3P2FA

Crystal structure of tofi in an apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
175
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein
molecule keywords AHL synthase
total genus 52
structure length 175
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2fA00
2HV2A 2OB0A 2Z0ZA 2Q7BA 1P4NA 1MJAA 4H89A 4NXYA 1YGHA 4KOSA 2ZPAA 4K30A 4ORFA 1M44A 5IV0A 4H6ZA 2CNMA 4MBUA 3EFAA 4QB9A 3I3GA 2VI7A 5H86A 4MY3A 3D2MA 2P6GA 1GHEA 3FB3A 4JXRA 1NE9A 2Z11A 3F5BA 3F8KA 4I49A 1VKCA 1I1DA 3C26A 4R87A 4RS2A 4QC6A 4CRZB 2G0BA 3VWEA 1PU9A 3PGPA 1MK4A 4KVME 2ZW5A 3FIXA 2B58A 2NMTA 2JDDA 4J3GA 4JJXA 2Q4VA 3GYAA 4HNXB 4KVXA 3JVNA 5HH1A 3SXOA 5JPHA 3FYNA 2B5GB 3TTHA 3T9YA 1S7KA 2O28A 4PK2A 2D4OA 3S6GA 3R95A 4OAEA 4II9A 5E96A 4MY0A 3DNSA 3FNCA 5F46A 5C82A 4X5KA 2CNTA 4KOVA 2EUIA 2QECA 3DR8A 2WPWA 1TIQA 3G3SA 1B87A 4AB7A 4MHDA 2Y0MA 4ONUA 4E8OA 5FVJA 1YR0A 1XE4A 2VQYA 4RI1A 3NE7A 4KLWA 3TE4A 2PSWA 5JQ4A 3WR7A 1VHSA 4QVTA 2IL4A 4JD6A 3R9EA 2BUEA 4KUAA 3TO9A 4YRHA 1IIDA 4KORA 3W6XA 1Q2CA 4HKFA 1Y9KA 2B3UA 2OZGA 4L8AA 1Q2DA 5KTDA 2R1IA 2EVNA 1OZPA 1YLEA 5HMNA 1I12A 4HNYB 4UWIA 4CAXA 4QBJA 3SXNA 1IYKA 2QMLA 2F5IA 4EVYA 4XPKA 1Z4RA 3EC4A 4XPDC 3CXQA 3MGDA 2Q0YA 3GKRA 4B5PA 2R8VA 2VXKA 4Y49C 1RO5A 1S7LA 4CAVA 4E0AA 4KOWA 1UFHA 4M3SA 2Z10A 2D4PA 1I21A 1CJWA 4HNWB 3S6KA 1M1DA 3QB8A 3RYOA 1YVKA 4GS4A 2BEIA 1M4DA 3EO4A 2FSRA 1MJ9A 4CS0B 3SHPA 1S7NA 3FBUA 2FCKA 3W91A 1N71A 1M4GA 1LRZA 4L89A 4AVBA 1R57A 1Y7RA 4F6AA 2JDCA 3F0AA 2FIWA 4KVOE 2KCWA 2WPXA 4U9ZA 3OWCA 4PSXA 4CRYB 2VEZA 2I00A 1IYLA 2FE7A 2VZZA 1YX0A 3BLNA 3V8IA 1Z9UA 2X7BA 3EXNA 5IB0A 1QSRA 3FRMA 3W6SA 2B5GA 2JLMA 2ATRA 4NEXA 2RC4A 1U6MA 1YREA 3CXPA 2K5TA 3ZZIA 1QSTA 1WK4A 1M4IA 4NF1A 4DNCA 2Q44A 3E0KA 2JEVA 3S6FA 1KUYA 1K4JA 1WWZA 3R96A 1KUXA 2B4DB 1CM0A 2ARHA 2BSWA 2PR1A 2PC1A 4MI4A 2FT0A 3R1KA 1P0HA 1Z4EA 4KUBA 1XMTA 2C27A 1S60A 5IX3A 1XIXA 1KZFA 4AG7A 1NMTA 1Y9WA 1RXTA 4YGOA 4XNHC 2B4BA 3H4QA 4OADA 4U5YA 3TFYA 2Q4YA 4JWPA 4NCZA 3I9SA 2DXQA 2FL4A 4IF5A 3EY5A 1NSLA 4JLYA 2J8RA 1XEBA 4UWJA 2Q04A 2AJ6A 2FXFA 1QSNA 2PDOA 4KOXA 3ZJ0A 3T90A 2CY2A 2R7HA 2H5MA 4B5PB 2FS5A 3IWGA 2REFA 4PSWA 5EBVA 1YVOA 1QSOA 2GANA 2G3TA 5I0CA 2OZHA 4XPDB 4R57A 3P2FA 3KKWA 4KLVA 4YFJA 1Q2YA 4R3LA 2PRBA 3TT2A 4F0YA 3DR6A 3TOAA 1S3ZA 2GIVA 3B8GA 3TCVA 5EC4A 4JXQA 4UBRA 3LD2A 3S6HA 3N7ZA 4OLLA 3QAHA 4FD4A 3BJ7A 4ZBGA 3JUWA 2CNSA 1SQHA 4AVCA 5F48A 5J8FA 4XPLA 2FIAA 3TO6A 2PQ8A 4M85A 2P6FA 2ZW6A 3GY9A 3CXSA 4IUSA 3LODA 2OU2A 1J4JA 3D3SA 3D2PA 5GCNA 2J8NA 3TO7A 1S5KA 3G8WA 1MJBA 1V0CA 3R9GA 2REEA 2J8MA 2OZUA 4LX9A 2AE6A 2QIRA 4LUAA 2ZW7A 5DWNA 4AVAA 2BL1A 5H84A 2A4NA 4CAWA 1IB1E 2HQYA 1S7FA 1ON0A 5DWMA 2ZW4A 4PK3A 1KUVA 4FD6A 4FD7A 1BOBA 3UY5A 2P6EA 4UA3A 3FXTA 4R9MA 4KOUA 1PUAA 2VZYA 1QSMA 1YK3A 5C88A 3P2HA 4Y49B 2P0WA 3R9FA 3BJ8A 3DSBA 4PV6A 2GE3A 3D8PA 3PP9A 1L0CA 4QUSA 3DDDA 5CNPA 4XNHB 2B4DA 5KTAA 4R3KA 2B3VA 4B5OA 2I79A 2OH1A 3TOBA 5F49A 4KOYA 4E2AA 1BO4A 2G3AA 4MJ8A 3PZJA 4U9YA 4H6UA 4NSQA 5ISVA 5KTCA 4AG9A 3IGRA 4FD5A 2ZXVA 1FY7A 3VWDA 5J8CA 3K9UA 1XF8A 5F47A 4KOTA 4KZTA 2HUZA 2VBQA 2PR8A 1IICA 4BMHA 2R98A 1B6BA
chains in the Genus database with same CATH superfamily
2HV2A 2OB0A 2EK8A 3D4UA 2NYQA 3H8EA 2Z0ZA 3PBBA 1JQGA 1P4NA 1MJAA 4H89A 4NXYA 4R76A 1YGHA 2Q7BA 4KOSA 4MFQA 4M6IA 2PJ5A 1Z8LA 4ZY0A 2ZPAA 4K30A 4ORFA 1M44A 4UEFA 2YNCC 5HVGA 4H6ZA 1OBRA 2CNMA 4WJBA 5IV0A 3FECA 5LRJA 2Q43A 1ZG8A 4OC0A 4MBUA 3EFAA 4KSIA 4A95A 1LANA 2JBKA 4QB9A 4ZGYB 2RFHA 3I3GA 5A27A 3N5FA 2VI7A 4Q36A 5H86A 4CGNA 4CAEA 4MY3A 3D2MA 1CG2A 1GHEA 1VGYA 2P6GA 3FB3A 3FJUA 4JXRA 2ZEDA 1NE9A 2C6GA 2Z11A 2PJBA 1XJOA 3F5BA 2V8VA 2WUUA 3F8KA 4ZX9A 4Z65A 1ZG7A 4F8ZA 4I49A 1VKCA 1I1DA 2Q4ZA 2V8DA 3C26A 4R87A 4C2ZA 4BD9A 2GFQA 4RS2A 4QC6A 3D68A 4CRZB 2G0BA 4EWTA 1PYTB 3VWEA 4ZY2A 1PU9A 4F0XA 3S9MA 2EWBA 1A2ZA 3PGPA 4ONWA 2AFWA 1MK4A 1XRYA 2ZW5A 3FIXA 2B58A 2NMTA 2XEFA 4KVME 4UIAA 4EMEA 3PB8X 2JDDA 2ABZA 1ARLA 4J3GA 2Q4VA 4JJXA 1Y7EA 3NH4A 2PIYA 3GYAA 4HNXB 4KVXA 1TF9A 2RB7A 1IOIA 3JVNA 3LACA 4ZYQA 5HH1A 4MFLA 3SXOA 5JPHA 5AG4A 3FYNA 2F7VA 3BI0A 1ELLP 2B5GB 1HEEA 3IWEA 1VHOA 3NH5A 3T9YA 3TTHA 4ZI6A 4C68A 3BHXA 1M4LA 1S7KA 2O28A 2PJ1A 3D66A 4PK2A 1GYTA 4A2ZA 2D4OA 2AFZA 4CPAA 4A33A 4EFDA 3S6GA 4OC3A 4MXUA 2PVVA 3R95A 4OAEA 6CPAA 3JTKA 2DPSA 1LAPA 5E96A 4II9A 3FEEA 2Z3PA 4KSFA 4MY0A 1CP7A 2QJ8A 4MHZA 3DNSA 3FNCA 3FMCA 3FEDA 3NFZA 5F46A 4G1PA 4NGQA 5C82A 2BO9A 1ZLIA 2VL1A 2ZEPA 4X5KA 4MHPA 2AFUA 4CYPA 3BXMA 3K2KA 4MFZA 1ZLHA 2CNTA 4KOVA 2EUIA 2QECA 3DR8A 5JGFA 2WPWA 3KQXA 4PXEA 4Q38A 4B13A 2WSAA 1TIQA 3G3SA 1B87A 3S9NA 4UFWA 1CPSA 1HDQA 3MN8A 3PB7X 2XEIA 3I1UA 4MRIA 3SI2A 4FBEA 4AB7A 4MHDA 3LMSA 2Y0MA 3V7ZA 4ONUA 1TF8A 4E8OA 5FVJA 1AMPA 1YR0A 2Z3OA 4Q7AA 5LYFA 1XE4A 2JBJA 4YU9A 2VQYA 4RI1A 4R7MA 3NE7A 4A37A 1HDUA 2HB6A 4CAFA 4KLWA 3GLJA 3TE4A 2PSWA 2YNDA 2CF4A 1H8LA 5JQ4A 4B11A 1R3NA 3WR7A 1VHSA 1Z8TA 4QVTA 2BOAA 2HC9A 2IL4A 3IU1A 4JD6A 3R9EA 4P4DA 2BUEA 4KUAA 4R6TA 2FVGA 2ZEFA 4P45A 3TO9A 4FAIA 3HLPA 5J1QA 4YRHA 3ISZA 3PFEA 1IIDA 4F9VA 4KORA 3RZAA 3W6XA 5HVHA 3SJEA 1Q2CA 4HKFA 2PJ8A 5IB9A 1Y9KA 2B3UA 3B3CA 2GU2A 3KGQA 2ODFA 3KHZA 2OZGA 2PJ3A 4L8AA 3KQZA 4PXBA 3WC7A 1Q2DA 5KTDA 3WC5A 1AYEA 1Y0YA 3MRUA 2R1IA 4M6GA 2F8HA 2EVNA 2V8HA 3B3TA 1OZPA 3PB6X 1YLEA 3IWWA 4X3RA 5HMNA 1I12A 4HNYB 4UWIA 4CAXA 4QBJA 2Q7SA 3SXNA 1IYKA 2QMLA 3FX6A 2F5IA 1QMUA 2PJ2A 4A39A 5CPAA 4EVYA 4XPKA 5DS0A 7CPAA 1Z4RA 3EC4A 3FF3A 4MCPA 4XPDC 4BBHA 3CXQA 3MGDA 2Q0YA 3GKRA 4B5PA 2WZNA 3QNVA 4GXHA 2YGWA 1XFOA 3PB4X 2R8VA 2VXKA 3A9LA 4P4FA 3CPXA 4Y49C 8CPAA 1RO5A 1S7LA 4CAVA 4E0AA 1YLOA 4KOWA 1UFHA 1Y0RA 4M3SA 2Z10A 2ANPA 3VH9A 2D4PA 4P4JA 3KHXA 1I21A 3K9TA 4AXVA 3IC1A 3PEIA 1CJWA 4WWVA 4HNWB 3S6KA 1M1DA 2ZEOA 3QB8A 1YW4A 3RYOA 1YVKA 4GS4A 2BEIA 1M4DA 5I4MA 4A31A 3EO4A 2FSRA 5HVFA 4NGPA 2V8GA 3IEHA 2PJ7A 1MJ9A 4MFKA 2YNEA 3IU2A 4CS0B 4IHMA 4OP4A 1S7NA 1X12A 3DLJA 3FBUA 2FCKA 3SHPA 3W91A 2IMOA 1N71A 2J9AA 1M4GA 3BI1A 1LRZA 4L89A 4KS9A 4UCNA 3WC6A 4AVBA 1CP6A 1R57A 5CBMA 1Y7RA 3L2NA 4F6AA 3D67A 2JDCA 4P44A 3F0AA 1KWMA 2FIWA 5D8NA 4KVOE 3KR5A 3TX8A 4A30A 4P6YA 2KCWA 2ZEEA 1BPMA 1NSAA 1XMBA 3WT4A 2WPXA 4U9ZA 5A28A 1DTDA 3GB0A 3OWCA 4PSXA 4UCPA 4CRYB 2VEZA 2AFSA 3B7IA 2I00A 1IYLA 2CIJA 4TWEA 2IJZA 4F9UA 1YQEA 2FE7A 4PQAA 2VZZA 4CGPA 4MCSA 1YX0A 3BLNA 3V8IA 1Z9UA 3QAYA 2X7BA 2PIZA 1Q7LA 3EXNA 4MFJA 2Z3MA 3SI0A 5JH9A 1F2OA 2AFXA 1QSRA 2ZEHA 5IB0A 3SJGA 3FRMA 3W6SA 1VHEA 4DYOA 4OC5A 3FVLA 2B5GA 2JLMA 2ATRA 3IO1A 4NEXA 4OIWA 1R43A 2RC4A 3RO0A 1U6MA 1VIXA 5G21A 1YREA 3NE8A 3CXPA 1LAMA 2K5TA 3PBEA 3ZZIA 1YSJA 1QSTA 1WK4A 3D7FA 4C7IA 4CGLA 1M4IA 3NH8A 4NF1A 4DNCA 2Q44A 1IGBA 3E0KA 3KL9A 5JM6A 1YMEA 2JEVA 4NJRA 2G9DA 4H2KA 1XOVA 4X8IA 3S6FA 5D29A 1KUYA 4C2XA 1K4JA 1WWZA 2Z3KA 3R96A 3IIBA 1KUXA 1Z8XA 2XEJA 2ZENA 4RN7A 2B4DB 5AG6A 1CM0A 2XEGA 2ARHA 2BSWA 5K8PA 2PR1A 2PC1A 4MI4A 2EO8A 2FT0A 1P0HA 3R1KA 1Z4EA 2ZOFA 4KUBA 1XMTA 2JEWA 2C27A 4OMEA 1S60A 2I3CA 2OR4A 3GUXA 1BPNA 5IX3A 1TKJA 1XIXA 1KZFA 4AG7A 1DE4C 4FUUA 4HPSA 1CX8A 1NMTA 1IU8A 1LOKA 1TKFA 1Y9WA 2IQ6A 4PXDA 1RXTA 4UFVA 4YGOA 4XNHC 5G22A 3VATA 4MCRA 2B4BA 3H4QA 4OADA 4PXCA 4U5YA 3TFYA 2Q4YA 2V77A 3B3SA 4B14A 1UWYA 3D7GA 4JWPA 3PFOA 4NCZA 3I9SA 2DXQA 2FL4A 3KASA 4IF5A 3EY5A 3H8FA 2PJ6A 3PRTA 3TC8A 1NSLA 2AFOA 2ZOGA 1CPXA 3H5ZA 5AG5A 4A38A 3CZXA 4JLYA 4B10A 4OC2A 2J8RA 1XEBA 4UWJA 3CDXA 4MHNA 2Q04A 3RBUA 2AJ6A 2FXFA 1QSNA 2PDOA 4KOXA 4A94A 4YWYA 1AUGA 4JYWA 4OIDA 3ZJ0A 3T90A 2CY2A 2R7HA 4UF4A 2PCUA 5G20A 4NJQA 2H5MA 4B5PB 2FS5A 1LFWA 3IWGA 2REFA 4PSWA 5G1ZA 4B6ZA 4NGRA 4P4BA 1YVOA 2PJ4A 5EBVA 1QSOA 4LQ6A 3SI1A 2GANA 2CTCA 1FT7A 2G3TA 5I0CA 2Z3NA 4C7HA 3D7DA 2EK9A 2OZHA 3B2YA 4OC1A 4R57A 4XPDB 3P2FA 3KKWA 4KLVA 4ZX8A 4YFJA 3WABA 1Q2YA 4R3LA 5K8MA 5LRKA 4K3NA 4IK2A 2PRBA 3TT2A 4F0YA 3DR6A 3TOAA 1S3ZA 2GIVA 4NGNA 4UCMA 4DJLA 1LCPA 1Z5RA 3B8GA 5LYLA 4RUHA 3HUVA 4IAVA 4KSAA 5F09A 4O23A 4NGMA 3IFEA 4PPZA 1ZO0A 2PJAA 5EC4A 3CT9A 3TCVA 4B12A 4JXQA 4UBRA 3LD2A 2GLFA 3N7ZA 4OLLA 1X10A 3S6HA 3QAHA 4FD4A 3BJ7A 4ZBGA 2GREA 4A32A 3JUWA 2CNSA 1SQHA 2PJ9A 4P4EA 4AVCA 5F48A 5J8FA 4XPLA 4CGMA 3NA6A 2FIAA 3VARA 1FNOA 3CPAA 3TO6A 2C1CA 2PQ8A 1TKHA 2P6FA 3H8GA 4M6HA 1ARMA 2ZW6A 3GY9A 4M85A 3SJFA 3CXSA 4MFPA 1IY7A 4IUSA 3JRUA 5AGEA 2DEAA 4JZ0A 3LODA 4P10A 2OU2A 3RNZA 1J4JA 2GLJA 3D3SA 1ELMP 5BWAB 1IOFA 4CYNA 3D2PA 5GCNA 4OC4A 4AG9A 2J8NA 3TO7A 5K8NA 1BAVA 1BLLE 2CXAA 4R8FA 5HXDA 1S5KA 2Z3LA 3G8WA 1TXRA 1MJBA 1V0CA 3DGVA 3B3WA 1EE3P 1Z8WA 3FH4A 3R9GA 2REEA 2J8MA 2OZUA 5LYDA 3T8WA 4LX9A 1JWQA 2AE6A 4BINA 4CYQA 3SJXA 2QIRA 2YNCA 2DF5A 1CBXA 5ELYA 4LUAA 2ZW7A 5DWNA 1RTQA 4AVAA 2BL1A 5H84A 2A4NA 2PJCA 4CAWA 1IB1E 5K8OA 2HQYA 2ZEMA 4C2YA 4LQGA 3GIUA 1F2PA 1S7FA 2PRQA 1ON0A 5AG7A 5DWMA 2C6PA 2ZW4A 4PK3A 3PB9X 1KUVA 4FD6A 4FD7A 1BOBA 3D7HA 3UY5A 4NFRA 2P6EA 3B35A 3FXTA 4OKOA 2QYVA 4R9MA 4UA3A 4KOUA 1PUAA 2VZYA 1QSMA 1YK3A 2PJ0A 4W9YA 5C88A 3P2HA 4Y49B 2P0WA 3ISXA 3R9FA 3BJ8A 3DSBA 3KI9A 4FWUA 3B3VA 4PV6A 3RAMA 2GE3A 3D8PA 1F57A 4MCQA 3PP9A 1QQ9A 1L0CA 4QUSA 3DDDA 5CNPA 4XNHB 2C6CA 4CYOA 2CTBA 2PVWA 4P4IA 2B4DA 5KTAA 4R3KA 4NGSA 4MMOA 1Z2LA 4UIBA 2B3VA 3V38A 2Q51A 4B5OA 1YW6A 2POKA 4UEEA 3IJ3A 2QVPA 2I79A 2OH1A 3TOBA 4UEZA 4KOYA 5F49A 2PE3A 4MHYA 5EMIA 2DPTA 4E2AA 5LRGA 1BO4A 2G3AA 2O53A 4MJ8A 4UFXA 1ZG9A 2EBJA 4GM5A 4DUKA 3PZJA 4U9YA 4H6UA 4NSQA 2O4HA 4X2TA 5ISVA 3LWUA 5KTCA 4TNUA 2ZEGA 2WYRA 3IGRA 4FD5A 2ZXVA 1FY7A 1PCAA 1XBUA 3K9UA 3KR4A 2OOTA 3VWDA 5J8CA 4CGOA 1XF8A 2AFMA 2ZELA 5F47A 2NSMA 4KOTA 3S9LA 4KZTA 2HUZA 3KZWA 2BCOA 2VBQA 4NGTA 5LYIA 5THWA 2PR8A 1IICA 4BMHA 4ZY1A 2R98A 1B6BA
chains in the Genus database with same CATH topology
2HV2A 2OB0A 2Z0ZA 2Q7BA 1P4NA 1MJAA 4H89A 4NXYA 1YGHA 4KOSA 4MFQA 2ZPAA 4K30A 4ORFA 1M44A 2YNCC 5IV0A 4H6ZA 2CNMA 4MBUA 3EFAA 4A95A 4QB9A 4ZGYB 3I3GA 5A27A 4Q36A 2VI7A 5H86A 4CAEA 4MY3A 3FB3A 2P6GA 1GHEA 3D2MA 4JXRA 4CGNA 3F8KA 1NE9A 2Z11A 3F5BA 2WUUA 4I49A 1VKCA 1I1DA 3C26A 4R87A 4C2ZA 4RS2A 4QC6A 4CRZB 2G0BA 3VWEA 1PU9A 4F0XA 3PGPA 1MK4A 4KVME 2ZW5A 3FIXA 2B58A 2NMTA 2JDDA 4J3GA 4JJXA 2Q4VA 3GYAA 4HNXB 4KVXA 3JVNA 5HH1A 4MFLA 3SXOA 5JPHA 5AG4A 3FYNA 2B5GB 3IWEA 3TTHA 3T9YA 4C68A 1S7KA 2O28A 4PK2A 4A2ZA 2D4OA 4A33A 3S6GA 3R95A 4OAEA 3JTKA 2DPSA 4II9A 5E96A 2Z3PA 4KSFA 4MY0A 3DNSA 3FNCA 5F46A 5C82A 4X5KA 4CYPA 4MFZA 2CNTA 4KOVA 2EUIA 2QECA 3DR8A 2WPWA 4B13A 4Q38A 2WSAA 1TIQA 3G3SA 1B87A 4UFWA 4AB7A 4MHDA 2Y0MA 4ONUA 4E8OA 5FVJA 1YR0A 2Z3OA 1XE4A 2VQYA 4RI1A 3NE7A 4CAFA 4KLWA 3TE4A 2PSWA 2YNDA 5JQ4A 4B11A 3WR7A 1VHSA 4QVTA 2IL4A 3IU1A 4JD6A 3R9EA 2BUEA 4KUAA 3TO9A 4YRHA 1IIDA 4KORA 3W6XA 1Q2CA 4HKFA 1Y9KA 2B3UA 2OZGA 4L8AA 1Q2DA 5KTDA 2R1IA 2EVNA 1OZPA 1YLEA 5HMNA 1I12A 4HNYB 4UWIA 4CAXA 4QBJA 3SXNA 1IYKA 2QMLA 2F5IA 4EVYA 4XPKA 1Z4RA 3EC4A 4XPDC 4BBHA 3CXQA 3MGDA 2Q0YA 3GKRA 4B5PA 2YGWA 2R8VA 2VXKA 3A9LA 4Y49C 1RO5A 1S7LA 4CAVA 4E0AA 4KOWA 1UFHA 4M3SA 2Z10A 2D4PA 1I21A 1CJWA 4HNWB 3S6KA 1M1DA 3QB8A 3RYOA 1YVKA 4GS4A 2BEIA 1M4DA 4A31A 3EO4A 2FSRA 1MJ9A 4MFKA 2YNEA 3IU2A 4CS0B 3SHPA 1S7NA 3FBUA 2FCKA 3W91A 1N71A 1M4GA 1LRZA 4L89A 4KS9A 4UCNA 4AVBA 1R57A 1Y7RA 4F6AA 2JDCA 3F0AA 2FIWA 4KVOE 4A30A 2KCWA 2WPXA 4U9ZA 5A28A 3OWCA 4PSXA 4UCPA 4CRYB 2VEZA 2I00A 1IYLA 2FE7A 2VZZA 4CGPA 1YX0A 3BLNA 3V8IA 1Z9UA 2X7BA 3EXNA 4MFJA 2Z3MA 5IB0A 1QSRA 3FRMA 3W6SA 2B5GA 2JLMA 2ATRA 4NEXA 2RC4A 1U6MA 5G21A 1YREA 3CXPA 2K5TA 3ZZIA 1QSTA 1WK4A 4C7IA 4CGLA 1M4IA 4NF1A 4DNCA 2Q44A 3E0KA 2JEVA 3S6FA 1KUYA 4C2XA 1K4JA 1WWZA 2Z3KA 3R96A 1KUXA 2B4DB 5AG6A 1CM0A 2ARHA 2BSWA 2PR1A 2PC1A 4MI4A 2FT0A 3R1KA 1P0HA 1Z4EA 4KUBA 1XMTA 2C27A 1S60A 5IX3A 1XIXA 1KZFA 4AG7A 1NMTA 1Y9WA 4UFVA 5G22A 1RXTA 4YGOA 4XNHC 2B4BA 3H4QA 4OADA 4U5YA 3TFYA 2Q4YA 4B14A 4JWPA 4NCZA 3I9SA 2DXQA 2FL4A 4IF5A 3EY5A 1NSLA 3H5ZA 5AG5A 4B10A 4JLYA 2J8RA 1XEBA 4UWJA 2Q04A 2AJ6A 2FXFA 1QSNA 2PDOA 4KOXA 3ZJ0A 3T90A 2CY2A 2R7HA 5G20A 2H5MA 4B5PB 2FS5A 3IWGA 2REFA 4PSWA 5G1ZA 5EBVA 1YVOA 1QSOA 2GANA 2G3TA 5I0CA 2Z3NA 4C7HA 2OZHA 4XPDB 4R57A 3P2FA 3KKWA 4KLVA 4YFJA 1Q2YA 4R3LA 2PRBA 3TT2A 4F0YA 3DR6A 3TOAA 1S3ZA 2GIVA 4UCMA 3B8GA 4KSAA 3TCVA 1ZO0A 4B12A 5EC4A 4JXQA 4UBRA 3LD2A 3S6HA 3N7ZA 4OLLA 3QAHA 4FD4A 3BJ7A 4ZBGA 4A32A 3JUWA 2CNSA 1SQHA 4AVCA 5F48A 5J8FA 4XPLA 4CGMA 2FIAA 3TO6A 2PQ8A 4M85A 2P6FA 2ZW6A 3GY9A 3CXSA 4MFPA 4IUSA 5AGEA 3LODA 2OU2A 1J4JA 3D3SA 5BWAB 4CYNA 3D2PA 5GCNA 2J8NA 3TO7A 2CXAA 1S5KA 2Z3LA 3G8WA 1MJBA 1V0CA 3R9GA 2REEA 2J8MA 2OZUA 4LX9A 2AE6A 4CYQA 2QIRA 2YNCA 4LUAA 2ZW7A 5DWNA 4AVAA 2BL1A 5H84A 2A4NA 4CAWA 1IB1E 2HQYA 4C2YA 1S7FA 1ON0A 5AG7A 5DWMA 2ZW4A 4PK3A 1KUVA 4FD6A 4FD7A 1BOBA 3UY5A 2P6EA 4R9MA 3FXTA 4UA3A 4KOUA 1PUAA 2VZYA 1QSMA 1YK3A 5C88A 3P2HA 4Y49B 2P0WA 3R9FA 3BJ8A 3DSBA 4PV6A 2GE3A 3D8PA 3PP9A 1L0CA 4QUSA 3DDDA 5CNPA 4XNHB 4CYOA 2B4DA 5KTAA 4R3KA 2B3VA 4B5OA 2I79A 2OH1A 3TOBA 5F49A 4KOYA 2DPTA 4E2AA 1BO4A 2G3AA 4MJ8A 4UFXA 3PZJA 4U9YA 4H6UA 4NSQA 5ISVA 5KTCA 4AG9A 3IGRA 4FD5A 2ZXVA 1FY7A 3VWDA 5J8CA 3K9UA 4CGOA 1XF8A 5F47A 4KOTA 4KZTA 2HUZA 2VBQA 2PR8A 1IICA 4BMHA 2R98A 1B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV2 A;  2OB0 A;  2Z0Z A;  2Q7B A;  1P4N A;  1MJA A;  4H89 A;  4NXY A;  1YGH A;  4KOS A;  2ZPA A;  4K30 A;  4ORF A;  1M44 A;  5IV0 A;  4H6Z A;  2CNM A;  4MBU A;  3EFA A;  4QB9 A;  3I3G A;  2VI7 A;  5H86 A;  4MY3 A;  3D2M A;  2P6G A;  1GHE A;  3FB3 A;  4JXR A;  1NE9 A;  2Z11 A;  3F5B A;  3F8K A;  4I49 A;  1VKC A;  1I1D A;  3C26 A;  4R87 A;  4RS2 A;  4QC6 A;  4CRZ B;  2G0B A;  3VWE A;  1PU9 A;  3PGP A;  1MK4 A;  4KVM E;  2ZW5 A;  3FIX A;  2B58 A;  2NMT A;  2JDD A;  4J3G A;  4JJX A;  2Q4V A;  3GYA A;  4HNX B;  4KVX A;  3JVN A;  5HH1 A;  3SXO A;  5JPH A;  3FYN A;  2B5G B;  3TTH A;  3T9Y A;  1S7K A;  2O28 A;  4PK2 A;  2D4O A;  3S6G A;  3R95 A;  4OAE A;  4II9 A;  5E96 A;  4MY0 A;  3DNS A;  3FNC A;  5F46 A;  5C82 A;  4X5K A;  2CNT A;  4KOV A;  2EUI A;  2QEC A;  3DR8 A;  2WPW A;  1TIQ A;  3G3S A;  1B87 A;  4AB7 A;  4MHD A;  2Y0M A;  4ONU A;  4E8O A;  5FVJ A;  1YR0 A;  1XE4 A;  2VQY A;  4RI1 A;  3NE7 A;  4KLW A;  3TE4 A;  2PSW A;  5JQ4 A;  3WR7 A;  1VHS A;  4QVT A;  2IL4 A;  4JD6 A;  3R9E A;  2BUE A;  4KUA A;  3TO9 A;  4YRH A;  1IID A;  4KOR A;  3W6X A;  1Q2C A;  4HKF A;  1Y9K A;  2B3U A;  2OZG A;  4L8A A;  1Q2D A;  5KTD A;  2R1I A;  2EVN A;  1OZP A;  1YLE A;  5HMN A;  1I12 A;  4HNY B;  4UWI A;  4CAX A;  4QBJ A;  3SXN A;  1IYK A;  2QML A;  2F5I A;  4EVY A;  4XPK A;  1Z4R A;  3EC4 A;  4XPD C;  3CXQ A;  3MGD A;  2Q0Y A;  3GKR A;  4B5P A;  2R8V A;  2VXK A;  4Y49 C;  1RO5 A;  1S7L A;  4CAV A;  4E0A A;  4KOW A;  1UFH A;  4M3S A;  2Z10 A;  2D4P A;  1I21 A;  1CJW A;  4HNW B;  3S6K A;  1M1D A;  3QB8 A;  3RYO A;  1YVK A;  4GS4 A;  2BEI A;  1M4D A;  3EO4 A;  2FSR A;  1MJ9 A;  4CS0 B;  3SHP A;  1S7N A;  3FBU A;  2FCK A;  3W91 A;  1N71 A;  1M4G A;  1LRZ A;  4L89 A;  4AVB A;  1R57 A;  1Y7R A;  4F6A A;  2JDC A;  3F0A A;  2FIW A;  4KVO E;  2KCW A;  2WPX A;  4U9Z A;  3OWC A;  4PSX A;  4CRY B;  2VEZ A;  2I00 A;  1IYL A;  2FE7 A;  2VZZ A;  1YX0 A;  3BLN A;  3V8I A;  1Z9U A;  2X7B A;  3EXN A;  5IB0 A;  1QSR A;  3FRM A;  3W6S A;  2B5G A;  2JLM A;  2ATR A;  4NEX A;  2RC4 A;  1U6M A;  1YRE A;  3CXP A;  2K5T A;  3ZZI A;  1QST A;  1WK4 A;  1M4I A;  4NF1 A;  4DNC A;  2Q44 A;  3E0K A;  2JEV A;  3S6F A;  1KUY A;  1K4J A;  1WWZ A;  3R96 A;  1KUX A;  2B4D B;  1CM0 A;  2ARH A;  2BSW A;  2PR1 A;  2PC1 A;  4MI4 A;  2FT0 A;  3R1K A;  1P0H A;  1Z4E A;  4KUB A;  1XMT A;  2C27 A;  1S60 A;  5IX3 A;  1XIX A;  1KZF A;  4AG7 A;  1NMT A;  1Y9W A;  1RXT A;  4YGO A;  4XNH C;  2B4B A;  3H4Q A;  4OAD A;  4U5Y A;  3TFY A;  2Q4Y A;  4JWP A;  4NCZ A;  3I9S A;  2DXQ A;  2FL4 A;  4IF5 A;  3EY5 A;  1NSL A;  4JLY A;  2J8R A;  1XEB A;  4UWJ A;  2Q04 A;  2AJ6 A;  2FXF A;  1QSN A;  2PDO A;  4KOX A;  3ZJ0 A;  3T90 A;  2CY2 A;  2R7H A;  2H5M A;  4B5P B;  2FS5 A;  3IWG A;  2REF A;  4PSW A;  5EBV A;  1YVO A;  1QSO A;  2GAN A;  2G3T A;  5I0C A;  2OZH A;  4XPD B;  4R57 A;  3P2F A;  3KKW A;  4KLV A;  4YFJ A;  1Q2Y A;  4R3L A;  2PRB A;  3TT2 A;  4F0Y A;  3DR6 A;  3TOA A;  1S3Z A;  2GIV A;  3B8G A;  3TCV A;  5EC4 A;  4JXQ A;  4UBR A;  3LD2 A;  3S6H A;  3N7Z A;  4OLL A;  3QAH A;  4FD4 A;  3BJ7 A;  4ZBG A;  3JUW A;  2CNS A;  1SQH A;  4AVC A;  5F48 A;  5J8F A;  4XPL A;  2FIA A;  3TO6 A;  2PQ8 A;  4M85 A;  2P6F A;  2ZW6 A;  3GY9 A;  3CXS A;  4IUS A;  3LOD A;  2OU2 A;  1J4J A;  3D3S A;  3D2P A;  5GCN A;  2J8N A;  3TO7 A;  1S5K A;  3G8W A;  1MJB A;  1V0C A;  3R9G A;  2REE A;  2J8M A;  2OZU A;  4LX9 A;  2AE6 A;  2QIR A;  4LUA A;  2ZW7 A;  5DWN A;  4AVA A;  2BL1 A;  5H84 A;  2A4N A;  4CAW A;  1IB1 E;  2HQY A;  1S7F A;  1ON0 A;  5DWM A;  2ZW4 A;  4PK3 A;  1KUV A;  4FD6 A;  4FD7 A;  1BOB A;  3UY5 A;  2P6E A;  4UA3 A;  3FXT A;  4R9M A;  4KOU A;  1PUA A;  2VZY A;  1QSM A;  1YK3 A;  5C88 A;  3P2H A;  4Y49 B;  2P0W A;  3R9F A;  3BJ8 A;  3DSB A;  4PV6 A;  2GE3 A;  3D8P A;  3PP9 A;  1L0C A;  4QUS A;  3DDD A;  5CNP A;  4XNH B;  2B4D A;  5KTA A;  4R3K A;  2B3V A;  4B5O A;  2I79 A;  2OH1 A;  3TOB A;  5F49 A;  4KOY A;  4E2A A;  1BO4 A;  2G3A A;  4MJ8 A;  3PZJ A;  4U9Y A;  4H6U A;  4NSQ A;  5ISV A;  5KTC A;  4AG9 A;  3IGR A;  4FD5 A;  2ZXV A;  1FY7 A;  3VWD A;  5J8C A;  3K9U A;  1XF8 A;  5F47 A;  4KOT A;  4KZT A;  2HUZ A;  2VBQ A;  2PR8 A;  1IIC A;  4BMH A;  2R98 A;  1B6B A; 
#chains in the Genus database with same CATH topology
 2HV2 A;  2OB0 A;  2EK8 A;  3D4U A;  2NYQ A;  3H8E A;  2Z0Z A;  3PBB A;  1JQG A;  1P4N A;  1MJA A;  4H89 A;  4NXY A;  4R76 A;  1YGH A;  2Q7B A;  4KOS A;  4MFQ A;  4M6I A;  2PJ5 A;  1Z8L A;  4ZY0 A;  2ZPA A;  4K30 A;  4ORF A;  1M44 A;  4UEF A;  2YNC C;  5HVG A;  4H6Z A;  1OBR A;  2CNM A;  4WJB A;  5IV0 A;  3FEC A;  5LRJ A;  2Q43 A;  1ZG8 A;  4OC0 A;  4MBU A;  3EFA A;  4KSI A;  4A95 A;  1LAN A;  2JBK A;  4QB9 A;  4ZGY B;  2RFH A;  3I3G A;  5A27 A;  3N5F A;  2VI7 A;  4Q36 A;  5H86 A;  4CGN A;  4CAE A;  4MY3 A;  3D2M A;  1CG2 A;  1GHE A;  1VGY A;  2P6G A;  3FB3 A;  3FJU A;  4JXR A;  2ZED A;  1NE9 A;  2C6G A;  2Z11 A;  2PJB A;  1XJO A;  3F5B A;  2V8V A;  2WUU A;  3F8K A;  4ZX9 A;  4Z65 A;  1ZG7 A;  4F8Z A;  4I49 A;  1VKC A;  1I1D A;  2Q4Z A;  2V8D A;  3C26 A;  4R87 A;  4C2Z A;  4BD9 A;  2GFQ A;  4RS2 A;  4QC6 A;  3D68 A;  4CRZ B;  2G0B A;  4EWT A;  1PYT B;  3VWE A;  4ZY2 A;  1PU9 A;  4F0X A;  3S9M A;  2EWB A;  1A2Z A;  3PGP A;  4ONW A;  2AFW A;  1MK4 A;  1XRY A;  2ZW5 A;  3FIX A;  2B58 A;  2NMT A;  2XEF A;  4KVM E;  4UIA A;  4EME A;  3PB8 X;  2JDD A;  2ABZ A;  1ARL A;  4J3G A;  2Q4V A;  4JJX A;  1Y7E A;  3NH4 A;  2PIY A;  3GYA A;  4HNX B;  4KVX A;  1TF9 A;  2RB7 A;  1IOI A;  3JVN A;  3LAC A;  4ZYQ A;  5HH1 A;  4MFL A;  3SXO A;  5JPH A;  5AG4 A;  3FYN A;  2F7V A;  3BI0 A;  1ELL P;  2B5G B;  1HEE A;  3IWE A;  1VHO A;  3NH5 A;  3T9Y A;  3TTH A;  4ZI6 A;  4C68 A;  3BHX A;  1M4L A;  1S7K A;  2O28 A;  2PJ1 A;  3D66 A;  4PK2 A;  1GYT A;  4A2Z A;  2D4O A;  2AFZ A;  4CPA A;  4A33 A;  4EFD A;  3S6G A;  4OC3 A;  4MXU A;  2PVV A;  3R95 A;  4OAE A;  6CPA A;  3JTK A;  2DPS A;  1LAP A;  5E96 A;  4II9 A;  3FEE A;  2Z3P A;  4KSF A;  4MY0 A;  1CP7 A;  2QJ8 A;  4MHZ A;  3DNS A;  3FNC A;  3FMC A;  3FED A;  3NFZ A;  5F46 A;  4G1P A;  4NGQ A;  5C82 A;  2BO9 A;  1ZLI A;  2VL1 A;  2ZEP A;  4X5K A;  4MHP A;  2AFU A;  4CYP A;  3BXM A;  3K2K A;  4MFZ A;  1ZLH A;  2CNT A;  4KOV A;  2EUI A;  2QEC A;  3DR8 A;  5JGF A;  2WPW A;  3KQX A;  4PXE A;  4Q38 A;  4B13 A;  2WSA A;  1TIQ A;  3G3S A;  1B87 A;  3S9N A;  4UFW A;  1CPS A;  1HDQ A;  3MN8 A;  3PB7 X;  2XEI A;  3I1U A;  4MRI A;  3SI2 A;  4FBE A;  4AB7 A;  4MHD A;  3LMS A;  2Y0M A;  3V7Z A;  4ONU A;  1TF8 A;  4E8O A;  5FVJ A;  1AMP A;  1YR0 A;  2Z3O A;  4Q7A A;  5LYF A;  1XE4 A;  2JBJ A;  4YU9 A;  2VQY A;  4RI1 A;  4R7M A;  3NE7 A;  4A37 A;  1HDU A;  2HB6 A;  4CAF A;  4KLW A;  3GLJ A;  3TE4 A;  2PSW A;  2YND A;  2CF4 A;  1H8L A;  5JQ4 A;  4B11 A;  1R3N A;  3WR7 A;  1VHS A;  1Z8T A;  4QVT A;  2BOA A;  2HC9 A;  2IL4 A;  3IU1 A;  4JD6 A;  3R9E A;  4P4D A;  2BUE A;  4KUA A;  4R6T A;  2FVG A;  2ZEF A;  4P45 A;  3TO9 A;  4FAI A;  3HLP A;  5J1Q A;  4YRH A;  3ISZ A;  3PFE A;  1IID A;  4F9V A;  4KOR A;  3RZA A;  3W6X A;  5HVH A;  3SJE A;  1Q2C A;  4HKF A;  2PJ8 A;  5IB9 A;  1Y9K A;  2B3U A;  3B3C A;  2GU2 A;  3KGQ A;  2ODF A;  3KHZ A;  2OZG A;  2PJ3 A;  4L8A A;  3KQZ A;  4PXB A;  3WC7 A;  1Q2D A;  5KTD A;  3WC5 A;  1AYE A;  1Y0Y A;  3MRU A;  2R1I A;  4M6G A;  2F8H A;  2EVN A;  2V8H A;  3B3T A;  1OZP A;  3PB6 X;  1YLE A;  3IWW A;  4X3R A;  5HMN A;  1I12 A;  4HNY B;  4UWI A;  4CAX A;  4QBJ A;  2Q7S A;  3SXN A;  1IYK A;  2QML A;  3FX6 A;  2F5I A;  1QMU A;  2PJ2 A;  4A39 A;  5CPA A;  4EVY A;  4XPK A;  5DS0 A;  7CPA A;  1Z4R A;  3EC4 A;  3FF3 A;  4MCP A;  4XPD C;  4BBH A;  3CXQ A;  3MGD A;  2Q0Y A;  3GKR A;  4B5P A;  2WZN A;  3QNV A;  4GXH A;  2YGW A;  1XFO A;  3PB4 X;  2R8V A;  2VXK A;  3A9L A;  4P4F A;  3CPX A;  4Y49 C;  8CPA A;  1RO5 A;  1S7L A;  4CAV A;  4E0A A;  1YLO A;  4KOW A;  1UFH A;  1Y0R A;  4M3S A;  2Z10 A;  2ANP A;  3VH9 A;  2D4P A;  4P4J A;  3KHX A;  1I21 A;  3K9T A;  4AXV A;  3IC1 A;  3PEI A;  1CJW A;  4WWV A;  4HNW B;  3S6K A;  1M1D A;  2ZEO A;  3QB8 A;  1YW4 A;  3RYO A;  1YVK A;  4GS4 A;  2BEI A;  1M4D A;  5I4M A;  4A31 A;  3EO4 A;  2FSR A;  5HVF A;  4NGP A;  2V8G A;  3IEH A;  2PJ7 A;  1MJ9 A;  4MFK A;  2YNE A;  3IU2 A;  4CS0 B;  4IHM A;  4OP4 A;  1S7N A;  1X12 A;  3DLJ A;  3FBU A;  2FCK A;  3SHP A;  3W91 A;  2IMO A;  1N71 A;  2J9A A;  1M4G A;  3BI1 A;  1LRZ A;  4L89 A;  4KS9 A;  4UCN A;  3WC6 A;  4AVB A;  1CP6 A;  1R57 A;  5CBM A;  1Y7R A;  3L2N A;  4F6A A;  3D67 A;  2JDC A;  4P44 A;  3F0A A;  1KWM A;  2FIW A;  5D8N A;  4KVO E;  3KR5 A;  3TX8 A;  4A30 A;  4P6Y A;  2KCW A;  2ZEE A;  1BPM A;  1NSA A;  1XMB A;  3WT4 A;  2WPX A;  4U9Z A;  5A28 A;  1DTD A;  3GB0 A;  3OWC A;  4PSX A;  4UCP A;  4CRY B;  2VEZ A;  2AFS A;  3B7I A;  2I00 A;  1IYL A;  2CIJ A;  4TWE A;  2IJZ A;  4F9U A;  1YQE A;  2FE7 A;  4PQA A;  2VZZ A;  4CGP A;  4MCS A;  1YX0 A;  3BLN A;  3V8I A;  1Z9U A;  3QAY A;  2X7B A;  2PIZ A;  1Q7L A;  3EXN A;  4MFJ A;  2Z3M A;  3SI0 A;  5JH9 A;  1F2O A;  2AFX A;  1QSR A;  2ZEH A;  5IB0 A;  3SJG A;  3FRM A;  3W6S A;  1VHE A;  4DYO A;  4OC5 A;  3FVL A;  2B5G A;  2JLM A;  2ATR A;  3IO1 A;  4NEX A;  4OIW A;  1R43 A;  2RC4 A;  3RO0 A;  1U6M A;  1VIX A;  5G21 A;  1YRE A;  3NE8 A;  3CXP A;  1LAM A;  2K5T A;  3PBE A;  3ZZI A;  1YSJ A;  1QST A;  1WK4 A;  3D7F A;  4C7I A;  4CGL A;  1M4I A;  3NH8 A;  4NF1 A;  4DNC A;  2Q44 A;  1IGB A;  3E0K A;  3KL9 A;  5JM6 A;  1YME A;  2JEV A;  4NJR A;  2G9D A;  4H2K A;  1XOV A;  4X8I A;  3S6F A;  5D29 A;  1KUY A;  4C2X A;  1K4J A;  1WWZ A;  2Z3K A;  3R96 A;  3IIB A;  1KUX A;  1Z8X A;  2XEJ A;  2ZEN A;  4RN7 A;  2B4D B;  5AG6 A;  1CM0 A;  2XEG A;  2ARH A;  2BSW A;  5K8P A;  2PR1 A;  2PC1 A;  4MI4 A;  2EO8 A;  2FT0 A;  1P0H A;  3R1K A;  1Z4E A;  2ZOF A;  4KUB A;  1XMT A;  2JEW A;  2C27 A;  4OME A;  1S60 A;  2I3C A;  2OR4 A;  3GUX A;  1BPN A;  5IX3 A;  1TKJ A;  1XIX A;  1KZF A;  4AG7 A;  1DE4 C;  4FUU A;  4HPS A;  1CX8 A;  1NMT A;  1IU8 A;  1LOK A;  1TKF A;  1Y9W A;  2IQ6 A;  4PXD A;  1RXT A;  4UFV A;  4YGO A;  4XNH C;  5G22 A;  3VAT A;  4MCR A;  2B4B A;  3H4Q A;  4OAD A;  4PXC A;  4U5Y A;  3TFY A;  2Q4Y A;  2V77 A;  3B3S A;  4B14 A;  1UWY A;  3D7G A;  4JWP A;  3PFO A;  4NCZ A;  3I9S A;  2DXQ A;  2FL4 A;  3KAS A;  4IF5 A;  3EY5 A;  3H8F A;  2PJ6 A;  3PRT A;  3TC8 A;  1NSL A;  2AFO A;  2ZOG A;  1CPX A;  3H5Z A;  5AG5 A;  4A38 A;  3CZX A;  4JLY A;  4B10 A;  4OC2 A;  2J8R A;  1XEB A;  4UWJ A;  3CDX A;  4MHN A;  2Q04 A;  3RBU A;  2AJ6 A;  2FXF A;  1QSN A;  2PDO A;  4KOX A;  4A94 A;  4YWY A;  1AUG A;  4JYW A;  4OID A;  3ZJ0 A;  3T90 A;  2CY2 A;  2R7H A;  4UF4 A;  2PCU A;  5G20 A;  4NJQ A;  2H5M A;  4B5P B;  2FS5 A;  1LFW A;  3IWG A;  2REF A;  4PSW A;  5G1Z A;  4B6Z A;  4NGR A;  4P4B A;  1YVO A;  2PJ4 A;  5EBV A;  1QSO A;  4LQ6 A;  3SI1 A;  2GAN A;  2CTC A;  1FT7 A;  2G3T A;  5I0C A;  2Z3N A;  4C7H A;  3D7D A;  2EK9 A;  2OZH A;  3B2Y A;  4OC1 A;  4R57 A;  4XPD B;  3P2F A;  3KKW A;  4KLV A;  4ZX8 A;  4YFJ A;  3WAB A;  1Q2Y A;  4R3L A;  5K8M A;  5LRK A;  4K3N A;  4IK2 A;  2PRB A;  3TT2 A;  4F0Y A;  3DR6 A;  3TOA A;  1S3Z A;  2GIV A;  4NGN A;  4UCM A;  4DJL A;  1LCP A;  1Z5R A;  3B8G A;  5LYL A;  4RUH A;  3HUV A;  4IAV A;  4KSA A;  5F09 A;  4O23 A;  4NGM A;  3IFE A;  4PPZ A;  1ZO0 A;  2PJA A;  5EC4 A;  3CT9 A;  3TCV A;  4B12 A;  4JXQ A;  4UBR A;  3LD2 A;  2GLF A;  3N7Z A;  4OLL A;  1X10 A;  3S6H A;  3QAH A;  4FD4 A;  3BJ7 A;  4ZBG A;  2GRE A;  4A32 A;  3JUW A;  2CNS A;  1SQH A;  2PJ9 A;  4P4E A;  4AVC A;  5F48 A;  5J8F A;  4XPL A;  4CGM A;  3NA6 A;  2FIA A;  3VAR A;  1FNO A;  3CPA A;  3TO6 A;  2C1C A;  2PQ8 A;  1TKH A;  2P6F A;  3H8G A;  4M6H A;  1ARM A;  2ZW6 A;  3GY9 A;  4M85 A;  3SJF A;  3CXS A;  4MFP A;  1IY7 A;  4IUS A;  3JRU A;  5AGE A;  2DEA A;  4JZ0 A;  3LOD A;  4P10 A;  2OU2 A;  3RNZ A;  1J4J A;  2GLJ A;  3D3S A;  1ELM P;  5BWA B;  1IOF A;  4CYN A;  3D2P A;  5GCN A;  4OC4 A;  4AG9 A;  2J8N A;  3TO7 A;  5K8N A;  1BAV A;  1BLL E;  2CXA A;  4R8F A;  5HXD A;  1S5K A;  2Z3L A;  3G8W A;  1TXR A;  1MJB A;  1V0C A;  3DGV A;  3B3W A;  1EE3 P;  1Z8W A;  3FH4 A;  3R9G A;  2REE A;  2J8M A;  2OZU A;  5LYD A;  3T8W A;  4LX9 A;  1JWQ A;  2AE6 A;  4BIN A;  4CYQ A;  3SJX A;  2QIR A;  2YNC A;  2DF5 A;  1CBX A;  5ELY A;  4LUA A;  2ZW7 A;  5DWN A;  1RTQ A;  4AVA A;  2BL1 A;  5H84 A;  2A4N A;  2PJC A;  4CAW A;  1IB1 E;  5K8O A;  2HQY A;  2ZEM A;  4C2Y A;  4LQG A;  3GIU A;  1F2P A;  1S7F A;  2PRQ A;  1ON0 A;  5AG7 A;  5DWM A;  2C6P A;  2ZW4 A;  4PK3 A;  3PB9 X;  1KUV A;  4FD6 A;  4FD7 A;  1BOB A;  3D7H A;  3UY5 A;  4NFR A;  2P6E A;  3B35 A;  3FXT A;  4OKO A;  2QYV A;  4R9M A;  4UA3 A;  4KOU A;  1PUA A;  2VZY A;  1QSM A;  1YK3 A;  2PJ0 A;  4W9Y A;  5C88 A;  3P2H A;  4Y49 B;  2P0W A;  3ISX A;  3R9F A;  3BJ8 A;  3DSB A;  3KI9 A;  4FWU A;  3B3V A;  4PV6 A;  3RAM A;  2GE3 A;  3D8P A;  1F57 A;  4MCQ A;  3PP9 A;  1QQ9 A;  1L0C A;  4QUS A;  3DDD A;  5CNP A;  4XNH B;  2C6C A;  4CYO A;  2CTB A;  2PVW A;  4P4I A;  2B4D A;  5KTA A;  4R3K A;  4NGS A;  4MMO A;  1Z2L A;  4UIB A;  2B3V A;  3V38 A;  2Q51 A;  4B5O A;  1YW6 A;  2POK A;  4UEE A;  3IJ3 A;  2QVP A;  2I79 A;  2OH1 A;  3TOB A;  4UEZ A;  4KOY A;  5F49 A;  2PE3 A;  4MHY A;  5EMI A;  2DPT A;  4E2A A;  5LRG A;  1BO4 A;  2G3A A;  2O53 A;  4MJ8 A;  4UFX A;  1ZG9 A;  2EBJ A;  4GM5 A;  4DUK A;  3PZJ A;  4U9Y A;  4H6U A;  4NSQ A;  2O4H A;  4X2T A;  5ISV A;  3LWU A;  5KTC A;  4TNU A;  2ZEG A;  2WYR A;  3IGR A;  4FD5 A;  2ZXV A;  1FY7 A;  1PCA A;  1XBU A;  3K9U A;  3KR4 A;  2OOT A;  3VWD A;  5J8C A;  4CGO A;  1XF8 A;  2AFM A;  2ZEL A;  5F47 A;  2NSM A;  4KOT A;  3S9L A;  4KZT A;  2HUZ A;  3KZW A;  2BCO A;  2VBQ A;  4NGT A;  5LYI A;  5THW A;  2PR8 A;  1IIC A;  4BMH A;  4ZY1 A;  2R98 A;  1B6B A; 
#chains in the Genus database with same CATH homology
 2HV2 A;  2OB0 A;  2Z0Z A;  2Q7B A;  1P4N A;  1MJA A;  4H89 A;  4NXY A;  1YGH A;  4KOS A;  4MFQ A;  2ZPA A;  4K30 A;  4ORF A;  1M44 A;  2YNC C;  5IV0 A;  4H6Z A;  2CNM A;  4MBU A;  3EFA A;  4A95 A;  4QB9 A;  4ZGY B;  3I3G A;  5A27 A;  4Q36 A;  2VI7 A;  5H86 A;  4CAE A;  4MY3 A;  3FB3 A;  2P6G A;  1GHE A;  3D2M A;  4JXR A;  4CGN A;  3F8K A;  1NE9 A;  2Z11 A;  3F5B A;  2WUU A;  4I49 A;  1VKC A;  1I1D A;  3C26 A;  4R87 A;  4C2Z A;  4RS2 A;  4QC6 A;  4CRZ B;  2G0B A;  3VWE A;  1PU9 A;  4F0X A;  3PGP A;  1MK4 A;  4KVM E;  2ZW5 A;  3FIX A;  2B58 A;  2NMT A;  2JDD A;  4J3G A;  4JJX A;  2Q4V A;  3GYA A;  4HNX B;  4KVX A;  3JVN A;  5HH1 A;  4MFL A;  3SXO A;  5JPH A;  5AG4 A;  3FYN A;  2B5G B;  3IWE A;  3TTH A;  3T9Y A;  4C68 A;  1S7K A;  2O28 A;  4PK2 A;  4A2Z A;  2D4O A;  4A33 A;  3S6G A;  3R95 A;  4OAE A;  3JTK A;  2DPS A;  4II9 A;  5E96 A;  2Z3P A;  4KSF A;  4MY0 A;  3DNS A;  3FNC A;  5F46 A;  5C82 A;  4X5K A;  4CYP A;  4MFZ A;  2CNT A;  4KOV A;  2EUI A;  2QEC A;  3DR8 A;  2WPW A;  4B13 A;  4Q38 A;  2WSA A;  1TIQ A;  3G3S A;  1B87 A;  4UFW A;  4AB7 A;  4MHD A;  2Y0M A;  4ONU A;  4E8O A;  5FVJ A;  1YR0 A;  2Z3O A;  1XE4 A;  2VQY A;  4RI1 A;  3NE7 A;  4CAF A;  4KLW A;  3TE4 A;  2PSW A;  2YND A;  5JQ4 A;  4B11 A;  3WR7 A;  1VHS A;  4QVT A;  2IL4 A;  3IU1 A;  4JD6 A;  3R9E A;  2BUE A;  4KUA A;  3TO9 A;  4YRH A;  1IID A;  4KOR A;  3W6X A;  1Q2C A;  4HKF A;  1Y9K A;  2B3U A;  2OZG A;  4L8A A;  1Q2D A;  5KTD A;  2R1I A;  2EVN A;  1OZP A;  1YLE A;  5HMN A;  1I12 A;  4HNY B;  4UWI A;  4CAX A;  4QBJ A;  3SXN A;  1IYK A;  2QML A;  2F5I A;  4EVY A;  4XPK A;  1Z4R A;  3EC4 A;  4XPD C;  4BBH A;  3CXQ A;  3MGD A;  2Q0Y A;  3GKR A;  4B5P A;  2YGW A;  2R8V A;  2VXK A;  3A9L A;  4Y49 C;  1RO5 A;  1S7L A;  4CAV A;  4E0A A;  4KOW A;  1UFH A;  4M3S A;  2Z10 A;  2D4P A;  1I21 A;  1CJW A;  4HNW B;  3S6K A;  1M1D A;  3QB8 A;  3RYO A;  1YVK A;  4GS4 A;  2BEI A;  1M4D A;  4A31 A;  3EO4 A;  2FSR A;  1MJ9 A;  4MFK A;  2YNE A;  3IU2 A;  4CS0 B;  3SHP A;  1S7N A;  3FBU A;  2FCK A;  3W91 A;  1N71 A;  1M4G A;  1LRZ A;  4L89 A;  4KS9 A;  4UCN A;  4AVB A;  1R57 A;  1Y7R A;  4F6A A;  2JDC A;  3F0A A;  2FIW A;  4KVO E;  4A30 A;  2KCW A;  2WPX A;  4U9Z A;  5A28 A;  3OWC A;  4PSX A;  4UCP A;  4CRY B;  2VEZ A;  2I00 A;  1IYL A;  2FE7 A;  2VZZ A;  4CGP A;  1YX0 A;  3BLN A;  3V8I A;  1Z9U A;  2X7B A;  3EXN A;  4MFJ A;  2Z3M A;  5IB0 A;  1QSR A;  3FRM A;  3W6S A;  2B5G A;  2JLM A;  2ATR A;  4NEX A;  2RC4 A;  1U6M A;  5G21 A;  1YRE A;  3CXP A;  2K5T A;  3ZZI A;  1QST A;  1WK4 A;  4C7I A;  4CGL A;  1M4I A;  4NF1 A;  4DNC A;  2Q44 A;  3E0K A;  2JEV A;  3S6F A;  1KUY A;  4C2X A;  1K4J A;  1WWZ A;  2Z3K A;  3R96 A;  1KUX A;  2B4D B;  5AG6 A;  1CM0 A;  2ARH A;  2BSW A;  2PR1 A;  2PC1 A;  4MI4 A;  2FT0 A;  3R1K A;  1P0H A;  1Z4E A;  4KUB A;  1XMT A;  2C27 A;  1S60 A;  5IX3 A;  1XIX A;  1KZF A;  4AG7 A;  1NMT A;  1Y9W A;  4UFV A;  5G22 A;  1RXT A;  4YGO A;  4XNH C;  2B4B A;  3H4Q A;  4OAD A;  4U5Y A;  3TFY A;  2Q4Y A;  4B14 A;  4JWP A;  4NCZ A;  3I9S A;  2DXQ A;  2FL4 A;  4IF5 A;  3EY5 A;  1NSL A;  3H5Z A;  5AG5 A;  4B10 A;  4JLY A;  2J8R A;  1XEB A;  4UWJ A;  2Q04 A;  2AJ6 A;  2FXF A;  1QSN A;  2PDO A;  4KOX A;  3ZJ0 A;  3T90 A;  2CY2 A;  2R7H A;  5G20 A;  2H5M A;  4B5P B;  2FS5 A;  3IWG A;  2REF A;  4PSW A;  5G1Z A;  5EBV A;  1YVO A;  1QSO A;  2GAN A;  2G3T A;  5I0C A;  2Z3N A;  4C7H A;  2OZH A;  4XPD B;  4R57 A;  3P2F A;  3KKW A;  4KLV A;  4YFJ A;  1Q2Y A;  4R3L A;  2PRB A;  3TT2 A;  4F0Y A;  3DR6 A;  3TOA A;  1S3Z A;  2GIV A;  4UCM A;  3B8G A;  4KSA A;  3TCV A;  1ZO0 A;  4B12 A;  5EC4 A;  4JXQ A;  4UBR A;  3LD2 A;  3S6H A;  3N7Z A;  4OLL A;  3QAH A;  4FD4 A;  3BJ7 A;  4ZBG A;  4A32 A;  3JUW A;  2CNS A;  1SQH A;  4AVC A;  5F48 A;  5J8F A;  4XPL A;  4CGM A;  2FIA A;  3TO6 A;  2PQ8 A;  4M85 A;  2P6F A;  2ZW6 A;  3GY9 A;  3CXS A;  4MFP A;  4IUS A;  5AGE A;  3LOD A;  2OU2 A;  1J4J A;  3D3S A;  5BWA B;  4CYN A;  3D2P A;  5GCN A;  2J8N A;  3TO7 A;  2CXA A;  1S5K A;  2Z3L A;  3G8W A;  1MJB A;  1V0C A;  3R9G A;  2REE A;  2J8M A;  2OZU A;  4LX9 A;  2AE6 A;  4CYQ A;  2QIR A;  2YNC A;  4LUA A;  2ZW7 A;  5DWN A;  4AVA A;  2BL1 A;  5H84 A;  2A4N A;  4CAW A;  1IB1 E;  2HQY A;  4C2Y A;  1S7F A;  1ON0 A;  5AG7 A;  5DWM A;  2ZW4 A;  4PK3 A;  1KUV A;  4FD6 A;  4FD7 A;  1BOB A;  3UY5 A;  2P6E A;  4R9M A;  3FXT A;  4UA3 A;  4KOU A;  1PUA A;  2VZY A;  1QSM A;  1YK3 A;  5C88 A;  3P2H A;  4Y49 B;  2P0W A;  3R9F A;  3BJ8 A;  3DSB A;  4PV6 A;  2GE3 A;  3D8P A;  3PP9 A;  1L0C A;  4QUS A;  3DDD A;  5CNP A;  4XNH B;  4CYO A;  2B4D A;  5KTA A;  4R3K A;  2B3V A;  4B5O A;  2I79 A;  2OH1 A;  3TOB A;  5F49 A;  4KOY A;  2DPT A;  4E2A A;  1BO4 A;  2G3A A;  4MJ8 A;  4UFX A;  3PZJ A;  4U9Y A;  4H6U A;  4NSQ A;  5ISV A;  5KTC A;  4AG9 A;  3IGR A;  4FD5 A;  2ZXV A;  1FY7 A;  3VWD A;  5J8C A;  3K9U A;  4CGO A;  1XF8 A;  5F47 A;  4KOT A;  4KZT A;  2HUZ A;  2VBQ A;  2PR8 A;  1IIC A;  4BMH A;  2R98 A;  1B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...