4B14A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 26)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 115
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b14A00
4A31A 3H5ZA 4A95A 2WUUA 4B11A 3IWEA 5G21A 4C2YA 5AGEA 4CAEA 4UFWA 4CGNA 5A28A 4CYNA 5AG7A 4BBHA 5G20A 5AG5A 4UCMA 4C2XA 2YNCC 5G1ZA 4C7IA 2YNEA 4A33A 3JTKA 4CYPA 4CAFA 4A2ZA 4B12A 4CGMA 4A32A 4C2ZA 5A27A 4C7HA 4UCPA 4B10A 2YNCA 4UFVA 4UFXA 4B13A 2WSAA 4UCNA 4CGOA 4A30A 5AG4A 3IU2A 4CGLA 4CYQA 4CGPA 5AG6A 5G22A 4CYOA 4C68A 4B14A 2YNDA 3IU1A
chains in the Genus database with same CATH superfamily
3VATA 1QSMA 2BCOA 3TOAA 4ZYQA 4X3RA 3VH9A 5BWAB 2D4PA 4XNHB 3SJXA 5D29A 2PJ4A 2JBKA 2PR1A 1Z4EA 3D67A 4R3KA 3T90A 3FXTA 1QQ9A 2FIAA 3QAHA 3S6KA 4ZY2A 5KTAA 2PDOA 2R98A 4E8OA 7CPAA 3NH4A 3IEHA 4A2ZA 2Q51A 1M4IA 5A27A 4P4EA 2PJBA 4AVAA 1YLOA 4NGSA 4R6TA 3FH4A 4R9MA 1LRZA 3DR8A 5C88A 3IU2A 5K8NA 2J8MA 3DR6A 2Z10A 4Q36A 4Y49C 2PJ2A 2AFXA 2CF4A 4F6AA 4BD9A 4L8AA 1NSAA 2G3TA 2QECA 4UA3A 4KUBA 2DPTA 1V0CA 1ZG7A 4TNUA 4RS2A 4A94A 4CAEA 5E96A 1LAMA 2AFOA 2FCKA 5EBVA 5H84A 4F9VA 3F0AA 1LAPA 2FS5A 1OBRA 2QMLA 2ZOGA 2Z3KA 4EWTA 2O53A 2OH1A 2EUIA 1DTDA 3EFAA 2CNSA 2O4HA 1NE9A 3PB6X 4KVME 3RYOA 4GM5A 1XE4A 5IB9A 3ZJ0A 3LD2A 4MI4A 1IOIA 2REEA 4AVBA 4P6YA 1B87A 5I0CA 4KOYA 3TTHA 4DNCA 3R9GA 2B4DA 2IL4A 2RC4A 3B3VA 2K5TA 1Y7RA 2JEVA 2I3CA 3HUVA 1Z8XA 2CIJA 1AMPA 3LACA 3CDXA 1M4GA 4NJQA 4IAVA 1ON0A 3ISZA 2Q4ZA 3EXNA 3TO6A 3OWCA 3RBUA 4MBUA 4P4DA 4QC6A 4MJ8A 4C2YA 4EMEA 4KSIA 1ZLIA 1TXRA 2CTBA 4GXHA 4KVOE 3SI0A 1BOBA 4I49A 4ONWA 4OC5A 3R1KA 2ZW5A 3D4UA 3W6XA 2NYQA 4IHMA 4Q38A 4K30A 4NXYA 4B5PB 4OLLA 4UEEA 3WABA 4ZI6A 4UFXA 3I1UA 1CG2A 4KLVA 4PSXA 4NJRA 2CNTA 1HDQA 1YQEA 2I00A 4E2AA 1XOVA 4UBRA 1X10A 3SJFA 2ZOFA 3H8EA 3NFZA 1XRYA 1BPMA 4NGRA 2FE7A 4X2TA 2B3VA 2PJ6A 3R9EA 5HH1A 2WYRA 4P44A 5K8PA 4CGNA 2O28A 5AG7A 4CS0B 2OZHA 4C7IA 5JH9A 1LANA 3WC7A 1Y9KA 1TF8A 5LRKA 2OB0A 4FUUA 3K9UA 4ZY0A 1X12A 4KLWA 2JBJA 2WZNA 3DDDA 3LWUA 1DE4C 2VEZA 4FD4A 3CPAA 2YNCA 3QNVA 3G8WA 4IF5A 4MHDA 4OIDA 3PBBA 3F8KA 4OAEA 3TO7A 4B13A 3VWDA 4QB9A 2EBJA 3D2PA 1Q2CA 4ONUA 5ISVA 3H8GA 3PZJA 2OZUA 1Y0RA 2PJ1A 4M6IA 4KOSA 2ZEPA 4KOVA 1QSNA 2QVPA 4Z65A 4FD5A 1R3NA 2Q7SA 2V8DA 1R43A 2ANPA 2HQYA 2RB7A 2CY2A 1S7LA 4YU9A 4KOTA 2GREA 4MCQA 2C6PA 3A9LA 2PR8A 4KZTA 2P0WA 4XPDC 3DLJA 2EVNA 3FNCA 3E0KA 1CPSA 2ZPAA 3NE8A 4J3GA 3TO9A 1XEBA 4A32A 4CGMA 4F0XA 3SXOA 1XIXA 1KWMA 1Q7LA 3PB7X 3IFEA 4UCNA 2JDDA 3WT4A 4NGQA 2XEGA 4MHPA 3CXQA 1VHOA 4OP4A 5DWNA 2YGWA 3I9SA 1IB1E 2ZEEA 5EC4A 1GHEA 4JYWA 5F48A 4R7MA 1TF9A 2BO9A 3PRTA 4A37A 1B6BA 2VI7A 4XPLA 4ZY1A 3P2FA 4KORA 2FIWA 6CPAA 3B3WA 1MJBA 2I79A 3D7HA 2IJZA 2VZYA 3KASA 3KHZA 3QAYA 2FL4A 2AFUA 1S7FA 2PVVA 5F46A 4H6ZA 4MFJA 3WR7A 2G0BA 4ZBGA 4UWJA 4A33A 3KGQA 4NGMA 3TT2A 5IB0A 1VHSA 4YFJA 1BAVA 1LCPA 3ZZIA 2B4DB 3JRUA 4MCPA 3LMSA 3FRMA 2PJ5A 4UEZA 4UIAA 5LYDA 3KKWA 2Q7BA 3FEEA 4JWPA 1XMBA 3FECA 1KZFA 4C68A 3H5ZA 4JXQA 1IGBA 4FBEA 1KUVA 3BHXA 1PCAA 2ZEDA 2Z0ZA 4PXCA 2JEWA 1Z8LA 4QBJA 5AGEA 4YRHA 4PSWA 4E0AA 3FX6A 4OC2A 4P4FA 3IJ3A 5F49A 2HV2A 3IC1A 4FD7A 2DXQA 3TFYA 2R7HA 3CXSA 2C6GA 2BUEA 4WWVA 5F09A 2Z11A 4PK2A 1VIXA 4MY0A 1TKHA 2B5GB 3SJGA 3T9YA 5JGFA 1ZG9A 5HVGA 1CBXA 2ZELA 3BJ7A 3PEIA 4KOUA 1VHEA 4HPSA 3W6SA 4UF4A 3FMCA 2ODFA 5F47A 1ZO0A 4OMEA 3NA6A 3T8WA 4BMHA 3BI1A 1XBUA 3IO1A 1TKJA 2F5IA 3B8GA 4FD6A 4KSAA 2WPXA 4MCRA 1QMUA 2B4BA 4NGPA 3DNSA 4K3NA 4A31A 1N71A 4FAIA 3D2MA 3GY9A 2PC1A 2VL1A 4KS9A 4A95A 2XEFA 4PK3A 5GCNA 3S9MA 5A28A 2ZW6A 1NMTA 4NFRA 1UFHA 5G20A 2YNEA 3D3SA 3IWWA 3KI9A 5IV0A 2PIYA 1BLLE 1ARLA 3H8FA 4OC1A 3V8IA 4DJLA 1Z8TA 1WWZA 3KZWA 3R95A 4BINA 2JLMA 5HMNA 1YX0A 3SHPA 5KTCA 2OOTA 3H4QA 2R1IA 1QSOA 2V8HA 1A2ZA 2Q43A 4R3LA 1QSRA 2DPSA 2XEJA 1AUGA 4W9YA 1F2PA 3HLPA 2IMOA 2PVWA 5G21A 2CXAA 3D7DA 1CJWA 1S7KA 2QYVA 2PRQA 4H89A 3R96A 3F5BA 1PUAA 4P4IA 4XPKA 1P0HA 1CP6A 2P6GA 3MRUA 4AVCA 1PYTB 3GYAA 4KUAA 4JLYA 4RI1A 3EY5A 4MRIA 4UCPA 2BL1A 4IUSA 3EO4A 3D7FA 3FJUA 3MGDA 1PU9A 3GB0A 3DGVA 3TC8A 2F8HA 4JD6A 3RNZA 5I4MA 3PGPA 3PB8X 4OKOA 1ARMA 2QJ8A 3BXMA 4NF1A 4P4BA 5LYIA 4TWEA 2J9AA 4O23A 3JVNA 1UWYA 2J8RA 3S9LA 4PXEA 4KOXA 2VZZA 3NE7A 3BI0A 4CYNA 1Y7EA 3B3TA 5CNPA 5DS0A 4H6UA 4C2XA 2AFSA 2P6EA 2R8VA 1OZPA 1TKFA 3JTKA 5H86A 3WC6A 4CPAA 3NH8A 2GIVA 4LQGA 5HXDA 2PJCA 1LFWA 1IIDA 1SQHA 4KVXA 3B35A 5DWMA 1IU8A 4CGOA 4A30A 4EVYA 2Q04A 1XMTA 1ZLHA 1P4NA 4OADA 2ZEOA 4YWYA 4FWUA 2Y0MA 3BJ8A 1Z4RA 2FVGA 2V77A 4MFKA 4B5PA 4CYOA 2Z3PA 2NMTA 4OC4A 2REFA 1MJAA 2ZENA 2WUUA 3KL9A 3IWEA 4MXUA 3NH5A 1F57A 1YREA 4X8IA 2V8GA 1GYTA 3L2NA 1MK4A 3K2KA 3RZAA 2Z3NA 5CPAA 1J4JA 2BOAA 2GFQA 2B5GA 2ZXVA 1XFOA 4DUKA 1VKCA 3D7GA 3ISXA 2PCUA 2H5MA 4HNWB 4CAWA 1KUYA 1K4JA 2DEAA 4C7HA 2AE6A 3N5FA 2Z3LA 3FYNA 4UWIA 1L0CA 4AB7A 1EE3P 1BPNA 1U6MA 1ELMP 2Q0YA 4HNXB 4JJXA 4MHNA 4Y49B 4X5KA 1JQGA 1I1DA 4F9UA 1RO5A 1Y0YA 1WK4A 4LUAA 2PJ0A 2YNDA 4RN7A 3IU1A 3FIXA 3RAMA 1YK3A 4MY3A 4RUHA 5J8CA 4IK2A 3VARA 1I21A 3P2HA 4PQAA 1FY7A 4NEXA 1S7NA 2C6CA 3KR4A 1S3ZA 4CAVA 2QIRA 3FF3A 3SI2A 4KSFA 4BBHA 3B7IA 3B3CA 2FSRA 3PB9X 4MCSA 2F7VA 1YW6A 4C2ZA 3JUWA 2ZEGA 4NGTA 4MHYA 2Q4VA 3GKRA 4MFZA 4MMOA 4NCZA 4UFVA 3KQXA 4XNHC 1XF8A 2PIZA 3KQZA 1ZG8A 2XEIA 3WC5A 1S5KA 4QVTA 2EK8A 1S60A 1M4DA 3D68A 3GLJA 3PBEA 4JZ0A 1HDUA 8CPAA 3G3SA 1IOFA 2OZGA 2V8VA 1R57A 3FBUA 4QUSA 2PE3A 5LYLA 3LODA 4NSQA 4CAXA 1IY7A 4HNYB 5HVHA 3IWGA 4UFWA 2Z3OA 3FB3A 4GS4A 5FVJA 4R76A 4A39A 2PJ3A 1YW4A 5AG5A 2VXKA 1Z2LA 2YNCC 1NSLA 4R8FA 4L89A 2ATRA 2A4NA 2GLFA 3S6GA 4CYPA 3K9TA 2ZEHA 5LRGA 2EO8A 2KCWA 1M44A 3SXNA 4Q7AA 4ZX9A 4OC3A 2DF5A 3S6HA 3B2YA 5LRJA 2BSWA 3S9NA 2Q44A 2PJ9A 4P45A 4F0YA 2HUZA 4CGLA 2PRBA 2GANA 4H2KA 1HEEA 5AG6A 3TX8A 1XJOA 2OU2A 4PXBA 3TOBA 1FT7A 2RFHA 3CPXA 5EMIA 4P4JA 1YGHA 4NGNA 3CXPA 4B11A 4ZX8A 3D8PA 4B6ZA 2X7BA 4U9ZA 1TIQA 2PSWA 5D8NA 5KTDA 2P6FA 3DSBA 3D66A 4KOWA 2PJ7A 1CPXA 2PQ8A 4P10A 1YLEA 3GIUA 4ZGYB 1IICA 5LYFA 5HVFA 1IYLA 1H8LA 2J8NA 4DYOA 3S6FA 2ABZA 4B5OA 4LX9A 2ZEMA 4MHZA 3W91A 1AYEA 2VQYA 2GU2A 1RXTA 1VGYA 2GE3A 4MFPA 4R57A 3V38A 2ZEFA 5J8FA 2C1CA 1IYKA 2EWBA 4AG7A 2WSAA 1YR0A 2AFZA 3SI1A 3BLNA 2EK9A 4UEFA 1CM0A 1ELLP 1QSTA 2CNMA 3PFEA 5G22A 3RO0A 3VWEA 4B14A 3GUXA 2AFWA 2HC9A 1KUXA 5IX3A 4M85A 3PP9A 2IQ6A 3FVLA 4YGOA 1BO4A 2Z3MA 2C27A 1CX8A 1I12A 4A38A 4CRZB 4PPZA 5K8OA 4WJBA 1YMEA 1YVOA 1Z9UA 2G9DA 2VBQA 3B3SA 1Z5RA 4ORFA 4PV6A 5G1ZA 3QB8A 5JPHA 2POKA 3PB4X 4AG9A 4U5YA 1Q2YA 2FXFA 3FEDA 4MFQA 3MN8A 4MFLA 4B12A 2PJAA 4G1PA 4B10A 2FT0A 2CTCA 4PXDA 2B3UA 2WPWA 5AG4A 2PJ8A 2AJ6A 4CGPA 3SJEA 3KHXA 2ZW7A 5K8MA 4OC0A 1Q2DA 1YSJA 1Z8WA 2ZW4A 2NSMA 4HKFA 4EFDA 4F8ZA 3IGRA 3CZXA 3KR5A 4M6HA 2HB6A 1F2OA 5CBMA 2JDCA 2Q4YA 4II9A 2AFMA 1Y9WA 1FNOA 1JWQA 3V7ZA 2B58A 4AXVA 5JQ4A 4CRYB 1RTQA 4M3SA 4UCMA 3R9FA 1CP7A 3UY5A 2ARHA 4CAFA 2D4OA 3CT9A 4M6GA 5J1QA 2G3AA 5THWA 2GLJA 1MJ9A 5C82A 3I3GA 4UIBA 5ELYA 4JXRA 4LQ6A 3C26A 1M1DA 4CYQA 2BEIA 1M4LA 3N7ZA 4U9YA 1LOKA 3TCVA 3EC4A 3TE4A 4OIWA 2OR4A 4XPDB 4R87A 3IIBA 3PFOA 5JM6A 1YVKA
chains in the Genus database with same CATH topology
1QSMA 3TOAA 5BWAB 2D4PA 4XNHB 2PR1A 1Z4EA 4R3KA 3T90A 3FXTA 2FIAA 3QAHA 3S6KA 5KTAA 2PDOA 2R98A 4E8OA 4A2ZA 5A27A 1M4IA 4AVAA 4R9MA 1LRZA 3DR8A 5C88A 3IU2A 2J8MA 3DR6A 2Z10A 4Q36A 4Y49C 4L8AA 4UA3A 2G3TA 2QECA 4KUBA 2DPTA 1V0CA 4RS2A 4CAEA 5E96A 2FCKA 5EBVA 5H84A 3F0AA 2FS5A 2QMLA 2Z3KA 2OH1A 2EUIA 3EFAA 2CNSA 1NE9A 4KVME 3RYOA 1XE4A 3ZJ0A 3LD2A 4MI4A 2REEA 4AVBA 1B87A 5I0CA 4KOYA 3TTHA 3R9GA 2B4DA 2IL4A 2RC4A 2K5TA 1Y7RA 2JEVA 1M4GA 1ON0A 3EXNA 3TO6A 3OWCA 4MBUA 4QC6A 4MJ8A 4C2YA 4KVOE 1BOBA 4I49A 3R1KA 2ZW5A 3W6XA 4Q38A 4K30A 4NXYA 4B5PB 4OLLA 4UFXA 4KLVA 4PSXA 2CNTA 4E2AA 2I00A 4UBRA 2FE7A 2B3VA 3R9EA 5HH1A 4CGNA 2O28A 5AG7A 4CS0B 2OZHA 4C7IA 1Y9KA 2OB0A 3K9UA 4KLWA 3DDDA 4IF5A 4F6AA 4FD4A 2VEZA 4DNCA 2YNCA 3G8WA 4MHDA 3TO7A 4OAEA 3F8KA 4B13A 3VWDA 4QB9A 3D2PA 1Q2CA 4ONUA 5ISVA 3PZJA 2OZUA 4KOSA 4KOVA 1QSNA 4FD5A 2HQYA 2CY2A 1S7LA 4KOTA 3A9LA 2PR8A 4KZTA 2P0WA 4XPDC 3FNCA 2EVNA 3E0KA 2ZPAA 4J3GA 3TO9A 4A32A 1XEBA 4CGMA 4F0XA 3SXOA 1XIXA 4UCNA 2JDDA 5DWNA 3CXQA 5EC4A 4YFJA 2YGWA 3I9SA 1IB1E 1GHEA 5F48A 1B6BA 2VI7A 4XPLA 3P2FA 4KORA 2FIWA 1MJBA 2I79A 2VZYA 2FL4A 1S7FA 5F46A 4H6ZA 4MFJA 3WR7A 2G0BA 4ZBGA 4UWJA 4A33A 3TT2A 5IB0A 1VHSA 3ZZIA 2B4DB 3FRMA 3KKWA 2Q7BA 4JWPA 1KZFA 4C68A 3H5ZA 4JXQA 1KUVA 2Z0ZA 4QBJA 5AGEA 4YRHA 4PSWA 4E0AA 5F49A 2HV2A 4FD7A 2DXQA 3TFYA 2R7HA 3CXSA 2BUEA 2Z11A 4PK2A 4MY0A 2B5GB 3T9YA 3BJ7A 4KOUA 3W6SA 5F47A 1ZO0A 4BMHA 4KSAA 4FD6A 2F5IA 3B8GA 2WPXA 2B4BA 3DNSA 4A31A 1N71A 3D2MA 3GY9A 2PC1A 4KS9A 4A95A 4PK3A 5GCNA 5A28A 2ZW6A 1NMTA 1UFHA 5G20A 2YNEA 3D3SA 5IV0A 3V8IA 1WWZA 3R95A 2JLMA 5HMNA 1YX0A 3SHPA 5KTCA 3H4QA 2R1IA 1QSOA 4R3LA 1QSRA 2DPSA 5G21A 2CXAA 4H89A 1CJWA 1S7KA 3R96A 3F5BA 1PUAA 4XPKA 1P0HA 2P6GA 4AVCA 3GYAA 4KUAA 4JLYA 4RI1A 3EY5A 4UCPA 2BL1A 4IUSA 3EO4A 3MGDA 1PU9A 4JD6A 3PGPA 4NF1A 3JVNA 2J8RA 4KOXA 2VZZA 3NE7A 4CYNA 5CNPA 4C2XA 4H6UA 2P6EA 2R8VA 1OZPA 3JTKA 5H86A 2GIVA 1SQHA 1IIDA 4KVXA 5DWMA 4CGOA 4A30A 4EVYA 2Q04A 1XMTA 1P4NA 4OADA 2Y0MA 3BJ8A 1Z4RA 4B5PA 4CYOA 4MFKA 2Z3PA 2NMTA 2REFA 1MJAA 2WUUA 3IWEA 1YREA 1MK4A 2Z3NA 1J4JA 2B5GA 2ZXVA 1VKCA 2H5MA 4HNWB 4CAWA 1KUYA 1K4JA 4C7HA 2AE6A 2Z3LA 3FYNA 4UWIA 1L0CA 4AB7A 1U6MA 4HNXB 2Q0YA 4JJXA 4Y49B 4X5KA 1I1DA 1RO5A 4LUAA 1WK4A 2YNDA 3IU1A 3FIXA 1YK3A 4MY3A 5J8CA 1I21A 3P2HA 1FY7A 4NEXA 1S7NA 1S3ZA 4CAVA 2QIRA 4BBHA 4KSFA 2FSRA 4C2ZA 3JUWA 2Q4VA 4MFZA 3GKRA 4NCZA 4UFVA 4XNHC 1XF8A 1S5KA 4QVTA 1S60A 1M4DA 3G3SA 2OZGA 1R57A 3FBUA 4QUSA 3LODA 4NSQA 4CAXA 4HNYB 3IWGA 4UFWA 2Z3OA 3FB3A 4GS4A 5FVJA 5AG5A 2VXKA 1NSLA 2YNCC 3S6GA 4L89A 2ATRA 2A4NA 4CYPA 2KCWA 1M44A 3SXNA 3S6HA 2BSWA 2Q44A 4F0YA 2HUZA 4CGLA 2PRBA 2GANA 5AG6A 2OU2A 3TOBA 1YGHA 4B11A 3CXPA 3D8PA 2X7BA 4U9ZA 1TIQA 2PSWA 5KTDA 2P6FA 3DSBA 4KOWA 2PQ8A 1YLEA 4ZGYB 1IICA 1IYLA 2J8NA 3S6FA 4B5OA 4LX9A 3W91A 2VQYA 1RXTA 5J8FA 4MFPA 2GE3A 4R57A 1IYKA 4AG7A 2WSAA 1YR0A 3BLNA 1CM0A 1QSTA 2CNMA 5G22A 3VWEA 4B14A 1KUXA 5IX3A 4M85A 3PP9A 4YGOA 1BO4A 2Z3MA 2C27A 4CRZB 1I12A 1YVOA 1Z9UA 4ORFA 2VBQA 4PV6A 5G1ZA 5JPHA 3QB8A 4AG9A 4U5YA 1Q2YA 2FXFA 4MFQA 4MFLA 4B12A 4B10A 2FT0A 2B3UA 2WPWA 5AG4A 2AJ6A 4CGPA 2ZW7A 1Q2DA 2ZW4A 4HKFA 3IGRA 2JDCA 2Q4YA 4II9A 1Y9WA 2B58A 5JQ4A 4CRYB 4M3SA 4UCMA 3R9FA 3UY5A 2ARHA 4CAFA 2D4OA 2G3AA 5C82A 1MJ9A 3I3GA 4JXRA 3C26A 1M1DA 4CYQA 2BEIA 3N7ZA 4U9YA 3TCVA 3EC4A 3TE4A 4XPDB 4R87A 1YVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  3H5Z A;  4A95 A;  2WUU A;  4B11 A;  3IWE A;  5G21 A;  4C2Y A;  5AGE A;  4CAE A;  4UFW A;  4CGN A;  5A28 A;  4CYN A;  5AG7 A;  4BBH A;  5G20 A;  5AG5 A;  4UCM A;  4C2X A;  2YNC C;  5G1Z A;  4C7I A;  2YNE A;  4A33 A;  3JTK A;  4CYP A;  4CAF A;  4A2Z A;  4B12 A;  4CGM A;  4A32 A;  4C2Z A;  5A27 A;  4C7H A;  4UCP A;  4B10 A;  2YNC A;  4UFV A;  4UFX A;  4B13 A;  2WSA A;  4UCN A;  4CGO A;  4A30 A;  5AG4 A;  3IU2 A;  4CGL A;  4CYQ A;  4CGP A;  5AG6 A;  5G22 A;  4CYO A;  4C68 A;  4B14 A;  2YND A;  3IU1 A; 
#chains in the Genus database with same CATH topology
 3VAT A;  1QSM A;  2BCO A;  3TOA A;  4ZYQ A;  4X3R A;  3VH9 A;  5BWA B;  2D4P A;  4XNH B;  3SJX A;  5D29 A;  2PJ4 A;  2JBK A;  2PR1 A;  1Z4E A;  3D67 A;  4R3K A;  3T90 A;  3FXT A;  1QQ9 A;  2FIA A;  3QAH A;  3S6K A;  4ZY2 A;  5KTA A;  2PDO A;  2R98 A;  4E8O A;  7CPA A;  3NH4 A;  3IEH A;  4A2Z A;  2Q51 A;  1M4I A;  5A27 A;  4P4E A;  2PJB A;  4AVA A;  1YLO A;  4NGS A;  4R6T A;  3FH4 A;  4R9M A;  1LRZ A;  3DR8 A;  5C88 A;  3IU2 A;  5K8N A;  2J8M A;  3DR6 A;  2Z10 A;  4Q36 A;  4Y49 C;  2PJ2 A;  2AFX A;  2CF4 A;  4F6A A;  4BD9 A;  4L8A A;  1NSA A;  2G3T A;  2QEC A;  4UA3 A;  4KUB A;  2DPT A;  1V0C A;  1ZG7 A;  4TNU A;  4RS2 A;  4A94 A;  4CAE A;  5E96 A;  1LAM A;  2AFO A;  2FCK A;  5EBV A;  5H84 A;  4F9V A;  3F0A A;  1LAP A;  2FS5 A;  1OBR A;  2QML A;  2ZOG A;  2Z3K A;  4EWT A;  2O53 A;  2OH1 A;  2EUI A;  1DTD A;  3EFA A;  2CNS A;  2O4H A;  1NE9 A;  3PB6 X;  4KVM E;  3RYO A;  4GM5 A;  1XE4 A;  5IB9 A;  3ZJ0 A;  3LD2 A;  4MI4 A;  1IOI A;  2REE A;  4AVB A;  4P6Y A;  1B87 A;  5I0C A;  4KOY A;  3TTH A;  4DNC A;  3R9G A;  2B4D A;  2IL4 A;  2RC4 A;  3B3V A;  2K5T A;  1Y7R A;  2JEV A;  2I3C A;  3HUV A;  1Z8X A;  2CIJ A;  1AMP A;  3LAC A;  3CDX A;  1M4G A;  4NJQ A;  4IAV A;  1ON0 A;  3ISZ A;  2Q4Z A;  3EXN A;  3TO6 A;  3OWC A;  3RBU A;  4MBU A;  4P4D A;  4QC6 A;  4MJ8 A;  4C2Y A;  4EME A;  4KSI A;  1ZLI A;  1TXR A;  2CTB A;  4GXH A;  4KVO E;  3SI0 A;  1BOB A;  4I49 A;  4ONW A;  4OC5 A;  3R1K A;  2ZW5 A;  3D4U A;  3W6X A;  2NYQ A;  4IHM A;  4Q38 A;  4K30 A;  4NXY A;  4B5P B;  4OLL A;  4UEE A;  3WAB A;  4ZI6 A;  4UFX A;  3I1U A;  1CG2 A;  4KLV A;  4PSX A;  4NJR A;  2CNT A;  1HDQ A;  1YQE A;  2I00 A;  4E2A A;  1XOV A;  4UBR A;  1X10 A;  3SJF A;  2ZOF A;  3H8E A;  3NFZ A;  1XRY A;  1BPM A;  4NGR A;  2FE7 A;  4X2T A;  2B3V A;  2PJ6 A;  3R9E A;  5HH1 A;  2WYR A;  4P44 A;  5K8P A;  4CGN A;  2O28 A;  5AG7 A;  4CS0 B;  2OZH A;  4C7I A;  5JH9 A;  1LAN A;  3WC7 A;  1Y9K A;  1TF8 A;  5LRK A;  2OB0 A;  4FUU A;  3K9U A;  4ZY0 A;  1X12 A;  4KLW A;  2JBJ A;  2WZN A;  3DDD A;  3LWU A;  1DE4 C;  2VEZ A;  4FD4 A;  3CPA A;  2YNC A;  3QNV A;  3G8W A;  4IF5 A;  4MHD A;  4OID A;  3PBB A;  3F8K A;  4OAE A;  3TO7 A;  4B13 A;  3VWD A;  4QB9 A;  2EBJ A;  3D2P A;  1Q2C A;  4ONU A;  5ISV A;  3H8G A;  3PZJ A;  2OZU A;  1Y0R A;  2PJ1 A;  4M6I A;  4KOS A;  2ZEP A;  4KOV A;  1QSN A;  2QVP A;  4Z65 A;  4FD5 A;  1R3N A;  2Q7S A;  2V8D A;  1R43 A;  2ANP A;  2HQY A;  2RB7 A;  2CY2 A;  1S7L A;  4YU9 A;  4KOT A;  2GRE A;  4MCQ A;  2C6P A;  3A9L A;  2PR8 A;  4KZT A;  2P0W A;  4XPD C;  3DLJ A;  2EVN A;  3FNC A;  3E0K A;  1CPS A;  2ZPA A;  3NE8 A;  4J3G A;  3TO9 A;  1XEB A;  4A32 A;  4CGM A;  4F0X A;  3SXO A;  1XIX A;  1KWM A;  1Q7L A;  3PB7 X;  3IFE A;  4UCN A;  2JDD A;  3WT4 A;  4NGQ A;  2XEG A;  4MHP A;  3CXQ A;  1VHO A;  4OP4 A;  5DWN A;  2YGW A;  3I9S A;  1IB1 E;  2ZEE A;  5EC4 A;  1GHE A;  4JYW A;  5F48 A;  4R7M A;  1TF9 A;  2BO9 A;  3PRT A;  4A37 A;  1B6B A;  2VI7 A;  4XPL A;  4ZY1 A;  3P2F A;  4KOR A;  2FIW A;  6CPA A;  3B3W A;  1MJB A;  2I79 A;  3D7H A;  2IJZ A;  2VZY A;  3KAS A;  3KHZ A;  3QAY A;  2FL4 A;  2AFU A;  1S7F A;  2PVV A;  5F46 A;  4H6Z A;  4MFJ A;  3WR7 A;  2G0B A;  4ZBG A;  4UWJ A;  4A33 A;  3KGQ A;  4NGM A;  3TT2 A;  5IB0 A;  1VHS A;  4YFJ A;  1BAV A;  1LCP A;  3ZZI A;  2B4D B;  3JRU A;  4MCP A;  3LMS A;  3FRM A;  2PJ5 A;  4UEZ A;  4UIA A;  5LYD A;  3KKW A;  2Q7B A;  3FEE A;  4JWP A;  1XMB A;  3FEC A;  1KZF A;  4C68 A;  3H5Z A;  4JXQ A;  1IGB A;  4FBE A;  1KUV A;  3BHX A;  1PCA A;  2ZED A;  2Z0Z A;  4PXC A;  2JEW A;  1Z8L A;  4QBJ A;  5AGE A;  4YRH A;  4PSW A;  4E0A A;  3FX6 A;  4OC2 A;  4P4F A;  3IJ3 A;  5F49 A;  2HV2 A;  3IC1 A;  4FD7 A;  2DXQ A;  3TFY A;  2R7H A;  3CXS A;  2C6G A;  2BUE A;  4WWV A;  5F09 A;  2Z11 A;  4PK2 A;  1VIX A;  4MY0 A;  1TKH A;  2B5G B;  3SJG A;  3T9Y A;  5JGF A;  1ZG9 A;  5HVG A;  1CBX A;  2ZEL A;  3BJ7 A;  3PEI A;  4KOU A;  1VHE A;  4HPS A;  3W6S A;  4UF4 A;  3FMC A;  2ODF A;  5F47 A;  1ZO0 A;  4OME A;  3NA6 A;  3T8W A;  4BMH A;  3BI1 A;  1XBU A;  3IO1 A;  1TKJ A;  2F5I A;  3B8G A;  4FD6 A;  4KSA A;  2WPX A;  4MCR A;  1QMU A;  2B4B A;  4NGP A;  3DNS A;  4K3N A;  4A31 A;  1N71 A;  4FAI A;  3D2M A;  3GY9 A;  2PC1 A;  2VL1 A;  4KS9 A;  4A95 A;  2XEF A;  4PK3 A;  5GCN A;  3S9M A;  5A28 A;  2ZW6 A;  1NMT A;  4NFR A;  1UFH A;  5G20 A;  2YNE A;  3D3S A;  3IWW A;  3KI9 A;  5IV0 A;  2PIY A;  1BLL E;  1ARL A;  3H8F A;  4OC1 A;  3V8I A;  4DJL A;  1Z8T A;  1WWZ A;  3KZW A;  3R95 A;  4BIN A;  2JLM A;  5HMN A;  1YX0 A;  3SHP A;  5KTC A;  2OOT A;  3H4Q A;  2R1I A;  1QSO A;  2V8H A;  1A2Z A;  2Q43 A;  4R3L A;  1QSR A;  2DPS A;  2XEJ A;  1AUG A;  4W9Y A;  1F2P A;  3HLP A;  2IMO A;  2PVW A;  5G21 A;  2CXA A;  3D7D A;  1CJW A;  1S7K A;  2QYV A;  2PRQ A;  4H89 A;  3R96 A;  3F5B A;  1PUA A;  4P4I A;  4XPK A;  1P0H A;  1CP6 A;  2P6G A;  3MRU A;  4AVC A;  1PYT B;  3GYA A;  4KUA A;  4JLY A;  4RI1 A;  3EY5 A;  4MRI A;  4UCP A;  2BL1 A;  4IUS A;  3EO4 A;  3D7F A;  3FJU A;  3MGD A;  1PU9 A;  3GB0 A;  3DGV A;  3TC8 A;  2F8H A;  4JD6 A;  3RNZ A;  5I4M A;  3PGP A;  3PB8 X;  4OKO A;  1ARM A;  2QJ8 A;  3BXM A;  4NF1 A;  4P4B A;  5LYI A;  4TWE A;  2J9A A;  4O23 A;  3JVN A;  1UWY A;  2J8R A;  3S9L A;  4PXE A;  4KOX A;  2VZZ A;  3NE7 A;  3BI0 A;  4CYN A;  1Y7E A;  3B3T A;  5CNP A;  5DS0 A;  4H6U A;  4C2X A;  2AFS A;  2P6E A;  2R8V A;  1OZP A;  1TKF A;  3JTK A;  5H86 A;  3WC6 A;  4CPA A;  3NH8 A;  2GIV A;  4LQG A;  5HXD A;  2PJC A;  1LFW A;  1IID A;  1SQH A;  4KVX A;  3B35 A;  5DWM A;  1IU8 A;  4CGO A;  4A30 A;  4EVY A;  2Q04 A;  1XMT A;  1ZLH A;  1P4N A;  4OAD A;  2ZEO A;  4YWY A;  4FWU A;  2Y0M A;  3BJ8 A;  1Z4R A;  2FVG A;  2V77 A;  4MFK A;  4B5P A;  4CYO A;  2Z3P A;  2NMT A;  4OC4 A;  2REF A;  1MJA A;  2ZEN A;  2WUU A;  3KL9 A;  3IWE A;  4MXU A;  3NH5 A;  1F57 A;  1YRE A;  4X8I A;  2V8G A;  1GYT A;  3L2N A;  1MK4 A;  3K2K A;  3RZA A;  2Z3N A;  5CPA A;  1J4J A;  2BOA A;  2GFQ A;  2B5G A;  2ZXV A;  1XFO A;  4DUK A;  1VKC A;  3D7G A;  3ISX A;  2PCU A;  2H5M A;  4HNW B;  4CAW A;  1KUY A;  1K4J A;  2DEA A;  4C7H A;  2AE6 A;  3N5F A;  2Z3L A;  3FYN A;  4UWI A;  1L0C A;  4AB7 A;  1EE3 P;  1BPN A;  1U6M A;  1ELM P;  2Q0Y A;  4HNX B;  4JJX A;  4MHN A;  4Y49 B;  4X5K A;  1JQG A;  1I1D A;  4F9U A;  1RO5 A;  1Y0Y A;  1WK4 A;  4LUA A;  2PJ0 A;  2YND A;  4RN7 A;  3IU1 A;  3FIX A;  3RAM A;  1YK3 A;  4MY3 A;  4RUH A;  5J8C A;  4IK2 A;  3VAR A;  1I21 A;  3P2H A;  4PQA A;  1FY7 A;  4NEX A;  1S7N A;  2C6C A;  3KR4 A;  1S3Z A;  4CAV A;  2QIR A;  3FF3 A;  3SI2 A;  4KSF A;  4BBH A;  3B7I A;  3B3C A;  2FSR A;  3PB9 X;  4MCS A;  2F7V A;  1YW6 A;  4C2Z A;  3JUW A;  2ZEG A;  4NGT A;  4MHY A;  2Q4V A;  3GKR A;  4MFZ A;  4MMO A;  4NCZ A;  4UFV A;  3KQX A;  4XNH C;  1XF8 A;  2PIZ A;  3KQZ A;  1ZG8 A;  2XEI A;  3WC5 A;  1S5K A;  4QVT A;  2EK8 A;  1S60 A;  1M4D A;  3D68 A;  3GLJ A;  3PBE A;  4JZ0 A;  1HDU A;  8CPA A;  3G3S A;  1IOF A;  2OZG A;  2V8V A;  1R57 A;  3FBU A;  4QUS A;  2PE3 A;  5LYL A;  3LOD A;  4NSQ A;  4CAX A;  1IY7 A;  4HNY B;  5HVH A;  3IWG A;  4UFW A;  2Z3O A;  3FB3 A;  4GS4 A;  5FVJ A;  4R76 A;  4A39 A;  2PJ3 A;  1YW4 A;  5AG5 A;  2VXK A;  1Z2L A;  2YNC C;  1NSL A;  4R8F A;  4L89 A;  2ATR A;  2A4N A;  2GLF A;  3S6G A;  4CYP A;  3K9T A;  2ZEH A;  5LRG A;  2EO8 A;  2KCW A;  1M44 A;  3SXN A;  4Q7A A;  4ZX9 A;  4OC3 A;  2DF5 A;  3S6H A;  3B2Y A;  5LRJ A;  2BSW A;  3S9N A;  2Q44 A;  2PJ9 A;  4P45 A;  4F0Y A;  2HUZ A;  4CGL A;  2PRB A;  2GAN A;  4H2K A;  1HEE A;  5AG6 A;  3TX8 A;  1XJO A;  2OU2 A;  4PXB A;  3TOB A;  1FT7 A;  2RFH A;  3CPX A;  5EMI A;  4P4J A;  1YGH A;  4NGN A;  3CXP A;  4B11 A;  4ZX8 A;  3D8P A;  4B6Z A;  2X7B A;  4U9Z A;  1TIQ A;  2PSW A;  5D8N A;  5KTD A;  2P6F A;  3DSB A;  3D66 A;  4KOW A;  2PJ7 A;  1CPX A;  2PQ8 A;  4P10 A;  1YLE A;  3GIU A;  4ZGY B;  1IIC A;  5LYF A;  5HVF A;  1IYL A;  1H8L A;  2J8N A;  4DYO A;  3S6F A;  2ABZ A;  4B5O A;  4LX9 A;  2ZEM A;  4MHZ A;  3W91 A;  1AYE A;  2VQY A;  2GU2 A;  1RXT A;  1VGY A;  2GE3 A;  4MFP A;  4R57 A;  3V38 A;  2ZEF A;  5J8F A;  2C1C A;  1IYK A;  2EWB A;  4AG7 A;  2WSA A;  1YR0 A;  2AFZ A;  3SI1 A;  3BLN A;  2EK9 A;  4UEF A;  1CM0 A;  1ELL P;  1QST A;  2CNM A;  3PFE A;  5G22 A;  3RO0 A;  3VWE A;  4B14 A;  3GUX A;  2AFW A;  2HC9 A;  1KUX A;  5IX3 A;  4M85 A;  3PP9 A;  2IQ6 A;  3FVL A;  4YGO A;  1BO4 A;  2Z3M A;  2C27 A;  1CX8 A;  1I12 A;  4A38 A;  4CRZ B;  4PPZ A;  5K8O A;  4WJB A;  1YME A;  1YVO A;  1Z9U A;  2G9D A;  2VBQ A;  3B3S A;  1Z5R A;  4ORF A;  4PV6 A;  5G1Z A;  3QB8 A;  5JPH A;  2POK A;  3PB4 X;  4AG9 A;  4U5Y A;  1Q2Y A;  2FXF A;  3FED A;  4MFQ A;  3MN8 A;  4MFL A;  4B12 A;  2PJA A;  4G1P A;  4B10 A;  2FT0 A;  2CTC A;  4PXD A;  2B3U A;  2WPW A;  5AG4 A;  2PJ8 A;  2AJ6 A;  4CGP A;  3SJE A;  3KHX A;  2ZW7 A;  5K8M A;  4OC0 A;  1Q2D A;  1YSJ A;  1Z8W A;  2ZW4 A;  2NSM A;  4HKF A;  4EFD A;  4F8Z A;  3IGR A;  3CZX A;  3KR5 A;  4M6H A;  2HB6 A;  1F2O A;  5CBM A;  2JDC A;  2Q4Y A;  4II9 A;  2AFM A;  1Y9W A;  1FNO A;  1JWQ A;  3V7Z A;  2B58 A;  4AXV A;  5JQ4 A;  4CRY B;  1RTQ A;  4M3S A;  4UCM A;  3R9F A;  1CP7 A;  3UY5 A;  2ARH A;  4CAF A;  2D4O A;  3CT9 A;  4M6G A;  5J1Q A;  2G3A A;  5THW A;  2GLJ A;  1MJ9 A;  5C82 A;  3I3G A;  4UIB A;  5ELY A;  4JXR A;  4LQ6 A;  3C26 A;  1M1D A;  4CYQ A;  2BEI A;  1M4L A;  3N7Z A;  4U9Y A;  1LOK A;  3TCV A;  3EC4 A;  3TE4 A;  4OIW A;  2OR4 A;  4XPD B;  4R87 A;  3IIB A;  3PFO A;  5JM6 A;  1YVK A; 
#chains in the Genus database with same CATH homology
 1QSM A;  3TOA A;  5BWA B;  2D4P A;  4XNH B;  2PR1 A;  1Z4E A;  4R3K A;  3T90 A;  3FXT A;  2FIA A;  3QAH A;  3S6K A;  5KTA A;  2PDO A;  2R98 A;  4E8O A;  4A2Z A;  5A27 A;  1M4I A;  4AVA A;  4R9M A;  1LRZ A;  3DR8 A;  5C88 A;  3IU2 A;  2J8M A;  3DR6 A;  2Z10 A;  4Q36 A;  4Y49 C;  4L8A A;  4UA3 A;  2G3T A;  2QEC A;  4KUB A;  2DPT A;  1V0C A;  4RS2 A;  4CAE A;  5E96 A;  2FCK A;  5EBV A;  5H84 A;  3F0A A;  2FS5 A;  2QML A;  2Z3K A;  2OH1 A;  2EUI A;  3EFA A;  2CNS A;  1NE9 A;  4KVM E;  3RYO A;  1XE4 A;  3ZJ0 A;  3LD2 A;  4MI4 A;  2REE A;  4AVB A;  1B87 A;  5I0C A;  4KOY A;  3TTH A;  3R9G A;  2B4D A;  2IL4 A;  2RC4 A;  2K5T A;  1Y7R A;  2JEV A;  1M4G A;  1ON0 A;  3EXN A;  3TO6 A;  3OWC A;  4MBU A;  4QC6 A;  4MJ8 A;  4C2Y A;  4KVO E;  1BOB A;  4I49 A;  3R1K A;  2ZW5 A;  3W6X A;  4Q38 A;  4K30 A;  4NXY A;  4B5P B;  4OLL A;  4UFX A;  4KLV A;  4PSX A;  2CNT A;  4E2A A;  2I00 A;  4UBR A;  2FE7 A;  2B3V A;  3R9E A;  5HH1 A;  4CGN A;  2O28 A;  5AG7 A;  4CS0 B;  2OZH A;  4C7I A;  1Y9K A;  2OB0 A;  3K9U A;  4KLW A;  3DDD A;  4IF5 A;  4F6A A;  4FD4 A;  2VEZ A;  4DNC A;  2YNC A;  3G8W A;  4MHD A;  3TO7 A;  4OAE A;  3F8K A;  4B13 A;  3VWD A;  4QB9 A;  3D2P A;  1Q2C A;  4ONU A;  5ISV A;  3PZJ A;  2OZU A;  4KOS A;  4KOV A;  1QSN A;  4FD5 A;  2HQY A;  2CY2 A;  1S7L A;  4KOT A;  3A9L A;  2PR8 A;  4KZT A;  2P0W A;  4XPD C;  3FNC A;  2EVN A;  3E0K A;  2ZPA A;  4J3G A;  3TO9 A;  4A32 A;  1XEB A;  4CGM A;  4F0X A;  3SXO A;  1XIX A;  4UCN A;  2JDD A;  5DWN A;  3CXQ A;  5EC4 A;  4YFJ A;  2YGW A;  3I9S A;  1IB1 E;  1GHE A;  5F48 A;  1B6B A;  2VI7 A;  4XPL A;  3P2F A;  4KOR A;  2FIW A;  1MJB A;  2I79 A;  2VZY A;  2FL4 A;  1S7F A;  5F46 A;  4H6Z A;  4MFJ A;  3WR7 A;  2G0B A;  4ZBG A;  4UWJ A;  4A33 A;  3TT2 A;  5IB0 A;  1VHS A;  3ZZI A;  2B4D B;  3FRM A;  3KKW A;  2Q7B A;  4JWP A;  1KZF A;  4C68 A;  3H5Z A;  4JXQ A;  1KUV A;  2Z0Z A;  4QBJ A;  5AGE A;  4YRH A;  4PSW A;  4E0A A;  5F49 A;  2HV2 A;  4FD7 A;  2DXQ A;  3TFY A;  2R7H A;  3CXS A;  2BUE A;  2Z11 A;  4PK2 A;  4MY0 A;  2B5G B;  3T9Y A;  3BJ7 A;  4KOU A;  3W6S A;  5F47 A;  1ZO0 A;  4BMH A;  4KSA A;  4FD6 A;  2F5I A;  3B8G A;  2WPX A;  2B4B A;  3DNS A;  4A31 A;  1N71 A;  3D2M A;  3GY9 A;  2PC1 A;  4KS9 A;  4A95 A;  4PK3 A;  5GCN A;  5A28 A;  2ZW6 A;  1NMT A;  1UFH A;  5G20 A;  2YNE A;  3D3S A;  5IV0 A;  3V8I A;  1WWZ A;  3R95 A;  2JLM A;  5HMN A;  1YX0 A;  3SHP A;  5KTC A;  3H4Q A;  2R1I A;  1QSO A;  4R3L A;  1QSR A;  2DPS A;  5G21 A;  2CXA A;  4H89 A;  1CJW A;  1S7K A;  3R96 A;  3F5B A;  1PUA A;  4XPK A;  1P0H A;  2P6G A;  4AVC A;  3GYA A;  4KUA A;  4JLY A;  4RI1 A;  3EY5 A;  4UCP A;  2BL1 A;  4IUS A;  3EO4 A;  3MGD A;  1PU9 A;  4JD6 A;  3PGP A;  4NF1 A;  3JVN A;  2J8R A;  4KOX A;  2VZZ A;  3NE7 A;  4CYN A;  5CNP A;  4C2X A;  4H6U A;  2P6E A;  2R8V A;  1OZP A;  3JTK A;  5H86 A;  2GIV A;  1SQH A;  1IID A;  4KVX A;  5DWM A;  4CGO A;  4A30 A;  4EVY A;  2Q04 A;  1XMT A;  1P4N A;  4OAD A;  2Y0M A;  3BJ8 A;  1Z4R A;  4B5P A;  4CYO A;  4MFK A;  2Z3P A;  2NMT A;  2REF A;  1MJA A;  2WUU A;  3IWE A;  1YRE A;  1MK4 A;  2Z3N A;  1J4J A;  2B5G A;  2ZXV A;  1VKC A;  2H5M A;  4HNW B;  4CAW A;  1KUY A;  1K4J A;  4C7H A;  2AE6 A;  2Z3L A;  3FYN A;  4UWI A;  1L0C A;  4AB7 A;  1U6M A;  4HNX B;  2Q0Y A;  4JJX A;  4Y49 B;  4X5K A;  1I1D A;  1RO5 A;  4LUA A;  1WK4 A;  2YND A;  3IU1 A;  3FIX A;  1YK3 A;  4MY3 A;  5J8C A;  1I21 A;  3P2H A;  1FY7 A;  4NEX A;  1S7N A;  1S3Z A;  4CAV A;  2QIR A;  4BBH A;  4KSF A;  2FSR A;  4C2Z A;  3JUW A;  2Q4V A;  4MFZ A;  3GKR A;  4NCZ A;  4UFV A;  4XNH C;  1XF8 A;  1S5K A;  4QVT A;  1S60 A;  1M4D A;  3G3S A;  2OZG A;  1R57 A;  3FBU A;  4QUS A;  3LOD A;  4NSQ A;  4CAX A;  4HNY B;  3IWG A;  4UFW A;  2Z3O A;  3FB3 A;  4GS4 A;  5FVJ A;  5AG5 A;  2VXK A;  1NSL A;  2YNC C;  3S6G A;  4L89 A;  2ATR A;  2A4N A;  4CYP A;  2KCW A;  1M44 A;  3SXN A;  3S6H A;  2BSW A;  2Q44 A;  4F0Y A;  2HUZ A;  4CGL A;  2PRB A;  2GAN A;  5AG6 A;  2OU2 A;  3TOB A;  1YGH A;  4B11 A;  3CXP A;  3D8P A;  2X7B A;  4U9Z A;  1TIQ A;  2PSW A;  5KTD A;  2P6F A;  3DSB A;  4KOW A;  2PQ8 A;  1YLE A;  4ZGY B;  1IIC A;  1IYL A;  2J8N A;  3S6F A;  4B5O A;  4LX9 A;  3W91 A;  2VQY A;  1RXT A;  5J8F A;  4MFP A;  2GE3 A;  4R57 A;  1IYK A;  4AG7 A;  2WSA A;  1YR0 A;  3BLN A;  1CM0 A;  1QST A;  2CNM A;  5G22 A;  3VWE A;  4B14 A;  1KUX A;  5IX3 A;  4M85 A;  3PP9 A;  4YGO A;  1BO4 A;  2Z3M A;  2C27 A;  4CRZ B;  1I12 A;  1YVO A;  1Z9U A;  4ORF A;  2VBQ A;  4PV6 A;  5G1Z A;  5JPH A;  3QB8 A;  4AG9 A;  4U5Y A;  1Q2Y A;  2FXF A;  4MFQ A;  4MFL A;  4B12 A;  4B10 A;  2FT0 A;  2B3U A;  2WPW A;  5AG4 A;  2AJ6 A;  4CGP A;  2ZW7 A;  1Q2D A;  2ZW4 A;  4HKF A;  3IGR A;  2JDC A;  2Q4Y A;  4II9 A;  1Y9W A;  2B58 A;  5JQ4 A;  4CRY B;  4M3S A;  4UCM A;  3R9F A;  3UY5 A;  2ARH A;  4CAF A;  2D4O A;  2G3A A;  5C82 A;  1MJ9 A;  3I3G A;  4JXR A;  3C26 A;  1M1D A;  4CYQ A;  2BEI A;  3N7Z A;  4U9Y A;  3TCV A;  3EC4 A;  3TE4 A;  4XPD B;  4R87 A;  1YVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...