1TKHA

Streptomyces griseus aminopeptidase complexed with d-phenylalanine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
277
structure length
274
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETERSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase
publication title Interactions of D Amino Acids with Streptomyces griseus Aminopeptidase
rcsb
molecule tags Hydrolase
total genus 112
structure length 274
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1tkhA00
4IHMA 4EWTA 2PCUA 2F7VA 3VATA 1ARLA 2AFXA 2BCOA 5HVHA 2PVVA 4YWYA 3WT4A 2PJ7A 2PJ8A 3KASA 1Z8LA 3PFEA 4P4EA 4ZX8A 3TX8A 3RZAA 1BLLE 3SI1A 1XRYA 3WC6A 3CPAA 3D7DA 1LCPA 4F9VA 5F09A 3WC7A 2PJ0A 2NYQA 2IMOA 5IB9A 2OR4A 3KR5A 4NJQA 4OMEA 2PJ9A 3DLJA 4Q7AA 4MCRA 1DE4C 1VIXA 1CG2A 1YW6A 1RTQA 4FBEA 3B3TA 3FX6A 4OKOA 2ZEHA 4ONWA 2I3CA 5LYLA 5LRGA 4MRIA 5K8NA 4WJBA 1LOKA 3LMSA 2PJ5A 2QYVA 2ZEFA 2IJZA 4EMEA 4DUKA 1QMUA 3KZWA 3KL9A 4OC4A 3ISZA 3LWUA 3IFEA 1Z2LA 1HDQA 2JBJA 1PCAA 4TNUA 4MCPA 1ARMA 4UEEA 4FUUA 4UF4A 4OC1A 3D7FA 3NH5A 3WC5A 2CTBA 4MHYA 2PJ6A 2GU2A 2Q51A 4X3RA 3B3VA 3BI0A 3IWWA 4IAVA 4PQAA 1HEEA 1PYTB 4P4IA 2CF4A 2IQ6A 4KSIA 4IK2A 3SJFA 2XEIA 3PBEA 4ZY1A 5JH9A 3SJGA 3BI1A 4R6TA 3KHXA 1CPXA 3IIBA 3S9MA 3B2YA 2GLFA 2RFHA 3WABA 4A38A 5LYFA 3S9NA 2EK8A 1H8LA 2WYRA 2C6PA 4X8IA 4ZI6A 4OC3A 3V7ZA 2C6CA 1NSAA 3FMCA 3SI0A 3NH8A 1XBUA 2FVGA 3K9TA 3GB0A 3KGQA 2ZEDA 3PRTA 1CX8A 2HB6A 4OIWA 1DTDA 4PXDA 2O4HA 4OC5A 1CPSA 2EWBA 1YSJA 1VHEA 4UEFA 4R7MA 3VH9A 4NGTA 1GYTA 2NSMA 2V8DA 1QQ9A 3PB4X 2XEJA 2ZELA 2WZNA 1EE3P 2VL1A 2ZOFA 4A37A 3B3WA 1F2PA 3FECA 2J9AA 3FH4A 1CP6A 1BPNA 5D8NA 3FJUA 5LRJA 2GREA 4UIBA 3PB6X 3GUXA 4ZX9A 3RBUA 3KQZA 4MHPA 4H2KA 4NGSA 4P6YA 2PIZA 1LAMA 1XJOA 2PIYA 1TF9A 3JRUA 2XEFA 4MCSA 3D7HA 4F8ZA 4PXCA 3IJ3A 2ABZA 4G1PA 4OP4A 2PJ2A 3RAMA 3D68A 1F57A 4EFDA 5HXDA 3B3SA 2XEGA 4PPZA 4FAIA 4R8FA 3MN8A 2PJ3A 4UEZA 1FT7A 4MCQA 2ZEPA 4NJRA 1YW4A 2EK9A 5K8OA 4PXEA 1UWYA 1ELLP 1KWMA 4NGQA 2GLJA 3GLJA 4DYOA 3SI2A 2V8VA 2ZEEA 2BO9A 5CPAA 2AFMA 5JGFA 4R76A 2AFUA 1R3NA 2Q4ZA 4RUHA 1Y7EA 4F9UA 1BPMA 3S9LA 2Q43A 3DGVA 6CPAA 3ISXA 2F8HA 4PXBA 4LQGA 5K8MA 4A94A 5DS0A 4AXVA 3BXMA 2ZOGA 1TF8A 1TXRA 8CPAA 4B6ZA 4JYWA 2CTCA 3HUVA 5CBMA 2OOTA 3TC8A 1IGBA 3D67A 2AFOA 4K3NA 4P4FA 3B35A 1VHOA 4Z65A 4ZY2A 5J1QA 3D66A 2ANPA 4BD9A 1LFWA 1FNOA 2AFSA 1M4LA 1AMPA 3IEHA 1TKHA 2AFWA 4GM5A 2V77A 4W9YA 3H8EA 2BOAA 1LANA 3D4UA 3I1UA 2PVWA 3PB8X 3KQXA 2V8GA 1ZG8A 1AYEA 2AFZA 5ELYA 1XMBA 2RB7A 3PB7X 4DJLA 5D29A 3PFOA 4YU9A 1Y0YA 3K2KA 4P4JA 1Q7LA 4ZY0A 3KR4A 4FWUA 1CBXA 3CT9A 4OC0A 1F2OA 5LRKA 4OIDA 3HLPA 5LYIA 4NGRA 1VGYA 5LYDA 1Y0RA 1Z5RA 5JM6A 3NH4A 4OC2A 2ZEMA 2QJ8A 3BHXA 3B7IA 1YMEA 4MXUA 1YLOA 2PJAA 1IY7A 2DEAA 3MRUA 1TKJA 4P4BA 4UIAA 3N5FA 3CPXA 2QVPA 4O23A 3H8GA 4A39A 4NFRA 5HVFA 7CPAA 2PJ4A 2ZEOA 3H8FA 3NFZA 1R43A 4P44A 4WWVA 4ZYQA 4X2TA 3FF3A 5K8PA 2ZEGA 2HC9A 1TKFA 4NGPA 5I4MA 2PJBA 3PBBA 2ZENA 4P4DA 3D7GA 2O53A 4MHZA 1ELMP 2G9DA 2PRQA 5THWA 1XFOA 3PEIA 1ZG7A 2CIJA 1ZLHA 3V38A 2POKA 5HVGA 3SJEA 1JQGA 3KI9A 4NGNA 2C1CA 2PJCA 1ZG9A 3L2NA 4CPAA 1OBRA 1LAPA 1BAVA 3FEEA 3PB9X 3T8WA 1ZLIA 4MMOA 2PE3A 3FVLA 4P45A 4TWEA 3NA6A 4NGMA 3IC1A 3IO1A 3CDXA 3QNVA 3VARA 2PJ1A 2C6GA 2JEWA 1CP7A 4JZ0A 3FEDA 4P10A 4MHNA 2V8HA 3B3CA 1HDUA 3SJXA 2JBKA 3KHZA
chains in the Genus database with same CATH superfamily
2F5IA 4CS0B 4JWPA 4IHMA 1TIQA 1B87A 4EWTA 2QMLA 2PCUA 2WPXA 4B12A 2F7VA 3VATA 1I21A 1ARLA 2AFXA 2BCOA 2ZPAA 3S6FA 5HVHA 2PVVA 4FD7A 2QIRA 4UCPA 4QBJA 2VZZA 4YWYA 3WT4A 2PJ7A 4KLVA 3W6XA 1I12A 2J8MA 2PJ8A 4UFWA 2Z3OA 4XNHB 1Z8XA 3KASA 5FVJA 1Z8LA 3PFEA 2B3UA 4CAFA 4P4EA 4ZX8A 3TX8A 2BSWA 3RZAA 3CXPA 1QSTA 1BLLE 4B5PA 4UFXA 3SI1A 3PZJA 5AG6A 1XRYA 4ONUA 1Q2YA 3WC6A 3CPAA 4OADA 4UBRA 3D7DA 1LCPA 4F9VA 5F09A 3WC7A 1I1DA 2PJ0A 4ORFA 4HNXB 4U5YA 2NYQA 2IMOA 5IB9A 4MFJA 2OR4A 5EC4A 4AG7A 3KR5A 4CYQA 4OLLA 4NJQA 1IYLA 2GANA 1YR0A 4M3SA 4OMEA 1QSRA 2P6FA 3LD2A 2PJ9A 3DLJA 2Z3KA 4Q7AA 4MCRA 5CNPA 4RI1A 2Y0MA 1DE4C 1VIXA 1CG2A 3LODA 1YW6A 4Q38A 4QUSA 5A28A 4BINA 3VWEA 2FL4A 1RTQA 1IYKA 2PRBA 3IU2A 4C68A 1QSNA 4FBEA 1IU8A 3B3TA 3FX6A 4OKOA 5E96A 2ZEHA 3GYAA 1S5KA 4ONWA 2I3CA 2Z0ZA 4B14A 5J8CA 3RYOA 4R3LA 5LYLA 3DSBA 2B3VA 2OH1A 5LRGA 5AG4A 4MRIA 5K8NA 4WJBA 4DNCA 3JUWA 4QC6A 2EUIA 3UY5A 3T90A 1YK3A 4CGLA 1S7FA 3FBUA 1LOKA 4XPDC 3LMSA 2PJ5A 4M6GA 2QYVA 3ZZIA 2ZEFA 4ZGYB 2IJZA 3E0KA 4EMEA 4MHDA 4DUKA 1QMUA 3KZWA 2YGWA 3KL9A 1BO4A 3CXQA 4OC4A 2REEA 5JH9A 3TCVA 4XPLA 2OU2A 3ISZA 3LWUA 3GY9A 3IFEA 5F48A 4IUSA 4J3GA 1Z2LA 1HDQA 2DF5A 3FB3A 2PC1A 2JBJA 1PCAA 3IWGA 4TNUA 2EBJA 4MCPA 1ARMA 4UEEA 4FUUA 3CXSA 4FD5A 4F0XA 4UF4A 3SXNA 4NF1A 4OC1A 3D7FA 3NH5A 4RN7A 3WC5A 2CTBA 4B10A 2PJ6A 3FRMA 4MHYA 3TO7A 2GU2A 2Q51A 4X3RA 3R9GA 3B3VA 3CZXA 3BI0A 3IWWA 4IAVA 2FIWA 4PQAA 2I00A 1HEEA 1MJAA 1K4JA 1PYTB 4CRZB 4A31A 4P4IA 4H6UA 2CF4A 1YREA 3NE7A 2IQ6A 3W91A 2B4BA 2Z11A 4IK2A 4KSIA 4KSAA 3SJFA 3T9YA 2XEIA 1ON0A 2ZW7A 2DPTA 3PBEA 3EO4A 4YGOA 2R7HA 3EFAA 3RO0A 3BI1A 4R6TA 3KHXA 1CPXA 3S6GA 3SJGA 4A32A 2EVNA 3IIBA 2R1IA 5GCNA 3S9MA 3B2YA 4MFKA 2VZYA 2GLFA 4JLYA 4KVOE 2FE7A 1S7NA 2RFHA 3WABA 4A38A 5HMNA 2PQ8A 1MJ9A 5LYFA 3S9NA 2EK8A 4B13A 1H8LA 1IICA 2C6PA 2WYRA 4KOXA 2J8NA 4X8IA 4ZI6A 4OC3A 3DNSA 4NSQA 1YQEA 3V7ZA 2OZUA 2C6CA 2B5GA 1NSAA 2B4DA 4II9A 4LQ6A 3F0AA 4UWIA 2ODFA 3DDDA 4CGOA 3FMCA 4R87A 3SI0A 3I9SA 2Q04A 3NH8A 1XBUA 2FVGA 1IIDA 3DR8A 2ZXVA 4B5PB 3BJ7A 3K9TA 2ZW5A 3GB0A 2QECA 3KGQA 2Z3NA 4NCZA 4C7HA 4KVXA 2ZEDA 3PRTA 2IL4A 2Q0YA 1Y7RA 1CX8A 2HB6A 3MGDA 2P0WA 3C26A 2Z3LA 4OIWA 4E8OA 1DTDA 3FXTA 4PXDA 2O4HA 4OC5A 4CYPA 4CGMA 2RC4A 1CPSA 4CGPA 2EWBA 4MI4A 1YSJA 5BWAB 1VHEA 2OZGA 4UEFA 2VI7A 4R7MA 3VH9A 4A30A 3A9LA 4NGTA 4ZY1A 1GYTA 2NSMA 4Y49C 3TTHA 2V8DA 4KS9A 1QQ9A 1QSOA 2Z10A 3PB4X 4QVTA 4AVAA 2XEJA 4U9YA 4LUAA 2ZELA 4UWJA 4AVBA 2WZNA 1EE3P 2VL1A 2ZOFA 4A37A 3B3WA 3PP9A 4MFQA 4A2ZA 3TE4A 1F2PA 4YFJA 3FECA 4NXYA 3D2PA 1YVOA 1BOBA 2HV2A 4L89A 4QB9A 2JLMA 4M6IA 5C82A 4IF5A 2J9AA 3FH4A 1CP6A 1BPNA 4GS4A 5D8NA 3FJUA 5LRJA 2YNEA 2GREA 4PSWA 4UIBA 3FYNA 1KZFA 3PB6X 5DWMA 3LACA 3GUXA 4ZX9A 3RBUA 3TOAA 1PU9A 3KQZA 2FIAA 5ISVA 4MHPA 4H2KA 4NGSA 2DXQA 4P6YA 2PIZA 4XPKA 3BLNA 4KLWA 5HH1A 1LAMA 4EVYA 2WSAA 1XJOA 4A33A 1U6MA 1S60A 1L0CA 1XE4A 3F5BA 4RS2A 3G8WA 1UFHA 1XMTA 1M4GA 2CNSA 2PIYA 2G0BA 1XEBA 4CAVA 5IX3A 1Z4EA 1YX0A 2FT0A 1TF9A 2Z3MA 4PK2A 1FY7A 4UCMA 3JRUA 5AGEA 2XEFA 4MCSA 2DPSA 3D7HA 2NMTA 3OWCA 2P6EA 4PXCA 4UFVA 5G1ZA 4UA3A 4F8ZA 2PDOA 2C27A 1WK4A 1S7KA 3IJ3A 5EBVA 2ABZA 4G1PA 4OP4A 2PJ2A 3RAMA 4C7IA 2Q7SA 3D68A 1M1DA 1F57A 3SHPA 4EFDA 4KOYA 4E0AA 5HXDA 3B3SA 3WR7A 2XEGA 4PPZA 4FAIA 3B8GA 3W6SA 4R8FA 3MN8A 3S6HA 4XPDB 2PJ3A 1R57A 4UEZA 1FT7A 4MCQA 2ZEPA 3DR6A 4NJRA 4HKFA 4CYNA 1YW4A 5AG7A 2EK9A 3F8KA 5K8OA 3FIXA 4AG9A 4PXEA 1B6BA 4CAEA 1UWYA 3EXNA 4HNWB 5F49A 2GIVA 1ELLP 1KWMA 4NGQA 2GLJA 3GLJA 3PGPA 1IOFA 3GKRA 2BL1A 1Z9UA 1OZPA 3SI2A 2V8VA 3R95A 2ZEEA 4DYOA 2BO9A 1ZO0A 5CPAA 2CNTA 5J8FA 2AFMA 3BJ8A 4KOVA 5JGFA 2B4DB 4R76A 3V8IA 3R1KA 2YNCC 4CRYB 2AFUA 1R3NA 1YGHA 1VHSA 4C2ZA 2Q4ZA 4MFPA 1Y7EA 2PR8A 4RUHA 4KOUA 4F9UA 1BPMA 3S9LA 4KOSA 4KZTA 2Q43A 3DGVA 2REFA 4M85A 3VWDA 6CPAA 3ISXA 2F8HA 4PXBA 2FCKA 4LQGA 5K8MA 4A94A 1GHEA 3KKWA 4HNYB 5DS0A 4AXVA 2CY2A 5JQ4A 1JWQA 1RXTA 1NMTA 4CYOA 4MY0A 2FSRA 3BXMA 4FD4A 2ZOGA 2ZW4A 4JD6A 4JXQA 3R9FA 2G3AA 1Q2DA 1TF8A 1TXRA 2OZHA 1J4JA 2ATRA 8CPAA 4MFZA 5KTCA 4B6ZA 4L8AA 4JYWA 2CTCA 3HUVA 5G21A 2B58A 3H4QA 2G3TA 5KTDA 3JTKA 3S6KA 1XOVA 3RNZA 5CBMA 4MFLA 2OOTA 1P0HA 3TC8A 1KUYA 1IGBA 2AJ6A 3D67A 2AFOA 4K3NA 2EO8A 3B35A 4P4FA 3TOBA 5IB0A 1VHOA 4Z65A 3SXOA 3IU1A 4ZY2A 2YNCA 5J1QA 2Q4YA 3D66A 4BBHA 2ANPA 4XNHC 4BD9A 1LFWA 1FNOA 2AFSA 1YLEA 3K9UA 1IOIA 1AMPA 1M4LA 3IEHA 4JXRA 3TO6A 1TKHA 1CJWA 2AFWA 4GM5A 2V77A 1QSMA 4W9YA 5A27A 4B5OA 3H8EA 2BOAA 1LANA 3JVNA 3D4UA 3I1UA 1M4IA 4E2AA 5KTAA 2PVWA 2Z3PA 3PB8X 2ZW6A 4H89A 4KSFA 3TO9A 3KQXA 4B11A 3TT2A 3P2FA 2Q4VA 2V8GA 1ZG8A 1AYEA 2J8RA 2AFZA 1XIXA 5ELYA 1KUXA 1XMBA 2CXAA 2VXKA 2RB7A 3PB7X 4Y49B 2R98A 4DJLA 5D29A 4UCNA 4I49A 2GE3A 3PFOA 3R9EA 4YU9A 1Y0YA 4F6AA 3K2KA 4P4JA 2D4PA 4JJXA 1Q7LA 2I79A 2WPWA 3KR4A 1Z8WA 4FWUA 4ZY0A 1CBXA 1X10A 5JPHA 3CT9A 4OC0A 3I3GA 1F2OA 5LRKA 4FD6A 4OIDA 3HLPA 5LYIA 4NGRA 2R8VA 1VGYA 5LYDA 1Y0RA 2JDCA 1XF8A 1Z5RA 4CGNA 5JM6A 3D2MA 3NH4A 3QAYA 4OC2A 4PSXA 3R96A 2ZEMA 2QJ8A 3BHXA 4KUAA 3QAHA 2BUEA 3B7IA 1YMEA 1N71A 4R9MA 3D8PA 4MXUA 3P2HA 2O28A 1YLOA 4KVME 4C2XA 4X5KA 1SQHA 3EC4A 2PJAA 1IY7A 1S7LA 2D4OA 2DEAA 3MRUA 4KOWA 1TKJA 4P4BA 1CM0A 4AVCA 1KUVA 2PR1A 4UIAA 3EY5A 3N5FA 1LRZA 1S3ZA 2VEZA 4PV6A 1MK4A 3CPXA 2GFQA 2QVPA 4M6HA 2K5TA 4O23A 3H8GA 4Q36A 2Q7BA 4CAXA 4A39A 1X12A 1P4NA 1MJBA 4NFRA 5HVFA 4BMHA 7CPAA 2ARHA 2PJ4A 2ZEOA 3H8FA 3NFZA 1R43A 4P44A 2WUUA 2P6GA 4WWVA 4KUBA 4ZYQA 4X2TA 3FF3A 3IGRA 2ZEGA 5K8PA 1A2ZA 2HC9A 1TKFA 1WWZA 4NGPA 2B5GB 2KCWA 5I4MA 2YNDA 2PJBA 3PBBA 2ZENA 2H5MA 4P4DA 3D7GA 5AG5A 3TFYA 4AB7A 2O53A 2VBQA 5F46A 4MHZA 2FXFA 2BEIA 1ELMP 1M4DA 2G9DA 1PUAA 2PRQA 3QB8A 4OAEA 5THWA 3IWEA 1XFOA 2AE6A 4A95A 5IV0A 3FNCA 1ZG7A 3PEIA 2CIJA 1ZLHA 5DWNA 2POKA 4MY3A 3V38A 5HVGA 4KOTA 3SJEA 1JQGA 3KI9A 1Z8TA 4GXHA 4NGNA 4PK3A 2C1CA 5G22A 1VKCA 4KORA 4HPSA 4F0YA 3H5ZA 4LX9A 2FS5A 3N7ZA 3GIUA 2PJCA 1ZG9A 5F47A 3L2NA 1AUGA 4H6ZA 4CPAA 1OBRA 1NSLA 1LAPA 1BAVA 4MBUA 1M44A 5H84A 1RO5A 3FEEA 3PB9X 2A4NA 5G20A 1YVKA 3T8WA 4C2YA 1ZLIA 1V0CA 2CNMA 2PSWA 4MMOA 2PE3A 4YRHA 2JEVA 3FVLA 4P45A 1Y9KA 2Q44A 4U9ZA 2JDDA 5I0CA 5EMIA 4TWEA 3NA6A 3ZJ0A 4MJ8A 4NGMA 3G3SA 3NE8A 1Y9WA 3D3SA 4K30A 2HUZA 3IC1A 1Z4RA 3IO1A 2OB0A 3CDXA 3QNVA 4ZBGA 3VARA 2PJ1A 4R3KA 2C6GA 4NEXA 2JEWA 5C88A 1CP7A 1IB1E 2VQYA 1NE9A 1Q2CA 3FEDA 4JZ0A 4P10A 4MHNA 2HQYA 2V8HA 3B3CA 1HDUA 4R57A 2X7BA 3SJXA 2JBKA 3KHZA 4CAWA 5H86A
chains in the Genus database with same CATH topology
4IHMA 4EWTA 2PCUA 2F7VA 3VATA 1ARLA 2AFXA 2BCOA 5HVHA 2PVVA 4YWYA 3WT4A 2PJ7A 2PJ8A 3KASA 1Z8LA 3PFEA 4P4EA 4ZX8A 3TX8A 3RZAA 1BLLE 3SI1A 1XRYA 3WC6A 3CPAA 3D7DA 1LCPA 4F9VA 5F09A 3WC7A 2PJ0A 2NYQA 2IMOA 5IB9A 2OR4A 3KR5A 4NJQA 4OMEA 2PJ9A 3DLJA 4Q7AA 4MCRA 1DE4C 1VIXA 1CG2A 1YW6A 1RTQA 4FBEA 3B3TA 3FX6A 4OKOA 2ZEHA 4ONWA 2I3CA 5LYLA 5LRGA 4MRIA 5K8NA 4WJBA 1LOKA 3LMSA 2PJ5A 2QYVA 2ZEFA 2IJZA 4EMEA 4DUKA 1QMUA 3KZWA 3KL9A 4OC4A 3ISZA 3LWUA 3IFEA 1Z2LA 1HDQA 2JBJA 1PCAA 4TNUA 4MCPA 1ARMA 4UEEA 4FUUA 4UF4A 4OC1A 3D7FA 3NH5A 3WC5A 2CTBA 4MHYA 2PJ6A 2GU2A 2Q51A 4X3RA 3B3VA 3BI0A 3IWWA 4IAVA 4PQAA 1HEEA 1PYTB 4P4IA 2CF4A 2IQ6A 4KSIA 4IK2A 3SJFA 2XEIA 3PBEA 4ZY1A 5JH9A 3SJGA 3BI1A 4R6TA 3KHXA 1CPXA 3IIBA 3S9MA 3B2YA 2GLFA 2RFHA 3WABA 4A38A 5LYFA 3S9NA 2EK8A 1H8LA 2WYRA 2C6PA 4X8IA 4ZI6A 4OC3A 3V7ZA 2C6CA 1NSAA 3FMCA 3SI0A 3NH8A 1XBUA 2FVGA 3K9TA 3GB0A 3KGQA 2ZEDA 3PRTA 1CX8A 2HB6A 4OIWA 1DTDA 4PXDA 2O4HA 4OC5A 1CPSA 2EWBA 1YSJA 1VHEA 4UEFA 4R7MA 3VH9A 4NGTA 1GYTA 2NSMA 2V8DA 1QQ9A 3PB4X 2XEJA 2ZELA 2WZNA 1EE3P 2VL1A 2ZOFA 4A37A 3B3WA 1F2PA 3FECA 2J9AA 3FH4A 1CP6A 1BPNA 5D8NA 3FJUA 5LRJA 2GREA 4UIBA 3PB6X 3GUXA 4ZX9A 3RBUA 3KQZA 4MHPA 4H2KA 4NGSA 4P6YA 2PIZA 1LAMA 1XJOA 2PIYA 1TF9A 3JRUA 2XEFA 4MCSA 3D7HA 4F8ZA 4PXCA 3IJ3A 2ABZA 4G1PA 4OP4A 2PJ2A 3RAMA 3D68A 1F57A 4EFDA 5HXDA 3B3SA 2XEGA 4PPZA 4FAIA 4R8FA 3MN8A 2PJ3A 4UEZA 1FT7A 4MCQA 2ZEPA 4NJRA 1YW4A 2EK9A 5K8OA 4PXEA 1UWYA 1ELLP 1KWMA 4NGQA 2GLJA 3GLJA 4DYOA 3SI2A 2V8VA 2ZEEA 2BO9A 5CPAA 2AFMA 5JGFA 4R76A 2AFUA 1R3NA 2Q4ZA 4RUHA 1Y7EA 4F9UA 1BPMA 3S9LA 2Q43A 3DGVA 6CPAA 3ISXA 2F8HA 4PXBA 4LQGA 5K8MA 4A94A 5DS0A 4AXVA 3BXMA 2ZOGA 1TF8A 1TXRA 8CPAA 4B6ZA 4JYWA 2CTCA 3HUVA 5CBMA 2OOTA 3TC8A 1IGBA 3D67A 2AFOA 4K3NA 4P4FA 3B35A 1VHOA 4Z65A 4ZY2A 5J1QA 3D66A 2ANPA 4BD9A 1LFWA 1FNOA 2AFSA 1M4LA 1AMPA 3IEHA 1TKHA 2AFWA 4GM5A 2V77A 4W9YA 3H8EA 2BOAA 1LANA 3D4UA 3I1UA 2PVWA 3PB8X 3KQXA 2V8GA 1ZG8A 1AYEA 2AFZA 5ELYA 1XMBA 2RB7A 3PB7X 4DJLA 5D29A 3PFOA 4YU9A 1Y0YA 3K2KA 4P4JA 1Q7LA 4ZY0A 3KR4A 4FWUA 1CBXA 3CT9A 4OC0A 1F2OA 5LRKA 4OIDA 3HLPA 5LYIA 4NGRA 1VGYA 5LYDA 1Y0RA 1Z5RA 5JM6A 3NH4A 4OC2A 2ZEMA 2QJ8A 3BHXA 3B7IA 1YMEA 4MXUA 1YLOA 2PJAA 1IY7A 2DEAA 3MRUA 1TKJA 4P4BA 4UIAA 3N5FA 3CPXA 2QVPA 4O23A 3H8GA 4A39A 4NFRA 5HVFA 7CPAA 2PJ4A 2ZEOA 3H8FA 3NFZA 1R43A 4P44A 4WWVA 4ZYQA 4X2TA 3FF3A 5K8PA 2ZEGA 2HC9A 1TKFA 4NGPA 5I4MA 2PJBA 3PBBA 2ZENA 4P4DA 3D7GA 2O53A 4MHZA 1ELMP 2G9DA 2PRQA 5THWA 1XFOA 3PEIA 1ZG7A 2CIJA 1ZLHA 3V38A 2POKA 5HVGA 3SJEA 1JQGA 3KI9A 4NGNA 2C1CA 2PJCA 1ZG9A 3L2NA 4CPAA 1OBRA 1LAPA 1BAVA 3FEEA 3PB9X 3T8WA 1ZLIA 4MMOA 2PE3A 3FVLA 4P45A 4TWEA 3NA6A 4NGMA 3IC1A 3IO1A 3CDXA 3QNVA 3VARA 2PJ1A 2C6GA 2JEWA 1CP7A 4JZ0A 3FEDA 4P10A 4MHNA 2V8HA 3B3CA 1HDUA 3SJXA 2JBKA 3KHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHM A;  4EWT A;  2PCU A;  2F7V A;  3VAT A;  1ARL A;  2AFX A;  2BCO A;  5HVH A;  2PVV A;  4YWY A;  3WT4 A;  2PJ7 A;  2PJ8 A;  3KAS A;  1Z8L A;  3PFE A;  4P4E A;  4ZX8 A;  3TX8 A;  3RZA A;  1BLL E;  3SI1 A;  1XRY A;  3WC6 A;  3CPA A;  3D7D A;  1LCP A;  4F9V A;  5F09 A;  3WC7 A;  2PJ0 A;  2NYQ A;  2IMO A;  5IB9 A;  2OR4 A;  3KR5 A;  4NJQ A;  4OME A;  2PJ9 A;  3DLJ A;  4Q7A A;  4MCR A;  1DE4 C;  1VIX A;  1CG2 A;  1YW6 A;  1RTQ A;  4FBE A;  3B3T A;  3FX6 A;  4OKO A;  2ZEH A;  4ONW A;  2I3C A;  5LYL A;  5LRG A;  4MRI A;  5K8N A;  4WJB A;  1LOK A;  3LMS A;  2PJ5 A;  2QYV A;  2ZEF A;  2IJZ A;  4EME A;  4DUK A;  1QMU A;  3KZW A;  3KL9 A;  4OC4 A;  3ISZ A;  3LWU A;  3IFE A;  1Z2L A;  1HDQ A;  2JBJ A;  1PCA A;  4TNU A;  4MCP A;  1ARM A;  4UEE A;  4FUU A;  4UF4 A;  4OC1 A;  3D7F A;  3NH5 A;  3WC5 A;  2CTB A;  4MHY A;  2PJ6 A;  2GU2 A;  2Q51 A;  4X3R A;  3B3V A;  3BI0 A;  3IWW A;  4IAV A;  4PQA A;  1HEE A;  1PYT B;  4P4I A;  2CF4 A;  2IQ6 A;  4KSI A;  4IK2 A;  3SJF A;  2XEI A;  3PBE A;  4ZY1 A;  5JH9 A;  3SJG A;  3BI1 A;  4R6T A;  3KHX A;  1CPX A;  3IIB A;  3S9M A;  3B2Y A;  2GLF A;  2RFH A;  3WAB A;  4A38 A;  5LYF A;  3S9N A;  2EK8 A;  1H8L A;  2WYR A;  2C6P A;  4X8I A;  4ZI6 A;  4OC3 A;  3V7Z A;  2C6C A;  1NSA A;  3FMC A;  3SI0 A;  3NH8 A;  1XBU A;  2FVG A;  3K9T A;  3GB0 A;  3KGQ A;  2ZED A;  3PRT A;  1CX8 A;  2HB6 A;  4OIW A;  1DTD A;  4PXD A;  2O4H A;  4OC5 A;  1CPS A;  2EWB A;  1YSJ A;  1VHE A;  4UEF A;  4R7M A;  3VH9 A;  4NGT A;  1GYT A;  2NSM A;  2V8D A;  1QQ9 A;  3PB4 X;  2XEJ A;  2ZEL A;  2WZN A;  1EE3 P;  2VL1 A;  2ZOF A;  4A37 A;  3B3W A;  1F2P A;  3FEC A;  2J9A A;  3FH4 A;  1CP6 A;  1BPN A;  5D8N A;  3FJU A;  5LRJ A;  2GRE A;  4UIB A;  3PB6 X;  3GUX A;  4ZX9 A;  3RBU A;  3KQZ A;  4MHP A;  4H2K A;  4NGS A;  4P6Y A;  2PIZ A;  1LAM A;  1XJO A;  2PIY A;  1TF9 A;  3JRU A;  2XEF A;  4MCS A;  3D7H A;  4F8Z A;  4PXC A;  3IJ3 A;  2ABZ A;  4G1P A;  4OP4 A;  2PJ2 A;  3RAM A;  3D68 A;  1F57 A;  4EFD A;  5HXD A;  3B3S A;  2XEG A;  4PPZ A;  4FAI A;  4R8F A;  3MN8 A;  2PJ3 A;  4UEZ A;  1FT7 A;  4MCQ A;  2ZEP A;  4NJR A;  1YW4 A;  2EK9 A;  5K8O A;  4PXE A;  1UWY A;  1ELL P;  1KWM A;  4NGQ A;  2GLJ A;  3GLJ A;  4DYO A;  3SI2 A;  2V8V A;  2ZEE A;  2BO9 A;  5CPA A;  2AFM A;  5JGF A;  4R76 A;  2AFU A;  1R3N A;  2Q4Z A;  4RUH A;  1Y7E A;  4F9U A;  1BPM A;  3S9L A;  2Q43 A;  3DGV A;  6CPA A;  3ISX A;  2F8H A;  4PXB A;  4LQG A;  5K8M A;  4A94 A;  5DS0 A;  4AXV A;  3BXM A;  2ZOG A;  1TF8 A;  1TXR A;  8CPA A;  4B6Z A;  4JYW A;  2CTC A;  3HUV A;  5CBM A;  2OOT A;  3TC8 A;  1IGB A;  3D67 A;  2AFO A;  4K3N A;  4P4F A;  3B35 A;  1VHO A;  4Z65 A;  4ZY2 A;  5J1Q A;  3D66 A;  2ANP A;  4BD9 A;  1LFW A;  1FNO A;  2AFS A;  1M4L A;  1AMP A;  3IEH A;  1TKH A;  2AFW A;  4GM5 A;  2V77 A;  4W9Y A;  3H8E A;  2BOA A;  1LAN A;  3D4U A;  3I1U A;  2PVW A;  3PB8 X;  3KQX A;  2V8G A;  1ZG8 A;  1AYE A;  2AFZ A;  5ELY A;  1XMB A;  2RB7 A;  3PB7 X;  4DJL A;  5D29 A;  3PFO A;  4YU9 A;  1Y0Y A;  3K2K A;  4P4J A;  1Q7L A;  4ZY0 A;  3KR4 A;  4FWU A;  1CBX A;  3CT9 A;  4OC0 A;  1F2O A;  5LRK A;  4OID A;  3HLP A;  5LYI A;  4NGR A;  1VGY A;  5LYD A;  1Y0R A;  1Z5R A;  5JM6 A;  3NH4 A;  4OC2 A;  2ZEM A;  2QJ8 A;  3BHX A;  3B7I A;  1YME A;  4MXU A;  1YLO A;  2PJA A;  1IY7 A;  2DEA A;  3MRU A;  1TKJ A;  4P4B A;  4UIA A;  3N5F A;  3CPX A;  2QVP A;  4O23 A;  3H8G A;  4A39 A;  4NFR A;  5HVF A;  7CPA A;  2PJ4 A;  2ZEO A;  3H8F A;  3NFZ A;  1R43 A;  4P44 A;  4WWV A;  4ZYQ A;  4X2T A;  3FF3 A;  5K8P A;  2ZEG A;  2HC9 A;  1TKF A;  4NGP A;  5I4M A;  2PJB A;  3PBB A;  2ZEN A;  4P4D A;  3D7G A;  2O53 A;  4MHZ A;  1ELM P;  2G9D A;  2PRQ A;  5THW A;  1XFO A;  3PEI A;  1ZG7 A;  2CIJ A;  1ZLH A;  3V38 A;  2POK A;  5HVG A;  3SJE A;  1JQG A;  3KI9 A;  4NGN A;  2C1C A;  2PJC A;  1ZG9 A;  3L2N A;  4CPA A;  1OBR A;  1LAP A;  1BAV A;  3FEE A;  3PB9 X;  3T8W A;  1ZLI A;  4MMO A;  2PE3 A;  3FVL A;  4P45 A;  4TWE A;  3NA6 A;  4NGM A;  3IC1 A;  3IO1 A;  3CDX A;  3QNV A;  3VAR A;  2PJ1 A;  2C6G A;  2JEW A;  1CP7 A;  4JZ0 A;  3FED A;  4P10 A;  4MHN A;  2V8H A;  3B3C A;  1HDU A;  3SJX A;  2JBK A;  3KHZ A; 
#chains in the Genus database with same CATH topology
 2F5I A;  4CS0 B;  4JWP A;  4IHM A;  1TIQ A;  1B87 A;  4EWT A;  2QML A;  2PCU A;  2WPX A;  4B12 A;  2F7V A;  3VAT A;  1I21 A;  1ARL A;  2AFX A;  2BCO A;  2ZPA A;  3S6F A;  5HVH A;  2PVV A;  4FD7 A;  2QIR A;  4UCP A;  4QBJ A;  2VZZ A;  4YWY A;  3WT4 A;  2PJ7 A;  4KLV A;  3W6X A;  1I12 A;  2J8M A;  2PJ8 A;  4UFW A;  2Z3O A;  4XNH B;  1Z8X A;  3KAS A;  5FVJ A;  1Z8L A;  3PFE A;  2B3U A;  4CAF A;  4P4E A;  4ZX8 A;  3TX8 A;  2BSW A;  3RZA A;  3CXP A;  1QST A;  1BLL E;  4B5P A;  4UFX A;  3SI1 A;  3PZJ A;  5AG6 A;  1XRY A;  4ONU A;  1Q2Y A;  3WC6 A;  3CPA A;  4OAD A;  4UBR A;  3D7D A;  1LCP A;  4F9V A;  5F09 A;  3WC7 A;  1I1D A;  2PJ0 A;  4ORF A;  4HNX B;  4U5Y A;  2NYQ A;  2IMO A;  5IB9 A;  4MFJ A;  2OR4 A;  5EC4 A;  4AG7 A;  3KR5 A;  4CYQ A;  4OLL A;  4NJQ A;  1IYL A;  2GAN A;  1YR0 A;  4M3S A;  4OME A;  1QSR A;  2P6F A;  3LD2 A;  2PJ9 A;  3DLJ A;  2Z3K A;  4Q7A A;  4MCR A;  5CNP A;  4RI1 A;  2Y0M A;  1DE4 C;  1VIX A;  1CG2 A;  3LOD A;  1YW6 A;  4Q38 A;  4QUS A;  5A28 A;  4BIN A;  3VWE A;  2FL4 A;  1RTQ A;  1IYK A;  2PRB A;  3IU2 A;  4C68 A;  1QSN A;  4FBE A;  1IU8 A;  3B3T A;  3FX6 A;  4OKO A;  5E96 A;  2ZEH A;  3GYA A;  1S5K A;  4ONW A;  2I3C A;  2Z0Z A;  4B14 A;  5J8C A;  3RYO A;  4R3L A;  5LYL A;  3DSB A;  2B3V A;  2OH1 A;  5LRG A;  5AG4 A;  4MRI A;  5K8N A;  4WJB A;  4DNC A;  3JUW A;  4QC6 A;  2EUI A;  3UY5 A;  3T90 A;  1YK3 A;  4CGL A;  1S7F A;  3FBU A;  1LOK A;  4XPD C;  3LMS A;  2PJ5 A;  4M6G A;  2QYV A;  3ZZI A;  2ZEF A;  4ZGY B;  2IJZ A;  3E0K A;  4EME A;  4MHD A;  4DUK A;  1QMU A;  3KZW A;  2YGW A;  3KL9 A;  1BO4 A;  3CXQ A;  4OC4 A;  2REE A;  5JH9 A;  3TCV A;  4XPL A;  2OU2 A;  3ISZ A;  3LWU A;  3GY9 A;  3IFE A;  5F48 A;  4IUS A;  4J3G A;  1Z2L A;  1HDQ A;  2DF5 A;  3FB3 A;  2PC1 A;  2JBJ A;  1PCA A;  3IWG A;  4TNU A;  2EBJ A;  4MCP A;  1ARM A;  4UEE A;  4FUU A;  3CXS A;  4FD5 A;  4F0X A;  4UF4 A;  3SXN A;  4NF1 A;  4OC1 A;  3D7F A;  3NH5 A;  4RN7 A;  3WC5 A;  2CTB A;  4B10 A;  2PJ6 A;  3FRM A;  4MHY A;  3TO7 A;  2GU2 A;  2Q51 A;  4X3R A;  3R9G A;  3B3V A;  3CZX A;  3BI0 A;  3IWW A;  4IAV A;  2FIW A;  4PQA A;  2I00 A;  1HEE A;  1MJA A;  1K4J A;  1PYT B;  4CRZ B;  4A31 A;  4P4I A;  4H6U A;  2CF4 A;  1YRE A;  3NE7 A;  2IQ6 A;  3W91 A;  2B4B A;  2Z11 A;  4IK2 A;  4KSI A;  4KSA A;  3SJF A;  3T9Y A;  2XEI A;  1ON0 A;  2ZW7 A;  2DPT A;  3PBE A;  3EO4 A;  4YGO A;  2R7H A;  3EFA A;  3RO0 A;  3BI1 A;  4R6T A;  3KHX A;  1CPX A;  3S6G A;  3SJG A;  4A32 A;  2EVN A;  3IIB A;  2R1I A;  5GCN A;  3S9M A;  3B2Y A;  4MFK A;  2VZY A;  2GLF A;  4JLY A;  4KVO E;  2FE7 A;  1S7N A;  2RFH A;  3WAB A;  4A38 A;  5HMN A;  2PQ8 A;  1MJ9 A;  5LYF A;  3S9N A;  2EK8 A;  4B13 A;  1H8L A;  1IIC A;  2C6P A;  2WYR A;  4KOX A;  2J8N A;  4X8I A;  4ZI6 A;  4OC3 A;  3DNS A;  4NSQ A;  1YQE A;  3V7Z A;  2OZU A;  2C6C A;  2B5G A;  1NSA A;  2B4D A;  4II9 A;  4LQ6 A;  3F0A A;  4UWI A;  2ODF A;  3DDD A;  4CGO A;  3FMC A;  4R87 A;  3SI0 A;  3I9S A;  2Q04 A;  3NH8 A;  1XBU A;  2FVG A;  1IID A;  3DR8 A;  2ZXV A;  4B5P B;  3BJ7 A;  3K9T A;  2ZW5 A;  3GB0 A;  2QEC A;  3KGQ A;  2Z3N A;  4NCZ A;  4C7H A;  4KVX A;  2ZED A;  3PRT A;  2IL4 A;  2Q0Y A;  1Y7R A;  1CX8 A;  2HB6 A;  3MGD A;  2P0W A;  3C26 A;  2Z3L A;  4OIW A;  4E8O A;  1DTD A;  3FXT A;  4PXD A;  2O4H A;  4OC5 A;  4CYP A;  4CGM A;  2RC4 A;  1CPS A;  4CGP A;  2EWB A;  4MI4 A;  1YSJ A;  5BWA B;  1VHE A;  2OZG A;  4UEF A;  2VI7 A;  4R7M A;  3VH9 A;  4A30 A;  3A9L A;  4NGT A;  4ZY1 A;  1GYT A;  2NSM A;  4Y49 C;  3TTH A;  2V8D A;  4KS9 A;  1QQ9 A;  1QSO A;  2Z10 A;  3PB4 X;  4QVT A;  4AVA A;  2XEJ A;  4U9Y A;  4LUA A;  2ZEL A;  4UWJ A;  4AVB A;  2WZN A;  1EE3 P;  2VL1 A;  2ZOF A;  4A37 A;  3B3W A;  3PP9 A;  4MFQ A;  4A2Z A;  3TE4 A;  1F2P A;  4YFJ A;  3FEC A;  4NXY A;  3D2P A;  1YVO A;  1BOB A;  2HV2 A;  4L89 A;  4QB9 A;  2JLM A;  4M6I A;  5C82 A;  4IF5 A;  2J9A A;  3FH4 A;  1CP6 A;  1BPN A;  4GS4 A;  5D8N A;  3FJU A;  5LRJ A;  2YNE A;  2GRE A;  4PSW A;  4UIB A;  3FYN A;  1KZF A;  3PB6 X;  5DWM A;  3LAC A;  3GUX A;  4ZX9 A;  3RBU A;  3TOA A;  1PU9 A;  3KQZ A;  2FIA A;  5ISV A;  4MHP A;  4H2K A;  4NGS A;  2DXQ A;  4P6Y A;  2PIZ A;  4XPK A;  3BLN A;  4KLW A;  5HH1 A;  1LAM A;  4EVY A;  2WSA A;  1XJO A;  4A33 A;  1U6M A;  1S60 A;  1L0C A;  1XE4 A;  3F5B A;  4RS2 A;  3G8W A;  1UFH A;  1XMT A;  1M4G A;  2CNS A;  2PIY A;  2G0B A;  1XEB A;  4CAV A;  5IX3 A;  1Z4E A;  1YX0 A;  2FT0 A;  1TF9 A;  2Z3M A;  4PK2 A;  1FY7 A;  4UCM A;  3JRU A;  5AGE A;  2XEF A;  4MCS A;  2DPS A;  3D7H A;  2NMT A;  3OWC A;  2P6E A;  4PXC A;  4UFV A;  5G1Z A;  4UA3 A;  4F8Z A;  2PDO A;  2C27 A;  1WK4 A;  1S7K A;  3IJ3 A;  5EBV A;  2ABZ A;  4G1P A;  4OP4 A;  2PJ2 A;  3RAM A;  4C7I A;  2Q7S A;  3D68 A;  1M1D A;  1F57 A;  3SHP A;  4EFD A;  4KOY A;  4E0A A;  5HXD A;  3B3S A;  3WR7 A;  2XEG A;  4PPZ A;  4FAI A;  3B8G A;  3W6S A;  4R8F A;  3MN8 A;  3S6H A;  4XPD B;  2PJ3 A;  1R57 A;  4UEZ A;  1FT7 A;  4MCQ A;  2ZEP A;  3DR6 A;  4NJR A;  4HKF A;  4CYN A;  1YW4 A;  5AG7 A;  2EK9 A;  3F8K A;  5K8O A;  3FIX A;  4AG9 A;  4PXE A;  1B6B A;  4CAE A;  1UWY A;  3EXN A;  4HNW B;  5F49 A;  2GIV A;  1ELL P;  1KWM A;  4NGQ A;  2GLJ A;  3GLJ A;  3PGP A;  1IOF A;  3GKR A;  2BL1 A;  1Z9U A;  1OZP A;  3SI2 A;  2V8V A;  3R95 A;  2ZEE A;  4DYO A;  2BO9 A;  1ZO0 A;  5CPA A;  2CNT A;  5J8F A;  2AFM A;  3BJ8 A;  4KOV A;  5JGF A;  2B4D B;  4R76 A;  3V8I A;  3R1K A;  2YNC C;  4CRY B;  2AFU A;  1R3N A;  1YGH A;  1VHS A;  4C2Z A;  2Q4Z A;  4MFP A;  1Y7E A;  2PR8 A;  4RUH A;  4KOU A;  4F9U A;  1BPM A;  3S9L A;  4KOS A;  4KZT A;  2Q43 A;  3DGV A;  2REF A;  4M85 A;  3VWD A;  6CPA A;  3ISX A;  2F8H A;  4PXB A;  2FCK A;  4LQG A;  5K8M A;  4A94 A;  1GHE A;  3KKW A;  4HNY B;  5DS0 A;  4AXV A;  2CY2 A;  5JQ4 A;  1JWQ A;  1RXT A;  1NMT A;  4CYO A;  4MY0 A;  2FSR A;  3BXM A;  4FD4 A;  2ZOG A;  2ZW4 A;  4JD6 A;  4JXQ A;  3R9F A;  2G3A A;  1Q2D A;  1TF8 A;  1TXR A;  2OZH A;  1J4J A;  2ATR A;  8CPA A;  4MFZ A;  5KTC A;  4B6Z A;  4L8A A;  4JYW A;  2CTC A;  3HUV A;  5G21 A;  2B58 A;  3H4Q A;  2G3T A;  5KTD A;  3JTK A;  3S6K A;  1XOV A;  3RNZ A;  5CBM A;  4MFL A;  2OOT A;  1P0H A;  3TC8 A;  1KUY A;  1IGB A;  2AJ6 A;  3D67 A;  2AFO A;  4K3N A;  2EO8 A;  3B35 A;  4P4F A;  3TOB A;  5IB0 A;  1VHO A;  4Z65 A;  3SXO A;  3IU1 A;  4ZY2 A;  2YNC A;  5J1Q A;  2Q4Y A;  3D66 A;  4BBH A;  2ANP A;  4XNH C;  4BD9 A;  1LFW A;  1FNO A;  2AFS A;  1YLE A;  3K9U A;  1IOI A;  1AMP A;  1M4L A;  3IEH A;  4JXR A;  3TO6 A;  1TKH A;  1CJW A;  2AFW A;  4GM5 A;  2V77 A;  1QSM A;  4W9Y A;  5A27 A;  4B5O A;  3H8E A;  2BOA A;  1LAN A;  3JVN A;  3D4U A;  3I1U A;  1M4I A;  4E2A A;  5KTA A;  2PVW A;  2Z3P A;  3PB8 X;  2ZW6 A;  4H89 A;  4KSF A;  3TO9 A;  3KQX A;  4B11 A;  3TT2 A;  3P2F A;  2Q4V A;  2V8G A;  1ZG8 A;  1AYE A;  2J8R A;  2AFZ A;  1XIX A;  5ELY A;  1KUX A;  1XMB A;  2CXA A;  2VXK A;  2RB7 A;  3PB7 X;  4Y49 B;  2R98 A;  4DJL A;  5D29 A;  4UCN A;  4I49 A;  2GE3 A;  3PFO A;  3R9E A;  4YU9 A;  1Y0Y A;  4F6A A;  3K2K A;  4P4J A;  2D4P A;  4JJX A;  1Q7L A;  2I79 A;  2WPW A;  3KR4 A;  1Z8W A;  4FWU A;  4ZY0 A;  1CBX A;  1X10 A;  5JPH A;  3CT9 A;  4OC0 A;  3I3G A;  1F2O A;  5LRK A;  4FD6 A;  4OID A;  3HLP A;  5LYI A;  4NGR A;  2R8V A;  1VGY A;  5LYD A;  1Y0R A;  2JDC A;  1XF8 A;  1Z5R A;  4CGN A;  5JM6 A;  3D2M A;  3NH4 A;  3QAY A;  4OC2 A;  4PSX A;  3R96 A;  2ZEM A;  2QJ8 A;  3BHX A;  4KUA A;  3QAH A;  2BUE A;  3B7I A;  1YME A;  1N71 A;  4R9M A;  3D8P A;  4MXU A;  3P2H A;  2O28 A;  1YLO A;  4KVM E;  4C2X A;  4X5K A;  1SQH A;  3EC4 A;  2PJA A;  1IY7 A;  1S7L A;  2D4O A;  2DEA A;  3MRU A;  4KOW A;  1TKJ A;  4P4B A;  1CM0 A;  4AVC A;  1KUV A;  2PR1 A;  4UIA A;  3EY5 A;  3N5F A;  1LRZ A;  1S3Z A;  2VEZ A;  4PV6 A;  1MK4 A;  3CPX A;  2GFQ A;  2QVP A;  4M6H A;  2K5T A;  4O23 A;  3H8G A;  4Q36 A;  2Q7B A;  4CAX A;  4A39 A;  1X12 A;  1P4N A;  1MJB A;  4NFR A;  5HVF A;  4BMH A;  7CPA A;  2ARH A;  2PJ4 A;  2ZEO A;  3H8F A;  3NFZ A;  1R43 A;  4P44 A;  2WUU A;  2P6G A;  4WWV A;  4KUB A;  4ZYQ A;  4X2T A;  3FF3 A;  3IGR A;  2ZEG A;  5K8P A;  1A2Z A;  2HC9 A;  1TKF A;  1WWZ A;  4NGP A;  2B5G B;  2KCW A;  5I4M A;  2YND A;  2PJB A;  3PBB A;  2ZEN A;  2H5M A;  4P4D A;  3D7G A;  5AG5 A;  3TFY A;  4AB7 A;  2O53 A;  2VBQ A;  5F46 A;  4MHZ A;  2FXF A;  2BEI A;  1ELM P;  1M4D A;  2G9D A;  1PUA A;  2PRQ A;  3QB8 A;  4OAE A;  5THW A;  3IWE A;  1XFO A;  2AE6 A;  4A95 A;  5IV0 A;  3FNC A;  1ZG7 A;  3PEI A;  2CIJ A;  1ZLH A;  5DWN A;  2POK A;  4MY3 A;  3V38 A;  5HVG A;  4KOT A;  3SJE A;  1JQG A;  3KI9 A;  1Z8T A;  4GXH A;  4NGN A;  4PK3 A;  2C1C A;  5G22 A;  1VKC A;  4KOR A;  4HPS A;  4F0Y A;  3H5Z A;  4LX9 A;  2FS5 A;  3N7Z A;  3GIU A;  2PJC A;  1ZG9 A;  5F47 A;  3L2N A;  1AUG A;  4H6Z A;  4CPA A;  1OBR A;  1NSL A;  1LAP A;  1BAV A;  4MBU A;  1M44 A;  5H84 A;  1RO5 A;  3FEE A;  3PB9 X;  2A4N A;  5G20 A;  1YVK A;  3T8W A;  4C2Y A;  1ZLI A;  1V0C A;  2CNM A;  2PSW A;  4MMO A;  2PE3 A;  4YRH A;  2JEV A;  3FVL A;  4P45 A;  1Y9K A;  2Q44 A;  4U9Z A;  2JDD A;  5I0C A;  5EMI A;  4TWE A;  3NA6 A;  3ZJ0 A;  4MJ8 A;  4NGM A;  3G3S A;  3NE8 A;  1Y9W A;  3D3S A;  4K30 A;  2HUZ A;  3IC1 A;  1Z4R A;  3IO1 A;  2OB0 A;  3CDX A;  3QNV A;  4ZBG A;  3VAR A;  2PJ1 A;  4R3K A;  2C6G A;  4NEX A;  2JEW A;  5C88 A;  1CP7 A;  1IB1 E;  2VQY A;  1NE9 A;  1Q2C A;  3FED A;  4JZ0 A;  4P10 A;  4MHN A;  2HQY A;  2V8H A;  3B3C A;  1HDU A;  4R57 A;  2X7B A;  3SJX A;  2JBK A;  3KHZ A;  4CAW A;  5H86 A; 
#chains in the Genus database with same CATH homology
 4IHM A;  4EWT A;  2PCU A;  2F7V A;  3VAT A;  1ARL A;  2AFX A;  2BCO A;  5HVH A;  2PVV A;  4YWY A;  3WT4 A;  2PJ7 A;  2PJ8 A;  3KAS A;  1Z8L A;  3PFE A;  4P4E A;  4ZX8 A;  3TX8 A;  3RZA A;  1BLL E;  3SI1 A;  1XRY A;  3WC6 A;  3CPA A;  3D7D A;  1LCP A;  4F9V A;  5F09 A;  3WC7 A;  2PJ0 A;  2NYQ A;  2IMO A;  5IB9 A;  2OR4 A;  3KR5 A;  4NJQ A;  4OME A;  2PJ9 A;  3DLJ A;  4Q7A A;  4MCR A;  1DE4 C;  1VIX A;  1CG2 A;  1YW6 A;  1RTQ A;  4FBE A;  3B3T A;  3FX6 A;  4OKO A;  2ZEH A;  4ONW A;  2I3C A;  5LYL A;  5LRG A;  4MRI A;  5K8N A;  4WJB A;  1LOK A;  3LMS A;  2PJ5 A;  2QYV A;  2ZEF A;  2IJZ A;  4EME A;  4DUK A;  1QMU A;  3KZW A;  3KL9 A;  4OC4 A;  3ISZ A;  3LWU A;  3IFE A;  1Z2L A;  1HDQ A;  2JBJ A;  1PCA A;  4TNU A;  4MCP A;  1ARM A;  4UEE A;  4FUU A;  4UF4 A;  4OC1 A;  3D7F A;  3NH5 A;  3WC5 A;  2CTB A;  4MHY A;  2PJ6 A;  2GU2 A;  2Q51 A;  4X3R A;  3B3V A;  3BI0 A;  3IWW A;  4IAV A;  4PQA A;  1HEE A;  1PYT B;  4P4I A;  2CF4 A;  2IQ6 A;  4KSI A;  4IK2 A;  3SJF A;  2XEI A;  3PBE A;  4ZY1 A;  5JH9 A;  3SJG A;  3BI1 A;  4R6T A;  3KHX A;  1CPX A;  3IIB A;  3S9M A;  3B2Y A;  2GLF A;  2RFH A;  3WAB A;  4A38 A;  5LYF A;  3S9N A;  2EK8 A;  1H8L A;  2WYR A;  2C6P A;  4X8I A;  4ZI6 A;  4OC3 A;  3V7Z A;  2C6C A;  1NSA A;  3FMC A;  3SI0 A;  3NH8 A;  1XBU A;  2FVG A;  3K9T A;  3GB0 A;  3KGQ A;  2ZED A;  3PRT A;  1CX8 A;  2HB6 A;  4OIW A;  1DTD A;  4PXD A;  2O4H A;  4OC5 A;  1CPS A;  2EWB A;  1YSJ A;  1VHE A;  4UEF A;  4R7M A;  3VH9 A;  4NGT A;  1GYT A;  2NSM A;  2V8D A;  1QQ9 A;  3PB4 X;  2XEJ A;  2ZEL A;  2WZN A;  1EE3 P;  2VL1 A;  2ZOF A;  4A37 A;  3B3W A;  1F2P A;  3FEC A;  2J9A A;  3FH4 A;  1CP6 A;  1BPN A;  5D8N A;  3FJU A;  5LRJ A;  2GRE A;  4UIB A;  3PB6 X;  3GUX A;  4ZX9 A;  3RBU A;  3KQZ A;  4MHP A;  4H2K A;  4NGS A;  4P6Y A;  2PIZ A;  1LAM A;  1XJO A;  2PIY A;  1TF9 A;  3JRU A;  2XEF A;  4MCS A;  3D7H A;  4F8Z A;  4PXC A;  3IJ3 A;  2ABZ A;  4G1P A;  4OP4 A;  2PJ2 A;  3RAM A;  3D68 A;  1F57 A;  4EFD A;  5HXD A;  3B3S A;  2XEG A;  4PPZ A;  4FAI A;  4R8F A;  3MN8 A;  2PJ3 A;  4UEZ A;  1FT7 A;  4MCQ A;  2ZEP A;  4NJR A;  1YW4 A;  2EK9 A;  5K8O A;  4PXE A;  1UWY A;  1ELL P;  1KWM A;  4NGQ A;  2GLJ A;  3GLJ A;  4DYO A;  3SI2 A;  2V8V A;  2ZEE A;  2BO9 A;  5CPA A;  2AFM A;  5JGF A;  4R76 A;  2AFU A;  1R3N A;  2Q4Z A;  4RUH A;  1Y7E A;  4F9U A;  1BPM A;  3S9L A;  2Q43 A;  3DGV A;  6CPA A;  3ISX A;  2F8H A;  4PXB A;  4LQG A;  5K8M A;  4A94 A;  5DS0 A;  4AXV A;  3BXM A;  2ZOG A;  1TF8 A;  1TXR A;  8CPA A;  4B6Z A;  4JYW A;  2CTC A;  3HUV A;  5CBM A;  2OOT A;  3TC8 A;  1IGB A;  3D67 A;  2AFO A;  4K3N A;  4P4F A;  3B35 A;  1VHO A;  4Z65 A;  4ZY2 A;  5J1Q A;  3D66 A;  2ANP A;  4BD9 A;  1LFW A;  1FNO A;  2AFS A;  1M4L A;  1AMP A;  3IEH A;  1TKH A;  2AFW A;  4GM5 A;  2V77 A;  4W9Y A;  3H8E A;  2BOA A;  1LAN A;  3D4U A;  3I1U A;  2PVW A;  3PB8 X;  3KQX A;  2V8G A;  1ZG8 A;  1AYE A;  2AFZ A;  5ELY A;  1XMB A;  2RB7 A;  3PB7 X;  4DJL A;  5D29 A;  3PFO A;  4YU9 A;  1Y0Y A;  3K2K A;  4P4J A;  1Q7L A;  4ZY0 A;  3KR4 A;  4FWU A;  1CBX A;  3CT9 A;  4OC0 A;  1F2O A;  5LRK A;  4OID A;  3HLP A;  5LYI A;  4NGR A;  1VGY A;  5LYD A;  1Y0R A;  1Z5R A;  5JM6 A;  3NH4 A;  4OC2 A;  2ZEM A;  2QJ8 A;  3BHX A;  3B7I A;  1YME A;  4MXU A;  1YLO A;  2PJA A;  1IY7 A;  2DEA A;  3MRU A;  1TKJ A;  4P4B A;  4UIA A;  3N5F A;  3CPX A;  2QVP A;  4O23 A;  3H8G A;  4A39 A;  4NFR A;  5HVF A;  7CPA A;  2PJ4 A;  2ZEO A;  3H8F A;  3NFZ A;  1R43 A;  4P44 A;  4WWV A;  4ZYQ A;  4X2T A;  3FF3 A;  5K8P A;  2ZEG A;  2HC9 A;  1TKF A;  4NGP A;  5I4M A;  2PJB A;  3PBB A;  2ZEN A;  4P4D A;  3D7G A;  2O53 A;  4MHZ A;  1ELM P;  2G9D A;  2PRQ A;  5THW A;  1XFO A;  3PEI A;  1ZG7 A;  2CIJ A;  1ZLH A;  3V38 A;  2POK A;  5HVG A;  3SJE A;  1JQG A;  3KI9 A;  4NGN A;  2C1C A;  2PJC A;  1ZG9 A;  3L2N A;  4CPA A;  1OBR A;  1LAP A;  1BAV A;  3FEE A;  3PB9 X;  3T8W A;  1ZLI A;  4MMO A;  2PE3 A;  3FVL A;  4P45 A;  4TWE A;  3NA6 A;  4NGM A;  3IC1 A;  3IO1 A;  3CDX A;  3QNV A;  3VAR A;  2PJ1 A;  2C6G A;  2JEW A;  1CP7 A;  4JZ0 A;  3FED A;  4P10 A;  4MHN A;  2V8H A;  3B3C A;  1HDU A;  3SJX A;  2JBK A;  3KHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...