4A32A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 118
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a32A00
4B11A 4CYQA 5AG4A 2WUUA 5AG5A 5G22A 3IU2A 4C2XA 4UFVA 4UCPA 4UFWA 4C68A 4A2ZA 4CGLA 4A32A 5G20A 4CYNA 4CYPA 3IWEA 2YNEA 3H5ZA 4A33A 5A27A 2YNCA 5AG6A 3IU1A 5AGEA 4B10A 4B12A 2WSAA 4C7IA 5A28A 4UCMA 2YNDA 2YNCC 4UCNA 4C2YA 3JTKA 4UFXA 4CAEA 4CYOA 4A31A 4B14A 5G21A 4CGNA 4CGOA 5AG7A 4A95A 4CAFA 4CGPA 4C2ZA 4BBHA 4A30A 4B13A 5G1ZA 4C7HA 4CGMA
chains in the Genus database with same CATH superfamily
3BI0A 4MFKA 4JLYA 3T90A 3RZAA 5AG4A 2DXQA 1YQEA 2Q44A 4NGPA 3EY5A 3IWWA 2IQ6A 1YSJA 2REFA 4CYPA 4IF5A 1FNOA 3KQXA 4OADA 2Z3MA 4R57A 1MK4A 4RI1A 1Q7LA 4KORA 2B4DA 4ZI6A 4NGNA 4QC6A 4NGQA 4AG7A 2D4OA 1UFHA 2EBJA 4B12A 2CTBA 4IK2A 4L89A 3S9MA 4ZX8A 2DPTA 2KCWA 2ZEOA 1ZO0A 2XEFA 4BD9A 2ZEHA 3ZZIA 2DPSA 3TE4A 2FT0A 5IX3A 1TXRA 3R96A 4R8FA 1CBXA 5LYIA 3PB7X 1IYKA 5K8OA 1IGBA 1LOKA 2I3CA 3TC8A 3LWUA 5G22A 2VEZA 3IWGA 3N7ZA 4AVAA 1S3ZA 2FVGA 2R8VA 5CNPA 3C26A 5K8NA 4UCPA 3JRUA 3DLJA 3QB8A 2PSWA 5G20A 3WC7A 2B58A 5LYFA 4FD6A 4UBRA 2Y0MA 2A4NA 3S6HA 2QECA 4P4FA 1OZPA 5EBVA 3VARA 5KTDA 2R7HA 3PRTA 2PR1A 3D2PA 4JZ0A 4UCNA 4EMEA 3JTKA 5THWA 4NCZA 1GHEA 2WYRA 1I21A 3PBBA 4HPSA 1JQGA 4PSXA 2ZW7A 1XJOA 2P6GA 3GUXA 3PFEA 3DSBA 1NSLA 3W6XA 1ELLP 3OWCA 3FJUA 4K3NA 2CY2A 2PC1A 4PV6A 1P4NA 4F9UA 4TNUA 5K8PA 1CPSA 1QQ9A 1M4LA 2G0BA 2EVNA 1P0HA 1F2OA 5HVHA 1YMEA 2OH1A 4UEFA 5KTCA 5LRJA 2ZXVA 1JWQA 4MFPA 3RAMA 1XMTA 1LANA 3RO0A 4PQAA 4DYOA 2B5GB 2JEVA 3PBEA 1AUGA 5E96A 2AFWA 2Q4YA 2VI7A 3A9LA 3K2KA 3B35A 3PB4X 2EUIA 3PGPA 5J8CA 4MCSA 4AVCA 4C2YA 4GXHA 2C27A 4JXRA 1IIDA 2JBJA 2P6FA 3HLPA 3BHXA 3D3SA 3VWEA 4YWYA 1Z4EA 1CG2A 4P10A 4ZGYB 3V38A 2AFMA 1XBUA 6CPAA 1IICA 4MMOA 5G1ZA 2FS5A 1WWZA 3NH8A 2Z0ZA 4KSFA 2EK9A 2FIWA 3PEIA 3GIUA 3WC5A 4JXQA 4A94A 2DEAA 2CNTA 1XOVA 4F6AA 2FL4A 1ZLIA 4A32A 4KUAA 3CPXA 2AFSA 3BLNA 4UIBA 5AG6A 4NFRA 1ARLA 4OIDA 1M44A 4CAVA 4YFJA 3IC1A 1YLOA 5HXDA 1Y0YA 2RC4A 4I49A 2O28A 1M4IA 4B5OA 1TIQA 2PJ4A 4UIAA 3B3VA 2GE3A 3PB6X 1XEBA 4XPDB 2PIYA 2ZW4A 4EWTA 1LAMA 4MY0A 4GM5A 4CS0B 4NGMA 2B3UA 3MGDA 4CRZB 1MJBA 5JH9A 3W91A 2BL1A 4RS2A 2VZZA 2J8MA 8CPAA 4R6TA 1Y9WA 2GLFA 1U6MA 2CNSA 3SI0A 1RXTA 3SJEA 3G8WA 2G9DA 2PVWA 4ORFA 1S5KA 1BPNA 1K4JA 1RTQA 4OMEA 4OIWA 1CJWA 3KQZA 3FX6A 3FECA 4OP4A 1H8LA 2AFXA 3BI1A 3CPAA 1WK4A 1QSRA 1KUYA 2C6GA 2R98A 4MY3A 3B3TA 3S6GA 4CRYB 4MHPA 1IYLA 3B7IA 3SJGA 4MI4A 4ZBGA 1TKFA 1YGHA 3HUVA 4KOWA 4MHNA 1NE9A 3F0AA 4HNXB 4KOSA 4LQ6A 5EMIA 4XPDC 4BBHA 2GLJA 3ZJ0A 3FBUA 4R76A 1KZFA 1MJ9A 2WUUA 3B3WA 3D8PA 3FIXA 3RNZA 1CM0A 4KLWA 2X7BA 2O4HA 4U5YA 4LX9A 2J9AA 4UFWA 3WR7A 3SJXA 5LYLA 3FEDA 4KUBA 1XRYA 3KHZA 4RN7A 4CYNA 1Q2DA 2Q04A 2B5GA 2VL1A 2H5MA 1R3NA 1Y9KA 2BCOA 5A27A 5C88A 2F5IA 2PRQA 4GS4A 1PU9A 2WSAA 2AE6A 3PZJA 3D4UA 4MXUA 4P45A 1IB1E 2IL4A 4MHZA 4R7MA 3ISZA 5D8NA 4A39A 1BLLE 1TKHA 3P2HA 4KVXA 1S7LA 1BOBA 2XEIA 2Z3LA 4AB7A 3G3SA 3LACA 4C2ZA 4PPZA 3IIBA 2PJ1A 4PXEA 5HVFA 1X10A 3D68A 4FWUA 3VH9A 3SHPA 4C7HA 2P6EA 4RUHA 3H8GA 3NH4A 5JGFA 4BINA 4OAEA 1ZG9A 2V8VA 4C68A 3LMSA 4KOXA 3D7GA 5KTAA 3IWEA 2GIVA 2F8HA 1XFOA 4NSQA 2PJ5A 4L8AA 4FUUA 3FF3A 2PJ2A 4R87A 3GKRA 5A28A 5F09A 4R3LA 5F46A 1LRZA 2B4BA 3H8EA 2PJCA 3KKWA 4P6YA 4QB9A 3JUWA 4B14A 5CPAA 5ELYA 3E0KA 1YLEA 1CX8A 3WABA 2I00A 4M6HA 3B2YA 3S9NA 4P4DA 3QAYA 4J3GA 1TF8A 2PDOA 2OZHA 4AXVA 1NSAA 1YX0A 3IU2A 4U9ZA 4II9A 2PQ8A 1ZG8A 2Q7BA 3PB9X 3VATA 3H5ZA 3R9EA 2PJ9A 2QMLA 3K9TA 4MFJA 3FB3A 3PB8X 4UCMA 3D7HA 4H6ZA 2Q51A 1Z8TA 2DF5A 2K5TA 3R1KA 3QNVA 4A31A 1R57A 5FVJA 5G21A 2F7VA 4TWEA 4CGOA 5ISVA 5JQ4A 1ZG7A 3V7ZA 1Y0RA 3GYAA 2ZEFA 1ARMA 5I4MA 1FY7A 2JDDA 3TX8A 2OOTA 2XEJA 5JM6A 4KOVA 4M6GA 4A37A 4H6UA 4KLVA 2FE7A 2PE3A 4UA3A 2R1IA 2Q43A 3GB0A 4P4IA 4E0AA 5F47A 4ZY1A 1KUVA 3CT9A 4EVYA 1S7NA 2I79A 4NJRA 4O23A 1XMBA 5J8FA 1Z8LA 3SI1A 1X12A 1F2PA 3DR6A 5IB0A 4B6ZA 1NMTA 5C82A 1AYEA 1YW6A 2G3TA 2ZW6A 4OC1A 4P4BA 2J8NA 3R95A 3TTHA 2GANA 2JLMA 3LD2A 3WC6A 2HB6A 2IJZA 4UF4A 4X8IA 1IOFA 3I1UA 2V8DA 4NXYA 4Q36A 3DDDA 4M85A 3NH5A 2V8GA 1XF8A 1Q2YA 1KWMA 3WT4A 1BPMA 3T8WA 4MRIA 2OR4A 4XPLA 4A30A 3CXPA 3D67A 4B13A 3FMCA 4OLLA 4CGMA 1ZLHA 3H4QA 3NFZA 5AG5A 1AMPA 4OC0A 4NGTA 3RBUA 4C2XA 2PJ3A 1KUXA 2EK8A 3D2MA 5H84A 4B5PB 1HDUA 2BSWA 3H8FA 3IO1A 5LYDA 4Z65A 1TKJA 4OC3A 3FYNA 4YRHA 4CAWA 1ELMP 4ONWA 3TOBA 1SQHA 5JPHA 3TFYA 3NE8A 2ZEMA 1B6BA 3S6FA 3W6SA 4QBJA 5BWAB 1IY7A 2Q0YA 2FCKA 2PJ0A 2J8RA 4M3SA 2OU2A 1J4JA 4PK2A 5AG7A 2QVPA 2QIRA 4WJBA 2BEIA 4JWPA 2P0WA 3NE7A 3MN8A 4P4JA 4YGOA 4CAXA 4KVME 2ZPAA 3KGQA 3R9GA 2Q7SA 1QSOA 1UWYA 2CIJA 4KVOE 2JEWA 1S60A 3RYOA 1DTDA 2FIAA 4X2TA 4OKOA 1M4GA 2PJ7A 2YNEA 4F9VA 3CZXA 2BO9A 4PK3A 5DWMA 5F48A 4A33A 1RO5A 1Z4RA 4NGRA 3KR4A 2Z3KA 2ZW5A 4MFZA 2Q4VA 2ZOGA 3S6KA 4MHYA 3JVNA 4CAEA 1M1DA 1TF9A 4PSWA 2B3VA 3FRMA 4DNCA 2CF4A 4NEXA 4Y49B 3FH4A 7CPAA 3NA6A 3DGVA 5IV0A 4R3KA 1QMUA 4AG9A 4MCQA 1VKCA 2CTCA 2HQYA 1QSNA 4FD7A 4KSIA 2GREA 1QSTA 3N5FA 3TO6A 5LRKA 4FBEA 4UFVA 2IMOA 4A2ZA 4JD6A 3P2FA 1LFWA 2BOAA 4UWJA 2OB0A 1N71A 1Z8XA 3UY5A 2FXFA 2AFZA 2ZEGA 4G1PA 4DJLA 5HMNA 1Q2CA 1S7KA 4HNYB 3KL9A 4ZYQA 4CYOA 2ZEPA 4AVBA 4QVTA 3I9SA 3T9YA 1CP7A 1MJAA 3TCVA 2VQYA 1I12A 2Z10A 3PP9A 3K9UA 4A38A 5J1QA 3KASA 4E8OA 3FEEA 3EXNA 1PUAA 2AFOA 2BUEA 2PCUA 1VHEA 2ZOFA 3FXTA 3QAHA 5EC4A 4ZY2A 3TO9A 4Y49C 4UWIA 2POKA 4F0YA 2PJAA 3V8IA 2C6CA 2QYVA 3MRUA 5K8MA 3EC4A 4R9MA 1R43A 1ON0A 2VXKA 2Z3OA 4HNWB 4P44A 4B5PA 4Q38A 4MCPA 3EO4A 1QSMA 4IAVA 5AGEA 4KOTA 4B10A 1Z9UA 5DS0A 4Q7AA 4W9YA 2D4PA 3IGRA 1YVKA 2ARHA 1B87A 3CXQA 2QJ8A 1V0CA 2ABZA 2ZEEA 4MCRA 3DR8A 4ONUA 4UEZA 2HUZA 1YR0A 1HDQA 4CGNA 4F0XA 3B8GA 1DE4C 3SJFA 2WPWA 2GU2A 3TO7A 1A2ZA 5H86A 2NSMA 1PCAA 4JYWA 3PFOA 4JJXA 2PJBA 5I0CA 3TT2A 4MJ8A 5F49A 4K30A 4QUSA 2G3AA 1EE3P 4PXBA 3D7DA 5IB9A 1CPXA 4OC5A 4ZY0A 1GYTA 4PXDA 3F8KA 2YGWA 3IFEA 4MBUA 4F8ZA 5LRGA 2Z3NA 1VIXA 1OBRA 1Z8WA 2C1CA 2B4DB 2PRBA 4H2KA 4KSAA 4KS9A 2PR8A 4PXCA 4EFDA 1L0CA 2YNDA 1PYTB 2YNCC 3R9FA 3IEHA 2ZEDA 5HH1A 1HEEA 3CXSA 2Z3PA 4NF1A 2V8HA 4BMHA 1VHOA 2VZYA 1VHSA 2EWBA 3BJ8A 4IUSA 2ANPA 5D29A 3B3CA 4HKFA 2NYQA 4OC4A 5CBMA 2FSRA 3KZWA 3TOAA 4A95A 1Y7EA 4CYQA 1YK3A 1IOIA 4KZTA 4NJQA 2WZNA 1I1DA 2AFUA 4XNHB 2EO8A 2V77A 1CP6A 1XE4A 3I3GA 2RFHA 2JBKA 3BJ7A 3S9LA 3IU1A 2NMTA 1F57A 1Z5RA 1BAVA 3GY9A 4OC2A 2AJ6A 4X3RA 5HVGA 4MHDA 1YREA 1LCPA 4IHMA 4UFXA 4X5KA 4E2AA 3SXOA 2PIZA 3IJ3A 3KR5A 2ODFA 4FD4A 3FNCA 2C6PA 1YVOA 2OZUA 4UEEA 3KI9A 5DWNA 2RB7A 4CAFA 2JDCA 4CGPA 1BO4A 1LAPA 2ZENA 3F5BA 2HV2A 4FD5A 3KHXA 4CGLA 2PVVA 2ZELA 3B3SA 4B11A 2XEGA 3FVLA 1IU8A 1Z2LA 2REEA 2O53A 4MFQA 4DUKA 1M4DA 4MFLA 2Z11A 2VBQA 4CPAA 3LODA 3VWDA 1XIXA 4H89A 4P4EA 4YU9A 4XNHC 2HC9A 4KOYA 3ISXA 1VGYA 2YNCA 5GCNA 1FT7A 4FAIA 2Q4ZA 3DNSA 3L2NA 1S7FA 3D66A 3D7FA 4XPKA 4C7IA 4LUAA 3BXMA 4U9YA 3GLJA 2CXAA 4KOUA 4M6IA 2PJ8A 2OZGA 2CNMA 3SXNA 1YW4A 3CDXA 2GFQA 1Y7RA 4NGSA 3SI2A 2PJ6A 4WWVA 2ATRA 4LQGA 2WPXA 3EFAA 4ZX9A
chains in the Genus database with same CATH topology
5AG4A 4MFKA 4JLYA 3T90A 2DXQA 2Q44A 3EY5A 2REFA 4CYPA 4IF5A 4R57A 4OADA 2Z3MA 1MK4A 4RI1A 4KORA 2B4DA 4QC6A 4AG7A 2D4OA 1UFHA 4B12A 4L89A 2DPTA 2KCWA 1ZO0A 3ZZIA 2DPSA 3TE4A 2FT0A 5IX3A 3R96A 1IYKA 5G22A 2VEZA 3IWGA 3N7ZA 4AVAA 1S3ZA 2R8VA 5CNPA 3C26A 4UCPA 3QB8A 2PSWA 5G20A 2B58A 4FD6A 4UBRA 2Y0MA 2A4NA 3S6HA 2QECA 5EBVA 1OZPA 5KTDA 2R7HA 2PR1A 3D2PA 4UCNA 3JTKA 4NCZA 1GHEA 1I21A 1NSLA 4PSXA 2ZW7A 3W6XA 2P6GA 3DSBA 3OWCA 2CY2A 2PC1A 4PV6A 1P4NA 2G0BA 2EVNA 1P0HA 2OH1A 5KTCA 2ZXVA 4MFPA 1XMTA 2B5GB 2JEVA 5E96A 2Q4YA 2VI7A 3A9LA 2EUIA 3PGPA 5J8CA 4AVCA 4C2YA 2C27A 4JXRA 1IIDA 2P6FA 3D3SA 3VWEA 1Z4EA 4ZGYB 1IICA 5G1ZA 2FS5A 1WWZA 2Z0ZA 4KSFA 2FIWA 4JXQA 2CNTA 4F6AA 2FL4A 4A32A 4KUAA 3BLNA 5AG6A 4CAVA 1M44A 4YFJA 2RC4A 4I49A 2O28A 1M4IA 4B5OA 1TIQA 2GE3A 1XEBA 4XPDB 2ZW4A 4MY0A 4CS0B 2B3UA 3MGDA 4CRZB 1MJBA 3W91A 2BL1A 4RS2A 2VZZA 2J8MA 1Y9WA 1U6MA 2CNSA 1RXTA 3G8WA 4ORFA 1S5KA 1K4JA 1CJWA 1WK4A 1QSRA 1KUYA 4CRYB 2R98A 4MY3A 3S6GA 1IYLA 4MI4A 4ZBGA 1YGHA 4KOWA 1NE9A 3F0AA 4HNXB 4KOSA 4XPDC 4BBHA 3ZJ0A 3FBUA 1KZFA 1MJ9A 2WUUA 3FIXA 3D8PA 1CM0A 4KLWA 2X7BA 4U5YA 4LX9A 4UFWA 3WR7A 4KUBA 4CYNA 1Q2DA 2Q04A 2B5GA 2H5MA 1Y9KA 5A27A 5C88A 2F5IA 4GS4A 1PU9A 2WSAA 2AE6A 3PZJA 1IB1E 2IL4A 3P2HA 4KVXA 1S7LA 1BOBA 2Z3LA 4AB7A 3G3SA 4C2ZA 3SHPA 4C7HA 2P6EA 4OAEA 4C68A 4KOXA 5KTAA 3IWEA 2GIVA 4NSQA 4L8AA 4R87A 3GKRA 5A28A 4R3LA 5F46A 1LRZA 2B4BA 3KKWA 4QB9A 3JUWA 4B14A 3E0KA 1YLEA 2I00A 4J3GA 2PDOA 2OZHA 1YX0A 4U9ZA 3IU2A 4II9A 2PQ8A 2Q7BA 3H5ZA 3R9EA 2QMLA 4MFJA 3FB3A 4UCMA 4H6ZA 2K5TA 3R1KA 4A31A 1R57A 5FVJA 5G21A 4CGOA 5ISVA 5JQ4A 3GYAA 1FY7A 2JDDA 4KOVA 4H6UA 4KLVA 2FE7A 4UA3A 2R1IA 4E0AA 5F47A 1KUVA 4EVYA 1S7NA 2I79A 5J8FA 3DR6A 5IB0A 1NMTA 5C82A 3TTHA 2G3TA 2ZW6A 3R95A 2J8NA 2GANA 2JLMA 3LD2A 4NXYA 4Q36A 3DDDA 4M85A 1XF8A 1Q2YA 4XPLA 4A30A 3CXPA 4B13A 4OLLA 4CGMA 3H4QA 5AG5A 4C2XA 1KUXA 3D2MA 5H84A 4B5PB 2BSWA 4YRHA 3FYNA 4CAWA 3TOBA 5JPHA 1SQHA 3TFYA 1B6BA 3S6FA 3W6SA 4QBJA 5BWAB 2Q0YA 2FCKA 2J8RA 4M3SA 2OU2A 1J4JA 4PK2A 5AG7A 2QIRA 2BEIA 4JWPA 2P0WA 3NE7A 4YGOA 4CAXA 4KVME 2ZPAA 3R9GA 1QSOA 4KVOE 1S60A 3RYOA 2FIAA 1M4GA 2YNEA 5DWMA 4PK3A 5F48A 4A33A 1RO5A 1Z4RA 2Z3KA 2ZW5A 4MFZA 2Q4VA 3S6KA 3JVNA 4CAEA 1M1DA 4PSWA 2B3VA 3FRMA 4DNCA 4NEXA 4Y49B 5IV0A 4R3KA 4AG9A 1VKCA 2HQYA 1QSNA 4FD7A 1QSTA 3TO6A 4UFVA 4A2ZA 4JD6A 3P2FA 4UWJA 2OB0A 1N71A 3UY5A 2FXFA 5HMNA 1Q2CA 1S7KA 4HNYB 4CYOA 4AVBA 4QVTA 3I9SA 3T9YA 3TCVA 1MJAA 2VQYA 1I12A 2Z10A 3PP9A 3K9UA 4E8OA 3EXNA 1PUAA 2BUEA 3FXTA 3QAHA 5EC4A 3TO9A 4Y49C 4UWIA 4F0YA 3V8IA 3EC4A 4R9MA 1ON0A 2VXKA 2Z3OA 4HNWB 4B5PA 4Q38A 3EO4A 1QSMA 5AGEA 4KOTA 4B10A 1Z9UA 2D4PA 3IGRA 1YVKA 2ARHA 1B87A 3CXQA 4ONUA 1V0CA 3DR8A 2HUZA 1YR0A 4CGNA 4F0XA 3B8GA 2WPWA 3TO7A 5H86A 4JJXA 5I0CA 3TT2A 4MJ8A 5F49A 4K30A 4QUSA 2G3AA 3F8KA 2YGWA 4MBUA 2Z3NA 2B4DB 2PRBA 4KSAA 4KS9A 2PR8A 1L0CA 2YNDA 2YNCC 3R9FA 5HH1A 3CXSA 2Z3PA 4NF1A 4BMHA 2VZYA 1VHSA 3BJ8A 4IUSA 4HKFA 2FSRA 3TOAA 4A95A 4CYQA 1YK3A 4KZTA 1I1DA 4XNHB 1XE4A 3I3GA 3BJ7A 3IU1A 2NMTA 3GY9A 2AJ6A 4MHDA 1YREA 4UFXA 4X5KA 4E2AA 3SXOA 4FD4A 3FNCA 1YVOA 2OZUA 5DWNA 4CAFA 2JDCA 4CGPA 1BO4A 3F5BA 2HV2A 4FD5A 4CGLA 4B11A 4MFQA 2REEA 1M4DA 4MFLA 2Z11A 2VBQA 3LODA 3VWDA 1XIXA 4H89A 4XNHC 4KOYA 2YNCA 5GCNA 3DNSA 1S7FA 4XPKA 4C7IA 4LUAA 4U9YA 2CXAA 4KOUA 2OZGA 2CNMA 3SXNA 1Y7RA 2ATRA 2WPXA 3EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4CYQ A;  5AG4 A;  2WUU A;  5AG5 A;  5G22 A;  3IU2 A;  4C2X A;  4UFV A;  4UCP A;  4UFW A;  4C68 A;  4A2Z A;  4CGL A;  4A32 A;  5G20 A;  4CYN A;  4CYP A;  3IWE A;  2YNE A;  3H5Z A;  4A33 A;  5A27 A;  2YNC A;  5AG6 A;  3IU1 A;  5AGE A;  4B10 A;  4B12 A;  2WSA A;  4C7I A;  5A28 A;  4UCM A;  2YND A;  2YNC C;  4UCN A;  4C2Y A;  3JTK A;  4UFX A;  4CAE A;  4CYO A;  4A31 A;  4B14 A;  5G21 A;  4CGN A;  4CGO A;  5AG7 A;  4A95 A;  4CAF A;  4CGP A;  4C2Z A;  4BBH A;  4A30 A;  4B13 A;  5G1Z A;  4C7H A;  4CGM A; 
#chains in the Genus database with same CATH topology
 3BI0 A;  4MFK A;  4JLY A;  3T90 A;  3RZA A;  5AG4 A;  2DXQ A;  1YQE A;  2Q44 A;  4NGP A;  3EY5 A;  3IWW A;  2IQ6 A;  1YSJ A;  2REF A;  4CYP A;  4IF5 A;  1FNO A;  3KQX A;  4OAD A;  2Z3M A;  4R57 A;  1MK4 A;  4RI1 A;  1Q7L A;  4KOR A;  2B4D A;  4ZI6 A;  4NGN A;  4QC6 A;  4NGQ A;  4AG7 A;  2D4O A;  1UFH A;  2EBJ A;  4B12 A;  2CTB A;  4IK2 A;  4L89 A;  3S9M A;  4ZX8 A;  2DPT A;  2KCW A;  2ZEO A;  1ZO0 A;  2XEF A;  4BD9 A;  2ZEH A;  3ZZI A;  2DPS A;  3TE4 A;  2FT0 A;  5IX3 A;  1TXR A;  3R96 A;  4R8F A;  1CBX A;  5LYI A;  3PB7 X;  1IYK A;  5K8O A;  1IGB A;  1LOK A;  2I3C A;  3TC8 A;  3LWU A;  5G22 A;  2VEZ A;  3IWG A;  3N7Z A;  4AVA A;  1S3Z A;  2FVG A;  2R8V A;  5CNP A;  3C26 A;  5K8N A;  4UCP A;  3JRU A;  3DLJ A;  3QB8 A;  2PSW A;  5G20 A;  3WC7 A;  2B58 A;  5LYF A;  4FD6 A;  4UBR A;  2Y0M A;  2A4N A;  3S6H A;  2QEC A;  4P4F A;  1OZP A;  5EBV A;  3VAR A;  5KTD A;  2R7H A;  3PRT A;  2PR1 A;  3D2P A;  4JZ0 A;  4UCN A;  4EME A;  3JTK A;  5THW A;  4NCZ A;  1GHE A;  2WYR A;  1I21 A;  3PBB A;  4HPS A;  1JQG A;  4PSX A;  2ZW7 A;  1XJO A;  2P6G A;  3GUX A;  3PFE A;  3DSB A;  1NSL A;  3W6X A;  1ELL P;  3OWC A;  3FJU A;  4K3N A;  2CY2 A;  2PC1 A;  4PV6 A;  1P4N A;  4F9U A;  4TNU A;  5K8P A;  1CPS A;  1QQ9 A;  1M4L A;  2G0B A;  2EVN A;  1P0H A;  1F2O A;  5HVH A;  1YME A;  2OH1 A;  4UEF A;  5KTC A;  5LRJ A;  2ZXV A;  1JWQ A;  4MFP A;  3RAM A;  1XMT A;  1LAN A;  3RO0 A;  4PQA A;  4DYO A;  2B5G B;  2JEV A;  3PBE A;  1AUG A;  5E96 A;  2AFW A;  2Q4Y A;  2VI7 A;  3A9L A;  3K2K A;  3B35 A;  3PB4 X;  2EUI A;  3PGP A;  5J8C A;  4MCS A;  4AVC A;  4C2Y A;  4GXH A;  2C27 A;  4JXR A;  1IID A;  2JBJ A;  2P6F A;  3HLP A;  3BHX A;  3D3S A;  3VWE A;  4YWY A;  1Z4E A;  1CG2 A;  4P10 A;  4ZGY B;  3V38 A;  2AFM A;  1XBU A;  6CPA A;  1IIC A;  4MMO A;  5G1Z A;  2FS5 A;  1WWZ A;  3NH8 A;  2Z0Z A;  4KSF A;  2EK9 A;  2FIW A;  3PEI A;  3GIU A;  3WC5 A;  4JXQ A;  4A94 A;  2DEA A;  2CNT A;  1XOV A;  4F6A A;  2FL4 A;  1ZLI A;  4A32 A;  4KUA A;  3CPX A;  2AFS A;  3BLN A;  4UIB A;  5AG6 A;  4NFR A;  1ARL A;  4OID A;  1M44 A;  4CAV A;  4YFJ A;  3IC1 A;  1YLO A;  5HXD A;  1Y0Y A;  2RC4 A;  4I49 A;  2O28 A;  1M4I A;  4B5O A;  1TIQ A;  2PJ4 A;  4UIA A;  3B3V A;  2GE3 A;  3PB6 X;  1XEB A;  4XPD B;  2PIY A;  2ZW4 A;  4EWT A;  1LAM A;  4MY0 A;  4GM5 A;  4CS0 B;  4NGM A;  2B3U A;  3MGD A;  4CRZ B;  1MJB A;  5JH9 A;  3W91 A;  2BL1 A;  4RS2 A;  2VZZ A;  2J8M A;  8CPA A;  4R6T A;  1Y9W A;  2GLF A;  1U6M A;  2CNS A;  3SI0 A;  1RXT A;  3SJE A;  3G8W A;  2G9D A;  2PVW A;  4ORF A;  1S5K A;  1BPN A;  1K4J A;  1RTQ A;  4OME A;  4OIW A;  1CJW A;  3KQZ A;  3FX6 A;  3FEC A;  4OP4 A;  1H8L A;  2AFX A;  3BI1 A;  3CPA A;  1WK4 A;  1QSR A;  1KUY A;  2C6G A;  2R98 A;  4MY3 A;  3B3T A;  3S6G A;  4CRY B;  4MHP A;  1IYL A;  3B7I A;  3SJG A;  4MI4 A;  4ZBG A;  1TKF A;  1YGH A;  3HUV A;  4KOW A;  4MHN A;  1NE9 A;  3F0A A;  4HNX B;  4KOS A;  4LQ6 A;  5EMI A;  4XPD C;  4BBH A;  2GLJ A;  3ZJ0 A;  3FBU A;  4R76 A;  1KZF A;  1MJ9 A;  2WUU A;  3B3W A;  3D8P A;  3FIX A;  3RNZ A;  1CM0 A;  4KLW A;  2X7B A;  2O4H A;  4U5Y A;  4LX9 A;  2J9A A;  4UFW A;  3WR7 A;  3SJX A;  5LYL A;  3FED A;  4KUB A;  1XRY A;  3KHZ A;  4RN7 A;  4CYN A;  1Q2D A;  2Q04 A;  2B5G A;  2VL1 A;  2H5M A;  1R3N A;  1Y9K A;  2BCO A;  5A27 A;  5C88 A;  2F5I A;  2PRQ A;  4GS4 A;  1PU9 A;  2WSA A;  2AE6 A;  3PZJ A;  3D4U A;  4MXU A;  4P45 A;  1IB1 E;  2IL4 A;  4MHZ A;  4R7M A;  3ISZ A;  5D8N A;  4A39 A;  1BLL E;  1TKH A;  3P2H A;  4KVX A;  1S7L A;  1BOB A;  2XEI A;  2Z3L A;  4AB7 A;  3G3S A;  3LAC A;  4C2Z A;  4PPZ A;  3IIB A;  2PJ1 A;  4PXE A;  5HVF A;  1X10 A;  3D68 A;  4FWU A;  3VH9 A;  3SHP A;  4C7H A;  2P6E A;  4RUH A;  3H8G A;  3NH4 A;  5JGF A;  4BIN A;  4OAE A;  1ZG9 A;  2V8V A;  4C68 A;  3LMS A;  4KOX A;  3D7G A;  5KTA A;  3IWE A;  2GIV A;  2F8H A;  1XFO A;  4NSQ A;  2PJ5 A;  4L8A A;  4FUU A;  3FF3 A;  2PJ2 A;  4R87 A;  3GKR A;  5A28 A;  5F09 A;  4R3L A;  5F46 A;  1LRZ A;  2B4B A;  3H8E A;  2PJC A;  3KKW A;  4P6Y A;  4QB9 A;  3JUW A;  4B14 A;  5CPA A;  5ELY A;  3E0K A;  1YLE A;  1CX8 A;  3WAB A;  2I00 A;  4M6H A;  3B2Y A;  3S9N A;  4P4D A;  3QAY A;  4J3G A;  1TF8 A;  2PDO A;  2OZH A;  4AXV A;  1NSA A;  1YX0 A;  3IU2 A;  4U9Z A;  4II9 A;  2PQ8 A;  1ZG8 A;  2Q7B A;  3PB9 X;  3VAT A;  3H5Z A;  3R9E A;  2PJ9 A;  2QML A;  3K9T A;  4MFJ A;  3FB3 A;  3PB8 X;  4UCM A;  3D7H A;  4H6Z A;  2Q51 A;  1Z8T A;  2DF5 A;  2K5T A;  3R1K A;  3QNV A;  4A31 A;  1R57 A;  5FVJ A;  5G21 A;  2F7V A;  4TWE A;  4CGO A;  5ISV A;  5JQ4 A;  1ZG7 A;  3V7Z A;  1Y0R A;  3GYA A;  2ZEF A;  1ARM A;  5I4M A;  1FY7 A;  2JDD A;  3TX8 A;  2OOT A;  2XEJ A;  5JM6 A;  4KOV A;  4M6G A;  4A37 A;  4H6U A;  4KLV A;  2FE7 A;  2PE3 A;  4UA3 A;  2R1I A;  2Q43 A;  3GB0 A;  4P4I A;  4E0A A;  5F47 A;  4ZY1 A;  1KUV A;  3CT9 A;  4EVY A;  1S7N A;  2I79 A;  4NJR A;  4O23 A;  1XMB A;  5J8F A;  1Z8L A;  3SI1 A;  1X12 A;  1F2P A;  3DR6 A;  5IB0 A;  4B6Z A;  1NMT A;  5C82 A;  1AYE A;  1YW6 A;  2G3T A;  2ZW6 A;  4OC1 A;  4P4B A;  2J8N A;  3R95 A;  3TTH A;  2GAN A;  2JLM A;  3LD2 A;  3WC6 A;  2HB6 A;  2IJZ A;  4UF4 A;  4X8I A;  1IOF A;  3I1U A;  2V8D A;  4NXY A;  4Q36 A;  3DDD A;  4M85 A;  3NH5 A;  2V8G A;  1XF8 A;  1Q2Y A;  1KWM A;  3WT4 A;  1BPM A;  3T8W A;  4MRI A;  2OR4 A;  4XPL A;  4A30 A;  3CXP A;  3D67 A;  4B13 A;  3FMC A;  4OLL A;  4CGM A;  1ZLH A;  3H4Q A;  3NFZ A;  5AG5 A;  1AMP A;  4OC0 A;  4NGT A;  3RBU A;  4C2X A;  2PJ3 A;  1KUX A;  2EK8 A;  3D2M A;  5H84 A;  4B5P B;  1HDU A;  2BSW A;  3H8F A;  3IO1 A;  5LYD A;  4Z65 A;  1TKJ A;  4OC3 A;  3FYN A;  4YRH A;  4CAW A;  1ELM P;  4ONW A;  3TOB A;  1SQH A;  5JPH A;  3TFY A;  3NE8 A;  2ZEM A;  1B6B A;  3S6F A;  3W6S A;  4QBJ A;  5BWA B;  1IY7 A;  2Q0Y A;  2FCK A;  2PJ0 A;  2J8R A;  4M3S A;  2OU2 A;  1J4J A;  4PK2 A;  5AG7 A;  2QVP A;  2QIR A;  4WJB A;  2BEI A;  4JWP A;  2P0W A;  3NE7 A;  3MN8 A;  4P4J A;  4YGO A;  4CAX A;  4KVM E;  2ZPA A;  3KGQ A;  3R9G A;  2Q7S A;  1QSO A;  1UWY A;  2CIJ A;  4KVO E;  2JEW A;  1S60 A;  3RYO A;  1DTD A;  2FIA A;  4X2T A;  4OKO A;  1M4G A;  2PJ7 A;  2YNE A;  4F9V A;  3CZX A;  2BO9 A;  4PK3 A;  5DWM A;  5F48 A;  4A33 A;  1RO5 A;  1Z4R A;  4NGR A;  3KR4 A;  2Z3K A;  2ZW5 A;  4MFZ A;  2Q4V A;  2ZOG A;  3S6K A;  4MHY A;  3JVN A;  4CAE A;  1M1D A;  1TF9 A;  4PSW A;  2B3V A;  3FRM A;  4DNC A;  2CF4 A;  4NEX A;  4Y49 B;  3FH4 A;  7CPA A;  3NA6 A;  3DGV A;  5IV0 A;  4R3K A;  1QMU A;  4AG9 A;  4MCQ A;  1VKC A;  2CTC A;  2HQY A;  1QSN A;  4FD7 A;  4KSI A;  2GRE A;  1QST A;  3N5F A;  3TO6 A;  5LRK A;  4FBE A;  4UFV A;  2IMO A;  4A2Z A;  4JD6 A;  3P2F A;  1LFW A;  2BOA A;  4UWJ A;  2OB0 A;  1N71 A;  1Z8X A;  3UY5 A;  2FXF A;  2AFZ A;  2ZEG A;  4G1P A;  4DJL A;  5HMN A;  1Q2C A;  1S7K A;  4HNY B;  3KL9 A;  4ZYQ A;  4CYO A;  2ZEP A;  4AVB A;  4QVT A;  3I9S A;  3T9Y A;  1CP7 A;  1MJA A;  3TCV A;  2VQY A;  1I12 A;  2Z10 A;  3PP9 A;  3K9U A;  4A38 A;  5J1Q A;  3KAS A;  4E8O A;  3FEE A;  3EXN A;  1PUA A;  2AFO A;  2BUE A;  2PCU A;  1VHE A;  2ZOF A;  3FXT A;  3QAH A;  5EC4 A;  4ZY2 A;  3TO9 A;  4Y49 C;  4UWI A;  2POK A;  4F0Y A;  2PJA A;  3V8I A;  2C6C A;  2QYV A;  3MRU A;  5K8M A;  3EC4 A;  4R9M A;  1R43 A;  1ON0 A;  2VXK A;  2Z3O A;  4HNW B;  4P44 A;  4B5P A;  4Q38 A;  4MCP A;  3EO4 A;  1QSM A;  4IAV A;  5AGE A;  4KOT A;  4B10 A;  1Z9U A;  5DS0 A;  4Q7A A;  4W9Y A;  2D4P A;  3IGR A;  1YVK A;  2ARH A;  1B87 A;  3CXQ A;  2QJ8 A;  1V0C A;  2ABZ A;  2ZEE A;  4MCR A;  3DR8 A;  4ONU A;  4UEZ A;  2HUZ A;  1YR0 A;  1HDQ A;  4CGN A;  4F0X A;  3B8G A;  1DE4 C;  3SJF A;  2WPW A;  2GU2 A;  3TO7 A;  1A2Z A;  5H86 A;  2NSM A;  1PCA A;  4JYW A;  3PFO A;  4JJX A;  2PJB A;  5I0C A;  3TT2 A;  4MJ8 A;  5F49 A;  4K30 A;  4QUS A;  2G3A A;  1EE3 P;  4PXB A;  3D7D A;  5IB9 A;  1CPX A;  4OC5 A;  4ZY0 A;  1GYT A;  4PXD A;  3F8K A;  2YGW A;  3IFE A;  4MBU A;  4F8Z A;  5LRG A;  2Z3N A;  1VIX A;  1OBR A;  1Z8W A;  2C1C A;  2B4D B;  2PRB A;  4H2K A;  4KSA A;  4KS9 A;  2PR8 A;  4PXC A;  4EFD A;  1L0C A;  2YND A;  1PYT B;  2YNC C;  3R9F A;  3IEH A;  2ZED A;  5HH1 A;  1HEE A;  3CXS A;  2Z3P A;  4NF1 A;  2V8H A;  4BMH A;  1VHO A;  2VZY A;  1VHS A;  2EWB A;  3BJ8 A;  4IUS A;  2ANP A;  5D29 A;  3B3C A;  4HKF A;  2NYQ A;  4OC4 A;  5CBM A;  2FSR A;  3KZW A;  3TOA A;  4A95 A;  1Y7E A;  4CYQ A;  1YK3 A;  1IOI A;  4KZT A;  4NJQ A;  2WZN A;  1I1D A;  2AFU A;  4XNH B;  2EO8 A;  2V77 A;  1CP6 A;  1XE4 A;  3I3G A;  2RFH A;  2JBK A;  3BJ7 A;  3S9L A;  3IU1 A;  2NMT A;  1F57 A;  1Z5R A;  1BAV A;  3GY9 A;  4OC2 A;  2AJ6 A;  4X3R A;  5HVG A;  4MHD A;  1YRE A;  1LCP A;  4IHM A;  4UFX A;  4X5K A;  4E2A A;  3SXO A;  2PIZ A;  3IJ3 A;  3KR5 A;  2ODF A;  4FD4 A;  3FNC A;  2C6P A;  1YVO A;  2OZU A;  4UEE A;  3KI9 A;  5DWN A;  2RB7 A;  4CAF A;  2JDC A;  4CGP A;  1BO4 A;  1LAP A;  2ZEN A;  3F5B A;  2HV2 A;  4FD5 A;  3KHX A;  4CGL A;  2PVV A;  2ZEL A;  3B3S A;  4B11 A;  2XEG A;  3FVL A;  1IU8 A;  1Z2L A;  2REE A;  2O53 A;  4MFQ A;  4DUK A;  1M4D A;  4MFL A;  2Z11 A;  2VBQ A;  4CPA A;  3LOD A;  3VWD A;  1XIX A;  4H89 A;  4P4E A;  4YU9 A;  4XNH C;  2HC9 A;  4KOY A;  3ISX A;  1VGY A;  2YNC A;  5GCN A;  1FT7 A;  4FAI A;  2Q4Z A;  3DNS A;  3L2N A;  1S7F A;  3D66 A;  3D7F A;  4XPK A;  4C7I A;  4LUA A;  3BXM A;  4U9Y A;  3GLJ A;  2CXA A;  4KOU A;  4M6I A;  2PJ8 A;  2OZG A;  2CNM A;  3SXN A;  1YW4 A;  3CDX A;  2GFQ A;  1Y7R A;  4NGS A;  3SI2 A;  2PJ6 A;  4WWV A;  2ATR A;  4LQG A;  2WPX A;  3EFA A;  4ZX9 A; 
#chains in the Genus database with same CATH homology
 5AG4 A;  4MFK A;  4JLY A;  3T90 A;  2DXQ A;  2Q44 A;  3EY5 A;  2REF A;  4CYP A;  4IF5 A;  4R57 A;  4OAD A;  2Z3M A;  1MK4 A;  4RI1 A;  4KOR A;  2B4D A;  4QC6 A;  4AG7 A;  2D4O A;  1UFH A;  4B12 A;  4L89 A;  2DPT A;  2KCW A;  1ZO0 A;  3ZZI A;  2DPS A;  3TE4 A;  2FT0 A;  5IX3 A;  3R96 A;  1IYK A;  5G22 A;  2VEZ A;  3IWG A;  3N7Z A;  4AVA A;  1S3Z A;  2R8V A;  5CNP A;  3C26 A;  4UCP A;  3QB8 A;  2PSW A;  5G20 A;  2B58 A;  4FD6 A;  4UBR A;  2Y0M A;  2A4N A;  3S6H A;  2QEC A;  5EBV A;  1OZP A;  5KTD A;  2R7H A;  2PR1 A;  3D2P A;  4UCN A;  3JTK A;  4NCZ A;  1GHE A;  1I21 A;  1NSL A;  4PSX A;  2ZW7 A;  3W6X A;  2P6G A;  3DSB A;  3OWC A;  2CY2 A;  2PC1 A;  4PV6 A;  1P4N A;  2G0B A;  2EVN A;  1P0H A;  2OH1 A;  5KTC A;  2ZXV A;  4MFP A;  1XMT A;  2B5G B;  2JEV A;  5E96 A;  2Q4Y A;  2VI7 A;  3A9L A;  2EUI A;  3PGP A;  5J8C A;  4AVC A;  4C2Y A;  2C27 A;  4JXR A;  1IID A;  2P6F A;  3D3S A;  3VWE A;  1Z4E A;  4ZGY B;  1IIC A;  5G1Z A;  2FS5 A;  1WWZ A;  2Z0Z A;  4KSF A;  2FIW A;  4JXQ A;  2CNT A;  4F6A A;  2FL4 A;  4A32 A;  4KUA A;  3BLN A;  5AG6 A;  4CAV A;  1M44 A;  4YFJ A;  2RC4 A;  4I49 A;  2O28 A;  1M4I A;  4B5O A;  1TIQ A;  2GE3 A;  1XEB A;  4XPD B;  2ZW4 A;  4MY0 A;  4CS0 B;  2B3U A;  3MGD A;  4CRZ B;  1MJB A;  3W91 A;  2BL1 A;  4RS2 A;  2VZZ A;  2J8M A;  1Y9W A;  1U6M A;  2CNS A;  1RXT A;  3G8W A;  4ORF A;  1S5K A;  1K4J A;  1CJW A;  1WK4 A;  1QSR A;  1KUY A;  4CRY B;  2R98 A;  4MY3 A;  3S6G A;  1IYL A;  4MI4 A;  4ZBG A;  1YGH A;  4KOW A;  1NE9 A;  3F0A A;  4HNX B;  4KOS A;  4XPD C;  4BBH A;  3ZJ0 A;  3FBU A;  1KZF A;  1MJ9 A;  2WUU A;  3FIX A;  3D8P A;  1CM0 A;  4KLW A;  2X7B A;  4U5Y A;  4LX9 A;  4UFW A;  3WR7 A;  4KUB A;  4CYN A;  1Q2D A;  2Q04 A;  2B5G A;  2H5M A;  1Y9K A;  5A27 A;  5C88 A;  2F5I A;  4GS4 A;  1PU9 A;  2WSA A;  2AE6 A;  3PZJ A;  1IB1 E;  2IL4 A;  3P2H A;  4KVX A;  1S7L A;  1BOB A;  2Z3L A;  4AB7 A;  3G3S A;  4C2Z A;  3SHP A;  4C7H A;  2P6E A;  4OAE A;  4C68 A;  4KOX A;  5KTA A;  3IWE A;  2GIV A;  4NSQ A;  4L8A A;  4R87 A;  3GKR A;  5A28 A;  4R3L A;  5F46 A;  1LRZ A;  2B4B A;  3KKW A;  4QB9 A;  3JUW A;  4B14 A;  3E0K A;  1YLE A;  2I00 A;  4J3G A;  2PDO A;  2OZH A;  1YX0 A;  4U9Z A;  3IU2 A;  4II9 A;  2PQ8 A;  2Q7B A;  3H5Z A;  3R9E A;  2QML A;  4MFJ A;  3FB3 A;  4UCM A;  4H6Z A;  2K5T A;  3R1K A;  4A31 A;  1R57 A;  5FVJ A;  5G21 A;  4CGO A;  5ISV A;  5JQ4 A;  3GYA A;  1FY7 A;  2JDD A;  4KOV A;  4H6U A;  4KLV A;  2FE7 A;  4UA3 A;  2R1I A;  4E0A A;  5F47 A;  1KUV A;  4EVY A;  1S7N A;  2I79 A;  5J8F A;  3DR6 A;  5IB0 A;  1NMT A;  5C82 A;  3TTH A;  2G3T A;  2ZW6 A;  3R95 A;  2J8N A;  2GAN A;  2JLM A;  3LD2 A;  4NXY A;  4Q36 A;  3DDD A;  4M85 A;  1XF8 A;  1Q2Y A;  4XPL A;  4A30 A;  3CXP A;  4B13 A;  4OLL A;  4CGM A;  3H4Q A;  5AG5 A;  4C2X A;  1KUX A;  3D2M A;  5H84 A;  4B5P B;  2BSW A;  4YRH A;  3FYN A;  4CAW A;  3TOB A;  5JPH A;  1SQH A;  3TFY A;  1B6B A;  3S6F A;  3W6S A;  4QBJ A;  5BWA B;  2Q0Y A;  2FCK A;  2J8R A;  4M3S A;  2OU2 A;  1J4J A;  4PK2 A;  5AG7 A;  2QIR A;  2BEI A;  4JWP A;  2P0W A;  3NE7 A;  4YGO A;  4CAX A;  4KVM E;  2ZPA A;  3R9G A;  1QSO A;  4KVO E;  1S60 A;  3RYO A;  2FIA A;  1M4G A;  2YNE A;  5DWM A;  4PK3 A;  5F48 A;  4A33 A;  1RO5 A;  1Z4R A;  2Z3K A;  2ZW5 A;  4MFZ A;  2Q4V A;  3S6K A;  3JVN A;  4CAE A;  1M1D A;  4PSW A;  2B3V A;  3FRM A;  4DNC A;  4NEX A;  4Y49 B;  5IV0 A;  4R3K A;  4AG9 A;  1VKC A;  2HQY A;  1QSN A;  4FD7 A;  1QST A;  3TO6 A;  4UFV A;  4A2Z A;  4JD6 A;  3P2F A;  4UWJ A;  2OB0 A;  1N71 A;  3UY5 A;  2FXF A;  5HMN A;  1Q2C A;  1S7K A;  4HNY B;  4CYO A;  4AVB A;  4QVT A;  3I9S A;  3T9Y A;  3TCV A;  1MJA A;  2VQY A;  1I12 A;  2Z10 A;  3PP9 A;  3K9U A;  4E8O A;  3EXN A;  1PUA A;  2BUE A;  3FXT A;  3QAH A;  5EC4 A;  3TO9 A;  4Y49 C;  4UWI A;  4F0Y A;  3V8I A;  3EC4 A;  4R9M A;  1ON0 A;  2VXK A;  2Z3O A;  4HNW B;  4B5P A;  4Q38 A;  3EO4 A;  1QSM A;  5AGE A;  4KOT A;  4B10 A;  1Z9U A;  2D4P A;  3IGR A;  1YVK A;  2ARH A;  1B87 A;  3CXQ A;  4ONU A;  1V0C A;  3DR8 A;  2HUZ A;  1YR0 A;  4CGN A;  4F0X A;  3B8G A;  2WPW A;  3TO7 A;  5H86 A;  4JJX A;  5I0C A;  3TT2 A;  4MJ8 A;  5F49 A;  4K30 A;  4QUS A;  2G3A A;  3F8K A;  2YGW A;  4MBU A;  2Z3N A;  2B4D B;  2PRB A;  4KSA A;  4KS9 A;  2PR8 A;  1L0C A;  2YND A;  2YNC C;  3R9F A;  5HH1 A;  3CXS A;  2Z3P A;  4NF1 A;  4BMH A;  2VZY A;  1VHS A;  3BJ8 A;  4IUS A;  4HKF A;  2FSR A;  3TOA A;  4A95 A;  4CYQ A;  1YK3 A;  4KZT A;  1I1D A;  4XNH B;  1XE4 A;  3I3G A;  3BJ7 A;  3IU1 A;  2NMT A;  3GY9 A;  2AJ6 A;  4MHD A;  1YRE A;  4UFX A;  4X5K A;  4E2A A;  3SXO A;  4FD4 A;  3FNC A;  1YVO A;  2OZU A;  5DWN A;  4CAF A;  2JDC A;  4CGP A;  1BO4 A;  3F5B A;  2HV2 A;  4FD5 A;  4CGL A;  4B11 A;  4MFQ A;  2REE A;  1M4D A;  4MFL A;  2Z11 A;  2VBQ A;  3LOD A;  3VWD A;  1XIX A;  4H89 A;  4XNH C;  4KOY A;  2YNC A;  5GCN A;  3DNS A;  1S7F A;  4XPK A;  4C7I A;  4LUA A;  4U9Y A;  2CXA A;  4KOU A;  2OZG A;  2CNM A;  3SXN A;  1Y7R A;  2ATR A;  2WPX A;  3EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...