3P2FA

Crystal structure of tofi in an apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
175
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
total genus 52
structure length 175
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2fA00
4MHDA 3JUWA 2IL4A 2GANA 4XNHB 2BUEA 1Z9UA 4RS2A 4CRZB 4F6AA 2I79A 3R96A 3F5BA 3TO7A 2R98A 2ZW6A 4NEXA 2JDCA 4M85A 3P2HA 3WR7A 2BSWA 3LD2A 4EVYA 2CY2A 1NMTA 3D2PA 3W6SA 2VXKA 1WWZA 1KUVA 4E0AA 2FL4A 2KCWA 3EC4A 3MGDA 5H86A 3EY5A 3TCVA 2Q04A 4OLLA 3W6XA 4KOUA 3D8PA 2FS5A 4KOXA 2JLMA 4PV6A 2OH1A 1Y9WA 3PP9A 4QB9A 5H84A 4AVCA 1YVKA 4KZTA 1MJAA 2PDOA 3D3SA 2AJ6A 3GY9A 2FSRA 4F0YA 1I12A 2FIAA 2B4DA 3JVNA 4AG9A 5FVJA 3VWDA 1YK3A 2GE3A 3SXNA 3G3SA 2AE6A 3FB3A 4ORFA 2REEA 4CAXA 3W91A 3CXQA 1YVOA 1IIDA 3CXPA 1XMTA 4B5OA 5F46A 4PSXA 4UA3A 4PK3A 2QECA 1Q2YA 2HV2A 4QC6A 3VWEA 3V8IA 5J8CA 2Z11A 1IYKA 1I1DA 2B4DB 3EO4A 4KOSA 4QUSA 1QSRA 1I21A 3IGRA 3S6FA 1CJWA 2R8VA 4U9ZA 2OB0A 4OAEA 5JPHA 3R9EA 4PK2A 1OZPA 4KUBA 2Q44A 5C82A 2VI7A 1YREA 2ARHA 1XF8A 1YX0A 1YGHA 2OZUA 3R95A 3TT2A 2X7BA 2HQYA 3H4QA 4KLWA 4KOVA 4R3KA 3S6GA 1XIXA 2J8RA 4BMHA 2G3TA 3LODA 4B5PB 4KVME 3FRMA 3T9YA 1S60A 3FNCA 4JWPA 1CM0A 5KTDA 2PC1A 3DSBA 2PQ8A 2J8MA 4MBUA 4XPDC 2Q4YA 4R9MA 2ZW7A 4ONUA 1SQHA 5F49A 4FD5A 2REFA 2EUIA 1P0HA 3FXTA 4UWIA 1R57A 4Y49C 1YLEA 3DNSA 1RO5A 3SHPA 1QSMA 4JJXA 2QIRA 3CXSA 1UFHA 3IWGA 1NE9A 2JDDA 4JLYA 2B3VA 2JEVA 1MJBA 2P0WA 5KTCA 2O28A 3FBUA 5KTAA 2C27A 5CNPA 2RC4A 4UWJA 4H6ZA 1IICA 3GKRA 3RYOA 5DWMA 3TOAA 4XPLA 2NMTA 2P6EA 3TO6A 1KZFA 4DNCA 1TIQA 2WPWA 2CNMA 4QVTA 3EFAA 1S7LA 4KOWA 4GS4A 4HNYB 2Z0ZA 1KUYA 4HKFA 4R57A 4M3SA 1Z4RA 3TO9A 1M1DA 1L0CA 1Q2DA 3R1KA 5IB0A 2OZGA 4II9A 1Y9KA 4PSWA 5GCNA 2VEZA 4LUAA 1Y7RA 3F8KA 5F47A 3S6KA 2VQYA 1Z4EA 4AVBA 3ZZIA 3KKWA 4L89A 3PZJA 4CAVA 2F5IA 4U5YA 2PRBA 4H89A 3OWCA 2R7HA 2PSWA 4FD6A 2B5GA 2DXQA 2Z10A 4H6UA 2D4OA 4HNXB 1S7KA 5DWNA 1FY7A 4MY0A 1YR0A 3R9GA 2H5MA 4XPKA 2ZW5A 4YGOA 2B58A 4KVXA 2P6GA 4CS0B 4E2AA 2FE7A 3ZJ0A 1PU9A 4XPDB 4FD4A 5I0CA 3EXNA 3TE4A 5IV0A 3B8GA 4KOTA 4MJ8A 2Y0MA 2CNTA 2G3AA 4Y49B 2B4BA 4RI1A 3E0KA 4YFJA 4YRHA 4IUSA 2G0BA 4U9YA 3DR6A 2FT0A 3C26A 1IYLA 1ON0A 1BOBA 2OZHA 4JXRA 3QB8A 2A4NA 3DDDA 4X5KA 3BJ7A 3QAHA 3PGPA 3FYNA 4CAWA 5HMNA 4KVOE 4NCZA 4XNHC 3R9FA 4J3GA 1S3ZA 5EC4A 3TTHA 4MI4A 2VZYA 2VZZA 5C88A 3GYAA 4E8OA 4NF1A 4AVAA 4JXQA 4KOYA 1GHEA 4CRYB 2ATRA 2R1IA 4L8AA 4ZBGA 4HNWB 3NE7A 1MK4A 5J8FA 4IF5A 4KLVA 2I00A 4KUAA 2FIWA 2GIVA 4UBRA 1XE4A 2Q4VA 2J8NA 2BL1A 1RXTA 1NSLA 1U6MA 3N7ZA 1V0CA 3G8WA 1LRZA 1QSTA 4JD6A 3F0AA 5E96A 4KORA 1WK4A 2ZPAA 1B6BA 3K9UA 4NXYA 4AB7A 1M44A 2PR8A 2EVNA 4FD7A 3DR8A 1QSOA 3TOBA 4AG7A 2OU2A 5JQ4A 5HH1A 2D4PA 1K4JA 1VKCA 2HUZA 1P4NA 3I9SA 1S5KA 4LX9A 1BO4A 4MY3A 3SXOA 1KUXA 2WPXA 2CNSA 2P6FA 1QSNA 3D2MA 2K5TA 4NSQA 1PUAA 4OADA 4R87A 4B5PA 1B87A 2ZW4A 2VBQA 1N71A 1J4JA 5ISVA 1IB1E 4I49A 1VHSA 1M4GA 3FIXA 4R3LA 1M4DA 2Q0YA 1Q2CA 3BLNA 5EBVA 4K30A 2ZXVA 2BEIA 3S6HA 5IX3A 1S7FA 2PR1A 3BJ8A 2FCKA 5F48A 2Q7BA 3TFYA 1S7NA 2QMLA 3I3GA 2B3UA 3P2FA 3UY5A 4QBJA 1MJ9A 1XEBA 2FXFA 2B5GB 1M4IA 3T90A
chains in the Genus database with same CATH superfamily
4MHDA 3JUWA 4CPAA 2IL4A 2GANA 4XNHB 2BUEA 1Z9UA 3KR5A 4RS2A 4CAFA 5A28A 4CRZB 4F6AA 4MCSA 1DE4C 2I79A 3R96A 4CYPA 1VGYA 5DS0A 3F5BA 4KS9A 4C7HA 3TO7A 5AG5A 1JQGA 2R98A 2ZW6A 4NEXA 2HC9A 2JDCA 4M85A 3P2HA 3K2KA 3WR7A 4OC5A 2BSWA 3LD2A 4EVYA 4MFZA 2CY2A 3H8EA 5G22A 1NMTA 4KSFA 3D2PA 2NYQA 3W6SA 1IOFA 2DPTA 2VXKA 1WWZA 1KUVA 3B7IA 3IU2A 4JYWA 4A37A 4E0AA 1X10A 2FL4A 2KCWA 3EC4A 3MGDA 3PFOA 4OC2A 4P4JA 3DGVA 3D7FA 3B3WA 4A31A 5AG4A 1EE3P 2V8VA 3EY5A 5H86A 3TCVA 2Q04A 4OLLA 2PJ5A 3WC7A 5HXDA 4WJBA 5JM6A 1LFWA 1VHOA 3W6XA 4KOUA 3D8PA 2OR4A 2FS5A 4KOXA 1ZG9A 2JLMA 4PV6A 3TX8A 2VL1A 4R6TA 4AXVA 3FECA 2OH1A 5HVGA 1Y9WA 2PCUA 3D67A 3MRUA 3PP9A 4QB9A 5H84A 2QVPA 3FJUA 4AVCA 1YVKA 4KZTA 1MJAA 2PDOA 3D3SA 5LRGA 4F0XA 2ZEMA 2AJ6A 4EMEA 3GY9A 4MFQA 2FSRA 4F0YA 1I12A 4UFXA 4C7IA 2FIAA 2EWBA 2B4DA 4CGOA 2GFQA 3B2YA 3JVNA 4UIBA 4AG9A 5FVJA 2PJ8A 2YNEA 5BWAB 3VWDA 1YK3A 2GE3A 2JBJA 3SXNA 3G3SA 4UF4A 2AE6A 4UFWA 3FB3A 4ORFA 2AFSA 3SJEA 2REEA 4CAXA 1ZG8A 3W91A 1YLOA 3CXQA 2PJ2A 3NH5A 1OBRA 2Q43A 2XEGA 3BHXA 5JGFA 1YVOA 2JEWA 3D7DA 2C6PA 4FUUA 1IIDA 3CXPA 4NGPA 4GXHA 4M6IA 4F9VA 1XMTA 3RNZA 2OOTA 3K9TA 4B5OA 1LOKA 4OC1A 4P45A 5F46A 4PSXA 4UA3A 4PK3A 5CPAA 2QECA 4C2XA 1Q2YA 4EWTA 4F9UA 4G1PA 1Q7LA 1ARMA 2HV2A 2ZEOA 3S9MA 4QC6A 4X3RA 4ZYQA 3VWEA 3B3CA 3V8IA 2Z11A 5J8CA 5CBMA 3PBEA 4BD9A 1IYKA 1I1DA 2B4DB 3D7GA 2CXAA 3EO4A 4B12A 4KOSA 1F2OA 4F8ZA 2Q4ZA 4QUSA 1FNOA 1QSRA 4IK2A 4B6ZA 4CGNA 4MRIA 3VH9A 2QYVA 3GLJA 3D68A 1I21A 2Z3PA 2EK8A 4A2ZA 2CIJA 3IGRA 3S6FA 1CJWA 1LANA 3D66A 4IHMA 2R8VA 4U9ZA 2OB0A 4OAEA 2FVGA 3PFEA 5JPHA 3IIBA 3R9EA 4PK2A 4B11A 1OZPA 4KUBA 2PJ4A 3ISZA 2Q44A 5C82A 2VI7A 1NSAA 1YREA 2ARHA 5G1ZA 5AGEA 3SI2A 2Z3OA 3T8WA 1XF8A 1HDUA 1YX0A 4OC4A 4ZY0A 1YGHA 2OZUA 3R95A 3TT2A 2X7BA 2HQYA 3H4QA 2V8GA 1QQ9A 1YMEA 4KLWA 4A33A 4KOVA 3WC6A 2BO9A 2GLFA 4YWYA 1ELLP 4R3KA 3S6GA 5LRKA 1XIXA 1TF9A 4Z65A 2J8RA 4CAEA 4DJLA 4MCPA 2V77A 4BMHA 2G3TA 3QNVA 3LODA 2AFWA 4B5PB 4CYNA 4KVME 3DLJA 3FRMA 3T9YA 1S60A 3FNCA 4JWPA 1XJOA 4MHYA 1CM0A 5KTDA 4PXBA 2PC1A 1XBUA 3DSBA 4OKOA 4MFPA 2PQ8A 2J8MA 3VARA 4FBEA 4R8FA 4MBUA 2CF4A 4XPDC 2Q4YA 4R9MA 1TF8A 1CP7A 2ZW7A 1H8LA 1M4IA 1Z5RA 1F2PA 1YW6A 3A9LA 4ONUA 3LWUA 1SQHA 3PB4X 5F49A 4HPSA 4FD5A 1TKJA 2EUIA 2REFA 1P0HA 5AG6A 1M4LA 2PJ3A 2ZEPA 3FXTA 3PB7X 4UWIA 4MFKA 1CPSA 1VHEA 4A30A 4UEFA 1TXRA 1R57A 4OIWA 3B35A 2ZENA 4Y49C 1YLEA 4LQGA 4OIDA 3KHXA 3DNSA 4A95A 1RO5A 1XOVA 3SHPA 1QSMA 1QMUA 2C6GA 4JJXA 3KL9A 4OP4A 2QIRA 3NFZA 3CXSA 4UFVA 8CPAA 1UFHA 1HEEA 4NGNA 1TKHA 3IWGA 1JWQA 1NE9A 4KSAA 5D29A 3BI0A 2JDDA 4X8IA 4NGQA 1YQEA 4JLYA 2B3VA 2JEVA 1IOIA 1MJBA 3FVLA 2P0WA 5K8MA 5KTCA 1VIXA 2O28A 3FBUA 5KTAA 2C27A 3HUVA 2RC4A 1CP6A 2AFMA 3JTKA 5CNPA 2Q51A 5G20A 4UWJA 4H6ZA 1IICA 3GKRA 3RBUA 3VATA 4P10A 3S9LA 2DF5A 3RYOA 5DWMA 3TOAA 4NGMA 4UEEA 4XPLA 3CT9A 2J9AA 2F7VA 2NMTA 2P6EA 3WC5A 3TO6A 1KZFA 2Z3KA 4B13A 4DNCA 1FT7A 1TIQA 3LMSA 4PXCA 1AUGA 1IGBA 2WPWA 6CPAA 3H8FA 3IWEA 2CNMA 2YGWA 1LAPA 3GB0A 2ZEHA 4QVTA 3EFAA 1ZLIA 1CPXA 1S7LA 4KOWA 4GS4A 4ZX9A 5AG7A 4Q36A 4HNYB 1Z8TA 1KUYA 2Z0ZA 2PE3A 4HKFA 4R57A 2IJZA 4M3SA 4P4BA 4ZY2A 3T90A 1Z4RA 3IC1A 4OC3A 3TO9A 2IMOA 1M1DA 1L0CA 4NFRA 4JZ0A 4P4DA 4B14A 1Q2DA 3R1KA 2AFOA 5IB0A 1CX8A 1XFOA 2GREA 2OZGA 4UCMA 4II9A 1Y9KA 4PSWA 2WUUA 5GCNA 2VEZA 4LUAA 1RTQA 5IB9A 1Y7RA 1XMBA 3WABA 3F8KA 5F47A 2XEIA 3S6KA 2VQYA 1Z4EA 4A38A 3H5ZA 4IAVA 4AVBA 3ZZIA 5A27A 3KHZA 2WYRA 2ZOGA 4MHZA 4M6HA 3KKWA 3CDXA 4L89A 2POKA 3PB6X 3PZJA 4NGSA 4CAVA 3D4UA 4ZGYB 3TC8A 2ODFA 2F5IA 3IFEA 1F57A 3FEEA 4X2TA 4B10A 3CPAA 4U5YA 2PRBA 3RO0A 2G9DA 3I1UA 3OWCA 4H89A 2R7HA 2PSWA 4MXUA 2PJBA 4YU9A 5LYFA 4FD6A 1PYTB 2DPSA 2B5GA 3S9NA 2DXQA 2Z10A 4H6UA 3V38A 2D4OA 4HNXB 4MFLA 3SJFA 1S7KA 4A39A 5DWNA 3PB9X 2I3CA 4CYQA 1FY7A 4MY0A 4C2YA 2C1CA 1YR0A 3SJGA 3WT4A 1ELMP 3R9GA 5ELYA 2H5MA 3RZAA 4XPKA 5LRJA 1Z8XA 2ZW5A 4YGOA 2B58A 4KVXA 5G21A 2P6GA 4CS0B 2PIZA 2FE7A 2XEJA 1PU9A 4MFJA 4XPDB 3ZJ0A 4E2AA 4R7MA 4EFDA 3FMCA 1Z8LA 4FD4A 3SJXA 5I0CA 4MHPA 3SI0A 1ZLHA 3EXNA 3TE4A 2EO8A 5IV0A 3B8GA 2NSMA 2PJ9A 4KOTA 4NJRA 2ZEFA 2BCOA 2PJ6A 2Y0MA 4MJ8A 5THWA 1KWMA 2CNTA 1LCPA 2G3AA 3CZXA 3LACA 4Y49B 2AFZA 2B4BA 4PXEA 4RI1A 1AYEA 3E0KA 1LAMA 4YRHA 2QJ8A 4ZX8A 4FAIA 4YFJA 4IUSA 2G0BA 3FEDA 4U9YA 4WWVA 2PJ1A 2EK9A 1ZO0A 3KR4A 2ZOFA 3DR6A 2FT0A 3B3TA 3C26A 3PRTA 3H8GA 1IYLA 1ON0A 3IEHA 1BOBA 2OZHA 4JXRA 3QB8A 4A32A 1BLLE 1Z2LA 4KSIA 4UCPA 1AMPA 2A4NA 4C68A 3DDDA 4X5KA 3BJ7A 4FWUA 3QAHA 5I4MA 2PJCA 3FYNA 3JRUA 3PGPA 3N5FA 4CAWA 5HMNA 4KVOE 2Z3MA 4M6GA 2JBKA 3B3VA 4NCZA 4XNHC 5JH9A 3R9FA 4J3GA 1S3ZA 5EC4A 4PQAA 3TTHA 4DUKA 2CTBA 4MI4A 2VZYA 4GM5A 2VZZA 5C88A 2O4HA 3IO1A 2ZEDA 4NJQA 5LYIA 3GYAA 4E8OA 1CG2A 4NF1A 4ZY1A 2AFUA 3L2NA 4AVAA 4JXQA 1PCAA 2GU2A 3GIUA 2ANPA 3MN8A 2YNCA 4O23A 3FX6A 5LYLA 4PXDA 4P4IA 1ARLA 4KOYA 1GHEA 4CRYB 2ATRA 2DEAA 3PBBA 2R1IA 3B3SA 3NH8A 2IQ6A 2PJ0A 4A94A 3KI9A 4L8AA 4R76A 5F09A 4P4FA 5J1QA 4ZBGA 1Z8WA 4BINA 4DYOA 2XEFA 4C2ZA 4HNWB 2CTCA 3NE7A 1MK4A 5J8FA 1X12A 1XRYA 3NE8A 2EBJA 4IF5A 4KLVA 2I00A 4LQ6A 2PVWA 4KUAA 4P44A 2FIWA 3IJ3A 2AFXA 2GIVA 1IY7A 4UCNA 4CGLA 1A2ZA 2PJ7A 3V7ZA 4PPZA 4UBRA 4TNUA 1XE4A 2Q4VA 3NA6A 2J8NA 2BL1A 2O53A 1RXTA 4TWEA 2BOAA 1DTDA 1NSLA 1U6MA 3N7ZA 1V0CA 2PVVA 3G8WA 1LRZA 1CBXA 1QSTA 2PRQA 2RB7A 3F0AA 4JD6A 4K3NA 5E96A 5EMIA 4KORA 1WK4A 2ZPAA 1R3NA 1B6BA 5HVFA 4ONWA 3K9UA 4NXYA 4CGPA 3KASA 3QAYA 4AB7A 1M44A 4ZI6A 5K8OA 2PR8A 2EVNA 2V8HA 4FD7A 3DR8A 1QSOA 3BXMA 3TOBA 4AG7A 2OU2A 4OMEA 5JQ4A 1GYTA 3FH4A 5HH1A 2D4PA 4CGMA 1K4JA 2ZEEA 1VKCA 2C6CA 1P4NA 2HUZA 2YNCC 3I9SA 3HLPA 1S5KA 3FF3A 4LX9A 1TKFA 4UEZA 4UIAA 2PIYA 4NGTA 1BO4A 3KGQA 4MY3A 2Z3NA 1Y0YA 3KQXA 4Q38A 3SXOA 1KUXA 2WPXA 2CNSA 2P6FA 1QSNA 3IWWA 1UWYA 3D2MA 2K5TA 3D7HA 5K8PA 4H2KA 4NSQA 1YSJA 4RUHA 7CPAA 1PUAA 4OADA 4NGRA 4W9YA 1BPMA 1IU8A 4R87A 2ZEGA 3RAMA 1B87A 4B5PA 2Q7SA 1Y7EA 2GLJA 1N71A 2VBQA 2ZW4A 3PEIA 4MHNA 4MMOA 2V8DA 2ZELA 3NH4A 1J4JA 5ISVA 1IB1E 4I49A 1VHSA 2WZNA 1M4GA 5K8NA 3FIXA 1HDQA 1Y0RA 4R3LA 1M4DA 5LYDA 2Q0YA 1Q2CA 3BLNA 5EBVA 3IU1A 2ZXVA 4K30A 2BEIA 3S6HA 2RFHA 5IX3A 1R43A 2F8HA 2HB6A 3SI1A 3BI1A 4P4EA 1S7FA 2PR1A 2YNDA 3BJ8A 2ABZA 3CPXA 4CYOA 1YW4A 2FCKA 5F48A 4BBHA 4MCRA 2Q7BA 3TFYA 1S7NA 2QMLA 3I3GA 3KQZA 5HVHA 2B3UA 1ZG7A 2WSAA 4Q7AA 4RN7A 3ISXA 3KZWA 3P2FA 4OC0A 3UY5A 4QBJA 3GUXA 1MJ9A 2PJAA 3PB8X 1XEBA 4P6YA 2FXFA 4MCQA 2B5GB 1BPNA 1BAVA 5D8NA 2Z3LA
chains in the Genus database with same CATH topology
4MHDA 3JUWA 2IL4A 2GANA 4XNHB 2BUEA 1Z9UA 4RS2A 4CAFA 5A28A 4CRZB 4F6AA 2I79A 3R96A 4CYPA 3F5BA 4KS9A 4C7HA 3TO7A 5AG5A 2R98A 2ZW6A 4NEXA 2JDCA 4M85A 3P2HA 3WR7A 2BSWA 3LD2A 4EVYA 4MFZA 2CY2A 5G22A 1NMTA 4KSFA 3D2PA 3W6SA 2VXKA 2DPTA 1WWZA 1KUVA 3IU2A 4E0AA 2FL4A 2KCWA 3EC4A 3MGDA 4A31A 5AG4A 5H86A 3EY5A 3TCVA 2Q04A 4OLLA 3W6XA 4KOUA 3D8PA 2FS5A 4KOXA 2JLMA 4PV6A 2OH1A 1Y9WA 3PP9A 4QB9A 5H84A 4AVCA 1YVKA 4KZTA 1MJAA 2PDOA 3D3SA 4F0XA 2AJ6A 3GY9A 4MFQA 2FSRA 4F0YA 1I12A 4UFXA 4C7IA 2FIAA 2B4DA 4CGOA 3JVNA 4AG9A 5FVJA 2YNEA 5BWAB 3VWDA 1YK3A 2GE3A 3SXNA 3G3SA 2AE6A 4UFWA 3FB3A 4ORFA 2REEA 4CAXA 3W91A 3CXQA 1YVOA 1IIDA 3CXPA 1XMTA 4B5OA 5F46A 4PSXA 4UA3A 4PK3A 2QECA 4C2XA 1Q2YA 2HV2A 4QC6A 3VWEA 3V8IA 5J8CA 2Z11A 1IYKA 1I1DA 2B4DB 3EO4A 2CXAA 4B12A 4KOSA 4QUSA 1QSRA 4CGNA 1I21A 2Z3PA 4A2ZA 3IGRA 3S6FA 1CJWA 2R8VA 4U9ZA 2OB0A 4OAEA 5JPHA 3R9EA 4PK2A 4B11A 1OZPA 4KUBA 2Q44A 5C82A 2VI7A 1YREA 2ARHA 5G1ZA 5AGEA 2Z3OA 1XF8A 1YX0A 1YGHA 2OZUA 3R95A 3TT2A 2X7BA 2HQYA 3H4QA 4KLWA 4A33A 4KOVA 4R3KA 3S6GA 1XIXA 2J8RA 4CAEA 4BMHA 2G3TA 3LODA 4CYNA 4B5PB 4KVME 3FRMA 3T9YA 1S60A 3FNCA 4JWPA 1CM0A 5KTDA 2PC1A 3DSBA 4MFPA 2PQ8A 2J8MA 4MBUA 4XPDC 2Q4YA 4R9MA 2ZW7A 3A9LA 4ONUA 1SQHA 5F49A 4FD5A 2REFA 2EUIA 1P0HA 5AG6A 3FXTA 4UWIA 4MFKA 4A30A 1R57A 4Y49C 1YLEA 3DNSA 4A95A 1RO5A 3SHPA 1QSMA 4JJXA 4UFVA 2QIRA 3CXSA 1UFHA 3IWGA 1NE9A 4KSAA 2JDDA 4JLYA 2B3VA 2JEVA 1MJBA 2P0WA 5KTCA 2O28A 3FBUA 5KTAA 2C27A 5CNPA 2RC4A 3JTKA 5G20A 4UWJA 4H6ZA 1IICA 3GKRA 3RYOA 5DWMA 3TOAA 4XPLA 2NMTA 2P6EA 3TO6A 1KZFA 2Z3KA 4B13A 4DNCA 1TIQA 2WPWA 3IWEA 2CNMA 2YGWA 4QVTA 3EFAA 1S7LA 4KOWA 4GS4A 5AG7A 4Q36A 4HNYB 2Z0ZA 1KUYA 4HKFA 4R57A 3T90A 4M3SA 1Z4RA 3TO9A 1M1DA 1L0CA 4B14A 1Q2DA 3R1KA 5IB0A 4UCMA 2OZGA 4II9A 1Y9KA 4PSWA 2WUUA 5GCNA 2VEZA 4LUAA 1Y7RA 3F8KA 5F47A 3S6KA 2VQYA 1Z4EA 3H5ZA 4AVBA 3ZZIA 5A27A 3KKWA 4L89A 3PZJA 4CAVA 4ZGYB 2F5IA 4B10A 4U5YA 2PRBA 4H89A 3OWCA 2R7HA 2PSWA 4FD6A 2DPSA 2B5GA 2DXQA 2Z10A 4H6UA 2D4OA 4HNXB 4MFLA 1S7KA 5DWNA 4CYQA 1FY7A 4MY0A 4C2YA 1YR0A 3R9GA 2H5MA 4XPKA 2ZW5A 4YGOA 2B58A 4KVXA 5G21A 2P6GA 4CS0B 4E2AA 2FE7A 4MFJA 1PU9A 3ZJ0A 4XPDB 4FD4A 5I0CA 3EXNA 3TE4A 5IV0A 3B8GA 4KOTA 4MJ8A 2Y0MA 2CNTA 2G3AA 4Y49B 2B4BA 4RI1A 3E0KA 4YFJA 4YRHA 4IUSA 2G0BA 4U9YA 1ZO0A 3DR6A 2FT0A 3C26A 1IYLA 1ON0A 1BOBA 2OZHA 4JXRA 3QB8A 4A32A 4UCPA 2A4NA 4C68A 3DDDA 4X5KA 3BJ7A 3QAHA 3PGPA 3FYNA 4CAWA 5HMNA 4KVOE 2Z3MA 4NCZA 4XNHC 3R9FA 4J3GA 1S3ZA 5EC4A 3TTHA 4MI4A 2VZYA 2VZZA 5C88A 3GYAA 4E8OA 4NF1A 4AVAA 4JXQA 2YNCA 4KOYA 1GHEA 4CRYB 2ATRA 2R1IA 4L8AA 4ZBGA 4C2ZA 4HNWB 3NE7A 1MK4A 5J8FA 4IF5A 4KLVA 2I00A 4KUAA 2FIWA 4CGLA 2GIVA 4UCNA 4UBRA 1XE4A 2Q4VA 2J8NA 2BL1A 1RXTA 1NSLA 1U6MA 3N7ZA 1V0CA 3G8WA 1LRZA 1QSTA 4JD6A 3F0AA 5E96A 4KORA 1WK4A 2ZPAA 1B6BA 3K9UA 4NXYA 4CGPA 4AB7A 1M44A 2PR8A 2EVNA 4FD7A 3DR8A 1QSOA 3TOBA 4AG7A 2OU2A 5JQ4A 5HH1A 2D4PA 4CGMA 1K4JA 1VKCA 2HUZA 1P4NA 2YNCC 3I9SA 1S5KA 4LX9A 1BO4A 4MY3A 2Z3NA 3SXOA 4Q38A 1KUXA 2WPXA 2CNSA 2P6FA 1QSNA 3D2MA 2K5TA 4NSQA 1PUAA 4OADA 4R87A 4B5PA 1B87A 2ZW4A 2VBQA 1N71A 1J4JA 5ISVA 1IB1E 4I49A 1VHSA 1M4GA 3FIXA 4R3LA 1M4DA 2Q0YA 1Q2CA 3BLNA 5EBVA 3IU1A 2ZXVA 4K30A 2BEIA 3S6HA 5IX3A 1S7FA 2PR1A 2YNDA 3BJ8A 4CYOA 2FCKA 5F48A 4BBHA 2Q7BA 3TFYA 1S7NA 2QMLA 3I3GA 2B3UA 2WSAA 3P2FA 3UY5A 4QBJA 1MJ9A 1XEBA 2FXFA 2B5GB 1M4IA 2Z3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHD A;  3JUW A;  2IL4 A;  2GAN A;  4XNH B;  2BUE A;  1Z9U A;  4RS2 A;  4CRZ B;  4F6A A;  2I79 A;  3R96 A;  3F5B A;  3TO7 A;  2R98 A;  2ZW6 A;  4NEX A;  2JDC A;  4M85 A;  3P2H A;  3WR7 A;  2BSW A;  3LD2 A;  4EVY A;  2CY2 A;  1NMT A;  3D2P A;  3W6S A;  2VXK A;  1WWZ A;  1KUV A;  4E0A A;  2FL4 A;  2KCW A;  3EC4 A;  3MGD A;  5H86 A;  3EY5 A;  3TCV A;  2Q04 A;  4OLL A;  3W6X A;  4KOU A;  3D8P A;  2FS5 A;  4KOX A;  2JLM A;  4PV6 A;  2OH1 A;  1Y9W A;  3PP9 A;  4QB9 A;  5H84 A;  4AVC A;  1YVK A;  4KZT A;  1MJA A;  2PDO A;  3D3S A;  2AJ6 A;  3GY9 A;  2FSR A;  4F0Y A;  1I12 A;  2FIA A;  2B4D A;  3JVN A;  4AG9 A;  5FVJ A;  3VWD A;  1YK3 A;  2GE3 A;  3SXN A;  3G3S A;  2AE6 A;  3FB3 A;  4ORF A;  2REE A;  4CAX A;  3W91 A;  3CXQ A;  1YVO A;  1IID A;  3CXP A;  1XMT A;  4B5O A;  5F46 A;  4PSX A;  4UA3 A;  4PK3 A;  2QEC A;  1Q2Y A;  2HV2 A;  4QC6 A;  3VWE A;  3V8I A;  5J8C A;  2Z11 A;  1IYK A;  1I1D A;  2B4D B;  3EO4 A;  4KOS A;  4QUS A;  1QSR A;  1I21 A;  3IGR A;  3S6F A;  1CJW A;  2R8V A;  4U9Z A;  2OB0 A;  4OAE A;  5JPH A;  3R9E A;  4PK2 A;  1OZP A;  4KUB A;  2Q44 A;  5C82 A;  2VI7 A;  1YRE A;  2ARH A;  1XF8 A;  1YX0 A;  1YGH A;  2OZU A;  3R95 A;  3TT2 A;  2X7B A;  2HQY A;  3H4Q A;  4KLW A;  4KOV A;  4R3K A;  3S6G A;  1XIX A;  2J8R A;  4BMH A;  2G3T A;  3LOD A;  4B5P B;  4KVM E;  3FRM A;  3T9Y A;  1S60 A;  3FNC A;  4JWP A;  1CM0 A;  5KTD A;  2PC1 A;  3DSB A;  2PQ8 A;  2J8M A;  4MBU A;  4XPD C;  2Q4Y A;  4R9M A;  2ZW7 A;  4ONU A;  1SQH A;  5F49 A;  4FD5 A;  2REF A;  2EUI A;  1P0H A;  3FXT A;  4UWI A;  1R57 A;  4Y49 C;  1YLE A;  3DNS A;  1RO5 A;  3SHP A;  1QSM A;  4JJX A;  2QIR A;  3CXS A;  1UFH A;  3IWG A;  1NE9 A;  2JDD A;  4JLY A;  2B3V A;  2JEV A;  1MJB A;  2P0W A;  5KTC A;  2O28 A;  3FBU A;  5KTA A;  2C27 A;  5CNP A;  2RC4 A;  4UWJ A;  4H6Z A;  1IIC A;  3GKR A;  3RYO A;  5DWM A;  3TOA A;  4XPL A;  2NMT A;  2P6E A;  3TO6 A;  1KZF A;  4DNC A;  1TIQ A;  2WPW A;  2CNM A;  4QVT A;  3EFA A;  1S7L A;  4KOW A;  4GS4 A;  4HNY B;  2Z0Z A;  1KUY A;  4HKF A;  4R57 A;  4M3S A;  1Z4R A;  3TO9 A;  1M1D A;  1L0C A;  1Q2D A;  3R1K A;  5IB0 A;  2OZG A;  4II9 A;  1Y9K A;  4PSW A;  5GCN A;  2VEZ A;  4LUA A;  1Y7R A;  3F8K A;  5F47 A;  3S6K A;  2VQY A;  1Z4E A;  4AVB A;  3ZZI A;  3KKW A;  4L89 A;  3PZJ A;  4CAV A;  2F5I A;  4U5Y A;  2PRB A;  4H89 A;  3OWC A;  2R7H A;  2PSW A;  4FD6 A;  2B5G A;  2DXQ A;  2Z10 A;  4H6U A;  2D4O A;  4HNX B;  1S7K A;  5DWN A;  1FY7 A;  4MY0 A;  1YR0 A;  3R9G A;  2H5M A;  4XPK A;  2ZW5 A;  4YGO A;  2B58 A;  4KVX A;  2P6G A;  4CS0 B;  4E2A A;  2FE7 A;  3ZJ0 A;  1PU9 A;  4XPD B;  4FD4 A;  5I0C A;  3EXN A;  3TE4 A;  5IV0 A;  3B8G A;  4KOT A;  4MJ8 A;  2Y0M A;  2CNT A;  2G3A A;  4Y49 B;  2B4B A;  4RI1 A;  3E0K A;  4YFJ A;  4YRH A;  4IUS A;  2G0B A;  4U9Y A;  3DR6 A;  2FT0 A;  3C26 A;  1IYL A;  1ON0 A;  1BOB A;  2OZH A;  4JXR A;  3QB8 A;  2A4N A;  3DDD A;  4X5K A;  3BJ7 A;  3QAH A;  3PGP A;  3FYN A;  4CAW A;  5HMN A;  4KVO E;  4NCZ A;  4XNH C;  3R9F A;  4J3G A;  1S3Z A;  5EC4 A;  3TTH A;  4MI4 A;  2VZY A;  2VZZ A;  5C88 A;  3GYA A;  4E8O A;  4NF1 A;  4AVA A;  4JXQ A;  4KOY A;  1GHE A;  4CRY B;  2ATR A;  2R1I A;  4L8A A;  4ZBG A;  4HNW B;  3NE7 A;  1MK4 A;  5J8F A;  4IF5 A;  4KLV A;  2I00 A;  4KUA A;  2FIW A;  2GIV A;  4UBR A;  1XE4 A;  2Q4V A;  2J8N A;  2BL1 A;  1RXT A;  1NSL A;  1U6M A;  3N7Z A;  1V0C A;  3G8W A;  1LRZ A;  1QST A;  4JD6 A;  3F0A A;  5E96 A;  4KOR A;  1WK4 A;  2ZPA A;  1B6B A;  3K9U A;  4NXY A;  4AB7 A;  1M44 A;  2PR8 A;  2EVN A;  4FD7 A;  3DR8 A;  1QSO A;  3TOB A;  4AG7 A;  2OU2 A;  5JQ4 A;  5HH1 A;  2D4P A;  1K4J A;  1VKC A;  2HUZ A;  1P4N A;  3I9S A;  1S5K A;  4LX9 A;  1BO4 A;  4MY3 A;  3SXO A;  1KUX A;  2WPX A;  2CNS A;  2P6F A;  1QSN A;  3D2M A;  2K5T A;  4NSQ A;  1PUA A;  4OAD A;  4R87 A;  4B5P A;  1B87 A;  2ZW4 A;  2VBQ A;  1N71 A;  1J4J A;  5ISV A;  1IB1 E;  4I49 A;  1VHS A;  1M4G A;  3FIX A;  4R3L A;  1M4D A;  2Q0Y A;  1Q2C A;  3BLN A;  5EBV A;  4K30 A;  2ZXV A;  2BEI A;  3S6H A;  5IX3 A;  1S7F A;  2PR1 A;  3BJ8 A;  2FCK A;  5F48 A;  2Q7B A;  3TFY A;  1S7N A;  2QML A;  3I3G A;  2B3U A;  3P2F A;  3UY5 A;  4QBJ A;  1MJ9 A;  1XEB A;  2FXF A;  2B5G B;  1M4I A;  3T90 A; 
#chains in the Genus database with same CATH topology
 4MHD A;  3JUW A;  4CPA A;  2IL4 A;  2GAN A;  4XNH B;  2BUE A;  1Z9U A;  3KR5 A;  4RS2 A;  4CAF A;  5A28 A;  4CRZ B;  4F6A A;  4MCS A;  1DE4 C;  2I79 A;  3R96 A;  4CYP A;  1VGY A;  5DS0 A;  3F5B A;  4KS9 A;  4C7H A;  3TO7 A;  5AG5 A;  1JQG A;  2R98 A;  2ZW6 A;  4NEX A;  2HC9 A;  2JDC A;  4M85 A;  3P2H A;  3K2K A;  3WR7 A;  4OC5 A;  2BSW A;  3LD2 A;  4EVY A;  4MFZ A;  2CY2 A;  3H8E A;  5G22 A;  1NMT A;  4KSF A;  3D2P A;  2NYQ A;  3W6S A;  1IOF A;  2DPT A;  2VXK A;  1WWZ A;  1KUV A;  3B7I A;  3IU2 A;  4JYW A;  4A37 A;  4E0A A;  1X10 A;  2FL4 A;  2KCW A;  3EC4 A;  3MGD A;  3PFO A;  4OC2 A;  4P4J A;  3DGV A;  3D7F A;  3B3W A;  4A31 A;  5AG4 A;  1EE3 P;  2V8V A;  3EY5 A;  5H86 A;  3TCV A;  2Q04 A;  4OLL A;  2PJ5 A;  3WC7 A;  5HXD A;  4WJB A;  5JM6 A;  1LFW A;  1VHO A;  3W6X A;  4KOU A;  3D8P A;  2OR4 A;  2FS5 A;  4KOX A;  1ZG9 A;  2JLM A;  4PV6 A;  3TX8 A;  2VL1 A;  4R6T A;  4AXV A;  3FEC A;  2OH1 A;  5HVG A;  1Y9W A;  2PCU A;  3D67 A;  3MRU A;  3PP9 A;  4QB9 A;  5H84 A;  2QVP A;  3FJU A;  4AVC A;  1YVK A;  4KZT A;  1MJA A;  2PDO A;  3D3S A;  5LRG A;  4F0X A;  2ZEM A;  2AJ6 A;  4EME A;  3GY9 A;  4MFQ A;  2FSR A;  4F0Y A;  1I12 A;  4UFX A;  4C7I A;  2FIA A;  2EWB A;  2B4D A;  4CGO A;  2GFQ A;  3B2Y A;  3JVN A;  4UIB A;  4AG9 A;  5FVJ A;  2PJ8 A;  2YNE A;  5BWA B;  3VWD A;  1YK3 A;  2GE3 A;  2JBJ A;  3SXN A;  3G3S A;  4UF4 A;  2AE6 A;  4UFW A;  3FB3 A;  4ORF A;  2AFS A;  3SJE A;  2REE A;  4CAX A;  1ZG8 A;  3W91 A;  1YLO A;  3CXQ A;  2PJ2 A;  3NH5 A;  1OBR A;  2Q43 A;  2XEG A;  3BHX A;  5JGF A;  1YVO A;  2JEW A;  3D7D A;  2C6P A;  4FUU A;  1IID A;  3CXP A;  4NGP A;  4GXH A;  4M6I A;  4F9V A;  1XMT A;  3RNZ A;  2OOT A;  3K9T A;  4B5O A;  1LOK A;  4OC1 A;  4P45 A;  5F46 A;  4PSX A;  4UA3 A;  4PK3 A;  5CPA A;  2QEC A;  4C2X A;  1Q2Y A;  4EWT A;  4F9U A;  4G1P A;  1Q7L A;  1ARM A;  2HV2 A;  2ZEO A;  3S9M A;  4QC6 A;  4X3R A;  4ZYQ A;  3VWE A;  3B3C A;  3V8I A;  2Z11 A;  5J8C A;  5CBM A;  3PBE A;  4BD9 A;  1IYK A;  1I1D A;  2B4D B;  3D7G A;  2CXA A;  3EO4 A;  4B12 A;  4KOS A;  1F2O A;  4F8Z A;  2Q4Z A;  4QUS A;  1FNO A;  1QSR A;  4IK2 A;  4B6Z A;  4CGN A;  4MRI A;  3VH9 A;  2QYV A;  3GLJ A;  3D68 A;  1I21 A;  2Z3P A;  2EK8 A;  4A2Z A;  2CIJ A;  3IGR A;  3S6F A;  1CJW A;  1LAN A;  3D66 A;  4IHM A;  2R8V A;  4U9Z A;  2OB0 A;  4OAE A;  2FVG A;  3PFE A;  5JPH A;  3IIB A;  3R9E A;  4PK2 A;  4B11 A;  1OZP A;  4KUB A;  2PJ4 A;  3ISZ A;  2Q44 A;  5C82 A;  2VI7 A;  1NSA A;  1YRE A;  2ARH A;  5G1Z A;  5AGE A;  3SI2 A;  2Z3O A;  3T8W A;  1XF8 A;  1HDU A;  1YX0 A;  4OC4 A;  4ZY0 A;  1YGH A;  2OZU A;  3R95 A;  3TT2 A;  2X7B A;  2HQY A;  3H4Q A;  2V8G A;  1QQ9 A;  1YME A;  4KLW A;  4A33 A;  4KOV A;  3WC6 A;  2BO9 A;  2GLF A;  4YWY A;  1ELL P;  4R3K A;  3S6G A;  5LRK A;  1XIX A;  1TF9 A;  4Z65 A;  2J8R A;  4CAE A;  4DJL A;  4MCP A;  2V77 A;  4BMH A;  2G3T A;  3QNV A;  3LOD A;  2AFW A;  4B5P B;  4CYN A;  4KVM E;  3DLJ A;  3FRM A;  3T9Y A;  1S60 A;  3FNC A;  4JWP A;  1XJO A;  4MHY A;  1CM0 A;  5KTD A;  4PXB A;  2PC1 A;  1XBU A;  3DSB A;  4OKO A;  4MFP A;  2PQ8 A;  2J8M A;  3VAR A;  4FBE A;  4R8F A;  4MBU A;  2CF4 A;  4XPD C;  2Q4Y A;  4R9M A;  1TF8 A;  1CP7 A;  2ZW7 A;  1H8L A;  1M4I A;  1Z5R A;  1F2P A;  1YW6 A;  3A9L A;  4ONU A;  3LWU A;  1SQH A;  3PB4 X;  5F49 A;  4HPS A;  4FD5 A;  1TKJ A;  2EUI A;  2REF A;  1P0H A;  5AG6 A;  1M4L A;  2PJ3 A;  2ZEP A;  3FXT A;  3PB7 X;  4UWI A;  4MFK A;  1CPS A;  1VHE A;  4A30 A;  4UEF A;  1TXR A;  1R57 A;  4OIW A;  3B35 A;  2ZEN A;  4Y49 C;  1YLE A;  4LQG A;  4OID A;  3KHX A;  3DNS A;  4A95 A;  1RO5 A;  1XOV A;  3SHP A;  1QSM A;  1QMU A;  2C6G A;  4JJX A;  3KL9 A;  4OP4 A;  2QIR A;  3NFZ A;  3CXS A;  4UFV A;  8CPA A;  1UFH A;  1HEE A;  4NGN A;  1TKH A;  3IWG A;  1JWQ A;  1NE9 A;  4KSA A;  5D29 A;  3BI0 A;  2JDD A;  4X8I A;  4NGQ A;  1YQE A;  4JLY A;  2B3V A;  2JEV A;  1IOI A;  1MJB A;  3FVL A;  2P0W A;  5K8M A;  5KTC A;  1VIX A;  2O28 A;  3FBU A;  5KTA A;  2C27 A;  3HUV A;  2RC4 A;  1CP6 A;  2AFM A;  3JTK A;  5CNP A;  2Q51 A;  5G20 A;  4UWJ A;  4H6Z A;  1IIC A;  3GKR A;  3RBU A;  3VAT A;  4P10 A;  3S9L A;  2DF5 A;  3RYO A;  5DWM A;  3TOA A;  4NGM A;  4UEE A;  4XPL A;  3CT9 A;  2J9A A;  2F7V A;  2NMT A;  2P6E A;  3WC5 A;  3TO6 A;  1KZF A;  2Z3K A;  4B13 A;  4DNC A;  1FT7 A;  1TIQ A;  3LMS A;  4PXC A;  1AUG A;  1IGB A;  2WPW A;  6CPA A;  3H8F A;  3IWE A;  2CNM A;  2YGW A;  1LAP A;  3GB0 A;  2ZEH A;  4QVT A;  3EFA A;  1ZLI A;  1CPX A;  1S7L A;  4KOW A;  4GS4 A;  4ZX9 A;  5AG7 A;  4Q36 A;  4HNY B;  1Z8T A;  1KUY A;  2Z0Z A;  2PE3 A;  4HKF A;  4R57 A;  2IJZ A;  4M3S A;  4P4B A;  4ZY2 A;  3T90 A;  1Z4R A;  3IC1 A;  4OC3 A;  3TO9 A;  2IMO A;  1M1D A;  1L0C A;  4NFR A;  4JZ0 A;  4P4D A;  4B14 A;  1Q2D A;  3R1K A;  2AFO A;  5IB0 A;  1CX8 A;  1XFO A;  2GRE A;  2OZG A;  4UCM A;  4II9 A;  1Y9K A;  4PSW A;  2WUU A;  5GCN A;  2VEZ A;  4LUA A;  1RTQ A;  5IB9 A;  1Y7R A;  1XMB A;  3WAB A;  3F8K A;  5F47 A;  2XEI A;  3S6K A;  2VQY A;  1Z4E A;  4A38 A;  3H5Z A;  4IAV A;  4AVB A;  3ZZI A;  5A27 A;  3KHZ A;  2WYR A;  2ZOG A;  4MHZ A;  4M6H A;  3KKW A;  3CDX A;  4L89 A;  2POK A;  3PB6 X;  3PZJ A;  4NGS A;  4CAV A;  3D4U A;  4ZGY B;  3TC8 A;  2ODF A;  2F5I A;  3IFE A;  1F57 A;  3FEE A;  4X2T A;  4B10 A;  3CPA A;  4U5Y A;  2PRB A;  3RO0 A;  2G9D A;  3I1U A;  3OWC A;  4H89 A;  2R7H A;  2PSW A;  4MXU A;  2PJB A;  4YU9 A;  5LYF A;  4FD6 A;  1PYT B;  2DPS A;  2B5G A;  3S9N A;  2DXQ A;  2Z10 A;  4H6U A;  3V38 A;  2D4O A;  4HNX B;  4MFL A;  3SJF A;  1S7K A;  4A39 A;  5DWN A;  3PB9 X;  2I3C A;  4CYQ A;  1FY7 A;  4MY0 A;  4C2Y A;  2C1C A;  1YR0 A;  3SJG A;  3WT4 A;  1ELM P;  3R9G A;  5ELY A;  2H5M A;  3RZA A;  4XPK A;  5LRJ A;  1Z8X A;  2ZW5 A;  4YGO A;  2B58 A;  4KVX A;  5G21 A;  2P6G A;  4CS0 B;  2PIZ A;  2FE7 A;  2XEJ A;  1PU9 A;  4MFJ A;  4XPD B;  3ZJ0 A;  4E2A A;  4R7M A;  4EFD A;  3FMC A;  1Z8L A;  4FD4 A;  3SJX A;  5I0C A;  4MHP A;  3SI0 A;  1ZLH A;  3EXN A;  3TE4 A;  2EO8 A;  5IV0 A;  3B8G A;  2NSM A;  2PJ9 A;  4KOT A;  4NJR A;  2ZEF A;  2BCO A;  2PJ6 A;  2Y0M A;  4MJ8 A;  5THW A;  1KWM A;  2CNT A;  1LCP A;  2G3A A;  3CZX A;  3LAC A;  4Y49 B;  2AFZ A;  2B4B A;  4PXE A;  4RI1 A;  1AYE A;  3E0K A;  1LAM A;  4YRH A;  2QJ8 A;  4ZX8 A;  4FAI A;  4YFJ A;  4IUS A;  2G0B A;  3FED A;  4U9Y A;  4WWV A;  2PJ1 A;  2EK9 A;  1ZO0 A;  3KR4 A;  2ZOF A;  3DR6 A;  2FT0 A;  3B3T A;  3C26 A;  3PRT A;  3H8G A;  1IYL A;  1ON0 A;  3IEH A;  1BOB A;  2OZH A;  4JXR A;  3QB8 A;  4A32 A;  1BLL E;  1Z2L A;  4KSI A;  4UCP A;  1AMP A;  2A4N A;  4C68 A;  3DDD A;  4X5K A;  3BJ7 A;  4FWU A;  3QAH A;  5I4M A;  2PJC A;  3FYN A;  3JRU A;  3PGP A;  3N5F A;  4CAW A;  5HMN A;  4KVO E;  2Z3M A;  4M6G A;  2JBK A;  3B3V A;  4NCZ A;  4XNH C;  5JH9 A;  3R9F A;  4J3G A;  1S3Z A;  5EC4 A;  4PQA A;  3TTH A;  4DUK A;  2CTB A;  4MI4 A;  2VZY A;  4GM5 A;  2VZZ A;  5C88 A;  2O4H A;  3IO1 A;  2ZED A;  4NJQ A;  5LYI A;  3GYA A;  4E8O A;  1CG2 A;  4NF1 A;  4ZY1 A;  2AFU A;  3L2N A;  4AVA A;  4JXQ A;  1PCA A;  2GU2 A;  3GIU A;  2ANP A;  3MN8 A;  2YNC A;  4O23 A;  3FX6 A;  5LYL A;  4PXD A;  4P4I A;  1ARL A;  4KOY A;  1GHE A;  4CRY B;  2ATR A;  2DEA A;  3PBB A;  2R1I A;  3B3S A;  3NH8 A;  2IQ6 A;  2PJ0 A;  4A94 A;  3KI9 A;  4L8A A;  4R76 A;  5F09 A;  4P4F A;  5J1Q A;  4ZBG A;  1Z8W A;  4BIN A;  4DYO A;  2XEF A;  4C2Z A;  4HNW B;  2CTC A;  3NE7 A;  1MK4 A;  5J8F A;  1X12 A;  1XRY A;  3NE8 A;  2EBJ A;  4IF5 A;  4KLV A;  2I00 A;  4LQ6 A;  2PVW A;  4KUA A;  4P44 A;  2FIW A;  3IJ3 A;  2AFX A;  2GIV A;  1IY7 A;  4UCN A;  4CGL A;  1A2Z A;  2PJ7 A;  3V7Z A;  4PPZ A;  4UBR A;  4TNU A;  1XE4 A;  2Q4V A;  3NA6 A;  2J8N A;  2BL1 A;  2O53 A;  1RXT A;  4TWE A;  2BOA A;  1DTD A;  1NSL A;  1U6M A;  3N7Z A;  1V0C A;  2PVV A;  3G8W A;  1LRZ A;  1CBX A;  1QST A;  2PRQ A;  2RB7 A;  3F0A A;  4JD6 A;  4K3N A;  5E96 A;  5EMI A;  4KOR A;  1WK4 A;  2ZPA A;  1R3N A;  1B6B A;  5HVF A;  4ONW A;  3K9U A;  4NXY A;  4CGP A;  3KAS A;  3QAY A;  4AB7 A;  1M44 A;  4ZI6 A;  5K8O A;  2PR8 A;  2EVN A;  2V8H A;  4FD7 A;  3DR8 A;  1QSO A;  3BXM A;  3TOB A;  4AG7 A;  2OU2 A;  4OME A;  5JQ4 A;  1GYT A;  3FH4 A;  5HH1 A;  2D4P A;  4CGM A;  1K4J A;  2ZEE A;  1VKC A;  2C6C A;  1P4N A;  2HUZ A;  2YNC C;  3I9S A;  3HLP A;  1S5K A;  3FF3 A;  4LX9 A;  1TKF A;  4UEZ A;  4UIA A;  2PIY A;  4NGT A;  1BO4 A;  3KGQ A;  4MY3 A;  2Z3N A;  1Y0Y A;  3KQX A;  4Q38 A;  3SXO A;  1KUX A;  2WPX A;  2CNS A;  2P6F A;  1QSN A;  3IWW A;  1UWY A;  3D2M A;  2K5T A;  3D7H A;  5K8P A;  4H2K A;  4NSQ A;  1YSJ A;  4RUH A;  7CPA A;  1PUA A;  4OAD A;  4NGR A;  4W9Y A;  1BPM A;  1IU8 A;  4R87 A;  2ZEG A;  3RAM A;  1B87 A;  4B5P A;  2Q7S A;  1Y7E A;  2GLJ A;  1N71 A;  2VBQ A;  2ZW4 A;  3PEI A;  4MHN A;  4MMO A;  2V8D A;  2ZEL A;  3NH4 A;  1J4J A;  5ISV A;  1IB1 E;  4I49 A;  1VHS A;  2WZN A;  1M4G A;  5K8N A;  3FIX A;  1HDQ A;  1Y0R A;  4R3L A;  1M4D A;  5LYD A;  2Q0Y A;  1Q2C A;  3BLN A;  5EBV A;  3IU1 A;  2ZXV A;  4K30 A;  2BEI A;  3S6H A;  2RFH A;  5IX3 A;  1R43 A;  2F8H A;  2HB6 A;  3SI1 A;  3BI1 A;  4P4E A;  1S7F A;  2PR1 A;  2YND A;  3BJ8 A;  2ABZ A;  3CPX A;  4CYO A;  1YW4 A;  2FCK A;  5F48 A;  4BBH A;  4MCR A;  2Q7B A;  3TFY A;  1S7N A;  2QML A;  3I3G A;  3KQZ A;  5HVH A;  2B3U A;  1ZG7 A;  2WSA A;  4Q7A A;  4RN7 A;  3ISX A;  3KZW A;  3P2F A;  4OC0 A;  3UY5 A;  4QBJ A;  3GUX A;  1MJ9 A;  2PJA A;  3PB8 X;  1XEB A;  4P6Y A;  2FXF A;  4MCQ A;  2B5G B;  1BPN A;  1BAV A;  5D8N A;  2Z3L A; 
#chains in the Genus database with same CATH homology
 4MHD A;  3JUW A;  2IL4 A;  2GAN A;  4XNH B;  2BUE A;  1Z9U A;  4RS2 A;  4CAF A;  5A28 A;  4CRZ B;  4F6A A;  2I79 A;  3R96 A;  4CYP A;  3F5B A;  4KS9 A;  4C7H A;  3TO7 A;  5AG5 A;  2R98 A;  2ZW6 A;  4NEX A;  2JDC A;  4M85 A;  3P2H A;  3WR7 A;  2BSW A;  3LD2 A;  4EVY A;  4MFZ A;  2CY2 A;  5G22 A;  1NMT A;  4KSF A;  3D2P A;  3W6S A;  2VXK A;  2DPT A;  1WWZ A;  1KUV A;  3IU2 A;  4E0A A;  2FL4 A;  2KCW A;  3EC4 A;  3MGD A;  4A31 A;  5AG4 A;  5H86 A;  3EY5 A;  3TCV A;  2Q04 A;  4OLL A;  3W6X A;  4KOU A;  3D8P A;  2FS5 A;  4KOX A;  2JLM A;  4PV6 A;  2OH1 A;  1Y9W A;  3PP9 A;  4QB9 A;  5H84 A;  4AVC A;  1YVK A;  4KZT A;  1MJA A;  2PDO A;  3D3S A;  4F0X A;  2AJ6 A;  3GY9 A;  4MFQ A;  2FSR A;  4F0Y A;  1I12 A;  4UFX A;  4C7I A;  2FIA A;  2B4D A;  4CGO A;  3JVN A;  4AG9 A;  5FVJ A;  2YNE A;  5BWA B;  3VWD A;  1YK3 A;  2GE3 A;  3SXN A;  3G3S A;  2AE6 A;  4UFW A;  3FB3 A;  4ORF A;  2REE A;  4CAX A;  3W91 A;  3CXQ A;  1YVO A;  1IID A;  3CXP A;  1XMT A;  4B5O A;  5F46 A;  4PSX A;  4UA3 A;  4PK3 A;  2QEC A;  4C2X A;  1Q2Y A;  2HV2 A;  4QC6 A;  3VWE A;  3V8I A;  5J8C A;  2Z11 A;  1IYK A;  1I1D A;  2B4D B;  3EO4 A;  2CXA A;  4B12 A;  4KOS A;  4QUS A;  1QSR A;  4CGN A;  1I21 A;  2Z3P A;  4A2Z A;  3IGR A;  3S6F A;  1CJW A;  2R8V A;  4U9Z A;  2OB0 A;  4OAE A;  5JPH A;  3R9E A;  4PK2 A;  4B11 A;  1OZP A;  4KUB A;  2Q44 A;  5C82 A;  2VI7 A;  1YRE A;  2ARH A;  5G1Z A;  5AGE A;  2Z3O A;  1XF8 A;  1YX0 A;  1YGH A;  2OZU A;  3R95 A;  3TT2 A;  2X7B A;  2HQY A;  3H4Q A;  4KLW A;  4A33 A;  4KOV A;  4R3K A;  3S6G A;  1XIX A;  2J8R A;  4CAE A;  4BMH A;  2G3T A;  3LOD A;  4CYN A;  4B5P B;  4KVM E;  3FRM A;  3T9Y A;  1S60 A;  3FNC A;  4JWP A;  1CM0 A;  5KTD A;  2PC1 A;  3DSB A;  4MFP A;  2PQ8 A;  2J8M A;  4MBU A;  4XPD C;  2Q4Y A;  4R9M A;  2ZW7 A;  3A9L A;  4ONU A;  1SQH A;  5F49 A;  4FD5 A;  2REF A;  2EUI A;  1P0H A;  5AG6 A;  3FXT A;  4UWI A;  4MFK A;  4A30 A;  1R57 A;  4Y49 C;  1YLE A;  3DNS A;  4A95 A;  1RO5 A;  3SHP A;  1QSM A;  4JJX A;  4UFV A;  2QIR A;  3CXS A;  1UFH A;  3IWG A;  1NE9 A;  4KSA A;  2JDD A;  4JLY A;  2B3V A;  2JEV A;  1MJB A;  2P0W A;  5KTC A;  2O28 A;  3FBU A;  5KTA A;  2C27 A;  5CNP A;  2RC4 A;  3JTK A;  5G20 A;  4UWJ A;  4H6Z A;  1IIC A;  3GKR A;  3RYO A;  5DWM A;  3TOA A;  4XPL A;  2NMT A;  2P6E A;  3TO6 A;  1KZF A;  2Z3K A;  4B13 A;  4DNC A;  1TIQ A;  2WPW A;  3IWE A;  2CNM A;  2YGW A;  4QVT A;  3EFA A;  1S7L A;  4KOW A;  4GS4 A;  5AG7 A;  4Q36 A;  4HNY B;  2Z0Z A;  1KUY A;  4HKF A;  4R57 A;  3T90 A;  4M3S A;  1Z4R A;  3TO9 A;  1M1D A;  1L0C A;  4B14 A;  1Q2D A;  3R1K A;  5IB0 A;  4UCM A;  2OZG A;  4II9 A;  1Y9K A;  4PSW A;  2WUU A;  5GCN A;  2VEZ A;  4LUA A;  1Y7R A;  3F8K A;  5F47 A;  3S6K A;  2VQY A;  1Z4E A;  3H5Z A;  4AVB A;  3ZZI A;  5A27 A;  3KKW A;  4L89 A;  3PZJ A;  4CAV A;  4ZGY B;  2F5I A;  4B10 A;  4U5Y A;  2PRB A;  4H89 A;  3OWC A;  2R7H A;  2PSW A;  4FD6 A;  2DPS A;  2B5G A;  2DXQ A;  2Z10 A;  4H6U A;  2D4O A;  4HNX B;  4MFL A;  1S7K A;  5DWN A;  4CYQ A;  1FY7 A;  4MY0 A;  4C2Y A;  1YR0 A;  3R9G A;  2H5M A;  4XPK A;  2ZW5 A;  4YGO A;  2B58 A;  4KVX A;  5G21 A;  2P6G A;  4CS0 B;  4E2A A;  2FE7 A;  4MFJ A;  1PU9 A;  3ZJ0 A;  4XPD B;  4FD4 A;  5I0C A;  3EXN A;  3TE4 A;  5IV0 A;  3B8G A;  4KOT A;  4MJ8 A;  2Y0M A;  2CNT A;  2G3A A;  4Y49 B;  2B4B A;  4RI1 A;  3E0K A;  4YFJ A;  4YRH A;  4IUS A;  2G0B A;  4U9Y A;  1ZO0 A;  3DR6 A;  2FT0 A;  3C26 A;  1IYL A;  1ON0 A;  1BOB A;  2OZH A;  4JXR A;  3QB8 A;  4A32 A;  4UCP A;  2A4N A;  4C68 A;  3DDD A;  4X5K A;  3BJ7 A;  3QAH A;  3PGP A;  3FYN A;  4CAW A;  5HMN A;  4KVO E;  2Z3M A;  4NCZ A;  4XNH C;  3R9F A;  4J3G A;  1S3Z A;  5EC4 A;  3TTH A;  4MI4 A;  2VZY A;  2VZZ A;  5C88 A;  3GYA A;  4E8O A;  4NF1 A;  4AVA A;  4JXQ A;  2YNC A;  4KOY A;  1GHE A;  4CRY B;  2ATR A;  2R1I A;  4L8A A;  4ZBG A;  4C2Z A;  4HNW B;  3NE7 A;  1MK4 A;  5J8F A;  4IF5 A;  4KLV A;  2I00 A;  4KUA A;  2FIW A;  4CGL A;  2GIV A;  4UCN A;  4UBR A;  1XE4 A;  2Q4V A;  2J8N A;  2BL1 A;  1RXT A;  1NSL A;  1U6M A;  3N7Z A;  1V0C A;  3G8W A;  1LRZ A;  1QST A;  4JD6 A;  3F0A A;  5E96 A;  4KOR A;  1WK4 A;  2ZPA A;  1B6B A;  3K9U A;  4NXY A;  4CGP A;  4AB7 A;  1M44 A;  2PR8 A;  2EVN A;  4FD7 A;  3DR8 A;  1QSO A;  3TOB A;  4AG7 A;  2OU2 A;  5JQ4 A;  5HH1 A;  2D4P A;  4CGM A;  1K4J A;  1VKC A;  2HUZ A;  1P4N A;  2YNC C;  3I9S A;  1S5K A;  4LX9 A;  1BO4 A;  4MY3 A;  2Z3N A;  3SXO A;  4Q38 A;  1KUX A;  2WPX A;  2CNS A;  2P6F A;  1QSN A;  3D2M A;  2K5T A;  4NSQ A;  1PUA A;  4OAD A;  4R87 A;  4B5P A;  1B87 A;  2ZW4 A;  2VBQ A;  1N71 A;  1J4J A;  5ISV A;  1IB1 E;  4I49 A;  1VHS A;  1M4G A;  3FIX A;  4R3L A;  1M4D A;  2Q0Y A;  1Q2C A;  3BLN A;  5EBV A;  3IU1 A;  2ZXV A;  4K30 A;  2BEI A;  3S6H A;  5IX3 A;  1S7F A;  2PR1 A;  2YND A;  3BJ8 A;  4CYO A;  2FCK A;  5F48 A;  4BBH A;  2Q7B A;  3TFY A;  1S7N A;  2QML A;  3I3G A;  2B3U A;  2WSA A;  3P2F A;  3UY5 A;  4QBJ A;  1MJ9 A;  1XEB A;  2FXF A;  2B5G B;  1M4I A;  2Z3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...