4B14A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 26)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 115
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b14A00
4C7HA 4B12A 4UFVA 4UCPA 3JTKA 2YNEA 2WSAA 3H5ZA 5AG7A 5G20A 4A32A 4B14A 4C2XA 2WUUA 4A30A 5G21A 4A2ZA 4B10A 4UFWA 4C2ZA 4CGNA 4CYOA 5A28A 3IWEA 4CGLA 2YNCC 5AG5A 5AG6A 3IU1A 5G22A 4A33A 4CGMA 2YNDA 4CYQA 4BBHA 4A95A 4CAEA 5A27A 5AGEA 2YNCA 5G1ZA 4UFXA 4CGPA 5AG4A 4CGOA 3IU2A 4B11A 4UCNA 4A31A 4C68A 4B13A 4UCMA 4C2YA 4CAFA 4CYNA 4CYPA 4C7IA
chains in the Genus database with same CATH superfamily
4JWPA 2OZUA 1FY7A 4QBJA 2ZEFA 2BEIA 4B14A 2AFSA 4BD9A 4HPSA 2GU2A 3CZXA 1ZG7A 2QECA 4XPDB 2B3UA 4M6HA 4KSAA 2PRBA 4KUBA 1IB1E 2FVGA 3B3SA 4CGLA 4F8ZA 2V77A 6CPAA 3FECA 3KQXA 4MI4A 1YW4A 1LOKA 3GLJA 3I9SA 3ZZIA 4ZY2A 4KSIA 2PJ6A 4CAVA 3EFAA 4UWIA 2OU2A 3WC6A 3RZAA 3B7IA 2Q43A 4H2KA 3QNVA 4ZYQA 1NSLA 2ZEHA 1F2OA 4MCPA 2FCKA 1IOFA 2FXFA 5CBMA 2CY2A 2ZOGA 3D68A 4JZ0A 4PXDA 4QB9A 3IGRA 3DNSA 4C7IA 1DE4C 2C1CA 2Q4ZA 2PVWA 4PXCA 2GE3A 5LRJA 1R3NA 4RI1A 3TX8A 2XEGA 8CPAA 5HXDA 4H6UA 1J4JA 3W91A 4A32A 2CXAA 1TKJA 4AG7A 2O53A 3V8IA 1OZPA 4A30A 3LWUA 2ZPAA 4CGNA 4UIBA 3KR4A 4XNHB 2AFXA 2Z0ZA 3BI1A 4NJRA 1GHEA 1CP6A 4IAVA 4A95A 3TOBA 3V38A 3TT2A 2VBQA 1YR0A 2DXQA 2CNMA 2VZZA 4RN7A 4CRYB 4CGPA 1S7NA 3CDXA 3GIUA 2B4DB 4E0AA 4Q38A 2CNSA 2HC9A 4X2TA 2NSMA 4NGMA 3SHPA 1A2ZA 4OC5A 2G9DA 4RUHA 3D7GA 4OADA 2Y0MA 1X12A 3CPAA 3FJUA 1YK3A 2B58A 2F5IA 3BJ8A 3ISZA 4JLYA 4M6IA 1BAVA 1I12A 1M1DA 4X5KA 2PJ0A 4MY0A 1P0HA 4CAWA 4AVBA 4KVME 2GREA 2F8HA 4F6AA 1L0CA 3FMCA 3PGPA 1ZO0A 4A39A 3LD2A 5JQ4A 2X7BA 1Z5RA 4YU9A 3NA6A 2B4BA 2PDOA 1YREA 1SQHA 2C6GA 2ZEGA 4MRIA 4ZGYB 4XPDC 1NE9A 2FE7A 2V8VA 1AYEA 3B3VA 3FB3A 3PB6X 4P4IA 1YQEA 3NH8A 1LFWA 2IMOA 3PB7X 3SI0A 2JDDA 4P4EA 4FBEA 4C68A 2AE6A 1CPSA 3E0KA 4CAFA 4CYNA 4CYPA 1QMUA 1YVKA 4F0YA 2JBJA 5IB0A 3WT4A 3TO7A 4XPKA 2DF5A 2BOAA 4IK2A 2EK9A 4DJLA 1TKFA 1MJAA 4ZX8A 4UBRA 5G21A 1VIXA 3SJFA 3QB8A 3TE4A 5HVFA 2I3CA 4IF5A 4KORA 4UEZA 5AG6A 1XJOA 4CGMA 4EFDA 1M44A 3BI0A 4IHMA 4UIAA 4PSXA 5DWNA 2B3VA 4CAEA 3KZWA 2P6GA 4PK3A 3H8GA 3V7ZA 4F9VA 2GLJA 4M6GA 4PXBA 5G1ZA 4MHNA 1ON0A 4CGOA 2O28A 1MJ9A 2VXKA 3R1KA 1Y0YA 4MHPA 4DUKA 1LRZA 1UFHA 3KR5A 1AUGA 3WC7A 5ISVA 2P6EA 3P2HA 4B5OA 4X3RA 2CNTA 3D2MA 4FD5A 1R57A 2ZXVA 3PB9X 1VKCA 5F49A 1Z2LA 2J8NA 5A28A 1LCPA 1YLOA 2QIRA 2ZELA 1KUXA 1JWQA 1KUYA 2OB0A 5G22A 2PJ7A 3G3SA 1R43A 2Q44A 4KS9A 4Q7AA 5F48A 4YGOA 5A27A 1H8LA 1I21A 2QYVA 3FH4A 4H6ZA 5IB9A 1RXTA 3JRUA 5DWMA 2EBJA 3VWEA 3CT9A 2VL1A 4OC1A 5C88A 2NMTA 1CPXA 4UCNA 4AVAA 1S60A 4YRHA 4B13A 1NSAA 3L2NA 2RFHA 2PC1A 3NH4A 4OAEA 5D8NA 2QJ8A 1XEBA 3KL9A 4PSWA 3ZJ0A 4BMHA 4QC6A 1XBUA 1LANA 2Z3OA 4UEFA 3SXNA 2WSAA 1QSTA 5K8OA 1TF9A 4MMOA 5KTAA 1N71A 3B3CA 3T90A 4A2ZA 4P4DA 2DPSA 1HEEA 3PRTA 1QSOA 1Z8WA 1IGBA 2FSRA 2OH1A 4Y49B 4ORFA 3TFYA 2BO9A 4MFQA 4NGNA 3H4QA 5F47A 4A38A 1YGHA 4JD6A 1LAPA 3PP9A 2J9AA 2JEVA 4LUAA 4X8IA 4B5PA 2Q4VA 3IJ3A 4UEEA 1FT7A 2C6PA 4OMEA 4KLWA 3LODA 2PJ9A 4HKFA 2DEAA 4LQGA 1XF8A 3KQZA 4I49A 3SJGA 2F7VA 3W6XA 5LYDA 2ANPA 3H5ZA 4R6TA 3TCVA 1CJWA 1RTQA 3R9FA 1CP7A 4UFWA 1XOVA 2BSWA 2GFQA 3IWEA 3TO6A 2HV2A 3GY9A 3TO9A 5AG5A 3N5FA 3D66A 3C26A 4YWYA 5K8NA 2PVVA 4FWUA 1BO4A 5THWA 3A9LA 4G1PA 1Z4RA 4L8AA 4MCSA 4OC0A 3TC8A 2PJCA 4TWEA 2P0WA 2QVPA 3FYNA 3F8KA 4NFRA 3FVLA 3IU2A 4R76A 1BPMA 2A4NA 1KWMA 2VEZA 3GB0A 3PEIA 4UCMA 1Y7EA 5JM6A 2PE3A 1U6MA 3GYAA 1Q7LA 2PRQA 1Z9UA 2OOTA 4CAXA 4II9A 2PR8A 1HDUA 1VHOA 3QAYA 4WJBA 2O4HA 5FVJA 1YMEA 4ZX9A 4R8FA 5I4MA 2XEFA 2WUUA 2PQ8A 5H84A 3FIXA 4KVOE 2IL4A 2P6FA 3NH5A 1IY7A 1EE3P 4MHYA 1Y9KA 2ZW6A 4KZTA 4ZY1A 3EXNA 1DTDA 3S9NA 3S6HA 1Z8TA 2YNCA 4FAIA 1M4DA 4EVYA 4U5YA 1B6BA 4Y49C 2D4OA 1FNOA 2KCWA 2V8DA 2ZEEA 3WABA 4A31A 5K8PA 1JQGA 3PB4X 2RB7A 2ARHA 1Q2CA 2PIYA 4HNWB 1AMPA 1F2PA 5CPAA 2AFOA 4E8OA 2AFWA 2B5GA 2V8GA 3HLPA 4C7HA 4PK2A 3D4UA 4R7MA 4NGSA 2AJ6A 1P4NA 1QSMA 2YNEA 3K9UA 4NXYA 5C82A 1IU8A 5KTCA 2EVNA 3S6KA 1IICA 4MXUA 3NE7A 4MHDA 1CG2A 1F57A 2PJBA 4JXRA 5F46A 2ZEPA 4NGQA 4R3LA 1V0CA 4OKOA 4A33A 2ZW4A 3SI1A 2Q0YA 2I00A 4QUSA 2REFA 2XEIA 4EMEA 1LAMA 1WWZA 3D8PA 3BXMA 2Z10A 1PU9A 2FL4A 2GIVA 4U9ZA 1XIXA 2R1IA 4K3NA 5F09A 4KOWA 1M4LA 2PJ5A 3KGQA 3PZJA 4KOUA 3IWGA 1NMTA 2VI7A 3RAMA 4B6ZA 2VQYA 3VH9A 1IOIA 4O23A 3R9GA 4AG9A 3WC5A 3FEDA 4FD7A 1IYLA 3F5BA 4NGPA 3B3WA 3BJ7A 3MN8A 1CM0A 2WYRA 3IFEA 4CYQA 1TIQA 4BBHA 4DYOA 3D7FA 4XPLA 3VWDA 4QVTA 4LX9A 4P44A 2ZEMA 4PQAA 3K9TA 4L89A 4R9MA 2OR4A 2FIAA 2Q7BA 2H5MA 3WR7A 2Z11A 3SJXA 1M4IA 3NFZA 7CPAA 4NSQA 4P4BA 3RO0A 2PJ2A 5J8FA 5H86A 1ZG8A 1KUVA 2C27A 1S7KA 2I79A 3DGVA 1XMBA 2PJ4A 3JVNA 1YLEA 4B12A 4CRZB 4UCPA 1ZG9A 3D7DA 3JTKA 3BHXA 4OIDA 3W6SA 1S3ZA 3IEHA 1QSRA 3IIBA 4AB7A 3IC1A 2PR1A 4UWJA 4MFZA 3DR8A 4OLLA 5ELYA 2JDCA 5EMIA 2YNCC 4RS2A 2Z3PA 4A37A 2IJZA 3KKWA 3KI9A 2CTBA 4UA3A 4KOTA 2JBKA 4NGTA 1YX0A 2G3AA 5AG4A 2Z3KA 1KZFA 2YGWA 3GKRA 1Q2DA 1XE4A 3CPXA 2AFMA 1K4JA 3NE8A 4KVXA 4YFJA 2ABZA 3BLNA 3CXQA 3S6GA 1XMTA 3G8WA 3SI2A 4CPAA 2JLMA 3LACA 2HB6A 3H8EA 4HNXB 2AFZA 3CXPA 2BCOA 4FUUA 2K5TA 4P4FA 1CBXA 2Z3MA 3FXTA 5LRGA 4A94A 3FEEA 4NCZA 5I0CA 4NF1A 3ISXA 4FD4A 2J8RA 5CNPA 2JEWA 4B5PB 5J8CA 2PCUA 3SXOA 3N7ZA 4PV6A 1TXRA 1VHSA 2HUZA 1I1DA 2YNDA 3D67A 4ZI6A 3IO1A 4P10A 1BPNA 2G3TA 3H8FA 1MJBA 2Q04A 1M4GA 4MBUA 4F9UA 4K30A 4KOSA 1PUAA 3B35A 2BL1A 4Z65A 2BUEA 2FIWA 2FT0A 2PJ8A 3FF3A 2OZGA 1GYTA 3PFEA 3FX6A 4J3GA 3VARA 5JGFA 3S9LA 4FD6A 4NEXA 2DPTA 4TNUA 1TKHA 2B4DA 1TF8A 2R8VA 1Z8XA 3T8WA 2AFUA 4R87A 1Y7RA 3PBEA 5JPHA 4IUSA 4B10A 3K2KA 2CIJA 3DSBA 1CX8A 3RBUA 4WWVA 2PIZA 4OIWA 4OC3A 1YW6A 5LYIA 4MJ8A 5EBVA 5HVGA 4OC4A 3KHZA 4MFKA 4CS0B 4MCQA 4DNCA 3GUXA 5LYFA 2ODFA 2HQYA 2VZYA 4B11A 5J1QA 1S5KA 2GANA 4R57A 4H89A 2Q4YA 2CF4A 3KASA 1HDQA 3R9EA 4P4JA 4PPZA 4NGRA 4M85A 1BOBA 5D29A 1MK4A 1S7FA 3I1UA 3PB8X 4GXHA 2D4PA 3TOAA 3TTHA 2FS5A 4GS4A 1ZLIA 3RYOA 2J8MA 4OC2A 2CTCA 4Q36A 5AG7A 4BINA 5G20A 2ZW7A 1WK4A 4GM5A 1IIDA 1Y9WA 1ARLA 1ZLHA 3HUVA 3JUWA 3KHXA 4C2ZA 5GCNA 1XRYA 3DDDA 2G0BA 4E2AA 1BLLE 4MFPA 1IYKA 4ZBGA 2EWBA 1PCAA 1Q2YA 2B5GB 4F0XA 2C6CA 3EC4A 4NJQA 4U9YA 2ZW5A 5E96A 5K8MA 3VATA 4KOVA 3I3GA 1ELLP 3MRUA 5HH1A 3D2PA 3IWWA 4OP4A 1B87A 1VHEA 3RNZA 5BWAB 1OBRA 1QQ9A 3P2FA 1VGYA 4P45A 5IV0A 4W9YA 4KLVA 1X10A 4M3SA 1Z4EA 2R7HA 2GLFA 2RC4A 2ZOFA 3PFOA 2Q51A 3DR6A 4UFVA 3S9MA 3SJEA 5LYLA 4PXEA 2PSWA 2OZHA 5HMNA 3F0AA 4CYOA 1ELMP 3T9YA 2WPXA 2ZEDA 3PBBA 3IU1A 1PYTB 4LQ6A 4MCRA 4AXVA 4XNHC 2ATRA 3EY5A 5AGEA 3FNCA 5IX3A 4UFXA 4P6YA 2EK8A 4UF4A 2Z3LA 1YSJA 1QSNA 4MY3A 2PJ3A 5HVHA 1XFOA 3LMSA 1UWYA 4JJXA 2EO8A 1RO5A 4KUAA 4C2YA 2ZENA 3B2YA 4MFJA 2R98A 3D7HA 4JYWA 1ARMA 2PJAA 1Y0RA 5KTDA 3D3SA 3B8GA 4C2XA 4ZY0A 2Q7SA 4R3KA 1YVOA 3R95A 3B3TA 3CXSA 3FBUA 4KOXA 5LRKA 5DS0A 4ONWA 3DLJA 2QMLA 2WPWA 3QAHA 4KOYA 3R96A 5JH9A 4JXQA 2WZNA 3UY5A 3EO4A 1S7LA 1Z8LA 3FRMA 4AVCA 2POKA 5EC4A 2ZEOA 4MHZA 2V8HA 2IQ6A 2NYQA 3OWCA 2XEJA 3MGDA 4KSFA 4ONUA 2REEA 2EUIA 2Z3NA 4HNYB 3S6FA 2PJ1A 4EWTA 4MFLA
chains in the Genus database with same CATH topology
4JWPA 2OZUA 1FY7A 4QBJA 2BEIA 4B14A 2QECA 4XPDB 2B3UA 4KSAA 2PRBA 4KUBA 1IB1E 4CGLA 4MI4A 3I9SA 3ZZIA 4CAVA 3EFAA 4UWIA 2OU2A 1NSLA 2FCKA 2FXFA 2CY2A 4QB9A 3IGRA 3DNSA 4C7IA 2GE3A 4RI1A 4H6UA 1J4JA 3W91A 4A32A 2CXAA 4AG7A 3V8IA 4A30A 1OZPA 4CGNA 2ZPAA 4XNHB 2Z0ZA 1GHEA 4A95A 3TOBA 3TT2A 2VBQA 1YR0A 2DXQA 2CNMA 2VZZA 4CRYB 4CGPA 1S7NA 4E0AA 2B4DB 4Q38A 2CNSA 3SHPA 4OADA 2Y0MA 1YK3A 2B58A 2F5IA 3BJ8A 4JLYA 4X5KA 1I12A 1M1DA 4MY0A 4CAWA 1P0HA 4AVBA 4KVME 4F6AA 1L0CA 3PGPA 1ZO0A 3LD2A 5JQ4A 2X7BA 2B4BA 2PDOA 1YREA 1SQHA 4ZGYB 4XPDC 1NE9A 2FE7A 3FB3A 2JDDA 4C68A 2AE6A 3E0KA 4CAFA 4CYNA 4CYPA 1YVKA 4F0YA 5IB0A 3TO7A 4XPKA 1MJAA 4UBRA 5G21A 3TE4A 3QB8A 4IF5A 4KORA 5AG6A 4CGMA 1M44A 4PSXA 5DWNA 2B3VA 4CAEA 2P6GA 4PK3A 5G1ZA 1ON0A 4CGOA 2O28A 1MJ9A 2VXKA 3R1KA 1LRZA 1UFHA 5ISVA 2P6EA 3P2HA 4B5OA 2CNTA 3D2MA 4FD5A 1R57A 2ZXVA 1VKCA 5F49A 2J8NA 5A28A 2QIRA 1KUXA 1KUYA 2OB0A 5G22A 3G3SA 2Q44A 4KS9A 5F48A 4YGOA 5A27A 1I21A 4H6ZA 1RXTA 3VWEA 5DWMA 5C88A 2NMTA 4UCNA 4AVAA 1S60A 4YRHA 4B13A 4OAEA 2PC1A 3ZJ0A 1XEBA 4PSWA 4BMHA 4QC6A 2Z3OA 3SXNA 2WSAA 1QSTA 5KTAA 1N71A 3T90A 4A2ZA 2DPSA 1QSOA 2FSRA 2OH1A 4Y49B 3TFYA 4ORFA 4MFQA 3H4QA 5F47A 1YGHA 4JD6A 4LUAA 3PP9A 2JEVA 4B5PA 2Q4VA 4KLWA 3LODA 4HKFA 1XF8A 4I49A 3W6XA 3H5ZA 3TCVA 1CJWA 3R9FA 4UFWA 2BSWA 3IWEA 3TO6A 2HV2A 3GY9A 3TO9A 5AG5A 3C26A 1BO4A 3A9LA 4L8AA 1Z4RA 2P0WA 3FYNA 3F8KA 3IU2A 2A4NA 2VEZA 4UCMA 1U6MA 3GYAA 1Z9UA 4CAXA 4II9A 2PR8A 5FVJA 2WUUA 2PQ8A 5H84A 3FIXA 4KVOE 2IL4A 2P6FA 1Y9KA 2ZW6A 4KZTA 3EXNA 3S6HA 2YNCA 1M4DA 4EVYA 4U5YA 1B6BA 4Y49C 2D4OA 2KCWA 4A31A 2ARHA 1Q2CA 4HNWB 4E8OA 2B5GA 4C7HA 4PK2A 2AJ6A 1P4NA 1QSMA 2YNEA 3K9UA 4NXYA 5C82A 5KTCA 2EVNA 3S6KA 1IICA 3NE7A 4MHDA 4JXRA 5F46A 4R3LA 1V0CA 4A33A 2ZW4A 2Q0YA 2I00A 4QUSA 2REFA 1WWZA 3D8PA 2Z10A 1PU9A 2FL4A 2GIVA 4U9ZA 1XIXA 2R1IA 4KOWA 3PZJA 4KOUA 3IWGA 1NMTA 2VI7A 2VQYA 3R9GA 4AG9A 4FD7A 1IYLA 3F5BA 3BJ7A 1CM0A 4CYQA 1TIQA 4BBHA 4XPLA 3VWDA 4QVTA 4LX9A 4L89A 4R9MA 2FIAA 2Q7BA 2H5MA 3WR7A 2Z11A 1M4IA 4NSQA 5J8FA 5H86A 1KUVA 2C27A 1S7KA 2I79A 4B12A 4CRZB 3JVNA 1YLEA 4UCPA 3JTKA 3W6SA 1S3ZA 1QSRA 4AB7A 2PR1A 4UWJA 4MFZA 3DR8A 4OLLA 2JDCA 2YNCC 4RS2A 2Z3PA 3KKWA 4UA3A 4KOTA 1YX0A 2G3AA 5AG4A 2Z3KA 1KZFA 2YGWA 3GKRA 1Q2DA 1XE4A 1K4JA 4KVXA 4YFJA 3BLNA 3CXQA 3S6GA 1XMTA 3G8WA 2JLMA 4HNXB 3CXPA 2K5TA 2Z3MA 3FXTA 4NCZA 5I0CA 4NF1A 4FD4A 5CNPA 2J8RA 4B5PB 5J8CA 3SXOA 3N7ZA 4PV6A 1VHSA 2HUZA 1I1DA 2YNDA 2G3TA 1MJBA 2Q04A 1M4GA 4MBUA 4K30A 4KOSA 1PUAA 2BL1A 2BUEA 2FIWA 2FT0A 2OZGA 4J3GA 4FD6A 4NEXA 2DPTA 2B4DA 2R8VA 4R87A 1Y7RA 5JPHA 4IUSA 4B10A 3DSBA 4MJ8A 5EBVA 4MFKA 4CS0B 4DNCA 2HQYA 2VZYA 4B11A 1S5KA 2GANA 4R57A 4H89A 2Q4YA 3R9EA 4M85A 1BOBA 1MK4A 1S7FA 3TOAA 3TTHA 2D4PA 2FS5A 4GS4A 3RYOA 2J8MA 4Q36A 5AG7A 5G20A 2ZW7A 1WK4A 1IIDA 1Y9WA 3JUWA 4C2ZA 5GCNA 3DDDA 2G0BA 4E2AA 4MFPA 1IYKA 4ZBGA 1Q2YA 2B5GB 4F0XA 3EC4A 4U9YA 2ZW5A 5E96A 4KOVA 3I3GA 5HH1A 3D2PA 1B87A 5IV0A 5BWAB 3P2FA 4KLVA 4M3SA 1Z4EA 2R7HA 2RC4A 3DR6A 4UFVA 2PSWA 2OZHA 5HMNA 3F0AA 4CYOA 3T9YA 2WPXA 3IU1A 4XNHC 2ATRA 3EY5A 5AGEA 3FNCA 5IX3A 4UFXA 2Z3LA 4MY3A 1QSNA 4JJXA 1RO5A 4KUAA 4C2YA 4MFJA 2R98A 5KTDA 3D3SA 3B8GA 4C2XA 4R3KA 1YVOA 3R95A 3CXSA 3FBUA 4KOXA 2QMLA 2WPWA 3QAHA 4KOYA 3R96A 4JXQA 3UY5A 3EO4A 1S7LA 3FRMA 4AVCA 5EC4A 3OWCA 4ONUA 3MGDA 4KSFA 2REEA 2EUIA 2Z3NA 4HNYB 3S6FA 4MFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7H A;  4B12 A;  4UFV A;  4UCP A;  3JTK A;  2YNE A;  2WSA A;  3H5Z A;  5AG7 A;  5G20 A;  4A32 A;  4B14 A;  4C2X A;  2WUU A;  4A30 A;  5G21 A;  4A2Z A;  4B10 A;  4UFW A;  4C2Z A;  4CGN A;  4CYO A;  5A28 A;  3IWE A;  4CGL A;  2YNC C;  5AG5 A;  5AG6 A;  3IU1 A;  5G22 A;  4A33 A;  4CGM A;  2YND A;  4CYQ A;  4BBH A;  4A95 A;  4CAE A;  5A27 A;  5AGE A;  2YNC A;  5G1Z A;  4UFX A;  4CGP A;  5AG4 A;  4CGO A;  3IU2 A;  4B11 A;  4UCN A;  4A31 A;  4C68 A;  4B13 A;  4UCM A;  4C2Y A;  4CAF A;  4CYN A;  4CYP A;  4C7I A; 
#chains in the Genus database with same CATH topology
 4JWP A;  2OZU A;  1FY7 A;  4QBJ A;  2ZEF A;  2BEI A;  4B14 A;  2AFS A;  4BD9 A;  4HPS A;  2GU2 A;  3CZX A;  1ZG7 A;  2QEC A;  4XPD B;  2B3U A;  4M6H A;  4KSA A;  2PRB A;  4KUB A;  1IB1 E;  2FVG A;  3B3S A;  4CGL A;  4F8Z A;  2V77 A;  6CPA A;  3FEC A;  3KQX A;  4MI4 A;  1YW4 A;  1LOK A;  3GLJ A;  3I9S A;  3ZZI A;  4ZY2 A;  4KSI A;  2PJ6 A;  4CAV A;  3EFA A;  4UWI A;  2OU2 A;  3WC6 A;  3RZA A;  3B7I A;  2Q43 A;  4H2K A;  3QNV A;  4ZYQ A;  1NSL A;  2ZEH A;  1F2O A;  4MCP A;  2FCK A;  1IOF A;  2FXF A;  5CBM A;  2CY2 A;  2ZOG A;  3D68 A;  4JZ0 A;  4PXD A;  4QB9 A;  3IGR A;  3DNS A;  4C7I A;  1DE4 C;  2C1C A;  2Q4Z A;  2PVW A;  4PXC A;  2GE3 A;  5LRJ A;  1R3N A;  4RI1 A;  3TX8 A;  2XEG A;  8CPA A;  5HXD A;  4H6U A;  1J4J A;  3W91 A;  4A32 A;  2CXA A;  1TKJ A;  4AG7 A;  2O53 A;  3V8I A;  1OZP A;  4A30 A;  3LWU A;  2ZPA A;  4CGN A;  4UIB A;  3KR4 A;  4XNH B;  2AFX A;  2Z0Z A;  3BI1 A;  4NJR A;  1GHE A;  1CP6 A;  4IAV A;  4A95 A;  3TOB A;  3V38 A;  3TT2 A;  2VBQ A;  1YR0 A;  2DXQ A;  2CNM A;  2VZZ A;  4RN7 A;  4CRY B;  4CGP A;  1S7N A;  3CDX A;  3GIU A;  2B4D B;  4E0A A;  4Q38 A;  2CNS A;  2HC9 A;  4X2T A;  2NSM A;  4NGM A;  3SHP A;  1A2Z A;  4OC5 A;  2G9D A;  4RUH A;  3D7G A;  4OAD A;  2Y0M A;  1X12 A;  3CPA A;  3FJU A;  1YK3 A;  2B58 A;  2F5I A;  3BJ8 A;  3ISZ A;  4JLY A;  4M6I A;  1BAV A;  1I12 A;  1M1D A;  4X5K A;  2PJ0 A;  4MY0 A;  1P0H A;  4CAW A;  4AVB A;  4KVM E;  2GRE A;  2F8H A;  4F6A A;  1L0C A;  3FMC A;  3PGP A;  1ZO0 A;  4A39 A;  3LD2 A;  5JQ4 A;  2X7B A;  1Z5R A;  4YU9 A;  3NA6 A;  2B4B A;  2PDO A;  1YRE A;  1SQH A;  2C6G A;  2ZEG A;  4MRI A;  4ZGY B;  4XPD C;  1NE9 A;  2FE7 A;  2V8V A;  1AYE A;  3B3V A;  3FB3 A;  3PB6 X;  4P4I A;  1YQE A;  3NH8 A;  1LFW A;  2IMO A;  3PB7 X;  3SI0 A;  2JDD A;  4P4E A;  4FBE A;  4C68 A;  2AE6 A;  1CPS A;  3E0K A;  4CAF A;  4CYN A;  4CYP A;  1QMU A;  1YVK A;  4F0Y A;  2JBJ A;  5IB0 A;  3WT4 A;  3TO7 A;  4XPK A;  2DF5 A;  2BOA A;  4IK2 A;  2EK9 A;  4DJL A;  1TKF A;  1MJA A;  4ZX8 A;  4UBR A;  5G21 A;  1VIX A;  3SJF A;  3QB8 A;  3TE4 A;  5HVF A;  2I3C A;  4IF5 A;  4KOR A;  4UEZ A;  5AG6 A;  1XJO A;  4CGM A;  4EFD A;  1M44 A;  3BI0 A;  4IHM A;  4UIA A;  4PSX A;  5DWN A;  2B3V A;  4CAE A;  3KZW A;  2P6G A;  4PK3 A;  3H8G A;  3V7Z A;  4F9V A;  2GLJ A;  4M6G A;  4PXB A;  5G1Z A;  4MHN A;  1ON0 A;  4CGO A;  2O28 A;  1MJ9 A;  2VXK A;  3R1K A;  1Y0Y A;  4MHP A;  4DUK A;  1LRZ A;  1UFH A;  3KR5 A;  1AUG A;  3WC7 A;  5ISV A;  2P6E A;  3P2H A;  4B5O A;  4X3R A;  2CNT A;  3D2M A;  4FD5 A;  1R57 A;  2ZXV A;  3PB9 X;  1VKC A;  5F49 A;  1Z2L A;  2J8N A;  5A28 A;  1LCP A;  1YLO A;  2QIR A;  2ZEL A;  1KUX A;  1JWQ A;  1KUY A;  2OB0 A;  5G22 A;  2PJ7 A;  3G3S A;  1R43 A;  2Q44 A;  4KS9 A;  4Q7A A;  5F48 A;  4YGO A;  5A27 A;  1H8L A;  1I21 A;  2QYV A;  3FH4 A;  4H6Z A;  5IB9 A;  1RXT A;  3JRU A;  5DWM A;  2EBJ A;  3VWE A;  3CT9 A;  2VL1 A;  4OC1 A;  5C88 A;  2NMT A;  1CPX A;  4UCN A;  4AVA A;  1S60 A;  4YRH A;  4B13 A;  1NSA A;  3L2N A;  2RFH A;  2PC1 A;  3NH4 A;  4OAE A;  5D8N A;  2QJ8 A;  1XEB A;  3KL9 A;  4PSW A;  3ZJ0 A;  4BMH A;  4QC6 A;  1XBU A;  1LAN A;  2Z3O A;  4UEF A;  3SXN A;  2WSA A;  1QST A;  5K8O A;  1TF9 A;  4MMO A;  5KTA A;  1N71 A;  3B3C A;  3T90 A;  4A2Z A;  4P4D A;  2DPS A;  1HEE A;  3PRT A;  1QSO A;  1Z8W A;  1IGB A;  2FSR A;  2OH1 A;  4Y49 B;  4ORF A;  3TFY A;  2BO9 A;  4MFQ A;  4NGN A;  3H4Q A;  5F47 A;  4A38 A;  1YGH A;  4JD6 A;  1LAP A;  3PP9 A;  2J9A A;  2JEV A;  4LUA A;  4X8I A;  4B5P A;  2Q4V A;  3IJ3 A;  4UEE A;  1FT7 A;  2C6P A;  4OME A;  4KLW A;  3LOD A;  2PJ9 A;  4HKF A;  2DEA A;  4LQG A;  1XF8 A;  3KQZ A;  4I49 A;  3SJG A;  2F7V A;  3W6X A;  5LYD A;  2ANP A;  3H5Z A;  4R6T A;  3TCV A;  1CJW A;  1RTQ A;  3R9F A;  1CP7 A;  4UFW A;  1XOV A;  2BSW A;  2GFQ A;  3IWE A;  3TO6 A;  2HV2 A;  3GY9 A;  3TO9 A;  5AG5 A;  3N5F A;  3D66 A;  3C26 A;  4YWY A;  5K8N A;  2PVV A;  4FWU A;  1BO4 A;  5THW A;  3A9L A;  4G1P A;  1Z4R A;  4L8A A;  4MCS A;  4OC0 A;  3TC8 A;  2PJC A;  4TWE A;  2P0W A;  2QVP A;  3FYN A;  3F8K A;  4NFR A;  3FVL A;  3IU2 A;  4R76 A;  1BPM A;  2A4N A;  1KWM A;  2VEZ A;  3GB0 A;  3PEI A;  4UCM A;  1Y7E A;  5JM6 A;  2PE3 A;  1U6M A;  3GYA A;  1Q7L A;  2PRQ A;  1Z9U A;  2OOT A;  4CAX A;  4II9 A;  2PR8 A;  1HDU A;  1VHO A;  3QAY A;  4WJB A;  2O4H A;  5FVJ A;  1YME A;  4ZX9 A;  4R8F A;  5I4M A;  2XEF A;  2WUU A;  2PQ8 A;  5H84 A;  3FIX A;  4KVO E;  2IL4 A;  2P6F A;  3NH5 A;  1IY7 A;  1EE3 P;  4MHY A;  1Y9K A;  2ZW6 A;  4KZT A;  4ZY1 A;  3EXN A;  1DTD A;  3S9N A;  3S6H A;  1Z8T A;  2YNC A;  4FAI A;  1M4D A;  4EVY A;  4U5Y A;  1B6B A;  4Y49 C;  2D4O A;  1FNO A;  2KCW A;  2V8D A;  2ZEE A;  3WAB A;  4A31 A;  5K8P A;  1JQG A;  3PB4 X;  2RB7 A;  2ARH A;  1Q2C A;  2PIY A;  4HNW B;  1AMP A;  1F2P A;  5CPA A;  2AFO A;  4E8O A;  2AFW A;  2B5G A;  2V8G A;  3HLP A;  4C7H A;  4PK2 A;  3D4U A;  4R7M A;  4NGS A;  2AJ6 A;  1P4N A;  1QSM A;  2YNE A;  3K9U A;  4NXY A;  5C82 A;  1IU8 A;  5KTC A;  2EVN A;  3S6K A;  1IIC A;  4MXU A;  3NE7 A;  4MHD A;  1CG2 A;  1F57 A;  2PJB A;  4JXR A;  5F46 A;  2ZEP A;  4NGQ A;  4R3L A;  1V0C A;  4OKO A;  4A33 A;  2ZW4 A;  3SI1 A;  2Q0Y A;  2I00 A;  4QUS A;  2REF A;  2XEI A;  4EME A;  1LAM A;  1WWZ A;  3D8P A;  3BXM A;  2Z10 A;  1PU9 A;  2FL4 A;  2GIV A;  4U9Z A;  1XIX A;  2R1I A;  4K3N A;  5F09 A;  4KOW A;  1M4L A;  2PJ5 A;  3KGQ A;  3PZJ A;  4KOU A;  3IWG A;  1NMT A;  2VI7 A;  3RAM A;  4B6Z A;  2VQY A;  3VH9 A;  1IOI A;  4O23 A;  3R9G A;  4AG9 A;  3WC5 A;  3FED A;  4FD7 A;  1IYL A;  3F5B A;  4NGP A;  3B3W A;  3BJ7 A;  3MN8 A;  1CM0 A;  2WYR A;  3IFE A;  4CYQ A;  1TIQ A;  4BBH A;  4DYO A;  3D7F A;  4XPL A;  3VWD A;  4QVT A;  4LX9 A;  4P44 A;  2ZEM A;  4PQA A;  3K9T A;  4L89 A;  4R9M A;  2OR4 A;  2FIA A;  2Q7B A;  2H5M A;  3WR7 A;  2Z11 A;  3SJX A;  1M4I A;  3NFZ A;  7CPA A;  4NSQ A;  4P4B A;  3RO0 A;  2PJ2 A;  5J8F A;  5H86 A;  1ZG8 A;  1KUV A;  2C27 A;  1S7K A;  2I79 A;  3DGV A;  1XMB A;  2PJ4 A;  3JVN A;  1YLE A;  4B12 A;  4CRZ B;  4UCP A;  1ZG9 A;  3D7D A;  3JTK A;  3BHX A;  4OID A;  3W6S A;  1S3Z A;  3IEH A;  1QSR A;  3IIB A;  4AB7 A;  3IC1 A;  2PR1 A;  4UWJ A;  4MFZ A;  3DR8 A;  4OLL A;  5ELY A;  2JDC A;  5EMI A;  2YNC C;  4RS2 A;  2Z3P A;  4A37 A;  2IJZ A;  3KKW A;  3KI9 A;  2CTB A;  4UA3 A;  4KOT A;  2JBK A;  4NGT A;  1YX0 A;  2G3A A;  5AG4 A;  2Z3K A;  1KZF A;  2YGW A;  3GKR A;  1Q2D A;  1XE4 A;  3CPX A;  2AFM A;  1K4J A;  3NE8 A;  4KVX A;  4YFJ A;  2ABZ A;  3BLN A;  3CXQ A;  3S6G A;  1XMT A;  3G8W A;  3SI2 A;  4CPA A;  2JLM A;  3LAC A;  2HB6 A;  3H8E A;  4HNX B;  2AFZ A;  3CXP A;  2BCO A;  4FUU A;  2K5T A;  4P4F A;  1CBX A;  2Z3M A;  3FXT A;  5LRG A;  4A94 A;  3FEE A;  4NCZ A;  5I0C A;  4NF1 A;  3ISX A;  4FD4 A;  2J8R A;  5CNP A;  2JEW A;  4B5P B;  5J8C A;  2PCU A;  3SXO A;  3N7Z A;  4PV6 A;  1TXR A;  1VHS A;  2HUZ A;  1I1D A;  2YND A;  3D67 A;  4ZI6 A;  3IO1 A;  4P10 A;  1BPN A;  2G3T A;  3H8F A;  1MJB A;  2Q04 A;  1M4G A;  4MBU A;  4F9U A;  4K30 A;  4KOS A;  1PUA A;  3B35 A;  2BL1 A;  4Z65 A;  2BUE A;  2FIW A;  2FT0 A;  2PJ8 A;  3FF3 A;  2OZG A;  1GYT A;  3PFE A;  3FX6 A;  4J3G A;  3VAR A;  5JGF A;  3S9L A;  4FD6 A;  4NEX A;  2DPT A;  4TNU A;  1TKH A;  2B4D A;  1TF8 A;  2R8V A;  1Z8X A;  3T8W A;  2AFU A;  4R87 A;  1Y7R A;  3PBE A;  5JPH A;  4IUS A;  4B10 A;  3K2K A;  2CIJ A;  3DSB A;  1CX8 A;  3RBU A;  4WWV A;  2PIZ A;  4OIW A;  4OC3 A;  1YW6 A;  5LYI A;  4MJ8 A;  5EBV A;  5HVG A;  4OC4 A;  3KHZ A;  4MFK A;  4CS0 B;  4MCQ A;  4DNC A;  3GUX A;  5LYF A;  2ODF A;  2HQY A;  2VZY A;  4B11 A;  5J1Q A;  1S5K A;  2GAN A;  4R57 A;  4H89 A;  2Q4Y A;  2CF4 A;  3KAS A;  1HDQ A;  3R9E A;  4P4J A;  4PPZ A;  4NGR A;  4M85 A;  1BOB A;  5D29 A;  1MK4 A;  1S7F A;  3I1U A;  3PB8 X;  4GXH A;  2D4P A;  3TOA A;  3TTH A;  2FS5 A;  4GS4 A;  1ZLI A;  3RYO A;  2J8M A;  4OC2 A;  2CTC A;  4Q36 A;  5AG7 A;  4BIN A;  5G20 A;  2ZW7 A;  1WK4 A;  4GM5 A;  1IID A;  1Y9W A;  1ARL A;  1ZLH A;  3HUV A;  3JUW A;  3KHX A;  4C2Z A;  5GCN A;  1XRY A;  3DDD A;  2G0B A;  4E2A A;  1BLL E;  4MFP A;  1IYK A;  4ZBG A;  2EWB A;  1PCA A;  1Q2Y A;  2B5G B;  4F0X A;  2C6C A;  3EC4 A;  4NJQ A;  4U9Y A;  2ZW5 A;  5E96 A;  5K8M A;  3VAT A;  4KOV A;  3I3G A;  1ELL P;  3MRU A;  5HH1 A;  3D2P A;  3IWW A;  4OP4 A;  1B87 A;  1VHE A;  3RNZ A;  5BWA B;  1OBR A;  1QQ9 A;  3P2F A;  1VGY A;  4P45 A;  5IV0 A;  4W9Y A;  4KLV A;  1X10 A;  4M3S A;  1Z4E A;  2R7H A;  2GLF A;  2RC4 A;  2ZOF A;  3PFO A;  2Q51 A;  3DR6 A;  4UFV A;  3S9M A;  3SJE A;  5LYL A;  4PXE A;  2PSW A;  2OZH A;  5HMN A;  3F0A A;  4CYO A;  1ELM P;  3T9Y A;  2WPX A;  2ZED A;  3PBB A;  3IU1 A;  1PYT B;  4LQ6 A;  4MCR A;  4AXV A;  4XNH C;  2ATR A;  3EY5 A;  5AGE A;  3FNC A;  5IX3 A;  4UFX A;  4P6Y A;  2EK8 A;  4UF4 A;  2Z3L A;  1YSJ A;  1QSN A;  4MY3 A;  2PJ3 A;  5HVH A;  1XFO A;  3LMS A;  1UWY A;  4JJX A;  2EO8 A;  1RO5 A;  4KUA A;  4C2Y A;  2ZEN A;  3B2Y A;  4MFJ A;  2R98 A;  3D7H A;  4JYW A;  1ARM A;  2PJA A;  1Y0R A;  5KTD A;  3D3S A;  3B8G A;  4C2X A;  4ZY0 A;  2Q7S A;  4R3K A;  1YVO A;  3R95 A;  3B3T A;  3CXS A;  3FBU A;  4KOX A;  5LRK A;  5DS0 A;  4ONW A;  3DLJ A;  2QML A;  2WPW A;  3QAH A;  4KOY A;  3R96 A;  5JH9 A;  4JXQ A;  2WZN A;  3UY5 A;  3EO4 A;  1S7L A;  1Z8L A;  3FRM A;  4AVC A;  2POK A;  5EC4 A;  2ZEO A;  4MHZ A;  2V8H A;  2IQ6 A;  2NYQ A;  3OWC A;  2XEJ A;  3MGD A;  4KSF A;  4ONU A;  2REE A;  2EUI A;  2Z3N A;  4HNY B;  3S6F A;  2PJ1 A;  4EWT A;  4MFL A; 
#chains in the Genus database with same CATH homology
 4JWP A;  2OZU A;  1FY7 A;  4QBJ A;  2BEI A;  4B14 A;  2QEC A;  4XPD B;  2B3U A;  4KSA A;  2PRB A;  4KUB A;  1IB1 E;  4CGL A;  4MI4 A;  3I9S A;  3ZZI A;  4CAV A;  3EFA A;  4UWI A;  2OU2 A;  1NSL A;  2FCK A;  2FXF A;  2CY2 A;  4QB9 A;  3IGR A;  3DNS A;  4C7I A;  2GE3 A;  4RI1 A;  4H6U A;  1J4J A;  3W91 A;  4A32 A;  2CXA A;  4AG7 A;  3V8I A;  4A30 A;  1OZP A;  4CGN A;  2ZPA A;  4XNH B;  2Z0Z A;  1GHE A;  4A95 A;  3TOB A;  3TT2 A;  2VBQ A;  1YR0 A;  2DXQ A;  2CNM A;  2VZZ A;  4CRY B;  4CGP A;  1S7N A;  4E0A A;  2B4D B;  4Q38 A;  2CNS A;  3SHP A;  4OAD A;  2Y0M A;  1YK3 A;  2B58 A;  2F5I A;  3BJ8 A;  4JLY A;  4X5K A;  1I12 A;  1M1D A;  4MY0 A;  4CAW A;  1P0H A;  4AVB A;  4KVM E;  4F6A A;  1L0C A;  3PGP A;  1ZO0 A;  3LD2 A;  5JQ4 A;  2X7B A;  2B4B A;  2PDO A;  1YRE A;  1SQH A;  4ZGY B;  4XPD C;  1NE9 A;  2FE7 A;  3FB3 A;  2JDD A;  4C68 A;  2AE6 A;  3E0K A;  4CAF A;  4CYN A;  4CYP A;  1YVK A;  4F0Y A;  5IB0 A;  3TO7 A;  4XPK A;  1MJA A;  4UBR A;  5G21 A;  3TE4 A;  3QB8 A;  4IF5 A;  4KOR A;  5AG6 A;  4CGM A;  1M44 A;  4PSX A;  5DWN A;  2B3V A;  4CAE A;  2P6G A;  4PK3 A;  5G1Z A;  1ON0 A;  4CGO A;  2O28 A;  1MJ9 A;  2VXK A;  3R1K A;  1LRZ A;  1UFH A;  5ISV A;  2P6E A;  3P2H A;  4B5O A;  2CNT A;  3D2M A;  4FD5 A;  1R57 A;  2ZXV A;  1VKC A;  5F49 A;  2J8N A;  5A28 A;  2QIR A;  1KUX A;  1KUY A;  2OB0 A;  5G22 A;  3G3S A;  2Q44 A;  4KS9 A;  5F48 A;  4YGO A;  5A27 A;  1I21 A;  4H6Z A;  1RXT A;  3VWE A;  5DWM A;  5C88 A;  2NMT A;  4UCN A;  4AVA A;  1S60 A;  4YRH A;  4B13 A;  4OAE A;  2PC1 A;  3ZJ0 A;  1XEB A;  4PSW A;  4BMH A;  4QC6 A;  2Z3O A;  3SXN A;  2WSA A;  1QST A;  5KTA A;  1N71 A;  3T90 A;  4A2Z A;  2DPS A;  1QSO A;  2FSR A;  2OH1 A;  4Y49 B;  3TFY A;  4ORF A;  4MFQ A;  3H4Q A;  5F47 A;  1YGH A;  4JD6 A;  4LUA A;  3PP9 A;  2JEV A;  4B5P A;  2Q4V A;  4KLW A;  3LOD A;  4HKF A;  1XF8 A;  4I49 A;  3W6X A;  3H5Z A;  3TCV A;  1CJW A;  3R9F A;  4UFW A;  2BSW A;  3IWE A;  3TO6 A;  2HV2 A;  3GY9 A;  3TO9 A;  5AG5 A;  3C26 A;  1BO4 A;  3A9L A;  4L8A A;  1Z4R A;  2P0W A;  3FYN A;  3F8K A;  3IU2 A;  2A4N A;  2VEZ A;  4UCM A;  1U6M A;  3GYA A;  1Z9U A;  4CAX A;  4II9 A;  2PR8 A;  5FVJ A;  2WUU A;  2PQ8 A;  5H84 A;  3FIX A;  4KVO E;  2IL4 A;  2P6F A;  1Y9K A;  2ZW6 A;  4KZT A;  3EXN A;  3S6H A;  2YNC A;  1M4D A;  4EVY A;  4U5Y A;  1B6B A;  4Y49 C;  2D4O A;  2KCW A;  4A31 A;  2ARH A;  1Q2C A;  4HNW B;  4E8O A;  2B5G A;  4C7H A;  4PK2 A;  2AJ6 A;  1P4N A;  1QSM A;  2YNE A;  3K9U A;  4NXY A;  5C82 A;  5KTC A;  2EVN A;  3S6K A;  1IIC A;  3NE7 A;  4MHD A;  4JXR A;  5F46 A;  4R3L A;  1V0C A;  4A33 A;  2ZW4 A;  2Q0Y A;  2I00 A;  4QUS A;  2REF A;  1WWZ A;  3D8P A;  2Z10 A;  1PU9 A;  2FL4 A;  2GIV A;  4U9Z A;  1XIX A;  2R1I A;  4KOW A;  3PZJ A;  4KOU A;  3IWG A;  1NMT A;  2VI7 A;  2VQY A;  3R9G A;  4AG9 A;  4FD7 A;  1IYL A;  3F5B A;  3BJ7 A;  1CM0 A;  4CYQ A;  1TIQ A;  4BBH A;  4XPL A;  3VWD A;  4QVT A;  4LX9 A;  4L89 A;  4R9M A;  2FIA A;  2Q7B A;  2H5M A;  3WR7 A;  2Z11 A;  1M4I A;  4NSQ A;  5J8F A;  5H86 A;  1KUV A;  2C27 A;  1S7K A;  2I79 A;  4B12 A;  4CRZ B;  3JVN A;  1YLE A;  4UCP A;  3JTK A;  3W6S A;  1S3Z A;  1QSR A;  4AB7 A;  2PR1 A;  4UWJ A;  4MFZ A;  3DR8 A;  4OLL A;  2JDC A;  2YNC C;  4RS2 A;  2Z3P A;  3KKW A;  4UA3 A;  4KOT A;  1YX0 A;  2G3A A;  5AG4 A;  2Z3K A;  1KZF A;  2YGW A;  3GKR A;  1Q2D A;  1XE4 A;  1K4J A;  4KVX A;  4YFJ A;  3BLN A;  3CXQ A;  3S6G A;  1XMT A;  3G8W A;  2JLM A;  4HNX B;  3CXP A;  2K5T A;  2Z3M A;  3FXT A;  4NCZ A;  5I0C A;  4NF1 A;  4FD4 A;  5CNP A;  2J8R A;  4B5P B;  5J8C A;  3SXO A;  3N7Z A;  4PV6 A;  1VHS A;  2HUZ A;  1I1D A;  2YND A;  2G3T A;  1MJB A;  2Q04 A;  1M4G A;  4MBU A;  4K30 A;  4KOS A;  1PUA A;  2BL1 A;  2BUE A;  2FIW A;  2FT0 A;  2OZG A;  4J3G A;  4FD6 A;  4NEX A;  2DPT A;  2B4D A;  2R8V A;  4R87 A;  1Y7R A;  5JPH A;  4IUS A;  4B10 A;  3DSB A;  4MJ8 A;  5EBV A;  4MFK A;  4CS0 B;  4DNC A;  2HQY A;  2VZY A;  4B11 A;  1S5K A;  2GAN A;  4R57 A;  4H89 A;  2Q4Y A;  3R9E A;  4M85 A;  1BOB A;  1MK4 A;  1S7F A;  3TOA A;  3TTH A;  2D4P A;  2FS5 A;  4GS4 A;  3RYO A;  2J8M A;  4Q36 A;  5AG7 A;  5G20 A;  2ZW7 A;  1WK4 A;  1IID A;  1Y9W A;  3JUW A;  4C2Z A;  5GCN A;  3DDD A;  2G0B A;  4E2A A;  4MFP A;  1IYK A;  4ZBG A;  1Q2Y A;  2B5G B;  4F0X A;  3EC4 A;  4U9Y A;  2ZW5 A;  5E96 A;  4KOV A;  3I3G A;  5HH1 A;  3D2P A;  1B87 A;  5IV0 A;  5BWA B;  3P2F A;  4KLV A;  4M3S A;  1Z4E A;  2R7H A;  2RC4 A;  3DR6 A;  4UFV A;  2PSW A;  2OZH A;  5HMN A;  3F0A A;  4CYO A;  3T9Y A;  2WPX A;  3IU1 A;  4XNH C;  2ATR A;  3EY5 A;  5AGE A;  3FNC A;  5IX3 A;  4UFX A;  2Z3L A;  4MY3 A;  1QSN A;  4JJX A;  1RO5 A;  4KUA A;  4C2Y A;  4MFJ A;  2R98 A;  5KTD A;  3D3S A;  3B8G A;  4C2X A;  4R3K A;  1YVO A;  3R95 A;  3CXS A;  3FBU A;  4KOX A;  2QML A;  2WPW A;  3QAH A;  4KOY A;  3R96 A;  4JXQ A;  3UY5 A;  3EO4 A;  1S7L A;  3FRM A;  4AVC A;  5EC4 A;  3OWC A;  4ONU A;  3MGD A;  4KSF A;  2REE A;  2EUI A;  2Z3N A;  4HNY B;  3S6F A;  4MFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...