4ORFA

Camp-binding acyltransferase from mycobacterium smegmatis, mutant r95k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
319
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIEPGLIIGEIALLRDAPKTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTSETLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 96
structure length 319
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4orfA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4orfA02
2Y0MA 3CL1A 3JZVA 2REFA 1J3RA 4Z82A 3R9FA 2J8NA 4I02A 1YLLA 3EJKA 3S6GA 1Z4EA 4LLOA 3FWEA 2XLAA 4HZFA 3D0JA 5E1RA 3EXNA 2BGCA 3OD0A 4I2OA 4Q0SA 5C8WA 5I0UA 4DINB 5CNPA 5BXXA 5JCTA 3TNPB 5FQ0B 3MGDA 1YHFA 4ONUA 2EA7A 3N4MA 3LWCA 2ARHA 3QAHA 4F8AA 1M4GA 4H6UA 4RI1A 3TE4A 4YRDA 1IICA 3DR6A 4OLLA 2EUIA 5BY5A 2ZW6A 1RTVA 1CAVB 4XPKA 4E2GA 2B3UA 5FPXA 3S0MA 2FIWA 4NXYA 4Q0QA 1WA4A 4AVAA 3TOAA 3WW2A 2AE6A 2PSWA 2HJIA 4JTNA 3I9SA 2FS5A 1Y3TA 2PHLA 2DXQA 3GYDA 2XL9A 4ORFA 4AVBA 3H1MA 5EC4A 5JSPA 1LRZA 4MGZE 4YSFA 2P6FA 3R9EA 4AVCA 3W91A 3FXTA 4K30A 2XKPA 1YX0A 4GULA 2A4NA 4MX3A 4XEZA 1CM0A 3OGJA 2ZPAA 4E8OA 1Q2CA 1B6BA 1J1LA 3IWZA 5FDBA 2BEIA 1EY2A 4KWLA 5KTAA 2QNKA 3UKNA 3E0KA 3O14A 2PTMA 1O3SA 3HT2A 4FD6A 2O1QA 4MBUA 4MI4A 4FAGA 4EVYA 4UA3A 2FIAA 2Q1ZB 4Q0VA 4I01A 2OA2A 3VWEA 3DV8A 3IWGA 2CNMA 4JVAA 1CAWA 1FT9A 3L2HA 5I8TA 1SFNA 5FLHA 4HN1A 4E2QA 1FXZA 2CNSA 4H89A 4QVTA 3BU7A 3FHIB 4XPLA 3FX3A 4D7TA 5KHKA 2K9ZA 2Q0AA 5JQ4A 5EBVA 5KHJA 4MV2A 1J4JA 4HSJA 4KWKA 1ZZCA 2JEVA 4I0AA 1X8MA 3H7JA 2R1IA 2KCWA 4KOTA 3EC4A 3FNCA 4MY3A 3RYPA 4YRHA 1RUOA 3SXWA 3M70A 3UKVA 3C26A 1IB1E 2Q0YA 2XLGA 4I09A 4EWAA 2QVSB 3B02A 4LUKA 4JWPA 4QM8A 1UW8A 4XF3A 2EAAA 3C3VA 2B4DB 4EV0A 2FL4A 3PLQA 4IEVA 2P0WA 3DR8A 2UYAA 4F6AA 1YVKA 3D2PA 2P6GA 3ES4A 1ZZ6A 2Z11A 1IIDA 4BH9A 1UIJA 5FQ0A 1ZRCA 1S7FA 3B8GA 1CAUB 2Q30A 1ON0A 3LODA 1N71A 4META 4EWEA 4CAXA 4Z07A 3JVNA 4J1WA 3PGPA 5J48A 4L2NA 1B87A 2VQAA 2WFPA 4KOSA 4KOWA 1V70A 4XF0A 5T3NA 4J3GA 3T90A 1X8EA 4X5KA 4E2SA 4HNXB 3RPQA 2PAMA 3NW4A 4DNCA 5JR7B 3E6CC 2PQ8A 4KOVA 4XNHC 1VJ2A 3TOBA 1PM7A 1PU9A 4E2AA 3USSA 1EP0A 1S60A 1CJWA 3MZHA 4I0BA 3E5UA 4L89A 5LEKA 2B3VA 4X6RB 3I7DA 1NE9A 2J8RA 2I00A 2G3AA 3DL3A 2R7HA 4O9GA 5KTCA 2E9QA 5KHIA 2GE3A 4JXRA 3ETQA 1I1DA 3BLNA 2C0ZA 4EWDA 2RC4A 1Q5OA 1UIKA 1YFYA 4F7ZA 5I0SA 2PYTA 1IPJA 3U0ZA 4IUSA 1BO4A 1UD1A 2PR1A 3RYKA 3EY5A 1NMTA 1IYKA 3R96A 1Y9KA 3SXNA 2H6BA 3KSCA 1XE7A 3EQEA 4AB7A 4IF5A 3BALA 3CLPA 2QCSB 5E16A 1YLEA 3LD2A 1YFUA 3HQXA 4YYOA 4KVXA 4AG7A 1RGSA 5IX3A 2K0GA 1FI2A 1YR0A 3W6SA 3SCHA 3EHKA 4IETA 1V0CA 3UKTA 2B5GB 3MYXA 2OH1A 4MH0E 4MUVA 3GY9A 5FCCA 3GYAA 3PZJA 4HKFA 2IXKA 1S7NA 1KUXA 1VKCA 5C82A 5BUVA 1MJBA 2F4PA 1YVOA 2IL4A 4PJYA 2FQPA 3IDBB 5E96A 1NYWA 4LUAA 3SHPA 5DWMA 4PK3A 1YFXA 3WR7A 4XFIA 2N7GA 3CXSA 4FT8A 4XNHB 4JXQA 3BB6A 1M4IA 2HV2A 2P6EA 2ZW4A 2Q04A 2MHFA 4R57A 3TTHA 1UPIA 1UFHA 1ZNPA 4MY0A 4CAWA 3FRMA 3R95A 4MZUA 2B4DA 1O5LA 4XFHA 4IEWA 2X7BA 1LRHA 4R52A 1L0CA 1YGHA 1PUAA 3H1WA 3R6SA 2HQYA 4R3LA 4YFJA 1J3PA 2OZUA 4A2UA 1HW5A 3TO6A 4UBGA 3CEWA 1G6NA 5CVRA 1L3JA 3ROUA 4CYDA 2ZW5A 4BYYA 3S6HA 3ST7A 2MPFA 3FBUA 2FMYA 4QBJA 1OI6A 4RS2A 4NF1A 2CAVA 2ZXVA 5FPZA 3VHRA 2GZWA 2FT0A 4L8AA 2Z10A 2GU9A 1LKNA 1QSNA 1O4TA 2K5TA 4IEZA 3S7EA 1Z4RA 4Q0PA 5GCNA 3JUWA 4KOXA 3F8KA 2CY2A 2CGPA 4M85A 3VWDA 3U10A 2F5IA 2OZHA 4B5PA 3T9YA 1CAXB 5I91A 1S7KA 3CO2A 4U5YA 3M3IA 4MGKE 3E5QA 2Q4VA 3H1YA 4JLYA 5I8SA 1ZRRA 4KOYA 3RZZA 5H84A 4PIZA 4LX9A 3LZZA 4P9GA 4ZU4A 1IPKA 4PSXA 4N9HA 4QX5A 4Q29A 3G7DA 1J3QA 3DKWA 4HLTA 1M4DA 1GHEA 2VEZA 2VI7A 4UWIA 4R8HA 3IDCB 3E5XA 1YWKA 2B5GA 2PAKA 5KHHA 2FXFA 3H3UA 4XFBA 2ZW7A 3MDPA 4IEYA 2QDRA 5FLJA 5I0TA 3S7IA 1ZZBA 4QGMA 1YREA 2MNGA 2B5HA 3MPBA 1ZRDA 4IEQA 3I59A 1I12A 3ELNA 5C88A 4FD4A 3E6BA 3ACLA 2BSWA 1H1MA 4CRYB 3F0AA 1X82A 3P2HA 5C6CA 1KZFA 4TLFA 1QSMA 1LB2A 4XFCA 4MHDA 1P0HA 3SMHA 3WW4A 1U12A 2C27A 4AQ2A 3DNSA 3NJZA 3TO9A 3D8PA 4IERA 2QIRA 4QB9A 4X6QB 2FE7A 1QSOA 1J58A 4YGOA 4JJXA 5HI0A 2O8QA 3S6FA 5I0CA 4AXOA 3D0SA 5BPXA 3OF1A 1U6MA 2G3TA 4UWJA 2D4PA 4NVPA 1CAVA 3BJ7A 1MJAA 5HH1A 4LEJA 4LTAA 1Q3EA 2ATFA 3HIFA 4ZU5A 1MJ9A 3RYOA 4B29A 1QSTA 3FZ3A 3KCCA 3KGZA 2D40A 3FFQA 1RO5A 1OD5A 4U9YA 4IEPA 1RUNA 4UBRA 4UBHA 3D2MA 1OZPA 1Z9UA 4XPDC 4IEOA 4KU7A 2V09A 1CX4A 2BUEA 2WC2A 5F47A 4MGIE 2ET1A 4UXAA 1Q2DA 2OB0A 4KWJA 3P2FA 2FCKA 3I3GA 5IV0A 3W6XA 5DWNA 4CAVA 4KL1A 2BNMA 2GANA 1CAXA 2PFWA 3CXPA 3ZJ0A 1NZCA 1ZZ9A 2OZGA 1QY4A 1NXMA 4JV4A 2IXLA 3SCGA 3D3SA 2PAEA 2Q44A 4JD6A 4MGYE 3LA3A 4IEUA 2IXJA 1J59A 3TO7A 3RYRA 2IXIA 5FVJA 1I5ZA 3FE5A 4BIFA 3BJ8A 1Y9QA 4BMHA 5AVPA 2VZZA 4KORA 3OTFA 4KU8A 1XF8A 5I0RA 3PP9A 5JPHA 4EROA 2ZKLA 2ETEA 3NL1A 5KBFA 3G3SA 3FJSA 2JLMA 4KUAA 5J8FA 3EO6A 3WW1A 4KLWA 1TQ5A 3CJXA 3TCVA 4JTOA 2VQYA 4E0AA 3EO4A 3KGLA 4XFFA 4XPDB 1YUDA 3NE7A 4WZCA 3GKRA 5CU1A 3D82A 4XF1A 2B9UA 2GC3A 2Q4SA 1M1DA 2Q7BA 4CRZB 2R8VA 3H3ZA 2BNOA 1WWZA 2Z69A 3DDDA 1ZREA 1BOBA 1KUYA 4KVME 3ZZIA 2GC2A 1ZRFA 1CAUA 3EBRA 1VP6A 3HT1A 1RL3A 2CV6A 3WW3A 1GQHA 4YARA 2OU2A 1RXTA 5EZWA 5JAXA 1P4NA 2IC1A 5J8CA 1H1IA 3H7YA 3TNQA 2IXHA 2B4BA 4N9IA 1ZX5A 4HVRA 2H0VA 3G8WA 4WVZA 5I93A 4XETA 4CS0B 1NE4A 2Z0ZA 2ATRA 2UYBA 4U9ZA 4HSLA 3SXOA 4HVQA 1KUVA 2PR8A 3TFYA 1O7FA 1XEBA 1IYLA 1DGWA 2D5HA 2BL1A 4WBBA 2R98A 5H86A 4AG9A 2XL7A 3S6KA 1Q43A 1O3QA 2B58A 2CAUA 2I45A 5F49A 4IEXA 5KTDA 2Q4YA 2EVNA 1S5KA 1R57A 3EFAA 2G0BA 3IBMA 4OFGA 3BCWA 5F1RA 1EPZA 1FY7A 2O28A 2QECA 1DZRA 1EYBA 1LR5A 2JDDA 3ES1A 3BPZA 4PIYA 4QGLA 3SCFA 4R9MA 1Y9WA 3SHRA 1O3RA 5ISVA 2VPVA 3OCPA 1XIXA 2HKXA 2GAUA 2I79A 2GC0A 4K8FA 4FBFA 1CGPA 3IGRA 1ZZ8A 4HN0A 3UY5A 3FB3A 3F5BA 1PMIA 4HMZA 2REEA 3CXQA 4QXKA 4QUSA 3LA7A 4OADA 2PRBA 4LULA 4I3PA 3H50A 1YFWA 4AQ6A 3K9UA 2KXLA 4PIXA 2DCTA 4XF4A 2Y0OA 2H6CA 2XKOA 2VZYA 5F46A 2CNTA 3H4QA 1Q2YA 4QC6A 2OZJA 4PSWA 4XF9A 3LA2A 4ZBGA 4RD7A 4QM9A 3IIAA 2B8MA 4KUBA 1DZTA 2UY9A 4XFAA 1O5UA 1VR3A 4YNIA 1O3TA 3NSTA 1MK4A 4MJ8A 2P17A 2VBQA 2PHDA 4HNWB 2OYZA 2EVXA 2JDCA 2J8MA 2XGXA 3NVCA 1SEFA 1UCXA 3NKTA 1K4JA 1QSRA 1I21A 5I8YA 4OAEA 3FYNA 4HBNA 2HUZA 3LAGA 4LUMA 1SQ4A 5HMNA 2Z2SB 2ZCWA 3KMHA 4GS4A 3TT2A 4LA3A 4R3KA 3E97A 4BHPA 5F48A 2PC1A 2UY8A 5BV6A 4M3SA 4Y49C 1I6XA 3E6DA 1OFNA 5J7MA 2QMLA 1QXRA 4L11A 3KKWA 2XHKA 4FD7A 5J3UA 1VHSA 4H7LA 2H5MA 2GH2A 1WLTA 1SQHA 2GIVA 1OMIA 5CADA 2D93A 1TIQA 3R1KA 4KVOE 5EFUA 3DN7A 3RNSA 3H8UA 1XRUA 3QACA 4QMAA 3PNAA 5D1IA 5K8SA 1S7LA 4NCZA 1NE6A 3PVBB 3LOIA 1DGRA 2PDOA 4J1XA 3U11A 3ZDSA 1WK4A 3N7ZA 5LEJA 1YK3A 2AJ6A 3H9AA 2WPXA 2XLFA 4HNYB 4F0YA 2PQQA 1X7NA 3QOPA 1WGPA 4D7SA 2BNNA 4B5PB 3DSBA 4O9EA 3RDIA 1JUHA 4R87A 2PA7A 4FAHA 1GQGA 1XMTA 2VXKA 4PK2A 3GBFA 2QJVA 4B5OA 4II9A 3R9GA 4Q0UA 4KOUA 1QWRA 1M44A 2FSRA 5IB0A 3I54A 4IESA 2ET7A 2GC1A 2D5FA 4PV6A 3V8IA 1CAWB 5JSOA 4KZTA 5KHGA 2IXCA 2BEOA 2OPKA 4HVOA 4ZU7A 4QGNA 5JSRA 4Y49B 4H6ZA 4XFGA 1Y7RA 3FIXA 4KLVA 1ZVFA 1QXJA 1XE8A 4NEXA 4NSQA 4I49A 5LRSA 1XE4A 2OZ6A 2D4OA 3OWCA 5LRRA 4FD5A 5FLIA 1S3ZA 4LA2A 1NSLA 2NMTA 3CF6E 3QB8A 2WPWA 1ZZ7A 3I59B 2VECA 2BYVE 1RC6A
chains in the Genus database with same CATH superfamily
2ZELA 4UFXA 3GNEA 5GKAC 4Q0SA 4N7IA 1PVC3 5JCTA 1OXCA 4BLJA 5T5LA 4OMCA 4K3NA 2EUIA 4NIIA 3POWA 4E2GA 3KHBA 1LAMA 1GWKA 4AVCA 1E5SA 5FO8B 1F2PA 2XKPA 2ZOEB 2W1SA 1VB4A 1CM0A 5FY0A 5HVFA 4IE0A 1HRI1 1AYN2 3THPA 3C7FA 3HT2A 2O1QA 2F8HA 3DV8A 3VDDA 1RUH3 5C3QA 1QHDA 3FHIB 3DPRC 4CGOA 3HD8B 4UF0B 1V6JA 4I0AA 3GF6A 1KJRA 2KCWA 4RYDA 3D66A 1MZ5A 1QJX2 4ZS2A 3J8F2 2A3WA 2VZVA 3C3VA 3O1OA 1W8TA 4TYSA 4C7HA 1S0EA 2X8KA 2YZ4A 3CKHA 2TUNA 3HQRA 2PHWA 5FUNA 1L7LA 1W6QB 1UZVA 4G9SB 1YQ5A 2E9QA 1BCXA 5FIXA 3TEZA 4ZYQA 1UIKA 4IUSA 1IPJA 1HRI2 3KSCA 4XCBA 4XURA 1K5MC 2R16A 4HKWA 1FI2A 3GYAA 3ZSLA 2HWD3 2VTXJ 3LF7A 4AFMA 4CDUC 3POJA 3WR7A 5IVBA 4M6GA 2A73B 2N7GA 1SFPA 1W3VA 4YW6A 3A4UA 4R3LA 3B7MA 4CPBD 3KQ4B 2QTWB 2W95A 3KZ4C 3IDAA 5IYYA 5HBAA 2ES3A 2B46X 5KXDA 3IU1A 3PHMA 3ZO0B 1QMJA 2Y38A 4C90A 1LAPA 2CY2A 5FY9A 2VMGA 5HCAA 2Q8EA 5LATA 4ONWA 1J1TA 3ATGA 4AFBA 1NLQA 3D4UA 3RZKA 1K42A 2GMPA 3WNPA 2PHRA 5KHHA 4MCPA 2QDRA 1LESA 4RL7A 4HPKA 4XTPA 3WDYA 3TN91 4MXVA 2JE9A 4YVSB 1XOYA 4E4ZA 2K46A 3WW4A 3DNSA 3WNXA 3VHPA 5J09A 4PHZA 2YU2A 3K9TA 2ATFA 2ZHLA 4WVMA 3VZKA 5F2WA 1CN1A 4IEOA 2R1DA 1TME1 2HEVF 3P2FA 3K3NA 3W6XA 5K8MA 5D8AB 3SCGA 3D3SA 4A6OA 3F95A 3NV4A 1H9PA 5T50A 5AVPA 2VZZA 2VR4A 5I0RA 5B2GB 5DDJ2 3AMQA 2GLJA 1W9WA 1TQ5A 3IEHA 2D6MA 4MFLA 3VD5A 2W0XA 5HXMA 1UYPA 4Q8KA 4UEZA 4NIGA 4C1WA 4CAFA 2RDSA 3TN92 1AUGA 3BODA 5CFCA 4DJLA 4QPWA 5DG1A 2PHUA 5DZFA 1RJ8A 4COVA 1W8FA 2VL4A 1SLIA 2I45A 3NAPC 3PTRB 4JC1A 3KV6A 1W05A 1TME2 3TRSB 3WF0A 5FXWA 1OF3A 3KWVA 5FXZA 3VBRA 2R30A 2ZGOA 4QDQA 4MGQA 3SH3A 1VBB2 2R6QA 1WMFA 2XKOA 1A2ZA 2CNTA 4ZZ5A 4UFLA 5AG5A 4M0HA 1IS5A 4GH4A 2AUYA 2ZMLA 3WNNA 2DF7A 4Y24A 3VUOA 2C1FA 5HMNA 1XU2A 4JGZA 3POBA 2E7AA 1ODMA 3E6DA 1JZ8A 3ISZA 3OBTA 5FYMA 3VARA 2DU0A 5IAXA 4LBQD 2VZ3A 4AEDB 3N7ZA 3VBHC 2BGPA 3H9AA 3CJIA 5L7OB 4K6BA 2IUWA 4R87A 3GZAA 4BXFA 3ZFGA 2GU2A 2ZGTA 4UEEA 3V0AB 2HWE3 1XSRA 1US2A 3T2PA 1QXJA 5LRSA 2VZOA 1TZOA 3NE8A 1NOVA 3D68A 2ORXA 3CL1A 3R9FA 2IVJA 1COV1 3UETA 2BPA2 4Y20B 1Z2LA 5JIAA 5FQ0B 4UF4A 4GWMA 2E6VA 1M4GA 3LB9A 3GM8A 2PJBA 2VU9A 1OFSA 1Y3TA 2PHLA 2DXQA 3ZYFA 1YW6A 2BOAA 2A4NA 3GDBA 4MI4A 3WF1A 1JMUB 4UA3A 5H9PA 4EJRA 1FT9A 2D6KA 4AAXA 5DABA 2GREA 4JRLA 3SNMA 2ZAAA 4P6YA 5C8CA 5F5AA 3NJXA 3RVHA 3DKQA 3FNCA 3LPFA 3VKOA 1WMEA 4OHYA 2VVEA 3KD4A 3B02A 1CPMA 4JWPA 1KQRA 1UW8A 4XF3A 2B4DB 1A8DA 1LU1A 4M3CA 3D2PA 1COV2 3ACIA 3LODA 2WNUB 1LODA 4AEKA 4Z07A 3MFAA 1NZIA 2VQ0A 1Z8LA 4CCDA 2VTXA 5J48A 4NAOA 1B87A 1ENXA 4KG8A 1OUXA 1V70A 5JMOA 4J3GA 3ZOIA 3E6CC 3VDAA 2YY1A 5ERLA 1RUC1 2X53S 4X6RB 2J9AA 2G3AA 2PJAA 4OC2A 1G9BA 5CBMA 2JDMA 3RRDA 4AB7A 3WQ1A 5F5QA 3UJQA 4MUVA 3PZJA 4FPGA 1LOEA 3I4IA 1IZ3A 1VBA1 4BINA 3S5AA 2VMDA 1BEV1 3AJYA 3WABA 1DE4C 1ZBA3 2J1UA 1LRHA 4QHBA 1QJFA 2OZUA 3CEWA 2Q8DA 1G6NA 1L3JA 1MZEA 3DUIA 2RS51 3OGRA 4A95A 3VLBB 3GIUA 1C5IA 1O4TA 4YG6A 4DMIA 2CGPA 4FPLA 4B5PA 1AL21 1TMF1 3VDCA 3RZZA 3OJBA 1RUC2 2DV9A 2HH9A 5FXVA 2BOJA 4Q4W3 4YPJA 2OVUA 2Q1FA 5FLJA 1WUVA 3CZUA 1TKFA 2VZ1A 4UFVA 1PHMA 1VBA2 2WT0A 3JXSA 1Z8TA 1TVGA 2CXAA 2J1AA 1BEV2 3UJOA 2O8QA 5BNPB 3AK0A 1OPOA 4LTAA 1OOPA 2VGDA 1PZ8A 2NM1A 1SDWA 1PVC1 2RVAA 2RS52 2V09A 5BNOC 2OB0A 2XJPA 3APBA 1F35A 1ZZ9A 3WNLA 4JKLA 1AL22 2PAEA 3S57A 3RYRA 3S30A 4X2TA 1JI6A 4Y4YA 1ASJ1 2AFXA 3PP9A 4WM7A 4LMFA 5JZGB 1HRV3 3AVSA 4KUAA 3ZXFA 3TCVA 1KWMA 5CU1A 2BBVA 4XF1A 4Y5Z0 1RUH1 2ZTNA 1U5XA 4CEWA 4COWA 3VBUB 3DDDA 3IZOA 2OU2A 1CJDA 4ES9A 5JAXA 4A2ZA 1W8WA 4N9IA 4FP3A 4G3YC 2YROA 3M3EA 3SXOA 5F3CA 2IZWA 2A7AA 4AI9A 5GM0A 4RR3A 1AJOA 1HB4A 1PVC2 1ZA7A 1W90A 3PDQA 2ZEPA 3ZFEA 1D4VB 3AM2A 3IM0A 4PXEA 1S2EA 4D94A 1DQ0A 2C5DA 3LA7A 4A4AA 1UX7A 2DCTA 1QH6A 1SFYA 1ASJ2 5EWSA 4PSWA 4LHLA 4XILA 2F7VA 4MJ8A 4M0NA 2VBQA 2HWD1 5LBCA 3AKRA 1KGYA 1RUH2 5LBEA 1UCXA 1QSRA 5JXGA 5A3NA 2CTCA 3PB6X 5BWAB 3B01A 3HJRA 3W9AA 1OFNA 2Y64A 2H5MA 5DQ0A 5LYLA 4P14A 3DPRB 1UAIA 1WK4A 4AHWA 1ALYA 3L9JT 2PQQA 2BNNA 5T52A 1EAH1 2YC0A 1JHJA 2POKA 4PDWB 1G86A 4IESA 3SQOA 5DUUA 4AK3A 2UURA 4EZHA 4MG2A 4I49A 2YBKA 4RS5A 4JQRA 1JODA 2WPWA 1JQGA 4M3CF 2WINB 2XJTA 3WP3A 2HWD2 4HFSA 4CU8A 4LO7A 1LNSA 2BGCA 2ZEXA 2PE3A 3KV4A 4IE5A 2EA7A 3J7NA 3WDTA 2JEMA 3RJRA 4KSAA 4CA9A 1K5MB 4QPGA 3OEBA 4N43A 3WW2A 1OF4A 5F3IA 3KR5A 1HB2A 3ZLIA 4NIAA 3GYDA 3H5ZA 4QPIC 2PIYA 4ZY9A 4K30A 3QH7A 4MX3A 5BNNA 1Q2CA 3FUOA 1J1LA 2VM9A 2PTMA 4GMP3 4KGGA 1PMHX 2HWB3 3IMNA 1OA4A 4WWVA 4Q0VA 3VWEA 3C7EA 2CNMA 1EAH2 1NLRA 2LALA 4NPLA 1BMV2 1MS3A 3LWUA 1LGCA 1J4JA 5A3UA 2IMOA 1DQ6A 2AC1A 3C26A 3NH5A 4I09A 1G7YA 2XJUA 4LUKA 5DUVA 3ZFFC 5A27A 2P6GA 4JRAA 3ES4A 1DF0A 2VBPA 4CAXA 1OC1A 2W92A 2WFPA 4L9BA 2JWPA 3WXPA 5IVJA 3N9PA 4MHNA 1OUSA 2H6BA 1GP6A 1TNFA 4W8JA 2K0GA 4RQPC 4A32A 1YR0A 3MYXA 4EN6B 4HKFA 4P4FA 1KUXA 1VKCA 4XQ4A 1CQ9A 2VZUA 1LGNA 5H9SA 3KHZA 4FT8A 4NN0A 3B69A 2WN3A 3RI8A 5FZ7A 3R6SA 1IKQA 2BW8A 2FMDA 2ARXA 4QB1A 5CVRA 4CYDA 2DBNA 3N9NA 4CXWA 4RS2A 1V6NA 4R4XA 1YQEA 4A45A 1LKNA 3OY8A 1Z4RA 2OZHA 3T9YA 3AZXA 4CCLA 4MHRA 4BM8A 1AYEA 1HQWA 2P6HA 1XQNA 3HPNA 3RZLA 4IV3A 3USUB 4TXWA 3H3UA 3Q8CA 4CUBA 2VQTA 1A8MA 4CDWB 3I2IA 1TKJA 4CYQA 4I30A 4NGQA 3WP4A 1RVF3 5EJZB 1P0HA 4GM5A 1RIRA 4QDRA 1YQ2A 3KT4A 5C4WC 4IV1C 3D7DA 1ULDA 4QX1A 5HH1A 1NCRB 4YM0A 3U14A 3JD73 3LEMA 4JGYB 2Y6KA 1W0NA 2I2SA 5A7PA 5FZ9A 5AFBA 5IK4A 5IV0A 2VO5A 5FR3A 2JDZA 2R073 5FZ1A 3CXPA 3TO7A 3D7GA 4NGSA 3VKNA 2Y60A 1XF8A 4XE9A 5A6YA 3KLSA 2ZKLA 1Y7EA 3OGSA 2F6BA 1MR5A 1C3HA 5D29A 3UYJA 3A9LA 4CDQB 3FLTA 1W04A 5FZ4A 2TBVA 4JQTA 4YVSA 3N3HA 1W9YA 2E31A 3NNMA 5FOJB 4BJ0A 2Y0IA 2VOVA 1W6NB 3NRUA 1DGRN 3KCXA 1ZRFA 4Z1VA 1P4NA 2VNOA 5A33A 2FZ1A 3PRTA 4D8MA 5SV5A 1XEBA 1A6CA 5J36A 2PJ5A 1SBDA 3EFAA 2LTNA 3BPZA 5KC5A 2EXIA 2HKXA 4HN0A 3ILFA 1GKBA 5J1XA 2WNVA 4HMZA 1UKGA 3SH4A 4CGLA 2L9LA 3ABZA 1UZYA 2VG9A 1O8SA 3SI0A 4PBPA 1YCIA 3U4SA 1VMFA 1DZTA 2VVFA 3L2YA 5FJHA 3J7LA 3T0BA 2RJLA 2DVDA 3IU2A 2QQIA 1QOTA 1GZ9A 3VDDC 2BJSA 4R76A 1VALA 4Y49C 5LY1A 2DEAA 2O8OA 2D6OX 1NA1B 3RZMA 3SH5A 2WIIB 2V4AA 2WPXA 3QOPA 2QUOA 2QQLA 4JZRA 1PGW2 1SZBA 2ET7A 2JIJA 4OC1A 1U5YA 2BEOA 3PUQA 4DEQA 4Q4W1 1ZYBA 2OZ6A 5LRRA 5FLIA 4CP1A 4N53A 2VBBA 2V77A 5IVFA 1YLLA 1Z4EA 1H2MA 4V2VA 1UO9A 5F37A 3PFOA 3SJEA 1RUI3 3FXTA 2D6PA 5L7OA 4IL7A 2BEIA 2QNKA 5L19A 4BDVB 3THDA 2YNCA 4DXZA 2G1MA 5CKQA 4MHUA 2ZZJA 3FX3A 4Q4W2 3H0OA 2VJXA 4YRHA 4Z2WA 1YI7A 3SXWA 1FT7A 2E33A 2R063 3ENRA 4OC3A 3T8WA 4LK7A 4K21A 3MN8A 1V6LA 4P00B 3T2TA 1S7FA 5FQ0A 2RS31 2Q30A 2EWBA 2ZOFA 4MSVA 4A41A 3MPPG 4Y5TA 4KOSA 4QX2A 4XNHC 4E2AA 1N47A 4H3WA 4A94A 1I1DA 3RFRA 4ZGYB 3R96A 3CLPA 1YLEA 4Q27A 2D97A 3ZM8A 1ENRA 5BUVA 2PLV1 4A39A 2XDVA 3MI8A 4WM8B 3CDXA 1YJLA 1IY7A 1CIWA 3FN9A 2A3YA 4R57A 1NCQB 5FKBA 4MZUA 2B4DA 1R1A3 4UYBA 4LHKA 2A70A 1BK1A 5CFDA 3S6HA 3JCIA 2PJ0A 2RS32 3VBFB 2V73A 4MFPA 2FT0A 1QSNA 2P5BA 2QZ2A 1WBFA 5C3OA 4KOXA 4PPZA 4JKMA 3U10A 2VVDA 3OUHA 5K7PA 1UMZA 3ZYIB 1PX4A 3LZZA 3OEAA 5CFCC 1IPKA 2ERFA 2TNFA 4P9WA 4P4EA 3LMSA 3PBEA 1M4DA 4C8DA 4YGCA 3H8RA 4IEYA 2MNGA 3JQWA 1X82A 2PLV2 4YZ3A 1POQA 4O61A 3SJGA 4YW5A 3NMBA 2VNVA 1U6MA 1IG3A 4ISQA 4B29A 1QJU1 1AX2A 2XQRA 3FFQA 5FYCA 2YV8A 5A80A 4IEPA 1XC6A 2BUEA 4UIBA 5F47A 4KGQA 3QAYA 5ELYA 2Q44A 2ZGQA 2ZEMA 3MV11 5FVJA 3BJ8A 5FZ8A 2YBPA 3O0XA 5A3OA 1JN2P 4QKFA 3G3SA 4TLGA 5FYBA 2WZ8A 1VGYA 2HWB1 4JCKA 4FO9A 4LE3A 4H2KA 3LDBA 4LIUA 2R8VA 2A6ZA 1ZRIA 1BOBA 4LBKA 2IFRA 1CAUA 1UXXX 2PHFA 5BNPA 1Q7LA 3ZFGC 5AG6A 2PR8A 3TFYA 4BD9A 1ENSA 2BVBA 2WRAA 2OW4A 4GIQA 1QJU2 1RJ7A 2EVNA 2ZX4A 4ARXA 4R9MA 5EYYA 4JHZA 1KD7A 3M2MA 4OADA 3AXDA 2WLPA 3K9UA 5JZGA 1KS4A 4IUGA 4OUSA 1SLBA 3I97A 3KF5A 4YVWC 1TEIA 2HWB2 4YNIA 1MK4A 1A78A 2P17A 4R8FA 1LEMA 4URAA 5K8PA 2CGNA 5A70A 2HUZA 3INAA 1X33A 2DVGA 2BWCA 3WCSA 1AJKA 5DAPA 2NQYA 5J3UA 4XXAA 4H7LA 4RFT0 2H0BA 3R1KA 1R1ZA 3MHZA 2JICA 1YIFA 2PDOA 4GAZA 1SLCA 5FWJA 1ZG8A 2AJ6A 2ILMA 4XBNA 4EN7B 4OHVA 4Y1UA 2QJVA 1CIYA 1S0IA 1CAWB 5JSOA 2ZAHA 5FYUA 4QGNA 4RGAA 1VAVA 1W2OA 2DCYA 1AR83 3WV6A 5ACA3 5JMCA 1SBFA 5ABJC 3KHCA 4X3RA 2J8NA 4YM2A 4V1PA 3QNVA 4LLOA 3VN4A 1XBFA 1RVF1 4S2FA 2WA4A 2WO1A 5I0UA 2ZGRA 1KS5A 3N4MA 3QAHA 4YRDA 3BTZA 5A32B 4C7IA 4XC9A 3ZYGA 2XB6C 2CL2A 5FDBA 2Y26A 2W3JA 4YGDA 2R071 2Q4ZA 2BRTA 4EVYA 2X29A 2XH6A 2FIAA 3NNLA 1S55A 1PNGA 1C8M3 3ZYJB 1ZLHA 5DUWA 1IQAA 2WT1A 4R4ZA 5KHKA 5FZGA 1DYOA 1ZZCA 1HJGA 5FZOA 5CA6A 4FTSA 3GB0A 4K8RB 4OKOA 4XQWA 3R4UA 2UWCA 4Y33A 1RVF2 1YQ6A 1Y9GA 1XOVA 3O1SA 2RM21 3K51A 2JEWA 4O7XA 5HVHA 3KVAA 5KTCA 1OSGA 3JD72 1QKQA 1EV13 1Q5OA 1BO4A 1Y7BA 3BALA 5FO9B 1OOPC 5IX3A 2WWUA 1IKPA 2R072 3EHKA 4IETA 2Z3MA 4N8MA 3IDBB 3NH8A 3WP6A 4DRVA 2RMU3 1KEXA 2F4LA 5IVYA 2YHJA 5F7UA 1NG0A 4RUHA 2Q04A 1UFHA 3FFZA 4GA9A 3R95A 5BNQA 2W52A 4WM7C 5F5IA 3FF3A 1ST8A 2BO9A 3ROUA 1VBD3 3AMHA 5FPLA 1OI6A 1DDLA 3IAPA 1CWPA 4WV8A 3DXUA 4CEWC 1DLLA 2RM22 4FPYA 1SDDB 3RMYA 1YRZA 5G04L 4LBNA 2BTVC 4R8HA 3B93A 1GWMA 4RR3C 5EP9A 2FCUA 3F0AA 2YGLA 3IB3A 1QSMA 4MHDA 2W68A 2AENA 2AFSA 4Q4X1 1JTZX 1X9TA 2RS13 3D3AA 1VHOA 1NQDA 3MO4A 3HIFA 4AEJA 1RO5A 4OIDA 1UX6A 2ZEYA 3ZN6B 3ITQA 3L2NA 4DNYA 3ZJ0A 3BYWA 4JD6A 3PUIA 4QQ2A 4NHXA 1Y9QA 4BMHA 1RUI1 2WWSA 4CDXA 4EROA 8CPAA 4LE4A 5J8FA 3AKPA 3EB7A 2JDUA 3T4VA 4Z2AA 1N1YA 3EO4A 4BQ2A 4XFFA 4G4FA 3RG0A 2K2SA 1CZVA 4FPCA 4DY3A 3OOXA 4XUPA 5A6ZA 1WKYA 2JBJA 4OI1A 1E5IA 4LXLA 1VP6A 4CYOA 1QNWA 4P4BA 3PFEA 1NCRA 2R061 4CS0B 4KBBA 2VOKA 1Q43A 4JGYA 4OQ8A 2CDOA 1CBXA 1TF9A 4XIKA 3SCFA 2XVGA 2ZHKA 3B9CA 1HKDA 1PMIA 2PRBA 1Q8VA 2ZEDA 1RUI2 1QJY3 4XF4A 3U07A 1MACA 1UN1A 1H8TB 3HR9A 2VZYA 4QPGC 3VHNA 1C57A 4N43C 2XEIA 4CDQA 3K4ZA 1XNDA 5FP9A 3PB7X 4P9LA 1Z0HA 3D6EA 4GXLA 4CZSA 2D43A 5BNNC 2JDCA 1TG7A 4Q7AA 3PB8X 2F17A 5I0DA 1F8VA 4Q5OA 3BTYA 5A7NA 1NX9A 2LS6A 5FP3A 4M3SA 1R1A1 5IATA 3RS6A 4L11A 2R062 3UT0A 1SQHA 4HPSA 2V4VA 1FYUA 3DN7A 3SLIA 5D1IA 1FV2A 3LOIA 3U11A 4LPLA 4X8NA 4XUTA 3IPVA 3LACA 2EIGA 5HXVA 2P3JA 2HWF3 2W46A 4C2YA 4NHLA 4D6SA 3POIA 3OWCA 2VCMA 5FZKA 2NMTA 1WW4A 2PCUA 1YIPA 4HT1T 1RC6A 4HPKB 1M4LA 2Y0MA 4FFIA 3U37A 3NKGA 4KBZA 1UY1A 3WEZA 1Q8PA 4NFRA 5K0UA 4HZFA 4M01A 2B4KA 3TNPB 4BE3A 1RMU3 2ARHA 4UCNA 4AEMA 1R1A2 1AYN3 2XL9A 4AVBA 1NA1A 1H2NA 2CGOA 1H8LA 4GULA 3WT3A 3A21A 1N1VA 2AEZA 2V5DA 5FMBA 4B7KA 3RWKX 4LHNA 3BKZA 3V38A 2A3XA 1K5JA 4XPLA 3GALA 3ZXKA 4MVTA 2Z79A 2Y8KA 1J83A 1POV1 2WUUA 5JM6A 1FOD1 3PEIA 5C70A 4EWAA 2HYXA 1VRBA 2QE3A 4XUNA 4QKBA 2UYAA 2ZMKA 5LCWL 2Z11A 2DPSA 5KC6A 4L2NA 2PMWB 3ZXDA 4P9JA 5FPBA 4GWNA 2GP3A 2QKDA 3RPQA 2ZEFA 4LJHA 1VJ2A 3SISA 4CU6A 1JYVA 2R7HA 5KHIA 3KS7A 1NMTA 2ZGNA 1PGL1 4IF5A 3LD2A 3A23A 4AG7A 4LLFA 3VBRB 3VZLA 3NJVA 4V2WA 4QU2A 3ZXAC 1NLSA 1DQ5A 1XNTA 3SHPA 4PK3A 4UCMA 2HV2A 4DZGA 4GH4B 3WC6A 3PVNA 1PUAA 3CNAA 3FEEA 1HX6A 3QLQA 2HB6A 3NH4A 4JGZB 4X8IA 2Z10A 2B7YA 2RV9A 2K5TA 4IEZA 1MEC1 3NV3A 4YVSC 3F8KA 1STMA 5GZGA 1LHWA 2FDHA 4XBQA 4JLYA 3BIWE 2BFUL 3NNJA 1F57A 5FYYA 4CYPA 2YC4A 3CJIB 1QQ9A 4ZXEA 3ZPYA 1YWKA 2KA3A 4FPOB 1PGL2 4K1YA 3M3QA 4YW1A 3E6BA 5AG4A 1XXNA 4OMEA 4ZONA 5D8AC 3SMHA 1RINA 2VOWA 2C27A 1C1FA 4XJUA 2VCAA 4AQ2A 1BVP1 1NCQA 1GOGA 4XDOA 4HONA 4QB9A 1AR81 5ACA1 2A6XA 4B4PA 1AUYA 4LIVA 2ZENA 4ZU5A 3KCCA 3KGZA 2X05A 3LOBA 1OZPA 4MGIE 3W20A 3WCRA 3I3GA 3AP6A 4XCAA 1WCKA 4Q4Y3 1QY4A 4MGYE 4FWUA 4OC4A 4CPBA 3FE5A 3P5BA 2EALA 3BI0A 2WQZC 4FXGB 3N7JA 2GLFA 2AFZA 2ZKNA 4MGSA 5F3EA 1D4M3 2IQ6A 3I2DA 3KGLA 3NE7A 3WNMA 2VUJA 3GKRA 2YMZA 2XEJA 1C8M1 2ZGKA 3D82A 3T1LA 2Q4SA 3AJZA 3M8LA 1FAYA 5C8CB 1UNBA 4UOJA 3T0AA 2PRQA 1RL3A 1GQHA 4MMOA 1UOGA 2IXHA 5F09A 2CU5A 1AR82 5L9VA 5ACA2 3THTA 4LK6A 2PQSA 1NE4A 3GXUA 3GZEA 2D7FA 4M3CB 1IYLA 4WBBA 4RHV3 5JDBA 5J96B 2VW1A 1X9PA 4FQ4A 3A7QA 1V00A 2P3KA 5FZAA 2I79A 3H8GA 4QUSA 4I3PA 4PIXA 1EV11 3K3OA 5DN2A 3LFMA 1WWYA 3IKWA 4J6GA 4YZ1A 4XUOA 1OH3A 4AEDC 1ULEA 3NSTA 4HNWB 2EVXA 1C8M2 5L7OC 2J8MA 2SBAA 1D0GA 4RN7A 2YNCC 4HBNA 4COZA 5IVEA 2R0FA 3JB4C 4E27A 4YFZA 2UY8A 3JUUA 2RB7A 3WX5A 2JKXA 2UU8A 4J1XA 3I8TA 3WHTA 3S9MA 3UK9A 3O1VA 4B5PB 2RJ2A 5F5CA 3V56A 3LSDA 1QWRA 3TX8A 4ASKA 4Y1YA 4LO5B 5GZEA 5KWRA 4GWJA 1IGBA 1CD3G 1EV12 4SBVA 5LK5A 3WG4A 3KR4A 1US3A 1GANA 1GLHA 1G8WA 2BYVE 1ZBE3 1J3RA 1LOGA 3D0JA 3EXNA 1ND3A 4NWVA 1N3OA 2QDNA 2RMU2 5EHDA 4IE6A 4RI1A 4F8AA 4ZX9A 2YNDA 1TF8A 4RGKA 1LHUA 5JPMB 4OC5A 2FIWA 3SI2A 2LRPA 4B7EA 4ORFA 2X5IA 1IOFA 2Z3OA 3M4FA 3Q8EA 1LOAA 4RGGA 4EYUA 2XVLA 3V7ZA 2WNUC 4I01A 4QX7A 5EIYB 1BLLE 1CAWA 3LGRA 1HV1A 1WMXA 3MGUA 4WM7B 4C68A 2QQVA 4HSJA 2FVGA 2JEVA 3NV2A 4D69A 4DYOA 1COV3 2GMEA 2CTBA 4CEWB 5JGFA 3OBRA 2FCTA 3DR8A 3HQUA 3VL8A 3ME2A 4CXXA 5LRGA 2EXHA 4XF0A 1BYHA 5LA9A 2C6GA 4HNXB 3KV9A 5FYSA 1F15A 2RS12 2R041 4L89A 4AI2A 4MCRA 2GE3A 3BLNA 1DQ4A 3ZFEB 3U0ZA 1HB1A 1XE7A 4CGPA 3EMRA 5FCCA 2F4PA 5F32A 4RA0A 4ET7A 2XJSA 1S4CA 4GJZA 2GP5A 1QJY1 3DYPA 5FTTC 3VD3A 5FZFA 1PO23 5DAVA 1IOAA 2W1QA 4IEWA 2YGMA 3VBOB 4A2UA 1HW5A 4BYYA 3JQXA 2WS93 4ZY1A 4LQ6A 1MS8A 3HLPA 1AHSA 5BYNA 3GHNA 2NSMA 5I8SA 2R042 5BNPC 5DAQA 3N35A 1J3QA 2BV4A 1REFA 2WJSA 2OR4A 3VV1A 2ZACA 1LOKA 1URXA 1F4AA 1YREA 3SKJE 1ZRDA 3K75B 5CB7A 4TTGA 1AX1A 2BSWA 1H1MA 2V72A 5E89A 4WVWA 1U12A 4B12A 1QJY2 3AKQA 4RS5B 4X6QB 2JG8B 4JJXA 1B35B 5I0CA 4E4DX 4UWJA 2WT2A 2ZMNA 5JZGC 4UBRA 4UBHA 1GNZA 1Z9UA 4DO0A 4JDOA 3MIFA 1NKGA 3OBZA 3RO0A 2FCKA 4W9YA 1TMF3 3VBUC 1AR71 2FDFA 4JV4A 1OVSA 5K8OA 4IEUA 3LQCA 1DU3D 1DP0A 3PUAA 5BNNB 4CTEA 3V0BB 1D0HA 2YXSA 1CESA 3J26N 3EO6A 2G9FA 3T08A 5CISA 2DTYA 3UGFA 3SC7X 3ACHA 4HANA 2HWF2 3BTXA 2Z69A 4HK9A 2R1BA 5K9YA 3T09A 1GNHA 1MS5A 1ZX5A 3G8WA 4WVZA 5LYFA 1YC61 1VBE1 2VCCA 5IK7A 4Y3OA 3S6KA 2WNEA 5F49A 4IEXA 3ZN6A 2JX9A 4WZFA 2O28A 2JDDA 4QGLA 1RMU2 4RN5A 1UMHA 2VPVA 3OCPA 4PQQA 1AR72 2BZDA 1ASJ3 3VL9A 5FZ6A 3CXQA 3T2OA 2KXLA 1N1TA 3KI9A 3DGVA 2R49A 2OZJA 4LNVA 2JDYA 2JG9B 4RD7A 1QNYA 2UY9A 4XFAA 1O5UA 1B09A 1XE0A 4FFHA 4D3WA 4EZ4A 2FBEA 2Q5TA 2ARCA 1RUE3 4GS4A 2OOTA 4PDWC 4LA3A 4WVVA 5LB6A 5F48A 3B2YA 1XYNA 3N9LA 4NAMA 4ATEA 3IWWA 4L97A 1VHSA 4CDUA 1WLTA 3ZZIA 1KJLA 1S7LA 1DFQA 1O91A 1S0CA 3OY8B 3ZDSA 4AVSA 3C7OA 1F5JA 4XHBA 1O8PA 1WGPA 4D7SA 5FXXA 3DSBA 1UZZA 1RTQA 4NWWA 5IB0A 4AXVA 3ILRA 2YG0A 1XU1A 4B3NA 1H8TA 4HVOA 2P1BA 1PIV3 4IV3B 4H6ZA 5IJRA 1HLCA 3K4AA 1KRIA 1LHNA 1H8VA 1POV0 3JZVA 3IIIA 3S6GA 2X09A 2E32A 4BOWA 4IE7A 3OPTA 5FK8A 1YHFA 1IICA 3P3PA 3T1MA 1YSJA 4A3ZA 3TC8A 1CJPA 1ARLA 1ZA4A 1V6OA 1Z7S3 2WYFA 3MLLA 2B9VA 2Q7SA 4B11A 1B6BA 3GBWA 4QXBA 5THWA 4KWLA 1W8NA 1N1SA 1EAH3 3ZSEA 5M0TA 1O3SA 3AMPA 3URFA 4CCNA 4FAGA 1PGSA 1XNAA 1JU4A 4Q4Y1 4HN1A 1BAVA 1FXZA 2NN8A 3LDRA 4FPFA 1E5HA 3B3CA 5JQ4A 1XB9A 4Y22B 2BGOA 1D4M1 2OXBA 4QXCA 3GJBA 2RJKA 5HVGA 3QCWA 4D6RA 2ZZQA 3B35A 4UW5A 4EV0A 3HUVA 3DYMA 1ZZ6A 4MHYA 4IK2A 4META 1OT5A 5A33B 1LGBA 4KOWA 3KVBA 4HETA 5FFOC 2LROA 3H8XA 3OUIA 3U78A 2VW0A 2FDJA 3ZXJA 3ZYRA 2FDKA 1Z5RA 1ULPA 2I00A 3NV1A 4RHV1 2NPIA 1UD1A 3CDZB 2E53A 2V8DA 2O53A 3SXNA 5E16A 1EE3P 2GN3A 2B5GB 1V0CA 1TE1B 4CP9A 4CGNA 2WNVB 4MH0E 4Q4Y2 2UWAA 5C82A 3V64A 2ZOGA 2IL4A 4XAEA 4QXHA 1NYWA 4MGTA 4LUAA 2VUAA 5F39A 1U5ZA 4JXQA 3UGGA 3GCWA 4YWAA 3HAGA 3WF4A 1D4M2 3FRMA 3POFA 2X7BA 2W1WA 4CDXC 2WZEA 4HK8A 3N36A 1F5FA 4UFHA 4CDWC 2JDHA 5FY4A 2Y6JA 2GU9A 3AMNA 4Q0PA 5GCNA 1REEA 4DOUA 4IGPA 3WF3A 4AI0A 2Z3PA 4N9HA 1NQJA 1W2AX 4RHV2 1NCRC 1OLQA 1GYKA 2VEZA 4UWIA 4E4HA 2PAKA 2FXFA 3O1TA 4JGYC 5FPUA 3MPBA 4QB6A 1I12A 1GQPA 4M4RA 1AYM3 1NSAA 2WZR3 1UF2C 3DCQA 4CEYB 4N53B 2EO8A 2EIEA 3QD6A 4AI1A 3LEKA 2VOXA 1AX0A 5JPNB 1AVBA 1ZBE1 3CU7A 3FH4A 1I9RA 2VE1A 2LM3A 4CDQC 3OG2A 1X10A 2GNBA 5IB9A 2ET1A 5DWNA 2RFHA 5G20A 5CZKA 2RR13 1IGOA 5GLZA 2AYHA 1UZWA 3FJSA 4KWUA 5ANQA 1JH5A 4QHZA 3CBNA 4XPDB 5IW0A 1QQP1 4OYUA 1GZWA 5LYIA 3IO1A 2WNOA 3KHXA 3AMMA 2IFWA 4CCCA 2JDKA 2CV6A 1GFF2 1PZ7A 2IC1A 5FYHA 1SMVA 4URTA 5DUXA 5LRJA 4HSLA 4HVQA 2P6CA 1DGWA 1ZBE2 1O3QA 3AKSA 4FTEA 3IBMA 1EPZA 1DZRA 4C1XA 4ZKTB 4D6QA 2GAUA 4XIOA 4FCAA 3TEXA 3KB5A 3W5MA 1QDCA 1AL0G 1T6BX 2PXJA 1YFWA 3H42B 5FZ3A 3KZWA 4CXYA 2PJ4A 4H2AA 1HIXA 3OSDA 1NA1C 2EIDA 1O3TA 1IG0A 2BU9A 1JOBA 4F0XA 1QQP2 3AYEA 3KT1A 1K4JA 5I8YA 2JDAA 3VD4A 2E51A 3J7HA 3KMHA 1PO21 5FMDA 4UW4A 4BIOA 5BV6A 4DPNA 1QXRA 4OHZA 4P9YA 1OVPA 5CFDB 4K20A 2DBIA 5EQUA 3PNAA 2WS91 3CHXA 3WQ7A 4J25A 2D3SA 1UY0A 4GALA 1AXYA 1X7NA 1IPSA 4CUCA 3MIEA 5FZCA 4BMBA 3NWKA 1RITA 3SEPA 2GALA 2D5FA 2D44A 4YGBA 3AZVA 3GCXA 3TYJA 4LO6B 1R57A 4XYXA 2REFA 4OHWA 4AWDA 1GZTA 4IW3A 1DYPA 5JXIA 5C8WA 1MZ6A 4DINB 3KQRA 3SI1A 4AHXA 3MGDA 3RNZA 3LWCA 3Q8AA 1PO22 3ECQA 3R4SA 4OLLA 4NRQA 5FPXA 3S0MA 2JENA 4Q0QA 1WCDJ 5EC4A 2P6FA 4YZ2A 3FHQA 4XEZA 1W6OA 4P9IA 2WS92 1W2NA 3O14A 3C7GA 2EAKA 5IUQA 1PNFA 1UWWA 4XJ8A 5I8TA 2XQXA 3IJ3A 2CNSA 4QVTA 3BU7A 5BNOA 3N9QA 4PLOA 4D7TA 2ZX2A 3H8FA 5KHJA 4KWKA 2JJ6A 3R05A 5CBLA 3J9SA 3BTAA 1VPHA 4QM8A 4P5HA 5B4XA 4B10A 1CAUB 4CUAA 2LW8A 4K1ZA 3W59A 4DNCA 1DQ2A 4NIDA 4WM8C 4HXCA 1V9U3 3KV5A 1NE9A 3I7DA 1NCQC 1X36A 2C0ZA 2RC4A 2PYTA 3Q8BA 3KQXA 3EY5A 1JZ4A 4UCPA 1W0OA 4Q1PA 3ALQA 1TMF2 4JYWA 2J1VA 3VBFC 3O1PA 2VTFA 3GY9A 1YVOA 2CHHA 2PELA 5E96A 3MRUA 4BU2A 1LANA 4XFIA 1WCSA 2KD7A 4K3UA 3TTHA 2FDIA 1ZNPA 4MRIA 1SCRA 3RI9A 2RS33 3LPGA 1JWQA 3MIGA 5IWFA 3CQOA 4UT5A 4NUBA 2MPFA 4CSWA 4YW2A 1RUE1 4L8QA 1GICA 4ASLA 2GZWA 2AZ5A 4KH9A 3I49A 1RUF1 5I91A 3E5QA 2Q4VA 3ACFA 2NYYA 4BCUA 4ITCA 3WF2A 1GHEA 4IHMA 2VI7A 2XWJB 5F3GA 2PLV3 2B5HA 2CSGA 3I59A 2YB7A 4PI0A 1CP7A 3IWEA 4XFCA 1G9AA 4NGMA 1PIV1 5IFTA 1A3KA 1G9FA 4AGVA 1R64A 2B45X 5IK5A 1W0PA 3K2OA 2QIRA 3S9NA 1V0AA 1QSOA 1WD4A 3D0SA 3VBOA 2G3TA 1PO13 1SLTA 4MXWB 3BJ7A 1BLZA 1PVXA 4P45A 4R7MA 5EV7A 4BBHA 2WC2A 1RUE2 5G05L 4KI5M 3K4DA 1LU2A 2PFWA 1NXMA 1OPMA 1RUF2 1S0BA 2QBXA 1J59A 1W06A 1Z7S1 5JPHA 5J1QA 2ETEA 4IDZA 2RDNA 3RGBA 2Z4FA 3LD8A 1GBGA 4XZUG 5FK7A 4WZCA 4QPIA 1NUKA 4W65A 2VZPA 1PK6A 1UQXA 1PIV2 2GC2A 5FZOB 2JG8A 4YARA 1HDQA 1B35A 2BDRA 4HVRA 4NJQA 1QJU3 1Q8QA 2GDFA 2D5HA 5H86A 4MADA 2C9KA 4MFJA 5KTDA 4UIAA 4E9KA 2DURA 3WDVA 4QHOA 2DF5A 1H9WA 4OULA 3ZFFA 5C3RA 1O3RA 1WBLA 1XFOA 3ZSJA 2GC0A 2XXZA 3V0BA 2CTVA 2C4XA 1DBNA 1Z7S2 5FPVA 3GLJA 4XMIA 3IIAA 3ETPA 4LHSA 1S0FA 3W21A 5FREA 1YNAA 2A6YA 2FDGA 4RQPA 4AGGA 4N7UA 4AYUA 1MS4A 3ILNA 4I0WB 4K40A 4XHXA 1WCUA 2WKKA 1HEEA 4F83A 2DVBA 4N90A 2XVKA 1VIXA 4PF5A 4C91A 3FEDA 4HG6B 1QIQA 4BPZA 2G19A 3GBFA 3TAYA 4C0BA 4Q0UA 4XMAA 2QQWA 4R9BA 3VDBA 4ZU7A 3VB9A 4MCQA 2AEYA 2JG9A 2XUMA 4NSQA 4NEXA 3HOBA 2OUJA 5CG9A 4KS9A 4CCEA 1TXRA 5L9BA 2VECA 3LFIA 2WSVA 3EJKA 2QQMA 3ZMOA 1AYM1 4BK4A 4QX0A 2WZR1 2JXAA 4LBOA 5CNPA 4ONUA 2KR2A 5FY1A 3TE4A 2HEWF 2ZW6A 1N3PA 5CG8A 3AKTA 2HJIA 1ND2B 1HXS1 5IVVA 3H1MA 1LRZA 5FY8A 5FMOL 1RUJ3 5TSWA 3M7AA 4XTMA 5KTAA 5LA0A 2VQUA 3POYA 5EMIA 5FYIA 4DUVA 4FD6A 2RR11 4LQRA 1HDUA 1OBNA 2A1XA 5L9RA 1M4WA 2Q8OA 3B3QE 4E8CA 4Q4V1 2C24A 4W6WA 4H89A 4QX3A 4CDXB 3NJYA 4AVTA 4FSJA 3H7JA 4KOTA 2WYRA 5FY7A 3UKVA 2QVSB 4Q26A 4R6TA 5FMOS 2EAAA 2A6VA 4YM1A 4D7YA 2QFEA 1AYM2 4IGQA 2WZR2 4BMEA 1CPSA 3CPXA 3JVNA 5FJKA 4QWNA 1UU6A 3AL6A 3O1MA 2D6NA 3RJ2X 2PQ8A 4KOVA 3MZHA 3Q8FA 1HXS2 4I0BA 5LEKA 3AZWA 2J8RA 3ETQA 1Y9MA 3GZUC 4EWDA 2PR1A 3EQEA 3THCA 4JZ0A 1QF3A 1QOSA 3ZMNA 2RR12 1R081 4AFCA 1S7NA 1QJX1 1XRYA 2VOTA 4INDA 3PB9X 4Q4V2 3J8F1 1L7RA 3NA6A 3NFZA 2XMLA 4Y22A 1Q8OA 1NT0A 5H9QA 2P6EA 3HMYA 4OZXA 4Y26A 4MY0A 4CAWA 1SPPA 2DCKA 2W39A 3VBSA 2TEPA 4YFJA 1H4HA 1RXFA 1RUD3 2ZW5A 3MIHA 3AYCA 2BP6A 1ACCA 1T2XA 4QBJA 5JI9A 5E6HA 5LBBA 5FZEA 2RM23 3ISXA 1CR7A 3WG1A 5FUPA 1YEWA 2DTWA 2F5IA 3OGGA 5C9AB 2PJ7A 4EFDA 4KG0A 3D7HA 1MQTB 3IPVB 1W8OA 4CRQA 2B5GA 4XFBA 3GBGA 4BZ4A 4QGMA 4DUWA 3B3VA 1R082 5GZFA 1O6UA 4MXUA 3P2HA 2BQPA 1LB2A 4RSUA 5AVAA 1LECA 1O59A 2VNGA 4AOCA 1OLME 1W2UA 2QQKA 1CAVA 5K0UB 4QD2A 2R7EB 5JOWA 3PUHA 3O12A 3HN3A 5A3WA 1CX4A 4K9SA 3S6PA 1MS0A 3C2UA 1LTEA 3ZYHA 2AGSA 4S2GA 3LA3A 4JDNA 4BK5A 4PXBA 1W6MB 2XEGA 2FD8A 4KU8A 1C28A 2YFZA 4CCMA 4DIQA 1A34A 3WW1A 4KLWA 2VMFA 2VQYA 1QU0A 2Z5WA 4P08A 4H55A 1SG3A 3OYWB 4CRZB 3O0WA 2Q1MA 4MFZA 3MIDA 2VMIA 4Q4X3 4CEYA 2YPJA 5A7WA 1WMDA 4FPKA 5K4LA 3RBUA 3WLUA 1XPWA 4MHZA 1REDA 4DB5A 4AFDA 1H8TC 4IXLA 5E88A 2Q4YA 2HBTA 5B4NA 3BCWA 1C5HA 1CP6A 1EYBA 1ZG9A 5C5TA 5DDJ1 3MUZ1 5GLVA 2XBO3 2C6SA 1V9U1 3SJXA 2JE8A 1HQNA 4BQ3A 3DXTA 3H8OA 4GWIA 1Y0YA 3ZXGA 2Y0OA 2VXJA 3H4QA 2QQJA 5T5PA 3WT4A 4IE4A 4BLIA 4XQDA 3HBZA 1KXGA 3RAMA 5F6KA 1S2KA 1I21A 3R4DB 3D7FA 4AI3A 2DCZA 4C2XA 1OLRA 1AXKA 5JH9A 2ARBA 4QB2A 2PC1A 2QMLA 4FOQA 2XHKA 3WOGA 1FNYA 4A7KA 2D93A 2HEYF 4A31A 1X12A 4U36A 4QMAA 1IQDC 4NCZA 3HWJA 2A75A 3MUY1 1VBB1 4RFRB 5JOZA 1GQGA 1OQEA 1XMTA 4IQPA 4B5OA 2IVIB 4HL0A 4KOUA 2AFMA 1V9U2 4ZI6A 3HNYM 4PXDA 4KZTA 4NHKA 3JB8A 1S3ZA 1UOBA 3CF6E 2W87A 3FVLA 4XDQA 4A38A 3OD0A 4EQVA 4UAPA 5FP7A 2BERA 4COYA 4UFIA 3N7MA 5FWEA 3GZTB 1PO11 1WA4A 1SBEA 3WHUA 3LIGA 4CE8A 5JSPA 4MGZE 1H1AA 4ASMB 1XYPA 2VUCA 2YBSA 3PU8A 1WW5A 4QAWA 4MBUA 3HBKA 2Q1ZB 2OA2A 3I2GA 4LOSA 2DUOA 2R0HA 1JUIA 2XUEA 3FL7A 5FY5A 1K3IA 4P4DA 3VH9A 4FFGA 2Q0YA 2GMMA 3I2FA 4YW7A 3VBRC 2I3CA 4YWYA 1ELMP 1ZRCA 1W03A 3MW2A 2DFBA 5GALA 3O5SA 4Z65A 1X8EA 4X5KA 2ZPXA 2ZBJA 1PO12 4OI4A 1UU5A 4KSIA 3E5UA 3A0NA 4AVVA 4A42A 5C71A 4GH4C 4OI0A 1YFYA 2AFOA 1Z8WA 2J1RA 3B5LB 4YYOA 2DFCA 1AZDA 1SACA 4XW3A 3UKTA 1JS9A 4JGZC 5HCBA 3VATA 2NMNA 5J98B 1POV3 2JB4A 4NGTA 5FO7B 1FOD3 1GV9A 5DWMA 4M4PA 1JW6A 4Y4RA 2CYFA 5FMCA 3VD9A 4PT6A 1O5LA 3CJIC 4R9CA 1J3PA 3HEIA 3AYAA 2E7TA 3FBUA 3WY6A 3VHRA 4YVWA 4XJAA 2O0OA 2ZEGA 3JUWA 4B1LA 1BPNA 3H1YA 3O1RA 3FC0A 3ZN4A 4QX5A 4W50A 4ZPIA 3G7DA 1NAEA 3IT8A 1LFWA 1J84A 1PMJX 2ZGUA 3JRUA 5C88A 2XR4A 5C6CA 1F2NA 4XJ9A 1SHWB 2CWMA 3WD5A 2YU1A 3SEEA 3TWIA 4W6XA 3S6FA 4AXOA 3OF1A 2D4PA 1Q8SA 5FOBB 1D2QA 3AXEA 3RZAA 4Y1ZA 1ND3B 1QSTA 2D40A 1RUNA 1HN0A 1MEC3 2Z3LA 4KU7A 5A6XA 3AFKA 3B3SA 5C3PA 1Q2DA 4UXAA 5ABJA 5J37A 3ZIXA 5C8CC 3IFEA 3LIHA 1WLWA 2X5IB 1TKHA 1IHMA 2CIJA 4CUGA 4NE9A 1RUJ1 4NIHA 3PVOA 3C7HA 5CKMA 1JYNA 2WFF3 4CP0A 5KBFA 2JLMA 3MEPA 3KL9A 4E0AA 5DMYA 4OCTA 2ZEZA 2B9UA 1GOFA 3ZKYA 1WWZA 4LBQB 3OD4A 3HT1A 1W28A 1RXTA 5EZWA 1I1EA 3TNQA 4MXWA 2H0VA 2Y6FA 3O7OA 1NXD1 5I93A 3EXUA 5FP8A 2Z0ZA 4F8ZA 1RYYA 1O7FA 5A3PA 2BL1A 3WG3A 2PJCA 3X29B 5AC93 3ZPOA 3ZIWA 1S5KA 2B42B 2VZSA 3ES1A 4AZZA 5ISVA 1GNYA 4OZOA 3VHOA 3AP4A 3IGRA 3FB3A 1WLDA 2REEA 3O1UA 4A33A 4H7MA 4AG4A 5SV8A 1RUJ2 2H6CA 1H4GA 3UV9A 1QEXA 3CMGA 4S2HA 3JU9A 2WDBA 4NJ4A 4KUBA 3LE0A 1OKQA 1FMD3 4OVEA 2Q8CA 1FATA 5T55A 1O4ZA 3TT2A 1UU4A 1UOJA 4MHPA 4NHMA 1HQLA 2PVVA 1YO8A 5CAZA 1RUD1 1LENA 5K8SA 1NE6A 3PVBB 4QKDA 4PXCA 1YK3A 4HNYB 4M6HA 5A3LA 1ONAA 5C5UA 3IDEA 4PQAA 2DWRA 1E57A 1GWLA 2ZGSA 3TB0A 2C6PA 1JBCA 1Y7RA 3FIXA 1XE8A 4FD5A 3K48A 4L92A 3QB8A 1R43A 1RUG3 1LEDA 5DAWA 2WA3A 2XG3A 4DUXA 3HVDA 4F3JA 1JU3A 2X10A 2OQ7A 5JXHA 4NRMA 4Z92B 1JYTA 1QMUA 2AE6A 4CU9A 2A5ZA 4FP2A 1LULA 1S0GA 3W91A 1RUD2 4FUUA 5E8AA 4NGNA 2OQ6A 4Q36A 4YG0A 1SFNA 4CPAA 2K9ZA 4NO4A 5EBVA 5JIUA 2VY0A 1UMIA 4BWOA 1X8MA 4YFWA 3EC4A 4M00A 5AG7A 1DTDA 3ZFEC 2JD4A 1HJFA 2XPJA 3WDXA 3PLQA 4IEVA 1YVKA 1D7PM 4BH9A 1QJZA 2XWBB 4UW6A 3CIHA 1KFUL 1ND2A 1Z8XA 1AF9A 2CF4A 2B3VA 3PMEA 3VKMA 3NO8A 1LCPA 1FNOA 3VBOC 4W6YA 1BMV1 2P3IA 4LBMA 2QCSB 3HQXA 1OURA 1YQCA 1W9FA 2XBO1 3MFCA 3SCHA 1JYXA 4BXSV 4TNUA 3ZKUA 3B94A 4Q8LA 4OQ9A 3VZJA 2EK8A 2E26A 4IAVA 2ZHNA 2ZXQA 2VUDA 2WQ4A 1L0CA 2HQYA 1H6YA 4UBGA 3WINE 4GZ9A 3ST7A 4LBLA 2FMYA 1WD3A 3PB4X 4Q4X2 2ZXVA 3OGVA 5JOXA 2R043 2WO3A 5JOYA 2VULA 4LKDA 4CDUB 5IK8A 3VWDA 4RS5C 3M3IA 1PK6C 2JG8C 1B35C 4PSXA 2IJZA 5FYZA 1VLNA 4R9DA 3DKWA 3OPWA 1BHGA 5AGEA 1WZXA 3IDCB 4GQ7A 2O14A 3MDPA 1XJOA 1ZZBA 2XBO2 2ZHMA 2G9GA 4XAAA 2ZEHA 2EK9A 1KZFA 3BOWA 4QX8A 1Q56A 3NJZA 4E8DA 1DYKA 2D98A 5HI0A 3WC7A 1Q3EA 4U9YA 1OD5A 4MFQA 3D2MA 4TZDA 5FAXA 3VZNA 3GJAA 3H8EA 5A7QA 4O65A 2ZJCA 4CAVA 1UXZA 3T2QA 4A30A 3CZXA 5C9AA 1YQ8A 1GR3A 5F6LB 1ZM1A 2BBAA 1MQTA 4C0HA 3OTFA 2AFUA 3WDUA 4UF0A 3ZX7A 5ANNA 4BB3A 1LOFA 4DXSA 3KT7A 5FYVA 3FJUA 3D4KA 5HPOA 2BNOA 2UWBA 5JXJA 3H7YA 3JBG3 4GB33 3K46A 5FV3A 1R3NA 4U9ZA 2J7MA 4Q38A 1UZ0A 5KXBA 2XL7A 5IAVA 1W6QA 2D3PA 2JG9C 3AP9A 1X50A 2CAUA 2QVPA 2VMHA 2Z3KA 3DECA 1AR73 1W6PB 1FY7A 1PM4A 2O4HA 4AAPA 3KGQA 3I3EA 4K8FA 4FBFA 1W6MA 1ZZ8A 5F9TA 2Y6GA 2WN2A 4PLMA 3VKFC 3LSEA 4BISA 1PX3A 2HWE1 4CP9B 3NAPB 3HNBM 1OKOA 3OYWA 2JIGA 1VR3A 4OMDA 2PHDA 5FZMA 4P5YA 4DEVA 2CWSA 3NVCA 2W2IA 2OX0A 4DUKA 3ACGA 4YW4A 1VBE3 4X8PA 1VBC3 4IV3C 1I6XA 3FUQA 4ZXKA 5EFUA 4GKXA 3UNPA 1XRUA 1S0DA 3QACA 1JZ3A 1DGRA 5LA1A 3K2KA 1UOFA 1FV3A 2EICA 3RDIA 1JUHA 4FAHA 2AH2A 4MFKA 3R9GA 2VCBA 5DAXA 3I54A 1BBT3 1T6GC 3I2OA 3T30A 2NYQA 5CKNA 3P6BA 2D4OA 2HWE2 5IVCA 1MS1A 4Z82A 3VBHB 3OBAA 3WUCA 3CPAA 3TEYA 1Y4WA 5E1RA 1FOD2 3WR0A 3WDWA 2VZRA 4FPHA 1RTVA 4XPKA 2HBUA 2B3UA 4NXYA 3MW3A 3TOAA 3QBQA 2QQOA 1OA2A 5D8AA 2YNEA 2FS5A 1W9TA 5DPNA 1VRH3 4YSFA 3GGLA 2DVAA 2HWC3 1PGW1 1YX0A 1HDKA 3OGJA 4NPMA 1D2SA 3VBSC 1FPN3 2A6WA 5D8NA 5FZ0A 1JOPA 4FQZA 3IWGA 1JYCA 2ZA9A 1CG2A 1GU3A 1EUUA 1DHKB 2Q0AA 2WFF1 1VIWB 4B1MA 2R1IA 2YC2A 3UESA 1GZWB 5A6QA 4UW3A 3Q9OA 5ISLA 3RZGA 4L99A 2P0WA 1ZBA1 4NMIA 3B7IA 4QU1A 4E4SA 2WNVC 2BFUS 1IU8A 3SKVA 1HB3A 5D21A 3PJQA 1GUIA 4OC0A 2V8GA 4DXRA 1PM7A 3USSA 3IC1A 3WVJA 5IFPA 5A7OA 5AC91 4BQWA 1MEC2 3RYKA 2YFUA 2WWJA 2BWAA 1YFUA 4KVXA 1ULOA 3VZOA 2OH1A 2ZGLA 4R3KA 2VD7A 2IXKA 5EJ1B 4PJYA 1PCAA 5G1ZA 1DGWX 5DXDA 1G9DA 2WFF2 3O0VA 1JYIA 5CYYA 2MHFA 5JVVA 2IWGB 2CDPA 4FOYA 1FMD1 5JI7A 4AE2A 1ZBA2 3N9OA 3CZJA 3RZJA 5FPZA 2DU1A 4AEDA 3S7EA 4LR4A 4CEYC 2VMCA 4NGPA 4U5YA 4N53C 1ZRRA 2Q51A 5H84A 4P9GA 4ZU4A 2VW2A 3V0AA 5AC92 4MLOA 3B3WA 4OIWA 3BHXA 2QZ3A 4XXPA 1HRV1 2GH8A 5LA2A 4F9UA 3J4UH 4Z8BA 3ZSMA 4Y20A 3PVEA 4OP4A 3D8PA 3WZ1A 1OA3A 1BZWA 3J7MA 4YGOA 2ADEA 1RUG1 4TN7A 1MJAA 1GMMA 4LEJA 3FBMA 1FMD2 1YJKA 3FZ3A 3WSOA 1ZG7A 4XPDC 3LKJA 2C26A 4KL1A 5T5JA 1XBUA 4QQPA 1ENQA 4ZHNA 5GLTA 3M1HA 1XJAA 2DCJA 2I07B 2EBJA 2ZGPA 1I5ZA 1W6OB 2CNAA 1UKRA 5C7GA 4HKOA 2PJ6A 3I3BA 4TSVA 1RB8G 4FOVA 3RMXA 1PYTB 1YUDA 4BQXA 1HRV2 3FHAA 4LT5A 5BNOB 3KM5A 1VMHA 1AR63 4B14A 4ZX8A 1KUYA 5L36A 1K12A 2W94A 3MLJA 3WW3A 2WNUA 5CNAA 2B4BA 3UGHA 2PHTA 2UYBA 1RUG2 3FECA 1LOCA 3MBWA 3BI3A 2R98A 4AG9A 3AL5A 4XPVA 1S1AA 2B58A 4CVUA 3POGA 3U4XA 3BUCA 3E0KA 4AQSA 1LR5A 2Y34A 1WA6X 2QJ8A 4H14A 3VKLA 1F2OA 2QYVA 2VNRA 1WCQA 4L0PA 4A44A 5CFDC 1JZ5A 4QC6A 2OIIA 4FAIA 1QQP3 4A7YA 2BUKA 1Y43B 4LBQA 2NZ9A 5FP4A 2JE7A 3D8CA 3DYOA 1AXZA 3R0RA 5I4MA 1SQ4A 2Z2SB 3PJYA 2WQ8A 4BHPA 1APNA 1UY4A 4FD7A 2ZGMA 2GIVA 2DUPA 1TIQA 3MV01 3RNSA 3U1XA 3IMMA 4F0YA 4P44A 1QDOA 1V6KA 3WQ0A 1AR93 3MW4A 4LQGA 4LKSA 4II9A 4CCJA 4CGMA 2R32A 4GMP1 1NY71 5KHGA 5FZBA 4M6IA 3VZMA 6CPAA 4KLVA 4GJYA 4BQ1A 5KXCA 4CU7A 2AACA 3LEGA 1YW4A 5LYDA 1ZZ7A 3I59B 4FPJA 4GXHA 3FWEA 1QOOA 2XLAA 4EE2A 4I2OA 2YGWA 2J22A 1UPSA 1KDKA 1ULGA 5A3MA 1QGLA 2WSUA 1OHFA 3FLRA 4P4JA 3GUXA 1OQDA 4AI8A 3R9EA 1SLLA 2ZPAA 4AF9A 2Y33A 5EJ3A 1DGLA 3W58A 2VBDA 4XABA 3EYPA 2YPDA 3BOPA 2ORZA 4NR1A 1NY72 2WABA 3FLPA 4NROA 1HV0A 1DZQA 3VBUA 1UL9A 1CONA 1IB1E 4QPIB 1XNKA 4P02B 5LWBA 1OLMA 4QPYA 2FL4A 4UFKA 4JX0A 1PK6B 4XBLA 2P37A 1IIDA 5FZHA 4EWEA 5CPAA 2AR6A 2ZABA 4B8EA 3PGPA 2OT7A 3JBG1 4GB31 4E2SA 3NW4A 5JR7B 5A7SA 1CJWA 5JR2A 1W2TA 3DL3A 2BOIA 4JXRA 5GLUA 4YW3A 4O23A 4F7ZA 1GP4A 1YYNA 1F31A 3ZFFB 1RHI3 2W47A 4MO3M 4GKYA 1F4HA 5LBFA 1N3QA 4EN8B 2ODFA 4A7ZA 1W3XA 5DZEA 1MJBA 2AREA 2FQPA 2JD9A 5GJ6A 5KXEA 3CXSA 3BB6A 3RZHA 3BVCA 1CX8A 2GN7A 3QH6A 3LCPA 4R52A 3H1WA 3BPSA 3AVRA 1OBRA 3TO6A 2PJ1A 4RQPB 4NF1A 1C1LA 1ULFA 1BKZA 4KQ7A 3DPRA 3JD71 2JDPA 4NOTA 3TEWA 3JBG2 2ABZA 1GSLA 4GB32 1VBC1 2HC9A 3B00A 1CAXB 5LY2A 3CO2A 1MPXA 1AMPA 1BVVA 4AGRA 4PDWA 2Z42A 4JAAA 3I3QA 3MF9A 4Q29A 2BCOA 1OQ1A 1Y0RA 2ZW7A 4IEQA 1VB2A 4CCOA 4TLFA 1BBT1 3T3YA 1MS9A 4IERA 2W91A 3I3MA 3HNMA 4Y1VA 1J58A 2WAOA 5BPXA 4M3CE 1MJ9A 1K5MA 5DG2A 1CZTA 5FBZA 4FFFA 4XJWA 1ARMA 4FOWA 1G9CA 1RUF3 3WUDA 1VBE2 2BNMA 3AP5A 1NZCA 4P10A 1VBC2 4CYNA 4AQTA 2IXJA 2RG4A 2IXIA 1KITA 1VRH1 5C4WB 4IV1B 1CX1A 2HWC1 4KORA 1ELLP 4YGEA 2WBKA 2DDUA 5EPAA 3SJFA 1GYTA 2V8HA 2QQNA 2XONA 1FPN1 1CZSA 4JTOA 1UY3A 3BN6A 5LW9A 2Q7BA 3KF3A 1R093 2JB8A 1ZREA 1BBT2 1QH7A 2JECA 3EBRA 2YUEA 4AW7A 4XETA 1KUVA 1CVNA 1DQ1A 1KDMA 2ZX1A 5CIRA 4ZZ8A 5F8PA 1VAMA 3POEA 2QECA 4FBEA 7CPAA 4PIYA 3SHRA 3IIBA 2DPTA 3PBBA 1S2BA 1VRH2 2HWC2 3WC5A 3S5QA 3ZYBA 2ZS6B 2MEV3 4XF9A 2NLRA 5H9RA 4QM9A 1FPN2 3RSJA 4UWDA 4PLNA 1QXPA 2OYZA 4LO4B 1BQPA 2NMOA 3FYNA 2ADDA 1FX5A 4I3GA 2OS2A 2D6LX 2RDQA 5FZIA 1ODNA 3E97A 2NP0A 1SPPB 5DZGA 4AHZA 2P3YA 4DFSA 4HOOA 3VBSB 3KKWA 1PZ9A 4EMEA 4UFMA 2G4IA 1W6PA 4YG3A 1YMEA 3DEMA 5LEJA 4CP2A 1H30A 3USUA 2W08A 1BXHA 5FPAA 4KSFA 4CDWA 2GC1A 1S0JA 3VDDB 4PV6A 4A37A 2ZX0A 4Y49B 3FBYA 4AL9A 1VAKA 1ND2C 3NAPA 5L73A 4LA2A 3POSA 1GP5A 1W99A 4XVHA 2G9DA 2KM2A 3MIBA 1JZ6A 2C9AA 3D5OA 4FTBA 1C4RA 5HCFA 3MICA 5HV0A 4H6UA 4ES8A 4LBJA 5D2AA 3DR6A 1YXWA 5LASA 1CAVB 3I9SA 5FYTA 1I3HA 4E8OA 3ZN5A 1EY2A 3D67A 3UKNA 4COUA 4NJRA 3ZXEA 5C3SA 4P4IA 5FBJA 4Y1XA 1XMBA 4E2QA 4QDSA 4DQAA 3N5FA 4NGRA 1K45A 2W1UA 4MV2A 1SLAA 2DUQA 5A1FA 2WLQA 1W6NA 4MY3A 3RYPA 3AB0A 1RUOA 3PIJA 1LHVA 4A3XA 3VBHA 4BA6A 4BQ5A 4UI9L 4PCRA 5AFEA 4F6AA 3KASA 4LOTA 1OH4A 1AR61 1UIJA 5A7WB 3B8GA 5FZLA 3A0KA 4J1WA 2ARAA 2VQAA 1HXS3 5A3TA 5CEHA 5T3NA 3T90A 3ZXLA 2PAMA 2QQUA 3TOBA 1PU9A 1S60A 2XOMA 1DIWA 4O9GA 5T5OA 2OKXA 1UYZA 4EN0A 3AX4A 3M3CA 1IYKA 3ASIA 2ANPA 4Q4V3 1RGSA 4U2AA 2G9ZA 4FVVA 5IT6A 4DY5A 2GFQA 3WNKA 4EWTA 4XNHB 2GNTA 1M4IA 2ZW4A 5C9AC 1UPIA 3DGTA 3A22A 3AFGA 1H0BA 4MOAA 1MQTC 3FX6A 4XACA 1MVQA 4B4RA 4AHYA 1AR62 4WVMB 2B39A 1LOFC 4L8AA 2SLIA 4M85A 4MGKE 1WW7A 4LX9A 1LJ7A 1GZCA 1IS3A 3FMGA 3OPZA 5K0UC 1R083 1QJX3 2PVWA 1AR91 5I0TA 3S7IA 3J8F3 2ZEOA 4BQYA 4DS0A 3TBDA 4TWTA 4MCSA 2C6CA 2WYSA 3S9LA 2W9XA 4AFAA 3U75A 5GLWA 2A71A 5CFCB 3SITA 4HKLA 4NVPA 1UWYA 1DG6A 4PQ9A 2YDEA 1W9SA 1HRI3 2ZEEA 4KWJA 2E63A 2GANA 4XJZA 3VD7A 1LAJA 4QQLA 1BJQA 5GZDA 2P2KA 1MZFA 2WAAA 4XOGA 3LEIA 1WW6A 3NL1A 1EPWA 3CJXA 2OPWA 5KR7A 3GHMA 1AR92 3ZR6A 2EIBA 1P8JA 4B4QA 1M1DA 1YI9A 2AFWA 1IS4A 1VMJA 5G22A 2VXRA 2BVVA 5J8CA 5C33A 3OB8A 4YZ5A 1GOHA 4PI2A 3IAQA 3DLJA 1JZ7A 1W8ZA 1JXNA 3PU3A 3RWNA 2G0BA 2VAUA 1U0AA 2PIZA 2E7QA 5A28A 3VGIA 3PTYA 1XIXA 2RE9A 5FUIA 1RXGA 2WZPP 4BQ4A 3V65A 2PJ2A 4LULA 5FKCA 3H50A 3ZFGB 4AQ6A 4GMP0 3I2KA 5EXOA 3WQBA 1RHI1 1YLOA 4WM8A 3W5NA 4ZBGA 5IHRA 5FZDA 1ZLIA 2PN5A 3PIGA 5A1AA 4KMQA 2XGXA 3NKTA 4QT6A 4SLIA 4JKKA 2J1EA 2J42A 1IOIA 1L7QA 4LITA 1WLCA 2ZCWA 3VBFA 1JYWA 3AC0A 4D0QA 5J7MA 3MF6A 3KCYA 4KVOE 1OMIA 4QQHA 3H8UA 5DDJ3 2Q43A 4YVWB 4B6ZA 2ZX3A 2PA7A 2VXKA 4PK2A 4LKEA 1I5PA 2JBKA 3TN93 3V8IA 3ZVXA 2WO2A 2XJRA 2OPKA 4FI9A 3T0DA 1RHI2 3K77A 1C8NA 4YZ4A 3UL2A 1TNRA 4I02A 3RQ0A 3BU0A 4ATFA 5BXXA 1TME3 4KNCA 2Z3NA 1LOBA 5BY5A 3CT9A 3BI1A 4PF1A 4TWEA 4AVAA 2PSWA 4JTNA 4S2DA 1VBB3 4XZPA 2PJ8A 5ABJB 3IWZA 2VZTA 5LRKA 4FPEA 2XJQA 5LK7B 1DLCA 1UYXA 4JVAA 1CPNA 3L2HA 5FLHA 1JHNA 2CY6A 2EXJA 2P4EA 3BGAA 5LZ6A 4W4ZA 4NPRA 1XNCA 2J1SA 2WSAA 2ID4A 3T4HB 3M70A 2RMU1 4ZS3A 2XLGA 5HV4A 4Q2FA 2WR9A 2W5FA 5DS0A 1R091 1VHEA 3JTKA 4EN9B 1ON0A 1N71A 3I3DA 5JUVA 1VBD1 3I2JA 3B3TA 3PURA 1ULCA 2YYOA 3WG2A 1EP0A 2XHNA 2PJ9A 2VH9A 4OUMA 5I0SA 3ZYPA 2GSYA 4UEFA 1Y9KA 3MLKA 3N7KA 3W6SA 2VC9A 2RDRA 3WP5A 1HN1A 1H2LA 1Z78A 1YFXA 3PUSA 2QQPA 4Y5SA 4DRRA 2MEV1 3FMCA 4XFHA 4YLZA 2PHXA 1YGHA 3AYDA 1VE0A 2JKBA 5JLVA 2WZNA 2RS11 1OOPB 1R092 1XSQA 3P3NA 2CAVA 4F9VA 3PL0A 3E1F1 1LCLA 1VBD2 5EYXA 1S7KA 4PBOA 3NQHA 4KOYA 4PIZA 1W8HA 4DXTA 2GNDA 2OUHA 4XDPA 2WUHA 3N7LA 4HLTA 1ND3C 2XJVA 3E5XA 3HN1A 3ZR5A 2ZEWA 3ELNA 4FD4A 3ACLA 4CRYB 3M3OA 4A6SA 3I2HA 4ISRA 1F9KA 1KFXL 2X5IC 1M06G 4XUQA 4ZY0A 1V6MA 4LKFA 3TO9A 4G1PA 3AZYA 2FE7A 2MEV2 4YM3A 5A32A 3NNGA 3RYOA 1XNBA 4CAEA 2EF6A 2ENRA 1QJEA 4QQOA 4AR2A 4RR3B 3F2ZA 2PJ3A 1CAXA 2OZGA 4OHXA 3LDKA 2IXLA 2WO7A 2V8VA 3KQZA 4GD4A 4BIFA 3DF0A 2FHRA 4LORA 5G21A 3I1UA 1E5RA 4MYEA 2HLEA 2RHPA 4CCKA 5K8NA 1EUTA 2HYKA 1SCSA 4Q1RA 1V6IA 2LUWA 1FNZA 2GC3A 1O4YA 2VMEA 3H3ZA 3P1IA 4KVME 1JZ2A 4OI2A 2WL1A 1H1IA 3PMSA 4UFWA 3AP7A 1CPXA 2V5YA 5T54A 2ATRA 3G6JB 1RUC3 5APAA 4UFJA 3B9IA 1UY2A 1U5IA 5JWPA 4JHTA 2DYCA 4OFGA 2J1TA 5F1RA 2FZ2A 2P34A 4LO8A 4NRPA 1Y9WA 4WJBA 3C8XA 1W39A 1CGPA 2Y6LA 5C4WA 4IV1A 3UY5A 3F5BA 3ZSKA 4QXKA 1VBA3 4JDMA 2DVFA 1BPMA 1H6XA 2HWF1 4OUEA 4P9XA 5F46A 1Q2YA 4ARYA 4QKNA 5GZCA 3LA2A 1BEV3 4IGOA 5F2SA 1MVEA 2B8MA 3NNFA 2Y6HA 3ON7A 1IS6A 5HCHA 4K7JA 4R9AA 1SEFA 3OUJA 4OAEA 2RS53 2VZQA 3LAGA 4LUMA 2C1CA 2I74A 3TOJA 2VL1A 3BIEA 1AL23 1RMU1 4B13A 2GH2A 5CADA 4QPGB 4N43B 1LHOA 5HXDA 3AZZA 1ZO0A 1AYN1 3ZDVA 2JDNA 3BXMA 2GNMA 2XLFA 2D3RA 1UYYA 4YU9A 1XYOA 4O9EA 1H2KA 2EXKA 3ORJA 2FCVA 3H3LA 1W8UA 1M44A 1JOJA 2FSRA 5FRAA 2XEFA 3WNOA 2IXCA 1BK0A 1DCSA 5JSRA 4XFGA 1ZVFA 4FXKB 1OD3A 4NHYA 1XE4A 3N9MA 5A1LA 4ZY2A 3IN9A 1NSLA 4C2ZA
chains in the Genus database with same CATH topology
4XYXA 2REFA 4UFXA 3GNEA 4Z82A 4OHWA 3VBHB 4AWDA 2J8NA 3WUCA 4YM2A 4V1PA 4LLOA 3VN4A 1DYPA 5GKAC 1RVF1 5E1RA 4S2FA 2WA4A 4Q0SA 5C8WA 1MZ6A 4N7IA 1PVC3 1FOD2 3KQRA 5I0UA 4DINB 4AHXA 5JCTA 2ZGRA 3WR0A 3WDWA 3MGDA 1KS5A 3N4MA 3LWCA 4BLJA 3QAHA 5T5LA 1PO22 4YRDA 3ECQA 3R4SA 4OLLA 2EUIA 4FPHA 1RTVA 5A32B 4XPKA 3POWA 4E2GA 2B3UA 5FPXA 3S0MA 2JENA 4NXYA 3MW3A 4Q0QA 3TOAA 3QBQA 1OA2A 5D8AA 2YNEA 2FS5A 1WCDJ 4C7IA 5EC4A 1VRH3 4YSFA 2P6FA 2DVAA 2HWC3 4AVCA 1PGW1 5FO8B 4YZ2A 2XKPA 2ZOEB 1YX0A 1VB4A 1W6OA 4XEZA 1HDKA 3OGJA 4P9IA 3ZYGA 2WS92 1CM0A 2XB6C 1HRI1 1AYN2 2CL2A 5FDBA 3THPA 1D2SA 3O14A 3VBSC 2Y26A 1FPN3 2A6WA 4YGDA 3HT2A 2O1QA 2R071 2EAKA 5IUQA 4EVYA 2X29A 2XH6A 2FIAA 1PNFA 1S55A 1PNGA 3DV8A 3VDDA 1C8M3 4FQZA 4XJ8A 3ZYJB 3IWGA 5DUWA 1JYCA 1IQAA 1RUH3 2ZA9A 5I8TA 2WT1A 1QHDA 2CNSA 4QVTA 3BU7A 3FHIB 4R4ZA 3DPRC 5BNOA 4PLOA 1DHKB 4D7TA