1TKHA

Streptomyces griseus aminopeptidase complexed with d-phenylalanine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aminopeptidase
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
total genus 112
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkhA00
3PFEA 2PRQA 4H2KA 3CDXA 3FMCA 3I1UA 2O4HA 2VL1A 5JGFA 3WT4A 4B6ZA 4UF4A 4GM5A 4NGRA 3PB6X 3IWWA 4NGPA 5I4MA 5CBMA 1Z2LA 3IEHA 1XRYA 4F9VA 4UIBA 4ZY2A 3FJUA 3SI2A 1QQ9A 2ZOGA 2G9DA 2GLFA 2ZELA 1BAVA 2PJ7A 4EFDA 3KL9A 3B3TA 4R7MA 2PJ3A 3PB7X 4NGNA 1UWYA 3PB8X 3PBEA 1CBXA 5JM6A 1CPSA 1XJOA 4BD9A 1HEEA 2JBKA 4PXDA 2WYRA 4YWYA 2CTBA 4LQGA 1FT7A 1CPXA 4O23A 2RFHA 4OIWA 3NH4A 4MMOA 1YW4A 4UEFA 4P4DA 5LRKA 4OC1A 3SJXA 1LFWA 2ZEGA 3IC1A 3VH9A 1VHEA 2J9AA 2QVPA 4P44A 2GREA 2PJ4A 1LAMA 1VHOA 2XEFA 5LYFA 3WABA 1XFOA 4P45A 2Q43A 2AFUA 1OBRA 2PIZA 4YU9A 2XEJA 2ZEOA 2ZEHA 3CPAA 1M4LA 4FAIA 3KHZA 2POKA 4MHYA 5ELYA 2AFXA 2CTCA 4JYWA 1QMUA 3GUXA 3TX8A 4IAVA 4OIDA 3PEIA 2ZENA 4UIAA 4OMEA 2NYQA 2CIJA 3K9TA 3FVLA 4NJRA 4FWUA 4ONWA 4W9YA 4OKOA 1H8LA 4P4BA 3FF3A 4FUUA 2PCUA 1KWMA 2BOAA 5HVHA 1AMPA 3DGVA 3KHXA 3L2NA 1YW6A 3MN8A 3KZWA 3B3VA 1F2PA 2PIYA 4A37A 4MCRA 2O53A 3KR5A 3JRUA 1ELLP 2QJ8A 3S9MA 3PRTA 1CP6A 5LYIA 3KQZA 3HLPA 1TKHA 2C6CA 2ZOFA 4ZY1A 5K8NA 4ZX8A 2ANPA 3RAMA 1NSAA 2XEIA 4X2TA 2CF4A 4MCPA 3SJGA 2ABZA 3FX6A 2F7VA 4AXVA 2V77A 2C1CA 4TNUA 2Q4ZA 3IFEA 2IMOA 1IGBA 4NGQA 3BI1A 3B2YA 4EWTA 3NFZA 1TF9A 1Y0YA 4OC0A 1LOKA 1R43A 4UEZA 1JQGA 2JBJA 1CX8A 1ARLA 4IK2A 3D7DA 6CPAA 3NA6A 3D7FA 3QNVA 3DLJA 2OR4A 2PVWA 4P6YA 4OC5A 4P4IA 4Z65A 4A94A 3CT9A 1FNOA 2V8GA 1TF8A 3SJFA 3D68A 4JZ0A 3CPXA 2PJ5A 3S9LA 3IJ3A 3V7ZA 5J1QA 1XMBA 1Q7LA 4MHZA 1YLOA 3RBUA 3BHXA 2GLJA 4NGTA 3MRUA 2AFOA 4CPAA 1LANA 2PJ6A 3ISXA 2FVGA 1ZG7A 3HUVA 4MCSA 2IQ6A 3ISZA 2V8VA 4PXCA 4PXEA 5JH9A 2AFWA 3N5FA 2ZEFA 4OC3A 3KASA 4X8IA 2PJAA 5HVGA 3LWUA 4MXUA 3IO1A 2BO9A 4A39A 4MHNA 4P4JA 3BXMA 2PJ8A 5K8PA 1VIXA 4ZYQA 1CG2A 2V8DA 1F57A 4WJBA 4MHPA 4PPZA 3WC5A 1ELMP 7CPAA 2DEAA 4TWEA 5THWA 2HC9A 1PCAA 1DTDA 4P4EA 3FEEA 3SJEA 3PB4X 5F09A 4DJLA 3D7HA 4DYOA 1RTQA 3KGQA 2GU2A 2F8HA 4WWVA 2V8HA 3PFOA 3WC6A 4NGMA 3D7GA 4P4FA 1IY7A 3GB0A 1Y7EA 3D67A 4OP4A 2PJBA 4OC4A 4NFRA 2PJ1A 4F9UA 1EE3P 2WZNA 2C6PA 1BLLE 3B7IA 3B3CA 4MCQA 3B3SA 4KSIA 4PQAA 8CPAA 3NH8A 4EMEA 2PE3A 3H8EA 1YSJA 3IIBA 5CPAA 5IB9A 2OOTA 5DS0A 4NGSA 1GYTA 4MRIA 3SI0A 5D8NA 4ZX9A 3SI1A 3B3WA 2XEGA 4FBEA 1R3NA 2PJ0A 2PVVA 1TKFA 2EK9A 2JEWA 2HB6A 1BPNA 4RUHA 4G1PA 3H8GA 3FH4A 5HVFA 2PJCA 4OC2A 1F2OA 3D4UA 3T8WA 2AFZA 3VATA 5K8OA 2EK8A 1ZG8A 1VGYA 2PJ2A 3KI9A 1YMEA 3H8FA 4K3NA 3K2KA 3LMSA 3VARA 2BCOA 1TKJA 5LYLA 1XBUA 1PYTB 4UEEA 1LAPA 3PBBA 3WC7A 2I3CA 1Z5RA 1ZLIA 2C6GA 4A38A 4Q7AA 5LRJA 1AYEA 5D29A 1HDQA 2AFSA 4R76A 1Z8LA 3PB9X 3GLJA 3RZAA 2AFMA 3NH5A 5LRGA 4F8ZA 1ZG9A 2Q51A 3BI0A 2ZEEA 1TXRA 5HXDA 4ZI6A 4NJQA 5K8MA 2IJZA 3KQXA 2RB7A 1BPMA 3FEDA 4ZY0A 4DUKA 1Y0RA 4X3RA 3D66A 2QYVA 1HDUA 4R6TA 3FECA 4PXBA 1DE4C 1ARMA 1LCPA 2ZEPA 2ZEDA 3B35A 3TC8A 4IHMA 1CP7A 2NSMA 3S9NA 3V38A 4R8FA 1ZLHA 2EWBA 2ZEMA 4P10A 5LYDA 3KR4A 2PJ9A
chains in the Genus database with same CATH superfamily
3PFEA 4MFZA 2GFQA 5BWAB 2PRQA 1P0HA 4H2KA 1QSTA 3SXOA 4LUAA 3DNSA 3CDXA 4K30A 2FXFA 3GYAA 3FMCA 4I49A 4M6GA 3I1UA 2O4HA 2REFA 3T90A 2VL1A 4UWJA 4E2AA 4KS9A 3N7ZA 4MBUA 5JGFA 1YVKA 1MJAA 3WT4A 4B6ZA 2REEA 3NE7A 5JQ4A 4UF4A 5AG7A 2GIVA 4GM5A 4MJ8A 3PB6X 4NGRA 3IWWA 2ZW5A 4UWIA 4NGPA 4F6AA 2Z11A 4CS0B 5IV0A 5I4MA 4JJXA 3T9YA 4R3LA 2ZPAA 1Q2YA 1Z2LA 3D2PA 5CBMA 3IEHA 3FRMA 1XRYA 3EY5A 4HNXB 4F9VA 3FB3A 4UIBA 4ZY2A 1OZPA 4FD4A 2ZW4A 1AUGA 3RO0A 3FJUA 4MFPA 4KZTA 1QQ9A 5F48A 3SI2A 2OZHA 1RO5A 1WK4A 2ZOGA 2FSRA 4KOTA 4MFLA 2G9DA 2GLFA 2X7BA 2ZELA 1BAVA 2PJ7A 3DR8A 3KL9A 2B3VA 4EFDA 2I00A 3B3TA 4R7MA 2PJ3A 3PB7X 3F8KA 2JEVA 4NGNA 1UWYA 3PB8X 4CGPA 4UBRA 3PBEA 1CBXA 1Z8TA 5JM6A 1KUVA 4JXQA 4XPKA 1CPSA 1XJOA 1IB1E 1HEEA 2D4OA 2JBKA 2WUUA 2WYRA 4PXDA 4YWYA 4HNWB 2CTBA 4LQGA 4A32A 2FIAA 1FT7A 1CPXA 2EUIA 4CYQA 2H5MA 2F5IA 3R9FA 5EC4A 1NSLA 1YVOA 4O23A 2RFHA 5H84A 2WPWA 3G8WA 4OIWA 4CGOA 3NH4A 1S7KA 3R96A 4HNYB 4MMOA 2VXKA 1YW4A 4UEFA 4P4DA 4UFWA 4JLYA 5A27A 4OC1A 3SJXA 1LFWA 2ZEGA 3IC1A 4UFVA 3VH9A 1VHEA 1M1DA 1Q2DA 4PSXA 3C26A 1S5KA 3E0KA 4B11A 4PV6A 2J9AA 2QVPA 4P44A 2GREA 2PJ4A 1QSMA 2DPSA 1LAMA 3JUWA 4CAEA 1VHOA 4QB9A 1KUYA 2XEFA 1IIDA 5LYFA 3WABA 4CGLA 1XFOA 2AJ6A 4AG7A 4P45A 2Q43A 2AFUA 1OBRA 2HQYA 3UY5A 3A9LA 2PIZA 5EBVA 4YU9A 2XEJA 2ZW6A 5KTCA 2ZEOA 2ZEHA 2VI7A 3CPAA 1M4LA 4UCPA 4FAIA 4PK2A 1XIXA 4CRYB 3KHZA 2VBQA 2BEIA 2POKA 4J3GA 4MHYA 2FIWA 1S7LA 3IWEA 3PZJA 2AFXA 2ARHA 2J8MA 5ELYA 2CTCA 4JYWA 2EVNA 3EXNA 4MY0A 1QMUA 1X10A 4KLVA 4R9MA 3GUXA 3TX8A 4IAVA 1QSNA 2RC4A 1BO4A 4KVOE 3IU1A 3PEIA 4OIDA 2ZENA 4UIAA 4OMEA 3TCVA 1QSRA 2NYQA 2VEZA 2FCKA 4KOYA 2CIJA 4A2ZA 1CJWA 3I9SA 2GE3A 3LACA 3K9TA 4KOSA 4EVYA 3FVLA 4NJRA 2GANA 4FWUA 3DSBA 1Y9WA 2Q4YA 4ONWA 4KOXA 4W9YA 4OKOA 1IOFA 3TO7A 1H8LA 5LRKA 4P4BA 1P4NA 3FF3A 4FUUA 4NCZA 4CRZB 2PCUA 1KWMA 2BOAA 5HVHA 1AMPA 2C27A 3DGVA 3KHXA 1YW6A 3L2NA 4LQ6A 1B6BA 2J8NA 2DXQA 3EO4A 3MN8A 2ZXVA 2R7HA 4RI1A 4CYOA 3FBUA 3KZWA 3B3VA 5DWNA 4CAXA 1F2PA 2PIYA 1S7FA 4A37A 4MCRA 2O53A 1TIQA 4KOVA 5EMIA 4FD5A 3VWEA 4Q36A 3KR5A 2OB0A 3JRUA 1ELLP 2QJ8A 3S9MA 4Y49B 3H4QA 3P2HA 3PRTA 2AE6A 3R95A 1CP6A 5LYIA 3KQZA 1I21A 3S6FA 3HLPA 3LODA 2R1IA 1I1DA 2YNCC 2FT0A 2P6EA 1TKHA 2YNEA 2Z3NA 2HV2A 2C6CA 5H86A 2ZOFA 4ZY1A 5K8NA 4ZX8A 2Q0YA 3TFYA 2ANPA 3R1KA 4KUBA 3RAMA 4NF1A 1NSAA 3CXPA 2XEIA 3WR7A 2NMTA 5C88A 4X2TA 2CF4A 4MCPA 5F49A 3SJGA 2ABZA 4R57A 4Y49C 3FX6A 2Q44A 4L89A 1GHEA 4IUSA 2F7VA 3LD2A 1M44A 2BUEA 5F46A 5AGEA 2V77A 1ON0A 2OH1A 2C1CA 4TNUA 4AXVA 2Q4ZA 4KOWA 3NE8A 1S60A 3IFEA 3QAYA 4OLLA 2IMOA 2G3TA 5I0CA 1BOBA 1IGBA 1Z9UA 4NGQA 3BI1A 3B2YA 4EWTA 3NFZA 1TF9A 1Y0YA 4OC0A 1FY7A 1LOKA 1I12A 4GXHA 1R43A 1YQEA 4UEZA 1S7NA 3RYOA 3S6HA 1JQGA 1YK3A 2JBJA 1U6MA 2PDOA 1CX8A 1ARLA 2B5GB 2B5GA 1Y9KA 3D7DA 4HKFA 4IK2A 4Q38A 6CPAA 4JXRA 4B5PA 2Z0ZA 4QUSA 3NA6A 3ZZIA 3D7FA 3B8GA 3QNVA 2PR8A 4QVTA 3JTKA 1MJ9A 1A2ZA 3D2MA 3DLJA 1J4JA 2OR4A 1RXTA 3P2FA 2PVWA 4CAFA 2VQYA 4P6YA 3RNZA 4QBJA 1XMTA 4B10A 4ZBGA 4OC5A 4P4IA 4C2ZA 4Z65A 4A94A 4ORFA 3R9EA 3I3GA 4XPDB 3VWDA 3CT9A 1FNOA 2V8GA 1TF8A 2YNDA 3SJFA 2FE7A 3D68A 2P6FA 4KLWA 3D8PA 3CPXA 4JZ0A 4UCMA 4C2XA 2PJ5A 4F0YA 3S9LA 3IJ3A 3V7ZA 5J1QA 1XMBA 3W6SA 3CZXA 1KZFA 5IB0A 1Q7LA 4YRHA 4AG9A 2BL1A 3ZJ0A 2B58A 3FXTA 4CYPA 4MHZA 4C68A 4U9YA 1YLOA 4MY3A 2DF5A 3RBUA 1N71A 1YX0A 3BHXA 2HUZA 4R3KA 2OZUA 2WSAA 4U9ZA 3TO6A 4XPDC 2O28A 4H6UA 2GLJA 3H5ZA 4NGTA 4M6IA 3MGDA 3MRUA 3QAHA 4YFJA 2AFOA 5JPHA 4CYNA 4CPAA 2A4NA 1VKCA 1LANA 2P0WA 2PC1A 2PJ6A 4ONUA 5FVJA 3ISXA 3EFAA 3IU2A 4MI4A 2FVGA 1ZG7A 2I79A 1YLEA 3HUVA 2K5TA 3GIUA 2IQ6A 4KSFA 3ISZA 2V8VA 4MCSA 2B4BA 4PXCA 4PXEA 5JH9A 4XPLA 2AFWA 4AB7A 4BBHA 3N5FA 1ZO0A 2ZEFA 4OC3A 4X5KA 4MFJA 5HMNA 3KASA 2PSWA 1Z8WA 3S6GA 2CNTA 2PQ8A 4X8IA 1Y7RA 4A31A 5AG6A 2PJAA 2Q7SA 3CXSA 3LWUA 2KCWA 4MXUA 5HVGA 4KUAA 3IO1A 3OWCA 4C7IA 2BO9A 4A39A 4B13A 4C2YA 4MHDA 4MHNA 4P4JA 1YR0A 4DNCA 2CY2A 3BXMA 5G21A 3IGRA 2PJ8A 5K8PA 1XE4A 2B4DA 5CNPA 4PSWA 4M85A 1VIXA 1IYKA 1CG2A 2V8DA 2VZYA 4M3SA 4ZYQA 1F57A 4WJBA 4A30A 4MHPA 4PPZA 3WC5A 1ELMP 2QECA 7CPAA 3K9UA 2DEAA 2FL4A 1IYLA 4JD6A 2CNMA 3GY9A 4TWEA 2YNCA 5THWA 3DDDA 4UA3A 2HC9A 2Q7BA 1PCAA 1DTDA 4QC6A 4P4EA 3FEEA 1Z8XA 3BJ8A 3G3SA 3SJEA 3PB4X 4KVME 4E8OA 3V8IA 5F09A 4DJLA 3D7HA 4DYOA 1RTQA 4L8AA 3KGQA 2GU2A 2F8HA 4IF5A 2V8HA 3PFOA 4WWVA 4NGMA 3WC6A 4A95A 3D7GA 1NMTA 1M4GA 4P4FA 1IY7A 1QSOA 4HPSA 4H6ZA 2Z3PA 3GB0A 3S6KA 4CAVA 5C82A 1CM0A 3R9GA 1Y7EA 2CNSA 3D67A 4UFXA 4OP4A 2PJBA 1L0CA 4MFKA 4E0AA 1PUAA 4OC4A 1XEBA 4NFRA 3QB8A 2PJ1A 1LRZA 1EE3P 4PK3A 2WZNA 4RN7A 1XOVA 4F9UA 2C6PA 5G20A 1BLLE 4F0XA 3B7IA 3B3CA 4MCQA 5G1ZA 4BD9A 1K4JA 3B3SA 4KSIA 1Q2CA 2JLMA 3PP9A 4PQAA 3TE4A 8CPAA 3NH8A 5A28A 4B5PB 4EMEA 2PE3A 3H8EA 1YSJA 3IIBA 4H89A 5CPAA 4II9A 2Z3OA 4CGMA 5J8CA 1XF8A 5IB9A 2OOTA 5DS0A 2R8VA 4NGSA 1GYTA 3TTHA 2OZGA 4MRIA 3SI0A 5D8NA 2ODFA 4ZX9A 3W6XA 3SI1A 4M6HA 4B12A 3B3WA 3PGPA 2XEGA 4R87A 2G0BA 4FBEA 1IU8A 1NE9A 2FS5A 1R3NA 3EC4A 2PJ0A 2PVVA 1R57A 1TKFA 2JDCA 2Z3MA 3BJ7A 2DPTA 4FD7A 5AG4A 2EK9A 2JEWA 1B87A 2HB6A 4AVAA 1BPNA 2Z3KA 5GCNA 4KVXA 4G1PA 2QMLA 4RUHA 3H8GA 5E96A 3IWGA 1X12A 3FH4A 5HVFA 2PJCA 1IOIA 1F2OA 4OC2A 5IX3A 5KTDA 1PU9A 1M4IA 3D4UA 3T8WA 2AFZA 3VATA 4A33A 2EK8A 1ZG8A 5K8OA 1VGYA 2PJ2A 1SQHA 3KI9A 1YMEA 3H8FA 4K3NA 2D4PA 2WPXA 4KOUA 3K2KA 3LMSA 3VARA 3W91A 2BCOA 4YGOA 4AVCA 1TKJA 5LYLA 3GKRA 1XBUA 1PYTB 4NXYA 2OU2A 1UFHA 4UEEA 1LAPA 3PBBA 2Y0MA 2J8RA 3WC7A 2I3CA 1MJBA 4JWPA 3TOBA 1Z5RA 4XNHB 1ZLIA 2C6GA 4A38A 1Z4EA 3KKWA 2Z3LA 4Q7AA 5LRJA 1AYEA 3CXQA 5D29A 1HDQA 3FIXA 2AFSA 4UCNA 2Z10A 4R76A 3F5BA 1Z8LA 2VZZA 3PB9X 5AG5A 1WWZA 3GLJA 4KORA 3RZAA 1S3ZA 4C7HA 3D3SA 2AFMA 3NH5A 5ISVA 2ATRA 5LRGA 1YGHA 4OAEA 3SXNA 4B5OA 4U5YA 5J8FA 4F8ZA 1YREA 1ZG9A 2Q51A 2JDDA 3FYNA 4XNHC 3BI0A 2ZEEA 1TXRA 3SHPA 5HXDA 2Q04A 5G22A 3FNCA 4OADA 1V0CA 1KUXA 4ZI6A 4NJQA 3F0AA 5K8MA 2IJZA 3KQXA 2RB7A 2CXAA 4ZGYB 1BPMA 1IICA 2BSWA 3FEDA 5HH1A 4MFQA 2B3UA 4NEXA 1Y0RA 4DUKA 2QIRA 3DR6A 4ZY0A 4X3RA 2B4DB 2QYVA 3D66A 5F47A 1HDUA 4R6TA 4CGNA 3FECA 4PXBA 1M4DA 1DE4C 1MK4A 1ARMA 1LCPA 2ZEPA 2ZEDA 3B35A 4FD6A 4GS4A 4BINA 2EO8A 4CAWA 3TC8A 3TO9A 2YGWA 4IHMA 4BMHA 4KSAA 1CP7A 4AVBA 4NSQA 3TOAA 2NSMA 2R98A 3S9NA 2EBJA 2P6GA 1VHSA 2ZW7A 4R8FA 1ZLHA 3V38A 5DWMA 4RS2A 5KTAA 2EWBA 1Z4RA 2ZEMA 4P10A 3TT2A 3BLNA 2PRBA 2Q4VA 2IL4A 3JVNA 5LYDA 1JWQA 2PR1A 2PJ9A 3KR4A 4B14A 4LX9A 2G3AA
chains in the Genus database with same CATH topology
3PFEA 2PRQA 4H2KA 3CDXA 3FMCA 3I1UA 2O4HA 2VL1A 5JGFA 3WT4A 4B6ZA 4UF4A 4GM5A 4NGRA 3PB6X 3IWWA 4NGPA 5I4MA 5CBMA 1Z2LA 3IEHA 1XRYA 4F9VA 4UIBA 4ZY2A 3FJUA 3SI2A 1QQ9A 2ZOGA 2G9DA 2GLFA 2ZELA 1BAVA 2PJ7A 4EFDA 3KL9A 3B3TA 4R7MA 2PJ3A 3PB7X 4NGNA 1UWYA 3PB8X 3PBEA 1CBXA 5JM6A 1CPSA 1XJOA 4BD9A 1HEEA 2JBKA 4PXDA 2WYRA 4YWYA 2CTBA 4LQGA 1FT7A 1CPXA 4O23A 2RFHA 4OIWA 3NH4A 4MMOA 1YW4A 4UEFA 4P4DA 5LRKA 4OC1A 3SJXA 1LFWA 2ZEGA 3IC1A 3VH9A 1VHEA 2J9AA 2QVPA 4P44A 2GREA 2PJ4A 1LAMA 1VHOA 2XEFA 5LYFA 3WABA 1XFOA 4P45A 2Q43A 2AFUA 1OBRA 2PIZA 4YU9A 2XEJA 2ZEOA 2ZEHA 3CPAA 1M4LA 4FAIA 3KHZA 2POKA 4MHYA 5ELYA 2AFXA 2CTCA 4JYWA 1QMUA 3GUXA 3TX8A 4IAVA 4OIDA 3PEIA 2ZENA 4UIAA 4OMEA 2NYQA 2CIJA 3K9TA 3FVLA 4NJRA 4FWUA 4ONWA 4W9YA 4OKOA 1H8LA 4P4BA 3FF3A 4FUUA 2PCUA 1KWMA 2BOAA 5HVHA 1AMPA 3DGVA 3KHXA 3L2NA 1YW6A 3MN8A 3KZWA 3B3VA 1F2PA 2PIYA 4A37A 4MCRA 2O53A 3KR5A 3JRUA 1ELLP 2QJ8A 3S9MA 3PRTA 1CP6A 5LYIA 3KQZA 3HLPA 1TKHA 2C6CA 2ZOFA 4ZY1A 5K8NA 4ZX8A 2ANPA 3RAMA 1NSAA 2XEIA 4X2TA 2CF4A 4MCPA 3SJGA 2ABZA 3FX6A 2F7VA 4AXVA 2V77A 2C1CA 4TNUA 2Q4ZA 3IFEA 2IMOA 1IGBA 4NGQA 3BI1A 3B2YA 4EWTA 3NFZA 1TF9A 1Y0YA 4OC0A 1LOKA 1R43A 4UEZA 1JQGA 2JBJA 1CX8A 1ARLA 4IK2A 3D7DA 6CPAA 3NA6A 3D7FA 3QNVA 3DLJA 2OR4A 2PVWA 4P6YA 4OC5A 4P4IA 4Z65A 4A94A 3CT9A 1FNOA 2V8GA 1TF8A 3SJFA 3D68A 4JZ0A 3CPXA 2PJ5A 3S9LA 3IJ3A 3V7ZA 5J1QA 1XMBA 1Q7LA 4MHZA 1YLOA 3RBUA 3BHXA 2GLJA 4NGTA 3MRUA 2AFOA 4CPAA 1LANA 2PJ6A 3ISXA 2FVGA 1ZG7A 3HUVA 4MCSA 2IQ6A 3ISZA 2V8VA 4PXCA 4PXEA 5JH9A 2AFWA 3N5FA 2ZEFA 4OC3A 3KASA 4X8IA 2PJAA 5HVGA 3LWUA 4MXUA 3IO1A 2BO9A 4A39A 4MHNA 4P4JA 3BXMA 2PJ8A 5K8PA 1VIXA 4ZYQA 1CG2A 2V8DA 1F57A 4WJBA 4MHPA 4PPZA 3WC5A 1ELMP 7CPAA 2DEAA 4TWEA 5THWA 2HC9A 1PCAA 1DTDA 4P4EA 3FEEA 3SJEA 3PB4X 5F09A 4DJLA 3D7HA 4DYOA 1RTQA 3KGQA 2GU2A 2F8HA 4WWVA 2V8HA 3PFOA 3WC6A 4NGMA 3D7GA 4P4FA 1IY7A 3GB0A 1Y7EA 3D67A 4OP4A 2PJBA 4OC4A 4NFRA 2PJ1A 4F9UA 1EE3P 2WZNA 2C6PA 1BLLE 3B7IA 3B3CA 4MCQA 3B3SA 4KSIA 4PQAA 8CPAA 3NH8A 4EMEA 2PE3A 3H8EA 1YSJA 3IIBA 5CPAA 5IB9A 2OOTA 5DS0A 4NGSA 1GYTA 4MRIA 3SI0A 5D8NA 4ZX9A 3SI1A 3B3WA 2XEGA 4FBEA 1R3NA 2PJ0A 2PVVA 1TKFA 2EK9A 2JEWA 2HB6A 1BPNA 4RUHA 4G1PA 3H8GA 3FH4A 5HVFA 2PJCA 4OC2A 1F2OA 3D4UA 3T8WA 2AFZA 3VATA 5K8OA 2EK8A 1ZG8A 1VGYA 2PJ2A 3KI9A 1YMEA 3H8FA 4K3NA 3K2KA 3LMSA 3VARA 2BCOA 1TKJA 5LYLA 1XBUA 1PYTB 4UEEA 1LAPA 3PBBA 3WC7A 2I3CA 1Z5RA 1ZLIA 2C6GA 4A38A 4Q7AA 5LRJA 1AYEA 5D29A 1HDQA 2AFSA 4R76A 1Z8LA 3PB9X 3GLJA 3RZAA 2AFMA 3NH5A 5LRGA 4F8ZA 1ZG9A 2Q51A 3BI0A 2ZEEA 1TXRA 5HXDA 4ZI6A 4NJQA 5K8MA 2IJZA 3KQXA 2RB7A 1BPMA 3FEDA 4ZY0A 4DUKA 1Y0RA 4X3RA 3D66A 2QYVA 1HDUA 4R6TA 3FECA 4PXBA 1DE4C 1ARMA 1LCPA 2ZEPA 2ZEDA 3B35A 3TC8A 4IHMA 1CP7A 2NSMA 3S9NA 3V38A 4R8FA 1ZLHA 2EWBA 2ZEMA 4P10A 5LYDA 3KR4A 2PJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PFE A;  2PRQ A;  4H2K A;  3CDX A;  3FMC A;  3I1U A;  2O4H A;  2VL1 A;  5JGF A;  3WT4 A;  4B6Z A;  4UF4 A;  4GM5 A;  4NGR A;  3PB6 X;  3IWW A;  4NGP A;  5I4M A;  5CBM A;  1Z2L A;  3IEH A;  1XRY A;  4F9V A;  4UIB A;  4ZY2 A;  3FJU A;  3SI2 A;  1QQ9 A;  2ZOG A;  2G9D A;  2GLF A;  2ZEL A;  1BAV A;  2PJ7 A;  4EFD A;  3KL9 A;  3B3T A;  4R7M A;  2PJ3 A;  3PB7 X;  4NGN A;  1UWY A;  3PB8 X;  3PBE A;  1CBX A;  5JM6 A;  1CPS A;  1XJO A;  4BD9 A;  1HEE A;  2JBK A;  4PXD A;  2WYR A;  4YWY A;  2CTB A;  4LQG A;  1FT7 A;  1CPX A;  4O23 A;  2RFH A;  4OIW A;  3NH4 A;  4MMO A;  1YW4 A;  4UEF A;  4P4D A;  5LRK A;  4OC1 A;  3SJX A;  1LFW A;  2ZEG A;  3IC1 A;  3VH9 A;  1VHE A;  2J9A A;  2QVP A;  4P44 A;  2GRE A;  2PJ4 A;  1LAM A;  1VHO A;  2XEF A;  5LYF A;  3WAB A;  1XFO A;  4P45 A;  2Q43 A;  2AFU A;  1OBR A;  2PIZ A;  4YU9 A;  2XEJ A;  2ZEO A;  2ZEH A;  3CPA A;  1M4L A;  4FAI A;  3KHZ A;  2POK A;  4MHY A;  5ELY A;  2AFX A;  2CTC A;  4JYW A;  1QMU A;  3GUX A;  3TX8 A;  4IAV A;  4OID A;  3PEI A;  2ZEN A;  4UIA A;  4OME A;  2NYQ A;  2CIJ A;  3K9T A;  3FVL A;  4NJR A;  4FWU A;  4ONW A;  4W9Y A;  4OKO A;  1H8L A;  4P4B A;  3FF3 A;  4FUU A;  2PCU A;  1KWM A;  2BOA A;  5HVH A;  1AMP A;  3DGV A;  3KHX A;  3L2N A;  1YW6 A;  3MN8 A;  3KZW A;  3B3V A;  1F2P A;  2PIY A;  4A37 A;  4MCR A;  2O53 A;  3KR5 A;  3JRU A;  1ELL P;  2QJ8 A;  3S9M A;  3PRT A;  1CP6 A;  5LYI A;  3KQZ A;  3HLP A;  1TKH A;  2C6C A;  2ZOF A;  4ZY1 A;  5K8N A;  4ZX8 A;  2ANP A;  3RAM A;  1NSA A;  2XEI A;  4X2T A;  2CF4 A;  4MCP A;  3SJG A;  2ABZ A;  3FX6 A;  2F7V A;  4AXV A;  2V77 A;  2C1C A;  4TNU A;  2Q4Z A;  3IFE A;  2IMO A;  1IGB A;  4NGQ A;  3BI1 A;  3B2Y A;  4EWT A;  3NFZ A;  1TF9 A;  1Y0Y A;  4OC0 A;  1LOK A;  1R43 A;  4UEZ A;  1JQG A;  2JBJ A;  1CX8 A;  1ARL A;  4IK2 A;  3D7D A;  6CPA A;  3NA6 A;  3D7F A;  3QNV A;  3DLJ A;  2OR4 A;  2PVW A;  4P6Y A;  4OC5 A;  4P4I A;  4Z65 A;  4A94 A;  3CT9 A;  1FNO A;  2V8G A;  1TF8 A;  3SJF A;  3D68 A;  4JZ0 A;  3CPX A;  2PJ5 A;  3S9L A;  3IJ3 A;  3V7Z A;  5J1Q A;  1XMB A;  1Q7L A;  4MHZ A;  1YLO A;  3RBU A;  3BHX A;  2GLJ A;  4NGT A;  3MRU A;  2AFO A;  4CPA A;  1LAN A;  2PJ6 A;  3ISX A;  2FVG A;  1ZG7 A;  3HUV A;  4MCS A;  2IQ6 A;  3ISZ A;  2V8V A;  4PXC A;  4PXE A;  5JH9 A;  2AFW A;  3N5F A;  2ZEF A;  4OC3 A;  3KAS A;  4X8I A;  2PJA A;  5HVG A;  3LWU A;  4MXU A;  3IO1 A;  2BO9 A;  4A39 A;  4MHN A;  4P4J A;  3BXM A;  2PJ8 A;  5K8P A;  1VIX A;  4ZYQ A;  1CG2 A;  2V8D A;  1F57 A;  4WJB A;  4MHP A;  4PPZ A;  3WC5 A;  1ELM P;  7CPA A;  2DEA A;  4TWE A;  5THW A;  2HC9 A;  1PCA A;  1DTD A;  4P4E A;  3FEE A;  3SJE A;  3PB4 X;  5F09 A;  4DJL A;  3D7H A;  4DYO A;  1RTQ A;  3KGQ A;  2GU2 A;  2F8H A;  4WWV A;  2V8H A;  3PFO A;  3WC6 A;  4NGM A;  3D7G A;  4P4F A;  1IY7 A;  3GB0 A;  1Y7E A;  3D67 A;  4OP4 A;  2PJB A;  4OC4 A;  4NFR A;  2PJ1 A;  4F9U A;  1EE3 P;  2WZN A;  2C6P A;  1BLL E;  3B7I A;  3B3C A;  4MCQ A;  3B3S A;  4KSI A;  4PQA A;  8CPA A;  3NH8 A;  4EME A;  2PE3 A;  3H8E A;  1YSJ A;  3IIB A;  5CPA A;  5IB9 A;  2OOT A;  5DS0 A;  4NGS A;  1GYT A;  4MRI A;  3SI0 A;  5D8N A;  4ZX9 A;  3SI1 A;  3B3W A;  2XEG A;  4FBE A;  1R3N A;  2PJ0 A;  2PVV A;  1TKF A;  2EK9 A;  2JEW A;  2HB6 A;  1BPN A;  4RUH A;  4G1P A;  3H8G A;  3FH4 A;  5HVF A;  2PJC A;  4OC2 A;  1F2O A;  3D4U A;  3T8W A;  2AFZ A;  3VAT A;  5K8O A;  2EK8 A;  1ZG8 A;  1VGY A;  2PJ2 A;  3KI9 A;  1YME A;  3H8F A;  4K3N A;  3K2K A;  3LMS A;  3VAR A;  2BCO A;  1TKJ A;  5LYL A;  1XBU A;  1PYT B;  4UEE A;  1LAP A;  3PBB A;  3WC7 A;  2I3C A;  1Z5R A;  1ZLI A;  2C6G A;  4A38 A;  4Q7A A;  5LRJ A;  1AYE A;  5D29 A;  1HDQ A;  2AFS A;  4R76 A;  1Z8L A;  3PB9 X;  3GLJ A;  3RZA A;  2AFM A;  3NH5 A;  5LRG A;  4F8Z A;  1ZG9 A;  2Q51 A;  3BI0 A;  2ZEE A;  1TXR A;  5HXD A;  4ZI6 A;  4NJQ A;  5K8M A;  2IJZ A;  3KQX A;  2RB7 A;  1BPM A;  3FED A;  4ZY0 A;  4DUK A;  1Y0R A;  4X3R A;  3D66 A;  2QYV A;  1HDU A;  4R6T A;  3FEC A;  4PXB A;  1DE4 C;  1ARM A;  1LCP A;  2ZEP A;  2ZED A;  3B35 A;  3TC8 A;  4IHM A;  1CP7 A;  2NSM A;  3S9N A;  3V38 A;  4R8F A;  1ZLH A;  2EWB A;  2ZEM A;  4P10 A;  5LYD A;  3KR4 A;  2PJ9 A; 
#chains in the Genus database with same CATH topology
 3PFE A;  4MFZ A;  2GFQ A;  5BWA B;  2PRQ A;  1P0H A;  4H2K A;  1QST A;  3SXO A;  4LUA A;  3DNS A;  3CDX A;  4K30 A;  2FXF A;  3GYA A;  3FMC A;  4I49 A;  4M6G A;  3I1U A;  2O4H A;  2REF A;  3T90 A;  2VL1 A;  4UWJ A;  4E2A A;  4KS9 A;  3N7Z A;  4MBU A;  5JGF A;  1YVK A;  1MJA A;  3WT4 A;  4B6Z A;  2REE A;  3NE7 A;  5JQ4 A;  4UF4 A;  5AG7 A;  2GIV A;  4GM5 A;  4MJ8 A;  3PB6 X;  4NGR A;  3IWW A;  2ZW5 A;  4UWI A;  4NGP A;  4F6A A;  2Z11 A;  4CS0 B;  5IV0 A;  5I4M A;  4JJX A;  3T9Y A;  4R3L A;  2ZPA A;  1Q2Y A;  1Z2L A;  3D2P A;  5CBM A;  3IEH A;  3FRM A;  1XRY A;  3EY5 A;  4HNX B;  4F9V A;  3FB3 A;  4UIB A;  4ZY2 A;  1OZP A;  4FD4 A;  2ZW4 A;  1AUG A;  3RO0 A;  3FJU A;  4MFP A;  4KZT A;  1QQ9 A;  5F48 A;  3SI2 A;  2OZH A;  1RO5 A;  1WK4 A;  2ZOG A;  2FSR A;  4KOT A;  4MFL A;  2G9D A;  2GLF A;  2X7B A;  2ZEL A;  1BAV A;  2PJ7 A;  3DR8 A;  3KL9 A;  2B3V A;  4EFD A;  2I00 A;  3B3T A;  4R7M A;  2PJ3 A;  3PB7 X;  3F8K A;  2JEV A;  4NGN A;  1UWY A;  3PB8 X;  4CGP A;  4UBR A;  3PBE A;  1CBX A;  1Z8T A;  5JM6 A;  1KUV A;  4JXQ A;  4XPK A;  1CPS A;  1XJO A;  1IB1 E;  1HEE A;  2D4O A;  2JBK A;  2WUU A;  2WYR A;  4PXD A;  4YWY A;  4HNW B;  2CTB A;  4LQG A;  4A32 A;  2FIA A;  1FT7 A;  1CPX A;  2EUI A;  4CYQ A;  2H5M A;  2F5I A;  3R9F A;  5EC4 A;  1NSL A;  1YVO A;  4O23 A;  2RFH A;  5H84 A;  2WPW A;  3G8W A;  4OIW A;  4CGO A;  3NH4 A;  1S7K A;  3R96 A;  4HNY B;  4MMO A;  2VXK A;  1YW4 A;  4UEF A;  4P4D A;  4UFW A;  4JLY A;  5A27 A;  4OC1 A;  3SJX A;  1LFW A;  2ZEG A;  3IC1 A;  4UFV A;  3VH9 A;  1VHE A;  1M1D A;  1Q2D A;  4PSX A;  3C26 A;  1S5K A;  3E0K A;  4B11 A;  4PV6 A;  2J9A A;  2QVP A;  4P44 A;  2GRE A;  2PJ4 A;  1QSM A;  2DPS A;  1LAM A;  3JUW A;  4CAE A;  1VHO A;  4QB9 A;  1KUY A;  2XEF A;  1IID A;  5LYF A;  3WAB A;  4CGL A;  1XFO A;  2AJ6 A;  4AG7 A;  4P45 A;  2Q43 A;  2AFU A;  1OBR A;  2HQY A;  3UY5 A;  3A9L A;  2PIZ A;  5EBV A;  4YU9 A;  2XEJ A;  2ZW6 A;  5KTC A;  2ZEO A;  2ZEH A;  2VI7 A;  3CPA A;  1M4L A;  4UCP A;  4FAI A;  4PK2 A;  1XIX A;  4CRY B;  3KHZ A;  2VBQ A;  2BEI A;  2POK A;  4J3G A;  4MHY A;  2FIW A;  1S7L A;  3IWE A;  3PZJ A;  2AFX A;  2ARH A;  2J8M A;  5ELY A;  2CTC A;  4JYW A;  2EVN A;  3EXN A;  4MY0 A;  1QMU A;  1X10 A;  4KLV A;  4R9M A;  3GUX A;  3TX8 A;  4IAV A;  1QSN A;  2RC4 A;  1BO4 A;  4KVO E;  3IU1 A;  3PEI A;  4OID A;  2ZEN A;  4UIA A;  4OME A;  3TCV A;  1QSR A;  2NYQ A;  2VEZ A;  2FCK A;  4KOY A;  2CIJ A;  4A2Z A;  1CJW A;  3I9S A;  2GE3 A;  3LAC A;  3K9T A;  4KOS A;  4EVY A;  3FVL A;  4NJR A;  2GAN A;  4FWU A;  3DSB A;  1Y9W A;  2Q4Y A;  4ONW A;  4KOX A;  4W9Y A;  4OKO A;  1IOF A;  3TO7 A;  1H8L A;  5LRK A;  4P4B A;  1P4N A;  3FF3 A;  4FUU A;  4NCZ A;  4CRZ B;  2PCU A;  1KWM A;  2BOA A;  5HVH A;  1AMP A;  2C27 A;  3DGV A;  3KHX A;  1YW6 A;  3L2N A;  4LQ6 A;  1B6B A;  2J8N A;  2DXQ A;  3EO4 A;  3MN8 A;  2ZXV A;  2R7H A;  4RI1 A;  4CYO A;  3FBU A;  3KZW A;  3B3V A;  5DWN A;  4CAX A;  1F2P A;  2PIY A;  1S7F A;  4A37 A;  4MCR A;  2O53 A;  1TIQ A;  4KOV A;  5EMI A;  4FD5 A;  3VWE A;  4Q36 A;  3KR5 A;  2OB0 A;  3JRU A;  1ELL P;  2QJ8 A;  3S9M A;  4Y49 B;  3H4Q A;  3P2H A;  3PRT A;  2AE6 A;  3R95 A;  1CP6 A;  5LYI A;  3KQZ A;  1I21 A;  3S6F A;  3HLP A;  3LOD A;  2R1I A;  1I1D A;  2YNC C;  2FT0 A;  2P6E A;  1TKH A;  2YNE A;  2Z3N A;  2HV2 A;  2C6C A;  5H86 A;  2ZOF A;  4ZY1 A;  5K8N A;  4ZX8 A;  2Q0Y A;  3TFY A;  2ANP A;  3R1K A;  4KUB A;  3RAM A;  4NF1 A;  1NSA A;  3CXP A;  2XEI A;  3WR7 A;  2NMT A;  5C88 A;  4X2T A;  2CF4 A;  4MCP A;  5F49 A;  3SJG A;  2ABZ A;  4R57 A;  4Y49 C;  3FX6 A;  2Q44 A;  4L89 A;  1GHE A;  4IUS A;  2F7V A;  3LD2 A;  1M44 A;  2BUE A;  5F46 A;  5AGE A;  2V77 A;  1ON0 A;  2OH1 A;  2C1C A;  4TNU A;  4AXV A;  2Q4Z A;  4KOW A;  3NE8 A;  1S60 A;  3IFE A;  3QAY A;  4OLL A;  2IMO A;  2G3T A;  5I0C A;  1BOB A;  1IGB A;  1Z9U A;  4NGQ A;  3BI1 A;  3B2Y A;  4EWT A;  3NFZ A;  1TF9 A;  1Y0Y A;  4OC0 A;  1FY7 A;  1LOK A;  1I12 A;  4GXH A;  1R43 A;  1YQE A;  4UEZ A;  1S7N A;  3RYO A;  3S6H A;  1JQG A;  1YK3 A;  2JBJ A;  1U6M A;  2PDO A;  1CX8 A;  1ARL A;  2B5G B;  2B5G A;  1Y9K A;  3D7D A;  4HKF A;  4IK2 A;  4Q38 A;  6CPA A;  4JXR A;  4B5P A;  2Z0Z A;  4QUS A;  3NA6 A;  3ZZI A;  3D7F A;  3B8G A;  3QNV A;  2PR8 A;  4QVT A;  3JTK A;  1MJ9 A;  1A2Z A;  3D2M A;  3DLJ A;  1J4J A;  2OR4 A;  1RXT A;  3P2F A;  2PVW A;  4CAF A;  2VQY A;  4P6Y A;  3RNZ A;  4QBJ A;  1XMT A;  4B10 A;  4ZBG A;  4OC5 A;  4P4I A;  4C2Z A;  4Z65 A;  4A94 A;  4ORF A;  3R9E A;  3I3G A;  4XPD B;  3VWD A;  3CT9 A;  1FNO A;  2V8G A;  1TF8 A;  2YND A;  3SJF A;  2FE7 A;  3D68 A;  2P6F A;  4KLW A;  3D8P A;  3CPX A;  4JZ0 A;  4UCM A;  4C2X A;  2PJ5 A;  4F0Y A;  3S9L A;  3IJ3 A;  3V7Z A;  5J1Q A;  1XMB A;  3W6S A;  3CZX A;  1KZF A;  5IB0 A;  1Q7L A;  4YRH A;  4AG9 A;  2BL1 A;  3ZJ0 A;  2B58 A;  3FXT A;  4CYP A;  4MHZ A;  4C68 A;  4U9Y A;  1YLO A;  4MY3 A;  2DF5 A;  3RBU A;  1N71 A;  1YX0 A;  3BHX A;  2HUZ A;  4R3K A;  2OZU A;  2WSA A;  4U9Z A;  3TO6 A;  4XPD C;  2O28 A;  4H6U A;  2GLJ A;  3H5Z A;  4NGT A;  4M6I A;  3MGD A;  3MRU A;  3QAH A;  4YFJ A;  2AFO A;  5JPH A;  4CYN A;  4CPA A;  2A4N A;  1VKC A;  1LAN A;  2P0W A;  2PC1 A;  2PJ6 A;  4ONU A;  5FVJ A;  3ISX A;  3EFA A;  3IU2 A;  4MI4 A;  2FVG A;  1ZG7 A;  2I79 A;  1YLE A;  3HUV A;  2K5T A;  3GIU A;  2IQ6 A;  4KSF A;  3ISZ A;  2V8V A;  4MCS A;  2B4B A;  4PXC A;  4PXE A;  5JH9 A;  4XPL A;  2AFW A;  4AB7 A;  4BBH A;  3N5F A;  1ZO0 A;  2ZEF A;  4OC3 A;  4X5K A;  4MFJ A;  5HMN A;  3KAS A;  2PSW A;  1Z8W A;  3S6G A;  2CNT A;  2PQ8 A;  4X8I A;  1Y7R A;  4A31 A;  5AG6 A;  2PJA A;  2Q7S A;  3CXS A;  3LWU A;  2KCW A;  4MXU A;  5HVG A;  4KUA A;  3IO1 A;  3OWC A;  4C7I A;  2BO9 A;  4A39 A;  4B13 A;  4C2Y A;  4MHD A;  4MHN A;  4P4J A;  1YR0 A;  4DNC A;  2CY2 A;  3BXM A;  5G21 A;  3IGR A;  2PJ8 A;  5K8P A;  1XE4 A;  2B4D A;  5CNP A;  4PSW A;  4M85 A;  1VIX A;  1IYK A;  1CG2 A;  2V8D A;  2VZY A;  4M3S A;  4ZYQ A;  1F57 A;  4WJB A;  4A30 A;  4MHP A;  4PPZ A;  3WC5 A;  1ELM P;  2QEC A;  7CPA A;  3K9U A;  2DEA A;  2FL4 A;  1IYL A;  4JD6 A;  2CNM A;  3GY9 A;  4TWE A;  2YNC A;  5THW A;  3DDD A;  4UA3 A;  2HC9 A;  2Q7B A;  1PCA A;  1DTD A;  4QC6 A;  4P4E A;  3FEE A;  1Z8X A;  3BJ8 A;  3G3S A;  3SJE A;  3PB4 X;  4KVM E;  4E8O A;  3V8I A;  5F09 A;  4DJL A;  3D7H A;  4DYO A;  1RTQ A;  4L8A A;  3KGQ A;  2GU2 A;  2F8H A;  4IF5 A;  2V8H A;  3PFO A;  4WWV A;  4NGM A;  3WC6 A;  4A95 A;  3D7G A;  1NMT A;  1M4G A;  4P4F A;  1IY7 A;  1QSO A;  4HPS A;  4H6Z A;  2Z3P A;  3GB0 A;  3S6K A;  4CAV A;  5C82 A;  1CM0 A;  3R9G A;  1Y7E A;  2CNS A;  3D67 A;  4UFX A;  4OP4 A;  2PJB A;  1L0C A;  4MFK A;  4E0A A;  1PUA A;  4OC4 A;  1XEB A;  4NFR A;  3QB8 A;  2PJ1 A;  1LRZ A;  1EE3 P;  4PK3 A;  2WZN A;  4RN7 A;  1XOV A;  4F9U A;  2C6P A;  5G20 A;  1BLL E;  4F0X A;  3B7I A;  3B3C A;  4MCQ A;  5G1Z A;  4BD9 A;  1K4J A;  3B3S A;  4KSI A;  1Q2C A;  2JLM A;  3PP9 A;  4PQA A;  3TE4 A;  8CPA A;  3NH8 A;  5A28 A;  4B5P B;  4EME A;  2PE3 A;  3H8E A;  1YSJ A;  3IIB A;  4H89 A;  5CPA A;  4II9 A;  2Z3O A;  4CGM A;  5J8C A;  1XF8 A;  5IB9 A;  2OOT A;  5DS0 A;  2R8V A;  4NGS A;  1GYT A;  3TTH A;  2OZG A;  4MRI A;  3SI0 A;  5D8N A;  2ODF A;  4ZX9 A;  3W6X A;  3SI1 A;  4M6H A;  4B12 A;  3B3W A;  3PGP A;  2XEG A;  4R87 A;  2G0B A;  4FBE A;  1IU8 A;  1NE9 A;  2FS5 A;  1R3N A;  3EC4 A;  2PJ0 A;  2PVV A;  1R57 A;  1TKF A;  2JDC A;  2Z3M A;  3BJ7 A;  2DPT A;  4FD7 A;  5AG4 A;  2EK9 A;  2JEW A;  1B87 A;  2HB6 A;  4AVA A;  1BPN A;  2Z3K A;  5GCN A;  4KVX A;  4G1P A;  2QML A;  4RUH A;  3H8G A;  5E96 A;  3IWG A;  1X12 A;  3FH4 A;  5HVF A;  2PJC A;  1IOI A;  1F2O A;  4OC2 A;  5IX3 A;  5KTD A;  1PU9 A;  1M4I A;  3D4U A;  3T8W A;  2AFZ A;  3VAT A;  4A33 A;  2EK8 A;  1ZG8 A;  5K8O A;  1VGY A;  2PJ2 A;  1SQH A;  3KI9 A;  1YME A;  3H8F A;  4K3N A;  2D4P A;  2WPX A;  4KOU A;  3K2K A;  3LMS A;  3VAR A;  3W91 A;  2BCO A;  4YGO A;  4AVC A;  1TKJ A;  5LYL A;  3GKR A;  1XBU A;  1PYT B;  4NXY A;  2OU2 A;  1UFH A;  4UEE A;  1LAP A;  3PBB A;  2Y0M A;  2J8R A;  3WC7 A;  2I3C A;  1MJB A;  4JWP A;  3TOB A;  1Z5R A;  4XNH B;  1ZLI A;  2C6G A;  4A38 A;  1Z4E A;  3KKW A;  2Z3L A;  4Q7A A;  5LRJ A;  1AYE A;  3CXQ A;  5D29 A;  1HDQ A;  3FIX A;  2AFS A;  4UCN A;  2Z10 A;  4R76 A;  3F5B A;  1Z8L A;  2VZZ A;  3PB9 X;  5AG5 A;  1WWZ A;  3GLJ A;  4KOR A;  3RZA A;  1S3Z A;  4C7H A;  3D3S A;  2AFM A;  3NH5 A;  5ISV A;  2ATR A;  5LRG A;  1YGH A;  4OAE A;  3SXN A;  4B5O A;  4U5Y A;  5J8F A;  4F8Z A;  1YRE A;  1ZG9 A;  2Q51 A;  2JDD A;  3FYN A;  4XNH C;  3BI0 A;  2ZEE A;  1TXR A;  3SHP A;  5HXD A;  2Q04 A;  5G22 A;  3FNC A;  4OAD A;  1V0C A;  1KUX A;  4ZI6 A;  4NJQ A;  3F0A A;  5K8M A;  2IJZ A;  3KQX A;  2RB7 A;  2CXA A;  4ZGY B;  1BPM A;  1IIC A;  2BSW A;  3FED A;  5HH1 A;  4MFQ A;  2B3U A;  4NEX A;  1Y0R A;  4DUK A;  2QIR A;  3DR6 A;  4ZY0 A;  4X3R A;  2B4D B;  2QYV A;  3D66 A;  5F47 A;  1HDU A;  4R6T A;  4CGN A;  3FEC A;  4PXB A;  1M4D A;  1DE4 C;  1MK4 A;  1ARM A;  1LCP A;  2ZEP A;  2ZED A;  3B35 A;  4FD6 A;  4GS4 A;  4BIN A;  2EO8 A;  4CAW A;  3TC8 A;  3TO9 A;  2YGW A;  4IHM A;  4BMH A;  4KSA A;  1CP7 A;  4AVB A;  4NSQ A;  3TOA A;  2NSM A;  2R98 A;  3S9N A;  2EBJ A;  2P6G A;  1VHS A;  2ZW7 A;  4R8F A;  1ZLH A;  3V38 A;  5DWM A;  4RS2 A;  5KTA A;  2EWB A;  1Z4R A;  2ZEM A;  4P10 A;  3TT2 A;  3BLN A;  2PRB A;  2Q4V A;  2IL4 A;  3JVN A;  5LYD A;  1JWQ A;  2PR1 A;  2PJ9 A;  3KR4 A;  4B14 A;  4LX9 A;  2G3A A; 
#chains in the Genus database with same CATH homology
 3PFE A;  2PRQ A;  4H2K A;  3CDX A;  3FMC A;  3I1U A;  2O4H A;  2VL1 A;  5JGF A;  3WT4 A;  4B6Z A;  4UF4 A;  4GM5 A;  4NGR A;  3PB6 X;  3IWW A;  4NGP A;  5I4M A;  5CBM A;  1Z2L A;  3IEH A;  1XRY A;  4F9V A;  4UIB A;  4ZY2 A;  3FJU A;  3SI2 A;  1QQ9 A;  2ZOG A;  2G9D A;  2GLF A;  2ZEL A;  1BAV A;  2PJ7 A;  4EFD A;  3KL9 A;  3B3T A;  4R7M A;  2PJ3 A;  3PB7 X;  4NGN A;  1UWY A;  3PB8 X;  3PBE A;  1CBX A;  5JM6 A;  1CPS A;  1XJO A;  4BD9 A;  1HEE A;  2JBK A;  4PXD A;  2WYR A;  4YWY A;  2CTB A;  4LQG A;  1FT7 A;  1CPX A;  4O23 A;  2RFH A;  4OIW A;  3NH4 A;  4MMO A;  1YW4 A;  4UEF A;  4P4D A;  5LRK A;  4OC1 A;  3SJX A;  1LFW A;  2ZEG A;  3IC1 A;  3VH9 A;  1VHE A;  2J9A A;  2QVP A;  4P44 A;  2GRE A;  2PJ4 A;  1LAM A;  1VHO A;  2XEF A;  5LYF A;  3WAB A;  1XFO A;  4P45 A;  2Q43 A;  2AFU A;  1OBR A;  2PIZ A;  4YU9 A;  2XEJ A;  2ZEO A;  2ZEH A;  3CPA A;  1M4L A;  4FAI A;  3KHZ A;  2POK A;  4MHY A;  5ELY A;  2AFX A;  2CTC A;  4JYW A;  1QMU A;  3GUX A;  3TX8 A;  4IAV A;  4OID A;  3PEI A;  2ZEN A;  4UIA A;  4OME A;  2NYQ A;  2CIJ A;  3K9T A;  3FVL A;  4NJR A;  4FWU A;  4ONW A;  4W9Y A;  4OKO A;  1H8L A;  4P4B A;  3FF3 A;  4FUU A;  2PCU A;  1KWM A;  2BOA A;  5HVH A;  1AMP A;  3DGV A;  3KHX A;  3L2N A;  1YW6 A;  3MN8 A;  3KZW A;  3B3V A;  1F2P A;  2PIY A;  4A37 A;  4MCR A;  2O53 A;  3KR5 A;  3JRU A;  1ELL P;  2QJ8 A;  3S9M A;  3PRT A;  1CP6 A;  5LYI A;  3KQZ A;  3HLP A;  1TKH A;  2C6C A;  2ZOF A;  4ZY1 A;  5K8N A;  4ZX8 A;  2ANP A;  3RAM A;  1NSA A;  2XEI A;  4X2T A;  2CF4 A;  4MCP A;  3SJG A;  2ABZ A;  3FX6 A;  2F7V A;  4AXV A;  2V77 A;  2C1C A;  4TNU A;  2Q4Z A;  3IFE A;  2IMO A;  1IGB A;  4NGQ A;  3BI1 A;  3B2Y A;  4EWT A;  3NFZ A;  1TF9 A;  1Y0Y A;  4OC0 A;  1LOK A;  1R43 A;  4UEZ A;  1JQG A;  2JBJ A;  1CX8 A;  1ARL A;  4IK2 A;  3D7D A;  6CPA A;  3NA6 A;  3D7F A;  3QNV A;  3DLJ A;  2OR4 A;  2PVW A;  4P6Y A;  4OC5 A;  4P4I A;  4Z65 A;  4A94 A;  3CT9 A;  1FNO A;  2V8G A;  1TF8 A;  3SJF A;  3D68 A;  4JZ0 A;  3CPX A;  2PJ5 A;  3S9L A;  3IJ3 A;  3V7Z A;  5J1Q A;  1XMB A;  1Q7L A;  4MHZ A;  1YLO A;  3RBU A;  3BHX A;  2GLJ A;  4NGT A;  3MRU A;  2AFO A;  4CPA A;  1LAN A;  2PJ6 A;  3ISX A;  2FVG A;  1ZG7 A;  3HUV A;  4MCS A;  2IQ6 A;  3ISZ A;  2V8V A;  4PXC A;  4PXE A;  5JH9 A;  2AFW A;  3N5F A;  2ZEF A;  4OC3 A;  3KAS A;  4X8I A;  2PJA A;  5HVG A;  3LWU A;  4MXU A;  3IO1 A;  2BO9 A;  4A39 A;  4MHN A;  4P4J A;  3BXM A;  2PJ8 A;  5K8P A;  1VIX A;  4ZYQ A;  1CG2 A;  2V8D A;  1F57 A;  4WJB A;  4MHP A;  4PPZ A;  3WC5 A;  1ELM P;  7CPA A;  2DEA A;  4TWE A;  5THW A;  2HC9 A;  1PCA A;  1DTD A;  4P4E A;  3FEE A;  3SJE A;  3PB4 X;  5F09 A;  4DJL A;  3D7H A;  4DYO A;  1RTQ A;  3KGQ A;  2GU2 A;  2F8H A;  4WWV A;  2V8H A;  3PFO A;  3WC6 A;  4NGM A;  3D7G A;  4P4F A;  1IY7 A;  3GB0 A;  1Y7E A;  3D67 A;  4OP4 A;  2PJB A;  4OC4 A;  4NFR A;  2PJ1 A;  4F9U A;  1EE3 P;  2WZN A;  2C6P A;  1BLL E;  3B7I A;  3B3C A;  4MCQ A;  3B3S A;  4KSI A;  4PQA A;  8CPA A;  3NH8 A;  4EME A;  2PE3 A;  3H8E A;  1YSJ A;  3IIB A;  5CPA A;  5IB9 A;  2OOT A;  5DS0 A;  4NGS A;  1GYT A;  4MRI A;  3SI0 A;  5D8N A;  4ZX9 A;  3SI1 A;  3B3W A;  2XEG A;  4FBE A;  1R3N A;  2PJ0 A;  2PVV A;  1TKF A;  2EK9 A;  2JEW A;  2HB6 A;  1BPN A;  4RUH A;  4G1P A;  3H8G A;  3FH4 A;  5HVF A;  2PJC A;  4OC2 A;  1F2O A;  3D4U A;  3T8W A;  2AFZ A;  3VAT A;  5K8O A;  2EK8 A;  1ZG8 A;  1VGY A;  2PJ2 A;  3KI9 A;  1YME A;  3H8F A;  4K3N A;  3K2K A;  3LMS A;  3VAR A;  2BCO A;  1TKJ A;  5LYL A;  1XBU A;  1PYT B;  4UEE A;  1LAP A;  3PBB A;  3WC7 A;  2I3C A;  1Z5R A;  1ZLI A;  2C6G A;  4A38 A;  4Q7A A;  5LRJ A;  1AYE A;  5D29 A;  1HDQ A;  2AFS A;  4R76 A;  1Z8L A;  3PB9 X;  3GLJ A;  3RZA A;  2AFM A;  3NH5 A;  5LRG A;  4F8Z A;  1ZG9 A;  2Q51 A;  3BI0 A;  2ZEE A;  1TXR A;  5HXD A;  4ZI6 A;  4NJQ A;  5K8M A;  2IJZ A;  3KQX A;  2RB7 A;  1BPM A;  3FED A;  4ZY0 A;  4DUK A;  1Y0R A;  4X3R A;  3D66 A;  2QYV A;  1HDU A;  4R6T A;  3FEC A;  4PXB A;  1DE4 C;  1ARM A;  1LCP A;  2ZEP A;  2ZED A;  3B35 A;  3TC8 A;  4IHM A;  1CP7 A;  2NSM A;  3S9N A;  3V38 A;  4R8F A;  1ZLH A;  2EWB A;  2ZEM A;  4P10 A;  5LYD A;  3KR4 A;  2PJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...