3P2FA

Crystal structure of tofi in an apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
175
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein
total genus 52
structure length 175
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2fA00
2G3TA 3D2MA 2BEIA 3SHPA 3NE7A 3QAHA 4HKFA 4UBRA 1IYLA 2FIWA 4FD6A 4KOYA 3TFYA 1RO5A 3I9SA 1M4IA 1J4JA 1QSOA 4JXQA 2Q04A 4YRHA 5EC4A 5GCNA 4CAVA 1QSNA 2OB0A 2QMLA 2CNSA 1IB1E 3GKRA 4ZBGA 2Q44A 5CNPA 3K9UA 5DWMA 4Y49B 3WR7A 5KTDA 2I00A 3TE4A 3FYNA 1RXTA 2IL4A 3EC4A 3IGRA 2FL4A 2PR8A 1P0HA 4MY0A 3R95A 3BJ8A 2B3UA 4CRZB 3DDDA 4MJ8A 5H84A 4U5YA 1Q2CA 3R1KA 2FIAA 2FCKA 2AE6A 4KOXA 3B8GA 3D2PA 4MHDA 4MY3A 2KCWA 1TIQA 1I12A 1Y9KA 3D8PA 1Y7RA 1U6MA 3FRMA 1B87A 4PV6A 2BL1A 2OZUA 1IYKA 2OZGA 3D3SA 4MI4A 4KUAA 1S7LA 3CXQA 4UWIA 4K30A 1B6BA 5F47A 2HUZA 4IUSA 4XNHB 2B4DB 4HNWB 4RS2A 2ZPAA 4JLYA 1Q2YA 2D4OA 1XMTA 4KVME 4E8OA 2CNMA 2K5TA 4R9MA 1YX0A 5F49A 2B4DA 3BJ7A 2QECA 4FD5A 4H6UA 5E96A 2REEA 1BO4A 2R1IA 4AG7A 5KTAA 4XNHC 2B58A 1KUYA 1KZFA 4KOVA 2DXQA 3P2FA 2VZYA 2ZXVA 1CM0A 2Q4VA 4B5OA 2PSWA 2ZW4A 1SQHA 3EFAA 2B3VA 2BUEA 4II9A 1L0CA 2HV2A 2VXKA 1MJBA 1XE4A 4OADA 4PK3A 2FS5A 1Z4RA 2WPWA 4IF5A 2NMTA 1OZPA 4AVCA 2JDCA 2JLMA 4KOTA 2B5GB 1I21A 1S5KA 3DR8A 5I0CA 4YFJA 1Q2DA 4XPLA 2VQYA 2B5GA 2VBQA 1IICA 1MJAA 3G8WA 3G3SA 3JVNA 3TCVA 3QB8A 4UA3A 4QVTA 4X5KA 3VWDA 2HQYA 3F0AA 3FNCA 4Y49C 2BSWA 4MBUA 4JXRA 4H89A 5HH1A 1S7NA 4ONUA 3W6SA 1WK4A 2C27A 2AJ6A 1Y9WA 3C26A 1S7KA 2O28A 2G0BA 4NSQA 2VI7A 3LD2A 1YVOA 4BMHA 3IWGA 3FBUA 4PSWA 4KUBA 5HMNA 4LUAA 1WWZA 4NEXA 2Q7BA 5J8FA 1BOBA 1VKCA 2PR1A 4KOUA 3ZZIA 4JWPA 2ZW5A 4HNYB 3GY9A 1P4NA 3PZJA 3OWCA 2R98A 4U9ZA 5IX3A 4XPKA 1S60A 2R7HA 5DWNA 1YLEA 4JD6A 2QIRA 1YVKA 3DNSA 4QUSA 4I49A 1PUAA 2OZHA 2Z11A 2ARHA 4CAXA 5IV0A 2PQ8A 5IB0A 4NF1A 3EXNA 3P2HA 3PP9A 3SXNA 2B4BA 2JDDA 2Q4YA 2WPXA 3MGDA 4QBJA 4FD7A 4KLVA 1NSLA 2CNTA 1YGHA 4AVBA 2EVNA 2ZW7A 4OLLA 1NE9A 4F0YA 2OU2A 3R9FA 5F48A 1M4GA 1N71A 1IIDA 2Z0ZA 4J3GA 1UFHA 3CXPA 2P0WA 3S6GA 5C88A 1XF8A 2FSRA 2PC1A 1YR0A 3S6FA 3R9EA 2PDOA 4UWJA 4AG9A 3I3GA 2OH1A 4NCZA 1S7FA 2ATRA 4GS4A 3R9GA 4KOSA 4FD4A 2EUIA 2J8MA 5J8CA 1PU9A 4QB9A 3S6HA 3W6XA 1MK4A 4KLWA 3ZJ0A 2PRBA 4KVOE 3FIXA 2FXFA 1Z9UA 4H6ZA 2F5IA 1S3ZA 1YK3A 3LODA 3TT2A 4YGOA 1R57A 3DR6A 3V8IA 2P6EA 2GANA 4QC6A 1I1DA 4KOWA 1M44A 2Z10A 1LRZA 1QSMA 3N7ZA 3TO6A 3S6KA 2VZZA 5FVJA 1YREA 2REFA 4CS0B 3KKWA 4F6AA 1QSRA 4PK2A 1V0CA 4M85A 2RC4A 3FXTA 4U9YA 4E0AA 3GYAA 4NXYA 1CJWA 4OAEA 4DNCA 2CY2A 2P6GA 1ON0A 5F46A 2JEVA 4L8AA 2A4NA 4KORA 5H86A 2X7BA 3H4QA 4R3KA 2H5MA 2Y0MA 3SXOA 1FY7A 1XIXA 5ISVA 4AVAA 5KTCA 4B5PB 2J8NA 4L89A 4CAWA 3E0KA 3F5BA 3CXSA 4E2AA 3EO4A 5C82A 4AB7A 4PSXA 3UY5A 1Z4EA 4JJXA 3TO9A 1MJ9A 4KZTA 4B5PA 2VEZA 2FT0A 3W91A 1QSTA 2D4PA 2FE7A 2GE3A 1XEBA 4LX9A 3R96A 3T9YA 4R87A 4RI1A 3PGPA 2Q0YA 4ORFA 3TO7A 1NMTA 3RYOA 4R3LA 1VHSA 2J8RA 4XPDB 3TTHA 2GIVA 5JQ4A 1K4JA 2I79A 3DSBA 3JUWA 3TOBA 1KUXA 4CRYB 3FB3A 4R57A 4EVYA 3TOAA 4M3SA 4KVXA 1KUVA 3F8KA 3EY5A 1M1DA 5JPHA 2G3AA 2P6FA 3VWEA 4XPDC 3T90A 3BLNA 1GHEA 2ZW6A 5EBVA 4HNXB 1M4DA 2R8VA
chains in the Genus database with same CATH superfamily
2G3TA 3D2MA 2BEIA 3SHPA 3FF3A 4OC4A 3NE7A 2PVWA 3QAHA 4HKFA 4P4BA 4NJRA 4UBRA 4GM5A 4UIBA 3PFOA 1IYLA 1TXRA 2FIWA 3VH9A 2PJ1A 4FD6A 4KOYA 3BHXA 5CBMA 2G9DA 3TFYA 4M6GA 2BCOA 1RO5A 4OMEA 2PJ9A 3I9SA 1M4IA 3JRUA 2Z3PA 1DE4C 1J4JA 1QSOA 4JXQA 2Q04A 4YRHA 1ARLA 5AG4A 3D4UA 2DPSA 5EC4A 5GCNA 4CAVA 1QSNA 2OB0A 3LMSA 2QMLA 2CNSA 1IB1E 2OR4A 3GKRA 4MRIA 2Q44A 5CNPA 3K9UA 4ZBGA 1Z8LA 5DWMA 4Y49B 3WR7A 4A38A 4EWTA 1Y0YA 5KTDA 5D29A 2I00A 3TE4A 3FYNA 5K8PA 1RXTA 2IL4A 4CGLA 3EC4A 1CG2A 3IGRA 1TF8A 4C2YA 2FL4A 1XFOA 2PR8A 1P0HA 4MY0A 3R95A 5K8MA 3BJ8A 3FECA 5AGEA 3RZAA 5CPAA 2B3UA 4CRZB 3DDDA 4MJ8A 5H84A 2AFSA 4U5YA 1Q2CA 2GREA 2V8DA 3BI1A 3SI2A 3R1KA 1YW6A 2FIAA 2FCKA 2AE6A 1LOKA 3S9LA 4KOXA 3D7DA 4MFKA 3B8GA 4KSFA 5JM6A 3D2PA 2CTCA 4MHDA 4MY3A 4JYWA 2KCWA 4FUUA 1TIQA 1Z8TA 3GIUA 3PBBA 1I12A 1Y9KA 3D8PA 1ZO0A 1Y7RA 3SJGA 1IGBA 2YNCA 4OKOA 1U6MA 1IU8A 3FRMA 2CIJA 1B87A 3KR5A 4UCPA 4X2TA 3FEEA 3PRTA 2BL1A 4PV6A 2OZUA 1Z5RA 3LWUA 1IYKA 2OZGA 3D3SA 1R43A 5IB9A 2YNCC 4MI4A 4KUAA 3K2KA 2FVGA 1S7LA 2YGWA 2HC9A 3CXQA 4UWIA 4K30A 4DJLA 8CPAA 4DUKA 3KGQA 1YW4A 3PB6X 1B6BA 1LCPA 5F47A 4P45A 4P4DA 1BAVA 2HUZA 4UIAA 4CGNA 2HB6A 3ISXA 3H8FA 3D7FA 4IUSA 2BOAA 4MFLA 2B4DB 4HNWB 4RS2A 2EO8A 4XNHB 3V38A 4EFDA 2ZPAA 4JLYA 1R3NA 3FJUA 1Q2YA 2PJBA 4Q7AA 4Q36A 2D4OA 4ZGYB 4P4JA 1AYEA 1XMTA 4KVME 4E8OA 2CNMA 3IO1A 5LYLA 2K5TA 2C1CA 4G1PA 2PJ5A 1YX0A 4R9MA 5F49A 5BWAB 4CAFA 4IAVA 2B4DA 3SI0A 3BJ7A 2QECA 3D7HA 4FD5A 4H6UA 5E96A 2AFZA 2REEA 1BO4A 3FMCA 4NJQA 3KQXA 2PJ2A 2R1IA 4AG7A 5KTAA 2PJCA 4XNHC 2B58A 2PJAA 4JZ0A 4IK2A 4C2XA 1KUYA 2V8GA 2PJ6A 1KZFA 4R8FA 1YMEA 4KOVA 4F9UA 2JBJA 4R7MA 2DXQA 2Q4ZA 3P2FA 2VZYA 3IC1A 2Z3LA 2ZXVA 1CM0A 1Z2LA 4BINA 3VARA 4KSAA 4TNUA 1VGYA 2Q4VA 4KS9A 4B5OA 2PSWA 2ZW4A 1SQHA 4B14A 3EFAA 3NH5A 4A2ZA 2B3VA 2BUEA 4X3RA 3B35A 1BPMA 2XEJA 3FEDA 4II9A 5HVHA 1L0CA 2HV2A 2V77A 2WZNA 3FX6A 2VXKA 4C7IA 1MJBA 2ZEOA 2ZOFA 4CYNA 2JEWA 1KWMA 1XE4A 1X12A 4OADA 4PK3A 2FS5A 2CTBA 1BLLE 1CP7A 3V7ZA 4F9VA 1Z4RA 1IY7A 2WPWA 3I1UA 6CPAA 4IF5A 1AUGA 2NMTA 3B3VA 3ISZA 1OZPA 1IOIA 3IWWA 3WABA 5G20A 4UEEA 2PRQA 2EBJA 4K3NA 1IOFA 1FT7A 2JDCA 1ZLIA 1H8LA 4AVCA 7CPAA 2JLMA 4OC5A 5LYFA 1CX8A 1VHOA 2B5GB 1I21A 4KOTA 4PXEA 1S5KA 4MHYA 5HVFA 1QMUA 3DR8A 1ZG8A 3D68A 5I0CA 4M6HA 4YFJA 1Q7LA 1Q2DA 2ABZA 4XPLA 1LANA 2VQYA 4B6ZA 2ANPA 4ZI6A 4NGTA 2PIYA 3SJEA 3PB9X 2B5GA 3D67A 2VBQA 1IICA 1MJAA 4ZX9A 3G8WA 5HXDA 3PB8X 2AFUA 1NSAA 2DEAA 3G3SA 3JVNA 3TCVA 2PIZA 2Q43A 3QB8A 4P44A 4UA3A 4QVTA 1M4LA 4ZY0A 4FAIA 4X5KA 5DS0A 4OIWA 1AMPA 3VWDA 4A37A 2HQYA 3F0AA 2GLFA 2EWBA 1HEEA 3FNCA 2F7VA 4Y49C 5THWA 2BSWA 4MBUA 1JQGA 5K8OA 4UF4A 4JXRA 3N5FA 4H89A 4P10A 5HH1A 1PYTB 3WC6A 1S7NA 4ONUA 3W6SA 1WK4A 3CT9A 2ZENA 4MHZA 1X10A 4UFXA 2C27A 2AJ6A 4WJBA 1Y9WA 1F57A 4AXVA 3C26A 4B12A 4C68A 1S7KA 1VIXA 1XJOA 2O28A 2G0BA 4NSQA 2VI7A 3LD2A 1YVOA 1BPNA 2I3CA 4BMHA 4C2ZA 3IWGA 3FBUA 3IEHA 2Z3OA 4PSWA 4KUBA 5HMNA 4DYOA 3RNZA 5G22A 4H2KA 4LUAA 1WWZA 3IIBA 4NEXA 1TKHA 1YQEA 2NYQA 2Q7BA 5J8FA 2Z3MA 4MFZA 5AG6A 1TKJA 1BOBA 1VKCA 2PR1A 4KOUA 3ZZIA 4ONWA 4JWPA 2ZW5A 1TKFA 3KR4A 4OC1A 3LACA 4HNYB 4P4EA 1F2OA 4MCQA 3GY9A 1CBXA 1P4NA 2DPTA 3PZJA 2ZEDA 4MCSA 2XEGA 1ZG7A 2R98A 3OWCA 4PQAA 4U9ZA 2RFHA 4HPSA 3TC8A 4CYPA 3MN8A 5IX3A 4RUHA 4XPKA 1S60A 2R7HA 4A39A 5DWNA 1YLEA 4MXUA 4A30A 1ELLP 3HUVA 2Q7SA 3NFZA 4JD6A 2QIRA 4YWYA 1YVKA 3DNSA 4F8ZA 4P4IA 4QUSA 1A2ZA 4MCRA 4I49A 2ZELA 1PUAA 2OZHA 4OC2A 2Z11A 2ARHA 4WWVA 4ZY2A 4CAXA 4UFVA 3B2YA 1PCAA 2PQ8A 5EMIA 5IB0A 5IV0A 4NF1A 1GYTA 3EXNA 4FBEA 4UCNA 3P2HA 2R8VA 2POKA 3JTKA 4YU9A 2QYVA 3PP9A 3SXNA 3QNVA 2F8HA 2B4BA 2JDDA 2Q4YA 2WPXA 4O23A 3RO0A 3MGDA 4PXBA 4A33A 4QBJA 4FD7A 4KLVA 1NSLA 2CNTA 1YGHA 4AVBA 1HDUA 2EVNA 2ZW7A 3B3TA 4LQ6A 4OLLA 3CPAA 1NE9A 5LRJA 3S9MA 4B10A 4CGOA 5LYDA 4F0YA 3NA6A 4IHMA 4F0XA 2OU2A 3R9FA 5F48A 1M4GA 1N71A 1IIDA 2Z0ZA 1OBRA 4BD9A 4J3GA 1UFHA 4Z65A 3TX8A 4NGMA 2GU2A 3CXPA 2P0WA 3QAYA 3S6GA 2PJ7A 5A27A 3IFEA 4NGQA 4A94A 1F2PA 5C88A 1XF8A 2FSRA 2PC1A 1YR0A 2JBKA 3PB4X 3VATA 3S6FA 3R9EA 2PDOA 4CAEA 4A31A 3PBEA 3SJFA 4R6TA 2AFXA 4UWJA 1CPSA 4PXDA 4AG9A 3I3GA 4BBHA 2OH1A 4NCZA 1S7FA 4NGPA 4CGMA 2ATRA 4GS4A 2ZEGA 4P4FA 3H8EA 4RN7A 2DF5A 3R9GA 4KOSA 2Q51A 4FD4A 4NFRA 4R76A 2ZEHA 4ZX8A 2EUIA 2J8MA 4NGNA 5J8CA 1PU9A 3NE8A 3KASA 1XBUA 4QB9A 4B13A 2BO9A 3IU2A 3S6HA 5J1QA 4MMOA 3W6XA 1MK4A 4KLWA 2NSMA 3ZJ0A 1Z8WA 2WUUA 2PRBA 1CPXA 3PB7X 4KVOE 3FIXA 2FXFA 1Z9UA 3IWEA 3L2NA 1ZLHA 3GB0A 4H6ZA 2QJ8A 2F5IA 2O53A 1S3ZA 1YK3A 3BXMA 3LODA 2ZOGA 3A9LA 4YGOA 2PJ0A 3TT2A 1R57A 4X8IA 3DR6A 2CXAA 3KI9A 1UWYA 4MFQA 4UEZA 4MFJA 3V8IA 1QQ9A 2P6EA 2GANA 4QC6A 4TWEA 1I1DA 4KOWA 1ELMP 5G21A 3FH4A 4ZYQA 2C6CA 4OC0A 1M44A 2Z10A 1LRZA 1LAMA 1QSMA 2AFOA 3N7ZA 3TO6A 3B3CA 4P6YA 3GLJA 3B7IA 4A32A 4KSIA 2EK8A 5LYIA 3K9TA 3S6KA 2O4HA 5AG7A 1ARMA 2VZZA 3H8GA 3CDXA 4MFPA 4UFWA 5FVJA 2Z3KA 1YREA 4M6IA 2V8VA 2REFA 3DGVA 3WC5A 4CS0B 3MRUA 2EK9A 3KKWA 4F6AA 3NH4A 1QSRA 4PK2A 3T8WA 5D8NA 1XRYA 2OOTA 1V0CA 4M85A 3SJXA 1FNOA 2XEIA 2RC4A 1RTQA 4UCMA 2YNDA 3B3SA 2RB7A 1Y7EA 3KZWA 5HVGA 3FXTA 2PE3A 4U9YA 2ZEFA 3PFEA 2GLJA 4E0AA 3GYAA 4NXYA 1CJWA 3KHZA 4GXHA 3B3WA 3KL9A 3S9NA 4OAEA 4DNCA 2ODFA 1Z8XA 2CY2A 5JH9A 2P6GA 4A95A 1EE3P 1ON0A 1YLOA 3D7GA 5F46A 3CPXA 2JEVA 4L8AA 4PXCA 4ZY1A 2A4NA 4KORA 4MCPA 5H86A 2X7BA 2PJ3A 3H4QA 4R3KA 1TF9A 2H5MA 2Y0MA 3SXOA 1FY7A 2Z3NA 3BI0A 2XEFA 3CZXA 1XIXA 3H5ZA 1LAPA 4AVAA 5ISVA 3GUXA 2PJ4A 4B5PB 5KTCA 3WT4A 5I4MA 2J8NA 1ZG9A 1CP6A 4L89A 4CPAA 4CAWA 4OIDA 4CYOA 3E0KA 3F5BA 3CXSA 3HLPA 4E2AA 3KQZA 3EO4A 5C82A 1XMBA 4AB7A 4PSXA 3UY5A 4OP4A 1Z4EA 4JJXA 5ELYA 1MJ9A 4LQGA 3FVLA 5LRGA 4KZTA 3TO9A 2WSAA 2C6PA 2GFQA 3NH8A 4B5PA 3D66A 2PJ8A 3SI1A 3WC7A 2ZEPA 2VEZA 4EMEA 2FT0A 4B11A 4UEFA 2PVVA 3PEIA 3W91A 1QSTA 2D4PA 2FE7A 2GE3A 1XEBA 3IJ3A 4LX9A 3R96A 3RBUA 1JWQA 3T9YA 1LFWA 2C6GA 4R87A 4RI1A 2ZEEA 2V8HA 4Q38A 2AFMA 2AFWA 2J9AA 4CGPA 3PGPA 5F09A 2Q0YA 4ORFA 3TO7A 1NMTA 2IMOA 4OC3A 3RYOA 4R3LA 1VHSA 1DTDA 1XOVA 2J8RA 2VL1A 4FWUA 4W9YA 4XPDB 5K8NA 4CYQA 3TTHA 3KHXA 2GIVA 5JQ4A 1K4JA 2I79A 2CF4A 2QVPA 3DSBA 3JUWA 3TOBA 1KUXA 1Y0RA 4CRYB 3FB3A 4R57A 4C7HA 2IJZA 4MHNA 4EVYA 3TOAA 4M3SA 4KVXA 1KUVA 3F8KA 3EY5A 1M1DA 5JPHA 3DLJA 2G3AA 2WYRA 2P6FA 4MHPA 3VWEA 4XPDC 2IQ6A 3T90A 4PPZA 5JGFA 3BLNA 4NGSA 5AG5A 5G1ZA 1GHEA 4NGRA 3IU1A 1HDQA 2ZEMA 5A28A 1VHEA 2PCUA 2ZW6A 3RAMA 2YNEA 5EBVA 5LRKA 4HNXB 1M4DA 1YSJA
chains in the Genus database with same CATH topology
2G3TA 3D2MA 2BEIA 3SHPA 3NE7A 3QAHA 4HKFA 4UBRA 1IYLA 2FIWA 4FD6A 4KOYA 3TFYA 1RO5A 3I9SA 1M4IA 2Z3PA 1J4JA 1QSOA 4JXQA 2Q04A 4YRHA 5AG4A 2DPSA 5EC4A 5GCNA 4CAVA 1QSNA 2OB0A 2QMLA 2CNSA 1IB1E 3GKRA 4ZBGA 2Q44A 5CNPA 3K9UA 5DWMA 4Y49B 3WR7A 5KTDA 2I00A 3TE4A 3FYNA 1RXTA 2IL4A 4CGLA 3EC4A 3IGRA 4C2YA 2FL4A 2PR8A 1P0HA 4MY0A 3R95A 3BJ8A 5AGEA 2B3UA 4CRZB 3DDDA 4MJ8A 5H84A 4U5YA 1Q2CA 3R1KA 2FIAA 2FCKA 2AE6A 4KOXA 4MFKA 3B8GA 4KSFA 3D2PA 4MHDA 4MY3A 2KCWA 1TIQA 1I12A 1Y9KA 3D8PA 1ZO0A 1Y7RA 2YNCA 1U6MA 3FRMA 1B87A 4UCPA 4PV6A 2BL1A 2OZUA 1IYKA 2OZGA 3D3SA 2YNCC 4MI4A 4KUAA 1S7LA 2YGWA 3CXQA 4UWIA 4K30A 1B6BA 5F47A 2HUZA 4CGNA 4IUSA 4XNHB 4MFLA 2B4DB 4HNWB 4RS2A 2ZPAA 4JLYA 1Q2YA 4Q36A 2D4OA 4ZGYB 1XMTA 4KVME 4E8OA 2CNMA 2K5TA 4R9MA 5BWAB 1YX0A 5F49A 4CAFA 2B4DA 3BJ7A 2QECA 4FD5A 4H6UA 5E96A 2REEA 1BO4A 2R1IA 4AG7A 5KTAA 4XNHC 2B58A 4C2XA 1KUYA 1KZFA 4KOVA 2DXQA 3P2FA 2VZYA 2Z3LA 2ZXVA 1CM0A 4KSAA 2Q4VA 4KS9A 4B5OA 2PSWA 2ZW4A 1SQHA 4B14A 3EFAA 4A2ZA 2B3VA 2BUEA 4II9A 1L0CA 2HV2A 2VXKA 4C7IA 1MJBA 4CYNA 1XE4A 4OADA 4PK3A 2FS5A 1Z4RA 2WPWA 4IF5A 2NMTA 1OZPA 5G20A 4AVCA 2JDCA 2JLMA 4KOTA 2B5GB 1I21A 1S5KA 3DR8A 5I0CA 4YFJA 1Q2DA 4XPLA 2VQYA 2B5GA 2VBQA 1IICA 1MJAA 3G8WA 3G3SA 3JVNA 3TCVA 3QB8A 4UA3A 4QVTA 4X5KA 3VWDA 2HQYA 3F0AA 3FNCA 4Y49C 2BSWA 4MBUA 4JXRA 4H89A 5HH1A 1S7NA 4ONUA 3W6SA 1WK4A 4UFXA 2C27A 2AJ6A 1Y9WA 4B12A 3C26A 4C68A 1S7KA 2O28A 2G0BA 4NSQA 2VI7A 3LD2A 1YVOA 4BMHA 4C2ZA 3IWGA 3FBUA 4PSWA 2Z3OA 4KUBA 5HMNA 5G22A 4LUAA 1WWZA 4NEXA 2Q7BA 5J8FA 2Z3MA 4MFZA 5AG6A 1BOBA 1VKCA 2PR1A 4KOUA 3ZZIA 4JWPA 2ZW5A 4HNYB 3GY9A 1P4NA 2DPTA 3PZJA 3OWCA 2R98A 4U9ZA 4CYPA 5IX3A 4XPKA 1S60A 2R7HA 5DWNA 1YLEA 4A30A 4JD6A 2QIRA 1YVKA 3DNSA 4QUSA 4I49A 1PUAA 2OZHA 2Z11A 2ARHA 4CAXA 5IV0A 4UFVA 2PQ8A 5IB0A 4NF1A 3EXNA 4UCNA 3P2HA 3JTKA 3PP9A 3SXNA 2B4BA 2JDDA 2Q4YA 2WPXA 3MGDA 4A33A 4QBJA 4FD7A 4KLVA 1NSLA 2CNTA 1YGHA 4AVBA 2EVNA 2ZW7A 4OLLA 1NE9A 4CGOA 4B10A 4F0YA 4F0XA 2OU2A 3R9FA 5F48A 1M4GA 1N71A 1IIDA 2Z0ZA 4J3GA 1UFHA 3CXPA 2P0WA 3S6GA 5A27A 5C88A 1XF8A 2FSRA 2PC1A 1YR0A 3S6FA 3R9EA 2PDOA 4CAEA 4A31A 4UWJA 4AG9A 3I3GA 4BBHA 2OH1A 4NCZA 1S7FA 4CGMA 2ATRA 4GS4A 3R9GA 4KOSA 4FD4A 2EUIA 2J8MA 5J8CA 1PU9A 4QB9A 4B13A 3IU2A 3S6HA 3W6XA 1MK4A 4KLWA 3ZJ0A 2WUUA 2PRBA 4KVOE 3FIXA 2FXFA 1Z9UA 3IWEA 4H6ZA 2F5IA 1S3ZA 1YK3A 3LODA 3A9LA 4YGOA 3TT2A 1R57A 3DR6A 2CXAA 4MFQA 4MFJA 3V8IA 2P6EA 2GANA 4QC6A 1I1DA 4KOWA 5G21A 1M44A 2Z10A 1LRZA 1QSMA 3N7ZA 3TO6A 4A32A 3S6KA 5AG7A 2VZZA 4MFPA 4UFWA 5FVJA 2Z3KA 1YREA 2REFA 4CS0B 3KKWA 4F6AA 1QSRA 4PK2A 1V0CA 4M85A 2RC4A 4UCMA 2YNDA 3FXTA 4U9YA 4E0AA 3GYAA 4NXYA 1CJWA 4OAEA 4DNCA 2CY2A 2P6GA 4A95A 1ON0A 5F46A 2JEVA 4L8AA 2A4NA 4KORA 5H86A 2X7BA 3H4QA 4R3KA 2H5MA 2Y0MA 3SXOA 1FY7A 2Z3NA 1XIXA 3H5ZA 5ISVA 4AVAA 5KTCA 4B5PB 2J8NA 4L89A 4CAWA 4CYOA 3E0KA 3F5BA 3CXSA 4E2AA 3EO4A 5C82A 4AB7A 4PSXA 3UY5A 1Z4EA 4JJXA 3TO9A 1MJ9A 4KZTA 2WSAA 4B5PA 2VEZA 2FT0A 4B11A 3W91A 1QSTA 2D4PA 2FE7A 2GE3A 1XEBA 4LX9A 3R96A 3T9YA 4R87A 4RI1A 4Q38A 4CGPA 3PGPA 2Q0YA 4ORFA 3TO7A 1NMTA 3RYOA 4R3LA 1VHSA 2J8RA 4XPDB 4CYQA 3TTHA 2GIVA 5JQ4A 1K4JA 2I79A 3DSBA 3JUWA 3TOBA 1KUXA 4CRYB 3FB3A 4R57A 4C7HA 4EVYA 3TOAA 4M3SA 4KVXA 1KUVA 3F8KA 3EY5A 1M1DA 5JPHA 2G3AA 2P6FA 3VWEA 4XPDC 3T90A 3BLNA 5AG5A 5G1ZA 1GHEA 3IU1A 5A28A 2ZW6A 2YNEA 5EBVA 4HNXB 1M4DA 2R8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3T A;  3D2M A;  2BEI A;  3SHP A;  3NE7 A;  3QAH A;  4HKF A;  4UBR A;  1IYL A;  2FIW A;  4FD6 A;  4KOY A;  3TFY A;  1RO5 A;  3I9S A;  1M4I A;  1J4J A;  1QSO A;  4JXQ A;  2Q04 A;  4YRH A;  5EC4 A;  5GCN A;  4CAV A;  1QSN A;  2OB0 A;  2QML A;  2CNS A;  1IB1 E;  3GKR A;  4ZBG A;  2Q44 A;  5CNP A;  3K9U A;  5DWM A;  4Y49 B;  3WR7 A;  5KTD A;  2I00 A;  3TE4 A;  3FYN A;  1RXT A;  2IL4 A;  3EC4 A;  3IGR A;  2FL4 A;  2PR8 A;  1P0H A;  4MY0 A;  3R95 A;  3BJ8 A;  2B3U A;  4CRZ B;  3DDD A;  4MJ8 A;  5H84 A;  4U5Y A;  1Q2C A;  3R1K A;  2FIA A;  2FCK A;  2AE6 A;  4KOX A;  3B8G A;  3D2P A;  4MHD A;  4MY3 A;  2KCW A;  1TIQ A;  1I12 A;  1Y9K A;  3D8P A;  1Y7R A;  1U6M A;  3FRM A;  1B87 A;  4PV6 A;  2BL1 A;  2OZU A;  1IYK A;  2OZG A;  3D3S A;  4MI4 A;  4KUA A;  1S7L A;  3CXQ A;  4UWI A;  4K30 A;  1B6B A;  5F47 A;  2HUZ A;  4IUS A;  4XNH B;  2B4D B;  4HNW B;  4RS2 A;  2ZPA A;  4JLY A;  1Q2Y A;  2D4O A;  1XMT A;  4KVM E;  4E8O A;  2CNM A;  2K5T A;  4R9M A;  1YX0 A;  5F49 A;  2B4D A;  3BJ7 A;  2QEC A;  4FD5 A;  4H6U A;  5E96 A;  2REE A;  1BO4 A;  2R1I A;  4AG7 A;  5KTA A;  4XNH C;  2B58 A;  1KUY A;  1KZF A;  4KOV A;  2DXQ A;  3P2F A;  2VZY A;  2ZXV A;  1CM0 A;  2Q4V A;  4B5O A;  2PSW A;  2ZW4 A;  1SQH A;  3EFA A;  2B3V A;  2BUE A;  4II9 A;  1L0C A;  2HV2 A;  2VXK A;  1MJB A;  1XE4 A;  4OAD A;  4PK3 A;  2FS5 A;  1Z4R A;  2WPW A;  4IF5 A;  2NMT A;  1OZP A;  4AVC A;  2JDC A;  2JLM A;  4KOT A;  2B5G B;  1I21 A;  1S5K A;  3DR8 A;  5I0C A;  4YFJ A;  1Q2D A;  4XPL A;  2VQY A;  2B5G A;  2VBQ A;  1IIC A;  1MJA A;  3G8W A;  3G3S A;  3JVN A;  3TCV A;  3QB8 A;  4UA3 A;  4QVT A;  4X5K A;  3VWD A;  2HQY A;  3F0A A;  3FNC A;  4Y49 C;  2BSW A;  4MBU A;  4JXR A;  4H89 A;  5HH1 A;  1S7N A;  4ONU A;  3W6S A;  1WK4 A;  2C27 A;  2AJ6 A;  1Y9W A;  3C26 A;  1S7K A;  2O28 A;  2G0B A;  4NSQ A;  2VI7 A;  3LD2 A;  1YVO A;  4BMH A;  3IWG A;  3FBU A;  4PSW A;  4KUB A;  5HMN A;  4LUA A;  1WWZ A;  4NEX A;  2Q7B A;  5J8F A;  1BOB A;  1VKC A;  2PR1 A;  4KOU A;  3ZZI A;  4JWP A;  2ZW5 A;  4HNY B;  3GY9 A;  1P4N A;  3PZJ A;  3OWC A;  2R98 A;  4U9Z A;  5IX3 A;  4XPK A;  1S60 A;  2R7H A;  5DWN A;  1YLE A;  4JD6 A;  2QIR A;  1YVK A;  3DNS A;  4QUS A;  4I49 A;  1PUA A;  2OZH A;  2Z11 A;  2ARH A;  4CAX A;  5IV0 A;  2PQ8 A;  5IB0 A;  4NF1 A;  3EXN A;  3P2H A;  3PP9 A;  3SXN A;  2B4B A;  2JDD A;  2Q4Y A;  2WPX A;  3MGD A;  4QBJ A;  4FD7 A;  4KLV A;  1NSL A;  2CNT A;  1YGH A;  4AVB A;  2EVN A;  2ZW7 A;  4OLL A;  1NE9 A;  4F0Y A;  2OU2 A;  3R9F A;  5F48 A;  1M4G A;  1N71 A;  1IID A;  2Z0Z A;  4J3G A;  1UFH A;  3CXP A;  2P0W A;  3S6G A;  5C88 A;  1XF8 A;  2FSR A;  2PC1 A;  1YR0 A;  3S6F A;  3R9E A;  2PDO A;  4UWJ A;  4AG9 A;  3I3G A;  2OH1 A;  4NCZ A;  1S7F A;  2ATR A;  4GS4 A;  3R9G A;  4KOS A;  4FD4 A;  2EUI A;  2J8M A;  5J8C A;  1PU9 A;  4QB9 A;  3S6H A;  3W6X A;  1MK4 A;  4KLW A;  3ZJ0 A;  2PRB A;  4KVO E;  3FIX A;  2FXF A;  1Z9U A;  4H6Z A;  2F5I A;  1S3Z A;  1YK3 A;  3LOD A;  3TT2 A;  4YGO A;  1R57 A;  3DR6 A;  3V8I A;  2P6E A;  2GAN A;  4QC6 A;  1I1D A;  4KOW A;  1M44 A;  2Z10 A;  1LRZ A;  1QSM A;  3N7Z A;  3TO6 A;  3S6K A;  2VZZ A;  5FVJ A;  1YRE A;  2REF A;  4CS0 B;  3KKW A;  4F6A A;  1QSR A;  4PK2 A;  1V0C A;  4M85 A;  2RC4 A;  3FXT A;  4U9Y A;  4E0A A;  3GYA A;  4NXY A;  1CJW A;  4OAE A;  4DNC A;  2CY2 A;  2P6G A;  1ON0 A;  5F46 A;  2JEV A;  4L8A A;  2A4N A;  4KOR A;  5H86 A;  2X7B A;  3H4Q A;  4R3K A;  2H5M A;  2Y0M A;  3SXO A;  1FY7 A;  1XIX A;  5ISV A;  4AVA A;  5KTC A;  4B5P B;  2J8N A;  4L89 A;  4CAW A;  3E0K A;  3F5B A;  3CXS A;  4E2A A;  3EO4 A;  5C82 A;  4AB7 A;  4PSX A;  3UY5 A;  1Z4E A;  4JJX A;  3TO9 A;  1MJ9 A;  4KZT A;  4B5P A;  2VEZ A;  2FT0 A;  3W91 A;  1QST A;  2D4P A;  2FE7 A;  2GE3 A;  1XEB A;  4LX9 A;  3R96 A;  3T9Y A;  4R87 A;  4RI1 A;  3PGP A;  2Q0Y A;  4ORF A;  3TO7 A;  1NMT A;  3RYO A;  4R3L A;  1VHS A;  2J8R A;  4XPD B;  3TTH A;  2GIV A;  5JQ4 A;  1K4J A;  2I79 A;  3DSB A;  3JUW A;  3TOB A;  1KUX A;  4CRY B;  3FB3 A;  4R57 A;  4EVY A;  3TOA A;  4M3S A;  4KVX A;  1KUV A;  3F8K A;  3EY5 A;  1M1D A;  5JPH A;  2G3A A;  2P6F A;  3VWE A;  4XPD C;  3T90 A;  3BLN A;  1GHE A;  2ZW6 A;  5EBV A;  4HNX B;  1M4D A;  2R8V A; 
#chains in the Genus database with same CATH topology
 2G3T A;  3D2M A;  2BEI A;  3SHP A;  3FF3 A;  4OC4 A;  3NE7 A;  2PVW A;  3QAH A;  4HKF A;  4P4B A;  4NJR A;  4UBR A;  4GM5 A;  4UIB A;  3PFO A;  1IYL A;  1TXR A;  2FIW A;  3VH9 A;  2PJ1 A;  4FD6 A;  4KOY A;  3BHX A;  5CBM A;  2G9D A;  3TFY A;  4M6G A;  2BCO A;  1RO5 A;  4OME A;  2PJ9 A;  3I9S A;  1M4I A;  3JRU A;  2Z3P A;  1DE4 C;  1J4J A;  1QSO A;  4JXQ A;  2Q04 A;  4YRH A;  1ARL A;  5AG4 A;  3D4U A;  2DPS A;  5EC4 A;  5GCN A;  4CAV A;  1QSN A;  2OB0 A;  3LMS A;  2QML A;  2CNS A;  1IB1 E;  2OR4 A;  3GKR A;  4MRI A;  2Q44 A;  5CNP A;  3K9U A;  4ZBG A;  1Z8L A;  5DWM A;  4Y49 B;  3WR7 A;  4A38 A;  4EWT A;  1Y0Y A;  5KTD A;  5D29 A;  2I00 A;  3TE4 A;  3FYN A;  5K8P A;  1RXT A;  2IL4 A;  4CGL A;  3EC4 A;  1CG2 A;  3IGR A;  1TF8 A;  4C2Y A;  2FL4 A;  1XFO A;  2PR8 A;  1P0H A;  4MY0 A;  3R95 A;  5K8M A;  3BJ8 A;  3FEC A;  5AGE A;  3RZA A;  5CPA A;  2B3U A;  4CRZ B;  3DDD A;  4MJ8 A;  5H84 A;  2AFS A;  4U5Y A;  1Q2C A;  2GRE A;  2V8D A;  3BI1 A;  3SI2 A;  3R1K A;  1YW6 A;  2FIA A;  2FCK A;  2AE6 A;  1LOK A;  3S9L A;  4KOX A;  3D7D A;  4MFK A;  3B8G A;  4KSF A;  5JM6 A;  3D2P A;  2CTC A;  4MHD A;  4MY3 A;  4JYW A;  2KCW A;  4FUU A;  1TIQ A;  1Z8T A;  3GIU A;  3PBB A;  1I12 A;  1Y9K A;  3D8P A;  1ZO0 A;  1Y7R A;  3SJG A;  1IGB A;  2YNC A;  4OKO A;  1U6M A;  1IU8 A;  3FRM A;  2CIJ A;  1B87 A;  3KR5 A;  4UCP A;  4X2T A;  3FEE A;  3PRT A;  2BL1 A;  4PV6 A;  2OZU A;  1Z5R A;  3LWU A;  1IYK A;  2OZG A;  3D3S A;  1R43 A;  5IB9 A;  2YNC C;  4MI4 A;  4KUA A;  3K2K A;  2FVG A;  1S7L A;  2YGW A;  2HC9 A;  3CXQ A;  4UWI A;  4K30 A;  4DJL A;  8CPA A;  4DUK A;  3KGQ A;  1YW4 A;  3PB6 X;  1B6B A;  1LCP A;  5F47 A;  4P45 A;  4P4D A;  1BAV A;  2HUZ A;  4UIA A;  4CGN A;  2HB6 A;  3ISX A;  3H8F A;  3D7F A;  4IUS A;  2BOA A;  4MFL A;  2B4D B;  4HNW B;  4RS2 A;  2EO8 A;  4XNH B;  3V38 A;  4EFD A;  2ZPA A;  4JLY A;  1R3N A;  3FJU A;  1Q2Y A;  2PJB A;  4Q7A A;  4Q36 A;  2D4O A;  4ZGY B;  4P4J A;  1AYE A;  1XMT A;  4KVM E;  4E8O A;  2CNM A;  3IO1 A;  5LYL A;  2K5T A;  2C1C A;  4G1P A;  2PJ5 A;  1YX0 A;  4R9M A;  5F49 A;  5BWA B;  4CAF A;  4IAV A;  2B4D A;  3SI0 A;  3BJ7 A;  2QEC A;  3D7H A;  4FD5 A;  4H6U A;  5E96 A;  2AFZ A;  2REE A;  1BO4 A;  3FMC A;  4NJQ A;  3KQX A;  2PJ2 A;  2R1I A;  4AG7 A;  5KTA A;  2PJC A;  4XNH C;  2B58 A;  2PJA A;  4JZ0 A;  4IK2 A;  4C2X A;  1KUY A;  2V8G A;  2PJ6 A;  1KZF A;  4R8F A;  1YME A;  4KOV A;  4F9U A;  2JBJ A;  4R7M A;  2DXQ A;  2Q4Z A;  3P2F A;  2VZY A;  3IC1 A;  2Z3L A;  2ZXV A;  1CM0 A;  1Z2L A;  4BIN A;  3VAR A;  4KSA A;  4TNU A;  1VGY A;  2Q4V A;  4KS9 A;  4B5O A;  2PSW A;  2ZW4 A;  1SQH A;  4B14 A;  3EFA A;  3NH5 A;  4A2Z A;  2B3V A;  2BUE A;  4X3R A;  3B35 A;  1BPM A;  2XEJ A;  3FED A;  4II9 A;  5HVH A;  1L0C A;  2HV2 A;  2V77 A;  2WZN A;  3FX6 A;  2VXK A;  4C7I A;  1MJB A;  2ZEO A;  2ZOF A;  4CYN A;  2JEW A;  1KWM A;  1XE4 A;  1X12 A;  4OAD A;  4PK3 A;  2FS5 A;  2CTB A;  1BLL E;  1CP7 A;  3V7Z A;  4F9V A;  1Z4R A;  1IY7 A;  2WPW A;  3I1U A;  6CPA A;  4IF5 A;  1AUG A;  2NMT A;  3B3V A;  3ISZ A;  1OZP A;  1IOI A;  3IWW A;  3WAB A;  5G20 A;  4UEE A;  2PRQ A;  2EBJ A;  4K3N A;  1IOF A;  1FT7 A;  2JDC A;  1ZLI A;  1H8L A;  4AVC A;  7CPA A;  2JLM A;  4OC5 A;  5LYF A;  1CX8 A;  1VHO A;  2B5G B;  1I21 A;  4KOT A;  4PXE A;  1S5K A;  4MHY A;  5HVF A;  1QMU A;  3DR8 A;  1ZG8 A;  3D68 A;  5I0C A;  4M6H A;  4YFJ A;  1Q7L A;  1Q2D A;  2ABZ A;  4XPL A;  1LAN A;  2VQY A;  4B6Z A;  2ANP A;  4ZI6 A;  4NGT A;  2PIY A;  3SJE A;  3PB9 X;  2B5G A;  3D67 A;  2VBQ A;  1IIC A;  1MJA A;  4ZX9 A;  3G8W A;  5HXD A;  3PB8 X;  2AFU A;  1NSA A;  2DEA A;  3G3S A;  3JVN A;  3TCV A;  2PIZ A;  2Q43 A;  3QB8 A;  4P44 A;  4UA3 A;  4QVT A;  1M4L A;  4ZY0 A;  4FAI A;  4X5K A;  5DS0 A;  4OIW A;  1AMP A;  3VWD A;  4A37 A;  2HQY A;  3F0A A;  2GLF A;  2EWB A;  1HEE A;  3FNC A;  2F7V A;  4Y49 C;  5THW A;  2BSW A;  4MBU A;  1JQG A;  5K8O A;  4UF4 A;  4JXR A;  3N5F A;  4H89 A;  4P10 A;  5HH1 A;  1PYT B;  3WC6 A;  1S7N A;  4ONU A;  3W6S A;  1WK4 A;  3CT9 A;  2ZEN A;  4MHZ A;  1X10 A;  4UFX A;  2C27 A;  2AJ6 A;  4WJB A;  1Y9W A;  1F57 A;  4AXV A;  3C26 A;  4B12 A;  4C68 A;  1S7K A;  1VIX A;  1XJO A;  2O28 A;  2G0B A;  4NSQ A;  2VI7 A;  3LD2 A;  1YVO A;  1BPN A;  2I3C A;  4BMH A;  4C2Z A;  3IWG A;  3FBU A;  3IEH A;  2Z3O A;  4PSW A;  4KUB A;  5HMN A;  4DYO A;  3RNZ A;  5G22 A;  4H2K A;  4LUA A;  1WWZ A;  3IIB A;  4NEX A;  1TKH A;  1YQE A;  2NYQ A;  2Q7B A;  5J8F A;  2Z3M A;  4MFZ A;  5AG6 A;  1TKJ A;  1BOB A;  1VKC A;  2PR1 A;  4KOU A;  3ZZI A;  4ONW A;  4JWP A;  2ZW5 A;  1TKF A;  3KR4 A;  4OC1 A;  3LAC A;  4HNY B;  4P4E A;  1F2O A;  4MCQ A;  3GY9 A;  1CBX A;  1P4N A;  2DPT A;  3PZJ A;  2ZED A;  4MCS A;  2XEG A;  1ZG7 A;  2R98 A;  3OWC A;  4PQA A;  4U9Z A;  2RFH A;  4HPS A;  3TC8 A;  4CYP A;  3MN8 A;  5IX3 A;  4RUH A;  4XPK A;  1S60 A;  2R7H A;  4A39 A;  5DWN A;  1YLE A;  4MXU A;  4A30 A;  1ELL P;  3HUV A;  2Q7S A;  3NFZ A;  4JD6 A;  2QIR A;  4YWY A;  1YVK A;  3DNS A;  4F8Z A;  4P4I A;  4QUS A;  1A2Z A;  4MCR A;  4I49 A;  2ZEL A;  1PUA A;  2OZH A;  4OC2 A;  2Z11 A;  2ARH A;  4WWV A;  4ZY2 A;  4CAX A;  4UFV A;  3B2Y A;  1PCA A;  2PQ8 A;  5EMI A;  5IB0 A;  5IV0 A;  4NF1 A;  1GYT A;  3EXN A;  4FBE A;  4UCN A;  3P2H A;  2R8V A;  2POK A;  3JTK A;  4YU9 A;  2QYV A;  3PP9 A;  3SXN A;  3QNV A;  2F8H A;  2B4B A;  2JDD A;  2Q4Y A;  2WPX A;  4O23 A;  3RO0 A;  3MGD A;  4PXB A;  4A33 A;  4QBJ A;  4FD7 A;  4KLV A;  1NSL A;  2CNT A;  1YGH A;  4AVB A;  1HDU A;  2EVN A;  2ZW7 A;  3B3T A;  4LQ6 A;  4OLL A;  3CPA A;  1NE9 A;  5LRJ A;  3S9M A;  4B10 A;  4CGO A;  5LYD A;  4F0Y A;  3NA6 A;  4IHM A;  4F0X A;  2OU2 A;  3R9F A;  5F48 A;  1M4G A;  1N71 A;  1IID A;  2Z0Z A;  1OBR A;  4BD9 A;  4J3G A;  1UFH A;  4Z65 A;  3TX8 A;  4NGM A;  2GU2 A;  3CXP A;  2P0W A;  3QAY A;  3S6G A;  2PJ7 A;  5A27 A;  3IFE A;  4NGQ A;  4A94 A;  1F2P A;  5C88 A;  1XF8 A;  2FSR A;  2PC1 A;  1YR0 A;  2JBK A;  3PB4 X;  3VAT A;  3S6F A;  3R9E A;  2PDO A;  4CAE A;  4A31 A;  3PBE A;  3SJF A;  4R6T A;  2AFX A;  4UWJ A;  1CPS A;  4PXD A;  4AG9 A;  3I3G A;  4BBH A;  2OH1 A;  4NCZ A;  1S7F A;  4NGP A;  4CGM A;  2ATR A;  4GS4 A;  2ZEG A;  4P4F A;  3H8E A;  4RN7 A;  2DF5 A;  3R9G A;  4KOS A;  2Q51 A;  4FD4 A;  4NFR A;  4R76 A;  2ZEH A;  4ZX8 A;  2EUI A;  2J8M A;  4NGN A;  5J8C A;  1PU9 A;  3NE8 A;  3KAS A;  1XBU A;  4QB9 A;  4B13 A;  2BO9 A;  3IU2 A;  3S6H A;  5J1Q A;  4MMO A;  3W6X A;  1MK4 A;  4KLW A;  2NSM A;  3ZJ0 A;  1Z8W A;  2WUU A;  2PRB A;  1CPX A;  3PB7 X;  4KVO E;  3FIX A;  2FXF A;  1Z9U A;  3IWE A;  3L2N A;  1ZLH A;  3GB0 A;  4H6Z A;  2QJ8 A;  2F5I A;  2O53 A;  1S3Z A;  1YK3 A;  3BXM A;  3LOD A;  2ZOG A;  3A9L A;  4YGO A;  2PJ0 A;  3TT2 A;  1R57 A;  4X8I A;  3DR6 A;  2CXA A;  3KI9 A;  1UWY A;  4MFQ A;  4UEZ A;  4MFJ A;  3V8I A;  1QQ9 A;  2P6E A;  2GAN A;  4QC6 A;  4TWE A;  1I1D A;  4KOW A;  1ELM P;  5G21 A;  3FH4 A;  4ZYQ A;  2C6C A;  4OC0 A;  1M44 A;  2Z10 A;  1LRZ A;  1LAM A;  1QSM A;  2AFO A;  3N7Z A;  3TO6 A;  3B3C A;  4P6Y A;  3GLJ A;  3B7I A;  4A32 A;  4KSI A;  2EK8 A;  5LYI A;  3K9T A;  3S6K A;  2O4H A;  5AG7 A;  1ARM A;  2VZZ A;  3H8G A;  3CDX A;  4MFP A;  4UFW A;  5FVJ A;  2Z3K A;  1YRE A;  4M6I A;  2V8V A;  2REF A;  3DGV A;  3WC5 A;  4CS0 B;  3MRU A;  2EK9 A;  3KKW A;  4F6A A;  3NH4 A;  1QSR A;  4PK2 A;  3T8W A;  5D8N A;  1XRY A;  2OOT A;  1V0C A;  4M85 A;  3SJX A;  1FNO A;  2XEI A;  2RC4 A;  1RTQ A;  4UCM A;  2YND A;  3B3S A;  2RB7 A;  1Y7E A;  3KZW A;  5HVG A;  3FXT A;  2PE3 A;  4U9Y A;  2ZEF A;  3PFE A;  2GLJ A;  4E0A A;  3GYA A;  4NXY A;  1CJW A;  3KHZ A;  4GXH A;  3B3W A;  3KL9 A;  3S9N A;  4OAE A;  4DNC A;  2ODF A;  1Z8X A;  2CY2 A;  5JH9 A;  2P6G A;  4A95 A;  1EE3 P;  1ON0 A;  1YLO A;  3D7G A;  5F46 A;  3CPX A;  2JEV A;  4L8A A;  4PXC A;  4ZY1 A;  2A4N A;  4KOR A;  4MCP A;  5H86 A;  2X7B A;  2PJ3 A;  3H4Q A;  4R3K A;  1TF9 A;  2H5M A;  2Y0M A;  3SXO A;  1FY7 A;  2Z3N A;  3BI0 A;  2XEF A;  3CZX A;  1XIX A;  3H5Z A;  1LAP A;  4AVA A;  5ISV A;  3GUX A;  2PJ4 A;  4B5P B;  5KTC A;  3WT4 A;  5I4M A;  2J8N A;  1ZG9 A;  1CP6 A;  4L89 A;  4CPA A;  4CAW A;  4OID A;  4CYO A;  3E0K A;  3F5B A;  3CXS A;  3HLP A;  4E2A A;  3KQZ A;  3EO4 A;  5C82 A;  1XMB A;  4AB7 A;  4PSX A;  3UY5 A;  4OP4 A;  1Z4E A;  4JJX A;  5ELY A;  1MJ9 A;  4LQG A;  3FVL A;  5LRG A;  4KZT A;  3TO9 A;  2WSA A;  2C6P A;  2GFQ A;  3NH8 A;  4B5P A;  3D66 A;  2PJ8 A;  3SI1 A;  3WC7 A;  2ZEP A;  2VEZ A;  4EME A;  2FT0 A;  4B11 A;  4UEF A;  2PVV A;  3PEI A;  3W91 A;  1QST A;  2D4P A;  2FE7 A;  2GE3 A;  1XEB A;  3IJ3 A;  4LX9 A;  3R96 A;  3RBU A;  1JWQ A;  3T9Y A;  1LFW A;  2C6G A;  4R87 A;  4RI1 A;  2ZEE A;  2V8H A;  4Q38 A;  2AFM A;  2AFW A;  2J9A A;  4CGP A;  3PGP A;  5F09 A;  2Q0Y A;  4ORF A;  3TO7 A;  1NMT A;  2IMO A;  4OC3 A;  3RYO A;  4R3L A;  1VHS A;  1DTD A;  1XOV A;  2J8R A;  2VL1 A;  4FWU A;  4W9Y A;  4XPD B;  5K8N A;  4CYQ A;  3TTH A;  3KHX A;  2GIV A;  5JQ4 A;  1K4J A;  2I79 A;  2CF4 A;  2QVP A;  3DSB A;  3JUW A;  3TOB A;  1KUX A;  1Y0R A;  4CRY B;  3FB3 A;  4R57 A;  4C7H A;  2IJZ A;  4MHN A;  4EVY A;  3TOA A;  4M3S A;  4KVX A;  1KUV A;  3F8K A;  3EY5 A;  1M1D A;  5JPH A;  3DLJ A;  2G3A A;  2WYR A;  2P6F A;  4MHP A;  3VWE A;  4XPD C;  2IQ6 A;  3T90 A;  4PPZ A;  5JGF A;  3BLN A;  4NGS A;  5AG5 A;  5G1Z A;  1GHE A;  4NGR A;  3IU1 A;  1HDQ A;  2ZEM A;  5A28 A;  1VHE A;  2PCU A;  2ZW6 A;  3RAM A;  2YNE A;  5EBV A;  5LRK A;  4HNX B;  1M4D A;  1YSJ A; 
#chains in the Genus database with same CATH homology
 2G3T A;  3D2M A;  2BEI A;  3SHP A;  3NE7 A;  3QAH A;  4HKF A;  4UBR A;  1IYL A;  2FIW A;  4FD6 A;  4KOY A;  3TFY A;  1RO5 A;  3I9S A;  1M4I A;  2Z3P A;  1J4J A;  1QSO A;  4JXQ A;  2Q04 A;  4YRH A;  5AG4 A;  2DPS A;  5EC4 A;  5GCN A;  4CAV A;  1QSN A;  2OB0 A;  2QML A;  2CNS A;  1IB1 E;  3GKR A;  4ZBG A;  2Q44 A;  5CNP A;  3K9U A;  5DWM A;  4Y49 B;  3WR7 A;  5KTD A;  2I00 A;  3TE4 A;  3FYN A;  1RXT A;  2IL4 A;  4CGL A;  3EC4 A;  3IGR A;  4C2Y A;  2FL4 A;  2PR8 A;  1P0H A;  4MY0 A;  3R95 A;  3BJ8 A;  5AGE A;  2B3U A;  4CRZ B;  3DDD A;  4MJ8 A;  5H84 A;  4U5Y A;  1Q2C A;  3R1K A;  2FIA A;  2FCK A;  2AE6 A;  4KOX A;  4MFK A;  3B8G A;  4KSF A;  3D2P A;  4MHD A;  4MY3 A;  2KCW A;  1TIQ A;  1I12 A;  1Y9K A;  3D8P A;  1ZO0 A;  1Y7R A;  2YNC A;  1U6M A;  3FRM A;  1B87 A;  4UCP A;  4PV6 A;  2BL1 A;  2OZU A;  1IYK A;  2OZG A;  3D3S A;  2YNC C;  4MI4 A;  4KUA A;  1S7L A;  2YGW A;  3CXQ A;  4UWI A;  4K30 A;  1B6B A;  5F47 A;  2HUZ A;  4CGN A;  4IUS A;  4XNH B;  4MFL A;  2B4D B;  4HNW B;  4RS2 A;  2ZPA A;  4JLY A;  1Q2Y A;  4Q36 A;  2D4O A;  4ZGY B;  1XMT A;  4KVM E;  4E8O A;  2CNM A;  2K5T A;  4R9M A;  5BWA B;  1YX0 A;  5F49 A;  4CAF A;  2B4D A;  3BJ7 A;  2QEC A;  4FD5 A;  4H6U A;  5E96 A;  2REE A;  1BO4 A;  2R1I A;  4AG7 A;  5KTA A;  4XNH C;  2B58 A;  4C2X A;  1KUY A;  1KZF A;  4KOV A;  2DXQ A;  3P2F A;  2VZY A;  2Z3L A;  2ZXV A;  1CM0 A;  4KSA A;  2Q4V A;  4KS9 A;  4B5O A;  2PSW A;  2ZW4 A;  1SQH A;  4B14 A;  3EFA A;  4A2Z A;  2B3V A;  2BUE A;  4II9 A;  1L0C A;  2HV2 A;  2VXK A;  4C7I A;  1MJB A;  4CYN A;  1XE4 A;  4OAD A;  4PK3 A;  2FS5 A;  1Z4R A;  2WPW A;  4IF5 A;  2NMT A;  1OZP A;  5G20 A;  4AVC A;  2JDC A;  2JLM A;  4KOT A;  2B5G B;  1I21 A;  1S5K A;  3DR8 A;  5I0C A;  4YFJ A;  1Q2D A;  4XPL A;  2VQY A;  2B5G A;  2VBQ A;  1IIC A;  1MJA A;  3G8W A;  3G3S A;  3JVN A;  3TCV A;  3QB8 A;  4UA3 A;  4QVT A;  4X5K A;  3VWD A;  2HQY A;  3F0A A;  3FNC A;  4Y49 C;  2BSW A;  4MBU A;  4JXR A;  4H89 A;  5HH1 A;  1S7N A;  4ONU A;  3W6S A;  1WK4 A;  4UFX A;  2C27 A;  2AJ6 A;  1Y9W A;  4B12 A;  3C26 A;  4C68 A;  1S7K A;  2O28 A;  2G0B A;  4NSQ A;  2VI7 A;  3LD2 A;  1YVO A;  4BMH A;  4C2Z A;  3IWG A;  3FBU A;  4PSW A;  2Z3O A;  4KUB A;  5HMN A;  5G22 A;  4LUA A;  1WWZ A;  4NEX A;  2Q7B A;  5J8F A;  2Z3M A;  4MFZ A;  5AG6 A;  1BOB A;  1VKC A;  2PR1 A;  4KOU A;  3ZZI A;  4JWP A;  2ZW5 A;  4HNY B;  3GY9 A;  1P4N A;  2DPT A;  3PZJ A;  3OWC A;  2R98 A;  4U9Z A;  4CYP A;  5IX3 A;  4XPK A;  1S60 A;  2R7H A;  5DWN A;  1YLE A;  4A30 A;  4JD6 A;  2QIR A;  1YVK A;  3DNS A;  4QUS A;  4I49 A;  1PUA A;  2OZH A;  2Z11 A;  2ARH A;  4CAX A;  5IV0 A;  4UFV A;  2PQ8 A;  5IB0 A;  4NF1 A;  3EXN A;  4UCN A;  3P2H A;  3JTK A;  3PP9 A;  3SXN A;  2B4B A;  2JDD A;  2Q4Y A;  2WPX A;  3MGD A;  4A33 A;  4QBJ A;  4FD7 A;  4KLV A;  1NSL A;  2CNT A;  1YGH A;  4AVB A;  2EVN A;  2ZW7 A;  4OLL A;  1NE9 A;  4CGO A;  4B10 A;  4F0Y A;  4F0X A;  2OU2 A;  3R9F A;  5F48 A;  1M4G A;  1N71 A;  1IID A;  2Z0Z A;  4J3G A;  1UFH A;  3CXP A;  2P0W A;  3S6G A;  5A27 A;  5C88 A;  1XF8 A;  2FSR A;  2PC1 A;  1YR0 A;  3S6F A;  3R9E A;  2PDO A;  4CAE A;  4A31 A;  4UWJ A;  4AG9 A;  3I3G A;  4BBH A;  2OH1 A;  4NCZ A;  1S7F A;  4CGM A;  2ATR A;  4GS4 A;  3R9G A;  4KOS A;  4FD4 A;  2EUI A;  2J8M A;  5J8C A;  1PU9 A;  4QB9 A;  4B13 A;  3IU2 A;  3S6H A;  3W6X A;  1MK4 A;  4KLW A;  3ZJ0 A;  2WUU A;  2PRB A;  4KVO E;  3FIX A;  2FXF A;  1Z9U A;  3IWE A;  4H6Z A;  2F5I A;  1S3Z A;  1YK3 A;  3LOD A;  3A9L A;  4YGO A;  3TT2 A;  1R57 A;  3DR6 A;  2CXA A;  4MFQ A;  4MFJ A;  3V8I A;  2P6E A;  2GAN A;  4QC6 A;  1I1D A;  4KOW A;  5G21 A;  1M44 A;  2Z10 A;  1LRZ A;  1QSM A;  3N7Z A;  3TO6 A;  4A32 A;  3S6K A;  5AG7 A;  2VZZ A;  4MFP A;  4UFW A;  5FVJ A;  2Z3K A;  1YRE A;  2REF A;  4CS0 B;  3KKW A;  4F6A A;  1QSR A;  4PK2 A;  1V0C A;  4M85 A;  2RC4 A;  4UCM A;  2YND A;  3FXT A;  4U9Y A;  4E0A A;  3GYA A;  4NXY A;  1CJW A;  4OAE A;  4DNC A;  2CY2 A;  2P6G A;  4A95 A;  1ON0 A;  5F46 A;  2JEV A;  4L8A A;  2A4N A;  4KOR A;  5H86 A;  2X7B A;  3H4Q A;  4R3K A;  2H5M A;  2Y0M A;  3SXO A;  1FY7 A;  2Z3N A;  1XIX A;  3H5Z A;  5ISV A;  4AVA A;  5KTC A;  4B5P B;  2J8N A;  4L89 A;  4CAW A;  4CYO A;  3E0K A;  3F5B A;  3CXS A;  4E2A A;  3EO4 A;  5C82 A;  4AB7 A;  4PSX A;  3UY5 A;  1Z4E A;  4JJX A;  3TO9 A;  1MJ9 A;  4KZT A;  2WSA A;  4B5P A;  2VEZ A;  2FT0 A;  4B11 A;  3W91 A;  1QST A;  2D4P A;  2FE7 A;  2GE3 A;  1XEB A;  4LX9 A;  3R96 A;  3T9Y A;  4R87 A;  4RI1 A;  4Q38 A;  4CGP A;  3PGP A;  2Q0Y A;  4ORF A;  3TO7 A;  1NMT A;  3RYO A;  4R3L A;  1VHS A;  2J8R A;  4XPD B;  4CYQ A;  3TTH A;  2GIV A;  5JQ4 A;  1K4J A;  2I79 A;  3DSB A;  3JUW A;  3TOB A;  1KUX A;  4CRY B;  3FB3 A;  4R57 A;  4C7H A;  4EVY A;  3TOA A;  4M3S A;  4KVX A;  1KUV A;  3F8K A;  3EY5 A;  1M1D A;  5JPH A;  2G3A A;  2P6F A;  3VWE A;  4XPD C;  3T90 A;  3BLN A;  5AG5 A;  5G1Z A;  1GHE A;  3IU1 A;  5A28 A;  2ZW6 A;  2YNE A;  5EBV A;  4HNX B;  1M4D A;  2R8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...