4A32A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 118
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a32A00
4C68A 4CYNA 3JTKA 5G1ZA 4A30A 4B11A 4C7IA 2YNCC 4UCMA 4UCPA 5G22A 5G20A 4A95A 4CYOA 4C2XA 2WSAA 4A31A 4CGMA 4B12A 4CGNA 5AG5A 5AG7A 4CYQA 3IWEA 4B13A 4UFWA 4A32A 4CAFA 4CAEA 2WUUA 3H5ZA 4CGOA 4B14A 3IU1A 4UFVA 4C2ZA 4A2ZA 5AG6A 4A33A 4CGPA 2YNDA 5A27A 2YNEA 4CGLA 5A28A 5AG4A 3IU2A 2YNCA 4CYPA 4UFXA 4B10A 4BBHA 4C2YA 5AGEA 5G21A 4C7HA 4UCNA
chains in the Genus database with same CATH superfamily
1ZG8A 1Z8LA 3DSBA 3GLJA 2PIYA 4OKOA 1LFWA 2D4OA 1IYLA 3TX8A 2R8VA 3EO4A 2POKA 3S6GA 5IB9A 2IMOA 3FXTA 4M85A 4OC4A 4YU9A 5KTCA 2AFMA 2YGWA 4NGPA 4BD9A 4ZI6A 4ZBGA 3ZZIA 4OP4A 3D7DA 4B12A 1IY7A 3FIXA 2PE3A 5F46A 1BAVA 1LAPA 1ZLIA 4JLYA 4EWTA 4MHDA 1ZG7A 1IYKA 5D8NA 3PB9X 3GB0A 4OC2A 2ZELA 1ON0A 2PDOA 4NJRA 2REEA 2B3VA 1UFHA 2I3CA 4CYPA 4NGNA 2ZEEA 1HDQA 2ZW5A 5IB0A 4UFXA 4MCQA 1R3NA 2HC9A 3K9TA 4XPKA 4OIDA 2XEIA 3FBUA 4R6TA 5G21A 3SJGA 3DR8A 1XMTA 3PP9A 4UIAA 1KUXA 1ARMA 4OC5A 4FWUA 2V77A 4B5OA 3PRTA 4U9ZA 2PJ6A 1Z4RA 2H5MA 2ZPAA 3R9EA 4OC1A 4JYWA 3LODA 3QNVA 4P44A 3BJ7A 5F09A 2GLFA 3KHZA 4MHPA 4O23A 2CY2A 3KHXA 4CAWA 2OOTA 5HMNA 3IU1A 4C2ZA 2G3TA 4KOXA 4R3LA 1Y7EA 2QMLA 1PYTB 3FB3A 3PEIA 3SI0A 3SXOA 4UA3A 3WC5A 1PUAA 2OZHA 1KUVA 2Q7SA 3T9YA 4NXYA 4PPZA 4MCRA 1RTQA 4C2YA 4UWIA 1TF9A 3IWWA 1BO4A 2F7VA 4P4JA 5DWMA 1M4LA 4KOWA 4PK2A 4F9UA 4MBUA 1VIXA 2B4DB 3PB8X 4B11A 2PJ4A 2PVWA 3IO1A 3K9UA 2EK9A 3FJUA 5K8MA 1XF8A 4LUAA 2Z10A 3PFEA 4PSXA 2QYVA 2AFSA 4CAFA 3H8GA 1Q7LA 4UEFA 2Q43A 1N71A 2PRQA 1J4JA 3SJFA 4CGPA 2G0BA 5E96A 4UEZA 3TC8A 2PJ0A 4MCSA 1JWQA 1ZLHA 1VHSA 4OAEA 4NF1A 3PB6X 1NE9A 3EC4A 4XPLA 4B10A 2VL1A 2WPWA 3FEEA 4G1PA 4KOYA 1KUYA 2DPSA 4EMEA 2P6EA 3D7GA 2NYQA 1Z2LA 4KOVA 4P4FA 2Q44A 1S3ZA 2C6PA 4MHNA 1AUGA 8CPAA 2JDDA 4U9YA 1TF8A 4FD7A 3FMCA 2FE7A 1Y7RA 3LWUA 4KUAA 4PXBA 5CNPA 4KVME 2FSRA 5F49A 1Z4EA 1M44A 2B4DA 4IF5A 2P6FA 4W9YA 5LRJA 2XEGA 3R95A 6CPAA 1OZPA 1YK3A 1VHOA 2B3UA 4P6YA 3WT4A 3GY9A 2GE3A 3DDDA 2OR4A 1LCPA 3ZJ0A 4DYOA 1CM0A 3F0AA 3FH4A 1BPMA 4M3SA 4FAIA 4JD6A 2P0WA 3NE7A 2ODFA 3CXPA 4MJ8A 5H84A 3D2PA 4DJLA 4LQGA 3JTKA 2PCUA 3B3TA 3FVLA 3KGQA 1XFOA 4R76A 4XNHC 2X7BA 5JH9A 4E8OA 4R9MA 4AVCA 1M4GA 4NGRA 2Q4YA 3KR5A 2FCKA 4K3NA 4ZGYB 4NFRA 4Z65A 2BO9A 3G3SA 3UY5A 3VWDA 2WYRA 3KKWA 2PR1A 2PR8A 3E0KA 2Z3KA 1MJAA 1ZO0A 4F0XA 1CG2A 3D7HA 2PJ3A 2DPTA 1P0HA 2PVVA 4M6GA 4MY3A 3VARA 4A37A 2PSWA 2Q0YA 5H86A 3TOBA 4KZTA 2ATRA 1ZG9A 4XPDB 3I3GA 2ZEHA 3S9NA 1NMTA 2Z0ZA 1PCAA 2AFZA 1M4DA 2C27A 1Q2YA 3TT2A 2Z11A 1P4NA 2JDCA 4JJXA 4UEEA 1XBUA 1YMEA 1IB1E 3DLJA 3NFZA 4UCMA 1QQ9A 3BHXA 1Q2CA 3LACA 2QJ8A 2OU2A 1BPNA 2O4HA 4QC6A 1TKJA 4IHMA 5AG5A 4CAVA 4A32A 4E0AA 3D66A 1QMUA 2BCOA 2OZUA 2PJCA 3H8EA 4KS9A 2BOAA 3L2NA 5HH1A 2CNTA 4MFJA 2ZEGA 1CX8A 2J8NA 2OB0A 3EXNA 3FECA 3MN8A 5DS0A 2Q7BA 3NA6A 5J8FA 5K8OA 4NEXA 4CS0B 4MHYA 3NH8A 1B6BA 4GXHA 5EBVA 3TO9A 3PGPA 3P2HA 4P4EA 2HUZA 1SQHA 4IUSA 1LANA 4BINA 2BEIA 1ELLP 1Z8WA 5I4MA 1CJWA 1ELMP 5LYLA 4IAVA 1R57A 2GFQA 4C7IA 2ZW7A 4UWJA 4H2KA 2GU2A 2JEVA 2AFUA 2JBJA 4MRIA 3MGDA 3KASA 4BMHA 1GYTA 3W6XA 3HLPA 4X8IA 2J8RA 4M6HA 2FIAA 2CTCA 4XPDC 2GREA 2QIRA 4P4IA 3TCVA 4B14A 1YW6A 2AJ6A 3TFYA 1VKCA 3NE8A 3R96A 1CPSA 2VQYA 2IL4A 4F8ZA 2I00A 3BI1A 3JVNA 5A28A 2ZENA 4QB9A 4MHZA 2JBKA 2CTBA 2K5TA 3DGVA 4PXEA 2Y0MA 3I9SA 2HV2A 4QVTA 1UWYA 4L8AA 4MFQA 1YW4A 3PFOA 2ZEOA 3B2YA 4X3RA 3N5FA 3RO0A 4C68A 1XIXA 4AXVA 4CPAA 1WK4A 1KWMA 1HEEA 3H4QA 2Q4VA 2FVGA 2V8GA 5KTAA 5KTDA 4Q7AA 4KSAA 1DTDA 4QBJA 2OH1A 2AFXA 2EWBA 2PIZA 2Z3PA 2PJ5A 5LYIA 3SJXA 4B13A 2F8HA 2Z3NA 4LQ6A 2NSMA 4KLWA 1GHEA 2Q04A 5AG6A 5BWAB 2CIJA 1CPXA 1Z5RA 2XEFA 4FD6A 4OIWA 2VXKA 4CGLA 2PJBA 1QSRA 1LAMA 3B3WA 2R98A 1RXTA 4Q38A 2Q51A 5K8PA 4YGOA 1YX0A 2ABZA 2ZXVA 4RI1A 1AYEA 2ZEFA 4UCNA 3TE4A 4CYNA 2ZOFA 5EMIA 1YREA 1BLLE 3CXSA 3IGRA 3GIUA 4TNUA 5G1ZA 5LRKA 4A39A 1CBXA 3JRUA 1XE4A 2V8DA 2BL1A 2VEZA 4OMEA 3TTHA 4B5PB 4B6ZA 3FNCA 5JGFA 4OADA 4NGSA 4QUSA 3VWEA 2VI7A 3MRUA 7CPAA 4UFWA 4AG7A 4CAEA 3DR6A 4P10A 1S7FA 2Z3MA 3DNSA 2WPXA 2PJ2A 2NMTA 5A27A 1IGBA 4MFPA 3FF3A 1XOVA 3CT9A 5EC4A 4IK2A 4R57A 5IX3A 4PK3A 4ORFA 4ZX8A 2RFHA 2AFOA 1TKFA 2PQ8A 3SI1A 5LYFA 4FD5A 1V0CA 3F5BA 1QSOA 4M6IA 4NGQA 1Z8XA 2EK8A 1NSLA 2CXAA 3JUWA 3PBBA 4HPSA 4YWYA 3S6KA 1YSJA 3WC7A 4FBEA 5GCNA 1KZFA 4OC3A 4HKFA 1AMPA 5CPAA 4CAXA 2BUEA 4CGMA 2ZEPA 1Y9WA 4AB7A 1F57A 2DXQA 2A4NA 1M4IA 3FRMA 3S6HA 2CF4A 4NGMA 2V8VA 1R43A 4KORA 4RUHA 1TKHA 4F9VA 2YNDA 3OWCA 3PZJA 3BJ8A 1CP6A 3IC1A 3FEDA 1XRYA 2EO8A 5HXDA 3S6FA 2DF5A 3KL9A 2EVNA 4MMOA 1EE3P 4JZ0A 4X5KA 3G8WA 4KSIA 1Y0YA 4PXDA 2ZW4A 3D4UA 3B8GA 1QSTA 2J8MA 1XEBA 4UCPA 3WABA 1QSNA 3R9FA 3WR7A 1FY7A 2PRBA 2VBQA 3SJEA 4MFZA 1F2OA 1TXRA 2PJ9A 4MCPA 4UF4A 1IIDA 5LRGA 5JQ4A 3A9LA 1JQGA 2JEWA 3R9GA 2IJZA 3CDXA 2R7HA 1I12A 3B7IA 3IIBA 5HVFA 2YNCA 4MFLA 4PSWA 3H8FA 4MI4A 4P45A 4WJBA 3TOAA 4R8FA 5JM6A 2B5GB 2GANA 4KOTA 4E2AA 5J1QA 2C6GA 2AFWA 3D67A 4GS4A 3CZXA 1XMBA 3TO7A 2V8HA 3F8KA 4KLVA 1WWZA 3KR4A 4II9A 1S7KA 4J3GA 5G22A 3B3VA 2HB6A 4CYOA 5HVGA 2I79A 4PV6A 4A31A 1IOIA 2Z3LA 3ISZA 4A38A 1BOBA 5AG7A 3SXNA 1MJ9A 3HUVA 4CYQA 3CXQA 1L0CA 3KZWA 4ONUA 3EY5A 2FXFA 3TO6A 4UIBA 1Y9KA 4JWPA 5C82A 2IQ6A 3IFEA 2PC1A 4P4DA 4R3KA 2QVPA 5AG4A 3EFAA 4GM5A 4LX9A 2PJ8A 2ANPA 2VZZA 4BBHA 3QAYA 3D7FA 3NH4A 4Q36A 5AGEA 2CNSA 2CNMA 4ZY2A 3S9MA 3KQZA 3SI2A 3RYOA 4MY0A 1M1DA 1IICA 1YGHA 3D2MA 2B5GA 3KQXA 4JXQA 5F48A 5HVHA 3GKRA 4EFDA 4PQAA 2B58A 1YVKA 1MJBA 2GLJA 4WWVA 2DEAA 5THWA 4FD4A 1VHEA 3VH9A 1FT7A 5FVJA 4OC0A 5D29A 4AG9A 1HDUA 3FX6A 1ARLA 4JXRA 5I0CA 2ARHA 5F47A 1PU9A 1TIQA 2ZW6A 4KOSA 4Y49B 1Z9UA 4MFKA 4A33A 4NCZA 1S7LA 1MK4A 2B4BA 1LOKA 3GUXA 3B3CA 1QSMA 4CRZB 2ZOGA 5IV0A 3B35A 2AE6A 4AVBA 4R7MA 1S7NA 4HNWB 2EBJA 4R87A 3NH5A 2HQYA 1F2PA 3LMSA 3VATA 4YRHA 2Z3OA 2C6CA 2VZYA 2D4PA 4MXUA 4RS2A 3IWGA 2EUIA 3BI0A 2G3AA 3K2KA 2ZEMA 4F6AA 1S60A 2FIWA 4ONWA 4ZY1A 4K30A 4ZYQA 4CGNA 3GYAA 5K8NA 3PB4X 1S5KA 3V38A 3R1KA 2WUUA 3V8IA 4KUBA 4TWEA 3RNZA 4F0YA 1XJOA 2WZNA 4EVYA 3IU2A 4KVXA 2PJAA 3C26A 3QAHA 4KVOE 5DWNA 1A2ZA 3N7ZA 1X10A 2BSWA 3SHPA 2OZGA 1K4JA 4KSFA 4H6ZA 2PJ7A 1H8LA 1Q2DA 1YR0A 4KOUA 3IJ3A 1NSAA 4HNYB 3RAMA 2RC4A 4H6UA 3PB7X 3W6SA 2REFA 5ISVA 4NJQA 1RO5A 4A95A 3FYNA 3D3SA 3LD2A 4Y49C 4ZX9A 3S9LA 3IWEA 2FL4A 4AVAA 3D8PA 3H5ZA 2J9AA 4P4BA 3V7ZA 4CGOA 2GIVA 4DUKA 4UFVA 4A2ZA 3W91A 1Y0RA 4HNXB 4RN7A 2KCWA 2R1IA 5C88A 2XEJA 4NGTA 2C1CA 3CPXA 2G9DA 4FUUA 4A94A 1IOFA 3BLNA 4I49A 1OBRA 3P2FA 2Q4ZA 1VGYA 4X2TA 4ZY0A 4C7HA 4L89A 1YVOA 3T90A 3RZAA 2F5IA 4PXCA 3B3SA 1YLEA 4B5PA 2ZEDA 4U5YA 3D68A 4A30A 3RBUA 2YNCC 1LRZA 1U6MA 4NSQA 5G20A 1YQEA 2RB7A 3IEHA 4C2XA 2P6GA 2WSAA 1DE4C 5J8CA 3I1UA 2FT0A 1B87A 2QECA 3BXMA 1Z8TA 3QB8A 5ELYA 3KI9A 2JLMA 2PJ1A 1YLOA 5CBMA 4YFJA 5JPHA 2YNEA 1IU8A 5LYDA 1CP7A 4DNCA 3T8WA 4OLLA 4H89A 4XNHB 2FS5A 1I21A 2O28A 1FNOA 3ISXA 4UBRA 2O53A 3CPAA 3WC6A 1I1DA 4CRYB 3PBEA 1X12A
chains in the Genus database with same CATH topology
3DSBA 2D4OA 1IYLA 2R8VA 3EO4A 3S6GA 3FXTA 4M85A 5KTCA 2YGWA 4ZBGA 3ZZIA 4B12A 3FIXA 5F46A 4JLYA 4MHDA 1IYKA 1ON0A 2PDOA 2REEA 2B3VA 1UFHA 4CYPA 2ZW5A 5IB0A 4UFXA 4XPKA 5G21A 3FBUA 3DR8A 1XMTA 3PP9A 1KUXA 4B5OA 4U9ZA 1Z4RA 2H5MA 2ZPAA 3R9EA 3LODA 3BJ7A 2CY2A 4CAWA 5HMNA 3IU1A 4C2ZA 2G3TA 4KOXA 4R3LA 2QMLA 3FB3A 3SXOA 4UA3A 1PUAA 2OZHA 1KUVA 3T9YA 4NXYA 4C2YA 4UWIA 1BO4A 5DWMA 4KOWA 4PK2A 4MBUA 4B11A 2B4DB 3K9UA 1XF8A 4LUAA 2Z10A 4PSXA 4CAFA 1N71A 1J4JA 4CGPA 2G0BA 5E96A 1VHSA 4OAEA 4NF1A 1NE9A 3EC4A 4XPLA 4B10A 2WPWA 4KOYA 1KUYA 2DPSA 2P6EA 4KOVA 2Q44A 1S3ZA 2JDDA 4U9YA 4FD7A 2FE7A 1Y7RA 4KUAA 5CNPA 4KVME 2FSRA 5F49A 1Z4EA 1M44A 2B4DA 4IF5A 2P6FA 3R95A 1OZPA 1YK3A 2B3UA 3GY9A 2GE3A 3DDDA 3ZJ0A 1CM0A 3F0AA 4M3SA 4JD6A 2P0WA 3NE7A 3CXPA 4MJ8A 5H84A 3D2PA 3JTKA 4XNHC 2X7BA 4E8OA 4R9MA 4AVCA 1M4GA 2Q4YA 2FCKA 4ZGYB 3UY5A 3G3SA 3VWDA 3KKWA 2PR1A 2PR8A 3E0KA 2Z3KA 1MJAA 1ZO0A 4F0XA 2DPTA 1P0HA 4MY3A 2PSWA 2Q0YA 5H86A 3TOBA 4KZTA 2ATRA 4XPDB 3I3GA 1NMTA 2Z0ZA 1M4DA 2C27A 1Q2YA 3TT2A 2Z11A 1P4NA 2JDCA 4JJXA 1IB1E 4UCMA 1Q2CA 2OU2A 4QC6A 5AG5A 4CAVA 4A32A 4E0AA 2OZUA 4KS9A 5HH1A 2CNTA 4MFJA 2Q7BA 2J8NA 2OB0A 3EXNA 5J8FA 4NEXA 4CS0B 1B6BA 5EBVA 3TO9A 3PGPA 3P2HA 2HUZA 1SQHA 4IUSA 2BEIA 1CJWA 4C7IA 1R57A 2ZW7A 4UWJA 2JEVA 3MGDA 4BMHA 3W6XA 2J8RA 2FIAA 4XPDC 2QIRA 3TCVA 4B14A 2AJ6A 3TFYA 1VKCA 3R96A 2VQYA 2IL4A 2I00A 3JVNA 5A28A 4QB9A 2K5TA 2Y0MA 3I9SA 2HV2A 4QVTA 4L8AA 4MFQA 4C68A 1XIXA 1WK4A 3H4QA 2Q4VA 5KTAA 5KTDA 4KSAA 4QBJA 2OH1A 4B13A 2Z3PA 2Z3NA 4KLWA 1GHEA 2Q04A 5AG6A 5BWAB 4FD6A 2VXKA 4CGLA 1QSRA 2R98A 1RXTA 4Q38A 4YGOA 1YX0A 2ZXVA 4RI1A 4UCNA 3TE4A 4CYNA 1YREA 3CXSA 3IGRA 5G1ZA 1XE4A 2VEZA 2BL1A 4B5PB 3TTHA 3FNCA 4OADA 4QUSA 3VWEA 4UFWA 4AG7A 4CAEA 3DR6A 1S7FA 2Z3MA 3DNSA 2WPXA 2NMTA 5A27A 4MFPA 5IX3A 5EC4A 4R57A 4PK3A 4ORFA 2PQ8A 4FD5A 1V0CA 3F5BA 1QSOA 1NSLA 3S6KA 2CXAA 3JUWA 5GCNA 1KZFA 4HKFA 4CAXA 2BUEA 4CGMA 1Y9WA 4AB7A 2DXQA 2A4NA 1M4IA 3FRMA 3S6HA 4KORA 2YNDA 3OWCA 3PZJA 3BJ8A 3S6FA 2EVNA 4X5KA 3G8WA 2ZW4A 3B8GA 1QSTA 2J8MA 1XEBA 4UCPA 1QSNA 3R9FA 3WR7A 1FY7A 2PRBA 2VBQA 4MFZA 1IIDA 5JQ4A 3A9LA 3R9GA 2R7HA 1I12A 2YNCA 4MFLA 4PSWA 4MI4A 3TOAA 2B5GB 2GANA 4KOTA 4E2AA 4GS4A 3TO7A 3F8KA 4KLVA 1WWZA 4II9A 1S7KA 4J3GA 5G22A 4CYOA 2I79A 4PV6A 4A31A 2Z3LA 1BOBA 5AG7A 3SXNA 1MJ9A 4CYQA 3CXQA 1L0CA 4ONUA 3EY5A 2FXFA 3TO6A 1Y9KA 4JWPA 5C82A 2PC1A 4R3KA 5AG4A 3EFAA 4LX9A 2VZZA 4BBHA 5AGEA 4Q36A 2CNSA 2CNMA 3RYOA 4MY0A 1M1DA 1IICA 1YGHA 3D2MA 2B5GA 4JXQA 5F48A 3GKRA 2B58A 1YVKA 1MJBA 4FD4A 5FVJA 4AG9A 4JXRA 5I0CA 2ARHA 5F47A 1PU9A 1TIQA 2ZW6A 4KOSA 4Y49B 1Z9UA 4MFKA 4A33A 4NCZA 1S7LA 1MK4A 2B4BA 1QSMA 4CRZB 5IV0A 2AE6A 4AVBA 1S7NA 4HNWB 4R87A 2HQYA 4YRHA 2Z3OA 2VZYA 2D4PA 4RS2A 3IWGA 2EUIA 2G3AA 4F6AA 1S60A 2FIWA 4K30A 4CGNA 3GYAA 1S5KA 3R1KA 2WUUA 3V8IA 4KUBA 4F0YA 4EVYA 3IU2A 4KVXA 3QAHA 3C26A 4KVOE 5DWNA 3N7ZA 2BSWA 3SHPA 2OZGA 1K4JA 4KSFA 4H6ZA 1YR0A 1Q2DA 4KOUA 4HNYB 2RC4A 4H6UA 3W6SA 2REFA 5ISVA 1RO5A 4A95A 3FYNA 3D3SA 3LD2A 4Y49C 3IWEA 2FL4A 4AVAA 3D8PA 3H5ZA 4CGOA 2GIVA 4UFVA 4A2ZA 3W91A 4HNXB 2KCWA 2R1IA 5C88A 3BLNA 4I49A 3P2FA 4C7HA 4L89A 1YVOA 3T90A 2F5IA 1YLEA 4B5PA 4U5YA 4A30A 2YNCC 1LRZA 1U6MA 4NSQA 5G20A 4C2XA 2P6GA 2WSAA 5J8CA 2FT0A 1B87A 2QECA 3QB8A 2JLMA 4YFJA 5JPHA 2YNEA 4DNCA 4OLLA 4H89A 4XNHB 2FS5A 1I21A 2O28A 4UBRA 4CRYB 1I1DA 2VI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C68 A;  4CYN A;  3JTK A;  5G1Z A;  4A30 A;  4B11 A;  4C7I A;  2YNC C;  4UCM A;  4UCP A;  5G22 A;  5G20 A;  4A95 A;  4CYO A;  4C2X A;  2WSA A;  4A31 A;  4CGM A;  4B12 A;  4CGN A;  5AG5 A;  5AG7 A;  4CYQ A;  3IWE A;  4B13 A;  4UFW A;  4A32 A;  4CAF A;  4CAE A;  2WUU A;  3H5Z A;  4CGO A;  4B14 A;  3IU1 A;  4UFV A;  4C2Z A;  4A2Z A;  5AG6 A;  4A33 A;  4CGP A;  2YND A;  5A27 A;  2YNE A;  4CGL A;  5A28 A;  5AG4 A;  3IU2 A;  2YNC A;  4CYP A;  4UFX A;  4B10 A;  4BBH A;  4C2Y A;  5AGE A;  5G21 A;  4C7H A;  4UCN A; 
#chains in the Genus database with same CATH topology
 1ZG8 A;  1Z8L A;  3DSB A;  3GLJ A;  2PIY A;  4OKO A;  1LFW A;  2D4O A;  1IYL A;  3TX8 A;  2R8V A;  3EO4 A;  2POK A;  3S6G A;  5IB9 A;  2IMO A;  3FXT A;  4M85 A;  4OC4 A;  4YU9 A;  5KTC A;  2AFM A;  2YGW A;  4NGP A;  4BD9 A;  4ZI6 A;  4ZBG A;  3ZZI A;  4OP4 A;  3D7D A;  4B12 A;  1IY7 A;  3FIX A;  2PE3 A;  5F46 A;  1BAV A;  1LAP A;  1ZLI A;  4JLY A;  4EWT A;  4MHD A;  1ZG7 A;  1IYK A;  5D8N A;  3PB9 X;  3GB0 A;  4OC2 A;  2ZEL A;  1ON0 A;  2PDO A;  4NJR A;  2REE A;  2B3V A;  1UFH A;  2I3C A;  4CYP A;  4NGN A;  2ZEE A;  1HDQ A;  2ZW5 A;  5IB0 A;  4UFX A;  4MCQ A;  1R3N A;  2HC9 A;  3K9T A;  4XPK A;  4OID A;  2XEI A;  3FBU A;  4R6T A;  5G21 A;  3SJG A;  3DR8 A;  1XMT A;  3PP9 A;  4UIA A;  1KUX A;  1ARM A;  4OC5 A;  4FWU A;  2V77 A;  4B5O A;  3PRT A;  4U9Z A;  2PJ6 A;  1Z4R A;  2H5M A;  2ZPA A;  3R9E A;  4OC1 A;  4JYW A;  3LOD A;  3QNV A;  4P44 A;  3BJ7 A;  5F09 A;  2GLF A;  3KHZ A;  4MHP A;  4O23 A;  2CY2 A;  3KHX A;  4CAW A;  2OOT A;  5HMN A;  3IU1 A;  4C2Z A;  2G3T A;  4KOX A;  4R3L A;  1Y7E A;  2QML A;  1PYT B;  3FB3 A;  3PEI A;  3SI0 A;  3SXO A;  4UA3 A;  3WC5 A;  1PUA A;  2OZH A;  1KUV A;  2Q7S A;  3T9Y A;  4NXY A;  4PPZ A;  4MCR A;  1RTQ A;  4C2Y A;  4UWI A;  1TF9 A;  3IWW A;  1BO4 A;  2F7V A;  4P4J A;  5DWM A;  1M4L A;  4KOW A;  4PK2 A;  4F9U A;  4MBU A;  1VIX A;  2B4D B;  3PB8 X;  4B11 A;  2PJ4 A;  2PVW A;  3IO1 A;  3K9U A;  2EK9 A;  3FJU A;  5K8M A;  1XF8 A;  4LUA A;  2Z10 A;  3PFE A;  4PSX A;  2QYV A;  2AFS A;  4CAF A;  3H8G A;  1Q7L A;  4UEF A;  2Q43 A;  1N71 A;  2PRQ A;  1J4J A;  3SJF A;  4CGP A;  2G0B A;  5E96 A;  4UEZ A;  3TC8 A;  2PJ0 A;  4MCS A;  1JWQ A;  1ZLH A;  1VHS A;  4OAE A;  4NF1 A;  3PB6 X;  1NE9 A;  3EC4 A;  4XPL A;  4B10 A;  2VL1 A;  2WPW A;  3FEE A;  4G1P A;  4KOY A;  1KUY A;  2DPS A;  4EME A;  2P6E A;  3D7G A;  2NYQ A;  1Z2L A;  4KOV A;  4P4F A;  2Q44 A;  1S3Z A;  2C6P A;  4MHN A;  1AUG A;  8CPA A;  2JDD A;  4U9Y A;  1TF8 A;  4FD7 A;  3FMC A;  2FE7 A;  1Y7R A;  3LWU A;  4KUA A;  4PXB A;  5CNP A;  4KVM E;  2FSR A;  5F49 A;  1Z4E A;  1M44 A;  2B4D A;  4IF5 A;  2P6F A;  4W9Y A;  5LRJ A;  2XEG A;  3R95 A;  6CPA A;  1OZP A;  1YK3 A;  1VHO A;  2B3U A;  4P6Y A;  3WT4 A;  3GY9 A;  2GE3 A;  3DDD A;  2OR4 A;  1LCP A;  3ZJ0 A;  4DYO A;  1CM0 A;  3F0A A;  3FH4 A;  1BPM A;  4M3S A;  4FAI A;  4JD6 A;  2P0W A;  3NE7 A;  2ODF A;  3CXP A;  4MJ8 A;  5H84 A;  3D2P A;  4DJL A;  4LQG A;  3JTK A;  2PCU A;  3B3T A;  3FVL A;  3KGQ A;  1XFO A;  4R76 A;  4XNH C;  2X7B A;  5JH9 A;  4E8O A;  4R9M A;  4AVC A;  1M4G A;  4NGR A;  2Q4Y A;  3KR5 A;  2FCK A;  4K3N A;  4ZGY B;  4NFR A;  4Z65 A;  2BO9 A;  3G3S A;  3UY5 A;  3VWD A;  2WYR A;  3KKW A;  2PR1 A;  2PR8 A;  3E0K A;  2Z3K A;  1MJA A;  1ZO0 A;  4F0X A;  1CG2 A;  3D7H A;  2PJ3 A;  2DPT A;  1P0H A;  2PVV A;  4M6G A;  4MY3 A;  3VAR A;  4A37 A;  2PSW A;  2Q0Y A;  5H86 A;  3TOB A;  4KZT A;  2ATR A;  1ZG9 A;  4XPD B;  3I3G A;  2ZEH A;  3S9N A;  1NMT A;  2Z0Z A;  1PCA A;  2AFZ A;  1M4D A;  2C27 A;  1Q2Y A;  3TT2 A;  2Z11 A;  1P4N A;  2JDC A;  4JJX A;  4UEE A;  1XBU A;  1YME A;  1IB1 E;  3DLJ A;  3NFZ A;  4UCM A;  1QQ9 A;  3BHX A;  1Q2C A;  3LAC A;  2QJ8 A;  2OU2 A;  1BPN A;  2O4H A;  4QC6 A;  1TKJ A;  4IHM A;  5AG5 A;  4CAV A;  4A32 A;  4E0A A;  3D66 A;  1QMU A;  2BCO A;  2OZU A;  2PJC A;  3H8E A;  4KS9 A;  2BOA A;  3L2N A;  5HH1 A;  2CNT A;  4MFJ A;  2ZEG A;  1CX8 A;  2J8N A;  2OB0 A;  3EXN A;  3FEC A;  3MN8 A;  5DS0 A;  2Q7B A;  3NA6 A;  5J8F A;  5K8O A;  4NEX A;  4CS0 B;  4MHY A;  3NH8 A;  1B6B A;  4GXH A;  5EBV A;  3TO9 A;  3PGP A;  3P2H A;  4P4E A;  2HUZ A;  1SQH A;  4IUS A;  1LAN A;  4BIN A;  2BEI A;  1ELL P;  1Z8W A;  5I4M A;  1CJW A;  1ELM P;  5LYL A;  4IAV A;  1R57 A;  2GFQ A;  4C7I A;  2ZW7 A;  4UWJ A;  4H2K A;  2GU2 A;  2JEV A;  2AFU A;  2JBJ A;  4MRI A;  3MGD A;  3KAS A;  4BMH A;  1GYT A;  3W6X A;  3HLP A;  4X8I A;  2J8R A;  4M6H A;  2FIA A;  2CTC A;  4XPD C;  2GRE A;  2QIR A;  4P4I A;  3TCV A;  4B14 A;  1YW6 A;  2AJ6 A;  3TFY A;  1VKC A;  3NE8 A;  3R96 A;  1CPS A;  2VQY A;  2IL4 A;  4F8Z A;  2I00 A;  3BI1 A;  3JVN A;  5A28 A;  2ZEN A;  4QB9 A;  4MHZ A;  2JBK A;  2CTB A;  2K5T A;  3DGV A;  4PXE A;  2Y0M A;  3I9S A;  2HV2 A;  4QVT A;  1UWY A;  4L8A A;  4MFQ A;  1YW4 A;  3PFO A;  2ZEO A;  3B2Y A;  4X3R A;  3N5F A;  3RO0 A;  4C68 A;  1XIX A;  4AXV A;  4CPA A;  1WK4 A;  1KWM A;  1HEE A;  3H4Q A;  2Q4V A;  2FVG A;  2V8G A;  5KTA A;  5KTD A;  4Q7A A;  4KSA A;  1DTD A;  4QBJ A;  2OH1 A;  2AFX A;  2EWB A;  2PIZ A;  2Z3P A;  2PJ5 A;  5LYI A;  3SJX A;  4B13 A;  2F8H A;  2Z3N A;  4LQ6 A;  2NSM A;  4KLW A;  1GHE A;  2Q04 A;  5AG6 A;  5BWA B;  2CIJ A;  1CPX A;  1Z5R A;  2XEF A;  4FD6 A;  4OIW A;  2VXK A;  4CGL A;  2PJB A;  1QSR A;  1LAM A;  3B3W A;  2R98 A;  1RXT A;  4Q38 A;  2Q51 A;  5K8P A;  4YGO A;  1YX0 A;  2ABZ A;  2ZXV A;  4RI1 A;  1AYE A;  2ZEF A;  4UCN A;  3TE4 A;  4CYN A;  2ZOF A;  5EMI A;  1YRE A;  1BLL E;  3CXS A;  3IGR A;  3GIU A;  4TNU A;  5G1Z A;  5LRK A;  4A39 A;  1CBX A;  3JRU A;  1XE4 A;  2V8D A;  2BL1 A;  2VEZ A;  4OME A;  3TTH A;  4B5P B;  4B6Z A;  3FNC A;  5JGF A;  4OAD A;  4NGS A;  4QUS A;  3VWE A;  2VI7 A;  3MRU A;  7CPA A;  4UFW A;  4AG7 A;  4CAE A;  3DR6 A;  4P10 A;  1S7F A;  2Z3M A;  3DNS A;  2WPX A;  2PJ2 A;  2NMT A;  5A27 A;  1IGB A;  4MFP A;  3FF3 A;  1XOV A;  3CT9 A;  5EC4 A;  4IK2 A;  4R57 A;  5IX3 A;  4PK3 A;  4ORF A;  4ZX8 A;  2RFH A;  2AFO A;  1TKF A;  2PQ8 A;  3SI1 A;  5LYF A;  4FD5 A;  1V0C A;  3F5B A;  1QSO A;  4M6I A;  4NGQ A;  1Z8X A;  2EK8 A;  1NSL A;  2CXA A;  3JUW A;  3PBB A;  4HPS A;  4YWY A;  3S6K A;  1YSJ A;  3WC7 A;  4FBE A;  5GCN A;  1KZF A;  4OC3 A;  4HKF A;  1AMP A;  5CPA A;  4CAX A;  2BUE A;  4CGM A;  2ZEP A;  1Y9W A;  4AB7 A;  1F57 A;  2DXQ A;  2A4N A;  1M4I A;  3FRM A;  3S6H A;  2CF4 A;  4NGM A;  2V8V A;  1R43 A;  4KOR A;  4RUH A;  1TKH A;  4F9V A;  2YND A;  3OWC A;  3PZJ A;  3BJ8 A;  1CP6 A;  3IC1 A;  3FED A;  1XRY A;  2EO8 A;  5HXD A;  3S6F A;  2DF5 A;  3KL9 A;  2EVN A;  4MMO A;  1EE3 P;  4JZ0 A;  4X5K A;  3G8W A;  4KSI A;  1Y0Y A;  4PXD A;  2ZW4 A;  3D4U A;  3B8G A;  1QST A;  2J8M A;  1XEB A;  4UCP A;  3WAB A;  1QSN A;  3R9F A;  3WR7 A;  1FY7 A;  2PRB A;  2VBQ A;  3SJE A;  4MFZ A;  1F2O A;  1TXR A;  2PJ9 A;  4MCP A;  4UF4 A;  1IID A;  5LRG A;  5JQ4 A;  3A9L A;  1JQG A;  2JEW A;  3R9G A;  2IJZ A;  3CDX A;  2R7H A;  1I12 A;  3B7I A;  3IIB A;  5HVF A;  2YNC A;  4MFL A;  4PSW A;  3H8F A;  4MI4 A;  4P45 A;  4WJB A;  3TOA A;  4R8F A;  5JM6 A;  2B5G B;  2GAN A;  4KOT A;  4E2A A;  5J1Q A;  2C6G A;  2AFW A;  3D67 A;  4GS4 A;  3CZX A;  1XMB A;  3TO7 A;  2V8H A;  3F8K A;  4KLV A;  1WWZ A;  3KR4 A;  4II9 A;  1S7K A;  4J3G A;  5G22 A;  3B3V A;  2HB6 A;  4CYO A;  5HVG A;  2I79 A;  4PV6 A;  4A31 A;  1IOI A;  2Z3L A;  3ISZ A;  4A38 A;  1BOB A;  5AG7 A;  3SXN A;  1MJ9 A;  3HUV A;  4CYQ A;  3CXQ A;  1L0C A;  3KZW A;  4ONU A;  3EY5 A;  2FXF A;  3TO6 A;  4UIB A;  1Y9K A;  4JWP A;  5C82 A;  2IQ6 A;  3IFE A;  2PC1 A;  4P4D A;  4R3K A;  2QVP A;  5AG4 A;  3EFA A;  4GM5 A;  4LX9 A;  2PJ8 A;  2ANP A;  2VZZ A;  4BBH A;  3QAY A;  3D7F A;  3NH4 A;  4Q36 A;  5AGE A;  2CNS A;  2CNM A;  4ZY2 A;  3S9M A;  3KQZ A;  3SI2 A;  3RYO A;  4MY0 A;  1M1D A;  1IIC A;  1YGH A;  3D2M A;  2B5G A;  3KQX A;  4JXQ A;  5F48 A;  5HVH A;  3GKR A;  4EFD A;  4PQA A;  2B58 A;  1YVK A;  1MJB A;  2GLJ A;  4WWV A;  2DEA A;  5THW A;  4FD4 A;  1VHE A;  3VH9 A;  1FT7 A;  5FVJ A;  4OC0 A;  5D29 A;  4AG9 A;  1HDU A;  3FX6 A;  1ARL A;  4JXR A;  5I0C A;  2ARH A;  5F47 A;  1PU9 A;  1TIQ A;  2ZW6 A;  4KOS A;  4Y49 B;  1Z9U A;  4MFK A;  4A33 A;  4NCZ A;  1S7L A;  1MK4 A;  2B4B A;  1LOK A;  3GUX A;  3B3C A;  1QSM A;  4CRZ B;  2ZOG A;  5IV0 A;  3B35 A;  2AE6 A;  4AVB A;  4R7M A;  1S7N A;  4HNW B;  2EBJ A;  4R87 A;  3NH5 A;  2HQY A;  1F2P A;  3LMS A;  3VAT A;  4YRH A;  2Z3O A;  2C6C A;  2VZY A;  2D4P A;  4MXU A;  4RS2 A;  3IWG A;  2EUI A;  3BI0 A;  2G3A A;  3K2K A;  2ZEM A;  4F6A A;  1S60 A;  2FIW A;  4ONW A;  4ZY1 A;  4K30 A;  4ZYQ A;  4CGN A;  3GYA A;  5K8N A;  3PB4 X;  1S5K A;  3V38 A;  3R1K A;  2WUU A;  3V8I A;  4KUB A;  4TWE A;  3RNZ A;  4F0Y A;  1XJO A;  2WZN A;  4EVY A;  3IU2 A;  4KVX A;  2PJA A;  3C26 A;  3QAH A;  4KVO E;  5DWN A;  1A2Z A;  3N7Z A;  1X10 A;  2BSW A;  3SHP A;  2OZG A;  1K4J A;  4KSF A;  4H6Z A;  2PJ7 A;  1H8L A;  1Q2D A;  1YR0 A;  4KOU A;  3IJ3 A;  1NSA A;  4HNY B;  3RAM A;  2RC4 A;  4H6U A;  3PB7 X;  3W6S A;  2REF A;  5ISV A;  4NJQ A;  1RO5 A;  4A95 A;  3FYN A;  3D3S A;  3LD2 A;  4Y49 C;  4ZX9 A;  3S9L A;  3IWE A;  2FL4 A;  4AVA A;  3D8P A;  3H5Z A;  2J9A A;  4P4B A;  3V7Z A;  4CGO A;  2GIV A;  4DUK A;  4UFV A;  4A2Z A;  3W91 A;  1Y0R A;  4HNX B;  4RN7 A;  2KCW A;  2R1I A;  5C88 A;  2XEJ A;  4NGT A;  2C1C A;  3CPX A;  2G9D A;  4FUU A;  4A94 A;  1IOF A;  3BLN A;  4I49 A;  1OBR A;  3P2F A;  2Q4Z A;  1VGY A;  4X2T A;  4ZY0 A;  4C7H A;  4L89 A;  1YVO A;  3T90 A;  3RZA A;  2F5I A;  4PXC A;  3B3S A;  1YLE A;  4B5P A;  2ZED A;  4U5Y A;  3D68 A;  4A30 A;  3RBU A;  2YNC C;  1LRZ A;  1U6M A;  4NSQ A;  5G20 A;  1YQE A;  2RB7 A;  3IEH A;  4C2X A;  2P6G A;  2WSA A;  1DE4 C;  5J8C A;  3I1U A;  2FT0 A;  1B87 A;  2QEC A;  3BXM A;  1Z8T A;  3QB8 A;  5ELY A;  3KI9 A;  2JLM A;  2PJ1 A;  1YLO A;  5CBM A;  4YFJ A;  5JPH A;  2YNE A;  1IU8 A;  5LYD A;  1CP7 A;  4DNC A;  3T8W A;  4OLL A;  4H89 A;  4XNH B;  2FS5 A;  1I21 A;  2O28 A;  1FNO A;  3ISX A;  4UBR A;  2O53 A;  3CPA A;  3WC6 A;  1I1D A;  4CRY B;  3PBE A;  1X12 A; 
#chains in the Genus database with same CATH homology
 3DSB A;  2D4O A;  1IYL A;  2R8V A;  3EO4 A;  3S6G A;  3FXT A;  4M85 A;  5KTC A;  2YGW A;  4ZBG A;  3ZZI A;  4B12 A;  3FIX A;  5F46 A;  4JLY A;  4MHD A;  1IYK A;  1ON0 A;  2PDO A;  2REE A;  2B3V A;  1UFH A;  4CYP A;  2ZW5 A;  5IB0 A;  4UFX A;  4XPK A;  5G21 A;  3FBU A;  3DR8 A;  1XMT A;  3PP9 A;  1KUX A;  4B5O A;  4U9Z A;  1Z4R A;  2H5M A;  2ZPA A;  3R9E A;  3LOD A;  3BJ7 A;  2CY2 A;  4CAW A;  5HMN A;  3IU1 A;  4C2Z A;  2G3T A;  4KOX A;  4R3L A;  2QML A;  3FB3 A;  3SXO A;  4UA3 A;  1PUA A;  2OZH A;  1KUV A;  3T9Y A;  4NXY A;  4C2Y A;  4UWI A;  1BO4 A;  5DWM A;  4KOW A;  4PK2 A;  4MBU A;  4B11 A;  2B4D B;  3K9U A;  1XF8 A;  4LUA A;  2Z10 A;  4PSX A;  4CAF A;  1N71 A;  1J4J A;  4CGP A;  2G0B A;  5E96 A;  1VHS A;  4OAE A;  4NF1 A;  1NE9 A;  3EC4 A;  4XPL A;  4B10 A;  2WPW A;  4KOY A;  1KUY A;  2DPS A;  2P6E A;  4KOV A;  2Q44 A;  1S3Z A;  2JDD A;  4U9Y A;  4FD7 A;  2FE7 A;  1Y7R A;  4KUA A;  5CNP A;  4KVM E;  2FSR A;  5F49 A;  1Z4E A;  1M44 A;  2B4D A;  4IF5 A;  2P6F A;  3R95 A;  1OZP A;  1YK3 A;  2B3U A;  3GY9 A;  2GE3 A;  3DDD A;  3ZJ0 A;  1CM0 A;  3F0A A;  4M3S A;  4JD6 A;  2P0W A;  3NE7 A;  3CXP A;  4MJ8 A;  5H84 A;  3D2P A;  3JTK A;  4XNH C;  2X7B A;  4E8O A;  4R9M A;  4AVC A;  1M4G A;  2Q4Y A;  2FCK A;  4ZGY B;  3UY5 A;  3G3S A;  3VWD A;  3KKW A;  2PR1 A;  2PR8 A;  3E0K A;  2Z3K A;  1MJA A;  1ZO0 A;  4F0X A;  2DPT A;  1P0H A;  4MY3 A;  2PSW A;  2Q0Y A;  5H86 A;  3TOB A;  4KZT A;  2ATR A;  4XPD B;  3I3G A;  1NMT A;  2Z0Z A;  1M4D A;  2C27 A;  1Q2Y A;  3TT2 A;  2Z11 A;  1P4N A;  2JDC A;  4JJX A;  1IB1 E;  4UCM A;  1Q2C A;  2OU2 A;  4QC6 A;  5AG5 A;  4CAV A;  4A32 A;  4E0A A;  2OZU A;  4KS9 A;  5HH1 A;  2CNT A;  4MFJ A;  2Q7B A;  2J8N A;  2OB0 A;  3EXN A;  5J8F A;  4NEX A;  4CS0 B;  1B6B A;  5EBV A;  3TO9 A;  3PGP A;  3P2H A;  2HUZ A;  1SQH A;  4IUS A;  2BEI A;  1CJW A;  4C7I A;  1R57 A;  2ZW7 A;  4UWJ A;  2JEV A;  3MGD A;  4BMH A;  3W6X A;  2J8R A;  2FIA A;  4XPD C;  2QIR A;  3TCV A;  4B14 A;  2AJ6 A;  3TFY A;  1VKC A;  3R96 A;  2VQY A;  2IL4 A;  2I00 A;  3JVN A;  5A28 A;  4QB9 A;  2K5T A;  2Y0M A;  3I9S A;  2HV2 A;  4QVT A;  4L8A A;  4MFQ A;  4C68 A;  1XIX A;  1WK4 A;  3H4Q A;  2Q4V A;  5KTA A;  5KTD A;  4KSA A;  4QBJ A;  2OH1 A;  4B13 A;  2Z3P A;  2Z3N A;  4KLW A;  1GHE A;  2Q04 A;  5AG6 A;  5BWA B;  4FD6 A;  2VXK A;  4CGL A;  1QSR A;  2R98 A;  1RXT A;  4Q38 A;  4YGO A;  1YX0 A;  2ZXV A;  4RI1 A;  4UCN A;  3TE4 A;  4CYN A;  1YRE A;  3CXS A;  3IGR A;  5G1Z A;  1XE4 A;  2VEZ A;  2BL1 A;  4B5P B;  3TTH A;  3FNC A;  4OAD A;  4QUS A;  3VWE A;  4UFW A;  4AG7 A;  4CAE A;  3DR6 A;  1S7F A;  2Z3M A;  3DNS A;  2WPX A;  2NMT A;  5A27 A;  4MFP A;  5IX3 A;  5EC4 A;  4R57 A;  4PK3 A;  4ORF A;  2PQ8 A;  4FD5 A;  1V0C A;  3F5B A;  1QSO A;  1NSL A;  3S6K A;  2CXA A;  3JUW A;  5GCN A;  1KZF A;  4HKF A;  4CAX A;  2BUE A;  4CGM A;  1Y9W A;  4AB7 A;  2DXQ A;  2A4N A;  1M4I A;  3FRM A;  3S6H A;  4KOR A;  2YND A;  3OWC A;  3PZJ A;  3BJ8 A;  3S6F A;  2EVN A;  4X5K A;  3G8W A;  2ZW4 A;  3B8G A;  1QST A;  2J8M A;  1XEB A;  4UCP A;  1QSN A;  3R9F A;  3WR7 A;  1FY7 A;  2PRB A;  2VBQ A;  4MFZ A;  1IID A;  5JQ4 A;  3A9L A;  3R9G A;  2R7H A;  1I12 A;  2YNC A;  4MFL A;  4PSW A;  4MI4 A;  3TOA A;  2B5G B;  2GAN A;  4KOT A;  4E2A A;  4GS4 A;  3TO7 A;  3F8K A;  4KLV A;  1WWZ A;  4II9 A;  1S7K A;  4J3G A;  5G22 A;  4CYO A;  2I79 A;  4PV6 A;  4A31 A;  2Z3L A;  1BOB A;  5AG7 A;  3SXN A;  1MJ9 A;  4CYQ A;  3CXQ A;  1L0C A;  4ONU A;  3EY5 A;  2FXF A;  3TO6 A;  1Y9K A;  4JWP A;  5C82 A;  2PC1 A;  4R3K A;  5AG4 A;  3EFA A;  4LX9 A;  2VZZ A;  4BBH A;  5AGE A;  4Q36 A;  2CNS A;  2CNM A;  3RYO A;  4MY0 A;  1M1D A;  1IIC A;  1YGH A;  3D2M A;  2B5G A;  4JXQ A;  5F48 A;  3GKR A;  2B58 A;  1YVK A;  1MJB A;  4FD4 A;  5FVJ A;  4AG9 A;  4JXR A;  5I0C A;  2ARH A;  5F47 A;  1PU9 A;  1TIQ A;  2ZW6 A;  4KOS A;  4Y49 B;  1Z9U A;  4MFK A;  4A33 A;  4NCZ A;  1S7L A;  1MK4 A;  2B4B A;  1QSM A;  4CRZ B;  5IV0 A;  2AE6 A;  4AVB A;  1S7N A;  4HNW B;  4R87 A;  2HQY A;  4YRH A;  2Z3O A;  2VZY A;  2D4P A;  4RS2 A;  3IWG A;  2EUI A;  2G3A A;  4F6A A;  1S60 A;  2FIW A;  4K30 A;  4CGN A;  3GYA A;  1S5K A;  3R1K A;  2WUU A;  3V8I A;  4KUB A;  4F0Y A;  4EVY A;  3IU2 A;  4KVX A;  3QAH A;  3C26 A;  4KVO E;  5DWN A;  3N7Z A;  2BSW A;  3SHP A;  2OZG A;  1K4J A;  4KSF A;  4H6Z A;  1YR0 A;  1Q2D A;  4KOU A;  4HNY B;  2RC4 A;  4H6U A;  3W6S A;  2REF A;  5ISV A;  1RO5 A;  4A95 A;  3FYN A;  3D3S A;  3LD2 A;  4Y49 C;  3IWE A;  2FL4 A;  4AVA A;  3D8P A;  3H5Z A;  4CGO A;  2GIV A;  4UFV A;  4A2Z A;  3W91 A;  4HNX B;  2KCW A;  2R1I A;  5C88 A;  3BLN A;  4I49 A;  3P2F A;  4C7H A;  4L89 A;  1YVO A;  3T90 A;  2F5I A;  1YLE A;  4B5P A;  4U5Y A;  4A30 A;  2YNC C;  1LRZ A;  1U6M A;  4NSQ A;  5G20 A;  4C2X A;  2P6G A;  2WSA A;  5J8C A;  2FT0 A;  1B87 A;  2QEC A;  3QB8 A;  2JLM A;  4YFJ A;  5JPH A;  2YNE A;  4DNC A;  4OLL A;  4H89 A;  4XNH B;  2FS5 A;  1I21 A;  2O28 A;  4UBR A;  4CRY B;  1I1D A;  2VI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...