1Z8XA

Structure of mutant pyrrolidone carboxyl peptidase (e192v) from a hyperthermophile, pyrococcus furiosus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMVLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 71
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8xA00
1AUGA 1A2ZA 1X12A 3LACA 1Z8XA 1Z8TA 4HPSA 1IU8A 2EO8A 1X10A 1Z8WA 2EBJA 4GXHA 1IOFA 1IOIA 3RO0A 2DF5A 3RNZA 3GIUA
chains in the Genus database with same CATH superfamily
4OKOA 4GS4A 5THWA 4UEEA 5KTDA 1MJBA 3LMSA 3BI1A 1VIXA 1Z8LA 2Q4VA 5EBVA 2PQ8A 2Z11A 4A33A 4F0XA 4P4EA 1ARLA 4UEFA 4WJBA 3CZXA 4X8IA 4P10A 4R6TA 3TCVA 4NGMA 1BLLE 1Z8TA 2ANPA 2JLMA 5E96A 3BI0A 2Q43A 2WPXA 2NYQA 3DR6A 1XRYA 1UFHA 2CNMA 3PB8X 1F2PA 3SJGA 2R8VA 4PXEA 4KOWA 3WABA 4UFWA 5K8OA 3N7ZA 4JJXA 4B5PA 2Z0ZA 2FXFA 2EWBA 1DE4C 2VXKA 4HKFA 3B3SA 4X2TA 3GIUA 2G9DA 5HMNA 3KI9A 3WR7A 1OZPA 4RUHA 4R7MA 3R9EA 5IX3A 3D7HA 4B6ZA 4UEZA 5H86A 2Y0MA 4AVAA 1TXRA 2PRBA 4NXYA 4TWEA 3V8IA 2Z3MA 3FH4A 4KUBA 1X12A 5J8CA 4MJ8A 2Z3PA 4JYWA 3VARA 3R95A 3PFOA 4OIDA 1PUAA 1KUXA 3NH5A 4AXVA 1M44A 2FIAA 3QAYA 4MCQA 3EXNA 4CGMA 2R1IA 3L2NA 4OLLA 3PEIA 4GXHA 3D2MA 3PBEA 4ZX8A 3S9NA 4Q36A 3GUXA 1XMBA 2P6FA 2QVPA 4ONWA 3TOAA 3S9MA 4B12A 3RO0A 3T9YA 4R57A 1M4GA 2PJ8A 1ZO0A 3FVLA 4MFPA 3TOBA 4KORA 3V38A 3FBUA 1KWMA 1IB1E 1R57A 1IGBA 4J3GA 1FY7A 1QSRA 2PJ4A 2WYRA 2XEFA 2ZEMA 2ZELA 3F5BA 4A37A 2WUUA 4IK2A 2PR1A 2GANA 2HV2A 2Z10A 7CPAA 5IV0A 4AG9A 1QSOA 4YGOA 4ZY1A 2CF4A 1QQ9A 4II9A 3PB4X 5I0CA 2Q0YA 2RC4A 2B5GA 4PXBA 2PIZA 5JPHA 3BHXA 2C6CA 4IHMA 4UIBA 4CS0B 1KUYA 1YK3A 2CY2A 2XEGA 4KLWA 3S6FA 3NE7A 4P4IA 2YNCA 3LODA 3FXTA 4LQ6A 5A27A 3P2HA 1Q7LA 1BAVA 4A39A 5K8MA 3T90A 1LANA 3JVNA 2PDOA 4U9ZA 5LRGA 4KLVA 3JTKA 3WC5A 2PVVA 4AG7A 2OOTA 5HVGA 1VHSA 4MHZA 4KS9A 2YNEA 3RZAA 4E2AA 2NSMA 1S7LA 3CT9A 4K3NA 3PBBA 2OZHA 1YLOA 5CBMA 3I3GA 1R3NA 4CGLA 4P6YA 1IU8A 1Z5RA 3F8KA 3D8PA 4FAIA 5J1QA 3DDDA 4AVBA 3KGQA 3HLPA 2PJBA 3IWEA 3FNCA 2PJ7A 2Z3NA 1LOKA 2DF5A 2FIWA 3QAHA 3CXQA 1IYKA 4CRYB 2AJ6A 4E0AA 2OH1A 4NJQA 1UWYA 2PSWA 2B4DB 2R98A 1YLEA 2P6GA 4MHNA 4P4FA 3VWEA 3IO1A 4R87A 3BXMA 2CTBA 3D7DA 4NGQA 2ZW7A 2AFXA 3W6SA 3SJFA 5LRKA 4CAVA 4FD4A 5DS0A 2NMTA 2V8VA 5JGFA 3TT2A 2HQYA 2O4HA 2CXAA 2EO8A 1X10A 2O53A 1S3ZA 4NF1A 1B87A 4ZY2A 3FECA 2FSRA 4KUAA 4L89A 4NGTA 2ZPAA 3CPAA 1Y9WA 2JDCA 1ELLP 2V8HA 4ZX9A 3RAMA 5LYFA 3PRTA 3R9GA 1AUGA 3QNVA 3IGRA 3P2FA 4CGPA 3H4QA 3F0AA 1B6BA 1LCPA 4ZI6A 2YNDA 1KZFA 3KHXA 2Q7BA 1IYLA 4U9YA 4C7IA 3ZZIA 3SJXA 1ZG7A 3VWDA 5J8FA 3K9UA 1I1DA 4DJLA 5DWMA 4NGPA 4CRZB 5JQ4A 1ELMP 2ZEPA 4R9MA 3NE8A 1M1DA 5K8PA 5K8NA 4PK3A 2FVGA 3IC1A 2FS5A 1CP6A 2XEIA 3JUWA 1Y0RA 2C6PA 4HNYB 1Y7EA 4AVCA 4K30A 4DUKA 1ZLHA 2D4PA 5LRJA 3TO9A 1RO5A 1Z2LA 4LUAA 2ABZA 3GLJA 4CAEA 1H8LA 2PJ9A 3ZJ0A 1JQGA 1VHEA 2FCKA 2REEA 2VL1A 4MXUA 2C1CA 2G3AA 1HDQA 2OZUA 4NFRA 4YFJA 1AMPA 1LRZA 4B13A 5LYLA 1VGYA 3MGDA 4UFXA 1S7NA 2F8HA 2V77A 4ORFA 2Z3LA 2JBKA 2JBJA 4BMHA 2J8NA 2BSWA 4F9VA 2VZZA 1XJOA 4LX9A 1R43A 3FB3A 4IF5A 2OZGA 1P4NA 2BL1A 5CNPA 3MRUA 4NGSA 2B4BA 3VH9A 2REFA 1XMTA 1L0CA 2I79A 1M4LA 1XF8A 2EK9A 4Q7AA 1M4IA 4RS2A 4KOXA 3LD2A 2Q4YA 4HNWB 1P0HA 4QVTA 3FRMA 1CJWA 1IICA 3H5ZA 4MFQA 2PJAA 2AFWA 2DEAA 1NSAA 2DXQA 2PJCA 3NH8A 4JXRA 2F7VA 4ONUA 3R9FA 1ZG8A 3D2PA 3S9LA 3UY5A 4M3SA 1BPMA 1Z4EA 2IJZA 8CPAA 1OBRA 5HXDA 1YMEA 4CAXA 3KR5A 2PVWA 1Z9UA 2CNTA 2PIYA 2YNCC 4R8FA 5F09A 3DNSA 3E0KA 3H8FA 1CP7A 2FT0A 5F46A 1TKFA 2EUIA 3H8EA 3ISXA 2PE3A 3IWGA 4L8AA 5JH9A 1Q2CA 1I21A 1I12A 4CYNA 3TFYA 3EFAA 3N5FA 2PJ6A 4HPSA 4FUUA 2GLJA 1F2OA 2V8GA 2PRQA 3TO6A 4A38A 5F47A 2PJ2A 4A94A 2JEWA 2K5TA 2ODFA 4C7HA 1XFOA 4YWYA 1J4JA 4Y49C 4XPDC 4UCMA 5BWAB 2WZNA 4PXCA 5G20A 3NH4A 2ZEOA 4KVME 2VEZA 3EC4A 1YVOA 2KCWA 2PJ1A 2DPSA 3FEEA 4H2KA 3S6HA 1RTQA 2PC1A 3D7FA 4RN7A 4QC6A 4CGOA 3SXOA 3D67A 4G1PA 4JWPA 3SXNA 1S60A 4X5KA 4MFJA 4A31A 4CYPA 1QSMA 4B5PB 4M85A 1S7KA 1CM0A 3GB0A 1Z8WA 3DLJA 4PK2A 5C82A 2QIRA 4PSXA 1XIXA 4WWVA 3B3WA 4PQAA 2Q4ZA 2I3CA 2ZEGA 3D7GA 3IU1A 1TKJA 2OU2A 2VZYA 4UWIA 4QBJA 4W9YA 2PR8A 4OMEA 4DYOA 1CG2A 4EMEA 3TC8A 3SHPA 4MHDA 5FVJA 1A2ZA 4R76A 5IB0A 3W91A 1FNOA 4PXDA 3I1UA 4UFVA 1YGHA 2ZXVA 5AG6A 2GIVA 2BUEA 3BJ8A 3GYAA 4Q38A 4UA3A 1BPNA 1Z8XA 4CPAA 3R1KA 1M4DA 3BJ7A 3A9LA 2HUZA 4R3KA 3CPXA 4UIAA 4ZY0A 4F9UA 4H89A 1Y0YA 1V0CA 2GLFA 1Q2YA 2CNSA 1QSTA 3KZWA 3D4UA 2PJ0A 3K2KA 1YVKA 1HDUA 3KASA 4KSFA 4A32A 5I4MA 1MJAA 1RXTA 3KL9A 2PJ5A 3B3CA 5D29A 2ZEFA 2Q51A 3B35A 3B8GA 4FD6A 5KTAA 4MBUA 1Q2DA 4IAVA 2G0BA 1AYEA 2AFZA 1YR0A 2VQYA 2FL4A 2GU2A 1XOVA 2AFOA 3IWWA 3KKWA 4P4JA 4MCRA 4Z65A 3SI2A 1BO4A 1LFWA 2B5GB 3NFZA 3B7IA 2VI7A 2Z3OA 4OIWA 4PV6A 2DPTA 3IU2A 3PZJA 3KHZA 4PSWA 3V7ZA 4NGNA 4M6GA 4P4BA 2WSAA 5AG4A 4OC4A 2A4NA 3PP9A 4CYQA 2X7BA 4UCPA 1EE3P 2Z3KA 3IIBA 3WC7A 4C2ZA 5AGEA 1KUVA 4UCNA 4XNHB 3EO4A 4KVXA 2YGWA 2AE6A 3FMCA 4OP4A 4KSAA 2P0WA 3S6GA 4PPZA 4Y49B 2EK8A 4P45A 4XPDB 5H84A 4A30A 2ZEEA 4UWJA 5HH1A 2ZENA 3IEHA 3DGVA 1Y9KA 2B3UA 3MN8A 2GFQA 2V8DA 3TO7A 1WWZA 4NSQA 1NMTA 3TE4A 3ISZA 1U6MA 5EC4A 3G8WA 4JLYA 3DSBA 2ARHA 1ZLIA 2ATRA 3FEDA 3WT4A 3JRUA 4JXQA 1ZG9A 4FD7A 4CAFA 1CPSA 4QB9A 4CGNA 1IOFA 2ZW4A 5HVFA 2PCUA 3H8GA 3FIXA 3W6XA 3D3SA 5IB9A 5C88A 1PCAA 4ZBGA 4BBHA 3LWUA 2C27A 3FF3A 1N71A 3G3SA 4F8ZA 3KQZA 5G1ZA 4P44A 3EY5A 1K4JA 3OWCA 4H6ZA 2QJ8A 4OC0A 4B11A 4FD5A 5DWNA 2QMLA 1WK4A 2J8RA 4YRHA 4AB7A 4C2XA 4ZGYB 3SI0A 4CYOA 1CX8A 2RFHA 1YSJA 2B4DA 4KOTA 2GE3A 4KVOE 5LYDA 4KOVA 2CIJA 2AFSA 1ON0A 4KZTA 4B5OA 5CPAA 5HVHA 4XNHC 1GHEA 4O23A 1YW4A 3K9TA 2Q04A 3BLNA 4MFKA 4MY3A 4OADA 5D8NA 3D66A 1HEEA 2QYVA 3IJ3A 4A2ZA 2GREA 1F57A 4OC3A 4OC5A 1XBUA 1ARMA 2B58A 4CAWA 2WPWA 3CXSA 2ZOGA 3NA6A 4E8OA 3C26A 4KSIA 5EMIA 2J9AA 4BINA 4P4DA 4YU9A 4MFZA 3LACA 1PU9A 2BCOA 4XPKA 4JD6A 1NE9A 2IQ6A 2J8MA 5KTCA 4JZ0A 4UF4A 3TTHA 1TKHA 3QB8A 4MCSA 1YW6A 5F48A 4C2YA 1XEBA 2BEIA 1YREA 3FJUA 2H5MA 1QMUA 2FE7A 4OC2A 2POKA 3FYNA 2IMOA 4BD9A 1VKCA 4X3RA 3CDXA 3PB6X 4KOUA 5ELYA 3RBUA 3RNZA 4A95A 4B10A 5G21A 1GYTA 3D68A 2ZOFA 4QUSA 5GCNA 4MHPA 3GKRA 4NEXA 2P6EA 4GM5A 2XEJA 3DR8A 2ZW5A 3PB9X 3R96A 5JM6A 1YX0A 1S7FA 3VATA 1JWQA 4EFDA 6CPAA 2RB7A 1IIDA 2BO9A 3PFEA 4RI1A 3TX8A 1TF9A 4ZYQA 2PJ3A 4C68A 4MFLA 3FX6A 3WC6A 4EVYA 4OAEA 1FT7A 4IUSA 3CXPA 3IFEA 4MRIA 3SJEA 1YQEA 3PB7X 4TNUA 1IY7A 3GY9A 1TF8A 2JDDA 4I49A 4M6HA 1PYTB 1QSNA 2O28A 1MJ9A 4F6AA 2C6GA 2ZW6A 4R3LA 2VBQA 3KQXA 4MMOA 4OC1A 2BOAA 4HNXB 3HUVA 1SQHA 4UBRA 1BOBA 4MCPA 4MI4A 3T8WA 2G3TA 2JEVA 4FWUA 1CBXA 2OB0A 1LAMA 4F0YA 2R7HA 4MY0A 1LAPA 2AFMA 4NGRA 5A28A 4KOYA 3B3TA 3B3VA 4DNCA 2QECA 3I9SA 4XPLA 5ISVA 2EVNA 2HC9A 3PGPA 5AG5A 3RYOA 2CTCA 5AG7A 1NSLA 3B2YA 2OR4A 5LYIA 4U5YA 1Z4RA 3SI1A 1Y7RA 2IL4A 4NCZA 1S5KA 4FBEA 2F5IA 4EWTA 2I00A 1TIQA 2ZEHA 1VHOA 2D4OA 1DTDA 2AFUA 2EBJA 4KOSA 3S6KA 3KR4A 2Q44A 1IOIA 5G22A 2B3VA 2Q7SA 4H6UA 4MHYA 4B14A 5F49A 1CPXA 2HB6A 2ZEDA 4M6IA 1MK4A 4LQGA 1XE4A 4NJRA
chains in the Genus database with same CATH topology
1AUGA 1A2ZA 1X12A 3LACA 1Z8XA 1Z8TA 4HPSA 1IU8A 2EO8A 1X10A 1Z8WA 2EBJA 4GXHA 1IOFA 1IOIA 3RO0A 2DF5A 3RNZA 3GIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUG A;  1A2Z A;  1X12 A;  3LAC A;  1Z8X A;  1Z8T A;  4HPS A;  1IU8 A;  2EO8 A;  1X10 A;  1Z8W A;  2EBJ A;  4GXH A;  1IOF A;  1IOI A;  3RO0 A;  2DF5 A;  3RNZ A;  3GIU A; 
#chains in the Genus database with same CATH topology
 4OKO A;  4GS4 A;  5THW A;  4UEE A;  5KTD A;  1MJB A;  3LMS A;  3BI1 A;  1VIX A;  1Z8L A;  2Q4V A;  5EBV A;  2PQ8 A;  2Z11 A;  4A33 A;  4F0X A;  4P4E A;  1ARL A;  4UEF A;  4WJB A;  3CZX A;  4X8I A;  4P10 A;  4R6T A;  3TCV A;  4NGM A;  1BLL E;  1Z8T A;  2ANP A;  2JLM A;  5E96 A;  3BI0 A;  2Q43 A;  2WPX A;  2NYQ A;  3DR6 A;  1XRY A;  1UFH A;  2CNM A;  3PB8 X;  1F2P A;  3SJG A;  2R8V A;  4PXE A;  4KOW A;  3WAB A;  4UFW A;  5K8O A;  3N7Z A;  4JJX A;  4B5P A;  2Z0Z A;  2FXF A;  2EWB A;  1DE4 C;  2VXK A;  4HKF A;  3B3S A;  4X2T A;  3GIU A;  2G9D A;  5HMN A;  3KI9 A;  3WR7 A;  1OZP A;  4RUH A;  4R7M A;  3R9E A;  5IX3 A;  3D7H A;  4B6Z A;  4UEZ A;  5H86 A;  2Y0M A;  4AVA A;  1TXR A;  2PRB A;  4NXY A;  4TWE A;  3V8I A;  2Z3M A;  3FH4 A;  4KUB A;  1X12 A;  5J8C A;  4MJ8 A;  2Z3P A;  4JYW A;  3VAR A;  3R95 A;  3PFO A;  4OID A;  1PUA A;  1KUX A;  3NH5 A;  4AXV A;  1M44 A;  2FIA A;  3QAY A;  4MCQ A;  3EXN A;  4CGM A;  2R1I A;  3L2N A;  4OLL A;  3PEI A;  4GXH A;  3D2M A;  3PBE A;  4ZX8 A;  3S9N A;  4Q36 A;  3GUX A;  1XMB A;  2P6F A;  2QVP A;  4ONW A;  3TOA A;  3S9M A;  4B12 A;  3RO0 A;  3T9Y A;  4R57 A;  1M4G A;  2PJ8 A;  1ZO0 A;  3FVL A;  4MFP A;  3TOB A;  4KOR A;  3V38 A;  3FBU A;  1KWM A;  1IB1 E;  1R57 A;  1IGB A;  4J3G A;  1FY7 A;  1QSR A;  2PJ4 A;  2WYR A;  2XEF A;  2ZEM A;  2ZEL A;  3F5B A;  4A37 A;  2WUU A;  4IK2 A;  2PR1 A;  2GAN A;  2HV2 A;  2Z10 A;  7CPA A;  5IV0 A;  4AG9 A;  1QSO A;  4YGO A;  4ZY1 A;  2CF4 A;  1QQ9 A;  4II9 A;  3PB4 X;  5I0C A;  2Q0Y A;  2RC4 A;  2B5G A;  4PXB A;  2PIZ A;  5JPH A;  3BHX A;  2C6C A;  4IHM A;  4UIB A;  4CS0 B;  1KUY A;  1YK3 A;  2CY2 A;  2XEG A;  4KLW A;  3S6F A;  3NE7 A;  4P4I A;  2YNC A;  3LOD A;  3FXT A;  4LQ6 A;  5A27 A;  3P2H A;  1Q7L A;  1BAV A;  4A39 A;  5K8M A;  3T90 A;  1LAN A;  3JVN A;  2PDO A;  4U9Z A;  5LRG A;  4KLV A;  3JTK A;  3WC5 A;  2PVV A;  4AG7 A;  2OOT A;  5HVG A;  1VHS A;  4MHZ A;  4KS9 A;  2YNE A;  3RZA A;  4E2A A;  2NSM A;  1S7L A;  3CT9 A;  4K3N A;  3PBB A;  2OZH A;  1YLO A;  5CBM A;  3I3G A;  1R3N A;  4CGL A;  4P6Y A;  1IU8 A;  1Z5R A;  3F8K A;  3D8P A;  4FAI A;  5J1Q A;  3DDD A;  4AVB A;  3KGQ A;  3HLP A;  2PJB A;  3IWE A;  3FNC A;  2PJ7 A;  2Z3N A;  1LOK A;  2DF5 A;  2FIW A;  3QAH A;  3CXQ A;  1IYK A;  4CRY B;  2AJ6 A;  4E0A A;  2OH1 A;  4NJQ A;  1UWY A;  2PSW A;  2B4D B;  2R98 A;  1YLE A;  2P6G A;  4MHN A;  4P4F A;  3VWE A;  3IO1 A;  4R87 A;  3BXM A;  2CTB A;  3D7D A;  4NGQ A;  2ZW7 A;  2AFX A;  3W6S A;  3SJF A;  5LRK A;  4CAV A;  4FD4 A;  5DS0 A;  2NMT A;  2V8V A;  5JGF A;  3TT2 A;  2HQY A;  2O4H A;  2CXA A;  2EO8 A;  1X10 A;  2O53 A;  1S3Z A;  4NF1 A;  1B87 A;  4ZY2 A;  3FEC A;  2FSR A;  4KUA A;  4L89 A;  4NGT A;  2ZPA A;  3CPA A;  1Y9W A;  2JDC A;  1ELL P;  2V8H A;  4ZX9 A;  3RAM A;  5LYF A;  3PRT A;  3R9G A;  1AUG A;  3QNV A;  3IGR A;  3P2F A;  4CGP A;  3H4Q A;  3F0A A;  1B6B A;  1LCP A;  4ZI6 A;  2YND A;  1KZF A;  3KHX A;  2Q7B A;  1IYL A;  4U9Y A;  4C7I A;  3ZZI A;  3SJX A;  1ZG7 A;  3VWD A;  5J8F A;  3K9U A;  1I1D A;  4DJL A;  5DWM A;  4NGP A;  4CRZ B;  5JQ4 A;  1ELM P;  2ZEP A;  4R9M A;  3NE8 A;  1M1D A;  5K8P A;  5K8N A;  4PK3 A;  2FVG A;  3IC1 A;  2FS5 A;  1CP6 A;  2XEI A;  3JUW A;  1Y0R A;  2C6P A;  4HNY B;  1Y7E A;  4AVC A;  4K30 A;  4DUK A;  1ZLH A;  2D4P A;  5LRJ A;  3TO9 A;  1RO5 A;  1Z2L A;  4LUA A;  2ABZ A;  3GLJ A;  4CAE A;  1H8L A;  2PJ9 A;  3ZJ0 A;  1JQG A;  1VHE A;  2FCK A;  2REE A;  2VL1 A;  4MXU A;  2C1C A;  2G3A A;  1HDQ A;  2OZU A;  4NFR A;  4YFJ A;  1AMP A;  1LRZ A;  4B13 A;  5LYL A;  1VGY A;  3MGD A;  4UFX A;  1S7N A;  2F8H A;  2V77 A;  4ORF A;  2Z3L A;  2JBK A;  2JBJ A;  4BMH A;  2J8N A;  2BSW A;  4F9V A;  2VZZ A;  1XJO A;  4LX9 A;  1R43 A;  3FB3 A;  4IF5 A;  2OZG A;  1P4N A;  2BL1 A;  5CNP A;  3MRU A;  4NGS A;  2B4B A;  3VH9 A;  2REF A;  1XMT A;  1L0C A;  2I79 A;  1M4L A;  1XF8 A;  2EK9 A;  4Q7A A;  1M4I A;  4RS2 A;  4KOX A;  3LD2 A;  2Q4Y A;  4HNW B;  1P0H A;  4QVT A;  3FRM A;  1CJW A;  1IIC A;  3H5Z A;  4MFQ A;  2PJA A;  2AFW A;  2DEA A;  1NSA A;  2DXQ A;  2PJC A;  3NH8 A;  4JXR A;  2F7V A;  4ONU A;  3R9F A;  1ZG8 A;  3D2P A;  3S9L A;  3UY5 A;  4M3S A;  1BPM A;  1Z4E A;  2IJZ A;  8CPA A;  1OBR A;  5HXD A;  1YME A;  4CAX A;  3KR5 A;  2PVW A;  1Z9U A;  2CNT A;  2PIY A;  2YNC C;  4R8F A;  5F09 A;  3DNS A;  3E0K A;  3H8F A;  1CP7 A;  2FT0 A;  5F46 A;  1TKF A;  2EUI A;  3H8E A;  3ISX A;  2PE3 A;  3IWG A;  4L8A A;  5JH9 A;  1Q2C A;  1I21 A;  1I12 A;  4CYN A;  3TFY A;  3EFA A;  3N5F A;  2PJ6 A;  4HPS A;  4FUU A;  2GLJ A;  1F2O A;  2V8G A;  2PRQ A;  3TO6 A;  4A38 A;  5F47 A;  2PJ2 A;  4A94 A;  2JEW A;  2K5T A;  2ODF A;  4C7H A;  1XFO A;  4YWY A;  1J4J A;  4Y49 C;  4XPD C;  4UCM A;  5BWA B;  2WZN A;  4PXC A;  5G20 A;  3NH4 A;  2ZEO A;  4KVM E;  2VEZ A;  3EC4 A;  1YVO A;  2KCW A;  2PJ1 A;  2DPS A;  3FEE A;  4H2K A;  3S6H A;  1RTQ A;  2PC1 A;  3D7F A;  4RN7 A;  4QC6 A;  4CGO A;  3SXO A;  3D67 A;  4G1P A;  4JWP A;  3SXN A;  1S60 A;  4X5K A;  4MFJ A;  4A31 A;  4CYP A;  1QSM A;  4B5P B;  4M85 A;  1S7K A;  1CM0 A;  3GB0 A;  1Z8W A;  3DLJ A;  4PK2 A;  5C82 A;  2QIR A;  4PSX A;  1XIX A;  4WWV A;  3B3W A;  4PQA A;  2Q4Z A;  2I3C A;  2ZEG A;  3D7G A;  3IU1 A;  1TKJ A;  2OU2 A;  2VZY A;  4UWI A;  4QBJ A;  4W9Y A;  2PR8 A;  4OME A;  4DYO A;  1CG2 A;  4EME A;  3TC8 A;  3SHP A;  4MHD A;  5FVJ A;  1A2Z A;  4R76 A;  5IB0 A;  3W91 A;  1FNO A;  4PXD A;  3I1U A;  4UFV A;  1YGH A;  2ZXV A;  5AG6 A;  2GIV A;  2BUE A;  3BJ8 A;  3GYA A;  4Q38 A;  4UA3 A;  1BPN A;  1Z8X A;  4CPA A;  3R1K A;  1M4D A;  3BJ7 A;  3A9L A;  2HUZ A;  4R3K A;  3CPX A;  4UIA A;  4ZY0 A;  4F9U A;  4H89 A;  1Y0Y A;  1V0C A;  2GLF A;  1Q2Y A;  2CNS A;  1QST A;  3KZW A;  3D4U A;  2PJ0 A;  3K2K A;  1YVK A;  1HDU A;  3KAS A;  4KSF A;  4A32 A;  5I4M A;  1MJA A;  1RXT A;  3KL9 A;  2PJ5 A;  3B3C A;  5D29 A;  2ZEF A;  2Q51 A;  3B35 A;  3B8G A;  4FD6 A;  5KTA A;  4MBU A;  1Q2D A;  4IAV A;  2G0B A;  1AYE A;  2AFZ A;  1YR0 A;  2VQY A;  2FL4 A;  2GU2 A;  1XOV A;  2AFO A;  3IWW A;  3KKW A;  4P4J A;  4MCR A;  4Z65 A;  3SI2 A;  1BO4 A;  1LFW A;  2B5G B;  3NFZ A;  3B7I A;  2VI7 A;  2Z3O A;  4OIW A;  4PV6 A;  2DPT A;  3IU2 A;  3PZJ A;  3KHZ A;  4PSW A;  3V7Z A;  4NGN A;  4M6G A;  4P4B A;  2WSA A;  5AG4 A;  4OC4 A;  2A4N A;  3PP9 A;  4CYQ A;  2X7B A;  4UCP A;  1EE3 P;  2Z3K A;  3IIB A;  3WC7 A;  4C2Z A;  5AGE A;  1KUV A;  4UCN A;  4XNH B;  3EO4 A;  4KVX A;  2YGW A;  2AE6 A;  3FMC A;  4OP4 A;  4KSA A;  2P0W A;  3S6G A;  4PPZ A;  4Y49 B;  2EK8 A;  4P45 A;  4XPD B;  5H84 A;  4A30 A;  2ZEE A;  4UWJ A;  5HH1 A;  2ZEN A;  3IEH A;  3DGV A;  1Y9K A;  2B3U A;  3MN8 A;  2GFQ A;  2V8D A;  3TO7 A;  1WWZ A;  4NSQ A;  1NMT A;  3TE4 A;  3ISZ A;  1U6M A;  5EC4 A;  3G8W A;  4JLY A;  3DSB A;  2ARH A;  1ZLI A;  2ATR A;  3FED A;  3WT4 A;  3JRU A;  4JXQ A;  1ZG9 A;  4FD7 A;  4CAF A;  1CPS A;  4QB9 A;  4CGN A;  1IOF A;  2ZW4 A;  5HVF A;  2PCU A;  3H8G A;  3FIX A;  3W6X A;  3D3S A;  5IB9 A;  5C88 A;  1PCA A;  4ZBG A;  4BBH A;  3LWU A;  2C27 A;  3FF3 A;  1N71 A;  3G3S A;  4F8Z A;  3KQZ A;  5G1Z A;  4P44 A;  3EY5 A;  1K4J A;  3OWC A;  4H6Z A;  2QJ8 A;  4OC0 A;  4B11 A;  4FD5 A;  5DWN A;  2QML A;  1WK4 A;  2J8R A;  4YRH A;  4AB7 A;  4C2X A;  4ZGY B;  3SI0 A;  4CYO A;  1CX8 A;  2RFH A;  1YSJ A;  2B4D A;  4KOT A;  2GE3 A;  4KVO E;  5LYD A;  4KOV A;  2CIJ A;  2AFS A;  1ON0 A;  4KZT A;  4B5O A;  5CPA A;  5HVH A;  4XNH C;  1GHE A;  4O23 A;  1YW4 A;  3K9T A;  2Q04 A;  3BLN A;  4MFK A;  4MY3 A;  4OAD A;  5D8N A;  3D66 A;  1HEE A;  2QYV A;  3IJ3 A;  4A2Z A;  2GRE A;  1F57 A;  4OC3 A;  4OC5 A;  1XBU A;  1ARM A;  2B58 A;  4CAW A;  2WPW A;  3CXS A;  2ZOG A;  3NA6 A;  4E8O A;  3C26 A;  4KSI A;  5EMI A;  2J9A A;  4BIN A;  4P4D A;  4YU9 A;  4MFZ A;  3LAC A;  1PU9 A;  2BCO A;  4XPK A;  4JD6 A;  1NE9 A;  2IQ6 A;  2J8M A;  5KTC A;  4JZ0 A;  4UF4 A;  3TTH A;  1TKH A;  3QB8 A;  4MCS A;  1YW6 A;  5F48 A;  4C2Y A;  1XEB A;  2BEI A;  1YRE A;  3FJU A;  2H5M A;  1QMU A;  2FE7 A;  4OC2 A;  2POK A;  3FYN A;  2IMO A;  4BD9 A;  1VKC A;  4X3R A;  3CDX A;  3PB6 X;  4KOU A;  5ELY A;  3RBU A;  3RNZ A;  4A95 A;  4B10 A;  5G21 A;  1GYT A;  3D68 A;  2ZOF A;  4QUS A;  5GCN A;  4MHP A;  3GKR A;  4NEX A;  2P6E A;  4GM5 A;  2XEJ A;  3DR8 A;  2ZW5 A;  3PB9 X;  3R96 A;  5JM6 A;  1YX0 A;  1S7F A;  3VAT A;  1JWQ A;  4EFD A;  6CPA A;  2RB7 A;  1IID A;  2BO9 A;  3PFE A;  4RI1 A;  3TX8 A;  1TF9 A;  4ZYQ A;  2PJ3 A;  4C68 A;  4MFL A;  3FX6 A;  3WC6 A;  4EVY A;  4OAE A;  1FT7 A;  4IUS A;  3CXP A;  3IFE A;  4MRI A;  3SJE A;  1YQE A;  3PB7 X;  4TNU A;  1IY7 A;  3GY9 A;  1TF8 A;  2JDD A;  4I49 A;  4M6H A;  1PYT B;  1QSN A;  2O28 A;  1MJ9 A;  4F6A A;  2C6G A;  2ZW6 A;  4R3L A;  2VBQ A;  3KQX A;  4MMO A;  4OC1 A;  2BOA A;  4HNX B;  3HUV A;  1SQH A;  4UBR A;  1BOB A;  4MCP A;  4MI4 A;  3T8W A;  2G3T A;  2JEV A;  4FWU A;  1CBX A;  2OB0 A;  1LAM A;  4F0Y A;  2R7H A;  4MY0 A;  1LAP A;  2AFM A;  4NGR A;  5A28 A;  4KOY A;  3B3T A;  3B3V A;  4DNC A;  2QEC A;  3I9S A;  4XPL A;  5ISV A;  2EVN A;  2HC9 A;  3PGP A;  5AG5 A;  3RYO A;  2CTC A;  5AG7 A;  1NSL A;  3B2Y A;  2OR4 A;  5LYI A;  4U5Y A;  1Z4R A;  3SI1 A;  1Y7R A;  2IL4 A;  4NCZ A;  1S5K A;  4FBE A;  2F5I A;  4EWT A;  2I00 A;  1TIQ A;  2ZEH A;  1VHO A;  2D4O A;  1DTD A;  2AFU A;  2EBJ A;  4KOS A;  3S6K A;  3KR4 A;  2Q44 A;  1IOI A;  5G22 A;  2B3V A;  2Q7S A;  4H6U A;  4MHY A;  4B14 A;  5F49 A;  1CPX A;  2HB6 A;  2ZED A;  4M6I A;  1MK4 A;  4LQG A;  1XE4 A;  4NJR A; 
#chains in the Genus database with same CATH homology
 1AUG A;  1A2Z A;  1X12 A;  3LAC A;  1Z8X A;  1Z8T A;  4HPS A;  1IU8 A;  2EO8 A;  1X10 A;  1Z8W A;  2EBJ A;  4GXH A;  1IOF A;  1IOI A;  3RO0 A;  2DF5 A;  3RNZ A;  3GIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...