4ORFA

Camp-binding acyltransferase from mycobacterium smegmatis, mutant r95k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
319
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIEPGLIIGEIALLRDAPKTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTSETLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 96
structure length 319
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4orfA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4orfA02
5I91A 3QOPA 2BNOA 2Z69A 3I59A 3WW2A 1IICA 3RDIA 1L3JA 3TTHA 2VEZA 4E2SA 3UY5A 3E97A 3NKTA 2HQYA 3H50A 2OZJA 4ZU5A 3RZZA 3ES1A 1ON0A 3N7ZA 3I7DA 1ZRDA 4RS2A 5T3NA 5KHIA 3BPZA 1P0HA 3D82A 4AXOA 1EP0A 3CEWA 3RPQA 2AE6A 4FD6A 2H6BA 2DCTA 4UBRA 2GC2A 2O8QA 3VWEA 2BSWA 2PR1A 4YFJA 1KUXA 4KU8A 2B58A 2QECA 1OFNA 1GQHA 4WBBA 4FAHA 5KHGA 2J8RA 1YFWA 3JUWA 1EY2A 4LTAA 2O28A 4DNCA 4FT8A 2VPVA 3ROUA 1ZX5A 5I0TA 1Z9UA 1I12A 3ETQA 2IXHA 2VZZA 2JDCA 4KLWA 3PNAA 2X7BA 1O5LA 1J3QA 1PMIA 4KWLA 3EC4A 2P17A 2OZGA 1L0CA 1CAXB 4HVRA 4YSFA 3ELNA 2IL4A 1PU9A 3OD0A 2BL1A 1WK4A 5E1RA 2P6EA 4LULA 2KXLA 1BOBA 3FX3A 4Y49C 4D7TA 4KOWA 1Q2YA 4LUAA 4IEPA 4HN0A 3R1KA 1PUAA 4I2OA 2EVNA 4R9MA 4IEVA 5DWMA 3ZJ0A 2KCWA 2GAUA 4KWJA 3PP9A 5D1IA 2CAVA 4KVOE 2B3VA 5ISVA 3TOAA 3HIFA 3LOIA 2J8MA 1IIDA 2ZW7A 2P6GA 1Z4EA 2ARHA 1RC6A 4KL1A 4Z07A 3QB8A 4RI1A 3V8IA 2IXKA 2IC1A 4UBGA 1RXTA 4JWPA 4XEZA 4XPLA 1WLTA 2WPWA 4HKFA 1NXMA 5F48A 3RYOA 3PVBB 3IIAA 4MH0E 5FLJA 3S7IA 1YVOA 2VXKA 1YX0A 5KBFA 3G7DA 1ZZ7A 4QBJA 4MGIE 1Y3TA 3DDDA 3P2FA 3D2MA 4YGOA 2A4NA 5C88A 1XE7A 4PIYA 5BPXA 1QSMA 4IEYA 5J8FA 1HW5A 4ZBGA 4XFGA 3SCGA 4XFHA 1I1DA 1TIQA 2ZW4A 1OMIA 1YK3A 4Y49B 2EVXA 2VZYA 3IGRA 1Q2CA 1XF8A 3S6FA 1ZREA 2BUEA 3PGPA 1QXRA 1IB1E 4IEQA 4IF5A 1V70A 2GC3A 4FAGA 4HNYB 5JQ4A 4Q0VA 2PSWA 1GQGA 1M4GA 2EA7A 3MZHA 1KUVA 2ZXVA 3MYXA 4U5YA 1J3PA 2HJIA 2PFWA 1S7KA 3CXSA 1UCXA 4HSJA 2WPXA 4KVME 3MGDA 1UD1A 1CAXA 5JR7B 1IPJA 4KOXA 2B5HA 2K5TA 3FIXA 4XPKA 1QSOA 4KU7A 1NE9A 3LZZA 3TE4A 4B5OA 1PM7A 2IXJA 2PAEA 4J1WA 1ZRCA 1X8EA 5F49A 3NE7A 4H89A 1QSNA 4LA2A 5FPZA 2B3UA 2AJ6A 2FIAA 5E96A 3G8WA 4Q29A 1OD5A 2XLFA 1SQHA 5FDBA 1O3RA 4MGKE 4MZUA 1QXJA 2O1QA 2BNMA 2B9UA 3RYKA 4EWEA 2B8MA 1H1IA 2D93A 5H84A 5HMNA 4QUSA 2PQ8A 5CU1A 4AG9A 4CS0B 5KTCA 5KTDA 5KHJA 3KGLA 2FXFA 4XF9A 3CXPA 4LUMA 1Y9WA 1CAUB 3FB3A 3FRMA 3I9SA 1I21A 4XF4A 3LA3A 4JVAA 3WW1A 4UXAA 2B4DA 2FCKA 3TO6A 2D40A 2PAMA 4Z82A 4IESA 4E8OA 4NVPA 2V09A 4QM8A 4BIFA 4FD7A 2VBQA 4ZU7A 4HN1A 4JLYA 1NE6A 5IV0A 4R3KA 1J3RA 2GZWA 2ZW5A 1X82A 4MBUA 4B5PB 1BO4A 4K30A 1H1MA 1Q2DA 4M3SA 3H1WA 1KZFA 4L8AA 2ZW6A 3IDBB 2FE7A 1VJ2A 1FY7A 1YWKA 3LA7A 1LR5A 4O9GA 1Q3EA 4II9A 4I3PA 4HLTA 3HT1A 4YARA 5J3UA 4EVYA 5JSPA 1B87A 4FBFA 2Q44A 3TCVA 3F0AA 3HT2A 3BJ7A 3WW3A 2OA2A 1XEBA 3P2HA 4XFAA 4JTNA 4N9IA 3SHRA 2HUZA 3TT2A 3ZZIA 3GY9A 1O3TA 4QGNA 2PRBA 4YNIA 4Q0PA 1KUYA 5JSRA 2I79A 2Y0MA 3ES4A 2Q1ZB 1O3QA 4PK3A 3F8KA 5I93A 1DZRA 3B02A 3BCWA 2OU2A 4UWJA 3H4QA 4R8HA 4XF0A 3BB6A 5I0UA 1QSTA 4OLLA 4XF1A 3M3IA 4F7ZA 3LODA 3W91A 4OAEA 1CAVB 5I0CA 4B29A 1U12A 4QVTA 2CGPA 2ZCWA 4E2QA 3TNQA 2XL9A 3K9UA 4X5KA 1CAWA 3OCPA 4R87A 1IPKA 2MHFA 4D7SA 5DWNA 3DV8A 4WVZA 1LB2A 4KOVA 5IX3A 5I8YA 1CAVA 3ACLA 4I09A 1S3ZA 2Z2SB 3OF1A 4Q0QA 3IWGA 1ZRRA 5LEJA 3E6CC 2GANA 3D2PA 3OWCA 2PQQA 3D3SA 5J8CA 1LRHA 3HQXA 4OFGA 4R57A 4A2UA 2ZKLA 1NZCA 3IBMA 1P4NA 1YHFA 5FLHA 4I0AA 2R7HA 2BGCA 2PA7A 3MPBA 4EV0A 3UKTA 5I0SA 2XGXA 4XPDC 3PZJA 1IYKA 1QSRA 3NW4A 4HSLA 2Y0OA 4B5PA 4F0YA 1J58A 2I45A 1O3SA 1S60A 5KHKA 2OH1A 1ZNPA 4I49A 1X7NA 2BYVE 4HBNA 3BJ8A 4FD5A 4AB7A 1J1LA 1CJWA 4NCZA 4Q0SA 3W6SA 4KUAA 2CNMA 4PV6A 4MUVA 1RUNA 1I5ZA 2OB0A 4JTOA 2Q4SA 4PSXA 2IXCA 3H7JA 5HH1A 4HVOA 5BV6A 3R96A 3CXQA 3IWZA 4I0BA 4HMZA 3SMHA 1B6BA 4XNHB 4I01A 2B4DB 1YFXA 1X8MA 3SXWA 5JSOA 3QACA 3FJSA 2Z11A 5FPXA 2ATFA 1YFYA 5LRRA 2R1IA 5I8SA 3UKVA 4CRZB 1S7NA 3CJXA 4QB9A 3EBRA 5LEKA 3T9YA 3LWCA 4CYDA 5F1RA 4XETA 2G3AA 3CL1A 1M44A 1YFUA 3I59B 2XLGA 4NEXA 3BLNA 1VHSA 1S7LA 1NYWA 2FL4A 4H6ZA 3FZ3A 1CX4A 4IEXA 2OZHA 5JPHA 1LRZA 3E6BA 2D4OA 2R8VA 4META 3U0ZA 3DNSA 2D4PA 4LX9A 2GC1A 3NVCA 3ST7A 1CGPA 3DR6A 2GC0A 3H9AA 4QGLA 4HNXB 3TO7A 2GIVA 1OI6A 3EO4A 3EXNA 4L2NA 2REEA 4FD4A 5HI0A 2OYZA 2PDOA 1UIKA 3EO6A 4XFBA 3DKWA 4L89A 1OZPA 5EFUA 3U10A 2XKPA 1RUOA 4CAVA 2H6CA 2CAUA 4WZCA 5CVRA 1NE4A 1XIXA 4QMAA 5EBVA 3TFYA 4PSWA 1LKNA 4KOTA 2FSRA 2PAKA 3BU7A 4BYYA 3TNPB 3SCHA 1XRUA 3LAGA 4MY3A 5EC4A 4CAXA 1RO5A 4U9ZA 2UYBA 1M1DA 1K4JA 1M4IA 1UPIA 4HZFA 1SEFA 4K8FA 4IEWA 3EFAA 3U11A 2BNNA 4JJXA 4E2AA 2D5FA 4XFCA 3FWEA 4QM9A 4CAWA 2I00A 4HNWB 1VKCA 1XMTA 2FIWA 2ZPAA 4F6AA 4QXKA 1NMTA 1U6MA 2OZ6A 1WWZA 4O9EA 5JAXA 1ZVFA 5I8TA 1Z4RA 4F8AA 4LEJA 4AVBA 2P0WA 5FQ0B 3S6HA 3S0MA 3D8PA 2R98A 1MK4A 3KKWA 4KUBA 4M85A 2CNTA 4U9YA 1NSLA 4I02A 3PLQA 3NSTA 4PK2A 5H86A 4AQ2A 1WA4A 4H6UA 3GKRA 2DXQA 5J7MA 4AQ6A 2HKXA 2GH2A 3H8UA 2Q0YA 3KMHA 4MJ8A 3KGZA 2QNKA 1MJAA 4ZU4A 1YUDA 4KORA 1QWRA 4KVXA 3T90A 4EWDA 3M70A 4J3GA 1Y9QA 4R52A 2IXIA 3H1MA 1MJBA 4MGYE 1M4DA 3EJKA 4MI4A 3LA2A 1CAUA 5EZWA 4IEZA 1O7FA 1ZRFA 2FT0A 5C82A 4GS4A 1UW8A 4XFFA 3R9FA 4E2GA 2QJVA 4Q0UA 4RD7A 4IEOA 3FYNA 2B5GA 3JVNA 4NSQA 3LD2A 4JV4A 4DINB 4YYOA 1XE4A 2H0VA 3I3GA 2ETEA 4MV2A 4QC6A 4UA3A 1ZZ9A 2Z10A 3FE5A 3DN7A 2B5GB 3F5BA 4KOUA 1DZTA 3EQEA 3RNSA 2FS5A 2QDRA 3EY5A 1Q5OA 1DGRA 2VECA 2QMLA 4ORFA 1UFHA 3FBUA 4PIXA 2OZUA 4MGZE 5J48A 2CY2A 3H3ZA 3CO2A 1RTVA 4N9HA 4UWIA 5FCCA 4P9GA 2MPFA 4J1XA 3ZDSA 1ZZ8A 2G0BA 1VP6A 3S6GA 3NL1A 5F47A 3EHKA 3SHPA 5JCTA 3DSBA 2VQAA 5CNPA 4PJYA 2BEOA 2XKOA 2XLAA 3OGJA 1SQ4A 5FLIA 2N7GA 3VHRA 5BXXA 5KHHA 4CRYB 5FVJA 2Q30A 2ET7A 3GBFA 2G3TA 2PHLA 4E0AA 4ONUA 2J8NA 3VWDA 4IUSA 4LUKA 1RGSA 3GYDA 4TLFA 4YRDA 1FI2A 4BMHA 3FNCA 1S5KA 2UY9A 2ET1A 5K8SA 3E5QA 4MY0A 5E16A 5BUVA 2B4BA 4BH9A 2VQYA 1YLLA 3R95A 5KTAA 4XF3A 3TOBA 2PTMA 1YREA 3W6XA 3SCFA 4MX3A 3BALA 4H7LA 3C26A 2XL7A 2GE3A 3GYAA 4JXRA 1O4TA 1CM0A 3KCCA 5LRSA 2FQPA 4AVCA 1ZZ6A 3H7YA 5C6CA 1IYLA 3UKNA 1WGPA 2D5HA 4KZTA 1Q43A 3E5XA 2JDDA 2PYTA 2XHKA 3CLPA 3FXTA 2RC4A 2GU9A 1UIJA 3KSCA 2F5IA 3TO9A 5C8WA 1J4JA 4KOSA 4EROA 3G3SA 3QAHA 1JUHA 1ZZBA 3H1YA 2Z0ZA 2QVSB 2P6FA 3JZVA 4XFIA 1XE8A 2UYAA 4QX5A 4X6RB 2HV2A 2C0ZA 1FT9A 1QY4A 3RYRA 1EYBA 1R57A 1ZZCA 4AVAA 3D0JA 4XNHC 4JD6A 5I0RA 4YRHA 2H5MA 2REFA 1TQ5A 2CV6A 1VR3A 3E6DA 1YVKA 1S7FA 4X6QB 4QGMA 5F46A 3SXOA 4KWKA 3NJZA 4IERA 1J59A 2OPKA 2PHDA 2JLMA 3C3VA 4LLOA 1Y7RA 4OADA 2JEVA 4JXQA 3USSA 3R9EA 4LA3A 4BHPA 4IEUA 2Q04A 1V0CA 2Q4VA 4EWAA 5GCNA 3N4MA 2FMYA 3DL3A 2WFPA 2CNSA 2WC2A 3FHIB 2PR8A 3MDPA 3OTFA 2C27A 1I6XA 4UBHA 2K0GA 1CAWB 1RL3A 3WR7A 3E0KA 5CADA 2QCSB 2VI7A 4KOYA 1FXZA 5BY5A 2NMTA 4R3LA 3SXNA 2EUIA 3O14A 1O5UA 3IDCB 3H3UA 4PIZA 2ATRA 3DR8A 5FQ0A 3R6SA 1YGHA 3CF6E 3S7EA 4XPDB 4NF1A 5IB0A 3R9GA 2EAAA 2BEIA 2Q4YA 2K9ZA 4NXYA 3E5UA 4GULA 1GHEA 1DGWA 2F4PA 2IXLA 2MNGA 1SFNA 2UY8A 3D0SA 4HVQA 1MJ9A 4L11A 3B8GA 4MHDA 1YR0A 3S6KA 3I54A 3RYPA 3FFQA 3WW4A 1Y9KA 1N71A 1YLEA 2QIRA 1EPZA 5AVPA 2Q7BA 4IETA 2E9QA 4AG7A 4KLVA 2Q0AA 3L2HA 1G6NA 2PC1A
chains in the Genus database with same CATH superfamily
1B35C 2FDJA 2JDZA 2BNOA 2WT2A 1MQTC 3D5OA 2VZQA 5FZBA 4XIOA 3TTHA 5FOJB 2G9GA 2YFZA 1A3KA 3E97A 3NKTA 4Q4V2 4CXXA 5C8CA 2WZR1 2OZJA 4NWVA 2WNUC 3ES1A 3I8TA 1ZRDA 3ZN5A 4RS2A 4TN7A 4NMIA 3KHBA 3KQZA 5HCHA 2WZR2 2Y33A 3BPZA 4H55A 4N53B 1US2A 5G1ZA 3S9MA 2RS52 2QQNA 5LK7B 2H6BA 1O4ZA 2DCTA 4FD6A 4ZX9A 3VWEA 2BSWA 3M7AA 3O1UA 1V6MA 4KU8A 2RS51 1IOIA 2B58A 4IGOA 2YXSA 5J96B 4KI5M 2QQUA 1YFWA 2J1UA 1UOBA 1BBT2 2RS31 2CHHA 3ZXAC 4COWA 4LTAA 2O28A 3H5ZA 3ROUA 3UK9A 3I2DA 3VHNA 1ZX5A 4LBOA 5I0TA 4B8EA 4CCDA 5DN2A 3WC5A 3VD3A 4YZ4A 4YW3A 3WP5A 1SPPA 4PBPA 2K46A 3MW2A 4ATFA 3PNAA 2EK9A 4D3WA 2CXAA 4XHXA 1CPSA 2JDCA 3KHXA 4YU9A 1CR7A 4B7KA 3T8WA 4G9SB 3GALA 2P17A 4PLNA 2OZGA 3CJIC 4HVRA 3NV3A 2YNEA 1PU9A 4IDZA 2PJ0A 1NCRB 2BL1A 1Y0YA 5JXGA 3ZXKA 2WO7A 3WY6A 1AJOA 2R063 2EIBA 4JKLA 2BJSA 2WJSA 3NRUA 5APAA 3A0KA 2PHTA 3NNFA 3B93A 4UIBA 2EAKA 3UJQA 1AUGA 5LYDA 3R4UA 4UW5A 2VZOA 4FOVA 2VW2A 2CAVA 1C4RA 2OXBA 2C9KA 4KVOE 5JOYA 3TOAA 4UF4A 1IIDA 1G9BA 1TXRA 1Z4EA 4F9UA 1RC6A 3LSEA 3ZM8A 5FJHA 5C3SA 3QB8A 1Q8QA 2IXKA 4UBGA 2TUNA 5LY1A 1OUXA 4IV3B 2YG0A 2OPWA 4QB2A 4CAWA 3W20A 1VMFA 1WD3A 2VH9A 1OLRA 3IIAA 4MH0E 5AVAA 5FLJA 3S7IA 4XYXA 2YNDA 2GNDA 4MHZA 4C2XA 3G7DA 2ADEA 2HEWF 1LGNA 3DDDA 5FPUA 4B3NA 3P2FA 2F7VA 3A9LA 4PXBA 5THWA 3ISZA 3WP3A 3TEZA 4YWAA 1GYTA 2A4NA 2R1DA 3AP7A 3AZXA 4XFGA 3LOBA 3SCGA 1ZM1A 4XUPA 1YK3A 3AXDA 2P3YA 4CP2A 1LOCA 1HDUA 3IGRA 1CIWA 4EZHA 4AQTA 1ZREA 3LEIA 3AP5A 1AYEA 3BVCA 2JENA 2VQ0A 3CBNA 4IEQA 4W4ZA 4XQWA 3MFAA 1V70A 5IWFA 4FAGA 2Z3NA 5FZFA 3CPAA 3IU2A 4IF5A 5BNOC 3MRUA 1LHNA 3HBZA 4KSFA 4KGQA 1GLHA 4Y20A 2VY0A 2YV8A 4YW6A 3VD4A 1OUSA 2NP0A 1YQEA 5BNPA 1GQPA 2ZXVA 1C57A 2JWPA 2HB6A 5K0UB 1JTZX 2PFWA 2FZ2A 1ND2A 1YNAA 2EXKA 4OQ9A 4N7IA 2G19A 4OI4A 3THCA 1UD1A 2ZGSA 1ARMA 5CNAA 5J36A 4KOXA 3HD8B 1QSOA 2HEYF 2PQSA 3HWJA 2X5IC 4CUCA 1F15A 4Y33A 3K46A 5IHRA 3IWEA 1W6NA 4J1WA 4Q26A 2PAEA 4HK9A 2ZEHA 5FZLA 4UEEA 2XHNA 2WZPP 4H89A 5E96A 5FPZA 3UGFA 1VBA3 2AJ6A 4BMBA 2ZX3A 2QUOA 1SQHA 5F2SA 1K5MB 5FYZA 1YCIA 1D0GA 1S0CA 3ACGA 4JRAA 5EHDA 3VZOA 1O3RA 1OA2A 3KVAA 4MZUA 2BNMA 1GWMA 1K42A 2BVBA 2B8MA 4BINA 1UAIA 3ZFFA 5H84A 5CU1A 3ZFGC 5GZEA 1W6OB 2FXFA 1DQ4A 4XF9A 1UX6A 3HJRA 3VBRC 3FRMA 4HK8A 2WQ8A 4ASLA 2UWBA 4XF4A 3SJGA 3WW1A 4A3ZA 2XJTA 1BMV1 2D40A 5G20A 4Z82A 4IESA 4E8OA 2V09A 4F0XA 1M4WA 2X53S 3NQHA 2VBQA 1TG7A 1HXS3 2EBJA 5FYYA 3DGTA 2X8KA 3JU9A 4KSAA 4R3KA 4PXDA 4RUHA 4UI9L 5L36A 3KLSA 3T1MA 1DP0A 1PO13 1PO12 2YPDA 3IB3A 2Z5WA 3IN9A 4SBVA 1BO4A 5EV7A 5FZOB 3SH3A 2CWMA 3B69A 1JZ2A 4UFVA 3H1WA 1YJKA 5FPBA 2AFMA 3ZMNA 4GA9A 1CZTA 1MPXA 1ULDA 3NAPA 2QTWB 2FE7A 1VJ2A 1FY7A 4UFLA 2GALA 2VOTA 1IS3A 1JYTA 2CYFA 4I3PA 4YZ5A 3TYJA 5FYBA 4WVWA 4AXVA 3HT1A 4P02B 3NJVA 1IG0A 1ALYA 1WW7A 2YMZA 1LENA 3F0AA 3P2HA 1WCQA 1UYZA 5G21A 2ZKNA 4GMP3 4N9IA 4XFAA 2ZEYA 3TT2A 3V7ZA 1OH4A 2RS53 5FZIA 4QGNA 1O3TA 3GCXA 3Q9OA 4KBZA 2ZA9A 4UW4A 4Q0PA 4WV8A 1CX8A 1LAMA 1QMUA 1YW4A 4OULA 2I79A 2D6NA 4F83A 2ANPA 3B3TA 1NA1A 3K3OA 1XOVA 4FPGA 1ELMP 1C1FA 1IZ3A 4NHXA 4P9JA 4QPGC 4MG2A 3F8KA 3MUY1 1YC61 5F3IA 4OMDA 4BQ4A 3B02A 3BCWA 2V8VA 4UWJA 2EK8A 2JICA 4XF0A 2ZAAA 3NKGA 3ZYIB 5ABJA 4JAAA 5FY4A 4IGQA 1W8UA 2BFUL 2R49A 4MHRA 2ZHMA 3VBUC 1UWWA 1N3OA 4YFWA 4A30A 2IVJA 1TZOA 4YM1A 3D67A 4F8ZA 2QQMA 2A70A 2CIJA 4F7ZA 4GH4C 5G05L 4MFQA 2IWGB 4AG4A 5I0CA 2VVEA 1U12A 3WOGA 3KT1A 5ACA3 2CGPA 2ZCWA 1ZG7A 2AFOA 2WUUA 3LIHA 4IE5A 3J8F2 3IFEA 4P08A 4R87A 3UV9A 5AGEA 1IPKA 5DWNA 1RJ8A 5DUXA 1GSLA 2WN2A 1LB2A 5F5QA 1C5IA 1OF4A 1L7QA 1KFUL 3AX4A 4LBMA 2P3JA 2LALA 2Z2SB 3OF1A 4HETA 3D2PA 3OWCA 2WRAA 2R0HA 4C91A 3AL5A 5IX3A 1D2SA 5J8CA 2D3PA 3HQXA 4BQ5A 4YGCA 2ZKLA 1NZCA 4FPCA 4AEMA 4TNUA 1RUF1 1HV0A 1VRH2 2AFWA 1Q8SA 3LB9A 3OPWA 3OY8B 3UKTA 4LKEA 2VCBA 2ILMA 3PZJA 4RQPA 4XPDC 1WBLA 2BU9A 5LRJA 1MEC3 3C7GA 3IC1A 1RUI1 3MLLA 3N7LA 5J98B 3T3YA 3WG1A 4DPNA 4BM8A 5KHKA 2IJZA 1ZLHA 4PDWB 5A7WB 1ZNPA 4ASMB 3OGRA 1U0AA 3T0BA 3ZSKA 3PEIA 2W94A 4M6GA 3JXSA 4PV6A 4C0BA 5ERLA 2CNMA 3J26N 4CEYA 2OB0A 1I5ZA 3MW4A 2HYKA 1CP7A 1XSQA 2HWD1 1HJFA 2JG8C 2Q4SA 4QB1A 5FWEA 3PHMA 5BV6A 4LOSA 5KWRA 1CWPA 4ET7A 3R96A 4W6WA 1OQ1A 2HYXA 1MZFA 2HWD2 4HMZA 2YU1A 3J9SA 3SMHA 4I01A 2D97A 5FZEA 5C70A 4YWYA 1X8MA 3U4XA 4UFHA 3QNVA 3QACA 1CIYA 3DXUA 1W8HA 2DCYA 4DO0A 3FJSA 4YW5A 2Z11A 1UO9A 5FPXA 3J7LA 3GXUA 3AP9A 5BNNA 3MUZ1 3K9TA 5JIUA 2R1IA 1BVVA 1LU1A 4CRZB 1IKQA 1AX0A 1W8WA 2JDMA 2XR4A 5FUPA 4R8FA 3EBRA 4XUQA 3Q8CA 3B00A 5HCFA 5LK5A 3AKSA 4TLGA 5GALA 5SV5A 1S0FA 2WNOA 2Q8EA 5FR3A 1YFUA 4XACA 3FMGA 3VDBA 2XLGA 1ZLIA 4FSJA 4A4AA 3FLPA 4AEDC 1EUUA 1S7LA 2YNCA 4NRMA 2GH8A 3GZUC 3D3AA 3U75A 2V72A 1PNFA 3MIDA 2R8VA 4META 4B12A 4CTEA 3OGGA 1FPN1 4MXWA 3NVCA 5CFDC 5AC93 1CGPA 1WA6X 2ZOEB 5FYCA 2ENRA 4AI3A 1OI6A 1R1A1 1U5XA 4FCAA 5FP9A 3WF1A 1FPN2 4B14A 2C6CA 4XCAA 4M0HA 1SDWA 4EWTA 4XFBA 3AMQA 4UFWA 1WW5A 3ZKYA 5ANNA 3JUUA 1APNA 3FBMA 4A31A 1IHMA 5EFUA 4CAVA 2WQ4A 3ATGA 1RYYA 5CVRA 1NE4A 4FPLA 3WDXA 2PCUA 5JH9A 3CDZB 1R093 3USUB 5FYVA 2PHFA 1XU2A 1RITA 2G9FA 5FP8A 1LKNA 4MVTA 5DG1A 4BQXA 4KOTA 3ORJA 2W47A 5IJRA 4N43A 4P45A 4Z1VA 1RUF3 4MY3A 4Q4Y2 4XTPA 4I0WB 4UF0B 2WINB 5EC4A 3AYAA 1QOOA 1QH6A 1YX0A 3W5MA 4WM7B 4K8FA 5T54A 3VD7A 4D8MA 3WABA 4XMAA 4JJXA 4E2AA 2D5FA 3O0WA 3R05A 2WL1A 4FPKA 5DZFA 4A7YA 2B9VA 1RUH2 1ND2B 2V5DA 3GJAA 2XWBB 5ACA2 5EJZB 1HB4A 2A6ZA 4OC2A 5AG6A 2OVUA 3RZMA 3AK0A 5ACA1 1CZSA 1T6BX 3KKWA 4KUBA 3AJZA 4U9YA 5EPAA 4I02A 1W99A 3PLQA 3NSTA 1BK1A 1HXS1 1WA4A 2LW8A 1HRV2 4RQPB 3U14A 2Z3LA 3GKRA 2E7QA 3WP4A 2DXQA 5C88A 4C2ZA 2GH2A 3VB9A 4XUOA 4MJ8A 1MJAA 1HRV1 4UCMA 1YUDA 3GCWA 4PDWA 5A7WA 1QJX2 1QJX3 4HG6B 5H9SA 2Q8OA 2VO5A 4KVXA 3T90A 3M70A 1QMJA 1Y9QA 1QOTA 3ZYBA 1JXNA 4FPFA 4Q4V3 4XBQA 3BN6A 1IPSA 4MXWB 4COVA 2IXIA 2X10A 3KV4A 5FZ9A 1AR81 5KR7A 1MJBA 3A22A 1WCKA 5LA1A 3POIA 2EIGA 4UEFA 2ZGKA 5HVGA 5H9PA 1AMPA 2ZEZA 3P3PA 5C4WB 5KTAA 2OT7A 4Y1VA 1FV3A 1H8VA 2WNEA 3UGHA 4AEDA 2WZNA 5C82A 1CX1A 4H2KA 5HPOA 2QJVA 4MHYA 3FYNA 5A3LA 3NJXA 4NPMA 2F8HA 2PJBA 3JVNA 2W39A 1JZ6A 4Y1YA 3V65A 5CB7A 1EAH2 2KD7A 4QC6A 1WCUA 2ARBA 3ZYJB 2CGOA 1ENSA 1ZZ9A 5ANQA 4N8MA 4NAOA 2Z10A 3LE0A 4GB31 1Y43B 2YGMA 3M3QA 1OQEA 2ZGRA 2B5GB 5HV4A 1DZTA 1D4M1 1TME3 2RHPA 4Q1RA 3RNSA 3THPA 3IM0A 4OI1A 4CGOA 4Y5Z0 3EY5A 2IVIB 1DGRA 2VECA 2XVLA 4UF0A 2QYVA 1QQP2 1QQP3 4NHLA 1VBD3 4ORFA 4AQSA 2QMLA 2W95A 4OIDA 5HVHA 4P9YA 2WLQA 1BEV3 4MGZE 5J48A 3H3ZA 1MS1A 5IB9A 2ARXA 4N9HA 5FCCA 2O53A 3AC0A 5IT6A 1OKOA 3AKRA 5KTDA 4J1XA 4Y22B 3ZDSA 2G0BA 2QFEA 1DG6A 4BISA 4LQGA 5FPVA 1VB4A 5D29A 1GP4A 2VQUA 4NOTA 2PIYA 3NO8A 2ZMLA 4AHXA 4ZKTB 5AFEA 4DUWA 1E57A 2ERFA 2VCCA 5KHHA 1XQNA 3U78A 5LWBA 2VZPA 1GOGA 4MADA 1DCSA 3POJA 4IE7A 2J8NA 2PJ1A 4LUKA 3GYDA 4QWNA 3AVRA 1UZVA 2VXRA 4P5YA 2V8GA 1PK6B 1CN1A 1D7PM 2HWF2 3FNCA 2UY9A 4OCTA 5EYYA 4DXTA 4CCKA 3GZTB 1HQWA 3N9LA 5BUVA 3F2ZA 2HWF1 1I5PA 4WM8B 4CPBD 1F2PA 1SCRA 2PTMA 1C8M2 4BK5A 1YREA 4CGLA 1XOYA 4AFMA 2XL7A 5A7PA 4UT5A 2RS32 1BBT1 4WZFA 5EWSA 3GDBA 4GIQA 1GUIA 4K7JA 3ME2A 3S5QA 1G9FA 1A6CA 2BDRA 4MHPA 1FATA 1ZZ6A 3FFZA 1DGRN 4FFHA 4CEYC 1KS4A 1VBB1 1VIWB 3AB0A 4DXSA 3AL6A 5A80A 5IK8A 3E5XA 1E5HA 5FPAA 1HEEA 3VZJA 4DEVA 4ZY2A 2RC4A 2RS11 1LU2A 1UIJA 1QJFA 4R9AA 2RMU1 2R32A 4Q4W2 5IVEA 3J4UH 1RUH3 1ZZBA 2RJKA 5E8AA 5JXHA 2Z0ZA 4Q38A 2P5BA 4Q4W1 5L9BA 5GZFA 4CPAA 4X6RB 5FZ0A 1FT9A 4MHNA 5FP7A 4FWUA 2EWBA 4JD6A 1FMD1 2W1WA 3ZXEA 5C5TA 2C1FA 4YW1A 4CGPA 3VBUA 1TQ5A 1XXNA 1XNBA 1YRZA 2CV6A 3HLPA 5ABJC 1PCAA 4K1YA 3HNYM 1S7FA 4NGPA 4DOUA 1JOBA 1COV1 2OPKA 2JLMA 5ABJB 4HPKB 4LLOA 4XUNA 5T50A 2JJ6A 3NNMA 3R9EA 4BHPA 2GP5A 3A7QA 5DAPA 4W9YA 3VDAA 2Q4VA 4H2AA 4M00A 5GCNA 5LBEA 3DL3A 1PIV1 3FHIB 3TRSB 4C7IA 3T2QA 2DVGA 1W2OA 1X10A 1I6XA 2JB8A 4GALA 4UBHA 2K0GA 3T09A 5AC92 2XEIA 1VBA2 3FHAA 1VMHA 2JG9B 5CFDB 3D66A 3E0KA 3WR7A 4Z2AA 1NA1C 3RQ0A 5FY8A 1AR83 2VI7A 1XYPA 3WF0A 5FWJA 3SXNA 4YPJA 1COV3 3IDCB 2QDNA 3URFA 3AKQA 5J09A 1EV12 1YGHA 1FNOA 2E7TA 4MFKA 3S7EA 4LHKA 4XPDB 4AK3A 3R9GA 1EV11 3AMHA 4JHTA 5K8MA 1C28A 1CESA 3GHMA 4YZ3A 3ZN6A 2ZX1A 3ZSEA 5AG5A 1LHVA 2OUHA 3O5SA 4YG6A 5FMOS 3ZSLA 1GHEA 2VZSA 2PJ4A 2MNGA 2HWC1 5L7OB 3K75B 1MJ9A 3V0BA 3B3VA 4MHDA 1SLTA 1YR0A 2Z3MA 2R7EB 1S0JA 4C8DA 1KRIA 4M6HA 2QIRA 1N71A 1EPZA 3FVLA 4IETA 4BQ2A 3C2UA 2A71A 1W2UA 2JECA 1VR3A 1HRI1 1NSLA 4N7UA 3IU1A 5T5JA 1CJDA 1IICA 1X36A 3RDIA 1L3JA 1W28A 3ZPYA 2VEZA 5LBFA 3VKOA 4NN0A 1O6UA 2EXHA 2QE3A 1V9U2 3H50A 5FREA 4CDQB 4OC5A 3S6GA 4ZU5A 3N7ZA 3CZXA 2ZENA 4NJQA 4XJ8A 5T3NA 3MI8A 3VBRA 5DXDA 1IY7A 1HQNA 1V9U1 1S0EA 2RG4A 3JQXA 3N9NA 2VNGA 3OPZA 3OBTA 1ODMA 2K2SA 5GLTA 1VRBA 2O4HA 3RPQA 3ZFFC 2O8QA 3PB7X 3WUDA 2PR1A 2AGSA 1KUXA 3AMPA 5CYYA 3SI0A 1OFNA 4FAHA 4I3GA 7CPAA 4PHZA 5D2AA 1AR62 4QXCA 2J8RA 1VBE2 1RUC2 3LWUA 2D43A 5FTTC 3JUWA 2VMFA 1EY2A 5LA2A 4FT8A 5C5UA 3WDWA 1GWKA 2HWE3 3ETQA 4YM2A 2VULA 2IXHA 2P4EA 3LKJA 2A6WA 5ELYA 4EFDA 2XONA 2X7BA 4PQAA 2D6PA 2ZHNA 4A7ZA 2HWB3 1IS5A 1PMIA 1H2MA 3ABZA 5I0DA 5A3PA 4Y4RA 1JQGA 4AR2A 4BA6A 2IL4A 2BP6A 5FXXA 2GP3A 3OD0A 1NLSA 4GAZA 3OG2A 3HPNA 1WK4A 5C3RA 2Y38A 5E1RA 1OXCA 5GZDA 3CMGA 2KXLA 3PDQA 1W6MA 1OOPA 1UU5A 4RR3C 1UF2C 3ZFEC 3POGA 2WFF3 4D7TA 4Y49C 1GZTA 5A3NA 1O8PA 4IEPA 4HN0A 1GZWB 3DF0A 4RL7A 5DWMA 1R082 5HCBA 3ZJ0A 2KCWA 3FLRA 3PP9A 2FDKA 4LBKA 4TSVA 4PPZA 1R092 1CJPA 1UXZA 3I3EA 2VNRA 3MEPA 4K3UA 2JDYA 5ISVA 4V1PA 2Z3KA 1JBCA 3HIFA 4LE3A 2W87A 3WEZA 4JHZA 4AZZA 2FDHA 2ARHA 4FBEA 2HWF3 4WM7A 1ND3A 5FZ6A 3VBFA 2PJ7A 5GLWA 3BI3A 1RXTA 4CP1A 4E4HA 4XEZA 1UYPA 1AR72 2PMWB 4WVMB 4OC3A 1UQXA 3I3MA 2RDSA 1KJLA 1UY3A 3RYOA 4ITCA 4NAMA 4U36A 2ZGLA 3V38A 1YVOA 3N9QA 1A34A 4URAA 1XC6A 2IMOA 1R64A 1UX7A 1GICA 2G1MA 2DFBA 4QBJA 4MGIE 1Y3TA 3V0AA 2XDVA 3N7MA 3WDTA 2EXIA 2J1TA 4YGOA 3AYDA 5CG9A 4PIYA 5BPXA 2PVWA 3VATA 1ZBA1 3HOBA 4UW6A 1HW5A 2VOWA 3PIGA 5IFTA 4ZBGA 4A2ZA 5A27A 5LW9A 2ZGQA 2HWB1 4XJ9A 4FP3A 5IUQA 1X50A 1OMIA 1I1DA 2ZW4A 4Y49B 2RVAA 1ZBA2 4NIIA 1HLCA 1R083 1SG3A 1F5FA 1UN1A 3PUAA 3H8EA 5C7GA 5FYTA 4M4RA 3SC7X 3NV2A 5A70A 5GZCA 2DBIA 5JQ4A 5F6LB 4JGYC 2ZHLA 4JDMA 1AL0G 1VAKA 2PSWA 4GJYA 2EA7A 1M4GA 5FZ8A 1Y7EA 2DEAA 1SPPB 3MYXA 4U5YA 5K9YA 2TBVA 2VZUA 2WABA 3ETPA 3ZXGA 1S7KA 4HSJA 2E51A 1BPNA 3ZXJA 2H0BA 2YB7A 4KVME 1PVC3 4ZGYB 5JXJA 5JR7B 1IPJA 4Y20B 4CDUA 3RG0A 1UZWA 2JDUA 2XJPA 3DLJA 2WSVA 3TE4A 4B5OA 1PM7A 5F49A 4I30A 3D6EA 2FVGA 5IW0A 1LOAA 1JI6A 1W9FA 4Q29A 2WWUA 5DUVA 4D0QA 1POQA 1YSJA 2FBEA 5FYHA 1RJ7A 3I2IA 1QXJA 4Q4Y3 2O1QA 2I3CA 1G7YA 2I74A 4NHMA 4AYUA 4Q8KA 5J1QA 1IGOA 4YVSB 4P4EA 1NCRC 4QUSA 4AG9A 2AR6A 4DJLA 2BW8A 2WLPA 4AI1A 2PVVA 1HX6A 3KGLA 3KWVA 4QDSA 2ZEWA 2R6QA 1Z78A 4FTBA 3CXPA 3WC6A 4B13A 1Y9WA 3FEEA 3OYWB 4JKKA 5DG2A 3I9SA 3VKFC 4JVAA 4AVSA 4JRLA 3KI9A 4UXAA 3NH5A 4IV3A 5JZGC 2PAMA 1V9U3 2Q8DA 2W1QA 3WV6A 1VALA 4FD7A 3MO4A 1US3A 1Z7S3 4LLFA 3I2GA 4HN1A 4PCRA 4JLYA 1B35A 1NE6A 1H2LA 2JE9A 2FD8A 2GZWA 3KZWA 1H6XA 2GMMA 4A3XA 1MS5A 4M3SA 2VCAA 1W2NA 3VBFC 2DTWA 3J7HA 3SNMA 4DQAA 3IDAA 1GZWA 4XDOA 1X9PA 3VH9A 3C7FA 3LA7A 3SKVA 4W50A 3O0XA 2Y60A 3AM2A 1Q3EA 1TE1B 4CA9A 4HLTA 4EN8B 2AFSA 5I4MA 3TCVA 3M4FA 3NA6A 1LOFC 2GNMA 3HT2A 3WW3A 1RUJ3 2OA2A 1UU4A 5CKQA 3BJ7A 1F31A 4NJ4A 2HUZA 1RUI3 1N1YA 2HEVF 1YQ6A 2WT1A 5JLVA 3PJQA 5JSRA 1QU0A 2V8HA 4E4ZA 2Y0MA 1Z8XA 3ES4A 2D7FA 4RSUA 3WNPA 1NXD1 2YBKA 4QQLA 1A78A 2GNBA 4AI8A 1W04A 3K77A 5GM0A 5DMYA 3B3SA 2HWD3 3H4QA 4R8HA 1Y9MA 3BB6A 4IV1B 4QX0A 1W9WA 1XRYA 4M3CE 4Y24A 2AFXA 1FMD3 3VGIA 3PTYA 3S57A 3M3IA 2DVFA 3LODA 2AC1A 2MEV2 2QQLA 2XQXA 2WYRA 1SBFA 1WWYA 4QVTA 1IU8A 1YIFA 2VD7A 4B1LA 4E2QA 4X5KA 4M0NA 4DXZA 5HXVA 2MEV1 1ST8A 1W6OA 3BKZA 3CT9A 4NPLA 1LODA 4XIKA 1QJY3 3OSDA 1RUJ2 4QU1A 5I8YA 3IWGA 3PL0A 4Q36A 1DF0A 3WF2A 4GJZA 1W8FA 2GANA 2RS13 3CHXA 4YW7A 1AYM2 3MICA 2J9AA 4BQ3A 2J42A 5EIYB 5CG8A 2B7YA 1QXPA 1TKJA 5C4WA 2WSAA 1YJLA 3HAGA 4QPIC 3BOPA 1OBNA 2XGXA 1N47A 5FZ7A 3PU3A 4HSLA 3MBWA 3PBBA 5JOWA 1J58A 4P44A 4LX9A 2BGOA 4GZ9A 1POV0 2NYYA 3MPPG 3VZMA 2IQ6A 5E89A 4COUA 1JYCA 2W5FA 4AGGA 4EJRA 4FOYA 4Q4W3 2DV9A 3PVNA 3NE8A 4OMEA 2Q5TA 1RXFA 3B01A 3DECA 3RO0A 3ZYGA 4YG0A 3T2PA 4AAXA 1CJWA 5CAZA 3KVBA 3M3OA 4COZA 4Y1XA 4HPSA 4DUKA 2E7AA 5FY0A 3AVSA 1Y9GA 1UZ0A 3BI0A 4JTOA 1OLMA 3T4HB 5LYIA 2IXCA 2FCVA 5HH1A 2CWSA 1W6PA 4JQRA 4D7YA 1CBXA 3BGAA 2PLV1 2VC9A 4FFIA 3ZX7A 3KCYA 2CDOA 1C8M3 1WMDA 2FMDA 5FKCA 3O1TA 3MN8A 1JUIA 3KS7A 4QKNA 2ATFA 1A8MA 1OC1A 2GREA 4AFBA 1LANA 4BE3A 3UKVA 2D3RA 5IVJA 1D2QA 4CCMA 1DLLA 5F1RA 1YYNA 2G3AA 1M44A 3O0VA 4AL9A 3UNPA 1JMUB 3WT3A 3Q8EA 2DURA 2WNVA 1UZYA 2VTXA 3FZ3A 3RWKX 2P6CA 5C33A 5IVVA 4H6ZA 2E31A 5JPHA 2QQIA 2ZEPA 2PHXA 3DNSA 1PO11 6CPAA 3WC7A 1MEC1 2ODFA 2GIVA 3CZJA 3PB8X 2C6PA 4QKFA 2VCMA 3G6JB 2OYZA 5HI0A 3IEHA 1LAJA 1UIKA 1XJAA 1XMBA 4A7KA 1PMHX 3P6BA 1HB2A 3T0DA 5B4NA 1LHUA 1OZPA 2J1VA 4GXHA 1C1LA 4UEZA 2WR9A 4PQQA 5LB6A 5E6HA 4WZCA 4CUAA 1H2NA 3O1RA 1MZ6A 1RUG2 3LGRA 4DUVA 3WG2A 2PE3A 2PRQA 1LHWA 4R76A 1ASJ2 4X8IA 4XC9A 2KA3A 1PZ7A 1VBB2 4FO9A 4M3CF 4CCCA 3U37A 2FSRA 3IWWA 4WJBA 2Y0IA 2V4AA 3TNPB 1IGBA 4GKYA 1EAH3 5A3WA 2QBXA 4XMIA 2W46A 2WZR3 1MZEA 1RO5A 1JWQA 2G9DA 2UYBA 1QJU2 4R9CA 1PK6A 1UPIA 3DPRB 4FAIA 2A3WA 4JQTA 4IEWA 1IQDC 3UETA 2BNNA 4EN7B 2AEZA 3NH4A 4XFCA 3VDDA 3I3QA 4QM9A 1LEMA 5FY1A 4X3RA 4AGVA 4CEWC 1FNZA 4DEQA 3RBUA 4Y1ZA 2CY6A 4Y1UA 4DY3A 1XNKA 5L9VA 4O9EA 5DDJ2 5I8TA 2CTCA 3S9LA 2ZMNA 3ZVXA 1Z4RA 4LEJA 3S6HA 5FQ0B 2P2KA 3K3NA 3S0MA 3PUIA 2ZEFA 2LROA 1AYN3 5GZGA 1MK4A 2PJ5A 5H9QA 4M85A 2QQVA 2G4IA 3J8F1 5JDBA 4PK2A 4IE6A 5H86A 3ON7A 1C8NA 2JX9A 3N36A 2YZ4A 3POBA 3SEEA 4NGSA 1JN2P 5A32B 4KH9A 3N7KA 2HKXA 3H8UA 4Q4X3 4TXWA 1ENQA 3UL2A 4AQ6A 4RGKA 2Q0YA 4CP9B 3L2YA 4ZU4A 2VR4A 5GJ6A 4Y3OA 1F8VA 2RB7A 2MEV3 1GNYA 4NE9A 1LAPA 3C7HA 3WHTA 5IK7A 3H1MA 2D44A 4MGYE 1M4DA 3ITQA 4BYYA 2C6GA 1T2XA 4W65A 5EYXA 3CDXA 3KQXA 1RUI2 1O7FA 2Q1MA 4RS5A 4QHOA 2W08A 3MIFA 3ACHA 4QHBA 4CDWC 2JD4A 1CQ9A 2CL2A 1VBA1 2GSYA 4NROA 4P00B 3ZYFA 4BXFA 2ZS6B 3KQRA 1W2AX 4XFFA 4GS4A 3TN93 4N43C 5DDJ3 4E2GA 1VHEA 1NQJA 4YFZA 3BODA 3K48A 4OI0A 3I3GA 1NX9A 2ETEA 4K40A 4P9WA 4UA3A 4S2FA 1G9CA 3B7MA 4NPRA 2D3SA 4B4QA 4NR1A 3DN7A 1W9TA 2TNFA 2VUCA 4R9DA 3KD4A 1SCSA 4OZXA 3L9JT 4C0HA 5A3TA 5IVYA 1KWMA 2NM1A 1LCPA 4BZ4A 1Q5OA 3RJ2X 1QEXA 3RZAA 3NNGA 5FZAA 1UFHA 3FBUA 4PIXA 2OZUA 1AXKA 2WYSA 4MFZA 2CY2A 3GLJA 1DQ2A 4X2TA 1JU4A 2VBBA 4UWIA 3TX8A 1GNHA 1ACCA 1K5JA 2OX0A 3W58A 5FXWA 1HRI2 1AR91 1VP6A 3U1XA 1BK0A 3AP4A 2W1SA 3EHKA 2XBO3 3QH6A 2VQAA 4CCEA 1X33A 2IFRA 2YBPA 2XLAA 4JCKA 1SQ4A 1WBFA 3HMYA 3QH7A 4AFDA 1H8LA 1IKPA 3VHRA 1BHGA 3OUHA 3TN92 4NGRA 2VQTA 3DYPA 4CRYB 4LNVA 2G3TA 4RQPC 4N53A 3VWDA 4CU8A 3ZYRA 3TN91 3LF7A 2BV4A 2AFZA 1W90A 1FI2A 2JEMA 2E53A 3A21A 3LCPA 3LIGA 3GNEA 4YVSA 5FY9A 4ZY9A 5JPNB 1S5KA 2X09A 3GB0A 3WR0A 1MS8A 5L7OA 4NGNA 2JD9A 1SBDA 2B4BA 3CJIA 3HVDA 4RR3B 3ZFEB 2VTFA 4BH9A 2VGDA 4XF3A 2VQYA 3TOBA 4A39A 3GGLA 3IMNA 3SCFA 2R071 5F39A 3BALA 3FL7A 3KV9A 1G86A 2QQWA 1MVQA 1BJQA 4LBNA 5C9AB 1JZ7A 1TKHA 4JXRA 1GU3A 2FQPA 2OS2A 3MV01 3T0AA 4AVCA 2AFUA 2BOAA 1Y0RA 2BWAA 5F32A 1IYLA 4B11A 3UKNA 1GZ9A 2D5HA 4UAPA 5K0UC 1FV2A 4J6GA 4AGRA 3PURA 4KZTA 3VDDC 2VU9A 3FXTA 4FPOB 4FP2A 3I97A 1REDA 2WN3A 2R061 4MOAA 5IATA 2F5IA 5BNOB 1J4JA 4F3JA 1NCRA 2RM21 3G3SA 4KOSA 4UIAA 2PXJA 1UZZA 1PVXA 3JQWA 4A37A 2EF6A 2P6FA 1GV9A 1E5SA 3JZVA 4ES9A 3FBYA 2J22A 1JYNA 1U5YA 2C0ZA 5FO7B 3D8CA 2FZ1A 3FEDA 1MS3A 5I0RA 4XABA 5HVFA 4AWDA 1J84A 1MQTA 4YRHA 1AF9A 4ZS2A 4BQ1A 1TME2 2H5MA 5FUIA 3GHNA 4O61A 4YW4A 3WXPA 2JBJA 1NY71 3E6DA 1MS4A 2PJ8A 4QGMA 1GOHA 3JBG2 4JGZC 1OPMA 1ASJ3 3NNJA 3IIBA 2PHDA 5FO8B 4OADA 3C3VA 5FO9B 3JD73 2JEVA 3USSA 3HQUA 2Q04A 5GLUA 4MXUA 4Q27A 2DCJA 2FDIA 3UESA 3N4MA 5CBLA 1FAYA 2WFPA 3EXUA 2C9AA 2PR8A 1OOPB 2C1CA 3K4ZA 4MCPA 2WUHA 2JG8B 4H14A 5L9RA 5CEHA 1I1EA 2C27A 2XEFA 1OOPC 4QPGA 3SKJE 3OD4A 1UMIA 2QCSB 2WNVB 2LUWA 4KOYA 5DQ0A 3USUA 4OC0A 1FXZA 2AUYA 4X8NA 2NQYA 2NMTA 4R3LA 2A6VA 1S1AA 1O5UA 4PIZA 3H3UA 2XVGA 2ATRA 4OIWA 1V6JA 4IE4A 3SI2A 1I9RA 3JD71 2ARAA 4GWNA 3P1IA 2VVFA 3AZVA 1Y4WA 3SH4A 5IVBA 1D4VB 4NF1A 1CP6A 2EAAA 2BEIA 2AREA 1JH5A 1ULOA 3OEBA 4QB6A 1RTQA 3E5UA 3POEA 2ZGTA 1DYPA 4UFJA 2IXLA 1KDKA 2F4PA 1PNGA 1ONAA 2PHWA 1VBE3 2UY8A 2ZGUA 3KV6A 4L11A 4OUSA 5C3QA 2VNOA 3RYPA 4FTEA 1YLEA 5JPMB 2OKXA 5AVPA 4AOCA 2PIZA 2Z3PA 4MCSA 1GP6A 3QLQA 4NGQA 2Q7BA 2FDGA 4HFSA 2F4LA 1G6NA 3WW2A 4D6RA 5IK5A 2TEPA 1IS6A 4B4RA 4P9IA 3GZEA 4QQHA 3POFA 3MLJA 4GH4B 1RHI2 4M3CA 3UY5A 4K1ZA 1BPMA 2HQYA 1YW6A 4QPIA 1OHFA 2YYOA 4RHV3 3RZZA 3PIJA 4UOJA 2NZ9A 2RR11 3I7DA 4XJAA 3VBUB 1ON0A 3DGVA 4PI2A 4RFRB 4Q4V1 2JG9A 1DLCA 1UYYA 1P0HA 3D82A 1EP0A 4UBRA 2GC2A 3L2NA 1NA1B 5A33B 3MF6A 4XTMA 2AENA 4AI9A 4P6YA 1C8M1 4GWJA 3M3CA 1GQHA 3VBSA 4ES8A 1AR63 5KHGA 1M06G 3BI1A 2NMOA 3LQCA 2ZPXA 1N3PA 3BYWA 2DVAA 1A2ZA 4PF1A 4QPGB 4J25A 5GKAC 2VZZA 1H8TB 1CG2A 1W2TA 4KLWA 1UPSA 1Z8TA 5IAVA 1J3QA 2BVVA 3IAPA 4NIDA 4KWLA 1GFF2 3EC4A 1CD3G 1NLQA 1L0CA 1CAXB 3P3NA 4XURA 3ZN4A 4A42A 3IT8A 4YSFA 5A7OA 4XAAA 2ZACA 3DYOA 4PXEA 4CAFA 4FPEA 4XUTA 1FPN3 1YIPA 1PGW2 2DTYA 2VNVA 3WCSA 5CFCC 2XBO1 1W6QA 2P6EA 1V6OA 5FP4A 2Y34A 1FOD2 5TSWA 4JZRA 3ZYPA 1BOBA 1PGW1 1PVC2 4KOWA 1GNZA 3R1KA 2O14A 4YZ2A 1PUAA 2EVNA 1NCQB 4IEVA 4R9MA 1PO22 1PO23 2GAUA 4KWJA 1PVC1 3DEMA 5D1IA 4BXSV 1UWYA 1RUG3 1UYXA 1Z8WA 5DAQA 5FJKA 5JWPA 1T6GC 4NGTA 1F9KA 1PO21 3VBOA 5A7SA 1Z0HA 3R0RA 2ZW7A 1AXYA 1IG3A 4KL1A 3GJBA 4C68A 4RI1A 2VUJA 2ZGNA 3ISXA 2B46X 3W21A 4JWPA 4X8PA 2WPWA 3OY8A 1H30A 3N35A 5LATA 2DYCA 3MV11 1FNYA 2ARCA 3VHOA 4CDXB 4SLIA 2R1BA 2CDPA 4FQ4A 4DB5A 3H0OA 1ZZ7A 2EALA 3TOJA 5KXEA 4FPHA 4EN0A 4MCRA 3D2MA 2Y6GA 4QD2A 3WINE 4FUUA 1SFYA 1VHOA 1CPNA 3HNBM 1XE7A 3I2JA 3OGVA 2ZEOA 1QSMA 3MFCA 4Q7AA 4Z65A 5J8FA 3D7DA 1Z7S2 3IO1A 1TIQA 2RJLA 3HEIA 2EVXA 4G3YC 4XCBA 1Q2CA 1XF8A 2JDKA 3BXMA 1Z7S1 4V2WA 4BBHA 1VGYA 5A1AA 4NWWA 5CISA 3CKHA 1GANA 4BCUA 1SHWB 1HB3A 3GF6A 4Q0VA 2DPSA 3H8RA 4MMOA 1PGL2 1S2KA 4B10A 4JYWA 4LJHA 2YPJA 4CDWB 1J3PA 3OB8A 1PHMA 4L0PA 2FDFA 3CXSA 1UCXA 3H8GA 2WPXA 2XUMA 4IL7A 4P4JA 4XDPA 3VL9A 4CDUC 1W0OA 1RB8G 4ARXA 3FIXA 3MW3A 4HL0A 1POV3 1S2EA 2CU5A 4LO6B 4XPKA 2RJ2A 1NE9A 3LZZA 5FMBA 3VBFB 3VHPA 3VBHB 4OUEA 1LNSA 4PI0A 5LASA 5KXDA 3B3WA 3D7FA 2VMDA 5EJ1B 4LA2A 3VBHC 1QSNA 2B3UA 2FIAA 3LFIA 4BMHA 2WIIB 3KF5A 3VZLA 3SH5A 4YM3A 5BNOA 3B2YA 4BOWA 4F9VA 4UW3A 4MGKE 2AEYA 1SDDB 4BDVB 3N9PA 4YW2A 4L97A 3LFMA 5C8CB 3VV1A 5KTCA 4YVWC 4CS0B 2JDAA 5HV0A 1JHJA 2OQ6A 3LEGA 5FZDA 5KHJA 2ZAHA 3O1VA 4MFJA 4K20A 3ILNA 1W06A 5L73A 4DUXA 1UY2A 3FB3A 5F2WA 3ZIWA 2V73A 3A23A 3LA3A 2FCKA 2B4DA 1ZO0A 3TO6A 4NIGA 1W39A 1V6NA 4QM8A 3GUXA 2R0FA 1G9DA 4BIFA 4GMP1 4KG0A 1S0DA 3AZYA 5IV0A 1GR3A 5LZ6A 2ZW5A 3GBGA 1UY1A 1M4LA 1X82A 4GM5A 4MBUA 5T5OA 1DBNA 3S6FA 1H1MA 2RDRA 4B5PB 5AG4A 1RVF2 1SLBA 1VMJA 1TEIA 1ND3C 2CTVA 1KZFA 3MIHA 4L8AA 4BLIA 3IDBB 1PX4A 4OHZA 4DRRA 5FY5A 1SLIA 3LACA 1ULEA 4RN5A 1G8WA 3T08A 1S4CA 1YWKA 1GYKA 1H4HA 1LR5A 2J1SA 2VBPA 4KQ7A 2A75A 4N53C 4O9GA 5E88A 5F5IA 2Y8KA 4YARA 4ASKA 3PUQA 3BTXA 5FZCA 5FAXA 3VBOB 2Q1FA 4FBFA 4AHYA 5F3CA 3DYMA 2VZTA 4XQDA 4JTNA 3SHRA 3ZZIA 4CDWA 1ASJ1 3GY9A 2PRBA 5D21A 3WD5A 2WZEA 1R081 1PGL1 1LOGA 5D8AA 4GWMA 2YNCC 4C2YA 3IZOA 4OQ8A 3I1UA 3TC8A 2Q1ZB 2JIGA 4DYOA 3CQOA 2SBAA 3OJBA 2VZ3A 4LO8A 4XJZA 3DPRC 3T2TA 4CDXA 5I93A 3M8LA 1W8NA 5GLZA 4A6SA 1XE0A 2C4XA 2GDFA 5I0UA 2ZELA 3I2FA 3IKWA 4A45A 4OLLA 2QQPA 3S9NA 3WNKA 3KZ4C 4L92A 3MHZA 5F37A 1VLNA 1F5JA 5T55A 4FFFA 4Y5TA 4TTGA 1CAVB 3HN3A 1H0BA 4FOQA 4BD9A 5K8OA 2BERA 1UMZA 3I2OA 3OCPA 2MHFA 2JG8A 2SLIA 1N1SA 4D7SA 1NOVA 1G9AA 2R043 4KOVA 3ACLA 4I09A 4CCNA 1S3ZA 2JDHA 3OUJA 3QAYA 1NG0A 1ZRRA 5LEJA 3E6CC 4LR4A 4FQZA 4JKMA 2PQQA 1AYM3 2W1UA 3RI8A 1C5HA 1LRHA 1EE3P 4R57A 5AG7A 2BFUS 3IBMA 1YHFA 1W3VA 4LQRA 5FLHA 3UT0A 2B4KA 2BGCA 2XWJB 4RS5B 2R7HA 3W9AA 1NUKA 2Z3OA 4A32A 1IYKA 3QD6A 1QSRA 3NW4A 1K45A 5FYIA 5FZ4A 3ZOIA 1LOKA 1JOJA 2GN3A 4PDWC 1O3SA 2DCKA 3BPSA 2XJQA 5DPNA 4AEDB 5F3EA 2O8OA 4QX8A 2BOJA 3VDCA 3M1HA 1X7NA 1EPWA 2PJ3A 4I49A 4OKOA 4FD5A 4AB7A 1J1LA 4NCZA 1Y7BA 3RMXA 4Z2WA 1YEWA 4MUVA 1SFPA 2WQZC 5DAVA 5EP9A 3ALQA 3WHUA 4E8DA 1RUNA 3H8FA 1KD7A 4DFSA 1XNDA 5EJ3A 1VBC3 4A94A 3CXQA 1DIWA 4I0BA 3IAQA 2RDQA 2YC4A 4XNHB 3A0NA 1W05A 2B4DB 1YFXA 1MZ5A 5HBAA 1DZQA 4CGNA 1K5MA 1P8JA 5CBMA 1O4YA 1OPOA 1U5ZA 1OVPA 1ZBE2 4KMQA 4K21A 4RYDA 5LRRA 5DZGA 1BLLE 1YQCA 2ZOGA 3ZFFB 1W0NA 2EXJA 4PLOA 2PJ2A 3CJXA 3OBRA 2X05A 4D69A 3T9YA 2PHUA 1W9YA 3VARA 2VE1A 3CL1A 3HQRA 5A33A 1RUE2 5KXBA 3I59B 4N90A 2WZ8A 2WDBA 3BTAA 1VB2A 3OBAA 3N3HA 1NYWA 2V5YA 2OZHA 1CX4A 2D4OA 2Q4ZA 4URTA 4AVVA 2P3KA 2ZEXA 3POWA 3PMEA 4XAEA 2YDEA 4W8JA 4BK4A 3U0ZA 2GC1A 2Y6FA 2ZX0A 3B9IA 3ST7A 2D4PA 3DR6A 3WT4A 3H9AA 4QGLA 4YG3A 4AI0A 3K4AA 5HCAA 4HNXB 2PHRA 4L2NA 4IV1C 2REEA 2QZ2A 2ID4A 2VXJA 4IUGA 4FD4A 3B3QE 3EO6A 2PN5A 2OR4A 4IQPA 3B3CA 2HWE2 4L89A 4COYA 5T5LA 1RMU3 3LDKA 2POKA 3K2OA 3U10A 2XKPA 1RUOA 1RUD3 3MGUA 2CAUA 2CTBA 2JEWA 1WD4A 1ULFA 4Q4X2 1GP5A 3ZR5A 1OD3A 4EN9B 1BEV2 5G04L 5EBVA 2YC2A 3KB5A 4EMEA 3WZ1A 1QH7A 4RA0A 4EN6B 4PSWA 3TFYA 2AZ5A 2PAKA 3BU7A 1XNTA 1VRH3 1BEV1 1ZA7A 3LEMA 1AYN2 3VL8A 2HBUA 3LAGA 3B7IA 4MCQA 5K4LA 4Q8LA 4CAXA 4ZY0A 4U9ZA 3RS6A 1M1DA 1WLWA 1XU1A 1SEFA 4HZFA 1LGCA 3EFAA 3U11A 2JE7A 3NAPB 1UOFA 2NLRA 3FWEA 2P3IA 4XQ4A 2XJSA 3ZXDA 1PIV3 4YM0A 5HXMA 2FIWA 2I00A 2ZPAA 2E26A 4PQ9A 3PB6X 3IPVA 4LKDA 4F8AA 2HLEA 2P0WA 1TF9A 4Q1PA 1BVP1 2WWJA 1KQRA 5FBZA 5JI9A 2XXZA 4MXVA 4KNCA 1HN1A 1IOFA 1QIQA 4R9BA 1SBEA 5A6YA 4H6UA 2VAUA 4LHNA 1NY72 2VOKA 4XOGA 3WNOA 2ZXQA 5J7MA 2ZEMA 2XH6A 1WUVA 3VBRB 4HPKA 5BWAB 5FYMA 3KGZA 2QNKA 4LO4B 3RGBA 3WQ0A 1AYM1 2Q7SA 4AF9A 1QDCA 1QJZA 2WSUA 4KORA 2ES3A 5JOXA 4MYEA 3QBQA 2JDPA 3WF4A 4J3GA 4DXRA 4P10A 4XDQA 5BNPC 2R041 4CCLA 1QJX1 4R52A 4A6OA 2J1EA 3EJKA 4MI4A 2ZABA 3LA2A 1WLDA 3GBWA 2PELA 2ZX4A 3IDEA 1LTEA 2R042 2ZJCA 1CONA 4IEZA 5EZWA 4QXBA 2W91A 5FZHA 1UY4A 1ZRFA 3W5NA 5K8PA 3BU0A 5F5CA 3I3DA 4DZGA 1HDQA 4IGPA 1VIXA 2YGLA 3THDA 1XSRA 1DQ0A 3AP6A 1EAH1 3F95A 4Q0UA 4RD7A 4IEOA 3WCRA 4MRIA 3THTA 5FZ3A 1J1TA 4M01A 3LD2A 1ENXA 4YYOA 1DTDA 1DQ5A 4GB32 4P9XA 4NJRA 2H0VA 2D6LX 5JMCA 1MACA 2YUEA 3BTZA 4W6XA 2X29A 3Q8FA 3PVEA 3EB7A 3SITA 3FE5A 4QU2A 3ACFA 4OZOA 3VKMA 4BQYA 4E8CA 5C3PA 4HT1T 1NAEA 4KOUA 4OP4A 3EQEA 4K9SA 1J83A 4CCJA 2FS5A 2QDRA 5JUVA 2YY1A 4L8QA 2B39A 1WCDJ 1QJEA 3FMCA 4C7HA 4LPLA 2IUWA 1W6MB 3Q8BA 5LBBA 4RGAA 5FZKA 3RI9A 4S2GA 3D7HA 1YQ5A 5A32A 3VZNA 1AL22 1QQP1 1V6LA 3AKTA 2BQPA 1ARLA 2MPFA 2BCOA 1QF3A 1RXGA 4RN7A 1ZZ8A 4LO5B 3VDDB 5JR2A 1X12A 3RMYA 1AL21 3NL1A 4AEKA 4DRVA 5D8AB 3D7GA 5JCTA 4E27A 3DSBA 3T2OA 4KS9A 5F47A 2XKOA 4QX7A 4MGSA 4OHWA 4P4DA 3OGJA 4TWEA 2YGWA 2BO9A 5BXXA 1RIRA 1TVGA 3NH8A 2Q30A 5F9TA 1FYUA 2XEGA 2F6BA 4ONUA 5AFBA 1H1AA 1U5IA 4QQPA 4AFCA 4DIQA 2GU2A 1RGSA 2BUKA 4LO7A 2ZTNA 4YRDA 4IUSA 4P4FA 1R1A3 2DVBA 1X9TA 2Y6JA 4MFPA 2ET1A 3VBSB 2VOXA 4UFMA 4GXLA 4EE2A 3V0AB 2XJVA 5K8SA 4MY0A 5E16A 2XOMA 3R95A 1JU3A 2A6XA 3VKNA 3P5BA 3WQBA 3X29B 2QJ8A 1UL9A 1AVBA 1GKBA 4MX3A 3TBDA 2WT0A 3C26A 3R4DB 2GE3A 3TAYA 4Y26A 1O4TA 3H8OA 1KJRA 3KCCA 1RUG1 2WKKA 3H7YA 1GWLA 2GNTA 5FPLA 4HKOA 3AXEA 3MLKA 5FMCA 1Q43A 1BKZA 1OURA 1JW6A 2DDUA 4WVVA 3H42B 2BGPA 4QKBA 2VUDA 4EROA 3QAHA 3AMNA 4QT6A 4R4XA 3RAMA 4G4FA 2RS12 1WW6A 2ORZA 2P6HA 1DYOA 4WVMA 2QVSB 1PZ8A 3POSA 4NRQA 4O7XA 2RMU2 1JZ8A 5DS0A 3ENRA 1DE4C 4D6QA 3O1OA 1LULA 1AR93 4QX5A 5FZGA 3JB4C 3ZR6A 1YQ8A 4XJUA 3I3BA 5DDJ1 5EXOA 3RYRA 2BOIA 1EYBA 3EMRA 1JODA 1ZZCA 2WAAA 1R57A 4XNHC 3RSJA 3BTYA 4BMEA 3QCWA 3H8XA 1W8TA 3N9MA 4NHKA 2REFA 2D98A 3BIWE 5D8NA 1FMD2 2EO8A 3PUHA 5EQUA 4X6QB 5A6QA 1ZG9A 5F46A 4KWKA 1V6KA 2HH9A 3NJZA 1IOAA 1HIXA 4LBQD 2W52A 4QHZA 1J59A 1BBT3 1RMU1 4U2AA 1Y7RA 4JGYA 2WA3A 2VG9A 5CFDA 1LEDA 3OYWA 1COV2 3EYPA 3INAA 2YU2A 1V0CA 4LOTA 4OHVA 1HKDA 1RMU2 4CUBA 4P4BA 3WNNA 2WC2A 4CEWB 3N5FA 3MDPA 1ULPA 2ZOFA 1YI7A 4FXGB 3I2HA 2BTVC 2GFQA 4A95A 1PIV2 1OFSA 1RL3A 3I2KA 4WM7C 4NO4A 4P4IA 5CADA 1KDMA 4Y4YA 1R43A 5IAXA 4C90A 4DY5A 5AC91 4OVEA 4NGMA 5A3UA 2QKDA 2EUIA 1S0GA 3ZSMA 4BWOA 5A6XA 1F4AA 5A7NA 3BUCA 2DVDA 2QQKA 4EYUA 3PB9X 2R073 4YVWA 4YGEA 1JYIA 1H9PA 2Q43A 3B35A 4KSIA 5IB0A 2RS33 3PFOA 3B94A 3S30A 3V64A 4NXYA 2UWCA 4GULA 4LQ6A 4HVQA 1SFNA 4LHSA 2WA4A 2UWAA 3VBHA 3S6KA 3K4DA 3AYEA 5B4XA 3I54A 3ZYHA 3FFQA 4CU6A 3CZUA 5T52A 1DQ1A 4K6BA 3S5AA 4RFT0 1DQ6A 1VBC1 4AG7A 3B9CA 2PC1A 5ISLA 1NSAA 2ADDA 3QOPA 3I59A 2Z69A 4IE0A 4W6YA 4NHYA 5I91A 2XPJA 3LMSA 3PUSA 3SISA 1S0BA 2JB4A 1MS9A 4E2SA 1BQPA 1RHI3 2DU1A 2V8DA 4LMFA 2WNUA 2VUAA 3LEKA 5FMDA 4BPZA 4DMIA 4AEJA 1WCSA 3WNLA 3ZFGB 3FX6A 5KHIA 4JDNA 3PMSA 5M0TA 1W8OA 1WKYA 1QQ9A 4AHWA 1A8DA 4AXOA 3MIBA 1PGSA 3CEWA 4QAWA 2AE6A 1VE0A 4YFJA 1E5RA 4TWTA 1AR61 3RZKA 2XG3A 2A3YA 3O7OA 4QX3A 2QECA 1BMV2 4WBBA 1WMEA 1UU6A 2W2IA 4L9BA 3U07A 3NV4A 4QX2A 1VAMA 1E5IA 4ZPIA 3RZLA 1R1ZA 4DNCA 2VPVA 4B6ZA 4WWVA 1Z9UA 2EIDA 5C3OA 4UFIA 1I12A 2G9ZA 1SLLA 1Q8OA 4OYUA 4RHV1 3WDVA 5BNPB 3WQ7A 1PYTB 4YGDA 1O5LA 4CYQA 5FFOC 1CPMA 3NNLA 4XJWA 4A38A 4ZXEA 1AUYA 1PZ9A 2RMU3 4ZYQA 3KR5A 3ELNA 3IJ3A 3C7EA 4P14A 2ZMKA 2IFWA 4GWIA 3E1F1 5C8CC 3VBOC 4LBLA 1YXWA 5DAWA 4MGTA 1K12A 1W3XA 4FPJA 1FT7A 4WM8A 4Y5SA 1DGWX 1LECA 2YROA 4LULA 1C3HA 2KM2A 2JXAA 3FX3A 4QPIB 5FK8A 4CRQA 4YZ1A 1Q2YA 4LUAA 2NSMA 4XE9A 5LRKA 1B09A 4I2OA 1SLCA 2WS93 3K51A 3Q8AA 3M3EA 3KHZA 4ZI6A 2DUQA 4OHXA 3ZSJA 1H2KA 5JI7A 3JBG3 2B3VA 4ISRA 4S2HA 1OA3A 2BZDA 3LOIA 4V2VA 2J8MA 1R091 5A1LA 2P6GA 2PLV3 3JBG1 4Z07A 5CZKA 5IYYA 4QPYA 2ZHKA 2GMEA 1O59A 3V8IA 2IC1A 3T1LA 3AKPA 4S2DA 4UFKA 1WLTA 4XPLA 4HKFA 1NXMA 4BB3A 2V77A 4ZS3A 5F48A 3PVBB 1QJY1 3PBEA 2VXKA 1AR71 1OH3A 5KXCA 5KBFA 1GOFA 3CJIB 4RR3A 3ZFEA 2PJAA 1JZ5A 2VMEA 4YVWB 4ZZ8A 1ND3B 3WG3A 1HV1A 3SLIA 3CLPA 4JZ0A 2YBSA 1LOBA 1N3QA 2EICA 4IEYA 2PJ9A 3K2KA 1BYHA 1POV1 4PBOA 4XFHA 1JHNA 2VZRA 4GQ7A 4LBQA 2JIJA 4FVVA 4CGMA 2VZYA 1VBD1 2WS92 1AZDA 4AE2A 1UKGA 4LK6A 1DFQA 4EQVA 5IK4A 2BUEA 1QXRA 2HWB2 2WFF1 3PGPA 1IB1E 2BWCA 1VRH1 2VZVA 2GC3A 1VBD2 4ZXKA 2WS91 4B7EA 4INDA 5CFCA 4HNYB 8CPAA 4LITA 1GQGA 4XILA 3KL9A 3MZHA 1PM4A 4DNYA 1H8TA 2A6YA 1KUVA 1DHKB 3ZIXA 1Z8LA 2HJIA 3ZN6B 5FKBA 5FOBB 4JX0A 1XJOA 3MGDA 4CU9A 1CAXA 5F8PA 1ULCA 2JKBA 2WNUB 2GLJA 1D0HA 2B5HA 4MLOA 2K5TA 2A3XA 4KU7A 4P9LA 2DBNA 2CF4A 1PX3A 2IXJA 1MQTB 2JDNA 4NIAA 1X8EA 1ZRCA 4UFXA 3NE7A 4ZY1A 2RM23 3G8WA 1OD5A 2VBDA 2XLFA 4XVHA 1RHI1 3VBSC 5FDBA 2P1BA 4UCNA 2ABZA 2DUOA 2JKXA 1KITA 2RR12 2AH2A 5FZ1A 2B9UA 2I07B 2ORXA 2D93A 1H1IA 3RYKA 4CDQA 4EWEA 3AFGA 3TEWA 4LORA 2PQ8A 4IAVA 1ZBE1 2VJXA 2ZEGA 3WF3A 4QQ2A 2JBKA 4JDOA 5LCWL 2A73B 4LUMA 4QDRA 1Q7LA 1CAUB 1GMMA 3FC0A 3LSDA 4YVSC 4TZDA 1I21A 1OQDA 3OUIA 3NFZA 1VAVA 1OF3A 1QNWA 1W0PA 1NCQC 4NVPA 5FZMA 3WLUA 4OC1A 4CPBA 4CP0A 4ZU7A 1UNBA 4M6IA 3KF3A 1H9WA 4HONA 1J3RA 1ZYBA 2Y6LA 5BYNA 4Z92B 4FTSA 5C71A 4K30A 5JZGB 1Q2DA 2OOTA 1KFXL 1YQ2A 4MHUA 1SMVA 2X5IB 2W3JA 4IW3A 5JMOA 3O1PA 4NFRA 1GZCA 1BXHA 1AX2A 2ZW6A 5JXIA 3KGQA 5DUWA 4HANA 3FJUA 2Z4FA 2Y26A 4XBNA 1Z2LA 3DKQA 3RWNA 1VPHA 2HWE1 3KT4A 1DDLA 4II9A 3ZPOA 5L19A 2AYHA 4EVYA 5J3UA 1F2OA 1DYKA 5JSPA 1B87A 2OIIA 2XBO2 2Q44A 2Q51A 4CP9A 4K3NA 5JGFA 1XEBA 1FOD1 2ZGPA 4ZZ5A 1AX1A 1EUTA 2NMNA 3ACIA 5LY2A 4E4SA 2YHJA 3JCIA 5DAXA 5LA0A 3LDBA 3AZWA 1REFA 4YNIA 5FYUA 3T30A 1KUYA 1LESA 3CPXA 2RDNA 1XB9A 1KXGA 2HBTA 1O3QA 4Q4Y1 4PK3A 5FRAA 1IQAA 4JGZA 4BQWA 1ODNA 2WO3A 1DZRA 4AHZA 2JE8A 2XEJA 2OU2A 1LCLA 5A3OA 1TKFA 3N9OA 1JYWA 1XFOA 2VW1A 4LBJA 1F35A 1QSTA 1XBUA 2Y64A 3SQOA 3RNZA 3KCXA 1N1TA 1LOEA 2HC9A 4XF1A 2W9XA 2WO1A 3MF9A 3W91A 3PTRB 4XPVA 1SACA 5IFPA 3BHXA 4B29A 4OAEA 1UMHA 5FMOL 3ZO0B 3TNQA 5FIXA 1NT0A 2XL9A 3K9UA 1CAWA 3KM5A 3R4SA 4B4PA 1RUE3 4O65A 1AL23 1HXS2 4AFAA 2Q8CA 1Q56A 3DV8A 1KGYA 4M4PA 4QDQA 4WVZA 5DABA 5FYSA 1CAVA 1H6YA 1YI9A 2BBVA 1W6NB 4Q0QA 5DZEA 1YMEA 1GBGA 1HDKA 3D3SA 3O12A 1RUJ1 4OFGA 3H3LA 4A2UA 2ZX2A 1P4NA 2XJRA 1ZBE3 1RINA 2B45X 3DCQA 3BOWA 4I0AA 2PA7A 1ENRA 4XXAA 3MPBA 5JVVA 4EV0A 2GLFA 5I0SA 1AR82 1F57A 4F0YA 2Y0OA 4B5PA 3J8F3 2I45A 2XQRA 4CE8A 1DU3D 4BLJA 4CEWA 1S60A 1JZ4A 1UXXX 4PF5A 1XNAA 1QJU3 2GN7A 2OH1A 4K8RB 2BYVE 4HBNA 3BJ8A 3ZXLA 1O91A 2LRPA 2R16A 5FBJA 4LT5A 4LHLA 3LPFA 3AZZA 5LYLA 3TEYA 5K0UA 4Q0SA 3W6SA 3RRDA 4NRPA 4KUAA 3KT7A 5LRGA 4QQOA 4LKSA 1DGLA 5F09A 4A33A 4CAEA 1VBB3 2PLV2 4LIVA 2E63A 3H7JA 1HQLA 4MGQA 4OHYA 4PSXA 4HVOA 1SLAA 1PMJX 2CNAA 1IS4A 3IWZA 3ZLIA 1BCXA 1B6BA 5FV3A 2A1XA 3SXWA 5JSOA 1L7LA 4CXYA 3SEPA 1SZBA 5L7OC 4HKLA 4OC4A 1YFYA 3CNAA 2RE9A 3PFEA 2VL1A 3PB4X 5FXVA 5I8SA 1S7NA 5CKNA 2WWSA 2ZEEA 4QB9A 2XJUA 4ZHNA 5LEKA 1MR5A 3LWCA 4QPWA 4CYDA 4XETA 4Z8BA 2QVPA 5C9AA 2QQJA 4NEXA 3BLNA 3M2MA 1VHSA 1JZ3A 2A7AA 5D8AC 3ASIA 4EZ4A 2FL4A 2Z42A 1W9SA 1CPXA 4IEXA 2NYQA 4UWDA 1LRZA 4ONWA 3E6BA 4AVTA 1S0IA 3JB8A 2WNVC 3TWIA 3U4SA 2OQ7A 4QX1A 1QKQA 1B35B 1F4HA 1S55A 2GC0A 2I2SA 1RVF1 3CIHA 3VN4A 1XYNA 3W59A 4BJ0A 4PXCA 3TO7A 3EXNA 3EO4A 2VMHA 2KR2A 1BLZA 2XVKA 2DF5A 1QHDA 3OBZA 4IHMA 2BPA2 2PDOA 1MEC2 3J7NA 3WVJA 2Y6HA 4GMP0 3DKWA 5FP3A 2PJ6A 1HJGA 3POYA 3RJRA 3UYJA 3WG4A 1R3NA 2H6CA 1NLRA 1NQDA 4OUMA 3VUOA 4KGGA 3WSOA 1QDOA 4QMAA 1XIXA 3OGSA 4CYPA 2ZBJA 1L7RA 5C9AC 3GIUA 2UU8A 4LBQB 2OUJA 4JC1A 4MSVA 5GLVA 4AI2A 4CCOA 3HUVA 4E4DX 4H3WA 4PT6A 3SCHA 1XRUA 3D68A 5CPAA 2VW0A 4KG8A 3DUIA 2QQOA 3LDRA 1LFWA 1V6IA 5BNNC 1FX5A 1K4JA 4RS5C 1M4IA 2J7MA 2P37A 3DXTA 4KBBA 4ATEA 3KHCA 1NKGA 1ZG8A 4ARYA 3ECQA 1QJU1 1VKCA 3NV1A 3N7JA 4XZPA 1XMTA 4F6AA 4QXKA 1NMTA 1U6MA 2OZ6A 1WWZA 5JAXA 3O1MA 1ZVFA 3TB0A 4AVBA 5FK7A 4Q2FA 2B42B 3WQ1A 3D8PA 2R98A 5IVFA 4XHBA 2CNTA 4CZSA 4C1XA 4GH4A 4M3CB 1O8SA 2QZ3A 4AQ2A 4FOWA 3OOXA 4CEYB 4JGYB 2DPTA 3FUQA 1NZIA 3KMHA 4R6TA 1WLCA 2GMPA 4GKXA 5JIAA 5J37A 4P5HA 3SI1A 1QWRA 3S6PA 4EWDA 3TEXA 3VLBB 4GB33 2E6VA 4BU2A 4CYOA 1RUF2 2W68A 1H8TC 3UJOA 2DF7A 2RFHA 1UKRA 4E9KA 5A7QA 1FOD3 1LHOA 3RZJA 4BIOA 1AXZA 2Z79A 3FN9A 5BNNB 1CAUA 2BBAA 1OA4A 1XYOA 2ZZJA 1JYVA 1PK6C 2F17A 4TYSA 2FT0A 2VZ1A 3LD8A 5K8NA 5LBCA 3RVHA 3MIGA 2VM9A 4YLZA 1YO8A 1UW8A 3PU8A 4PLMA 2V4VA 4MFLA 3R9FA 1ZRIA 3AJYA 5F6KA 5A1FA 1XPWA 5A28A 2FCUA 3FHQA 2B5GA 4NSQA 1JS9A 2O0OA 3J7MA 3NJYA 4JV4A 3ZMOA 4DINB 1XE4A 4D6SA 4MV2A 1JYXA 1WMXA 1W03A 1OVSA 1S2BA 2D6KA 2D6MA 3HR9A 3PJYA 4D94A 5J1XA 1BAVA 3D4UA 3HBKA 1MS0A 4MO3M 4ZONA 2FHRA 2WBKA 4H7MA 1K5MC 3VZKA 1RUD2 3O1SA 3F5BA 4XXPA 5LYFA 2AACA 5F3GA 1V0AA 5DUUA 4IXLA 3RFRA 4Y22A 5CA6A 1I3HA 2HWC2 4O23A 1RUD1 1XBFA 2C24A 2ZGMA 3VKLA 4XZUG 4C1WA 2VMGA 3WNMA 3ZKUA 4IV1A 4HXCA 3FECA 3CO2A 1AR92 1RTVA 2D6OX 4FPYA 1V00A 4FFGA 3IMMA 4XBLA 2DWRA 4P9GA 4CXWA 1AJKA 1UY0A 1VBC2 3UGGA 1K3IA 1XNCA 4Q5OA 1RUE1 4UCPA 3SHPA 2R30A 3WNXA 1W8ZA 5CNPA 4PJYA 2L9LA 2BEOA 3D4KA 3C7OA 5SV8A 4CSWA 1YLOA 3IPVB 5FLIA 3KR4A 3OPTA 3C8XA 2N7GA 3FUOA 1AHSA 3WX5A 4CDQC 3VD9A 3GM8A 1F2NA 4N43B 4LIUA 3FF3A 5FVJA 2ET7A 3GBFA 5KC5A 2PHLA 2VOVA 4E0AA 4TLFA 1JOPA 4IV3C 1OSGA 3I4IA 5JZGA 1QNYA 1R1A2 1WZXA 3KV5A 3NAPC 5C4WC 5IVCA 2WAOA 1KEXA 4XW3A 4QKDA 2R072 3E5QA 4HKWA 1N1VA 1W6PB 1Q8PA 1EV13 1YLLA 3HN1A 3LPGA 4OI2A 1Q8VA 1W6QB 1CZVA 2VL4A 3PVOA 5A6ZA 3W6XA 3ZXFA 2C5DA 3HNMA 4H7LA 4L99A 2DU0A 3I49A 1REEA 1RUC1 1VBE1 4R4ZA 3JTKA 3GYAA 3AMMA 2J1AA 3NMBA 4Q4X1 5LRSA 1CM0A 1NCQA 3FH4A 2XMLA 2YFUA 5C6CA 1LGBA 2NN8A 1TNRA 2R062 5BNQA 1WGPA 1BZWA 3JRUA 4RHV2 2JDDA 2PYTA 1ZA4A 1AYN1 2XHKA 2ZGOA 1H4GA 1WMFA 2BRTA 2GU9A 2CGNA 2E32A 2X5IA 3APBA 3KSCA 3TO9A 3RZHA 3ZFGA 5C8WA 4CVUA 2A5ZA 4JGZB 5EMIA 1CVNA 1RVF3 5T5PA 1JUHA 2ZZQA 3H1YA 3AYCA 1ND2C 1OBRA 3CU7A 5FUNA 2JG9C 2RM22 3DPRA 3KQ4B 4XFIA 3NWKA 3SJFA 1XE8A 2UYAA 1RUH1 2FCTA 5A3MA 1ULGA 2HV2A 5HMNA 1QY4A 1QGLA 4CDUB 1TNFA 3D0JA 4AVAA 4NIHA 2NPIA 1HB1A 2W92A 2XUEA 2C26A 2UURA 1ELLP 2DFCA 5HXDA 3AFKA 3WUCA 1LOFA 1UOJA 4NUBA 3V0BB 5LA9A 4A44A 5KC6A 4LE4A 1YVKA 1D4M3 1TME1 3A4UA 1HN0A 2ZEDA 4CUGA 3KASA 3SXOA 4IERA 4R7MA 5FY7A 1RUC3 5CKMA 4UYBA 3WDYA 5FZOA 4A41A 3BIEA 4JXQA 4ZX8A 3SJXA 2WO2A 1UOGA 1QOSA 1URXA 2OW4A 4LA3A 4IEUA 1ZBA3 2C6SA 1QJY2 4FXKB 4B1MA 4EWAA 1AR73 2YC0A 2RR13 2FMYA 4G1PA 2E33A 4KWUA 5B2GB 1TF8A 2CNSA 2W0XA 3OTFA 4AW7A 4IK2A 2P34A 5F7UA 1Z5RA 1CAWB 3FLTA 4CDXC 3T4VA 5G22A 4CU7A 2LS6A 1KS5A 1LJ7A 1OLQA 1OLME 2VTXJ 2WYFA 4RGGA 4WM8C 4CYNA 3IIIA 4FI9A 3JD72 1HRI3 2RV9A 2XB6C 4LKFA 2IZWA 5F5AA 5BY5A 1OKQA 3MIEA 3O14A 5CFCB 3PRTA 3DR8A 5H9RA 4YGBA 5FQ0A 3R6SA 1WW4A 2WFF2 3ZDVA 3CF6E 1STMA 1TMF1 5K7PA 1MVEA 2EIEA 3WP6A 1HRV3 3OEAA 5FXZA 3V56A 3GZAA 4LXLA 2CSGA 2HWC3 2LM3A 2VMIA 1D4M2 2VVDA 2Q4YA 1TMF3 1TMF2 2K9ZA 2LTNA 4OMCA 4GD4A 4DS0A 2PJCA 5CIRA 2Y6KA 1DGWA 3B5LB 3D0SA 3ILFA 2J1RA 4ISQA 4LK7A 3RZGA 3B8GA 3VD5A 4AAPA 4HOOA 5JOZA 3SJEA 2VMCA 2DCZA 3WDUA 3WW4A 1Y9KA 1OT5A 2DUPA 2E9QA 4KLVA 3ILRA 2Q0AA 3L2HA 4QXHA 5JM6A 4HNWB
chains in the Genus database with same CATH topology
1B35C 2JDZA 2BNOA 2WT2A 1MQTC 3D5OA 3TTHA 4XIOA 5FOJB 2G9GA 1A3KA 3E97A 3NKTA 4Q4V2 5C8CA 2WZR1 2OZJA 4NWVA 2WNUC 3ES1A 3I8TA 1ZRDA 3ZN5A 4RS2A 2WZR2 3BPZA 4H55A 4N53B 5G1ZA 2RS52 5LK7B 2H6BA 1O4ZA 2DCTA 4FD6A 3VWEA 2BSWA 3M7AA 1V6MA 4KU8A 2RS51 2B58A 2YXSA 5J96B 1YFWA 2RS31 1BBT2 4COWA 4LTAA 2O28A 3H5ZA 3ROUA 3UK9A 3I2DA 3VHNA 1ZX5A 4LBOA 5I0TA 4B8EA 4YZ4A 4YW3A 3WP5A 4PBPA 3MW2A 4ATFA 2JDCA 3PNAA 4D3WA 2CXAA 4XHXA 1CR7A 4B7KA 4G9SB 3GALA 2P17A 4PLNA 2OZGA 3CJIC 4HVRA 3NV3A 2YNEA 1PU9A 1NCRB 2BL1A 3ZXKA 3WY6A 1AJOA 2R063 2WJSA 3A0KA 2PHTA 3B93A 2EAKA 3UJQA 3R4UA 4UW5A 4FOVA 2VW2A 2CAVA 1C4RA 4KVOE 5JOYA 3TOAA 1IIDA 1G9BA 1Z4EA 1RC6A 3LSEA 3QB8A 1Q8QA 2IXKA 4UBGA 2TUNA 4IV3B 1WD3A 2VH9A 1OLRA 3IIAA 4MH0E 5AVAA 5FLJA 3S7IA 4XYXA 2YNDA 2GNDA 4C2XA 3G7DA 2HEWF 3DDDA 1LGNA 3P2FA 4B3NA 3A9LA 3WP3A 2A4NA 2R1DA 3AP7A 3AZXA 4XFGA 3LOBA