4B14A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 26)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 115
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b14A00
5AG4A 5AG6A 5G22A 3IWEA 4CAEA 4C2ZA 4C7IA 5AG7A 3IU1A 2WUUA 4B14A 4UCPA 4A31A 5G21A 4BBHA 4UFXA 4B10A 4C2XA 4C68A 4CAFA 4CGOA 4A30A 4A33A 4A32A 5A27A 5A28A 4B12A 4CYPA 4CYOA 5AG5A 4A95A 3JTKA 4CYNA 2WSAA 4CGPA 3H5ZA 4UCNA 2YNCA 5G20A 4UFVA 4UCMA 2YNDA 4CGNA 4C2YA 4A2ZA 4C7HA 4CGMA 4CGLA 2YNCC 4B13A 4UFWA 4CYQA 5G1ZA 5AGEA 2YNEA 4B11A 3IU2A
chains in the Genus database with same CATH superfamily
2O4HA 3KQXA 4NGMA 5AG6A 2F5IA 2PJ9A 4A37A 1M4DA 4IAVA 4P4EA 5ISVA 3S6HA 1DE4C 1FY7A 2ZEHA 1Q2DA 4H6UA 4HNYB 1VKCA 3K2KA 4MHDA 5LRJA 5JPHA 6CPAA 4XPDC 5A28A 3TO7A 1EE3P 2J9AA 2IJZA 4H89A 1B6BA 2EVNA 4A95A 1CM0A 3RO0A 4CYNA 3PB9X 2C6GA 1A2ZA 2J8NA 2Q4ZA 2Z10A 3EO4A 4OAEA 2CTBA 2I00A 2OZHA 1PUAA 2G3TA 2PJBA 4KSFA 3ZJ0A 3DSBA 4JYWA 1S7NA 5GCNA 4FUUA 2PJ0A 4UEZA 4P4DA 2PCUA 4MHZA 3SHPA 2EK9A 2ZW7A 3B3VA 3B8GA 3PFEA 1Z8TA 2B4DA 4MCSA 2G0BA 4NGRA 5JGFA 2YGWA 3IU1A 5HXDA 4A31A 4C2XA 4CRYB 3BHXA 4UFXA 4NJQA 5E96A 1XRYA 3BI1A 3PP9A 2PVVA 3EFAA 3KKWA 4MY0A 4KOTA 4EMEA 3H8FA 3PZJA 2Q4YA 1F2OA 1IGBA 1MJ9A 2IL4A 3SJEA 4UCMA 3V7ZA 2EUIA 1TXRA 2Z3KA 4QUSA 4R9MA 3S9MA 3FEDA 4NF1A 4DNCA 4P4IA 4FBEA 3WC6A 5F09A 1PYTB 3CXQA 2ABZA 2Q51A 2WPXA 3F5BA 4KOSA 2QYVA 4E8OA 1AYEA 1S5KA 3WC7A 1YLEA 1Z4EA 2G3AA 3D67A 1TIQA 1LFWA 2C6PA 2ZEDA 4F8ZA 2HV2A 3D7GA 3GYAA 4RI1A 4U9ZA 3HLPA 5JQ4A 3IO1A 3BI0A 2PJ2A 4P6YA 4PXEA 1VHEA 4A32A 3TX8A 1QSNA 1XIXA 2XEFA 3MGDA 4OC3A 3WT4A 1Y0YA 4ZX9A 3NE8A 1VIXA 1JWQA 1YMEA 3DNSA 5EMIA 3W91A 4F9VA 4DUKA 2YNCA 3ISZA 4MMOA 4II9A 2CTCA 2C27A 4CGMA 2P6EA 5LYIA 3FF3A 4NGNA 4ZY2A 2C6CA 4HNXB 2BO9A 3PB7X 4PK2A 3DR6A 3D7DA 3IC1A 1L0CA 2ZOGA 2EBJA 2ZPAA 4L89A 1CJWA 5KTDA 4H2KA 4UBRA 1Z2LA 1YREA 4L8AA 2XEGA 1B87A 5H84A 3I1UA 2R7HA 4KSIA 3IWEA 3BLNA 1M1DA 2ZXVA 4MHNA 4MBUA 5EC4A 4ZGYB 4PXDA 3CPAA 2EK8A 4IK2A 3S9LA 5JM6A 4P45A 3QNVA 1N71A 3DR8A 4R8FA 4RN7A 3KQZA 3LWUA 1M4LA 1LOKA 4ZY1A 1BOBA 1S7KA 3GY9A 3H5ZA 5F49A 1ON0A 4PPZA 2Z0ZA 2GREA 1BPNA 4KORA 4UIBA 4NGSA 1ZG8A 4UFWA 4CYQA 2AFOA 2PJ7A 3IIBA 1XMBA 4IF5A 2CNTA 3H4QA 4NEXA 1CX8A 2QECA 4P4BA 3EC4A 3FH4A 2OOTA 4B5PB 3H8EA 4AB7A 5AG4A 2ZENA 4XPDB 4NGQA 4O23A 5IB9A 4KVOE 1XBUA 4C2ZA 2AE6A 2FS5A 4ORFA 2R1IA 4KOYA 2Q7SA 3PB8X 4KVXA 3FJUA 1CPSA 1CP6A 2QVPA 3D4UA 5ELYA 1FT7A 1R43A 2VZZA 1TKJA 4LUAA 2BEIA 1PCAA 4E2AA 3B3CA 4UWJA 3WABA 2B5GA 3CPXA 3EY5A 1WK4A 2GIVA 2HUZA 5G20A 4CAVA 5LYLA 1R3NA 4KOVA 2I3CA 4Y49C 3CDXA 4KS9A 4ONWA 3RAMA 2ODFA 4B13A 2PC1A 3TO6A 5G1ZA 4JJXA 3LMSA 3D3SA 2FT0A 3KR5A 1VGYA 1UFHA 3IU2A 1XOVA 3SJXA 5K8OA 2J8MA 2B3UA 4C7IA 1YK3A 2AFMA 3K9TA 4MXUA 2PE3A 5G21A 3R9GA 3N7ZA 4A39A 4P4FA 4OKOA 4PXCA 4A30A 1Q2CA 4KOXA 1U6MA 2BL1A 2B3VA 2VXKA 5J8CA 3L2NA 5DWNA 2JEWA 1IICA 2GANA 3TE4A 1Z8WA 5J8FA 2PJ5A 4IUSA 2PIYA 4X2TA 3S9NA 4MFLA 2VEZA 3PRTA 4GS4A 4UFVA 1HEEA 2GLJA 4HPSA 4OC0A 4CGLA 2IQ6A 4R87A 5DWMA 1Y0RA 5K8MA 1IOIA 4ZBGA 2Q7BA 1VHOA 1Z8XA 3GIUA 2OB0A 4FWUA 4W9YA 3VH9A 2GE3A 1YQEA 4EFDA 2FSRA 2VL1A 1MK4A 4A38A 3NH5A 3D7FA 3I3GA 4ZI6A 3IWGA 3BXMA 3FEEA 1YVOA 3CXSA 2ZW6A 2XEIA 2V8HA 3IEHA 1Y9KA 3KHZA 2PQ8A 3ISXA 2FCKA 2JLMA 4PSWA 1PU9A 1Y7EA 2V8GA 3LD2A 3S6GA 4EVYA 1GHEA 2AFZA 4AG9A 3SI1A 2V8VA 1BPMA 1S3ZA 1S7LA 1VHSA 3JUWA 3PEIA 3R1KA 1BLLE 3D2MA 3IJ3A 1IYLA 1DTDA 4NGTA 2Q0YA 4OC2A 3FNCA 4QBJA 5BWAB 4G1PA 2GLFA 1H8LA 4MCPA 1I21A 2Z11A 1Z5RA 4NCZA 4K30A 3V8IA 4RUHA 1F2PA 1YLOA 2AFUA 1QSMA 3A9LA 3CZXA 4CRZB 3PFOA 5D8NA 5F46A 2PJAA 4UF4A 4FD6A 5HMNA 2GFQA 2J8RA 2PJ8A 4KLWA 3G3SA 5C82A 3FRMA 4CS0B 4A33A 4EWTA 2PJ6A 5IB0A 4YGOA 3G8WA 2P6FA 2PJCA 2REEA 4R76A 5H86A 4R6TA 3TCVA 3JTKA 5J1QA 4HNWB 4UCNA 1RTQA 1S7FA 2YNDA 4CGNA 2HQYA 4C7HA 1Q7LA 2BUEA 4MI4A 2OU2A 5AGEA 1YSJA 3GUXA 5HVFA 4K3NA 4MFZA 1YVKA 1OZPA 1M4GA 3FB3A 4X5KA 2NMTA 2OR4A 2PRQA 2POKA 1ZLHA 3R9FA 3TT2A 4KVME 4NGPA 2DEAA 2Z3NA 4CPAA 2QMLA 2WUUA 1ARLA 2D4OA 4MHYA 4B10A 2B4BA 4TWEA 2FXFA 2C1CA 5A27A 5CBMA 4NJRA 2ANPA 4Y49B 4KLVA 4F6AA 3FX6A 2P6GA 3JRUA 4KSAA 2VZYA 2JBJA 1X10A 1P0HA 2JBKA 1XJOA 5HVHA 4WJBA 2AFWA 3E0KA 2YNCC 1CBXA 3N5FA 1Z9UA 2CIJA 4OMEA 3CXPA 2Q44A 4B5OA 1Y9WA 2G9DA 5KTCA 3VATA 1HDQA 1LANA 1CG2A 4M6HA 3S6FA 2PSWA 2ARHA 4PV6A 4FAIA 3C26A 4R7MA 2AFXA 2DPSA 2EWBA 3BJ8A 1FNOA 2R8VA 3R96A 2CXAA 4OC1A 1IOFA 1M4IA 3B3TA 2D4PA 3IWWA 3MRUA 4OIDA 4LX9A 5THWA 4CYOA 2AJ6A 5AG5A 5FVJA 2BOAA 2WSAA 1MJBA 3KGQA 1YW6A 3KR4A 1I12A 3NH8A 4PK3A 4A94A 5I4MA 2Z3OA 1F57A 1LAPA 4MFKA 3B3SA 3ZZIA 2VI7A 2BSWA 2ZEMA 3QB8A 3TOBA 5LRKA 2QIRA 3FVLA 4XPLA 1JQGA 1RO5A 5AG7A 1P4NA 1XFOA 1XEBA 2HB6A 2XEJA 5JH9A 4CAFA 4F0YA 5K8PA 2ZEFA 1OBRA 1QMUA 2FE7A 3QAYA 1QSRA 4KOWA 4NSQA 1X12A 2FIAA 3IFEA 2A4NA 3DDDA 1S60A 3VARA 4KZTA 1TKFA 3DGVA 2JDDA 4M85A 4JD6A 3F8KA 1YW4A 3D8PA 3TOAA 4BMHA 3D66A 4MJ8A 8CPAA 5HVGA 3EXNA 2B4DB 2GU2A 4P44A 4UWIA 4R57A 5F48A 3R9EA 2R98A 4F0XA 3PBBA 4GXHA 4CAEA 4KOUA 3LODA 3SXNA 2ZEGA 4FD5A 1NSLA 1QQ9A 4J3GA 2ZEEA 4UIAA 3TC8A 4QC6A 4MFPA 4ZYQA 1XMTA 5IX3A 3R95A 2FL4A 4M3SA 3GKRA 2O53A 4MFJA 3TFYA 2PRBA 4KUBA 4X8IA 3SJFA 1SQHA 4DJLA 4I49A 4QVTA 4TNUA 3RZAA 3BJ7A 4OC4A 1KUXA 1NMTA 2I79A 3KZWA 5C88A 3WR7A 3T9YA 3DLJA 4R3KA 3NFZA 5HH1A 4A2ZA 3B3WA 1NE9A 2WYRA 5CNPA 2DXQA 2F8HA 1ARMA 2DPTA 2EO8A 2FIWA 2Q04A 2Z3MA 4B11A 1XE4A 3IGRA 4JLYA 1HDUA 2CNSA 1KUYA 2Y0MA 2ZW4A 3PB4X 3WC5A 2F7VA 3T90A 1YX0A 3HUVA 3P2FA 5LRGA 3FBUA 5EBVA 4P4JA 3V38A 2Z3PA 2K5TA 3GB0A 2KCWA 4NXYA 4ZX8A 1LRZA 3SXOA 3RBUA 2ZOFA 2PJ1A 1Y7RA 2WZNA 4JZ0A 5F47A 4U9YA 4AG7A 4MHPA 5KTAA 4CGPA 3FIXA 5IV0A 4MRIA 1TF9A 4YFJA 1GYTA 3TO9A 5LYFA 4UEFA 1IYKA 1QSTA 3D2PA 1CPXA 2RB7A 1Z8LA 2OH1A 2OZGA 3PGPA 5D29A 2DF5A 4OC5A 3D7HA 4OADA 1TF8A 4PQAA 1IU8A 2RFHA 3KI9A 3T8WA 2PVWA 3FMCA 1TKHA 1BO4A 1IIDA 4BD9A 2P0WA 4JXRA 1KUVA 1I1DA 4QB9A 4BBHA 4UCPA 4Z65A 1YGHA 4ZY0A 3FYNA 1IB1E 1K4JA 3FXTA 3SJGA 1ZLIA 2H5MA 4LQ6A 2WPWA 2V77A 2VQYA 1ZG9A 3S6KA 1CP7A 2O28A 3QAHA 4ONUA 2REFA 5LYDA 2QJ8A 3FECA 2BCOA 4MY3A 4UEEA 4X3RA 4MCQA 4LQGA 2CF4A 2ATRA 3H8GA 2FVGA 3B7IA 4AVCA 4R3LA 2NSMA 4FD7A 3KASA 1QSOA 3PB6X 3I9SA 4U5YA 3LACA 4AXVA 4YU9A 1LAMA 2PJ4A 4DYOA 2B58A 4B14A 2IMOA 1Q2YA 4C68A 1V0CA 1ZO0A 1YR0A 4XNHB 4P10A 4CGOA 3W6XA 1KZFA 4CAXA 4MFQA 1R57A 3D68A 4WWVA 2B5GB 4B12A 1ELLP 3KHXA 4XPKA 2HC9A 5DS0A 4F9UA 3NA6A 2JDCA 2PR8A 2ZEOA 4MCRA 2OZUA 2X7BA 4OLLA 1AUGA 1BAVA 1RXTA 3K9UA 3OWCA 4YWYA 4C2YA 4E0AA 4FD4A 3VWEA 4B6ZA 1WWZA 2AFSA 2YNEA 5K8NA 2NYQA 4AVAA 3NH4A 4HKFA 3PBEA 2PDOA 4JWPA 3TTHA 2CY2A 2Q4VA 2VBQA 2JEVA 2ZEPA 4OIWA 4GM5A 1LCPA 2Q43A 4IHMA 4JXQA 1ZG7A 5G22A 4PSXA 3RNZA 3VWDA 3B35A 4AVBA 1ELMP 1M44A 1J4JA 4H6ZA 4B5PA 4OP4A 1UWYA 3KL9A 1XF8A 1IY7A 3UY5A 4UA3A 3B2YA 4Q38A 7CPAA 4Q36A 2RC4A 3CT9A 3NE7A 3RYOA 5CPAA 3W6SA 2PJ3A 4CYPA 5I0CA 2PIZA 1AMPA 4XNHC 2Z3LA 3GLJA 3JVNA 3P2HA 4BINA 3MN8A 1MJAA 4NFRA 2CNMA 2ZW5A 4PXBA 2ZELA 4Q7AA 1Z4RA 4KUAA 1NSAA 4RS2A 3SI0A 4M6GA 2PR1A 4M6IA 1KWMA 4YRHA 3F0AA 3SI2A 4CAWA 2V8DA
chains in the Genus database with same CATH topology
5AG6A 2F5IA 1M4DA 5ISVA 3S6HA 1FY7A 5JPHA 1Q2DA 4H6UA 4HNYB 1VKCA 4MHDA 4XPDC 5A28A 3TO7A 4H89A 1B6BA 2EVNA 4A95A 1CM0A 4CYNA 2J8NA 2Z10A 3EO4A 4OAEA 2I00A 2OZHA 1PUAA 2G3TA 4KSFA 3ZJ0A 3DSBA 1S7NA 5GCNA 3SHPA 2ZW7A 3B8GA 2B4DA 2G0BA 2YGWA 3IU1A 4A31A 4C2XA 4CRYB 4UFXA 5E96A 3PP9A 3EFAA 4MY0A 3KKWA 4KOTA 3PZJA 2Q4YA 1MJ9A 2IL4A 4UCMA 2EUIA 2Z3KA 4QUSA 4R9MA 4NF1A 4DNCA 3CXQA 2WPXA 3F5BA 4KOSA 4E8OA 1S5KA 1YLEA 1Z4EA 2G3AA 1TIQA 2HV2A 3GYAA 4RI1A 4U9ZA 5JQ4A 4A32A 1QSNA 1XIXA 3MGDA 3DNSA 3W91A 2YNCA 4II9A 2C27A 4CGMA 2P6EA 4HNXB 4PK2A 3DR6A 5KTDA 1L0CA 2ZPAA 4L89A 1CJWA 4UBRA 1YREA 4L8AA 5H84A 1B87A 2R7HA 3IWEA 3BLNA 1M1DA 2ZXVA 4MBUA 5EC4A 4ZGYB 1N71A 3DR8A 1BOBA 1S7KA 3GY9A 3H5ZA 5F49A 1ON0A 2Z0ZA 4KORA 4UFWA 4CYQA 4IF5A 2CNTA 3H4QA 4NEXA 2QECA 3EC4A 5AG4A 4B5PB 4AB7A 4XPDB 4KVOE 4C2ZA 2AE6A 2FS5A 4ORFA 2R1IA 4KOYA 4KVXA 2VZZA 4LUAA 2BEIA 4E2AA 4UWJA 2B5GA 4CAVA 3EY5A 1WK4A 2GIVA 2HUZA 5G20A 4KOVA 4Y49C 4KS9A 4B13A 2PC1A 3TO6A 5G1ZA 4JJXA 3D3SA 2FT0A 1UFHA 3IU2A 2J8MA 2B3UA 4C7IA 1YK3A 3R9GA 5G21A 3N7ZA 4A30A 1Q2CA 4KOXA 1U6MA 2BL1A 2B3VA 2VXKA 5J8CA 5DWNA 1IICA 2GANA 3TE4A 5J8FA 4IUSA 4MFLA 2VEZA 4GS4A 4UFVA 4CGLA 4R87A 5DWMA 4ZBGA 2Q7BA 2OB0A 2GE3A 2FSRA 1MK4A 3I3GA 3IWGA 1YVOA 3CXSA 2ZW6A 1Y9KA 2PQ8A 2FCKA 2JLMA 4PSWA 1PU9A 3LD2A 3S6GA 4EVYA 1GHEA 4AG9A 1S3ZA 1S7LA 1VHSA 3JUWA 3R1KA 3D2MA 1IYLA 2Q0YA 3FNCA 4QBJA 5BWAB 1I21A 2Z11A 4NCZA 4K30A 3V8IA 3A9LA 1QSMA 4CRZB 5F46A 4FD6A 5HMNA 2J8RA 4KLWA 5C82A 3G3SA 3FRMA 4CS0B 4A33A 5IB0A 4YGOA 3G8WA 2P6FA 2REEA 5H86A 3TCVA 3JTKA 4HNWB 4UCNA 1S7FA 2YNDA 4CGNA 2HQYA 4C7HA 2BUEA 4MI4A 2OU2A 5AGEA 4MFZA 1YVKA 1OZPA 1M4GA 3FB3A 4X5KA 2NMTA 3TT2A 3R9FA 4KVME 2Z3NA 2QMLA 2WUUA 2D4OA 4B10A 2B4BA 2FXFA 5A27A 4Y49B 4KLVA 4F6AA 2P6GA 4KSAA 2VZYA 1P0HA 3E0KA 2YNCC 1Z9UA 3CXPA 2Q44A 4B5OA 1Y9WA 5KTCA 3S6FA 2PSWA 2ARHA 4PV6A 3C26A 2DPSA 3BJ8A 3R96A 2R8VA 2CXAA 1M4IA 2D4PA 4LX9A 4CYOA 2AJ6A 5AG5A 5FVJA 2WSAA 1MJBA 1I12A 4PK3A 2Z3OA 4MFKA 3ZZIA 2VI7A 2BSWA 3QB8A 3TOBA 2QIRA 4XPLA 1RO5A 5AG7A 1P4NA 1XEBA 4CAFA 4F0YA 2FE7A 1QSRA 4KOWA 4NSQA 2FIAA 2A4NA 3DDDA 1S60A 4KZTA 2JDDA 4M85A 4JD6A 3F8KA 3D8PA 3TOAA 4BMHA 4MJ8A 3EXNA 2B4DB 4UWIA 4R57A 5F48A 3R9EA 2R98A 4F0XA 4CAEA 4KOUA 3LODA 3SXNA 1NSLA 4FD5A 4J3GA 4QC6A 4MFPA 1XMTA 5IX3A 3R95A 2FL4A 4M3SA 3GKRA 4MFJA 3TFYA 2PRBA 4KUBA 1SQHA 4I49A 4QVTA 3BJ7A 1KUXA 1NMTA 2I79A 5C88A 3WR7A 3T9YA 4R3KA 5HH1A 4A2ZA 1NE9A 5CNPA 2DXQA 2DPTA 2Q04A 2Z3MA 2FIWA 4B11A 1XE4A 3IGRA 4JLYA 2CNSA 1KUYA 2Y0MA 2ZW4A 3T90A 1YX0A 3P2FA 3FBUA 5EBVA 2Z3PA 2K5TA 2KCWA 4NXYA 1LRZA 3SXOA 1Y7RA 5F47A 4AG7A 4U9YA 5KTAA 4CGPA 3FIXA 5IV0A 4YFJA 3TO9A 1IYKA 1QSTA 3D2PA 3PGPA 2OH1A 2OZGA 4OADA 1BO4A 1IIDA 2P0WA 4JXRA 1KUVA 1I1DA 4QB9A 4BBHA 4UCPA 1YGHA 3FYNA 1IB1E 1K4JA 3FXTA 2H5MA 2WPWA 2VQYA 3S6KA 2O28A 3QAHA 4ONUA 2REFA 4MY3A 2ATRA 4AVCA 4R3LA 4FD7A 1QSOA 3I9SA 4U5YA 2B58A 4B14A 1Q2YA 4C68A 1V0CA 1ZO0A 1YR0A 4XNHB 4CGOA 3W6XA 1KZFA 4CAXA 4MFQA 1R57A 2B5GB 4B12A 4XPKA 2JDCA 2PR8A 2OZUA 2X7BA 4OLLA 1RXTA 3K9UA 3OWCA 4C2YA 4E0AA 4FD4A 3VWEA 1WWZA 2YNEA 4AVAA 4HKFA 4JWPA 2PDOA 3TTHA 2CY2A 2Q4VA 2VBQA 2JEVA 4JXQA 5G22A 4PSXA 3VWDA 4AVBA 1M44A 1J4JA 4H6ZA 4B5PA 1XF8A 3UY5A 4UA3A 4Q38A 4Q36A 2RC4A 3RYOA 3NE7A 3W6SA 4CYPA 5I0CA 4XNHC 2Z3LA 3JVNA 3P2HA 1MJAA 2CNMA 2ZW5A 1Z4RA 4KUAA 4RS2A 2PR1A 4YRHA 3F0AA 4CAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG4 A;  5AG6 A;  5G22 A;  3IWE A;  4CAE A;  4C2Z A;  4C7I A;  5AG7 A;  3IU1 A;  2WUU A;  4B14 A;  4UCP A;  4A31 A;  5G21 A;  4BBH A;  4UFX A;  4B10 A;  4C2X A;  4C68 A;  4CAF A;  4CGO A;  4A30 A;  4A33 A;  4A32 A;  5A27 A;  5A28 A;  4B12 A;  4CYP A;  4CYO A;  5AG5 A;  4A95 A;  3JTK A;  4CYN A;  2WSA A;  4CGP A;  3H5Z A;  4UCN A;  2YNC A;  5G20 A;  4UFV A;  4UCM A;  2YND A;  4CGN A;  4C2Y A;  4A2Z A;  4C7H A;  4CGM A;  4CGL A;  2YNC C;  4B13 A;  4UFW A;  4CYQ A;  5G1Z A;  5AGE A;  2YNE A;  4B11 A;  3IU2 A; 
#chains in the Genus database with same CATH topology
 2O4H A;  3KQX A;  4NGM A;  5AG6 A;  2F5I A;  2PJ9 A;  4A37 A;  1M4D A;  4IAV A;  4P4E A;  5ISV A;  3S6H A;  1DE4 C;  1FY7 A;  2ZEH A;  1Q2D A;  4H6U A;  4HNY B;  1VKC A;  3K2K A;  4MHD A;  5LRJ A;  5JPH A;  6CPA A;  4XPD C;  5A28 A;  3TO7 A;  1EE3 P;  2J9A A;  2IJZ A;  4H89 A;  1B6B A;  2EVN A;  4A95 A;  1CM0 A;  3RO0 A;  4CYN A;  3PB9 X;  2C6G A;  1A2Z A;  2J8N A;  2Q4Z A;  2Z10 A;  3EO4 A;  4OAE A;  2CTB A;  2I00 A;  2OZH A;  1PUA A;  2G3T A;  2PJB A;  4KSF A;  3ZJ0 A;  3DSB A;  4JYW A;  1S7N A;  5GCN A;  4FUU A;  2PJ0 A;  4UEZ A;  4P4D A;  2PCU A;  4MHZ A;  3SHP A;  2EK9 A;  2ZW7 A;  3B3V A;  3B8G A;  3PFE A;  1Z8T A;  2B4D A;  4MCS A;  2G0B A;  4NGR A;  5JGF A;  2YGW A;  3IU1 A;  5HXD A;  4A31 A;  4C2X A;  4CRY B;  3BHX A;  4UFX A;  4NJQ A;  5E96 A;  1XRY A;  3BI1 A;  3PP9 A;  2PVV A;  3EFA A;  3KKW A;  4MY0 A;  4KOT A;  4EME A;  3H8F A;  3PZJ A;  2Q4Y A;  1F2O A;  1IGB A;  1MJ9 A;  2IL4 A;  3SJE A;  4UCM A;  3V7Z A;  2EUI A;  1TXR A;  2Z3K A;  4QUS A;  4R9M A;  3S9M A;  3FED A;  4NF1 A;  4DNC A;  4P4I A;  4FBE A;  3WC6 A;  5F09 A;  1PYT B;  3CXQ A;  2ABZ A;  2Q51 A;  2WPX A;  3F5B A;  4KOS A;  2QYV A;  4E8O A;  1AYE A;  1S5K A;  3WC7 A;  1YLE A;  1Z4E A;  2G3A A;  3D67 A;  1TIQ A;  1LFW A;  2C6P A;  2ZED A;  4F8Z A;  2HV2 A;  3D7G A;  3GYA A;  4RI1 A;  4U9Z A;  3HLP A;  5JQ4 A;  3IO1 A;  3BI0 A;  2PJ2 A;  4P6Y A;  4PXE A;  1VHE A;  4A32 A;  3TX8 A;  1QSN A;  1XIX A;  2XEF A;  3MGD A;  4OC3 A;  3WT4 A;  1Y0Y A;  4ZX9 A;  3NE8 A;  1VIX A;  1JWQ A;  1YME A;  3DNS A;  5EMI A;  3W91 A;  4F9V A;  4DUK A;  2YNC A;  3ISZ A;  4MMO A;  4II9 A;  2CTC A;  2C27 A;  4CGM A;  2P6E A;  5LYI A;  3FF3 A;  4NGN A;  4ZY2 A;  2C6C A;  4HNX B;  2BO9 A;  3PB7 X;  4PK2 A;  3DR6 A;  3D7D A;  3IC1 A;  1L0C A;  2ZOG A;  2EBJ A;  2ZPA A;  4L89 A;  1CJW A;  5KTD A;  4H2K A;  4UBR A;  1Z2L A;  1YRE A;  4L8A A;  2XEG A;  1B87 A;  5H84 A;  3I1U A;  2R7H A;  4KSI A;  3IWE A;  3BLN A;  1M1D A;  2ZXV A;  4MHN A;  4MBU A;  5EC4 A;  4ZGY B;  4PXD A;  3CPA A;  2EK8 A;  4IK2 A;  3S9L A;  5JM6 A;  4P45 A;  3QNV A;  1N71 A;  3DR8 A;  4R8F A;  4RN7 A;  3KQZ A;  3LWU A;  1M4L A;  1LOK A;  4ZY1 A;  1BOB A;  1S7K A;  3GY9 A;  3H5Z A;  5F49 A;  1ON0 A;  4PPZ A;  2Z0Z A;  2GRE A;  1BPN A;  4KOR A;  4UIB A;  4NGS A;  1ZG8 A;  4UFW A;  4CYQ A;  2AFO A;  2PJ7 A;  3IIB A;  1XMB A;  4IF5 A;  2CNT A;  3H4Q A;  4NEX A;  1CX8 A;  2QEC A;  4P4B A;  3EC4 A;  3FH4 A;  2OOT A;  4B5P B;  3H8E A;  4AB7 A;  5AG4 A;  2ZEN A;  4XPD B;  4NGQ A;  4O23 A;  5IB9 A;  4KVO E;  1XBU A;  4C2Z A;  2AE6 A;  2FS5 A;  4ORF A;  2R1I A;  4KOY A;  2Q7S A;  3PB8 X;  4KVX A;  3FJU A;  1CPS A;  1CP6 A;  2QVP A;  3D4U A;  5ELY A;  1FT7 A;  1R43 A;  2VZZ A;  1TKJ A;  4LUA A;  2BEI A;  1PCA A;  4E2A A;  3B3C A;  4UWJ A;  3WAB A;  2B5G A;  3CPX A;  3EY5 A;  1WK4 A;  2GIV A;  2HUZ A;  5G20 A;  4CAV A;  5LYL A;  1R3N A;  4KOV A;  2I3C A;  4Y49 C;  3CDX A;  4KS9 A;  4ONW A;  3RAM A;  2ODF A;  4B13 A;  2PC1 A;  3TO6 A;  5G1Z A;  4JJX A;  3LMS A;  3D3S A;  2FT0 A;  3KR5 A;  1VGY A;  1UFH A;  3IU2 A;  1XOV A;  3SJX A;  5K8O A;  2J8M A;  2B3U A;  4C7I A;  1YK3 A;  2AFM A;  3K9T A;  4MXU A;  2PE3 A;  5G21 A;  3R9G A;  3N7Z A;  4A39 A;  4P4F A;  4OKO A;  4PXC A;  4A30 A;  1Q2C A;  4KOX A;  1U6M A;  2BL1 A;  2B3V A;  2VXK A;  5J8C A;  3L2N A;  5DWN A;  2JEW A;  1IIC A;  2GAN A;  3TE4 A;  1Z8W A;  5J8F A;  2PJ5 A;  4IUS A;  2PIY A;  4X2T A;  3S9N A;  4MFL A;  2VEZ A;  3PRT A;  4GS4 A;  4UFV A;  1HEE A;  2GLJ A;  4HPS A;  4OC0 A;  4CGL A;  2IQ6 A;  4R87 A;  5DWM A;  1Y0R A;  5K8M A;  1IOI A;  4ZBG A;  2Q7B A;  1VHO A;  1Z8X A;  3GIU A;  2OB0 A;  4FWU A;  4W9Y A;  3VH9 A;  2GE3 A;  1YQE A;  4EFD A;  2FSR A;  2VL1 A;  1MK4 A;  4A38 A;  3NH5 A;  3D7F A;  3I3G A;  4ZI6 A;  3IWG A;  3BXM A;  3FEE A;  1YVO A;  3CXS A;  2ZW6 A;  2XEI A;  2V8H A;  3IEH A;  1Y9K A;  3KHZ A;  2PQ8 A;  3ISX A;  2FCK A;  2JLM A;  4PSW A;  1PU9 A;  1Y7E A;  2V8G A;  3LD2 A;  3S6G A;  4EVY A;  1GHE A;  2AFZ A;  4AG9 A;  3SI1 A;  2V8V A;  1BPM A;  1S3Z A;  1S7L A;  1VHS A;  3JUW A;  3PEI A;  3R1K A;  1BLL E;  3D2M A;  3IJ3 A;  1IYL A;  1DTD A;  4NGT A;  2Q0Y A;  4OC2 A;  3FNC A;  4QBJ A;  5BWA B;  4G1P A;  2GLF A;  1H8L A;  4MCP A;  1I21 A;  2Z11 A;  1Z5R A;  4NCZ A;  4K30 A;  3V8I A;  4RUH A;  1F2P A;  1YLO A;  2AFU A;  1QSM A;  3A9L A;  3CZX A;  4CRZ B;  3PFO A;  5D8N A;  5F46 A;  2PJA A;  4UF4 A;  4FD6 A;  5HMN A;  2GFQ A;  2J8R A;  2PJ8 A;  4KLW A;  3G3S A;  5C82 A;  3FRM A;  4CS0 B;  4A33 A;  4EWT A;  2PJ6 A;  5IB0 A;  4YGO A;  3G8W A;  2P6F A;  2PJC A;  2REE A;  4R76 A;  5H86 A;  4R6T A;  3TCV A;  3JTK A;  5J1Q A;  4HNW B;  4UCN A;  1RTQ A;  1S7F A;  2YND A;  4CGN A;  2HQY A;  4C7H A;  1Q7L A;  2BUE A;  4MI4 A;  2OU2 A;  5AGE A;  1YSJ A;  3GUX A;  5HVF A;  4K3N A;  4MFZ A;  1YVK A;  1OZP A;  1M4G A;  3FB3 A;  4X5K A;  2NMT A;  2OR4 A;  2PRQ A;  2POK A;  1ZLH A;  3R9F A;  3TT2 A;  4KVM E;  4NGP A;  2DEA A;  2Z3N A;  4CPA A;  2QML A;  2WUU A;  1ARL A;  2D4O A;  4MHY A;  4B10 A;  2B4B A;  4TWE A;  2FXF A;  2C1C A;  5A27 A;  5CBM A;  4NJR A;  2ANP A;  4Y49 B;  4KLV A;  4F6A A;  3FX6 A;  2P6G A;  3JRU A;  4KSA A;  2VZY A;  2JBJ A;  1X10 A;  1P0H A;  2JBK A;  1XJO A;  5HVH A;  4WJB A;  2AFW A;  3E0K A;  2YNC C;  1CBX A;  3N5F A;  1Z9U A;  2CIJ A;  4OME A;  3CXP A;  2Q44 A;  4B5O A;  1Y9W A;  2G9D A;  5KTC A;  3VAT A;  1HDQ A;  1LAN A;  1CG2 A;  4M6H A;  3S6F A;  2PSW A;  2ARH A;  4PV6 A;  4FAI A;  3C26 A;  4R7M A;  2AFX A;  2DPS A;  2EWB A;  3BJ8 A;  1FNO A;  2R8V A;  3R96 A;  2CXA A;  4OC1 A;  1IOF A;  1M4I A;  3B3T A;  2D4P A;  3IWW A;  3MRU A;  4OID A;  4LX9 A;  5THW A;  4CYO A;  2AJ6 A;  5AG5 A;  5FVJ A;  2BOA A;  2WSA A;  1MJB A;  3KGQ A;  1YW6 A;  3KR4 A;  1I12 A;  3NH8 A;  4PK3 A;  4A94 A;  5I4M A;  2Z3O A;  1F57 A;  1LAP A;  4MFK A;  3B3S A;  3ZZI A;  2VI7 A;  2BSW A;  2ZEM A;  3QB8 A;  3TOB A;  5LRK A;  2QIR A;  3FVL A;  4XPL A;  1JQG A;  1RO5 A;  5AG7 A;  1P4N A;  1XFO A;  1XEB A;  2HB6 A;  2XEJ A;  5JH9 A;  4CAF A;  4F0Y A;  5K8P A;  2ZEF A;  1OBR A;  1QMU A;  2FE7 A;  3QAY A;  1QSR A;  4KOW A;  4NSQ A;  1X12 A;  2FIA A;  3IFE A;  2A4N A;  3DDD A;  1S60 A;  3VAR A;  4KZT A;  1TKF A;  3DGV A;  2JDD A;  4M85 A;  4JD6 A;  3F8K A;  1YW4 A;  3D8P A;  3TOA A;  4BMH A;  3D66 A;  4MJ8 A;  8CPA A;  5HVG A;  3EXN A;  2B4D B;  2GU2 A;  4P44 A;  4UWI A;  4R57 A;  5F48 A;  3R9E A;  2R98 A;  4F0X A;  3PBB A;  4GXH A;  4CAE A;  4KOU A;  3LOD A;  3SXN A;  2ZEG A;  4FD5 A;  1NSL A;  1QQ9 A;  4J3G A;  2ZEE A;  4UIA A;  3TC8 A;  4QC6 A;  4MFP A;  4ZYQ A;  1XMT A;  5IX3 A;  3R95 A;  2FL4 A;  4M3S A;  3GKR A;  2O53 A;  4MFJ A;  3TFY A;  2PRB A;  4KUB A;  4X8I A;  3SJF A;  1SQH A;  4DJL A;  4I49 A;  4QVT A;  4TNU A;  3RZA A;  3BJ7 A;  4OC4 A;  1KUX A;  1NMT A;  2I79 A;  3KZW A;  5C88 A;  3WR7 A;  3T9Y A;  3DLJ A;  4R3K A;  3NFZ A;  5HH1 A;  4A2Z A;  3B3W A;  1NE9 A;  2WYR A;  5CNP A;  2DXQ A;  2F8H A;  1ARM A;  2DPT A;  2EO8 A;  2FIW A;  2Q04 A;  2Z3M A;  4B11 A;  1XE4 A;  3IGR A;  4JLY A;  1HDU A;  2CNS A;  1KUY A;  2Y0M A;  2ZW4 A;  3PB4 X;  3WC5 A;  2F7V A;  3T90 A;  1YX0 A;  3HUV A;  3P2F A;  5LRG A;  3FBU A;  5EBV A;  4P4J A;  3V38 A;  2Z3P A;  2K5T A;  3GB0 A;  2KCW A;  4NXY A;  4ZX8 A;  1LRZ A;  3SXO A;  3RBU A;  2ZOF A;  2PJ1 A;  1Y7R A;  2WZN A;  4JZ0 A;  5F47 A;  4U9Y A;  4AG7 A;  4MHP A;  5KTA A;  4CGP A;  3FIX A;  5IV0 A;  4MRI A;  1TF9 A;  4YFJ A;  1GYT A;  3TO9 A;  5LYF A;  4UEF A;  1IYK A;  1QST A;  3D2P A;  1CPX A;  2RB7 A;  1Z8L A;  2OH1 A;  2OZG A;  3PGP A;  5D29 A;  2DF5 A;  4OC5 A;  3D7H A;  4OAD A;  1TF8 A;  4PQA A;  1IU8 A;  2RFH A;  3KI9 A;  3T8W A;  2PVW A;  3FMC A;  1TKH A;  1BO4 A;  1IID A;  4BD9 A;  2P0W A;  4JXR A;  1KUV A;  1I1D A;  4QB9 A;  4BBH A;  4UCP A;  4Z65 A;  1YGH A;  4ZY0 A;  3FYN A;  1IB1 E;  1K4J A;  3FXT A;  3SJG A;  1ZLI A;  2H5M A;  4LQ6 A;  2WPW A;  2V77 A;  2VQY A;  1ZG9 A;  3S6K A;  1CP7 A;  2O28 A;  3QAH A;  4ONU A;  2REF A;  5LYD A;  2QJ8 A;  3FEC A;  2BCO A;  4MY3 A;  4UEE A;  4X3R A;  4MCQ A;  4LQG A;  2CF4 A;  2ATR A;  3H8G A;  2FVG A;  3B7I A;  4AVC A;  4R3L A;  2NSM A;  4FD7 A;  3KAS A;  1QSO A;  3PB6 X;  3I9S A;  4U5Y A;  3LAC A;  4AXV A;  4YU9 A;  1LAM A;  2PJ4 A;  4DYO A;  2B58 A;  4B14 A;  2IMO A;  1Q2Y A;  4C68 A;  1V0C A;  1ZO0 A;  1YR0 A;  4XNH B;  4P10 A;  4CGO A;  3W6X A;  1KZF A;  4CAX A;  4MFQ A;  1R57 A;  3D68 A;  4WWV A;  2B5G B;  4B12 A;  1ELL P;  3KHX A;  4XPK A;  2HC9 A;  5DS0 A;  4F9U A;  3NA6 A;  2JDC A;  2PR8 A;  2ZEO A;  4MCR A;  2OZU A;  2X7B A;  4OLL A;  1AUG A;  1BAV A;  1RXT A;  3K9U A;  3OWC A;  4YWY A;  4C2Y A;  4E0A A;  4FD4 A;  3VWE A;  4B6Z A;  1WWZ A;  2AFS A;  2YNE A;  5K8N A;  2NYQ A;  4AVA A;  3NH4 A;  4HKF A;  3PBE A;  2PDO A;  4JWP A;  3TTH A;  2CY2 A;  2Q4V A;  2VBQ A;  2JEV A;  2ZEP A;  4OIW A;  4GM5 A;  1LCP A;  2Q43 A;  4IHM A;  4JXQ A;  1ZG7 A;  5G22 A;  4PSX A;  3RNZ A;  3VWD A;  3B35 A;  4AVB A;  1ELM P;  1M44 A;  1J4J A;  4H6Z A;  4B5P A;  4OP4 A;  1UWY A;  3KL9 A;  1XF8 A;  1IY7 A;  3UY5 A;  4UA3 A;  3B2Y A;  4Q38 A;  7CPA A;  4Q36 A;  2RC4 A;  3CT9 A;  3NE7 A;  3RYO A;  5CPA A;  3W6S A;  2PJ3 A;  4CYP A;  5I0C A;  2PIZ A;  1AMP A;  4XNH C;  2Z3L A;  3GLJ A;  3JVN A;  3P2H A;  4BIN A;  3MN8 A;  1MJA A;  4NFR A;  2CNM A;  2ZW5 A;  4PXB A;  2ZEL A;  4Q7A A;  1Z4R A;  4KUA A;  1NSA A;  4RS2 A;  3SI0 A;  4M6G A;  2PR1 A;  4M6I A;  1KWM A;  4YRH A;  3F0A A;  3SI2 A;  4CAW A;  2V8D A; 
#chains in the Genus database with same CATH homology
 5AG6 A;  2F5I A;  1M4D A;  5ISV A;  3S6H A;  1FY7 A;  5JPH A;  1Q2D A;  4H6U A;  4HNY B;  1VKC A;  4MHD A;  4XPD C;  5A28 A;  3TO7 A;  4H89 A;  1B6B A;  2EVN A;  4A95 A;  1CM0 A;  4CYN A;  2J8N A;  2Z10 A;  3EO4 A;  4OAE A;  2I00 A;  2OZH A;  1PUA A;  2G3T A;  4KSF A;  3ZJ0 A;  3DSB A;  1S7N A;  5GCN A;  3SHP A;  2ZW7 A;  3B8G A;  2B4D A;  2G0B A;  2YGW A;  3IU1 A;  4A31 A;  4C2X A;  4CRY B;  4UFX A;  5E96 A;  3PP9 A;  3EFA A;  4MY0 A;  3KKW A;  4KOT A;  3PZJ A;  2Q4Y A;  1MJ9 A;  2IL4 A;  4UCM A;  2EUI A;  2Z3K A;  4QUS A;  4R9M A;  4NF1 A;  4DNC A;  3CXQ A;  2WPX A;  3F5B A;  4KOS A;  4E8O A;  1S5K A;  1YLE A;  1Z4E A;  2G3A A;  1TIQ A;  2HV2 A;  3GYA A;  4RI1 A;  4U9Z A;  5JQ4 A;  4A32 A;  1QSN A;  1XIX A;  3MGD A;  3DNS A;  3W91 A;  2YNC A;  4II9 A;  2C27 A;  4CGM A;  2P6E A;  4HNX B;  4PK2 A;  3DR6 A;  5KTD A;  1L0C A;  2ZPA A;  4L89 A;  1CJW A;  4UBR A;  1YRE A;  4L8A A;  5H84 A;  1B87 A;  2R7H A;  3IWE A;  3BLN A;  1M1D A;  2ZXV A;  4MBU A;  5EC4 A;  4ZGY B;  1N71 A;  3DR8 A;  1BOB A;  1S7K A;  3GY9 A;  3H5Z A;  5F49 A;  1ON0 A;  2Z0Z A;  4KOR A;  4UFW A;  4CYQ A;  4IF5 A;  2CNT A;  3H4Q A;  4NEX A;  2QEC A;  3EC4 A;  5AG4 A;  4B5P B;  4AB7 A;  4XPD B;  4KVO E;  4C2Z A;  2AE6 A;  2FS5 A;  4ORF A;  2R1I A;  4KOY A;  4KVX A;  2VZZ A;  4LUA A;  2BEI A;  4E2A A;  4UWJ A;  2B5G A;  4CAV A;  3EY5 A;  1WK4 A;  2GIV A;  2HUZ A;  5G20 A;  4KOV A;  4Y49 C;  4KS9 A;  4B13 A;  2PC1 A;  3TO6 A;  5G1Z A;  4JJX A;  3D3S A;  2FT0 A;  1UFH A;  3IU2 A;  2J8M A;  2B3U A;  4C7I A;  1YK3 A;  3R9G A;  5G21 A;  3N7Z A;  4A30 A;  1Q2C A;  4KOX A;  1U6M A;  2BL1 A;  2B3V A;  2VXK A;  5J8C A;  5DWN A;  1IIC A;  2GAN A;  3TE4 A;  5J8F A;  4IUS A;  4MFL A;  2VEZ A;  4GS4 A;  4UFV A;  4CGL A;  4R87 A;  5DWM A;  4ZBG A;  2Q7B A;  2OB0 A;  2GE3 A;  2FSR A;  1MK4 A;  3I3G A;  3IWG A;  1YVO A;  3CXS A;  2ZW6 A;  1Y9K A;  2PQ8 A;  2FCK A;  2JLM A;  4PSW A;  1PU9 A;  3LD2 A;  3S6G A;  4EVY A;  1GHE A;  4AG9 A;  1S3Z A;  1S7L A;  1VHS A;  3JUW A;  3R1K A;  3D2M A;  1IYL A;  2Q0Y A;  3FNC A;  4QBJ A;  5BWA B;  1I21 A;  2Z11 A;  4NCZ A;  4K30 A;  3V8I A;  3A9L A;  1QSM A;  4CRZ B;  5F46 A;  4FD6 A;  5HMN A;  2J8R A;  4KLW A;  5C82 A;  3G3S A;  3FRM A;  4CS0 B;  4A33 A;  5IB0 A;  4YGO A;  3G8W A;  2P6F A;  2REE A;  5H86 A;  3TCV A;  3JTK A;  4HNW B;  4UCN A;  1S7F A;  2YND A;  4CGN A;  2HQY A;  4C7H A;  2BUE A;  4MI4 A;  2OU2 A;  5AGE A;  4MFZ A;  1YVK A;  1OZP A;  1M4G A;  3FB3 A;  4X5K A;  2NMT A;  3TT2 A;  3R9F A;  4KVM E;  2Z3N A;  2QML A;  2WUU A;  2D4O A;  4B10 A;  2B4B A;  2FXF A;  5A27 A;  4Y49 B;  4KLV A;  4F6A A;  2P6G A;  4KSA A;  2VZY A;  1P0H A;  3E0K A;  2YNC C;  1Z9U A;  3CXP A;  2Q44 A;  4B5O A;  1Y9W A;  5KTC A;  3S6F A;  2PSW A;  2ARH A;  4PV6 A;  3C26 A;  2DPS A;  3BJ8 A;  3R96 A;  2R8V A;  2CXA A;  1M4I A;  2D4P A;  4LX9 A;  4CYO A;  2AJ6 A;  5AG5 A;  5FVJ A;  2WSA A;  1MJB A;  1I12 A;  4PK3 A;  2Z3O A;  4MFK A;  3ZZI A;  2VI7 A;  2BSW A;  3QB8 A;  3TOB A;  2QIR A;  4XPL A;  1RO5 A;  5AG7 A;  1P4N A;  1XEB A;  4CAF A;  4F0Y A;  2FE7 A;  1QSR A;  4KOW A;  4NSQ A;  2FIA A;  2A4N A;  3DDD A;  1S60 A;  4KZT A;  2JDD A;  4M85 A;  4JD6 A;  3F8K A;  3D8P A;  3TOA A;  4BMH A;  4MJ8 A;  3EXN A;  2B4D B;  4UWI A;  4R57 A;  5F48 A;  3R9E A;  2R98 A;  4F0X A;  4CAE A;  4KOU A;  3LOD A;  3SXN A;  1NSL A;  4FD5 A;  4J3G A;  4QC6 A;  4MFP A;  1XMT A;  5IX3 A;  3R95 A;  2FL4 A;  4M3S A;  3GKR A;  4MFJ A;  3TFY A;  2PRB A;  4KUB A;  1SQH A;  4I49 A;  4QVT A;  3BJ7 A;  1KUX A;  1NMT A;  2I79 A;  5C88 A;  3WR7 A;  3T9Y A;  4R3K A;  5HH1 A;  4A2Z A;  1NE9 A;  5CNP A;  2DXQ A;  2DPT A;  2Q04 A;  2Z3M A;  2FIW A;  4B11 A;  1XE4 A;  3IGR A;  4JLY A;  2CNS A;  1KUY A;  2Y0M A;  2ZW4 A;  3T90 A;  1YX0 A;  3P2F A;  3FBU A;  5EBV A;  2Z3P A;  2K5T A;  2KCW A;  4NXY A;  1LRZ A;  3SXO A;  1Y7R A;  5F47 A;  4AG7 A;  4U9Y A;  5KTA A;  4CGP A;  3FIX A;  5IV0 A;  4YFJ A;  3TO9 A;  1IYK A;  1QST A;  3D2P A;  3PGP A;  2OH1 A;  2OZG A;  4OAD A;  1BO4 A;  1IID A;  2P0W A;  4JXR A;  1KUV A;  1I1D A;  4QB9 A;  4BBH A;  4UCP A;  1YGH A;  3FYN A;  1IB1 E;  1K4J A;  3FXT A;  2H5M A;  2WPW A;  2VQY A;  3S6K A;  2O28 A;  3QAH A;  4ONU A;  2REF A;  4MY3 A;  2ATR A;  4AVC A;  4R3L A;  4FD7 A;  1QSO A;  3I9S A;  4U5Y A;  2B58 A;  4B14 A;  1Q2Y A;  4C68 A;  1V0C A;  1ZO0 A;  1YR0 A;  4XNH B;  4CGO A;  3W6X A;  1KZF A;  4CAX A;  4MFQ A;  1R57 A;  2B5G B;  4B12 A;  4XPK A;  2JDC A;  2PR8 A;  2OZU A;  2X7B A;  4OLL A;  1RXT A;  3K9U A;  3OWC A;  4C2Y A;  4E0A A;  4FD4 A;  3VWE A;  1WWZ A;  2YNE A;  4AVA A;  4HKF A;  4JWP A;  2PDO A;  3TTH A;  2CY2 A;  2Q4V A;  2VBQ A;  2JEV A;  4JXQ A;  5G22 A;  4PSX A;  3VWD A;  4AVB A;  1M44 A;  1J4J A;  4H6Z A;  4B5P A;  1XF8 A;  3UY5 A;  4UA3 A;  4Q38 A;  4Q36 A;  2RC4 A;  3RYO A;  3NE7 A;  3W6S A;  4CYP A;  5I0C A;  4XNH C;  2Z3L A;  3JVN A;  3P2H A;  1MJA A;  2CNM A;  2ZW5 A;  1Z4R A;  4KUA A;  4RS2 A;  2PR1 A;  4YRH A;  3F0A A;  4CAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...