3P2FA

Crystal structure of tofi in an apo form
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
194
structure length
175
Chain Sequence
MQTFVHEAGRLPAHIAAELGSYRYRVFVEQLKMERDQYDRDDTVYVLGRDANGEICGCARLLPTTRPYLLQEVFPHLLADEAPRSAHVWELSRFAATAWSVRPMLAAAVECAARRGARQLIGVTFCSMERMFRRIGVHAHRAGAPVSIDGRMVVACWIDIDAQTLAALDLDPALC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AHL synthase
publication title Small-molecule inhibitor binding to an N-acyl-homoserine lactone synthase
pubmed doi rcsb
source organism Burkholderia glumae
molecule tags Signaling protein
total genus 52
structure length 175
sequence length 194
ec nomenclature
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3p2fA00
1YGHA 4M85A 1Q2YA 2P6EA 3TE4A 2O28A 2REEA 1Y9KA 1IICA 2BUEA 2OZHA 5CNPA 5E96A 2FSRA 3TT2A 1VHSA 4MY0A 1FY7A 2Q4VA 4B5PB 2BSWA 3FIXA 4YFJA 3G3SA 4FD6A 2OB0A 2FE7A 3DR6A 1YK3A 2GIVA 1I12A 2ZW7A 4QC6A 1QSTA 3D2MA 4XPKA 2OU2A 1GHEA 1Y7RA 1BOBA 3P2HA 4F6AA 1QSOA 2F5IA 3T90A 4MY3A 4KZTA 1QSNA 3GKRA 4M3SA 2H5MA 4AB7A 4PK3A 3E0KA 3N7ZA 4I49A 4Y49B 2RC4A 4R9MA 1LRZA 3TO9A 3GYAA 1IIDA 3IGRA 4KOYA 1KUYA 5I0CA 3JVNA 2B5GB 1YR0A 2BL1A 4ORFA 4KOSA 1QSRA 3F0AA 5IB0A 3S6GA 2D4PA 3NE7A 1Z9UA 2ZW6A 2FL4A 5JPHA 2FS5A 4FD7A 1WWZA 4UA3A 3RYOA 4JD6A 2PR8A 2P0WA 4XNHB 3KKWA 2B3UA 5KTDA 3TOBA 4OLLA 1L0CA 2FCKA 4NEXA 1SQHA 3D2PA 2GANA 4IF5A 3ZJ0A 4B5PA 4PV6A 1UFHA 1S3ZA 2PSWA 2ZW5A 2FXFA 3BJ8A 4X5KA 1MJAA 3DDDA 2OZGA 4KVXA 3PZJA 4YGOA 3OWCA 4R3LA 5ISVA 2G3TA 3CXQA 3W91A 3PP9A 3W6XA 4KOXA 4E8OA 4LUAA 1ON0A 2Q44A 4NCZA 1B6BA 1S7KA 1Q2DA 5F47A 5EBVA 1YLEA 3R9GA 4GS4A 3I3GA 3LD2A 2A4NA 5F48A 2Z11A 4CAVA 3EC4A 4R3KA 3CXPA 3D3SA 4NXYA 2D4OA 2ZW4A 3VWDA 2DXQA 2HUZA 2R7HA 4JWPA 5HMNA 2PDOA 3D8PA 2FIAA 2REFA 3TCVA 2R98A 2CY2A 3TOAA 2NMTA 4KORA 1VKCA 4AVAA 5KTCA 3I9SA 2PRBA 2B5GA 4KVME 1S7NA 4L89A 4AVBA 2BEIA 5FVJA 3W6SA 4AVCA 4OADA 3K9UA 4KOVA 4QB9A 4U5YA 2CNMA 3C26A 2WPWA 2KCWA 4YRHA 2VZZA 1KUVA 2G0BA 1PU9A 4NSQA 3TO7A 1Q2CA 4IUSA 1PUAA 4II9A 4HNYB 3CXSA 3F8KA 3R9FA 5DWNA 3ZZIA 3EY5A 1YREA 1KZFA 3QB8A 2JDCA 2I00A 1XF8A 4AG9A 2CNSA 4OAEA 3FNCA 2OH1A 1XMTA 1XIXA 2I79A 2FT0A 1IYKA 4KUAA 4MHDA 5F49A 2VI7A 4CRZB 1IB1E 2PC1A 4MBUA 3MGDA 3LODA 4NF1A 4H6ZA 3TFYA 4JXRA 4XPDC 4UBRA 4MJ8A 4KOTA 1V0CA 1M44A 2B4BA 4FD4A 2ATRA 2HV2A 2Q7BA 3R96A 4LX9A 1MJ9A 2ARHA 3JUWA 3QAHA 3VWEA 2B58A 4UWIA 3TTHA 1Y9WA 4H89A 1XEBA 4ZBGA 2EVNA 4HNWB 3R9EA 1M4IA 3FYNA 2HQYA 4JLYA 3S6FA 4PSWA 4U9YA 4CAWA 3H4QA 2J8MA 5KTAA 2AE6A 2K5TA 5EC4A 3PGPA 1S60A 1MK4A 3B8GA 5J8FA 5IX3A 1BO4A 2VZYA 4KVOE 1RO5A 2OZUA 4Y49C 4BMHA 4QBJA 4KUBA 2QIRA 4PSXA 4CS0B 1NMTA 3F5BA 3DR8A 4UWJA 4K30A 3FBUA 2WPXA 1P4NA 1NSLA 3GY9A 4ONUA 5HH1A 4XPLA 2Z0ZA 3EO4A 1S5KA 4MI4A 1P0HA 2B3VA 1M4DA 2PR1A 1M1DA 3BLNA 3R1KA 5C82A 1Z4EA 2B4DB 2JLMA 2Q0YA 3FXTA 2ZXVA 3SXOA 2P6FA 2QMLA 1IYLA 4QUSA 2JEVA 5C88A 3G8WA 4KLWA 3V8IA 2Q4YA 3DNSA 4CRYB 1S7LA 2C27A 1CJWA 4KOWA 4XNHC 4HNXB 3S6KA 3EXNA 3EFAA 1NE9A 1YVOA 1U6MA 5J8CA 2PQ8A 3SXNA 4R57A 2Q04A 2Y0MA 4B5OA 4KLVA 4AG7A 3SHPA 4CAXA 1I1DA 3S6HA 1R57A 4JXQA 2VXKA 1MJBA 4HKFA 4DNCA 1XE4A 3FRMA 5H84A 2VBQA 1I21A 4J3GA 1K4JA 1M4GA 2GE3A 2QECA 2R1IA 1Z4RA 2CNTA 1N71A 4JJXA 2G3AA 3DSBA 2IL4A 4E2AA 5DWMA 1S7FA 4E0AA 2P6GA 4F0YA 4PK2A 2ZPAA 5JQ4A 4H6UA 3FB3A 2X7BA 5GCNA 3R95A 3WR7A 4RI1A 4EVYA 4QVTA 5IV0A 1RXTA 1J4JA 1B87A 4R87A 2JDDA 2VQYA 2Z10A 3BJ7A 1YX0A 2EUIA 5F46A 1QSMA 2J8RA 4FD5A 1TIQA 4KOUA 1WK4A 2J8NA 3P2FA 2R8VA 4L8AA 1CM0A 2FIWA 2VEZA 4RS2A 4U9ZA 2B4DA 3TO6A 3IWGA 3UY5A 2AJ6A 1OZPA 5H86A 1YVKA 1KUXA 4XPDB 3T9YA
chains in the Genus database with same CATH superfamily
1YGHA 4P4DA 4M85A 4A33A 1Q2YA 2P6EA 4CAFA 3TE4A 2O28A 3JTKA 2REEA 1Y9KA 3DGVA 1IICA 2BUEA 2OZHA 5CNPA 4A31A 1H8LA 2Z3KA 3NE8A 1DE4C 2FSRA 5E96A 3TT2A 4P6YA 2PCUA 4OMEA 1VHSA 2PJ4A 4B6ZA 4CAEA 3ISXA 4MY0A 1FY7A 2Q4VA 4A37A 2BSWA 4B5PB 3K9TA 3FIXA 2ZEDA 3WABA 5HVHA 1M4LA 1YSJA 3PB9X 4MHZA 4YFJA 4H2KA 3G3SA 3H8EA 1Q7LA 4NGRA 4FD6A 1ZG9A 2OB0A 2FE7A 2NYQA 3DR6A 1YK3A 3WT4A 5THWA 4UEZA 2GIVA 1I12A 2O4HA 1PCAA 2ZW7A 3VARA 4RUHA 4QC6A 1QSTA 3D2MA 1XBUA 4GXHA 2OU2A 4XPKA 3NA6A 2QJ8A 3PB6X 1GHEA 3BI0A 1Y7RA 1BOBA 2RB7A 3P2HA 3NFZA 4F6AA 3IC1A 1QSOA 2F5IA 4MCSA 3T90A 4C7HA 4K3NA 1IGBA 2V8GA 4MY3A 4KZTA 3ISZA 1QSNA 4C2YA 5LRKA 3GKRA 2ZEGA 5D8NA 3D7GA 3RZAA 4NFRA 4M3SA 3WC6A 2H5MA 4AB7A 1AYEA 4UCMA 4TNUA 2DPTA 3SJXA 4IHMA 1LOKA 4P4JA 4PK3A 3LACA 3GB0A 4YU9A 2V77A 4M6IA 2AFSA 3E0KA 3N7ZA 1BLLE 4I49A 4Y49B 4ZI6A 4KSIA 2RC4A 4X3RA 3SI2A 4PPZA 1EE3P 1LRZA 4MFPA 4R9MA 4C2XA 1CG2A 3LMSA 2EWBA 3TO9A 2ZENA 3GYAA 1IIDA 3IGRA 2I3CA 4KOYA 1CPSA 1KUYA 5I0CA 3FMCA 4B14A 4JZ0A 1Z8TA 3BXMA 2XEGA 4O23A 3JVNA 2PJAA 2B5GB 3PBBA 1YR0A 2BL1A 2ZEMA 4ORFA 4PQAA 4KOSA 1QSRA 3F0AA 5G1ZA 3S9MA 5IB0A 3S6GA 2D4PA 1DTDA 3NE7A 1Z9UA 2ZW6A 5LRJA 8CPAA 2FL4A 3B7IA 3IFEA 2CIJA 5JPHA 5K8NA 3QNVA 1VIXA 2FS5A 4FD7A 1WWZA 4UA3A 3CZXA 4NGTA 3RYOA 2EBJA 4DYOA 4JD6A 2ODFA 2PR8A 4MCQA 3KHXA 1KWMA 2P0WA 4XNHB 5LYDA 3KKWA 2B3UA 5EMIA 5KTDA 3TOBA 4OLLA 2JEWA 1L0CA 2WUUA 4UEEA 3KASA 2FCKA 3PFEA 1Y7EA 3MRUA 3IWWA 4MFZA 4R76A 2PE3A 4NEXA 1SQHA 3KI9A 3D2PA 1LAPA 2GANA 3K2KA 4IF5A 4B11A 2Z3MA 4UIAA 3ZJ0A 3FH4A 1YLOA 2GREA 4NGQA 1Z8LA 4B5PA 4PV6A 1UFHA 1S3ZA 1FT7A 2PSWA 4FBEA 2CXAA 3B3SA 4ONWA 4DUKA 2ZW5A 2FXFA 3BJ8A 2PJCA 2FVGA 2YNCA 3FX6A 4X5KA 4X2TA 1MJAA 4B12A 4MHNA 3DDDA 4A2ZA 4P4EA 3L2NA 2OZGA 4KVXA 2CTCA 4FAIA 3PZJA 4YGOA 3OWCA 4R3LA 3SJFA 3D66A 5ISVA 2EO8A 2G3TA 3CXQA 3W91A 2Z3PA 3PP9A 3W6XA 4Z65A 5AG6A 1ZG8A 3GLJA 4KOXA 3IU2A 3H5ZA 2PJ0A 4E8OA 4LUAA 3JRUA 4F0XA 1ON0A 5LRGA 2Q44A 5J1QA 4UFVA 5AG5A 4NCZA 1B6BA 1S7KA 3D7DA 4PXCA 1Q2DA 5F47A 2PJ2A 5EBVA 1YLEA 3R9GA 4KS9A 4GS4A 3I3GA 3LD2A 4NGNA 4OC3A 2A4NA 5F48A 3NH5A 4PXEA 3HUVA 4MRIA 2ABZA 2Z11A 3EC4A 1Z5RA 2HB6A 2PJ5A 3CXPA 4R3KA 2ZEPA 3D3SA 4NXYA 4CGMA 2D4OA 1Z8XA 2XEJA 2DPSA 2ZW4A 3VWDA 1VHOA 2DXQA 2YNEA 5LYIA 2HUZA 5CBMA 5HXDA 1X10A 4ZYQA 1XRYA 3D7HA 2R7HA 4UFXA 2PJ8A 1BPMA 4JWPA 1HEEA 5HMNA 2DEAA 2PDOA 3D8PA 4OKOA 1YW6A 1F57A 1CPXA 2FIAA 2REFA 4CGPA 5DS0A 3TCVA 1IOFA 2Q43A 4Q7AA 1OBRA 4A38A 5JM6A 2R98A 2CY2A 3TOAA 4CGOA 2OR4A 2BO9A 4P4BA 4JYWA 2NMTA 1TKJA 2Z3NA 4KORA 1VKCA 3IU1A 1FNOA 1CP6A 4C68A 2PJ9A 4AVAA 5KTCA 3I9SA 2PRBA 4NJQA 4GM5A 2IJZA 2B5GA 2WSAA 4KVME 3RAMA 2Z3OA 5I4MA 1S7NA 3H8FA 5K8OA 4CYQA 4L89A 4MMOA 4AVBA 2BEIA 5FVJA 2AFXA 3W6SA 4AVCA 2ANPA 1ZG7A 3K9UA 3IO1A 4OADA 4KOVA 4QB9A 4U5YA 3SI0A 4FWUA 2V8DA 2CNMA 4MCPA 2Q7SA 3V7ZA 4A94A 3C26A 2WPWA 2KCWA 4OC0A 2C6GA 5CPAA 4YRHA 3S9LA 3HLPA 2J9AA 2VZZA 1KUVA 2G0BA 1PU9A 4NSQA 3TO7A 1Q2CA 4P44A 2JBKA 2PVWA 4IUSA 1PUAA 2ZOFA 4HNYB 4II9A 3CXSA 3F8KA 3R9FA 1XMBA 1ARLA 4OC5A 4UCPA 1TXRA 5DWNA 1HDUA 3ZZIA 3EY5A 1JWQA 5F09A 1YREA 1QMUA 1KZFA 3QB8A 2JDCA 2I00A 1XF8A 5HVGA 3DLJA 4OIWA 2CNSA 4AG9A 4OAEA 5AG4A 3FNCA 2OH1A 1XMTA 1XOVA 3RNZA 1XIXA 3NH4A 2I79A 2PIYA 2QYVA 4X8IA 2FT0A 5G22A 1IYKA 1X12A 4KUAA 4W9YA 3CPAA 4ZX8A 3MN8A 2PJ3A 3KGQA 4MHDA 5F49A 3BI1A 2PVVA 4HPSA 2VI7A 4PXDA 4A30A 4CRZB 4EFDA 1ARMA 1IB1E 3KHZA 4EWTA 2CF4A 2PC1A 3TC8A 4MBUA 2XEFA 3MGDA 3LODA 3I1UA 3KR4A 2PJ6A 4IAVA 4NF1A 4H6ZA 3TFYA 4CGLA 4JXRA 4XPDC 4UBRA 4MHYA 4WJBA 3S9NA 4MJ8A 4KOTA 4AXVA 3PBEA 2PJBA 2BCOA 2PRQA 2DF5A 1V0CA 1M44A 2B4BA 4FD4A 3KQZA 2ATRA 1TF8A 2HV2A 4MXUA 2Q7BA 3R96A 4MFKA 4DJLA 1YQEA 5ELYA 4F9VA 3FF3A 1VHEA 4M6HA 4WWVA 4LX9A 4MFJA 1MJ9A 4CPAA 2ARHA 3JUWA 5BWAB 3QAHA 3VWEA 2GFQA 5AG7A 2OOTA 2B58A 4UWIA 2PIZA 1XJOA 3TTHA 4UFWA 1Y9WA 2YNCC 4H89A 5JGFA 4BD9A 1UWYA 1XEBA 4ZBGA 5HVFA 2EVNA 2V8VA 3FJUA 2ZELA 1ZLHA 3SJGA 1YMEA 1TKFA 1TF9A 4OC1A 2IQ6A 3VH9A 4MCRA 4HNWB 3R9EA 1M4IA 1ELMP 3FYNA 2G9DA 3KZWA 2HQYA 2C6PA 4JLYA 3S6FA 4PSWA 4U9YA 4CAWA 2JBJA 2GU2A 2QVPA 1LFWA 3B2YA 3H4QA 1QQ9A 4NGMA 4M6GA 4CGNA 2J8MA 2ZEFA 5KTAA 5LYLA 2AE6A 2BOAA 2EK8A 2K5TA 5EC4A 3PGPA 4B13A 2AFWA 1S60A 1Z2LA 1AUGA 1MK4A 3B8GA 5J8FA 5IX3A 1BO4A 3D67A 3D7FA 2VZYA 1Y0YA 3PB8X 4KVOE 4KSFA 2AFZA 3VATA 2YNDA 1RO5A 2OZUA 4Y49C 4BMHA 4QBJA 4UF4A 4KUBA 2C6CA 4CYPA 3SI1A 2GLJA 2QIRA 4PSXA 4CS0B 1NMTA 1ZLIA 2GLFA 3B35A 3F5BA 3DR8A 4UWJA 4K30A 3FBUA 2WPXA 1P4NA 1NSLA 2ZEHA 3GY9A 4ONUA 4ZX9A 4YWYA 4P4FA 1R43A 1YW4A 5HH1A 4ZGYB 4UIBA 4XPLA 1RTQA 2Z0ZA 3EO4A 1S5KA 4MI4A 1P0HA 3FECA 2B3VA 1M4DA 4IK2A 2PR1A 1M1DA 3GIUA 4NGPA 4BINA 5G20A 1CP7A 3BLNA 3R1KA 5C82A 1Z4EA 1F2OA 2AFMA 2B4DB 2JLMA 2Q0YA 3FXTA 2ZXVA 4NGSA 4R8FA 2P6FA 3SXOA 1IYLA 2QMLA 4QUSA 2JEVA 3PEIA 3FVLA 1CX8A 3B3WA 4OIDA 5C88A 1TKHA 4C2ZA 2IMOA 3G8WA 4KLWA 4OC4A 4Q36A 3IWEA 4RN7A 3V8IA 4MFLA 4F8ZA 3B3TA 2Q4YA 1AMPA 3DNSA 3IIBA 5IB9A 1PYTB 4CRYB 1S7LA 2C27A 1CJWA 4KOWA 3KL9A 4XNHC 1BPNA 4ZY0A 4HNXB 3NH8A 4A32A 3S6KA 3BHXA 3EXNA 5A27A 2C1CA 3EFAA 1HDQA 4NJRA 1NE9A 2ZEOA 3PFOA 1YVOA 3RBUA 4PXBA 3V38A 1U6MA 5J8CA 2PQ8A 3A9LA 1R3NA 4G1PA 3SXNA 4F9UA 4R57A 2Q04A 2Y0MA 4B5OA 4KLVA 4AG7A 3SHPA 4CAXA 1Y0RA 3QAYA 1IOIA 1I1DA 3S6HA 3GUXA 1XFOA 4B10A 1R57A 4JXQA 4CYOA 1JQGA 1GYTA 2F8HA 1MJBA 2VXKA 3D68A 4HKFA 4LQ6A 4OC2A 3SJEA 4DNCA 5K8MA 1XE4A 3FRMA 3D4UA 1Z8WA 3PB4X 5H84A 2VBQA 1I21A 2Q4ZA 1A2ZA 4J3GA 4MHPA 5LYFA 1K4JA 1M4GA 3IEHA 2GE3A 2QECA 2R1IA 4LQGA 2WYRA 1Z4RA 2CNTA 1LAMA 4TWEA 1N71A 1NSAA 4UEFA 4Q38A 2VL1A 4JJXA 2G3AA 3DSBA 2IL4A 4R6TA 4CAVA 4C7IA 3T8WA 4E2AA 5DWMA 1S7FA 4E0AA 2P6GA 4R7MA 5JH9A 2PJ7A 3PB7X 3LWUA 2XEIA 4F0YA 4PK2A 2ZPAA 5G21A 4BBHA 5JQ4A 4H6UA 3FB3A 2X7BA 3CPXA 2POKA 5GCNA 2AFUA 3R95A 3WR7A 4RI1A 4A39A 4QVTA 4EVYA 2ZEEA 4UCNA 5IV0A 1LCPA 1RXTA 1J4JA 1B87A 3B3VA 3WC7A 4R87A 6CPAA 2JDDA 2VQYA 1F2PA 2Z10A 3CT9A 3BJ7A 1YX0A 3TX8A 2EUIA 1IU8A 1ZO0A 2F7VA 3FEDA 5F46A 1QSMA 2RFHA 5A28A 2J8RA 4ZY2A 5D29A 4CYNA 4FD5A 2YGWA 1TIQA 1IY7A 3FEEA 3N5FA 1BAVA 4KOUA 2WZNA 4MFQA 1WK4A 5K8PA 2Q51A 2J8NA 1CBXA 4P4IA 3B3CA 2V8HA 3KQXA 5AGEA 3P2FA 4KSAA 3IJ3A 2R8VA 4L8AA 4P10A 2CTBA 4A95A 2EK9A 1VGYA 2O53A 1CM0A 2FIWA 2NSMA 2VEZA 4RS2A 4U9ZA 3RO0A 2B4DA 2HC9A 3TO6A 4OP4A 7CPAA 3IWGA 3CDXA 4P45A 1LANA 3UY5A 2AJ6A 3H8GA 3KR5A 1OZPA 3PRTA 2ZOGA 5H86A 1YVKA 1KUXA 2AFOA 3WC5A 4FUUA 2Z3LA 4XPDB 2PJ1A 3T9YA 4ZY1A 1ELLP 4EMEA
chains in the Genus database with same CATH topology
1YGHA 4M85A 4A33A 1Q2YA 2P6EA 4CAFA 3TE4A 2O28A 3JTKA 2REEA 1Y9KA 1IICA 2BUEA 2OZHA 5CNPA 4A31A 2Z3KA 5E96A 2FSRA 3TT2A 1VHSA 4CAEA 4MY0A 1FY7A 2Q4VA 4B5PB 2BSWA 3FIXA 4YFJA 3G3SA 4FD6A 2OB0A 2FE7A 3DR6A 1YK3A 2GIVA 1I12A 2ZW7A 4QC6A 1QSTA 3D2MA 4XPKA 2OU2A 1GHEA 1Y7RA 1BOBA 3P2HA 4F6AA 1QSOA 2F5IA 3T90A 4C7HA 4MY3A 4KZTA 1QSNA 4C2YA 3GKRA 4M3SA 2H5MA 4AB7A 4UCMA 2DPTA 4PK3A 3E0KA 3N7ZA 4I49A 4Y49B 2RC4A 4R9MA 1LRZA 4MFPA 4C2XA 3TO9A 3GYAA 1IIDA 3IGRA 4KOYA 1KUYA 5I0CA 4B14A 3JVNA 2B5GB 1YR0A 2BL1A 4ORFA 5G1ZA 4KOSA 1QSRA 3F0AA 5IB0A 3S6GA 2D4PA 3NE7A 1Z9UA 2ZW6A 2FL4A 5JPHA 2FS5A 4FD7A 1WWZA 4UA3A 3RYOA 4JD6A 2PR8A 2P0WA 4XNHB 3KKWA 2B3UA 5KTDA 3TOBA 4OLLA 1L0CA 2WUUA 2FCKA 4MFZA 4NEXA 1SQHA 3D2PA 2GANA 4IF5A 4B11A 2Z3MA 3ZJ0A 4B5PA 4PV6A 1UFHA 1S3ZA 2PSWA 2CXAA 2ZW5A 2FXFA 3BJ8A 4X5KA 2YNCA 4B12A 1MJAA 3DDDA 4A2ZA 2OZGA 4KVXA 3PZJA 4YGOA 3OWCA 4R3LA 5ISVA 2G3TA 3CXQA 3W91A 2Z3PA 3PP9A 3W6XA 5AG6A 4KOXA 3IU2A 3H5ZA 4E8OA 4LUAA 4F0XA 1ON0A 2Q44A 4UFVA 5AG5A 4NCZA 1B6BA 1S7KA 1Q2DA 5F47A 5EBVA 1YLEA 3R9GA 4KS9A 4GS4A 3I3GA 3LD2A 2A4NA 5F48A 2Z11A 4CAVA 3EC4A 4R3KA 4CGMA 3CXPA 3D3SA 4NXYA 2D4OA 2DPSA 2ZW4A 3VWDA 2DXQA 2YNEA 2HUZA 2R7HA 4UFXA 4JWPA 5HMNA 2PDOA 3D8PA 2FIAA 4CGPA 2REFA 3TCVA 2R98A 2CY2A 3TOAA 4CGOA 2NMTA 2Z3NA 4KORA 1VKCA 3IU1A 4C68A 4AVAA 5KTCA 3I9SA 2PRBA 2B5GA 2WSAA 4KVME 2Z3OA 1S7NA 4CYQA 4L89A 4AVBA 2BEIA 5FVJA 3W6SA 4AVCA 4OADA 3K9UA 4KOVA 4QB9A 4U5YA 2CNMA 3C26A 2WPWA 2KCWA 4YRHA 2VZZA 1KUVA 2G0BA 1PU9A 4NSQA 3TO7A 1Q2CA 4IUSA 1PUAA 4II9A 4HNYB 3CXSA 3F8KA 3R9FA 4UCPA 5DWNA 3ZZIA 3EY5A 1YREA 1KZFA 3QB8A 2JDCA 2I00A 1XF8A 4AG9A 2CNSA 4OAEA 5AG4A 3FNCA 2OH1A 1XMTA 1XIXA 2I79A 2FT0A 5G22A 1IYKA 4KUAA 4MHDA 5F49A 4A30A 2VI7A 4CRZB 1IB1E 2PC1A 4MBUA 3MGDA 3LODA 4NF1A 4H6ZA 3TFYA 4CGLA 4JXRA 4XPDC 4UBRA 4MJ8A 4KOTA 1V0CA 1M44A 2B4BA 4FD4A 2ATRA 2HV2A 2Q7BA 3R96A 4MFKA 4LX9A 4MFJA 1MJ9A 2ARHA 3JUWA 5BWAB 3QAHA 3VWEA 5AG7A 2B58A 4UWIA 3TTHA 4UFWA 1Y9WA 2YNCC 4H89A 1XEBA 4ZBGA 2EVNA 4HNWB 3R9EA 1M4IA 3FYNA 2HQYA 4JLYA 3S6FA 4PSWA 4U9YA 4CAWA 3H4QA 4CGNA 2J8MA 5KTAA 2AE6A 2K5TA 5EC4A 3PGPA 4B13A 1S60A 1MK4A 3B8GA 5J8FA 5IX3A 1BO4A 2VZYA 4KVOE 4KSFA 2YNDA 1RO5A 2OZUA 4Y49C 4BMHA 4QBJA 4KUBA 4CYPA 2QIRA 4PSXA 4CS0B 1NMTA 3F5BA 3DR8A 4UWJA 4K30A 3FBUA 2WPXA 1P4NA 1NSLA 3GY9A 4ONUA 5HH1A 4ZGYB 4XPLA 2Z0ZA 3EO4A 1S5KA 4MI4A 1P0HA 2B3VA 1M4DA 2PR1A 1M1DA 5G20A 3BLNA 3R1KA 5C82A 1Z4EA 2B4DB 2JLMA 2Q0YA 3FXTA 2ZXVA 3SXOA 2P6FA 2QMLA 1IYLA 4QUSA 2JEVA 5C88A 4C2ZA 4Q36A 3G8WA 4KLWA 3IWEA 3V8IA 4MFLA 2Q4YA 3DNSA 4CRYB 1S7LA 2C27A 1CJWA 4KOWA 4XNHC 4HNXB 4A32A 3S6KA 3EXNA 5A27A 3EFAA 1NE9A 1YVOA 1U6MA 5J8CA 2PQ8A 3A9LA 3SXNA 4R57A 2Q04A 2Y0MA 4B5OA 4KLVA 4AG7A 3SHPA 4CAXA 1I1DA 3S6HA 4B10A 1R57A 4JXQA 4CYOA 2VXKA 1MJBA 4HKFA 4DNCA 1XE4A 3FRMA 5H84A 2VBQA 1I21A 4J3GA 1K4JA 1M4GA 2GE3A 2QECA 2R1IA 1Z4RA 2CNTA 1N71A 4Q38A 4JJXA 2G3AA 3DSBA 2IL4A 4C7IA 4E2AA 5DWMA 1S7FA 4E0AA 2P6GA 4F0YA 4PK2A 2ZPAA 5G21A 4BBHA 5JQ4A 4H6UA 3FB3A 2X7BA 5GCNA 3R95A 3WR7A 4RI1A 4EVYA 4QVTA 4UCNA 5IV0A 1RXTA 1J4JA 1B87A 4R87A 2JDDA 2VQYA 2Z10A 3BJ7A 1YX0A 2EUIA 1ZO0A 5F46A 1QSMA 5A28A 2J8RA 4CYNA 4FD5A 2YGWA 1TIQA 4KOUA 4MFQA 1WK4A 2J8NA 5AGEA 3P2FA 4KSAA 2R8VA 4L8AA 4A95A 1CM0A 2FIWA 2VEZA 4RS2A 4U9ZA 2B4DA 3TO6A 3IWGA 3UY5A 2AJ6A 1OZPA 5H86A 1YVKA 1KUXA 2Z3LA 4XPDB 3T9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGH A;  4M85 A;  1Q2Y A;  2P6E A;  3TE4 A;  2O28 A;  2REE A;  1Y9K A;  1IIC A;  2BUE A;  2OZH A;  5CNP A;  5E96 A;  2FSR A;  3TT2 A;  1VHS A;  4MY0 A;  1FY7 A;  2Q4V A;  4B5P B;  2BSW A;  3FIX A;  4YFJ A;  3G3S A;  4FD6 A;  2OB0 A;  2FE7 A;  3DR6 A;  1YK3 A;  2GIV A;  1I12 A;  2ZW7 A;  4QC6 A;  1QST A;  3D2M A;  4XPK A;  2OU2 A;  1GHE A;  1Y7R A;  1BOB A;  3P2H A;  4F6A A;  1QSO A;  2F5I A;  3T90 A;  4MY3 A;  4KZT A;  1QSN A;  3GKR A;  4M3S A;  2H5M A;  4AB7 A;  4PK3 A;  3E0K A;  3N7Z A;  4I49 A;  4Y49 B;  2RC4 A;  4R9M A;  1LRZ A;  3TO9 A;  3GYA A;  1IID A;  3IGR A;  4KOY A;  1KUY A;  5I0C A;  3JVN A;  2B5G B;  1YR0 A;  2BL1 A;  4ORF A;  4KOS A;  1QSR A;  3F0A A;  5IB0 A;  3S6G A;  2D4P A;  3NE7 A;  1Z9U A;  2ZW6 A;  2FL4 A;  5JPH A;  2FS5 A;  4FD7 A;  1WWZ A;  4UA3 A;  3RYO A;  4JD6 A;  2PR8 A;  2P0W A;  4XNH B;  3KKW A;  2B3U A;  5KTD A;  3TOB A;  4OLL A;  1L0C A;  2FCK A;  4NEX A;  1SQH A;  3D2P A;  2GAN A;  4IF5 A;  3ZJ0 A;  4B5P A;  4PV6 A;  1UFH A;  1S3Z A;  2PSW A;  2ZW5 A;  2FXF A;  3BJ8 A;  4X5K A;  1MJA A;  3DDD A;  2OZG A;  4KVX A;  3PZJ A;  4YGO A;  3OWC A;  4R3L A;  5ISV A;  2G3T A;  3CXQ A;  3W91 A;  3PP9 A;  3W6X A;  4KOX A;  4E8O A;  4LUA A;  1ON0 A;  2Q44 A;  4NCZ A;  1B6B A;  1S7K A;  1Q2D A;  5F47 A;  5EBV A;  1YLE A;  3R9G A;  4GS4 A;  3I3G A;  3LD2 A;  2A4N A;  5F48 A;  2Z11 A;  4CAV A;  3EC4 A;  4R3K A;  3CXP A;  3D3S A;  4NXY A;  2D4O A;  2ZW4 A;  3VWD A;  2DXQ A;  2HUZ A;  2R7H A;  4JWP A;  5HMN A;  2PDO A;  3D8P A;  2FIA A;  2REF A;  3TCV A;  2R98 A;  2CY2 A;  3TOA A;  2NMT A;  4KOR A;  1VKC A;  4AVA A;  5KTC A;  3I9S A;  2PRB A;  2B5G A;  4KVM E;  1S7N A;  4L89 A;  4AVB A;  2BEI A;  5FVJ A;  3W6S A;  4AVC A;  4OAD A;  3K9U A;  4KOV A;  4QB9 A;  4U5Y A;  2CNM A;  3C26 A;  2WPW A;  2KCW A;  4YRH A;  2VZZ A;  1KUV A;  2G0B A;  1PU9 A;  4NSQ A;  3TO7 A;  1Q2C A;  4IUS A;  1PUA A;  4II9 A;  4HNY B;  3CXS A;  3F8K A;  3R9F A;  5DWN A;  3ZZI A;  3EY5 A;  1YRE A;  1KZF A;  3QB8 A;  2JDC A;  2I00 A;  1XF8 A;  4AG9 A;  2CNS A;  4OAE A;  3FNC A;  2OH1 A;  1XMT A;  1XIX A;  2I79 A;  2FT0 A;  1IYK A;  4KUA A;  4MHD A;  5F49 A;  2VI7 A;  4CRZ B;  1IB1 E;  2PC1 A;  4MBU A;  3MGD A;  3LOD A;  4NF1 A;  4H6Z A;  3TFY A;  4JXR A;  4XPD C;  4UBR A;  4MJ8 A;  4KOT A;  1V0C A;  1M44 A;  2B4B A;  4FD4 A;  2ATR A;  2HV2 A;  2Q7B A;  3R96 A;  4LX9 A;  1MJ9 A;  2ARH A;  3JUW A;  3QAH A;  3VWE A;  2B58 A;  4UWI A;  3TTH A;  1Y9W A;  4H89 A;  1XEB A;  4ZBG A;  2EVN A;  4HNW B;  3R9E A;  1M4I A;  3FYN A;  2HQY A;  4JLY A;  3S6F A;  4PSW A;  4U9Y A;  4CAW A;  3H4Q A;  2J8M A;  5KTA A;  2AE6 A;  2K5T A;  5EC4 A;  3PGP A;  1S60 A;  1MK4 A;  3B8G A;  5J8F A;  5IX3 A;  1BO4 A;  2VZY A;  4KVO E;  1RO5 A;  2OZU A;  4Y49 C;  4BMH A;  4QBJ A;  4KUB A;  2QIR A;  4PSX A;  4CS0 B;  1NMT A;  3F5B A;  3DR8 A;  4UWJ A;  4K30 A;  3FBU A;  2WPX A;  1P4N A;  1NSL A;  3GY9 A;  4ONU A;  5HH1 A;  4XPL A;  2Z0Z A;  3EO4 A;  1S5K A;  4MI4 A;  1P0H A;  2B3V A;  1M4D A;  2PR1 A;  1M1D A;  3BLN A;  3R1K A;  5C82 A;  1Z4E A;  2B4D B;  2JLM A;  2Q0Y A;  3FXT A;  2ZXV A;  3SXO A;  2P6F A;  2QML A;  1IYL A;  4QUS A;  2JEV A;  5C88 A;  3G8W A;  4KLW A;  3V8I A;  2Q4Y A;  3DNS A;  4CRY B;  1S7L A;  2C27 A;  1CJW A;  4KOW A;  4XNH C;  4HNX B;  3S6K A;  3EXN A;  3EFA A;  1NE9 A;  1YVO A;  1U6M A;  5J8C A;  2PQ8 A;  3SXN A;  4R57 A;  2Q04 A;  2Y0M A;  4B5O A;  4KLV A;  4AG7 A;  3SHP A;  4CAX A;  1I1D A;  3S6H A;  1R57 A;  4JXQ A;  2VXK A;  1MJB A;  4HKF A;  4DNC A;  1XE4 A;  3FRM A;  5H84 A;  2VBQ A;  1I21 A;  4J3G A;  1K4J A;  1M4G A;  2GE3 A;  2QEC A;  2R1I A;  1Z4R A;  2CNT A;  1N71 A;  4JJX A;  2G3A A;  3DSB A;  2IL4 A;  4E2A A;  5DWM A;  1S7F A;  4E0A A;  2P6G A;  4F0Y A;  4PK2 A;  2ZPA A;  5JQ4 A;  4H6U A;  3FB3 A;  2X7B A;  5GCN A;  3R95 A;  3WR7 A;  4RI1 A;  4EVY A;  4QVT A;  5IV0 A;  1RXT A;  1J4J A;  1B87 A;  4R87 A;  2JDD A;  2VQY A;  2Z10 A;  3BJ7 A;  1YX0 A;  2EUI A;  5F46 A;  1QSM A;  2J8R A;  4FD5 A;  1TIQ A;  4KOU A;  1WK4 A;  2J8N A;  3P2F A;  2R8V A;  4L8A A;  1CM0 A;  2FIW A;  2VEZ A;  4RS2 A;  4U9Z A;  2B4D A;  3TO6 A;  3IWG A;  3UY5 A;  2AJ6 A;  1OZP A;  5H86 A;  1YVK A;  1KUX A;  4XPD B;  3T9Y A; 
#chains in the Genus database with same CATH topology
 1YGH A;  4P4D A;  4M85 A;  4A33 A;  1Q2Y A;  2P6E A;  4CAF A;  3TE4 A;  2O28 A;  3JTK A;  2REE A;  1Y9K A;  3DGV A;  1IIC A;  2BUE A;  2OZH A;  5CNP A;  4A31 A;  1H8L A;  2Z3K A;  3NE8 A;  1DE4 C;  2FSR A;  5E96 A;  3TT2 A;  4P6Y A;  2PCU A;  4OME A;  1VHS A;  2PJ4 A;  4B6Z A;  4CAE A;  3ISX A;  4MY0 A;  1FY7 A;  2Q4V A;  4A37 A;  2BSW A;  4B5P B;  3K9T A;  3FIX A;  2ZED A;  3WAB A;  5HVH A;  1M4L A;  1YSJ A;  3PB9 X;  4MHZ A;  4YFJ A;  4H2K A;  3G3S A;  3H8E A;  1Q7L A;  4NGR A;  4FD6 A;  1ZG9 A;  2OB0 A;  2FE7 A;  2NYQ A;  3DR6 A;  1YK3 A;  3WT4 A;  5THW A;  4UEZ A;  2GIV A;  1I12 A;  2O4H A;  1PCA A;  2ZW7 A;  3VAR A;  4RUH A;  4QC6 A;  1QST A;  3D2M A;  1XBU A;  4GXH A;  2OU2 A;  4XPK A;  3NA6 A;  2QJ8 A;  3PB6 X;  1GHE A;  3BI0 A;  1Y7R A;  1BOB A;  2RB7 A;  3P2H A;  3NFZ A;  4F6A A;  3IC1 A;  1QSO A;  2F5I A;  4MCS A;  3T90 A;  4C7H A;  4K3N A;  1IGB A;  2V8G A;  4MY3 A;  4KZT A;  3ISZ A;  1QSN A;  4C2Y A;  5LRK A;  3GKR A;  2ZEG A;  5D8N A;  3D7G A;  3RZA A;  4NFR A;  4M3S A;  3WC6 A;  2H5M A;  4AB7 A;  1AYE A;  4UCM A;  4TNU A;  2DPT A;  3SJX A;  4IHM A;  1LOK A;  4P4J A;  4PK3 A;  3LAC A;  3GB0 A;  4YU9 A;  2V77 A;  4M6I A;  2AFS A;  3E0K A;  3N7Z A;  1BLL E;  4I49 A;  4Y49 B;  4ZI6 A;  4KSI A;  2RC4 A;  4X3R A;  3SI2 A;  4PPZ A;  1EE3 P;  1LRZ A;  4MFP A;  4R9M A;  4C2X A;  1CG2 A;  3LMS A;  2EWB A;  3TO9 A;  2ZEN A;  3GYA A;  1IID A;  3IGR A;  2I3C A;  4KOY A;  1CPS A;  1KUY A;  5I0C A;  3FMC A;  4B14 A;  4JZ0 A;  1Z8T A;  3BXM A;  2XEG A;  4O23 A;  3JVN A;  2PJA A;  2B5G B;  3PBB A;  1YR0 A;  2BL1 A;  2ZEM A;  4ORF A;  4PQA A;  4KOS A;  1QSR A;  3F0A A;  5G1Z A;  3S9M A;  5IB0 A;  3S6G A;  2D4P A;  1DTD A;  3NE7 A;  1Z9U A;  2ZW6 A;  5LRJ A;  8CPA A;  2FL4 A;  3B7I A;  3IFE A;  2CIJ A;  5JPH A;  5K8N A;  3QNV A;  1VIX A;  2FS5 A;  4FD7 A;  1WWZ A;  4UA3 A;  3CZX A;  4NGT A;  3RYO A;  2EBJ A;  4DYO A;  4JD6 A;  2ODF A;  2PR8 A;  4MCQ A;  3KHX A;  1KWM A;  2P0W A;  4XNH B;  5LYD A;  3KKW A;  2B3U A;  5EMI A;  5KTD A;  3TOB A;  4OLL A;  2JEW A;  1L0C A;  2WUU A;  4UEE A;  3KAS A;  2FCK A;  3PFE A;  1Y7E A;  3MRU A;  3IWW A;  4MFZ A;  4R76 A;  2PE3 A;  4NEX A;  1SQH A;  3KI9 A;  3D2P A;  1LAP A;  2GAN A;  3K2K A;  4IF5 A;  4B11 A;  2Z3M A;  4UIA A;  3ZJ0 A;  3FH4 A;  1YLO A;  2GRE A;  4NGQ A;  1Z8L A;  4B5P A;  4PV6 A;  1UFH A;  1S3Z A;  1FT7 A;  2PSW A;  4FBE A;  2CXA A;  3B3S A;  4ONW A;  4DUK A;  2ZW5 A;  2FXF A;  3BJ8 A;  2PJC A;  2FVG A;  2YNC A;  3FX6 A;  4X5K A;  4X2T A;  1MJA A;  4B12 A;  4MHN A;  3DDD A;  4A2Z A;  4P4E A;  3L2N A;  2OZG A;  4KVX A;  2CTC A;  4FAI A;  3PZJ A;  4YGO A;  3OWC A;  4R3L A;  3SJF A;  3D66 A;  5ISV A;  2EO8 A;  2G3T A;  3CXQ A;  3W91 A;  2Z3P A;  3PP9 A;  3W6X A;  4Z65 A;  5AG6 A;  1ZG8 A;  3GLJ A;  4KOX A;  3IU2 A;  3H5Z A;  2PJ0 A;  4E8O A;  4LUA A;  3JRU A;  4F0X A;  1ON0 A;  5LRG A;  2Q44 A;  5J1Q A;  4UFV A;  5AG5 A;  4NCZ A;  1B6B A;  1S7K A;  3D7D A;  4PXC A;  1Q2D A;  5F47 A;  2PJ2 A;  5EBV A;  1YLE A;  3R9G A;  4KS9 A;  4GS4 A;  3I3G A;  3LD2 A;  4NGN A;  4OC3 A;  2A4N A;  5F48 A;  3NH5 A;  4PXE A;  3HUV A;  4MRI A;  2ABZ A;  2Z11 A;  3EC4 A;  1Z5R A;  2HB6 A;  2PJ5 A;  3CXP A;  4R3K A;  2ZEP A;  3D3S A;  4NXY A;  4CGM A;  2D4O A;  1Z8X A;  2XEJ A;  2DPS A;  2ZW4 A;  3VWD A;  1VHO A;  2DXQ A;  2YNE A;  5LYI A;  2HUZ A;  5CBM A;  5HXD A;  1X10 A;  4ZYQ A;  1XRY A;  3D7H A;  2R7H A;  4UFX A;  2PJ8 A;  1BPM A;  4JWP A;  1HEE A;  5HMN A;  2DEA A;  2PDO A;  3D8P A;  4OKO A;  1YW6 A;  1F57 A;  1CPX A;  2FIA A;  2REF A;  4CGP A;  5DS0 A;  3TCV A;  1IOF A;  2Q43 A;  4Q7A A;  1OBR A;  4A38 A;  5JM6 A;  2R98 A;  2CY2 A;  3TOA A;  4CGO A;  2OR4 A;  2BO9 A;  4P4B A;  4JYW A;  2NMT A;  1TKJ A;  2Z3N A;  4KOR A;  1VKC A;  3IU1 A;  1FNO A;  1CP6 A;  4C68 A;  2PJ9 A;  4AVA A;  5KTC A;  3I9S A;  2PRB A;  4NJQ A;  4GM5 A;  2IJZ A;  2B5G A;  2WSA A;  4KVM E;  3RAM A;  2Z3O A;  5I4M A;  1S7N A;  3H8F A;  5K8O A;  4CYQ A;  4L89 A;  4MMO A;  4AVB A;  2BEI A;  5FVJ A;  2AFX A;  3W6S A;  4AVC A;  2ANP A;  1ZG7 A;  3K9U A;  3IO1 A;  4OAD A;  4KOV A;  4QB9 A;  4U5Y A;  3SI0 A;  4FWU A;  2V8D A;  2CNM A;  4MCP A;  2Q7S A;  3V7Z A;  4A94 A;  3C26 A;  2WPW A;  2KCW A;  4OC0 A;  2C6G A;  5CPA A;  4YRH A;  3S9L A;  3HLP A;  2J9A A;  2VZZ A;  1KUV A;  2G0B A;  1PU9 A;  4NSQ A;  3TO7 A;  1Q2C A;  4P44 A;  2JBK A;  2PVW A;  4IUS A;  1PUA A;  2ZOF A;  4HNY B;  4II9 A;  3CXS A;  3F8K A;  3R9F A;  1XMB A;  1ARL A;  4OC5 A;  4UCP A;  1TXR A;  5DWN A;  1HDU A;  3ZZI A;  3EY5 A;  1JWQ A;  5F09 A;  1YRE A;  1QMU A;  1KZF A;  3QB8 A;  2JDC A;  2I00 A;  1XF8 A;  5HVG A;  3DLJ A;  4OIW A;  2CNS A;  4AG9 A;  4OAE A;  5AG4 A;  3FNC A;  2OH1 A;  1XMT A;  1XOV A;  3RNZ A;  1XIX A;  3NH4 A;  2I79 A;  2PIY A;  2QYV A;  4X8I A;  2FT0 A;  5G22 A;  1IYK A;  1X12 A;  4KUA A;  4W9Y A;  3CPA A;  4ZX8 A;  3MN8 A;  2PJ3 A;  3KGQ A;  4MHD A;  5F49 A;  3BI1 A;  2PVV A;  4HPS A;  2VI7 A;  4PXD A;  4A30 A;  4CRZ B;  4EFD A;  1ARM A;  1IB1 E;  3KHZ A;  4EWT A;  2CF4 A;  2PC1 A;  3TC8 A;  4MBU A;  2XEF A;  3MGD A;  3LOD A;  3I1U A;  3KR4 A;  2PJ6 A;  4IAV A;  4NF1 A;  4H6Z A;  3TFY A;  4CGL A;  4JXR A;  4XPD C;  4UBR A;  4MHY A;  4WJB A;  3S9N A;  4MJ8 A;  4KOT A;  4AXV A;  3PBE A;  2PJB A;  2BCO A;  2PRQ A;  2DF5 A;  1V0C A;  1M44 A;  2B4B A;  4FD4 A;  3KQZ A;  2ATR A;  1TF8 A;  2HV2 A;  4MXU A;  2Q7B A;  3R96 A;  4MFK A;  4DJL A;  1YQE A;  5ELY A;  4F9V A;  3FF3 A;  1VHE A;  4M6H A;  4WWV A;  4LX9 A;  4MFJ A;  1MJ9 A;  4CPA A;  2ARH A;  3JUW A;  5BWA B;  3QAH A;  3VWE A;  2GFQ A;  5AG7 A;  2OOT A;  2B58 A;  4UWI A;  2PIZ A;  1XJO A;  3TTH A;  4UFW A;  1Y9W A;  2YNC C;  4H89 A;  5JGF A;  4BD9 A;  1UWY A;  1XEB A;  4ZBG A;  5HVF A;  2EVN A;  2V8V A;  3FJU A;  2ZEL A;  1ZLH A;  3SJG A;  1YME A;  1TKF A;  1TF9 A;  4OC1 A;  2IQ6 A;  3VH9 A;  4MCR A;  4HNW B;  3R9E A;  1M4I A;  1ELM P;  3FYN A;  2G9D A;  3KZW A;  2HQY A;  2C6P A;  4JLY A;  3S6F A;  4PSW A;  4U9Y A;  4CAW A;  2JBJ A;  2GU2 A;  2QVP A;  1LFW A;  3B2Y A;  3H4Q A;  1QQ9 A;  4NGM A;  4M6G A;  4CGN A;  2J8M A;  2ZEF A;  5KTA A;  5LYL A;  2AE6 A;  2BOA A;  2EK8 A;  2K5T A;  5EC4 A;  3PGP A;  4B13 A;  2AFW A;  1S60 A;  1Z2L A;  1AUG A;  1MK4 A;  3B8G A;  5J8F A;  5IX3 A;  1BO4 A;  3D67 A;  3D7F A;  2VZY A;  1Y0Y A;  3PB8 X;  4KVO E;  4KSF A;  2AFZ A;  3VAT A;  2YND A;  1RO5 A;  2OZU A;  4Y49 C;  4BMH A;  4QBJ A;  4UF4 A;  4KUB A;  2C6C A;  4CYP A;  3SI1 A;  2GLJ A;  2QIR A;  4PSX A;  4CS0 B;  1NMT A;  1ZLI A;  2GLF A;  3B35 A;  3F5B A;  3DR8 A;  4UWJ A;  4K30 A;  3FBU A;  2WPX A;  1P4N A;  1NSL A;  2ZEH A;  3GY9 A;  4ONU A;  4ZX9 A;  4YWY A;  4P4F A;  1R43 A;  1YW4 A;  5HH1 A;  4ZGY B;  4UIB A;  4XPL A;  1RTQ A;  2Z0Z A;  3EO4 A;  1S5K A;  4MI4 A;  1P0H A;  3FEC A;  2B3V A;  1M4D A;  4IK2 A;  2PR1 A;  1M1D A;  3GIU A;  4NGP A;  4BIN A;  5G20 A;  1CP7 A;  3BLN A;  3R1K A;  5C82 A;  1Z4E A;  1F2O A;  2AFM A;  2B4D B;  2JLM A;  2Q0Y A;  3FXT A;  2ZXV A;  4NGS A;  4R8F A;  2P6F A;  3SXO A;  1IYL A;  2QML A;  4QUS A;  2JEV A;  3PEI A;  3FVL A;  1CX8 A;  3B3W A;  4OID A;  5C88 A;  1TKH A;  4C2Z A;  2IMO A;  3G8W A;  4KLW A;  4OC4 A;  4Q36 A;  3IWE A;  4RN7 A;  3V8I A;  4MFL A;  4F8Z A;  3B3T A;  2Q4Y A;  1AMP A;  3DNS A;  3IIB A;  5IB9 A;  1PYT B;  4CRY B;  1S7L A;  2C27 A;  1CJW A;  4KOW A;  3KL9 A;  4XNH C;  1BPN A;  4ZY0 A;  4HNX B;  3NH8 A;  4A32 A;  3S6K A;  3BHX A;  3EXN A;  5A27 A;  2C1C A;  3EFA A;  1HDQ A;  4NJR A;  1NE9 A;  2ZEO A;  3PFO A;  1YVO A;  3RBU A;  4PXB A;  3V38 A;  1U6M A;  5J8C A;  2PQ8 A;  3A9L A;  1R3N A;  4G1P A;  3SXN A;  4F9U A;  4R57 A;  2Q04 A;  2Y0M A;  4B5O A;  4KLV A;  4AG7 A;  3SHP A;  4CAX A;  1Y0R A;  3QAY A;  1IOI A;  1I1D A;  3S6H A;  3GUX A;  1XFO A;  4B10 A;  1R57 A;  4JXQ A;  4CYO A;  1JQG A;  1GYT A;  2F8H A;  1MJB A;  2VXK A;  3D68 A;  4HKF A;  4LQ6 A;  4OC2 A;  3SJE A;  4DNC A;  5K8M A;  1XE4 A;  3FRM A;  3D4U A;  1Z8W A;  3PB4 X;  5H84 A;  2VBQ A;  1I21 A;  2Q4Z A;  1A2Z A;  4J3G A;  4MHP A;  5LYF A;  1K4J A;  1M4G A;  3IEH A;  2GE3 A;  2QEC A;  2R1I A;  4LQG A;  2WYR A;  1Z4R A;  2CNT A;  1LAM A;  4TWE A;  1N71 A;  1NSA A;  4UEF A;  4Q38 A;  2VL1 A;  4JJX A;  2G3A A;  3DSB A;  2IL4 A;  4R6T A;  4CAV A;  4C7I A;  3T8W A;  4E2A A;  5DWM A;  1S7F A;  4E0A A;  2P6G A;  4R7M A;  5JH9 A;  2PJ7 A;  3PB7 X;  3LWU A;  2XEI A;  4F0Y A;  4PK2 A;  2ZPA A;  5G21 A;  4BBH A;  5JQ4 A;  4H6U A;  3FB3 A;  2X7B A;  3CPX A;  2POK A;  5GCN A;  2AFU A;  3R95 A;  3WR7 A;  4RI1 A;  4A39 A;  4QVT A;  4EVY A;  2ZEE A;  4UCN A;  5IV0 A;  1LCP A;  1RXT A;  1J4J A;  1B87 A;  3B3V A;  3WC7 A;  4R87 A;  6CPA A;  2JDD A;  2VQY A;  1F2P A;  2Z10 A;  3CT9 A;  3BJ7 A;  1YX0 A;  3TX8 A;  2EUI A;  1IU8 A;  1ZO0 A;  2F7V A;  3FED A;  5F46 A;  1QSM A;  2RFH A;  5A28 A;  2J8R A;  4ZY2 A;  5D29 A;  4CYN A;  4FD5 A;  2YGW A;  1TIQ A;  1IY7 A;  3FEE A;  3N5F A;  1BAV A;  4KOU A;  2WZN A;  4MFQ A;  1WK4 A;  5K8P A;  2Q51 A;  2J8N A;  1CBX A;  4P4I A;  3B3C A;  2V8H A;  3KQX A;  5AGE A;  3P2F A;  4KSA A;  3IJ3 A;  2R8V A;  4L8A A;  4P10 A;  2CTB A;  4A95 A;  2EK9 A;  1VGY A;  2O53 A;  1CM0 A;  2FIW A;  2NSM A;  2VEZ A;  4RS2 A;  4U9Z A;  3RO0 A;  2B4D A;  2HC9 A;  3TO6 A;  4OP4 A;  7CPA A;  3IWG A;  3CDX A;  4P45 A;  1LAN A;  3UY5 A;  2AJ6 A;  3H8G A;  3KR5 A;  1OZP A;  3PRT A;  2ZOG A;  5H86 A;  1YVK A;  1KUX A;  2AFO A;  3WC5 A;  4FUU A;  2Z3L A;  4XPD B;  2PJ1 A;  3T9Y A;  4ZY1 A;  1ELL P;  4EME A; 
#chains in the Genus database with same CATH homology
 1YGH A;  4M85 A;  4A33 A;  1Q2Y A;  2P6E A;  4CAF A;  3TE4 A;  2O28 A;  3JTK A;  2REE A;  1Y9K A;  1IIC A;  2BUE A;  2OZH A;  5CNP A;  4A31 A;  2Z3K A;  5E96 A;  2FSR A;  3TT2 A;  1VHS A;  4CAE A;  4MY0 A;  1FY7 A;  2Q4V A;  4B5P B;  2BSW A;  3FIX A;  4YFJ A;  3G3S A;  4FD6 A;  2OB0 A;  2FE7 A;  3DR6 A;  1YK3 A;  2GIV A;  1I12 A;  2ZW7 A;  4QC6 A;  1QST A;  3D2M A;  4XPK A;  2OU2 A;  1GHE A;  1Y7R A;  1BOB A;  3P2H A;  4F6A A;  1QSO A;  2F5I A;  3T90 A;  4C7H A;  4MY3 A;  4KZT A;  1QSN A;  4C2Y A;  3GKR A;  4M3S A;  2H5M A;  4AB7 A;  4UCM A;  2DPT A;  4PK3 A;  3E0K A;  3N7Z A;  4I49 A;  4Y49 B;  2RC4 A;  4R9M A;  1LRZ A;  4MFP A;  4C2X A;  3TO9 A;  3GYA A;  1IID A;  3IGR A;  4KOY A;  1KUY A;  5I0C A;  4B14 A;  3JVN A;  2B5G B;  1YR0 A;  2BL1 A;  4ORF A;  5G1Z A;  4KOS A;  1QSR A;  3F0A A;  5IB0 A;  3S6G A;  2D4P A;  3NE7 A;  1Z9U A;  2ZW6 A;  2FL4 A;  5JPH A;  2FS5 A;  4FD7 A;  1WWZ A;  4UA3 A;  3RYO A;  4JD6 A;  2PR8 A;  2P0W A;  4XNH B;  3KKW A;  2B3U A;  5KTD A;  3TOB A;  4OLL A;  1L0C A;  2WUU A;  2FCK A;  4MFZ A;  4NEX A;  1SQH A;  3D2P A;  2GAN A;  4IF5 A;  4B11 A;  2Z3M A;  3ZJ0 A;  4B5P A;  4PV6 A;  1UFH A;  1S3Z A;  2PSW A;  2CXA A;  2ZW5 A;  2FXF A;  3BJ8 A;  4X5K A;  2YNC A;  4B12 A;  1MJA A;  3DDD A;  4A2Z A;  2OZG A;  4KVX A;  3PZJ A;  4YGO A;  3OWC A;  4R3L A;  5ISV A;  2G3T A;  3CXQ A;  3W91 A;  2Z3P A;  3PP9 A;  3W6X A;  5AG6 A;  4KOX A;  3IU2 A;  3H5Z A;  4E8O A;  4LUA A;  4F0X A;  1ON0 A;  2Q44 A;  4UFV A;  5AG5 A;  4NCZ A;  1B6B A;  1S7K A;  1Q2D A;  5F47 A;  5EBV A;  1YLE A;  3R9G A;  4KS9 A;  4GS4 A;  3I3G A;  3LD2 A;  2A4N A;  5F48 A;  2Z11 A;  4CAV A;  3EC4 A;  4R3K A;  4CGM A;  3CXP A;  3D3S A;  4NXY A;  2D4O A;  2DPS A;  2ZW4 A;  3VWD A;  2DXQ A;  2YNE A;  2HUZ A;  2R7H A;  4UFX A;  4JWP A;  5HMN A;  2PDO A;  3D8P A;  2FIA A;  4CGP A;  2REF A;  3TCV A;  2R98 A;  2CY2 A;  3TOA A;  4CGO A;  2NMT A;  2Z3N A;  4KOR A;  1VKC A;  3IU1 A;  4C68 A;  4AVA A;  5KTC A;  3I9S A;  2PRB A;  2B5G A;  2WSA A;  4KVM E;  2Z3O A;  1S7N A;  4CYQ A;  4L89 A;  4AVB A;  2BEI A;  5FVJ A;  3W6S A;  4AVC A;  4OAD A;  3K9U A;  4KOV A;  4QB9 A;  4U5Y A;  2CNM A;  3C26 A;  2WPW A;  2KCW A;  4YRH A;  2VZZ A;  1KUV A;  2G0B A;  1PU9 A;  4NSQ A;  3TO7 A;  1Q2C A;  4IUS A;  1PUA A;  4II9 A;  4HNY B;  3CXS A;  3F8K A;  3R9F A;  4UCP A;  5DWN A;  3ZZI A;  3EY5 A;  1YRE A;  1KZF A;  3QB8 A;  2JDC A;  2I00 A;  1XF8 A;  4AG9 A;  2CNS A;  4OAE A;  5AG4 A;  3FNC A;  2OH1 A;  1XMT A;  1XIX A;  2I79 A;  2FT0 A;  5G22 A;  1IYK A;  4KUA A;  4MHD A;  5F49 A;  4A30 A;  2VI7 A;  4CRZ B;  1IB1 E;  2PC1 A;  4MBU A;  3MGD A;  3LOD A;  4NF1 A;  4H6Z A;  3TFY A;  4CGL A;  4JXR A;  4XPD C;  4UBR A;  4MJ8 A;  4KOT A;  1V0C A;  1M44 A;  2B4B A;  4FD4 A;  2ATR A;  2HV2 A;  2Q7B A;  3R96 A;  4MFK A;  4LX9 A;  4MFJ A;  1MJ9 A;  2ARH A;  3JUW A;  5BWA B;  3QAH A;  3VWE A;  5AG7 A;  2B58 A;  4UWI A;  3TTH A;  4UFW A;  1Y9W A;  2YNC C;  4H89 A;  1XEB A;  4ZBG A;  2EVN A;  4HNW B;  3R9E A;  1M4I A;  3FYN A;  2HQY A;  4JLY A;  3S6F A;  4PSW A;  4U9Y A;  4CAW A;  3H4Q A;  4CGN A;  2J8M A;  5KTA A;  2AE6 A;  2K5T A;  5EC4 A;  3PGP A;  4B13 A;  1S60 A;  1MK4 A;  3B8G A;  5J8F A;  5IX3 A;  1BO4 A;  2VZY A;  4KVO E;  4KSF A;  2YND A;  1RO5 A;  2OZU A;  4Y49 C;  4BMH A;  4QBJ A;  4KUB A;  4CYP A;  2QIR A;  4PSX A;  4CS0 B;  1NMT A;  3F5B A;  3DR8 A;  4UWJ A;  4K30 A;  3FBU A;  2WPX A;  1P4N A;  1NSL A;  3GY9 A;  4ONU A;  5HH1 A;  4ZGY B;  4XPL A;  2Z0Z A;  3EO4 A;  1S5K A;  4MI4 A;  1P0H A;  2B3V A;  1M4D A;  2PR1 A;  1M1D A;  5G20 A;  3BLN A;  3R1K A;  5C82 A;  1Z4E A;  2B4D B;  2JLM A;  2Q0Y A;  3FXT A;  2ZXV A;  3SXO A;  2P6F A;  2QML A;  1IYL A;  4QUS A;  2JEV A;  5C88 A;  4C2Z A;  4Q36 A;  3G8W A;  4KLW A;  3IWE A;  3V8I A;  4MFL A;  2Q4Y A;  3DNS A;  4CRY B;  1S7L A;  2C27 A;  1CJW A;  4KOW A;  4XNH C;  4HNX B;  4A32 A;  3S6K A;  3EXN A;  5A27 A;  3EFA A;  1NE9 A;  1YVO A;  1U6M A;  5J8C A;  2PQ8 A;  3A9L A;  3SXN A;  4R57 A;  2Q04 A;  2Y0M A;  4B5O A;  4KLV A;  4AG7 A;  3SHP A;  4CAX A;  1I1D A;  3S6H A;  4B10 A;  1R57 A;  4JXQ A;  4CYO A;  2VXK A;  1MJB A;  4HKF A;  4DNC A;  1XE4 A;  3FRM A;  5H84 A;  2VBQ A;  1I21 A;  4J3G A;  1K4J A;  1M4G A;  2GE3 A;  2QEC A;  2R1I A;  1Z4R A;  2CNT A;  1N71 A;  4Q38 A;  4JJX A;  2G3A A;  3DSB A;  2IL4 A;  4C7I A;  4E2A A;  5DWM A;  1S7F A;  4E0A A;  2P6G A;  4F0Y A;  4PK2 A;  2ZPA A;  5G21 A;  4BBH A;  5JQ4 A;  4H6U A;  3FB3 A;  2X7B A;  5GCN A;  3R95 A;  3WR7 A;  4RI1 A;  4EVY A;  4QVT A;  4UCN A;  5IV0 A;  1RXT A;  1J4J A;  1B87 A;  4R87 A;  2JDD A;  2VQY A;  2Z10 A;  3BJ7 A;  1YX0 A;  2EUI A;  1ZO0 A;  5F46 A;  1QSM A;  5A28 A;  2J8R A;  4CYN A;  4FD5 A;  2YGW A;  1TIQ A;  4KOU A;  4MFQ A;  1WK4 A;  2J8N A;  5AGE A;  3P2F A;  4KSA A;  2R8V A;  4L8A A;  4A95 A;  1CM0 A;  2FIW A;  2VEZ A;  4RS2 A;  4U9Z A;  2B4D A;  3TO6 A;  3IWG A;  3UY5 A;  2AJ6 A;  1OZP A;  5H86 A;  1YVK A;  1KUX A;  2Z3L A;  4XPD B;  3T9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...