3P2FA

Crystal structure of tofi in an apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
175
Chain Sequence
b'MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein
total genus 52
structure length 175
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2fA00
4R3KA 4CS0B 3DDDA 1KUXA 2Z10A 3EC4A 1J4JA 1YREA 3W6SA 3FBUA 4NXYA 2IL4A 3D8PA 5HMNA 1XIXA 1WWZA 3G3SA 4UWJA 1I12A 2J8RA 1NE9A 1IYKA 5GCNA 3R9EA 5EC4A 1VHSA 1Y7RA 1Y9KA 3ZZIA 3EXNA 2D4OA 4R87A 5IB0A 4HNXB 4U5YA 1MJBA 1QSTA 4AB7A 4PSXA 3FRMA 2ZW7A 3FIXA 4FD6A 3CXPA 3BJ8A 1WK4A 1Q2DA 4AVCA 5F48A 1Q2CA 3G8WA 5JPHA 2Q4VA 3VWDA 4KOSA 4F6AA 2QMLA 1S60A 4U9YA 4JJXA 1P0HA 2VI7A 4AG9A 1I1DA 2ZW4A 3DR8A 3EY5A 2CNMA 3F0AA 2BEIA 4JLYA 3R96A 4R57A 2R1IA 2Z11A 3F8KA 4YFJA 4CAXA 1YVKA 3EO4A 3JVNA 1K4JA 2JLMA 1U6MA 1Z4RA 1S7LA 3R95A 3NE7A 5F46A 1XEBA 2JEVA 1IB1E 1IICA 2AE6A 3BJ7A 3TOBA 4KOXA 1KZFA 2P6GA 1LRZA 4OADA 4YGOA 1I21A 4OLLA 5H86A 4U9ZA 3VWEA 2P6EA 5ISVA 3TT2A 2OU2A 2BL1A 2EUIA 4QB9A 1R57A 5CNPA 4L89A 3FB3A 2PQ8A 2PDOA 2PRBA 4KUAA 4PSWA 1SQHA 3K9UA 4X5KA 4MY0A 2VZYA 3TE4A 4FD4A 1B6BA 5E96A 4B5PA 4XPDB 3GYAA 1FY7A 5HH1A 3F5BA 3QAHA 4ORFA 3P2FA 1P4NA 3LODA 4UA3A 3MGDA 4M3SA 2ATRA 1S7KA 4JXQA 4UBRA 2HQYA 3SXOA 3FXTA 3S6GA 3S6KA 1IYLA 1NSLA 4KOUA 2G3AA 4KOWA 5KTDA 2FIWA 3TTHA 4XNHC 2FXFA 4IUSA 4NEXA 2FS5A 3D2MA 1MK4A 2R7HA 2P0WA 2KCWA 2DXQA 2AJ6A 2CNSA 2OZUA 2R8VA 2VEZA 2B3VA 1XF8A 2OZGA 3CXQA 4B5OA 1M4IA 1Z9UA 1M1DA 4QVTA 4F0YA 3TCVA 1S3ZA 2EVNA 4L8AA 2JDDA 2G0BA 4XPLA 2F5IA 3RYOA 2HUZA 2B4BA 2WPWA 4KOTA 4KOVA 4E0AA 2G3TA 2Z0ZA 3EFAA 1OZPA 3B8GA 2Q04A 3SXNA 4KOYA 3QB8A 1V0CA 4Y49B 4AVBA 2HV2A 4CAWA 1QSOA 2B5GA 2B58A 4NSQA 4KORA 1Q2YA 2Y0MA 3C26A 3N7ZA 2QIRA 4JD6A 4KVME 4R3LA 1S7NA 5EBVA 4KVOE 4HNWB 2D4PA 3LD2A 3TFYA 4R9MA 1BOBA 2H5MA 2Q44A 2FIAA 2FSRA 2I79A 5F47A 1PU9A 3I9SA 3DSBA 4QBJA 3TOAA 2ZW6A 4HKFA 1UFHA 2VXKA 1MJ9A 3PGPA 1XE4A 3WR7A 2B4DA 2BUEA 2K5TA 4EVYA 3E0KA 2OH1A 2P6FA 1Y9WA 4H89A 1KUYA 4KUBA 4E8OA 2J8NA 1QSMA 3TO6A 3GY9A 3TO9A 5JQ4A 2PC1A 1CJWA 2OZHA 4CRYB 3R1KA 1S7FA 4J3GA 4ZBGA 1YX0A 2PSWA 5IX3A 4RI1A 4PK3A 3T90A 4XPKA 3T9YA 4B5PB 1M4GA 2PR8A 2GE3A 2JDCA 4XPDC 1M4DA 2CY2A 2FT0A 3IWGA 3DNSA 3GKRA 1ON0A 2FCKA 4I49A 4NCZA 5I0CA 4KLVA 2FE7A 3S6FA 3TO7A 2Q4YA 1MJAA 2OB0A 1GHEA 2BSWA 3FYNA 4KVXA 3P2HA 1VKCA 2RC4A 4NF1A 4M85A 5DWNA 3W6XA 1M44A 4CAVA 2QECA 3D2PA 4IF5A 3ZJ0A 4H6UA 5DWMA 1RO5A 3PZJA 3I3GA 2ZPAA 2REEA 4KZTA 3IGRA 4ONUA 4II9A 2FL4A 4RS2A 4GS4A 2C27A 4UWIA 1N71A 5J8FA 2A4NA 4LUAA 3PP9A 3W91A 4MI4A 5J8CA 1YK3A 3BLNA 5C88A 2ZW5A 5C82A 2I00A 2PR1A 5F49A 1Z4EA 5H84A 1YR0A 4Y49C 2REFA 4MJ8A 2B5GB 1NMTA 1YVOA 4HNYB 2GIVA 3FNCA 4AG7A 1BO4A 2ARHA 4CRZB 4BMHA 3R9FA 4QUSA 1B87A 1IIDA 3D3SA 5IV0A 1PUAA 3SHPA 4LX9A 2WPXA 1KUVA 1XMTA 1S5KA 1YLEA 4K30A 2GANA 4MBUA 1CM0A 4JXRA 3R9GA 3OWCA 2J8MA 4MY3A 2O28A 3CXSA 2CNTA 2VZZA 2NMTA 4FD5A 5KTCA 1TIQA 4AVAA 4H6ZA 2B4DB 4FD7A 5FVJA 2X7BA 4DNCA 3V8IA 4PK2A 3DR6A 1YGHA 2R98A 4QC6A 4OAEA 3H4QA 4PV6A 4JWPA 1QSRA 3S6HA 4E2AA 2VQYA 4KLWA 3UY5A 2B3UA 4YRHA 1L0CA 5KTAA 4MHDA 1RXTA 2VBQA 2ZXVA 1QSNA 4XNHB 2Q0YA 3KKWA 2Q7BA 3JUWA
chains in the Genus database with same CATH superfamily
4R3KA 2YNEA 4CAEA 4CS0B 3DDDA 4BINA 1KUXA 2Z10A 3H8GA 1GYTA 3EC4A 1J4JA 1YREA 3W6SA 3FBUA 2PJ4A 4R6TA 3N5FA 4NXYA 2IL4A 1ZG8A 3D8PA 5HMNA 1LANA 1XBUA 2WSAA 1AYEA 4X3RA 1XIXA 1WWZA 2GFQA 3GLJA 3MN8A 4NGPA 3NE8A 4F9UA 3G3SA 3HUVA 1I12A 3PB7X 2J8RA 4UWJA 1NE9A 1IYKA 5GCNA 3R9EA 4UFWA 3WC6A 3SI1A 2PJ3A 4M6GA 4YU9A 5EC4A 1VHSA 1Y7RA 1BAVA 1Y9KA 2ZOGA 3ZZIA 3NFZA 3EXNA 2D4OA 2QVPA 2Z3OA 4R87A 5IB0A 4HNXB 3NH4A 4U5YA 1MJBA 1QSTA 4OC0A 4AB7A 4FWUA 1FT7A 3PRTA 4NGRA 4P44A 4PSXA 7CPAA 3FRMA 2ZW7A 3FIXA 4FD6A 3S9MA 3CXPA 4NJQA 2AFZA 3BJ8A 3IEHA 3KASA 4OC4A 3S9LA 1WK4A 4IK2A 1Q2DA 4AVCA 5F48A 5DS0A 3D68A 1Q2CA 3G8WA 1HEEA 5JPHA 1XFOA 2PJ7A 2Q4VA 3VWDA 2O53A 4KOSA 4YWYA 5ELYA 1ZG7A 2XEGA 4F6AA 5D8NA 2QMLA 4CYPA 4Q7AA 1S60A 2EO8A 4C2XA 4U9YA 4JJXA 1P0HA 2VI7A 2PJ6A 1ZLIA 4AG9A 1I1DA 2GLJA 2ZW4A 3DR8A 3EY5A 2CNMA 4IHMA 3B7IA 1CPSA 3F0AA 2BEIA 4JLYA 3R96A 4R57A 2C6CA 1M4LA 2PIZA 4P45A 5IB9A 2YNCC 2R1IA 2Z11A 2G9DA 1PYTB 3IIBA 3LMSA 3QAYA 3D7DA 3F8KA 4OMEA 4R8FA 4CAXA 4YFJA 1X10A 2F7VA 4MFKA 1YVKA 4MFPA 3EO4A 3GIUA 3JVNA 1K4JA 5K8PA 2JLMA 2ZEFA 4CPAA 3RO0A 2PJCA 1U6MA 4MXUA 2O4HA 1Z4RA 1S7LA 2PE3A 4H2KA 4ZYQA 5LRGA 3NE7A 2PJ8A 2C1CA 3R95A 1XEBA 2JEVA 3KR4A 1IB1E 4TWEA 5F46A 1IICA 2DPSA 2AE6A 3PB8X 3BJ7A 1LOKA 3KQZA 2AFMA 3TC8A 3TOBA 1CP7A 2WYRA 2YGWA 4GXHA 4KOXA 1KZFA 2P6GA 4OKOA 2JEWA 4F9VA 1ZG9A 1LRZA 2Z3KA 4OADA 1CG2A 4YGOA 1BPNA 4P4DA 2JBJA 1I21A 2Z3LA 4NGTA 3IU2A 4OLLA 4B6ZA 1TXRA 5H86A 4U9ZA 3VWEA 2P6EA 5ISVA 3TT2A 2OU2A 2BL1A 2C6PA 2EUIA 3FH4A 4OP4A 4QB9A 3VATA 1Y0RA 1QMUA 5CPAA 1R57A 5CNPA 4L89A 2PCUA 4R76A 1TKJA 2QYVA 4A33A 2V8GA 1IU8A 4A39A 2PIYA 3FB3A 2PQ8A 2PDOA 2PRBA 4KUAA 3NH5A 3KL9A 4PSWA 2JBKA 1SQHA 3K9UA 1F2OA 4P10A 4X5KA 4EMEA 2IQ6A 2WUUA 4MY0A 4B14A 2VZYA 3TE4A 4FD4A 1B6BA 3BXMA 3FX6A 4RN7A 5E96A 4B5PA 2Q43A 4GM5A 4UEZA 1Z2LA 2ZELA 5LYLA 2ZEHA 4WJBA 4XPDB 4EFDA 3GYAA 4UCNA 3GUXA 4CGPA 1IOFA 1FY7A 3F5BA 5HH1A 1Z8XA 1VGYA 3QAHA 4UIAA 5HVHA 5A28A 4PXBA 1ZLHA 4ORFA 3P2FA 1P4NA 2J9AA 3LODA 4JZ0A 4UA3A 1X12A 1LAPA 3MGDA 4A30A 4M3SA 4C2YA 4P6YA 2ATRA 3KHXA 4MFQA 1S7KA 2DF5A 1BPMA 4JXQA 3IWEA 3PB6X 4G1PA 4MCPA 4UBRA 3VARA 2HQYA 5LYFA 3SXOA 3FXTA 3S6GA 3S6KA 1IYLA 1NSLA 5K8MA 3LWUA 3K9TA 5F09A 4KOUA 2G3AA 4KOWA 3CPXA 2FIWA 5KTDA 3WC7A 3TTHA 2OR4A 3KHZA 1XRYA 4DYOA 4XNHC 2FXFA 4IUSA 4NEXA 2FS5A 3RZAA 4OC1A 5HXDA 1H8LA 3D2MA 1MK4A 5JGFA 2AFOA 2R7HA 4UFVA 2P0WA 1A2ZA 2CTBA 2KCWA 4UCPA 2DXQA 4OC2A 1CP6A 2AJ6A 4UCMA 3KQXA 5G22A 3QNVA 2CNSA 3FECA 3VH9A 2OZUA 4A95A 4DJLA 1UWYA 5AG7A 2R8VA 1Q7LA 2VEZA 2B3VA 4FBEA 2NYQA 4W9YA 1CPXA 1XF8A 1YSJA 3T8WA 2OZGA 3CXQA 4B5OA 4C2ZA 1M4IA 1Z9UA 1M1DA 3SJXA 4P4EA 2ZEEA 3IJ3A 4QVTA 3CZXA 4F0YA 3WT4A 3TCVA 1S3ZA 1F2PA 2EVNA 3ISXA 4L8AA 2JDDA 2G0BA 4NGNA 2F5IA 2PJ2A 4XPLA 3RYOA 2HUZA 2B4BA 2ZENA 1PCAA 2WPWA 4KOTA 4UF4A 5K8OA 3IWWA 2DPTA 4MFLA 4KOVA 3TX8A 4E0AA 1FNOA 2G3TA 2Z0ZA 2CIJA 5AG5A 3EFAA 1OZPA 2GLFA 3B8GA 2Q04A 3IO1A 4B10A 1LFWA 3BHXA 3SXNA 3PBEA 3KI9A 4KOYA 4PXEA 3QB8A 1V0CA 3PB9X 4Y49B 3KR5A 5CBMA 4AVBA 2C6GA 2HV2A 4CAWA 4MRIA 1ARMA 1QSOA 2B5GA 4MCSA 3I1UA 2V77A 3SI2A 3D7GA 3IC1A 2B58A 1YW6A 4NSQA 3IU1A 4RUHA 1CX8A 3JTKA 4KORA 1TKHA 4A94A 1Q2YA 2GREA 2Y0MA 3C26A 5F49A 1TF9A 3N7ZA 2I3CA 2QIRA 2V8HA 4JD6A 3CPAA 2EWBA 4A37A 4KVME 2PJAA 3SJEA 2WZNA 3D66A 4C68A 2Q7SA 4KSAA 4AXVA 1VHOA 2Q7BA 3D7FA 4R3LA 1S7NA 5EBVA 3B3VA 3HLPA 2QJ8A 2D4PA 3LD2A 4HNWB 4KVOE 3TFYA 1AMPA 4R9MA 1BOBA 2H5MA 4CYNA 2PJBA 3BI0A 1F57A 2Q44A 1VHEA 2FIAA 1AUGA 1Z8TA 3SJFA 4IAVA 2PJ5A 2FSRA 3KZWA 1ARLA 2I79A 4A2ZA 3H5ZA 2Z3MA 4OIWA 2HC9A 4NGMA 1Z5RA 2POKA 4PQAA 5F47A 4ZY1A 3B3TA 1PU9A 3MRUA 3I9SA 1R43A 3DSBA 4QBJA 3TOAA 2ZW6A 2V8VA 4HKFA 4R7MA 1XMBA 1UFHA 2VXKA 1ELMP 1MJ9A 4C7IA 3PGPA 1XE4A 3B3SA 4OC5A 3WR7A 4CGNA 2B4DA 2BUEA 2K5TA 4EVYA 2XEJA 3E0KA 2OH1A 2P6FA 1DTDA 1Y9WA 3CDXA 4H89A 1KUYA 4P4FA 4Q38A 4WWVA 8CPAA 4HPSA 1EE3P 4KUBA 1IGBA 4E8OA 2J8NA 1QSMA 3TO6A 3GY9A 1Z8WA 2PRQA 4M6HA 5THWA 3TO9A 2ZEGA 5A27A 5JQ4A 4ONWA 2Z3NA 2PC1A 1CJWA 2OZHA 4CRYB 3R1KA 2ZEOA 3FF3A 1S7FA 4ZI6A 2Q4ZA 3CT9A 4J3GA 2AFXA 4KSIA 4ZBGA 1YX0A 2PSWA 5IX3A 4RI1A 2EK9A 2PJ9A 4PK3A 3T90A 4XPKA 4F8ZA 3T9YA 4B5PB 3ISZA 1M4GA 2PR8A 2GE3A 1YQEA 4PXDA 1XJOA 2Z3PA 4MHZA 2JDCA 4UEEA 4Q36A 4NJRA 4XPDC 5HVFA 4P4JA 4BD9A 1M4DA 1IOIA 2CY2A 3GB0A 2PJ0A 3PFEA 2FT0A 3FEDA 3IWGA 3DNSA 3GKRA 4MFZA 1ON0A 4B12A 1YLOA 2FCKA 2CXAA 4I49A 4MCRA 2PVWA 4NCZA 5I0CA 2XEFA 4F0XA 1KWMA 4KLVA 2FE7A 3FVLA 2OOTA 3S6FA 3A9LA 3TO7A 4EWTA 2Q4YA 1MJAA 2OB0A 1GHEA 2BSWA 4A38A 3FYNA 5LYIA 4Z65A 2EBJA 4KVXA 3P2HA 2F8HA 1VKCA 3V38A 2ZEMA 3DLJA 2RC4A 2ZEPA 4NF1A 4B13A 4M85A 4CYOA 2PVVA 5EMIA 1VIXA 2AFSA 5DWNA 2BO9A 1M44A 3W6XA 4MHNA 2QECA 4CAVA 3D2PA 4IF5A 2YNCA 3ZJ0A 3K2KA 4H6UA 1ELLP 5HVGA 4B11A 5DWMA 2AFWA 1RO5A 3PZJA 4X2TA 3I3GA 1XOVA 2IJZA 2ZPAA 2REEA 4NFRA 4KZTA 3L2NA 3SI0A 3IGRA 4CAFA 4ONUA 4II9A 3B35A 2XEIA 4CGMA 1JWQA 2FL4A 4RS2A 2ZOFA 1TF8A 2C27A 4GS4A 4P4IA 1N71A 2BCOA 4UWIA 3RAMA 1HDQA 4A32A 3FEEA 2GU2A 1R3NA 2ANPA 4LQGA 2A4NA 1YMEA 2ODFA 4LUAA 4DUKA 5J8FA 2VL1A 2DEAA 3PFOA 3PP9A 3B3CA 3D4UA 1JQGA 4O23A 3W91A 4MI4A 5J8CA 1DE4C 1YK3A 3BLNA 3V7ZA 5C88A 2V8DA 2ZW5A 4MCQA 3NA6A 1LAMA 1IY7A 2I00A 5BWAB 3IFEA 2PR1A 4UEFA 5C82A 2ZEDA 1NSAA 1Z4EA 3NH8A 4KS9A 1YR0A 3H8FA 4UFXA 4Y49C 2REFA 4MJ8A 1QQ9A 4ZX9A 5H84A 5LRJA 1ZO0A 1HDUA 2B5GB 4CYQA 1NMTA 1YVOA 5G20A 5K8NA 4HNYB 2GIVA 3KGQA 1TKFA 3FNCA 5AGEA 5G21A 4AG7A 1RTQA 3BI1A 1BO4A 2HB6A 2ARHA 3H8EA 3PEIA 4CRZB 4C7HA 2NSMA 4BMHA 6CPAA 3JRUA 3R9FA 4QUSA 4LQ6A 1B87A 1IIDA 3D3SA 4MFJA 1OBRA 5IV0A 1PUAA 1BLLE 3SHPA 4LX9A 5J1QA 4ZGYB 1CBXA 1Z8LA 4MHPA 2WPXA 1KUVA 3D7HA 2ABZA 2FVGA 3RBUA 3B3WA 1XMTA 3PB4X 4M6IA 3RNZA 1S5KA 1YLEA 5JM6A 3PBBA 4K30A 2GANA 4X8IA 2RFHA 4MBUA 5LRKA 2YNDA 1CM0A 5I4MA 4NGSA 4OC3A 4JXRA 3R9GA 4MHYA 5AG6A 2RB7A 3OWCA 4CGLA 4ZY2A 2J8MA 4MY3A 2O28A 3FMCA 2BOAA 2Q51A 3WC5A 3CXSA 2CNTA 3B2YA 3WABA 2AFUA 4MMOA 4BBHA 2VZZA 4PPZA 4P4BA 2NMTA 4FD5A 4CGOA 5KTCA 1TIQA 4AVAA 4FUUA 2PJ1A 4UIBA 4H6ZA 3SJGA 4NGQA 5D29A 4ZY0A 2B4DB 2CTCA 4FD7A 2X7BA 5FVJA 4DNCA 3V8IA 4FAIA 4PK2A 3DR6A 1YGHA 2R98A 3S9NA 4OIDA 4K3NA 2CF4A 4A31A 3LACA 4QC6A 4OAEA 5G1ZA 4KSFA 3H4QA 4PV6A 1Y7EA 4JWPA 5AG4A 1QSRA 3S6HA 4E2AA 2VQYA 4KLWA 5LYDA 3UY5A 2B3UA 4YRHA 1L0CA 5JH9A 1Y0YA 2IMOA 5KTAA 4MHDA 1RXTA 4TNUA 2VBQA 2ZXVA 1QSNA 4XNHB 2Q0YA 1YW4A 2EK8A 1LCPA 3D67A 4ZX8A 3KKWA 4JYWA 3FJUA 4PXCA 3DGVA 3JUWA
chains in the Genus database with same CATH topology
4R3KA 2YNEA 4CAEA 4CS0B 3DDDA 1KUXA 2Z10A 3EC4A 1J4JA 1YREA 3W6SA 3FBUA 4NXYA 2IL4A 3D8PA 5HMNA 2WSAA 1XIXA 1WWZA 3G3SA 4UWJA 1I12A 2J8RA 1NE9A 1IYKA 5GCNA 3R9EA 4UFWA 5EC4A 1VHSA 1Y7RA 1Y9KA 3ZZIA 3EXNA 2D4OA 2Z3OA 4R87A 5IB0A 4HNXB 4U5YA 1MJBA 1QSTA 4AB7A 4PSXA 3FRMA 2ZW7A 3FIXA 4FD6A 3CXPA 3BJ8A 1WK4A 1Q2DA 4AVCA 5F48A 1Q2CA 3G8WA 5JPHA 2Q4VA 3VWDA 4KOSA 4F6AA 4CYPA 2QMLA 1S60A 4C2XA 4U9YA 4JJXA 1P0HA 2VI7A 4AG9A 1I1DA 2ZW4A 3DR8A 3EY5A 2CNMA 3F0AA 2BEIA 4JLYA 3R96A 4R57A 2YNCC 2R1IA 2Z11A 3F8KA 4YFJA 4CAXA 4MFKA 1YVKA 4MFPA 3EO4A 3JVNA 1K4JA 2JLMA 1U6MA 1Z4RA 1S7LA 3R95A 3NE7A 5F46A 1XEBA 2JEVA 1IB1E 1IICA 2DPSA 2AE6A 3BJ7A 3TOBA 2YGWA 4KOXA 1KZFA 2P6GA 1LRZA 2Z3KA 4OADA 4YGOA 1I21A 2Z3LA 4OLLA 3IU2A 5H86A 4U9ZA 3VWEA 2P6EA 5ISVA 3TT2A 2OU2A 2BL1A 2EUIA 4QB9A 1R57A 5CNPA 4L89A 4A33A 3FB3A 2PQ8A 2PDOA 2PRBA 4KUAA 4PSWA 1SQHA 3K9UA 4X5KA 2WUUA 4MY0A 4B14A 2VZYA 3TE4A 4FD4A 1B6BA 5E96A 4B5PA 4XPDB 3GYAA 4UCNA 4CGPA 1FY7A 5HH1A 3F5BA 3QAHA 5A28A 4ORFA 3P2FA 1P4NA 3LODA 4UA3A 3MGDA 4A30A 4C2YA 4M3SA 2ATRA 4MFQA 1S7KA 4JXQA 3IWEA 4UBRA 2HQYA 3SXOA 3FXTA 3S6GA 3S6KA 1IYLA 1NSLA 4KOUA 2G3AA 4KOWA 5KTDA 2FIWA 3TTHA 4XNHC 2FXFA 4IUSA 4NEXA 2FS5A 3D2MA 1MK4A 2R7HA 4UFVA 2P0WA 2KCWA 4UCPA 2DXQA 2AJ6A 4UCMA 5G22A 2CNSA 4A95A 2OZUA 5AG7A 2R8VA 2VEZA 2B3VA 1XF8A 2OZGA 3CXQA 4B5OA 4C2ZA 1M4IA 1Z9UA 1M1DA 4QVTA 4F0YA 3TCVA 1S3ZA 2EVNA 4L8AA 2JDDA 2G0BA 4XPLA 2F5IA 3RYOA 2HUZA 2B4BA 2WPWA 4KOTA 4MFLA 2DPTA 4KOVA 4E0AA 2G3TA 2Z0ZA 5AG5A 3EFAA 1OZPA 3B8GA 2Q04A 4B10A 3SXNA 4KOYA 3QB8A 1V0CA 4Y49B 4AVBA 2HV2A 4CAWA 1QSOA 2B5GA 2B58A 4NSQA 3IU1A 3JTKA 4KORA 1Q2YA 2Y0MA 3C26A 3N7ZA 2QIRA 4JD6A 4KVME 4C68A 4KSAA 2Q7BA 4R3LA 1S7NA 5EBVA 4KVOE 4HNWB 2D4PA 3LD2A 3TFYA 4R9MA 1BOBA 2H5MA 4CYNA 2Q44A 2FIAA 2FSRA 2I79A 4A2ZA 3H5ZA 2Z3MA 5F47A 1PU9A 3I9SA 3DSBA 4QBJA 3TOAA 2ZW6A 4HKFA 1UFHA 2VXKA 1MJ9A 4C7IA 3PGPA 1XE4A 3WR7A 4CGNA 2B4DA 2BUEA 2K5TA 4EVYA 3E0KA 2OH1A 2P6FA 1Y9WA 4H89A 4Q38A 1KUYA 4KUBA 4E8OA 2J8NA 1QSMA 3TO6A 3GY9A 3TO9A 5A27A 5JQ4A 2Z3NA 2PC1A 1CJWA 2OZHA 4CRYB 3R1KA 1S7FA 4J3GA 4ZBGA 1YX0A 2PSWA 5IX3A 4RI1A 4PK3A 3T90A 4XPKA 3T9YA 4B5PB 1M4GA 2PR8A 2GE3A 2Z3PA 2JDCA 4Q36A 4XPDC 1M4DA 2CY2A 2FT0A 3IWGA 4MFZA 3DNSA 3GKRA 4B12A 1ON0A 2FCKA 2CXAA 4I49A 4NCZA 5I0CA 4F0XA 4KLVA 2FE7A 3S6FA 3A9LA 3TO7A 2Q4YA 1MJAA 2OB0A 1GHEA 2BSWA 3FYNA 4KVXA 3P2HA 1VKCA 2RC4A 4NF1A 4B13A 4M85A 4CYOA 5DWNA 3W6XA 1M44A 4CAVA 2QECA 3D2PA 4IF5A 2YNCA 3ZJ0A 4H6UA 4B11A 5DWMA 1RO5A 3PZJA 3I3GA 2ZPAA 2REEA 4KZTA 3IGRA 4CAFA 4ONUA 4II9A 4CGMA 2FL4A 4RS2A 4GS4A 2C27A 4UWIA 1N71A 4A32A 5J8FA 2A4NA 4LUAA 3PP9A 3W91A 4MI4A 5J8CA 1YK3A 3BLNA 5C88A 2ZW5A 5C82A 2I00A 5BWAB 2PR1A 4KS9A 1Z4EA 5F49A 5H84A 1YR0A 4UFXA 4Y49C 2REFA 4MJ8A 4C7HA 1ZO0A 2B5GB 4CYQA 1NMTA 1YVOA 4HNYB 2GIVA 3FNCA 5AGEA 5G21A 4AG7A 1BO4A 2ARHA 4CRZB 4BMHA 3R9FA 4QUSA 1B87A 1IIDA 3D3SA 4MFJA 5IV0A 1PUAA 3SHPA 4LX9A 4ZGYB 2WPXA 1KUVA 1XMTA 1S5KA 1YLEA 4K30A 2GANA 4MBUA 2YNDA 1CM0A 4JXRA 3R9GA 5AG6A 3OWCA 4CGLA 2J8MA 4MY3A 2O28A 3CXSA 2CNTA 4BBHA 2VZZA 2NMTA 4FD5A 4CGOA 5KTCA 1TIQA 4AVAA 4H6ZA 2B4DB 4FD7A 5FVJA 2X7BA 4DNCA 3V8IA 4PK2A 3DR6A 1YGHA 2R98A 4A31A 4QC6A 4OAEA 5G1ZA 4KSFA 3H4QA 4PV6A 4JWPA 5AG4A 1QSRA 3S6HA 4E2AA 2VQYA 4KLWA 3UY5A 2B3UA 4YRHA 1L0CA 5KTAA 4MHDA 1RXTA 2VBQA 2ZXVA 1QSNA 4XNHB 2Q0YA 3KKWA 5G20A 3JUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3K A;  4CS0 B;  3DDD A;  1KUX A;  2Z10 A;  3EC4 A;  1J4J A;  1YRE A;  3W6S A;  3FBU A;  4NXY A;  2IL4 A;  3D8P A;  5HMN A;  1XIX A;  1WWZ A;  3G3S A;  4UWJ A;  1I12 A;  2J8R A;  1NE9 A;  1IYK A;  5GCN A;  3R9E A;  5EC4 A;  1VHS A;  1Y7R A;  1Y9K A;  3ZZI A;  3EXN A;  2D4O A;  4R87 A;  5IB0 A;  4HNX B;  4U5Y A;  1MJB A;  1QST A;  4AB7 A;  4PSX A;  3FRM A;  2ZW7 A;  3FIX A;  4FD6 A;  3CXP A;  3BJ8 A;  1WK4 A;  1Q2D A;  4AVC A;  5F48 A;  1Q2C A;  3G8W A;  5JPH A;  2Q4V A;  3VWD A;  4KOS A;  4F6A A;  2QML A;  1S60 A;  4U9Y A;  4JJX A;  1P0H A;  2VI7 A;  4AG9 A;  1I1D A;  2ZW4 A;  3DR8 A;  3EY5 A;  2CNM A;  3F0A A;  2BEI A;  4JLY A;  3R96 A;  4R57 A;  2R1I A;  2Z11 A;  3F8K A;  4YFJ A;  4CAX A;  1YVK A;  3EO4 A;  3JVN A;  1K4J A;  2JLM A;  1U6M A;  1Z4R A;  1S7L A;  3R95 A;  3NE7 A;  5F46 A;  1XEB A;  2JEV A;  1IB1 E;  1IIC A;  2AE6 A;  3BJ7 A;  3TOB A;  4KOX A;  1KZF A;  2P6G A;  1LRZ A;  4OAD A;  4YGO A;  1I21 A;  4OLL A;  5H86 A;  4U9Z A;  3VWE A;  2P6E A;  5ISV A;  3TT2 A;  2OU2 A;  2BL1 A;  2EUI A;  4QB9 A;  1R57 A;  5CNP A;  4L89 A;  3FB3 A;  2PQ8 A;  2PDO A;  2PRB A;  4KUA A;  4PSW A;  1SQH A;  3K9U A;  4X5K A;  4MY0 A;  2VZY A;  3TE4 A;  4FD4 A;  1B6B A;  5E96 A;  4B5P A;  4XPD B;  3GYA A;  1FY7 A;  5HH1 A;  3F5B A;  3QAH A;  4ORF A;  3P2F A;  1P4N A;  3LOD A;  4UA3 A;  3MGD A;  4M3S A;  2ATR A;  1S7K A;  4JXQ A;  4UBR A;  2HQY A;  3SXO A;  3FXT A;  3S6G A;  3S6K A;  1IYL A;  1NSL A;  4KOU A;  2G3A A;  4KOW A;  5KTD A;  2FIW A;  3TTH A;  4XNH C;  2FXF A;  4IUS A;  4NEX A;  2FS5 A;  3D2M A;  1MK4 A;  2R7H A;  2P0W A;  2KCW A;  2DXQ A;  2AJ6 A;  2CNS A;  2OZU A;  2R8V A;  2VEZ A;  2B3V A;  1XF8 A;  2OZG A;  3CXQ A;  4B5O A;  1M4I A;  1Z9U A;  1M1D A;  4QVT A;  4F0Y A;  3TCV A;  1S3Z A;  2EVN A;  4L8A A;  2JDD A;  2G0B A;  4XPL A;  2F5I A;  3RYO A;  2HUZ A;  2B4B A;  2WPW A;  4KOT A;  4KOV A;  4E0A A;  2G3T A;  2Z0Z A;  3EFA A;  1OZP A;  3B8G A;  2Q04 A;  3SXN A;  4KOY A;  3QB8 A;  1V0C A;  4Y49 B;  4AVB A;  2HV2 A;  4CAW A;  1QSO A;  2B5G A;  2B58 A;  4NSQ A;  4KOR A;  1Q2Y A;  2Y0M A;  3C26 A;  3N7Z A;  2QIR A;  4JD6 A;  4KVM E;  4R3L A;  1S7N A;  5EBV A;  4KVO E;  4HNW B;  2D4P A;  3LD2 A;  3TFY A;  4R9M A;  1BOB A;  2H5M A;  2Q44 A;  2FIA A;  2FSR A;  2I79 A;  5F47 A;  1PU9 A;  3I9S A;  3DSB A;  4QBJ A;  3TOA A;  2ZW6 A;  4HKF A;  1UFH A;  2VXK A;  1MJ9 A;  3PGP A;  1XE4 A;  3WR7 A;  2B4D A;  2BUE A;  2K5T A;  4EVY A;  3E0K A;  2OH1 A;  2P6F A;  1Y9W A;  4H89 A;  1KUY A;  4KUB A;  4E8O A;  2J8N A;  1QSM A;  3TO6 A;  3GY9 A;  3TO9 A;  5JQ4 A;  2PC1 A;  1CJW A;  2OZH A;  4CRY B;  3R1K A;  1S7F A;  4J3G A;  4ZBG A;  1YX0 A;  2PSW A;  5IX3 A;  4RI1 A;  4PK3 A;  3T90 A;  4XPK A;  3T9Y A;  4B5P B;  1M4G A;  2PR8 A;  2GE3 A;  2JDC A;  4XPD C;  1M4D A;  2CY2 A;  2FT0 A;  3IWG A;  3DNS A;  3GKR A;  1ON0 A;  2FCK A;  4I49 A;  4NCZ A;  5I0C A;  4KLV A;  2FE7 A;  3S6F A;  3TO7 A;  2Q4Y A;  1MJA A;  2OB0 A;  1GHE A;  2BSW A;  3FYN A;  4KVX A;  3P2H A;  1VKC A;  2RC4 A;  4NF1 A;  4M85 A;  5DWN A;  3W6X A;  1M44 A;  4CAV A;  2QEC A;  3D2P A;  4IF5 A;  3ZJ0 A;  4H6U A;  5DWM A;  1RO5 A;  3PZJ A;  3I3G A;  2ZPA A;  2REE A;  4KZT A;  3IGR A;  4ONU A;  4II9 A;  2FL4 A;  4RS2 A;  4GS4 A;  2C27 A;  4UWI A;  1N71 A;  5J8F A;  2A4N A;  4LUA A;  3PP9 A;  3W91 A;  4MI4 A;  5J8C A;  1YK3 A;  3BLN A;  5C88 A;  2ZW5 A;  5C82 A;  2I00 A;  2PR1 A;  5F49 A;  1Z4E A;  5H84 A;  1YR0 A;  4Y49 C;  2REF A;  4MJ8 A;  2B5G B;  1NMT A;  1YVO A;  4HNY B;  2GIV A;  3FNC A;  4AG7 A;  1BO4 A;  2ARH A;  4CRZ B;  4BMH A;  3R9F A;  4QUS A;  1B87 A;  1IID A;  3D3S A;  5IV0 A;  1PUA A;  3SHP A;  4LX9 A;  2WPX A;  1KUV A;  1XMT A;  1S5K A;  1YLE A;  4K30 A;  2GAN A;  4MBU A;  1CM0 A;  4JXR A;  3R9G A;  3OWC A;  2J8M A;  4MY3 A;  2O28 A;  3CXS A;  2CNT A;  2VZZ A;  2NMT A;  4FD5 A;  5KTC A;  1TIQ A;  4AVA A;  4H6Z A;  2B4D B;  4FD7 A;  5FVJ A;  2X7B A;  4DNC A;  3V8I A;  4PK2 A;  3DR6 A;  1YGH A;  2R98 A;  4QC6 A;  4OAE A;  3H4Q A;  4PV6 A;  4JWP A;  1QSR A;  3S6H A;  4E2A A;  2VQY A;  4KLW A;  3UY5 A;  2B3U A;  4YRH A;  1L0C A;  5KTA A;  4MHD A;  1RXT A;  2VBQ A;  2ZXV A;  1QSN A;  4XNH B;  2Q0Y A;  3KKW A;  2Q7B A;  3JUW A; 
#chains in the Genus database with same CATH topology
 4R3K A;  2YNE A;  4CAE A;  4CS0 B;  3DDD A;  4BIN A;  1KUX A;  2Z10 A;  3H8G A;  1GYT A;  3EC4 A;  1J4J A;  1YRE A;  3W6S A;  3FBU A;  2PJ4 A;  4R6T A;  3N5F A;  4NXY A;  2IL4 A;  1ZG8 A;  3D8P A;  5HMN A;  1LAN A;  1XBU A;  2WSA A;  1AYE A;  4X3R A;  1XIX A;  1WWZ A;  2GFQ A;  3GLJ A;  3MN8 A;  4NGP A;  3NE8 A;  4F9U A;  3G3S A;  3HUV A;  1I12 A;  3PB7 X;  2J8R A;  4UWJ A;  1NE9 A;  1IYK A;  5GCN A;  3R9E A;  4UFW A;  3WC6 A;  3SI1 A;  2PJ3 A;  4M6G A;  4YU9 A;  5EC4 A;  1VHS A;  1Y7R A;  1BAV A;  1Y9K A;  2ZOG A;  3ZZI A;  3NFZ A;  3EXN A;  2D4O A;  2QVP A;  2Z3O A;  4R87 A;  5IB0 A;  4HNX B;  3NH4 A;  4U5Y A;  1MJB A;  1QST A;  4OC0 A;  4AB7 A;  4FWU A;  1FT7 A;  3PRT A;  4NGR A;  4P44 A;  4PSX A;  7CPA A;  3FRM A;  2ZW7 A;  3FIX A;  4FD6 A;  3S9M A;  3CXP A;  4NJQ A;  2AFZ A;  3BJ8 A;  3IEH A;  3KAS A;  4OC4 A;  3S9L A;  1WK4 A;  4IK2 A;  1Q2D A;  4AVC A;  5F48 A;  5DS0 A;  3D68 A;  1Q2C A;  3G8W A;  1HEE A;  5JPH A;  1XFO A;  2PJ7 A;  2Q4V A;  3VWD A;  2O53 A;  4KOS A;  4YWY A;  5ELY A;  1ZG7 A;  2XEG A;  4F6A A;  5D8N A;  2QML A;  4CYP A;  4Q7A A;  1S60 A;  2EO8 A;  4C2X A;  4U9Y A;  4JJX A;  1P0H A;  2VI7 A;  2PJ6 A;  1ZLI A;  4AG9 A;  1I1D A;  2GLJ A;  2ZW4 A;  3DR8 A;  3EY5 A;  2CNM A;  4IHM A;  3B7I A;  1CPS A;  3F0A A;  2BEI A;  4JLY A;  3R96 A;  4R57 A;  2C6C A;  1M4L A;  2PIZ A;  4P45 A;  5IB9 A;  2YNC C;  2R1I A;  2Z11 A;  2G9D A;  1PYT B;  3IIB A;  3LMS A;  3QAY A;  3D7D A;  3F8K A;  4OME A;  4R8F A;  4CAX A;  4YFJ A;  1X10 A;  2F7V A;  4MFK A;  1YVK A;  4MFP A;  3EO4 A;  3GIU A;  3JVN A;  1K4J A;  5K8P A;  2JLM A;  2ZEF A;  4CPA A;  3RO0 A;  2PJC A;  1U6M A;  4MXU A;  2O4H A;  1Z4R A;  1S7L A;  2PE3 A;  4H2K A;  4ZYQ A;  5LRG A;  3NE7 A;  2PJ8 A;  2C1C A;  3R95 A;  1XEB A;  2JEV A;  3KR4 A;  1IB1 E;  4TWE A;  5F46 A;  1IIC A;  2DPS A;  2AE6 A;  3PB8 X;  3BJ7 A;  1LOK A;  3KQZ A;  2AFM A;  3TC8 A;  3TOB A;  1CP7 A;  2WYR A;  2YGW A;  4GXH A;  4KOX A;  1KZF A;  2P6G A;  4OKO A;  2JEW A;  4F9V A;  1ZG9 A;  1LRZ A;  2Z3K A;  4OAD A;  1CG2 A;  4YGO A;  1BPN A;  4P4D A;  2JBJ A;  1I21 A;  2Z3L A;  4NGT A;  3IU2 A;  4OLL A;  4B6Z A;  1TXR A;  5H86 A;  4U9Z A;  3VWE A;  2P6E A;  5ISV A;  3TT2 A;  2OU2 A;  2BL1 A;  2C6P A;  2EUI A;  3FH4 A;  4OP4 A;  4QB9 A;  3VAT A;  1Y0R A;  1QMU A;  5CPA A;  1R57 A;  5CNP A;  4L89 A;  2PCU A;  4R76 A;  1TKJ A;  2QYV A;  4A33 A;  2V8G A;  1IU8 A;  4A39 A;  2PIY A;  3FB3 A;  2PQ8 A;  2PDO A;  2PRB A;  4KUA A;  3NH5 A;  3KL9 A;  4PSW A;  2JBK A;  1SQH A;  3K9U A;  1F2O A;  4P10 A;  4X5K A;  4EME A;  2IQ6 A;  2WUU A;  4MY0 A;  4B14 A;  2VZY A;  3TE4 A;  4FD4 A;  1B6B A;  3BXM A;  3FX6 A;  4RN7 A;  5E96 A;  4B5P A;  2Q43 A;  4GM5 A;  4UEZ A;  1Z2L A;  2ZEL A;  5LYL A;  2ZEH A;  4WJB A;  4XPD B;  4EFD A;  3GYA A;  4UCN A;  3GUX A;  4CGP A;  1IOF A;  1FY7 A;  3F5B A;  5HH1 A;  1Z8X A;  1VGY A;  3QAH A;  4UIA A;  5HVH A;  5A28 A;  4PXB A;  1ZLH A;  4ORF A;  3P2F A;  1P4N A;  2J9A A;  3LOD A;  4JZ0 A;  4UA3 A;  1X12 A;  1LAP A;  3MGD A;  4A30 A;  4M3S A;  4C2Y A;  4P6Y A;  2ATR A;  3KHX A;  4MFQ A;  1S7K A;  2DF5 A;  1BPM A;  4JXQ A;  3IWE A;  3PB6 X;  4G1P A;  4MCP A;  4UBR A;  3VAR A;  2HQY A;  5LYF A;  3SXO A;  3FXT A;  3S6G A;  3S6K A;  1IYL A;  1NSL A;  5K8M A;  3LWU A;  3K9T A;  5F09 A;  4KOU A;  2G3A A;  4KOW A;  3CPX A;  2FIW A;  5KTD A;  3WC7 A;  3TTH A;  2OR4 A;  3KHZ A;  1XRY A;  4DYO A;  4XNH C;  2FXF A;  4IUS A;  4NEX A;  2FS5 A;  3RZA A;  4OC1 A;  5HXD A;  1H8L A;  3D2M A;  1MK4 A;  5JGF A;  2AFO A;  2R7H A;  4UFV A;  2P0W A;  1A2Z A;  2CTB A;  2KCW A;  4UCP A;  2DXQ A;  4OC2 A;  1CP6 A;  2AJ6 A;  4UCM A;  3KQX A;  5G22 A;  3QNV A;  2CNS A;  3FEC A;  3VH9 A;  2OZU A;  4A95 A;  4DJL A;  1UWY A;  5AG7 A;  2R8V A;  1Q7L A;  2VEZ A;  2B3V A;  4FBE A;  2NYQ A;  4W9Y A;  1CPX A;  1XF8 A;  1YSJ A;  3T8W A;  2OZG A;  3CXQ A;  4B5O A;  4C2Z A;  1M4I A;  1Z9U A;  1M1D A;  3SJX A;  4P4E A;  2ZEE A;  3IJ3 A;  4QVT A;  3CZX A;  4F0Y A;  3WT4 A;  3TCV A;  1S3Z A;  1F2P A;  2EVN A;  3ISX A;  4L8A A;  2JDD A;  2G0B A;  4NGN A;  2F5I A;  2PJ2 A;  4XPL A;  3RYO A;  2HUZ A;  2B4B A;  2ZEN A;  1PCA A;  2WPW A;  4KOT A;  4UF4 A;  5K8O A;  3IWW A;  2DPT A;  4MFL A;  4KOV A;  3TX8 A;  4E0A A;  1FNO A;  2G3T A;  2Z0Z A;  2CIJ A;  5AG5 A;  3EFA A;  1OZP A;  2GLF A;  3B8G A;  2Q04 A;  3IO1 A;  4B10 A;  1LFW A;  3BHX A;  3SXN A;  3PBE A;  3KI9 A;  4KOY A;  4PXE A;  3QB8 A;  1V0C A;  3PB9 X;  4Y49 B;  3KR5 A;  5CBM A;  4AVB A;  2C6G A;  2HV2 A;  4CAW A;  4MRI A;  1ARM A;  1QSO A;  2B5G A;  4MCS A;  3I1U A;  2V77 A;  3SI2 A;  3D7G A;  3IC1 A;  2B58 A;  1YW6 A;  4NSQ A;  3IU1 A;  4RUH A;  1CX8 A;  3JTK A;  4KOR A;  1TKH A;  4A94 A;  1Q2Y A;  2GRE A;  2Y0M A;  3C26 A;  5F49 A;  1TF9 A;  3N7Z A;  2I3C A;  2QIR A;  2V8H A;  4JD6 A;  3CPA A;  2EWB A;  4A37 A;  4KVM E;  2PJA A;  3SJE A;  2WZN A;  3D66 A;  4C68 A;  2Q7S A;  4KSA A;  4AXV A;  1VHO A;  2Q7B A;  3D7F A;  4R3L A;  1S7N A;  5EBV A;  3B3V A;  3HLP A;  2QJ8 A;  2D4P A;  3LD2 A;  4HNW B;  4KVO E;  3TFY A;  1AMP A;  4R9M A;  1BOB A;  2H5M A;  4CYN A;  2PJB A;  3BI0 A;  1F57 A;  2Q44 A;  1VHE A;  2FIA A;  1AUG A;  1Z8T A;  3SJF A;  4IAV A;  2PJ5 A;  2FSR A;  3KZW A;  1ARL A;  2I79 A;  4A2Z A;  3H5Z A;  2Z3M A;  4OIW A;  2HC9 A;  4NGM A;  1Z5R A;  2POK A;  4PQA A;  5F47 A;  4ZY1 A;  3B3T A;  1PU9 A;  3MRU A;  3I9S A;  1R43 A;  3DSB A;  4QBJ A;  3TOA A;  2ZW6 A;  2V8V A;  4HKF A;  4R7M A;  1XMB A;  1UFH A;  2VXK A;  1ELM P;  1MJ9 A;  4C7I A;  3PGP A;  1XE4 A;  3B3S A;  4OC5 A;  3WR7 A;  4CGN A;  2B4D A;  2BUE A;  2K5T A;  4EVY A;  2XEJ A;  3E0K A;  2OH1 A;  2P6F A;  1DTD A;  1Y9W A;  3CDX A;  4H89 A;  1KUY A;  4P4F A;  4Q38 A;  4WWV A;  8CPA A;  4HPS A;  1EE3 P;  4KUB A;  1IGB A;  4E8O A;  2J8N A;  1QSM A;  3TO6 A;  3GY9 A;  1Z8W A;  2PRQ A;  4M6H A;  5THW A;  3TO9 A;  2ZEG A;  5A27 A;  5JQ4 A;  4ONW A;  2Z3N A;  2PC1 A;  1CJW A;  2OZH A;  4CRY B;  3R1K A;  2ZEO A;  3FF3 A;  1S7F A;  4ZI6 A;  2Q4Z A;  3CT9 A;  4J3G A;  2AFX A;  4KSI A;  4ZBG A;  1YX0 A;  2PSW A;  5IX3 A;  4RI1 A;  2EK9 A;  2PJ9 A;  4PK3 A;  3T90 A;  4XPK A;  4F8Z A;  3T9Y A;  4B5P B;  3ISZ A;  1M4G A;  2PR8 A;  2GE3 A;  1YQE A;  4PXD A;  1XJO A;  2Z3P A;  4MHZ A;  2JDC A;  4UEE A;  4Q36 A;  4NJR A;  4XPD C;  5HVF A;  4P4J A;  4BD9 A;  1M4D A;  1IOI A;  2CY2 A;  3GB0 A;  2PJ0 A;  3PFE A;  2FT0 A;  3FED A;  3IWG A;  3DNS A;  3GKR A;  4MFZ A;  1ON0 A;  4B12 A;  1YLO A;  2FCK A;  2CXA A;  4I49 A;  4MCR A;  2PVW A;  4NCZ A;  5I0C A;  2XEF A;  4F0X A;  1KWM A;  4KLV A;  2FE7 A;  3FVL A;  2OOT A;  3S6F A;  3A9L A;  3TO7 A;  4EWT A;  2Q4Y A;  1MJA A;  2OB0 A;  1GHE A;  2BSW A;  4A38 A;  3FYN A;  5LYI A;  4Z65 A;  2EBJ A;  4KVX A;  3P2H A;  2F8H A;  1VKC A;  3V38 A;  2ZEM A;  3DLJ A;  2RC4 A;  2ZEP A;  4NF1 A;  4B13 A;  4M85 A;  4CYO A;  2PVV A;  5EMI A;  1VIX A;  2AFS A;  5DWN A;  2BO9 A;  1M44 A;  3W6X A;  4MHN A;  2QEC A;  4CAV A;  3D2P A;  4IF5 A;  2YNC A;  3ZJ0 A;  3K2K A;  4H6U A;  1ELL P;  5HVG A;  4B11 A;  5DWM A;  2AFW A;  1RO5 A;  3PZJ A;  4X2T A;  3I3G A;  1XOV A;  2IJZ A;  2ZPA A;  2REE A;  4NFR A;  4KZT A;  3L2N A;  3SI0 A;  3IGR A;  4CAF A;  4ONU A;  4II9 A;  3B35 A;  2XEI A;  4CGM A;  1JWQ A;  2FL4 A;  4RS2 A;  2ZOF A;  1TF8 A;  2C27 A;  4GS4 A;  4P4I A;  1N71 A;  2BCO A;  4UWI A;  3RAM A;  1HDQ A;  4A32 A;  3FEE A;  2GU2 A;  1R3N A;  2ANP A;  4LQG A;  2A4N A;  1YME A;  2ODF A;  4LUA A;  4DUK A;  5J8F A;  2VL1 A;  2DEA A;  3PFO A;  3PP9 A;  3B3C A;  3D4U A;  1JQG A;  4O23 A;  3W91 A;  4MI4 A;  5J8C A;  1DE4 C;  1YK3 A;  3BLN A;  3V7Z A;  5C88 A;  2V8D A;  2ZW5 A;  4MCQ A;  3NA6 A;  1LAM A;  1IY7 A;  2I00 A;  5BWA B;  3IFE A;  2PR1 A;  4UEF A;  5C82 A;  2ZED A;  1NSA A;  1Z4E A;  3NH8 A;  4KS9 A;  1YR0 A;  3H8F A;  4UFX A;  4Y49 C;  2REF A;  4MJ8 A;  1QQ9 A;  4ZX9 A;  5H84 A;  5LRJ A;  1ZO0 A;  1HDU A;  2B5G B;  4CYQ A;  1NMT A;  1YVO A;  5G20 A;  5K8N A;  4HNY B;  2GIV A;  3KGQ A;  1TKF A;  3FNC A;  5AGE A;  5G21 A;  4AG7 A;  1RTQ A;  3BI1 A;  1BO4 A;  2HB6 A;  2ARH A;  3H8E A;  3PEI A;  4CRZ B;  4C7H A;  2NSM A;  4BMH A;  6CPA A;  3JRU A;  3R9F A;  4QUS A;  4LQ6 A;  1B87 A;  1IID A;  3D3S A;  4MFJ A;  1OBR A;  5IV0 A;  1PUA A;  1BLL E;  3SHP A;  4LX9 A;  5J1Q A;  4ZGY B;  1CBX A;  1Z8L A;  4MHP A;  2WPX A;  1KUV A;  3D7H A;  2ABZ A;  2FVG A;  3RBU A;  3B3W A;  1XMT A;  3PB4 X;  4M6I A;  3RNZ A;  1S5K A;  1YLE A;  5JM6 A;  3PBB A;  4K30 A;  2GAN A;  4X8I A;  2RFH A;  4MBU A;  5LRK A;  2YND A;  1CM0 A;  5I4M A;  4NGS A;  4OC3 A;  4JXR A;  3R9G A;  4MHY A;  5AG6 A;  2RB7 A;  3OWC A;  4CGL A;  4ZY2 A;  2J8M A;  4MY3 A;  2O28 A;  3FMC A;  2BOA A;  2Q51 A;  3WC5 A;  3CXS A;  2CNT A;  3B2Y A;  3WAB A;  2AFU A;  4MMO A;  4BBH A;  2VZZ A;  4PPZ A;  4P4B A;  2NMT A;  4FD5 A;  4CGO A;  5KTC A;  1TIQ A;  4AVA A;  4FUU A;  2PJ1 A;  4UIB A;  4H6Z A;  3SJG A;  4NGQ A;  5D29 A;  4ZY0 A;  2B4D B;  2CTC A;  4FD7 A;  2X7B A;  5FVJ A;  4DNC A;  3V8I A;  4FAI A;  4PK2 A;  3DR6 A;  1YGH A;  2R98 A;  3S9N A;  4OID A;  4K3N A;  2CF4 A;  4A31 A;  3LAC A;  4QC6 A;  4OAE A;  5G1Z A;  4KSF A;  3H4Q A;  4PV6 A;  1Y7E A;  4JWP A;  5AG4 A;  1QSR A;  3S6H A;  4E2A A;  2VQY A;  4KLW A;  5LYD A;  3UY5 A;  2B3U A;  4YRH A;  1L0C A;  5JH9 A;  1Y0Y A;  2IMO A;  5KTA A;  4MHD A;  1RXT A;  4TNU A;  2VBQ A;  2ZXV A;  1QSN A;  4XNH B;  2Q0Y A;  1YW4 A;  2EK8 A;  1LCP A;  3D67 A;  4ZX8 A;  3KKW A;  4JYW A;  3FJU A;  4PXC A;  3DGV A;  3JUW A; 
#chains in the Genus database with same CATH homology
 4R3K A;  2YNE A;  4CAE A;  4CS0 B;  3DDD A;  1KUX A;  2Z10 A;  3EC4 A;  1J4J A;  1YRE A;  3W6S A;  3FBU A;  4NXY A;  2IL4 A;  3D8P A;  5HMN A;  2WSA A;  1XIX A;  1WWZ A;  3G3S A;  4UWJ A;  1I12 A;  2J8R A;  1NE9 A;  1IYK A;  5GCN A;  3R9E A;  4UFW A;  5EC4 A;  1VHS A;  1Y7R A;  1Y9K A;  3ZZI A;  3EXN A;  2D4O A;  2Z3O A;  4R87 A;  5IB0 A;  4HNX B;  4U5Y A;  1MJB A;  1QST A;  4AB7 A;  4PSX A;  3FRM A;  2ZW7 A;  3FIX A;  4FD6 A;  3CXP A;  3BJ8 A;  1WK4 A;  1Q2D A;  4AVC A;  5F48 A;  1Q2C A;  3G8W A;  5JPH A;  2Q4V A;  3VWD A;  4KOS A;  4F6A A;  4CYP A;  2QML A;  1S60 A;  4C2X A;  4U9Y A;  4JJX A;  1P0H A;  2VI7 A;  4AG9 A;  1I1D A;  2ZW4 A;  3DR8 A;  3EY5 A;  2CNM A;  3F0A A;  2BEI A;  4JLY A;  3R96 A;  4R57 A;  2YNC C;  2R1I A;  2Z11 A;  3F8K A;  4YFJ A;  4CAX A;  4MFK A;  1YVK A;  4MFP A;  3EO4 A;  3JVN A;  1K4J A;  2JLM A;  1U6M A;  1Z4R A;  1S7L A;  3R95 A;  3NE7 A;  5F46 A;  1XEB A;  2JEV A;  1IB1 E;  1IIC A;  2DPS A;  2AE6 A;  3BJ7 A;  3TOB A;  2YGW A;  4KOX A;  1KZF A;  2P6G A;  1LRZ A;  2Z3K A;  4OAD A;  4YGO A;  1I21 A;  2Z3L A;  4OLL A;  3IU2 A;  5H86 A;  4U9Z A;  3VWE A;  2P6E A;  5ISV A;  3TT2 A;  2OU2 A;  2BL1 A;  2EUI A;  4QB9 A;  1R57 A;  5CNP A;  4L89 A;  4A33 A;  3FB3 A;  2PQ8 A;  2PDO A;  2PRB A;  4KUA A;  4PSW A;  1SQH A;  3K9U A;  4X5K A;  2WUU A;  4MY0 A;  4B14 A;  2VZY A;  3TE4 A;  4FD4 A;  1B6B A;  5E96 A;  4B5P A;  4XPD B;  3GYA A;  4UCN A;  4CGP A;  1FY7 A;  5HH1 A;  3F5B A;  3QAH A;  5A28 A;  4ORF A;  3P2F A;  1P4N A;  3LOD A;  4UA3 A;  3MGD A;  4A30 A;  4C2Y A;  4M3S A;  2ATR A;  4MFQ A;  1S7K A;  4JXQ A;  3IWE A;  4UBR A;  2HQY A;  3SXO A;  3FXT A;  3S6G A;  3S6K A;  1IYL A;  1NSL A;  4KOU A;  2G3A A;  4KOW A;  5KTD A;  2FIW A;  3TTH A;  4XNH C;  2FXF A;  4IUS A;  4NEX A;  2FS5 A;  3D2M A;  1MK4 A;  2R7H A;  4UFV A;  2P0W A;  2KCW A;  4UCP A;  2DXQ A;  2AJ6 A;  4UCM A;  5G22 A;  2CNS A;  4A95 A;  2OZU A;  5AG7 A;  2R8V A;  2VEZ A;  2B3V A;  1XF8 A;  2OZG A;  3CXQ A;  4B5O A;  4C2Z A;  1M4I A;  1Z9U A;  1M1D A;  4QVT A;  4F0Y A;  3TCV A;  1S3Z A;  2EVN A;  4L8A A;  2JDD A;  2G0B A;  4XPL A;  2F5I A;  3RYO A;  2HUZ A;  2B4B A;  2WPW A;  4KOT A;  4MFL A;  2DPT A;  4KOV A;  4E0A A;  2G3T A;  2Z0Z A;  5AG5 A;  3EFA A;  1OZP A;  3B8G A;  2Q04 A;  4B10 A;  3SXN A;  4KOY A;  3QB8 A;  1V0C A;  4Y49 B;  4AVB A;  2HV2 A;  4CAW A;  1QSO A;  2B5G A;  2B58 A;  4NSQ A;  3IU1 A;  3JTK A;  4KOR A;  1Q2Y A;  2Y0M A;  3C26 A;  3N7Z A;  2QIR A;  4JD6 A;  4KVM E;  4C68 A;  4KSA A;  2Q7B A;  4R3L A;  1S7N A;  5EBV A;  4KVO E;  4HNW B;  2D4P A;  3LD2 A;  3TFY A;  4R9M A;  1BOB A;  2H5M A;  4CYN A;  2Q44 A;  2FIA A;  2FSR A;  2I79 A;  4A2Z A;  3H5Z A;  2Z3M A;  5F47 A;  1PU9 A;  3I9S A;  3DSB A;  4QBJ A;  3TOA A;  2ZW6 A;  4HKF A;  1UFH A;  2VXK A;  1MJ9 A;  4C7I A;  3PGP A;  1XE4 A;  3WR7 A;  4CGN A;  2B4D A;  2BUE A;  2K5T A;  4EVY A;  3E0K A;  2OH1 A;  2P6F A;  1Y9W A;  4H89 A;  4Q38 A;  1KUY A;  4KUB A;  4E8O A;  2J8N A;  1QSM A;  3TO6 A;  3GY9 A;  3TO9 A;  5A27 A;  5JQ4 A;  2Z3N A;  2PC1 A;  1CJW A;  2OZH A;  4CRY B;  3R1K A;  1S7F A;  4J3G A;  4ZBG A;  1YX0 A;  2PSW A;  5IX3 A;  4RI1 A;  4PK3 A;  3T90 A;  4XPK A;  3T9Y A;  4B5P B;  1M4G A;  2PR8 A;  2GE3 A;  2Z3P A;  2JDC A;  4Q36 A;  4XPD C;  1M4D A;  2CY2 A;  2FT0 A;  3IWG A;  4MFZ A;  3DNS A;  3GKR A;  4B12 A;  1ON0 A;  2FCK A;  2CXA A;  4I49 A;  4NCZ A;  5I0C A;  4F0X A;  4KLV A;  2FE7 A;  3S6F A;  3A9L A;  3TO7 A;  2Q4Y A;  1MJA A;  2OB0 A;  1GHE A;  2BSW A;  3FYN A;  4KVX A;  3P2H A;  1VKC A;  2RC4 A;  4NF1 A;  4B13 A;  4M85 A;  4CYO A;  5DWN A;  3W6X A;  1M44 A;  4CAV A;  2QEC A;  3D2P A;  4IF5 A;  2YNC A;  3ZJ0 A;  4H6U A;  4B11 A;  5DWM A;  1RO5 A;  3PZJ A;  3I3G A;  2ZPA A;  2REE A;  4KZT A;  3IGR A;  4CAF A;  4ONU A;  4II9 A;  4CGM A;  2FL4 A;  4RS2 A;  4GS4 A;  2C27 A;  4UWI A;  1N71 A;  4A32 A;  5J8F A;  2A4N A;  4LUA A;  3PP9 A;  3W91 A;  4MI4 A;  5J8C A;  1YK3 A;  3BLN A;  5C88 A;  2ZW5 A;  5C82 A;  2I00 A;  5BWA B;  2PR1 A;  4KS9 A;  1Z4E A;  5F49 A;  5H84 A;  1YR0 A;  4UFX A;  4Y49 C;  2REF A;  4MJ8 A;  4C7H A;  1ZO0 A;  2B5G B;  4CYQ A;  1NMT A;  1YVO A;  4HNY B;  2GIV A;  3FNC A;  5AGE A;  5G21 A;  4AG7 A;  1BO4 A;  2ARH A;  4CRZ B;  4BMH A;  3R9F A;  4QUS A;  1B87 A;  1IID A;  3D3S A;  4MFJ A;  5IV0 A;  1PUA A;  3SHP A;  4LX9 A;  4ZGY B;  2WPX A;  1KUV A;  1XMT A;  1S5K A;  1YLE A;  4K30 A;  2GAN A;  4MBU A;  2YND A;  1CM0 A;  4JXR A;  3R9G A;  5AG6 A;  3OWC A;  4CGL A;  2J8M A;  4MY3 A;  2O28 A;  3CXS A;  2CNT A;  4BBH A;  2VZZ A;  2NMT A;  4FD5 A;  4CGO A;  5KTC A;  1TIQ A;  4AVA A;  4H6Z A;  2B4D B;  4FD7 A;  5FVJ A;  2X7B A;  4DNC A;  3V8I A;  4PK2 A;  3DR6 A;  1YGH A;  2R98 A;  4A31 A;  4QC6 A;  4OAE A;  5G1Z A;  4KSF A;  3H4Q A;  4PV6 A;  4JWP A;  5AG4 A;  1QSR A;  3S6H A;  4E2A A;  2VQY A;  4KLW A;  3UY5 A;  2B3U A;  4YRH A;  1L0C A;  5KTA A;  4MHD A;  1RXT A;  2VBQ A;  2ZXV A;  1QSN A;  4XNH B;  2Q0Y A;  3KKW A;  5G20 A;  3JUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...