1Z8XA

Structure of mutant pyrrolidone carboxyl peptidase (e192v) from a hyperthermophile, pyrococcus furiosus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMVLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 71
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8xA00
3GIUA 1X12A 1IU8A 4GXHA 4HPSA 1IOIA 1Z8TA 2EO8A 1Z8WA 1X10A 3RNZA 3RO0A 2EBJA 3LACA 1A2ZA 1Z8XA 2DF5A 1IOFA 1AUGA
chains in the Genus database with same CATH superfamily
1Q2CA 4P4FA 2CIJA 4M85A 3FX6A 4X5KA 2IL4A 3FECA 2B3UA 3FMCA 2PJ0A 7CPAA 3C26A 4KSAA 2RB7A 4PXEA 1KUVA 2ANPA 2F5IA 2GIVA 2B3VA 3CXQA 4LQ6A 1YQEA 3TCVA 4JWPA 4CAXA 5J1QA 3S6KA 4MMOA 4NEXA 1P0HA 1YGHA 5H84A 5JQ4A 3R9EA 5BWAB 5G1ZA 1CP7A 1BPNA 1TF8A 4OMEA 5DS0A 2JBJA 4MCRA 4ZY1A 4JYWA 5DWNA 2PJ2A 4KSFA 4NFRA 4KUAA 1PCAA 5ISVA 2R1IA 4CGPA 4MFKA 4AG9A 3IU2A 3FEEA 1OZPA 4NJQA 1ZLIA 2FIWA 5C82A 2ATRA 2GE3A 1Z2LA 2CXAA 2ZEFA 4KOUA 4OIDA 1CJWA 4C2ZA 1S7FA 2YNEA 3V38A 3S6HA 3NFZA 1QSOA 3CT9A 4RI1A 2ZW6A 4A30A 4CGNA 1KZFA 2DEAA 4R3KA 3SI0A 2ABZA 4QBJA 3IGRA 4QB9A 2ARHA 2OZHA 2YNDA 3R1KA 3ZJ0A 1YW6A 4M3SA 5LRJA 3PP9A 4JZ0A 3IWWA 4CYOA 2JBKA 3D66A 2EVNA 4WWVA 4MFLA 3WR7A 2BCOA 4CAVA 1PUAA 3KHXA 4M6HA 5D29A 5LYDA 2ZW5A 4U5YA 2WUUA 2Q4VA 1YVOA 2VBQA 1Q2YA 3NE8A 1F2PA 1JQGA 1I1DA 2AFMA 3QAYA 4LQGA 4C7IA 2Q7SA 3TT2A 4JLYA 3EXNA 3IEHA 4OC3A 5THWA 1QSNA 2OB0A 1N71A 2ZXVA 4A33A 1NSAA 1Q7LA 2WZNA 4P45A 3SI2A 3VATA 3FB3A 4NGNA 4CYPA 4F9VA 2BUEA 5LRGA 2QJ8A 2HQYA 3ISZA 3N7ZA 1XMBA 4UEFA 3JVNA 4UCMA 3TOAA 3IIBA 3KKWA 2D4OA 3R95A 4C2XA 4CAWA 4E0AA 2PJBA 3B7IA 4DNCA 2FXFA 3B3TA 4KS9A 2KCWA 4HKFA 1HEEA 4AVBA 4B12A 2GLJA 2QYVA 3E0KA 5HVGA 4EVYA 4E2AA 3NA6A 1TKHA 3CPXA 1YK3A 1Z8TA 4LX9A 3B8GA 4ZX9A 4DJLA 3BI1A 3KHZA 4FAIA 3GKRA 1Y9KA 4MHYA 1BAVA 1WK4A 1Z4RA 3DSBA 1BO4A 3FF3A 4IHMA 4MFZA 4R3LA 5F47A 5GCNA 2VI7A 4NGPA 2WPWA 3B3CA 4XPKA 2RFHA 2Q4ZA 1XBUA 3SI1A 4ONUA 4A2ZA 4EWTA 2J9AA 2Q51A 2VEZA 4PK2A 4OC5A 3BXMA 2AFZA 4C68A 2Q43A 3VWEA 4ZBGA 2VXKA 3GY9A 2VZZA 4E8OA 4JJXA 3TFYA 3HUVA 4P4EA 1IOIA 2PC1A 3KQZA 2Z10A 1XOVA 2VQYA 8CPAA 5AG6A 2ZEMA 4KOWA 5DWMA 5K8NA 4BMHA 4PK3A 2BOAA 3G8WA 4PV6A 1HDQA 2A4NA 1LRZA 1IYLA 2GU2A 3FNCA 1ZO0A 4MBUA 4NXYA 2F7VA 4FD5A 1VGYA 4IF5A 3QB8A 4M6GA 4F8ZA 1I21A 4H89A 3VARA 1S60A 2Z3NA 1XFOA 5LRKA 5AGEA 4U9YA 1K4JA 1IOFA 1BPMA 2I3CA 4YRHA 2FIAA 1TF9A 2P6GA 3CXSA 1Z5RA 2Y0MA 5K8MA 4EFDA 3WC6A 3RAMA 1CM0A 5A28A 1S7KA 3CZXA 1PU9A 4MJ8A 2CNMA 1BOBA 2PJ7A 3F5BA 2B5GA 4L8AA 2PVWA 3D2MA 5IB9A 3S9NA 3PB4X 3PBBA 5A27A 4R9MA 5I4MA 2HB6A 2JDDA 4A37A 4G1PA 1YX0A 4KOTA 2PJ8A 4IUSA 4AXVA 4FBEA 1IY7A 3IFEA 3HLPA 3R96A 4AG7A 3H8EA 3B2YA 4CPAA 4YU9A 3K9UA 2O28A 1CX8A 1KWMA 2WYRA 1B6BA 1CPXA 4PXBA 5LYIA 2XEIA 4CAEA 3F8KA 1ON0A 4F0YA 3DLJA 3TO7A 1AUGA 3D4UA 4OLLA 1M1DA 1S5KA 2Z3LA 3PRTA 4OC4A 4F9UA 1YVKA 4GXHA 3TX8A 3V8IA 2G3AA 3SXNA 2EK8A 5J8FA 2NSMA 4NGSA 2JEVA 4YWYA 3PZJA 3GUXA 4OC2A 1Z8WA 1MJ9A 3EC4A 2IJZA 2ZENA 1QSTA 3PB6X 3FRMA 5HVFA 3I3GA 3T8WA 5JM6A 3D67A 3I1UA 5HVHA 3WC5A 2CTBA 4IAVA 2BEIA 1IGBA 3QNVA 4JD6A 3S6GA 1J4JA 3FYNA 4U9ZA 2F8HA 3PFEA 1LFWA 3JRUA 1VHSA 4I49A 1PYTB 3TO6A 1M44A 2HC9A 3BI0A 1R57A 2ZEHA 1X12A 2RC4A 4UIAA 1S3ZA 2PR8A 5G22A 2Z3OA 4FUUA 4M6IA 4ZY2A 1MK4A 1IYKA 4R76A 2JEWA 3D7FA 2EK9A 2EO8A 4OP4A 4F0XA 1M4GA 1CBXA 1ELMP 2PJ4A 3EY5A 1YMEA 1I12A 4H2KA 1DE4C 2ZEEA 3W6XA 2XEJA 4IK2A 3LWUA 2Q04A 3GLJA 4NGRA 3CPAA 2CNTA 4F6AA 3B3WA 4MI4A 4ZX8A 4CYQA 2AFOA 1P4NA 5CNPA 4NGTA 1A2ZA 2ZOFA 4H6UA 4MFJA 4OIWA 5JPHA 4NJRA 5KTAA 3ZZIA 3EFAA 3F0AA 4MCSA 4Z65A 1R3NA 2FCKA 1LCPA 3GYAA 4KOVA 3T90A 3TE4A 3RZAA 4MXUA 4A32A 4X8IA 2EUIA 2WPXA 4H6ZA 4B13A 1S7NA 4KOYA 3RYOA 2V8VA 4MHZA 3W91A 3DDDA 3BJ7A 3SHPA 4X3RA 5I0CA 2PR1A 1X10A 1SQHA 1YW4A 1XF8A 3KI9A 1MJAA 2PQ8A 4R6TA 4MFQA 4DYOA 5C88A 4ZYQA 4CAFA 1BLLE 4PXCA 4UA3A 4FWUA 2HUZA 4HNWB 2OZUA 4Q36A 1NSLA 4KUBA 3FBUA 3QAHA 1XE4A 2G9DA 4A38A 5KTCA 4P6YA 2OZGA 3CXPA 4P4IA 2PJ3A 5IB0A 2J8MA 3W6SA 3D8PA 1TKJA 3VWDA 4TNUA 3R9GA 4EMEA 2ZPAA 3SJEA 3D7GA 4QC6A 2R8VA 4C7HA 1Z8LA 5EC4A 5JH9A 4B10A 2P0WA 4CGLA 2JDCA 2PIYA 1MJBA 1XMTA 3H8GA 2Q4YA 1JWQA 3LMSA 4Q7AA 5J8CA 3PB8X 2BSWA 4XPDB 1LAMA 3PFOA 4R57A 2WSAA 4Y49B 3FVLA 4R87A 3RNZA 4NCZA 2YNCA 2PDOA 2REEA 2PSWA 3FIXA 3JUWA 5E96A 2XEFA 3WT4A 1QQ9A 1HDUA 2C1CA 2B5GB 3IO1A 2PJ6A 5EBVA 4PSXA 2FT0A 1UWYA 2X7BA 3GB0A 1NMTA 2DPTA 2AJ6A 3I9SA 1CPSA 3PGPA 4KOXA 4CYNA 2ZEDA 4NSQA 4ZI6A 4NF1A 3SJGA 4CGMA 2G3TA 2ZEPA 2GLFA 4W9YA 2AFWA 2JLMA 4KLWA 3TOBA 4B5PA 2IMOA 1XJOA 2V8DA 2R98A 3FXTA 4HNXB 3D7DA 4P4BA 1B87A 2D4PA 4A95A 4OC1A 1DTDA 2C6PA 6CPAA 3P2FA 1TKFA 4QUSA 1VHEA 4XPDC 4UCNA 4WJBA 4Y49C 5HH1A 3FEDA 2VZYA 2CF4A 3IC1A 4LUAA 1KUXA 1LANA 4FD6A 5D8NA 2PRQA 5ELYA 2Q7BA 2B4DA 2REFA 3T9YA 2FE7A 1ZG8A 4FD4A 4CRYB 1Y7RA 2NYQA 2P6EA 3LACA 4R8FA 1WWZA 3N5FA 3S9LA 3LODA 2XEGA 2EWBA 1L0CA 4AB7A 1VHOA 4TWEA 4X2TA 3SJFA 4HNYB 4UFXA 2GFQA 1Z8XA 5H86A 4KLVA 2PCUA 2PJ9A 2OOTA 4UCPA 1AYEA 2QMLA 2QVPA 3VH9A 2P6FA 5AG5A 5AG4A 1IU8A 1OBRA 5K8OA 4AVAA 2PE3A 2PJAA 4PQAA 5KTDA 4P4JA 2C27A 4CGOA 4MY0A 1RXTA 2ZW4A 1FT7A 4YGOA 3DR8A 3FJUA 4A94A 2B58A 4OKOA 1Z9UA 4MY3A 2OR4A 1CG2A 3DNSA 3DGVA 4MHDA 1F57A 1NE9A 2EBJA 3PB7X 1M4DA 3KR5A 4BBHA 4RUHA 3KL9A 4P4DA 2Z11A 4ZGYB 1FY7A 4KSIA 2G0BA 5CPAA 5HMNA 4II9A 1TIQA 3A9LA 4MCQA 2I79A 3FH4A 3IU1A 2J8NA 2VL1A 3NH8A 4R7MA 2I00A 4L89A 4MFPA 4UWJA 5F46A 3GIUA 5K8PA 3BJ8A 1CP6A 3D3SA 4KVME 4UF4A 1RTQA 2AE6A 3WABA 1GHEA 3KZWA 1H8LA 2DPSA 2ZEGA 2BO9A 2C6CA 2H5MA 3MN8A 3P2HA 4UFWA 4XNHB 1RO5A 1F2OA 2ODFA 2ZOGA 3CDXA 2K5TA 1GYTA 3B3VA 3D2PA 5F49A 1XIXA 1LAPA 3V7ZA 1Y7EA 2Z3MA 4ORFA 3LD2A 4KZTA 1M4LA 5JGFA 4KVXA 4OAEA 3B35A 3S6FA 1S7LA 3IWEA 4B5OA 1Q2DA 1Y0YA 2PJCA 3TC8A 3IWGA 5G21A 1ARMA 2PVVA 4XNHC 1V0CA 2Q44A 2J8RA 3ISXA 3G3SA 4Q38A 3NH4A 4UEZA 5FVJA 1YLEA 2POKA 4C2YA 3BHXA 2C6GA 4PXDA 2IQ6A 2QECA 2R7HA 1IIDA 1KUYA 1YLOA 5LYLA 5AG7A 4BD9A 4KOSA 2FL4A 2PIZA 3BLNA 3K2KA 4B6ZA 2V8HA 1VIXA 3JTKA 4UFVA 1IB1E 2GREA 3KGQA 1Z4EA 4NGMA 4GS4A 2Z0ZA 1VKCA 2ZELA 1IICA 3KASA 1TXRA 4B14A 4A31A 4PSWA 2V77A 2FSRA 1R43A 4HPSA 4K3NA 4UIBA 3D7HA 1ZG9A 4MHPA 1FNOA 2FS5A 2NMTA 4B5PB 2PJ5A 1M4IA 2BL1A 3KQXA 1LOKA 2ZEOA 4FD7A 1XEBA 5IV0A 3MGDA 4P10A 3RBUA 3RO0A 1YR0A 2Q0YA 4RS2A 4A39A 4J3GA 4JXQA 2CTCA 2Z3PA 3D68A 2YNCC 3H8FA 3K9TA 5EMIA 2PRBA 2Z3KA 2O4HA 3S9MA 3TTHA 1ARLA 3OWCA 2B4DB 4XPLA 2YGWA 3UY5A 2HV2A 4UEEA 5LYFA 5IX3A 3PB9X 2DF5A 3SJXA 3TO9A 2FVGA 3L2NA 4GM5A 3PBEA 3PEIA 4OC0A 1UFHA 4OADA 5HXDA 5CBMA 4O23A 2PJ1A 1YSJA 4MHNA 4ZY0A 4K30A 1ZLHA 3EO4A 4ONWA 5G20A 4MRIA 1YREA 4CRZB 5F48A 2CY2A 4AVCA 1Y0RA 2OH1A 3H4QA 4RN7A 5F09A 1QMUA 3R9FA 2CNSA 2AFUA 3IJ3A 4UBRA 4UWIA 4BINA 1AMPA 4NGQA 3MRUA 3B3SA 4YFJA 3SXOA 3NE7A 2V8GA 2GANA 2AFSA 4CS0B 4PPZA 3NH5A 4QVTA 4DUKA 4JXRA 4P44A 1Y9WA 1QSRA 4KVOE 3WC7A 3DR6A 2B4BA 1ELLP 1EE3P 1XRYA 4B11A 3KR4A 2DXQA 1U6MA 2OU2A 2QIRA 4MCPA 2ZW7A 4KORA 2AFXA 3H5ZA 1ZG7A 1QSMA 2O53A
chains in the Genus database with same CATH topology
3GIUA 1X12A 1IU8A 4GXHA 4HPSA 1IOIA 1Z8TA 2EO8A 1Z8WA 1X10A 3RNZA 3RO0A 2EBJA 3LACA 1A2ZA 1Z8XA 2DF5A 1IOFA 1AUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIU A;  1X12 A;  1IU8 A;  4GXH A;  4HPS A;  1IOI A;  1Z8T A;  2EO8 A;  1Z8W A;  1X10 A;  3RNZ A;  3RO0 A;  2EBJ A;  3LAC A;  1A2Z A;  1Z8X A;  2DF5 A;  1IOF A;  1AUG A; 
#chains in the Genus database with same CATH topology
 1Q2C A;  4P4F A;  2CIJ A;  4M85 A;  3FX6 A;  4X5K A;  2IL4 A;  3FEC A;  2B3U A;  3FMC A;  2PJ0 A;  7CPA A;  3C26 A;  4KSA A;  2RB7 A;  4PXE A;  1KUV A;  2ANP A;  2F5I A;  2GIV A;  2B3V A;  3CXQ A;  4LQ6 A;  1YQE A;  3TCV A;  4JWP A;  4CAX A;  5J1Q A;  3S6K A;  4MMO A;  4NEX A;  1P0H A;  1YGH A;  5H84 A;  5JQ4 A;  3R9E A;  5BWA B;  5G1Z A;  1CP7 A;  1BPN A;  1TF8 A;  4OME A;  5DS0 A;  2JBJ A;  4MCR A;  4ZY1 A;  4JYW A;  5DWN A;  2PJ2 A;  4KSF A;  4NFR A;  4KUA A;  1PCA A;  5ISV A;  2R1I A;  4CGP A;  4MFK A;  4AG9 A;  3IU2 A;  3FEE A;  1OZP A;  4NJQ A;  1ZLI A;  2FIW A;  5C82 A;  2ATR A;  2GE3 A;  1Z2L A;  2CXA A;  2ZEF A;  4KOU A;  4OID A;  1CJW A;  4C2Z A;  1S7F A;  2YNE A;  3V38 A;  3S6H A;  3NFZ A;  1QSO A;  3CT9 A;  4RI1 A;  2ZW6 A;  4A30 A;  4CGN A;  1KZF A;  2DEA A;  4R3K A;  3SI0 A;  2ABZ A;  4QBJ A;  3IGR A;  4QB9 A;  2ARH A;  2OZH A;  2YND A;  3R1K A;  3ZJ0 A;  1YW6 A;  4M3S A;  5LRJ A;  3PP9 A;  4JZ0 A;  3IWW A;  4CYO A;  2JBK A;  3D66 A;  2EVN A;  4WWV A;  4MFL A;  3WR7 A;  2BCO A;  4CAV A;  1PUA A;  3KHX A;  4M6H A;  5D29 A;  5LYD A;  2ZW5 A;  4U5Y A;  2WUU A;  2Q4V A;  1YVO A;  2VBQ A;  1Q2Y A;  3NE8 A;  1F2P A;  1JQG A;  1I1D A;  2AFM A;  3QAY A;  4LQG A;  4C7I A;  2Q7S A;  3TT2 A;  4JLY A;  3EXN A;  3IEH A;  4OC3 A;  5THW A;  1QSN A;  2OB0 A;  1N71 A;  2ZXV A;  4A33 A;  1NSA A;  1Q7L A;  2WZN A;  4P45 A;  3SI2 A;  3VAT A;  3FB3 A;  4NGN A;  4CYP A;  4F9V A;  2BUE A;  5LRG A;  2QJ8 A;  2HQY A;  3ISZ A;  3N7Z A;  1XMB A;  4UEF A;  3JVN A;  4UCM A;  3TOA A;  3IIB A;  3KKW A;  2D4O A;  3R95 A;  4C2X A;  4CAW A;  4E0A A;  2PJB A;  3B7I A;  4DNC A;  2FXF A;  3B3T A;  4KS9 A;  2KCW A;  4HKF A;  1HEE A;  4AVB A;  4B12 A;  2GLJ A;  2QYV A;  3E0K A;  5HVG A;  4EVY A;  4E2A A;  3NA6 A;  1TKH A;  3CPX A;  1YK3 A;  1Z8T A;  4LX9 A;  3B8G A;  4ZX9 A;  4DJL A;  3BI1 A;  3KHZ A;  4FAI A;  3GKR A;  1Y9K A;  4MHY A;  1BAV A;  1WK4 A;  1Z4R A;  3DSB A;  1BO4 A;  3FF3 A;  4IHM A;  4MFZ A;  4R3L A;  5F47 A;  5GCN A;  2VI7 A;  4NGP A;  2WPW A;  3B3C A;  4XPK A;  2RFH A;  2Q4Z A;  1XBU A;  3SI1 A;  4ONU A;  4A2Z A;  4EWT A;  2J9A A;  2Q51 A;  2VEZ A;  4PK2 A;  4OC5 A;  3BXM A;  2AFZ A;  4C68 A;  2Q43 A;  3VWE A;  4ZBG A;  2VXK A;  3GY9 A;  2VZZ A;  4E8O A;  4JJX A;  3TFY A;  3HUV A;  4P4E A;  1IOI A;  2PC1 A;  3KQZ A;  2Z10 A;  1XOV A;  2VQY A;  8CPA A;  5AG6 A;  2ZEM A;  4KOW A;  5DWM A;  5K8N A;  4BMH A;  4PK3 A;  2BOA A;  3G8W A;  4PV6 A;  1HDQ A;  2A4N A;  1LRZ A;  1IYL A;  2GU2 A;  3FNC A;  1ZO0 A;  4MBU A;  4NXY A;  2F7V A;  4FD5 A;  1VGY A;  4IF5 A;  3QB8 A;  4M6G A;  4F8Z A;  1I21 A;  4H89 A;  3VAR A;  1S60 A;  2Z3N A;  1XFO A;  5LRK A;  5AGE A;  4U9Y A;  1K4J A;  1IOF A;  1BPM A;  2I3C A;  4YRH A;  2FIA A;  1TF9 A;  2P6G A;  3CXS A;  1Z5R A;  2Y0M A;  5K8M A;  4EFD A;  3WC6 A;  3RAM A;  1CM0 A;  5A28 A;  1S7K A;  3CZX A;  1PU9 A;  4MJ8 A;  2CNM A;  1BOB A;  2PJ7 A;  3F5B A;  2B5G A;  4L8A A;  2PVW A;  3D2M A;  5IB9 A;  3S9N A;  3PB4 X;  3PBB A;  5A27 A;  4R9M A;  5I4M A;  2HB6 A;  2JDD A;  4A37 A;  4G1P A;  1YX0 A;  4KOT A;  2PJ8 A;  4IUS A;  4AXV A;  4FBE A;  1IY7 A;  3IFE A;  3HLP A;  3R96 A;  4AG7 A;  3H8E A;  3B2Y A;  4CPA A;  4YU9 A;  3K9U A;  2O28 A;  1CX8 A;  1KWM A;  2WYR A;  1B6B A;  1CPX A;  4PXB A;  5LYI A;  2XEI A;  4CAE A;  3F8K A;  1ON0 A;  4F0Y A;  3DLJ A;  3TO7 A;  1AUG A;  3D4U A;  4OLL A;  1M1D A;  1S5K A;  2Z3L A;  3PRT A;  4OC4 A;  4F9U A;  1YVK A;  4GXH A;  3TX8 A;  3V8I A;  2G3A A;  3SXN A;  2EK8 A;  5J8F A;  2NSM A;  4NGS A;  2JEV A;  4YWY A;  3PZJ A;  3GUX A;  4OC2 A;  1Z8W A;  1MJ9 A;  3EC4 A;  2IJZ A;  2ZEN A;  1QST A;  3PB6 X;  3FRM A;  5HVF A;  3I3G A;  3T8W A;  5JM6 A;  3D67 A;  3I1U A;  5HVH A;  3WC5 A;  2CTB A;  4IAV A;  2BEI A;  1IGB A;  3QNV A;  4JD6 A;  3S6G A;  1J4J A;  3FYN A;  4U9Z A;  2F8H A;  3PFE A;  1LFW A;  3JRU A;  1VHS A;  4I49 A;  1PYT B;  3TO6 A;  1M44 A;  2HC9 A;  3BI0 A;  1R57 A;  2ZEH A;  1X12 A;  2RC4 A;  4UIA A;  1S3Z A;  2PR8 A;  5G22 A;  2Z3O A;  4FUU A;  4M6I A;  4ZY2 A;  1MK4 A;  1IYK A;  4R76 A;  2JEW A;  3D7F A;  2EK9 A;  2EO8 A;  4OP4 A;  4F0X A;  1M4G A;  1CBX A;  1ELM P;  2PJ4 A;  3EY5 A;  1YME A;  1I12 A;  4H2K A;  1DE4 C;  2ZEE A;  3W6X A;  2XEJ A;  4IK2 A;  3LWU A;  2Q04 A;  3GLJ A;  4NGR A;  3CPA A;  2CNT A;  4F6A A;  3B3W A;  4MI4 A;  4ZX8 A;  4CYQ A;  2AFO A;  1P4N A;  5CNP A;  4NGT A;  1A2Z A;  2ZOF A;  4H6U A;  4MFJ A;  4OIW A;  5JPH A;  4NJR A;  5KTA A;  3ZZI A;  3EFA A;  3F0A A;  4MCS A;  4Z65 A;  1R3N A;  2FCK A;  1LCP A;  3GYA A;  4KOV A;  3T90 A;  3TE4 A;  3RZA A;  4MXU A;  4A32 A;  4X8I A;  2EUI A;  2WPX A;  4H6Z A;  4B13 A;  1S7N A;  4KOY A;  3RYO A;  2V8V A;  4MHZ A;  3W91 A;  3DDD A;  3BJ7 A;  3SHP A;  4X3R A;  5I0C A;  2PR1 A;  1X10 A;  1SQH A;  1YW4 A;  1XF8 A;  3KI9 A;  1MJA A;  2PQ8 A;  4R6T A;  4MFQ A;  4DYO A;  5C88 A;  4ZYQ A;  4CAF A;  1BLL E;  4PXC A;  4UA3 A;  4FWU A;  2HUZ A;  4HNW B;  2OZU A;  4Q36 A;  1NSL A;  4KUB A;  3FBU A;  3QAH A;  1XE4 A;  2G9D A;  4A38 A;  5KTC A;  4P6Y A;  2OZG A;  3CXP A;  4P4I A;  2PJ3 A;  5IB0 A;  2J8M A;  3W6S A;  3D8P A;  1TKJ A;  3VWD A;  4TNU A;  3R9G A;  4EME A;  2ZPA A;  3SJE A;  3D7G A;  4QC6 A;  2R8V A;  4C7H A;  1Z8L A;  5EC4 A;  5JH9 A;  4B10 A;  2P0W A;  4CGL A;  2JDC A;  2PIY A;  1MJB A;  1XMT A;  3H8G A;  2Q4Y A;  1JWQ A;  3LMS A;  4Q7A A;  5J8C A;  3PB8 X;  2BSW A;  4XPD B;  1LAM A;  3PFO A;  4R57 A;  2WSA A;  4Y49 B;  3FVL A;  4R87 A;  3RNZ A;  4NCZ A;  2YNC A;  2PDO A;  2REE A;  2PSW A;  3FIX A;  3JUW A;  5E96 A;  2XEF A;  3WT4 A;  1QQ9 A;  1HDU A;  2C1C A;  2B5G B;  3IO1 A;  2PJ6 A;  5EBV A;  4PSX A;  2FT0 A;  1UWY A;  2X7B A;  3GB0 A;  1NMT A;  2DPT A;  2AJ6 A;  3I9S A;  1CPS A;  3PGP A;  4KOX A;  4CYN A;  2ZED A;  4NSQ A;  4ZI6 A;  4NF1 A;  3SJG A;  4CGM A;  2G3T A;  2ZEP A;  2GLF A;  4W9Y A;  2AFW A;  2JLM A;  4KLW A;  3TOB A;  4B5P A;  2IMO A;  1XJO A;  2V8D A;  2R98 A;  3FXT A;  4HNX B;  3D7D A;  4P4B A;  1B87 A;  2D4P A;  4A95 A;  4OC1 A;  1DTD A;  2C6P A;  6CPA A;  3P2F A;  1TKF A;  4QUS A;  1VHE A;  4XPD C;  4UCN A;  4WJB A;  4Y49 C;  5HH1 A;  3FED A;  2VZY A;  2CF4 A;  3IC1 A;  4LUA A;  1KUX A;  1LAN A;  4FD6 A;  5D8N A;  2PRQ A;  5ELY A;  2Q7B A;  2B4D A;  2REF A;  3T9Y A;  2FE7 A;  1ZG8 A;  4FD4 A;  4CRY B;  1Y7R A;  2NYQ A;  2P6E A;  3LAC A;  4R8F A;  1WWZ A;  3N5F A;  3S9L A;  3LOD A;  2XEG A;  2EWB A;  1L0C A;  4AB7 A;  1VHO A;  4TWE A;  4X2T A;  3SJF A;  4HNY B;  4UFX A;  2GFQ A;  1Z8X A;  5H86 A;  4KLV A;  2PCU A;  2PJ9 A;  2OOT A;  4UCP A;  1AYE A;  2QML A;  2QVP A;  3VH9 A;  2P6F A;  5AG5 A;  5AG4 A;  1IU8 A;  1OBR A;  5K8O A;  4AVA A;  2PE3 A;  2PJA A;  4PQA A;  5KTD A;  4P4J A;  2C27 A;  4CGO A;  4MY0 A;  1RXT A;  2ZW4 A;  1FT7 A;  4YGO A;  3DR8 A;  3FJU A;  4A94 A;  2B58 A;  4OKO A;  1Z9U A;  4MY3 A;  2OR4 A;  1CG2 A;  3DNS A;  3DGV A;  4MHD A;  1F57 A;  1NE9 A;  2EBJ A;  3PB7 X;  1M4D A;  3KR5 A;  4BBH A;  4RUH A;  3KL9 A;  4P4D A;  2Z11 A;  4ZGY B;  1FY7 A;  4KSI A;  2G0B A;  5CPA A;  5HMN A;  4II9 A;  1TIQ A;  3A9L A;  4MCQ A;  2I79 A;  3FH4 A;  3IU1 A;  2J8N A;  2VL1 A;  3NH8 A;  4R7M A;  2I00 A;  4L89 A;  4MFP A;  4UWJ A;  5F46 A;  3GIU A;  5K8P A;  3BJ8 A;  1CP6 A;  3D3S A;  4KVM E;  4UF4 A;  1RTQ A;  2AE6 A;  3WAB A;  1GHE A;  3KZW A;  1H8L A;  2DPS A;  2ZEG A;  2BO9 A;  2C6C A;  2H5M A;  3MN8 A;  3P2H A;  4UFW A;  4XNH B;  1RO5 A;  1F2O A;  2ODF A;  2ZOG A;  3CDX A;  2K5T A;  1GYT A;  3B3V A;  3D2P A;  5F49 A;  1XIX A;  1LAP A;  3V7Z A;  1Y7E A;  2Z3M A;  4ORF A;  3LD2 A;  4KZT A;  1M4L A;  5JGF A;  4KVX A;  4OAE A;  3B35 A;  3S6F A;  1S7L A;  3IWE A;  4B5O A;  1Q2D A;  1Y0Y A;  2PJC A;  3TC8 A;  3IWG A;  5G21 A;  1ARM A;  2PVV A;  4XNH C;  1V0C A;  2Q44 A;  2J8R A;  3ISX A;  3G3S A;  4Q38 A;  3NH4 A;  4UEZ A;  5FVJ A;  1YLE A;  2POK A;  4C2Y A;  3BHX A;  2C6G A;  4PXD A;  2IQ6 A;  2QEC A;  2R7H A;  1IID A;  1KUY A;  1YLO A;  5LYL A;  5AG7 A;  4BD9 A;  4KOS A;  2FL4 A;  2PIZ A;  3BLN A;  3K2K A;  4B6Z A;  2V8H A;  1VIX A;  3JTK A;  4UFV A;  1IB1 E;  2GRE A;  3KGQ A;  1Z4E A;  4NGM A;  4GS4 A;  2Z0Z A;  1VKC A;  2ZEL A;  1IIC A;  3KAS A;  1TXR A;  4B14 A;  4A31 A;  4PSW A;  2V77 A;  2FSR A;  1R43 A;  4HPS A;  4K3N A;  4UIB A;  3D7H A;  1ZG9 A;  4MHP A;  1FNO A;  2FS5 A;  2NMT A;  4B5P B;  2PJ5 A;  1M4I A;  2BL1 A;  3KQX A;  1LOK A;  2ZEO A;  4FD7 A;  1XEB A;  5IV0 A;  3MGD A;  4P10 A;  3RBU A;  3RO0 A;  1YR0 A;  2Q0Y A;  4RS2 A;  4A39 A;  4J3G A;  4JXQ A;  2CTC A;  2Z3P A;  3D68 A;  2YNC C;  3H8F A;  3K9T A;  5EMI A;  2PRB A;  2Z3K A;  2O4H A;  3S9M A;  3TTH A;  1ARL A;  3OWC A;  2B4D B;  4XPL A;  2YGW A;  3UY5 A;  2HV2 A;  4UEE A;  5LYF A;  5IX3 A;  3PB9 X;  2DF5 A;  3SJX A;  3TO9 A;  2FVG A;  3L2N A;  4GM5 A;  3PBE A;  3PEI A;  4OC0 A;  1UFH A;  4OAD A;  5HXD A;  5CBM A;  4O23 A;  2PJ1 A;  1YSJ A;  4MHN A;  4ZY0 A;  4K30 A;  1ZLH A;  3EO4 A;  4ONW A;  5G20 A;  4MRI A;  1YRE A;  4CRZ B;  5F48 A;  2CY2 A;  4AVC A;  1Y0R A;  2OH1 A;  3H4Q A;  4RN7 A;  5F09 A;  1QMU A;  3R9F A;  2CNS A;  2AFU A;  3IJ3 A;  4UBR A;  4UWI A;  4BIN A;  1AMP A;  4NGQ A;  3MRU A;  3B3S A;  4YFJ A;  3SXO A;  3NE7 A;  2V8G A;  2GAN A;  2AFS A;  4CS0 B;  4PPZ A;  3NH5 A;  4QVT A;  4DUK A;  4JXR A;  4P44 A;  1Y9W A;  1QSR A;  4KVO E;  3WC7 A;  3DR6 A;  2B4B A;  1ELL P;  1EE3 P;  1XRY A;  4B11 A;  3KR4 A;  2DXQ A;  1U6M A;  2OU2 A;  2QIR A;  4MCP A;  2ZW7 A;  4KOR A;  2AFX A;  3H5Z A;  1ZG7 A;  1QSM A;  2O53 A; 
#chains in the Genus database with same CATH homology
 3GIU A;  1X12 A;  1IU8 A;  4GXH A;  4HPS A;  1IOI A;  1Z8T A;  2EO8 A;  1Z8W A;  1X10 A;  3RNZ A;  3RO0 A;  2EBJ A;  3LAC A;  1A2Z A;  1Z8X A;  2DF5 A;  1IOF A;  1AUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...