3RYO A;  5AG4 A;  3OWC A;  1Z4R A;  2IL4 A;  3D3S A;  4UWJ A;  2OU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...