1Z8XA

Structure of mutant pyrrolidone carboxyl peptidase (e192v) from a hyperthermophile, pyrococcus furiosus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMVLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
total genus 71
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8xA00
3GIUA 1A2ZA 1AUGA 2EO8A 4HPSA 4GXHA 1Z8XA 1IOFA 1X12A 2EBJA 1Z8WA 3RNZA 1IOIA 3RO0A 3LACA 2DF5A 1IU8A 1Z8TA 1X10A
chains in the Genus database with same CATH superfamily
1H8LA 4C68A 4DUKA 3N5FA 1TKFA 1TF9A 1YR0A 5F47A 4U9YA 2FVGA 4AVBA 1IY7A 5JM6A 4P4FA 1KUXA 4ZY2A 3D3SA 5LYLA 3VWDA 4Z65A 3FYNA 2QIRA 3PRTA 1P0HA 1JWQA 3IC1A 4C7IA 2CTBA 1AUGA 4P10A 3A9LA 1GYTA 3RBUA 4CRZB 2QMLA 5JH9A 2AFOA 3H5ZA 2NMTA 3DSBA 3JRUA 2YGWA 3SJGA 3V8IA 3WC6A 5K8NA 1XF8A 1YGHA 2ZOFA 4MCPA 3CT9A 3EO4A 6CPAA 4J3GA 4KLWA 2PJ8A 4QUSA 4ZGYB 3QB8A 4NGSA 3R96A 3KZWA 1FY7A 2Z3MA 4LQGA 4A30A 1HDUA 3NFZA 3DDDA 3E0KA 3TT2A 3S6KA 4C2YA 1YLEA 1R3NA 1ARLA 2VEZA 2ZENA 3N7ZA 5G21A 4YWYA 2EWBA 1XJOA 1XMTA 2QVPA 5I4MA 1KZFA 1VHEA 4HNXB 3SXNA 1S7FA 5IV0A 5LYFA 3B3TA 2ZW5A 5AGEA 4EVYA 2XEIA 3R9EA 2ZEDA 5K8OA 4MFQA 4MMOA 3TO6A 2ABZA 1A2ZA 4UFXA 1AYEA 1Y0RA 2JBJA 4JXRA 4NF1A 4G1PA 4ZY1A 4HKFA 5D8NA 2FSRA 2B58A 1IIDA 1S7KA 4F9VA 4MCSA 4AXVA 4I49A 4L89A 5G1ZA 4NJQA 7CPAA 4NGRA 1M44A 2H5MA 3NA6A 1DE4C 4KOVA 1F2OA 3R95A 2P6EA 2F5IA 4HPSA 2FIAA 3KHXA 5BWAB 3JTKA 2WZNA 4JD6A 2FL4A 4KOUA 1LAMA 4XPDB 4MHPA 2OH1A 4FWUA 4KVOE 4IAVA 2ZXVA 4FAIA 5JGFA 4KZTA 2AFSA 1JQGA 2R1IA 2VXKA 2P6GA 3H8EA 2EVNA 3B3VA 4FD6A 2WPWA 2ZEGA 4KOSA 2VQYA 2JLMA 2OZHA 3PZJA 3B2YA 5CPAA 4AG9A 2ZW7A 1YMEA 4X8IA 1S7LA 3IWEA 5IB0A 3D7FA 4NSQA 2ODFA 4A94A 4UCPA 2C27A 3B3SA 4L8AA 4A95A 5JPHA 2B3UA 1ELMP 4A2ZA 3G3SA 3B8GA 4Q7AA 2Q4YA 2VBQA 3GYAA 4JLYA 2B4DB 2V8GA 3H8GA 1Q2DA 1S5KA 2C6GA 2XEGA 3CZXA 4Y49C 3S6FA 2J8NA 2HC9A 3TFYA 1RO5A 1V0CA 1QSOA 3GB0A 5H84A 3KASA 1NSAA 2PDOA 5J8CA 1YVKA 1LRZA 1Z8TA 2GU2A 3TTHA 3KI9A 5KTCA 2AFXA 1CM0A 2Z11A 3PB7X 1YVOA 5JQ4A 3TCVA 4ZY0A 4PSWA 4UWIA 2Q0YA 3IEHA 1RTQA 4CGLA 2ARHA 3DNSA 2REEA 3FBUA 3RNZA 5KTDA 3R9FA 4B5OA 3WR7A 5G20A 5KTAA 4F0YA 3ZZIA 1X10A 3ZJ0A 4P6YA 1RXTA 2PJ3A 4U5YA 2CXAA 2YNDA 3JVNA 1F2PA 2BUEA 4MFJA 4X3RA 5AG7A 2CY2A 1S7NA 3WC5A 1IYKA 2BOAA 4OP4A 5LRKA 1OBRA 4AVAA 3KR5A 1CG2A 3KHZA 3KR4A 3LODA 2JDDA 4UCNA 3GY9A 1Y7EA 3BI1A 3DLJA 2G3AA 4KUAA 2HUZA 2ZEFA 3FNCA 4NJRA 4R76A 4XPLA 1IOFA 4JZ0A 1XMBA 2C6CA 2Q43A 1BO4A 1UFHA 4R3KA 4QBJA 1I12A 2C6PA 1VIXA 2ZEOA 4NGNA 1PUAA 1Y9WA 4OKOA 4MFKA 4PXBA 4EMEA 2EUIA 4A38A 3CPXA 4KSFA 5C88A 1YK3A 4MJ8A 3VARA 4M6IA 3KGQA 4AB7A 3D2PA 4E0AA 1IB1E 2ZEEA 5J1QA 3TO9A 3NH5A 2POKA 1XE4A 4B5PB 4FD7A 5DWNA 2O4HA 2GE3A 2ZEMA 1QMUA 3F5BA 4LX9A 3D7GA 4X2TA 4KVXA 5EMIA 3D67A 1XEBA 3OWCA 3CPAA 3IU2A 5IB9A 4E2AA 1TKJA 5I0CA 1IICA 2PJ0A 2CF4A 3FJUA 1MK4A 5EC4A 4CAVA 2KCWA 8CPAA 5F09A 4CAWA 4II9A 3G8WA 4CYOA 1CJWA 4ZBGA 3F0AA 2FT0A 4NXYA 2FIWA 1WK4A 2B4BA 2PJAA 2ZEHA 3KQZA 5AG6A 1KUVA 4C2ZA 2JDCA 1SQHA 2K5TA 3FMCA 2XEJA 3UY5A 4W9YA 5J8FA 3KQXA 1QQ9A 5AG5A 2BL1A 3D2MA 4FBEA 3IO1A 1Q2YA 2CTCA 4R8FA 4UFWA 4PV6A 4UIBA 4OC5A 4RUHA 2HV2A 2G0BA 4RI1A 3D66A 4GXHA 4IF5A 4CAXA 3BJ7A 1WWZA 4NEXA 1Z4RA 3NH4A 3V7ZA 3IU1A 2Z3PA 3TOAA 1QSMA 3PFEA 3DR6A 3I3GA 2BO9A 4JYWA 4UEFA 5F48A 5H86A 1Y7RA 1IU8A 1QSNA 3P2FA 4PXEA 4ZI6A 1FNOA 3IGRA 2IJZA 4CYQA 4A31A 2DEAA 1XOVA 1TKHA 4P4BA 1PU9A 5F46A 3DGVA 5HVFA 2Q4VA 4MHDA 4O23A 4ONWA 1L0CA 2RB7A 3FF3A 1PYTB 2YNCA 4R9MA 4ZX9A 4CPAA 3BXMA 2D4OA 2ZPAA 2REFA 4B6ZA 4C7HA 1CPXA 3IFEA 2IL4A 3H4QA 1ZG8A 4Q38A 2Q44A 2WSAA 2AJ6A 2DF5A 3FB3A 2CNTA 2Q7SA 4C2XA 2ZW4A 3W91A 2Z3OA 4R7MA 2WYRA 3LMSA 4UCMA 4PSXA 5AG4A 4PPZA 4OAEA 1QSTA 2OB0A 3VWEA 3MRUA 4WWVA 3S6GA 5HXDA 1VGYA 2YNEA 2B5GB 4MHZA 4P4JA 1M4IA 5HH1A 1Z8XA 1Z5RA 3PB9X 4OIDA 3S6HA 4A39A 2EK9A 4KUBA 4B12A 2D4PA 5LYDA 3FX6A 3ISZA 4GS4A 4F8ZA 1HEEA 3VATA 2BCOA 2VZZA 3V38A 4AG7A 1CBXA 2BSWA 1MJ9A 2AFWA 5LRJA 3H8FA 4FUUA 4XNHB 1R43A 1Y9KA 4BD9A 4CGPA 4UEEA 2PR8A 3D4UA 4B11A 2J9AA 3TC8A 1B87A 2GLJA 2PVVA 3R1KA 4H2KA 2PRQA 4WJBA 1YW4A 2PJ6A 2HQYA 2PJ1A 1LANA 2J8MA 3FH4A 4LUAA 4AVCA 2I00A 3SHPA 4XPKA 2EK8A 5E96A 1QSRA 4KOYA 1XRYA 5K8MA 4R57A 2YNCC 2ZW6A 5GCNA 4Q36A 3QNVA 3PEIA 4MHNA 4NCZA 4CYNA 2ZELA 3D8PA 1U6MA 4A32A 4YFJA 1LAPA 4CGOA 4RS2A 2A4NA 4OC1A 3T8WA 1Z4EA 2HB6A 1BPNA 1CX8A 1YX0A 4U9ZA 1MJAA 2XEFA 4YRHA 3TX8A 2F8HA 3WABA 3FIXA 4IK2A 3PGPA 4X5KA 2V8HA 3PP9A 4P45A 1Y0YA 2WPXA 3SJFA 1IGBA 4QB9A 4M3SA 4PK2A 3GKRA 4CGMA 1XIXA 4KSIA 5K8PA 2PRBA 3CXSA 5DWMA 3QAYA 3JUWA 3WT4A 3F8KA 2RFHA 5ELYA 3CDXA 5F49A 2FCKA 2DXQA 1J4JA 2AFZA 2OZUA 2PC1A 3NE8A 2V77A 4PK3A 4UFVA 4OMEA 5FVJA 4MBUA 2Z3LA 3QAHA 3TOBA 2Q04A 2ZOGA 2P6FA 4JJXA 4KSAA 3T9YA 4A33A 2ANPA 2Q4ZA 3P2HA 4DJLA 4UWJA 4IUSA 4PQAA 4PXDA 1X12A 4JWPA 5DS0A 1GHEA 4MRIA 1K4JA 1NE9A 2Z0ZA 2FE7A 2R7HA 2P0WA 4NFRA 4NGQA 4ORFA 3B3WA 3W6SA 2PCUA 4P4EA 4KOWA 4YU9A 4BBHA 4EFDA 4B10A 4H89A 5EBVA 1ZLHA 3GIUA 4P4IA 4R3LA 4KS9A 5HVGA 2PJBA 2GIVA 3RAMA 4BINA 4PXCA 3HUVA 5A28A 3LWUA 3TE4A 4P4DA 3GLJA 2JEWA 4K30A 3NH8A 4UEZA 4MFZA 2OZGA 4MFPA 3PBBA 2Y0MA 1XBUA 1YSJA 3K9UA 4UIAA 4OC4A 3VH9A 5CNPA 4NGMA 2G3TA 3IJ3A 4F0XA 2Z3KA 3IIBA 5LYIA 3RZAA 3BLNA 1ZO0A 3RO0A 2PJ7A 4UA3A 1F57A 3SJEA 4A37A 2J8RA 4ONUA 4YGOA 2QECA 2Z10A 1M4LA 2AFUA 2B5GA 4MCRA 4B5PA 4OC0A 1I21A 1S3ZA 4IHMA 1M4DA 4KVME 2O53A 3MGDA 3SI1A 2WUUA 2DPSA 1IOIA 4OC2A 2PJ9A 3I9SA 3PB4X 5THWA 2FXFA 3RYOA 2Z3NA 4M85A 3PBEA 3L2NA 1NSLA 3R9GA 5G22A 1BAVA 2R98A 1BLLE 2VL1A 4CGNA 1DTDA 1ON0A 2JBKA 1HDQA 2RC4A 4JXQA 4QC6A 2Q7BA 4MI4A 5HVHA 4BMHA 4UBRA 1VHOA 3D7DA 2FS5A 4MY0A 3LD2A 4H6UA 4TWEA 1I1DA 2BEIA 3T90A 3EFAA 2GFQA 1M4GA 4CAFA 4KOXA 3FEEA 2OR4A 2QYVA 2PQ8A 2GANA 2IQ6A 1MJBA 1YQEA 1ZLIA 4R87A 4OADA 1M1DA 1NMTA 2PIYA 3FVLA 4DNCA 5CBMA 3SI2A 1OZPA 1BOBA 3BHXA 4KLVA 4LQ6A 1R57A 1ZG7A 4CYPA 3FXTA 3K2KA 3PB6X 1TXRA 1P4NA 5HMNA 2EBJA 1ZG9A 4B14A 2GLFA 4XPDC 2R8VA 5ISVA 2PJCA 4XNHC 5D29A 2GREA 4M6GA 3S9NA 3C26A 2B4DA 1KWMA 2PSWA 4CRYB 3MN8A 3W6XA 4F6AA 4EWTA 3S9LA 1Z9UA 3D68A 3PB8X 4P44A 4TNUA 1XFOA 2I79A 3FECA 2VZYA 3HLPA 2Q51A 1LOKA 1LCPA 2X7BA 1LFWA 4NGPA 2JEVA 1N71A 2V8VA 4MCQA 1FT7A 3D7HA 1Q7LA 1IYLA 2QJ8A 2DPTA 3BJ8A 2G9DA 1YLOA 2OU2A 3KKWA 2OOTA 2NSMA 1EE3P 2PJ5A 3CXQA 5IX3A 2C1CA 4GM5A 4HNYB 4H6ZA 3SXOA 1PCAA 3TO7A 4OIWA 4CS0B 2PJ4A 2PE3A 3LACA 1CPSA 4B13A 1KUYA 1UWYA 4RN7A 2B3VA 2CNSA 3PFOA 2CNMA 2ZEPA 4MY3A 4DYOA 1BPMA 1ARMA 2ATRA 4MHYA 4KORA 5A27A 2PJ2A 3IWGA 4OLLA 4E8OA 2NYQA 3IWWA 4KOTA 1S60A 2V8DA 5C82A 1VKCA 2IMOA 3FRMA 3GUXA 3FEDA 4Y49B 4ZYQA 3EY5A 5LRGA 3B7IA 4NGTA 4MXUA 2I3CA 2O28A 4OC3A 3KL9A 1ELLP 1Z8WA 2PVWA 4FD4A 4MFLA 3EC4A 1YW6A 2PIZA 3B35A 3I1UA 2CIJA 1CP6A 3S9MA 3WC7A 3BI0A 4CAEA 2PR1A 4ZX8A 1TF8A 3ISXA 4F9UA 3K9TA 2F7VA 2EO8A 1CP7A 1AMPA 1VHSA 4FD5A 3B3CA 1Z8LA 2VI7A 4HNWB 1TIQA 2AFMA 4M6HA 3DR8A 3EXNA 3NE7A 4K3NA 1YREA 1B6BA 2AE6A 4QVTA 3SJXA 1Z2LA 3CXPA 4R6TA 1Q2CA 3SI0A 4UF4A
chains in the Genus database with same CATH topology
3GIUA 1A2ZA 1AUGA 2EO8A 4HPSA 4GXHA 1Z8XA 1IOFA 1X12A 2EBJA 1Z8WA 3RNZA 1IOIA 3RO0A 3LACA 2DF5A 1IU8A 1Z8TA 1X10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GIU A;  1A2Z A;  1AUG A;  2EO8 A;  4HPS A;  4GXH A;  1Z8X A;  1IOF A;  1X12 A;  2EBJ A;  1Z8W A;  3RNZ A;  1IOI A;  3RO0 A;  3LAC A;  2DF5 A;  1IU8 A;  1Z8T A;  1X10 A; 
#chains in the Genus database with same CATH topology
 1H8L A;  4C68 A;  4DUK A;  3N5F A;  1TKF A;  1TF9 A;  1YR0 A;  5F47 A;  4U9Y A;  2FVG A;  4AVB A;  1IY7 A;  5JM6 A;  4P4F A;  1KUX A;  4ZY2 A;  3D3S A;  5LYL A;  3VWD A;  4Z65 A;  3FYN A;  2QIR A;  3PRT A;  1P0H A;  1JWQ A;  3IC1 A;  4C7I A;  2CTB A;  1AUG A;  4P10 A;  3A9L A;  1GYT A;  3RBU A;  4CRZ B;  2QML A;  5JH9 A;  2AFO A;  3H5Z A;  2NMT A;  3DSB A;  3JRU A;  2YGW A;  3SJG A;  3V8I A;  3WC6 A;  5K8N A;  1XF8 A;  1YGH A;  2ZOF A;  4MCP A;  3CT9 A;  3EO4 A;  6CPA A;  4J3G A;  4KLW A;  2PJ8 A;  4QUS A;  4ZGY B;  3QB8 A;  4NGS A;  3R96 A;  3KZW A;  1FY7 A;  2Z3M A;  4LQG A;  4A30 A;  1HDU A;  3NFZ A;  3DDD A;  3E0K A;  3TT2 A;  3S6K A;  4C2Y A;  1YLE A;  1R3N A;  1ARL A;  2VEZ A;  2ZEN A;  3N7Z A;  5G21 A;  4YWY A;  2EWB A;  1XJO A;  1XMT A;  2QVP A;  5I4M A;  1KZF A;  1VHE A;  4HNX B;  3SXN A;  1S7F A;  5IV0 A;  5LYF A;  3B3T A;  2ZW5 A;  5AGE A;  4EVY A;  2XEI A;  3R9E A;  2ZED A;  5K8O A;  4MFQ A;  4MMO A;  3TO6 A;  2ABZ A;  1A2Z A;  4UFX A;  1AYE A;  1Y0R A;  2JBJ A;  4JXR A;  4NF1 A;  4G1P A;  4ZY1 A;  4HKF A;  5D8N A;  2FSR A;  2B58 A;  1IID A;  1S7K A;  4F9V A;  4MCS A;  4AXV A;  4I49 A;  4L89 A;  5G1Z A;  4NJQ A;  7CPA A;  4NGR A;  1M44 A;  2H5M A;  3NA6 A;  1DE4 C;  4KOV A;  1F2O A;  3R95 A;  2P6E A;  2F5I A;  4HPS A;  2FIA A;  3KHX A;  5BWA B;  3JTK A;  2WZN A;  4JD6 A;  2FL4 A;  4KOU A;  1LAM A;  4XPD B;  4MHP A;  2OH1 A;  4FWU A;  4KVO E;  4IAV A;  2ZXV A;  4FAI A;  5JGF A;  4KZT A;  2AFS A;  1JQG A;  2R1I A;  2VXK A;  2P6G A;  3H8E A;  2EVN A;  3B3V A;  4FD6 A;  2WPW A;  2ZEG A;  4KOS A;  2VQY A;  2JLM A;  2OZH A;  3PZJ A;  3B2Y A;  5CPA A;  4AG9 A;  2ZW7 A;  1YME A;  4X8I A;  1S7L A;  3IWE A;  5IB0 A;  3D7F A;  4NSQ A;  2ODF A;  4A94 A;  4UCP A;  2C27 A;  3B3S A;  4L8A A;  4A95 A;  5JPH A;  2B3U A;  1ELM P;  4A2Z A;  3G3S A;  3B8G A;  4Q7A A;  2Q4Y A;  2VBQ A;  3GYA A;  4JLY A;  2B4D B;  2V8G A;  3H8G A;  1Q2D A;  1S5K A;  2C6G A;  2XEG A;  3CZX A;  4Y49 C;  3S6F A;  2J8N A;  2HC9 A;  3TFY A;  1RO5 A;  1V0C A;  1QSO A;  3GB0 A;  5H84 A;  3KAS A;  1NSA A;  2PDO A;  5J8C A;  1YVK A;  1LRZ A;  1Z8T A;  2GU2 A;  3TTH A;  3KI9 A;  5KTC A;  2AFX A;  1CM0 A;  2Z11 A;  3PB7 X;  1YVO A;  5JQ4 A;  3TCV A;  4ZY0 A;  4PSW A;  4UWI A;  2Q0Y A;  3IEH A;  1RTQ A;  4CGL A;  2ARH A;  3DNS A;  2REE A;  3FBU A;  3RNZ A;  5KTD A;  3R9F A;  4B5O A;  3WR7 A;  5G20 A;  5KTA A;  4F0Y A;  3ZZI A;  1X10 A;  3ZJ0 A;  4P6Y A;  1RXT A;  2PJ3 A;  4U5Y A;  2CXA A;  2YND A;  3JVN A;  1F2P A;  2BUE A;  4MFJ A;  4X3R A;  5AG7 A;  2CY2 A;  1S7N A;  3WC5 A;  1IYK A;  2BOA A;  4OP4 A;  5LRK A;  1OBR A;  4AVA A;  3KR5 A;  1CG2 A;  3KHZ A;  3KR4 A;  3LOD A;  2JDD A;  4UCN A;  3GY9 A;  1Y7E A;  3BI1 A;  3DLJ A;  2G3A A;  4KUA A;  2HUZ A;  2ZEF A;  3FNC A;  4NJR A;  4R76 A;  4XPL A;  1IOF A;  4JZ0 A;  1XMB A;  2C6C A;  2Q43 A;  1BO4 A;  1UFH A;  4R3K A;  4QBJ A;  1I12 A;  2C6P A;  1VIX A;  2ZEO A;  4NGN A;  1PUA A;  1Y9W A;  4OKO A;  4MFK A;  4PXB A;  4EME A;  2EUI A;  4A38 A;  3CPX A;  4KSF A;  5C88 A;  1YK3 A;  4MJ8 A;  3VAR A;  4M6I A;  3KGQ A;  4AB7 A;  3D2P A;  4E0A A;  1IB1 E;  2ZEE A;  5J1Q A;  3TO9 A;  3NH5 A;  2POK A;  1XE4 A;  4B5P B;  4FD7 A;  5DWN A;  2O4H A;  2GE3 A;  2ZEM A;  1QMU A;  3F5B A;  4LX9 A;  3D7G A;  4X2T A;  4KVX A;  5EMI A;  3D67 A;  1XEB A;  3OWC A;  3CPA A;  3IU2 A;  5IB9 A;  4E2A A;  1TKJ A;  5I0C A;  1IIC A;  2PJ0 A;  2CF4 A;  3FJU A;  1MK4 A;  5EC4 A;  4CAV A;  2KCW A;  8CPA A;  5F09 A;  4CAW A;  4II9 A;  3G8W A;  4CYO A;  1CJW A;  4ZBG A;  3F0A A;  2FT0 A;  4NXY A;  2FIW A;  1WK4 A;  2B4B A;  2PJA A;  2ZEH A;  3KQZ A;  5AG6 A;  1KUV A;  4C2Z A;  2JDC A;  1SQH A;  2K5T A;  3FMC A;  2XEJ A;  3UY5 A;  4W9Y A;  5J8F A;  3KQX A;  1QQ9 A;  5AG5 A;  2BL1 A;  3D2M A;  4FBE A;  3IO1 A;  1Q2Y A;  2CTC A;  4R8F A;  4UFW A;  4PV6 A;  4UIB A;  4OC5 A;  4RUH A;  2HV2 A;  2G0B A;  4RI1 A;  3D66 A;  4GXH A;  4IF5 A;  4CAX A;  3BJ7 A;  1WWZ A;  4NEX A;  1Z4R A;  3NH4 A;  3V7Z A;  3IU1 A;  2Z3P A;  3TOA A;  1QSM A;  3PFE A;  3DR6 A;  3I3G A;  2BO9 A;  4JYW A;  4UEF A;  5F48 A;  5H86 A;  1Y7R A;  1IU8 A;  1QSN A;  3P2F A;  4PXE A;  4ZI6 A;  1FNO A;  3IGR A;  2IJZ A;  4CYQ A;  4A31 A;  2DEA A;  1XOV A;  1TKH A;  4P4B A;  1PU9 A;  5F46 A;  3DGV A;  5HVF A;  2Q4V A;  4MHD A;  4O23 A;  4ONW A;  1L0C A;  2RB7 A;  3FF3 A;  1PYT B;  2YNC A;  4R9M A;  4ZX9 A;  4CPA A;  3BXM A;  2D4O A;  2ZPA A;  2REF A;  4B6Z A;  4C7H A;  1CPX A;  3IFE A;  2IL4 A;  3H4Q A;  1ZG8 A;  4Q38 A;  2Q44 A;  2WSA A;  2AJ6 A;  2DF5 A;  3FB3 A;  2CNT A;  2Q7S A;  4C2X A;  2ZW4 A;  3W91 A;  2Z3O A;  4R7M A;  2WYR A;  3LMS A;  4UCM A;  4PSX A;  5AG4 A;  4PPZ A;  4OAE A;  1QST A;  2OB0 A;  3VWE A;  3MRU A;  4WWV A;  3S6G A;  5HXD A;  1VGY A;  2YNE A;  2B5G B;  4MHZ A;  4P4J A;  1M4I A;  5HH1 A;  1Z8X A;  1Z5R A;  3PB9 X;  4OID A;  3S6H A;  4A39 A;  2EK9 A;  4KUB A;  4B12 A;  2D4P A;  5LYD A;  3FX6 A;  3ISZ A;  4GS4 A;  4F8Z A;  1HEE A;  3VAT A;  2BCO A;  2VZZ A;  3V38 A;  4AG7 A;  1CBX A;  2BSW A;  1MJ9 A;  2AFW A;  5LRJ A;  3H8F A;  4FUU A;  4XNH B;  1R43 A;  1Y9K A;  4BD9 A;  4CGP A;  4UEE A;  2PR8 A;  3D4U A;  4B11 A;  2J9A A;  3TC8 A;  1B87 A;  2GLJ A;  2PVV A;  3R1K A;  4H2K A;  2PRQ A;  4WJB A;  1YW4 A;  2PJ6 A;  2HQY A;  2PJ1 A;  1LAN A;  2J8M A;  3FH4 A;  4LUA A;  4AVC A;  2I00 A;  3SHP A;  4XPK A;  2EK8 A;  5E96 A;  1QSR A;  4KOY A;  1XRY A;  5K8M A;  4R57 A;  2YNC C;  2ZW6 A;  5GCN A;  4Q36 A;  3QNV A;  3PEI A;  4MHN A;  4NCZ A;  4CYN A;  2ZEL A;  3D8P A;  1U6M A;  4A32 A;  4YFJ A;  1LAP A;  4CGO A;  4RS2 A;  2A4N A;  4OC1 A;  3T8W A;  1Z4E A;  2HB6 A;  1BPN A;  1CX8 A;  1YX0 A;  4U9Z A;  1MJA A;  2XEF A;  4YRH A;  3TX8 A;  2F8H A;  3WAB A;  3FIX A;  4IK2 A;  3PGP A;  4X5K A;  2V8H A;  3PP9 A;  4P45 A;  1Y0Y A;  2WPX A;  3SJF A;  1IGB A;  4QB9 A;  4M3S A;  4PK2 A;  3GKR A;  4CGM A;  1XIX A;  4KSI A;  5K8P A;  2PRB A;  3CXS A;  5DWM A;  3QAY A;  3JUW A;  3WT4 A;  3F8K A;  2RFH A;  5ELY A;  3CDX A;  5F49 A;  2FCK A;  2DXQ A;  1J4J A;  2AFZ A;  2OZU A;  2PC1 A;  3NE8 A;  2V77 A;  4PK3 A;  4UFV A;  4OME A;  5FVJ A;  4MBU A;  2Z3L A;  3QAH A;  3TOB A;  2Q04 A;  2ZOG A;  2P6F A;  4JJX A;  4KSA A;  3T9Y A;  4A33 A;  2ANP A;  2Q4Z A;  3P2H A;  4DJL A;  4UWJ A;  4IUS A;  4PQA A;  4PXD A;  1X12 A;  4JWP A;  5DS0 A;  1GHE A;  4MRI A;  1K4J A;  1NE9 A;  2Z0Z A;  2FE7 A;  2R7H A;  2P0W A;  4NFR A;  4NGQ A;  4ORF A;  3B3W A;  3W6S A;  2PCU A;  4P4E A;  4KOW A;  4YU9 A;  4BBH A;  4EFD A;  4B10 A;  4H89 A;  5EBV A;  1ZLH A;  3GIU A;  4P4I A;  4R3L A;  4KS9 A;  5HVG A;  2PJB A;  2GIV A;  3RAM A;  4BIN A;  4PXC A;  3HUV A;  5A28 A;  3LWU A;  3TE4 A;  4P4D A;  3GLJ A;  2JEW A;  4K30 A;  3NH8 A;  4UEZ A;  4MFZ A;  2OZG A;  4MFP A;  3PBB A;  2Y0M A;  1XBU A;  1YSJ A;  3K9U A;  4UIA A;  4OC4 A;  3VH9 A;  5CNP A;  4NGM A;  2G3T A;  3IJ3 A;  4F0X A;  2Z3K A;  3IIB A;  5LYI A;  3RZA A;  3BLN A;  1ZO0 A;  3RO0 A;  2PJ7 A;  4UA3 A;  1F57 A;  3SJE A;  4A37 A;  2J8R A;  4ONU A;  4YGO A;  2QEC A;  2Z10 A;  1M4L A;  2AFU A;  2B5G A;  4MCR A;  4B5P A;  4OC0 A;  1I21 A;  1S3Z A;  4IHM A;  1M4D A;  4KVM E;  2O53 A;  3MGD A;  3SI1 A;  2WUU A;  2DPS A;  1IOI A;  4OC2 A;  2PJ9 A;  3I9S A;  3PB4 X;  5THW A;  2FXF A;  3RYO A;  2Z3N A;  4M85 A;  3PBE A;  3L2N A;  1NSL A;  3R9G A;  5G22 A;  1BAV A;  2R98 A;  1BLL E;  2VL1 A;  4CGN A;  1DTD A;  1ON0 A;  2JBK A;  1HDQ A;  2RC4 A;  4JXQ A;  4QC6 A;  2Q7B A;  4MI4 A;  5HVH A;  4BMH A;  4UBR A;  1VHO A;  3D7D A;  2FS5 A;  4MY0 A;  3LD2 A;  4H6U A;  4TWE A;  1I1D A;  2BEI A;  3T90 A;  3EFA A;  2GFQ A;  1M4G A;  4CAF A;  4KOX A;  3FEE A;  2OR4 A;  2QYV A;  2PQ8 A;  2GAN A;  2IQ6 A;  1MJB A;  1YQE A;  1ZLI A;  4R87 A;  4OAD A;  1M1D A;  1NMT A;  2PIY A;  3FVL A;  4DNC A;  5CBM A;  3SI2 A;  1OZP A;  1BOB A;  3BHX A;  4KLV A;  4LQ6 A;  1R57 A;  1ZG7 A;  4CYP A;  3FXT A;  3K2K A;  3PB6 X;  1TXR A;  1P4N A;  5HMN A;  2EBJ A;  1ZG9 A;  4B14 A;  2GLF A;  4XPD C;  2R8V A;  5ISV A;  2PJC A;  4XNH C;  5D29 A;  2GRE A;  4M6G A;  3S9N A;  3C26 A;  2B4D A;  1KWM A;  2PSW A;  4CRY B;  3MN8 A;  3W6X A;  4F6A A;  4EWT A;  3S9L A;  1Z9U A;  3D68 A;  3PB8 X;  4P44 A;  4TNU A;  1XFO A;  2I79 A;  3FEC A;  2VZY A;  3HLP A;  2Q51 A;  1LOK A;  1LCP A;  2X7B A;  1LFW A;  4NGP A;  2JEV A;  1N71 A;  2V8V A;  4MCQ A;  1FT7 A;  3D7H A;  1Q7L A;  1IYL A;  2QJ8 A;  2DPT A;  3BJ8 A;  2G9D A;  1YLO A;  2OU2 A;  3KKW A;  2OOT A;  2NSM A;  1EE3 P;  2PJ5 A;  3CXQ A;  5IX3 A;  2C1C A;  4GM5 A;  4HNY B;  4H6Z A;  3SXO A;  1PCA A;  3TO7 A;  4OIW A;  4CS0 B;  2PJ4 A;  2PE3 A;  3LAC A;  1CPS A;  4B13 A;  1KUY A;  1UWY A;  4RN7 A;  2B3V A;  2CNS A;  3PFO A;  2CNM A;  2ZEP A;  4MY3 A;  4DYO A;  1BPM A;  1ARM A;  2ATR A;  4MHY A;  4KOR A;  5A27 A;  2PJ2 A;  3IWG A;  4OLL A;  4E8O A;  2NYQ A;  3IWW A;  4KOT A;  1S60 A;  2V8D A;  5C82 A;  1VKC A;  2IMO A;  3FRM A;  3GUX A;  3FED A;  4Y49 B;  4ZYQ A;  3EY5 A;  5LRG A;  3B7I A;  4NGT A;  4MXU A;  2I3C A;  2O28 A;  4OC3 A;  3KL9 A;  1ELL P;  1Z8W A;  2PVW A;  4FD4 A;  4MFL A;  3EC4 A;  1YW6 A;  2PIZ A;  3B35 A;  3I1U A;  2CIJ A;  1CP6 A;  3S9M A;  3WC7 A;  3BI0 A;  4CAE A;  2PR1 A;  4ZX8 A;  1TF8 A;  3ISX A;  4F9U A;  3K9T A;  2F7V A;  2EO8 A;  1CP7 A;  1AMP A;  1VHS A;  4FD5 A;  3B3C A;  1Z8L A;  2VI7 A;  4HNW B;  1TIQ A;  2AFM A;  4M6H A;  3DR8 A;  3EXN A;  3NE7 A;  4K3N A;  1YRE A;  1B6B A;  2AE6 A;  4QVT A;  3SJX A;  1Z2L A;  3CXP A;  4R6T A;  1Q2C A;  3SI0 A;  4UF4 A; 
#chains in the Genus database with same CATH homology
 3GIU A;  1A2Z A;  1AUG A;  2EO8 A;  4HPS A;  4GXH A;  1Z8X A;  1IOF A;  1X12 A;  2EBJ A;  1Z8W A;  3RNZ A;  1IOI A;  3RO0 A;  3LAC A;  2DF5 A;  1IU8 A;  1Z8T A;  1X10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...