4ORFA

Camp-binding acyltransferase from mycobacterium smegmatis, mutant r95k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
319
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIEPGLIIGEIALLRDAPKTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTSETLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 96
structure length 319
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4orfA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4orfA02
3GYDA 3EO4A 1XE4A 4PK3A 2B8MA 5T3NA 3EXNA 4Y49B 3RYPA 2GU9A 3IGRA 5F48A 1CAXB 2R7HA 3SHRA 5IV0A 1J3RA 2OU2A 2PTMA 3USSA 3I7DA 2IXCA 3QB8A 3NW4A 3V8IA 3RYRA 4FAGA 2EVNA 4HNYB 1X8EA 4R9MA 3BPZA 2GC0A 3I59A 3W6SA 4IEUA 4JVAA 1EP0A 5DWMA 3QACA 4LA3A 1S5KA 4IF5A 4XF1A 2VQYA 2KCWA 4AVBA 2R1IA 3R9FA 4XF3A 4Y49C 2BL1A 3FE5A 4IERA 1UFHA 4FD6A 2FSRA 3PNAA 3RYKA 2EUIA 5JAXA 4JTOA 2ZW7A 4AVAA 1OI6A 4KWLA 1QWRA 4O9EA 3F5BA 4IEQA 4LTAA 4Q0QA 1XE7A 3IWGA 2HQYA 5H84A 1NSLA 2MNGA 2OZ6A 4KOUA 2B4DB 4YFJA 4GULA 1Q43A 1I5ZA 4OFGA 5ISVA 1S60A 4YRDA 1Z9UA 3EBRA 2J8NA 3JVNA 1MJ9A 2HV2A 3H9AA 1YHFA 2ZW6A 4CYDA 2B5GA 2C0ZA 4HLTA 1RXTA 3EQEA 3NJZA 3D2MA 4I0BA 2A4NA 3R9EA 3SXOA 2XGXA 2Y0OA 3LD2A 1QSOA 1OMIA 4K30A 2K9ZA 4KVME 2C27A 4PIZA 1RL3A 1O3QA 2IC1A 2Z0ZA 4H89A 5I0SA 3S7EA 4KOTA 3TT2A 3D0SA 1O3RA 1G6NA 3E6BA 2BUEA 3OTFA 5BY5A 4N9HA 4R8HA 3S0MA 2P6GA 4E8OA 2PRBA 1J3PA 1VKCA 3G7DA 4PJYA 3R96A 2D5FA 1ZX5A 3OD0A 3WW3A 2BNMA 5J48A 2PR1A 3H50A 1Y9WA 4YARA 3NL1A 4YSFA 4KOVA 2XLFA 3GKRA 3I9SA 1J4JA 5F47A 2OZHA 3H1WA 1UIKA 1SQHA 1VHSA 3WW4A 4AG9A 4WBBA 3PGPA 5H86A 4UBRA 3RPQA 4F8AA 4LULA 4UWJA 4EWAA 4JV4A 5I0RA 2PSWA 4LEJA 3RZZA 1CX4A 3TOAA 3U10A 3H7JA 4LA2A 4J1WA 1OFNA 3IDBB 2H6CA 4IETA 1OZPA 5JSOA 4JXRA 4XPDC 3TO9A 2G3TA 3FWEA 4CAXA 4KU7A 3KCCA 4Q0VA 5I8SA 3KKWA 3R95A 4LUMA 1ZVFA 4QM9A 4HBNA 1RC6A 2CAVA 1LB2A 1PU9A 1O4TA 1IIDA 2GC1A 1ZNPA 3ES4A 3DL3A 2GE3A 3SCFA 1ZRRA 2CV6A 3BU7A 3IIAA 5LRSA 3N7ZA 2FIAA 2PAKA 4KZTA 3SCGA 5F46A 3IDCB 4KOSA 1VR3A 1KUXA 1Y3TA 4WVZA 4R57A 3W6XA 4I49A 4YRHA 1WGPA 3FNCA 4I3PA 2X7BA 4CS0B 1XRUA 1ZZBA 4UWIA 4OAEA 4QM8A 1I1DA 3S6GA 4HZFA 2GZWA 4YYOA 4MGIE 5JR7B 2FT0A 2HJIA 2PA7A 4MH0E 1EYBA 4AB7A 1FT9A 1S7FA 5KHGA 2K0GA 1YREA 2H5MA 5EC4A 4XNHB 5KTAA 3M3IA 2VEZA 3OCPA 4QC6A 1TQ5A 3ZDSA 1DGRA 3MPBA 4HSJA 2ZPAA 2GANA 3C26A 3FB3A 4PK2A 5GCNA 3VHRA 4IEYA 3DKWA 4L2NA 2ATFA 4CRZB 5C82A 4EROA 4D7TA 2J8MA 4L8AA 2PHLA 2AE6A 3QOPA 1MJAA 3W91A 4XFGA 1I6XA 4H6ZA 2BEIA 3SHPA 4CRYB 1UIJA 3G3SA 3EJKA 1O5UA 2CNSA 3H1MA 1J59A 3ZJ0A 3VWDA 2D40A 4AQ2A 5C8WA 5I8TA 4I2OA 2PQ8A 3PLQA 1VP6A 4XETA 2UY9A 3SCHA 5FPXA 3FHIB 4MI4A 1XE8A 4QX5A 5BUVA 1NXMA 4ZU4A 3ZZIA 2UY8A 1X8MA 4YNIA 4FBFA 4HNWB 4R3LA 5JQ4A 4HVOA 4IEVA 3GYAA 4FT8A 1XF8A 1EPZA 3N4MA 2B3VA 2QMLA 4HVQA 4Q0PA 3EHKA 2UYAA 4B29A 3LAGA 1XEBA 1Y9KA 2GC3A 3LA7A 3H7YA 4HNXB 5E96A 2GC2A 2Q1ZB 2P6FA 2Z11A 1RO5A 1CJWA 4R3KA 4BYYA 4ZBGA 4B5PA 3B02A 4XFAA 4OLLA 4P9GA 2PHDA 2J8RA 1QXJA 1RUNA 1PM7A 2D93A 2VBQA 3M70A 4M85A 2AJ6A 3S6HA 2Z69A 2QIRA 1V0CA 4E2QA 5D1IA 2VECA 3ELNA 2MHFA 1CM0A 2Q0YA 5E16A 1Q2YA 3E5QA 1S7LA 3E6CC 4NF1A 4ONUA 3O14A 3UKTA 5HI0A 3H4QA 1YLLA 1YFYA 2I45A 2QCSB 1J58A 2QDRA 3SXNA 5FQ0A 5BXXA 3KMHA 2P6EA 1UW8A 3OWCA 2XL7A 4NCZA 2I79A 3DR6A 2B4BA 2I00A 4PSWA 2ETEA 3D8PA 2REEA 5FDBA 1U6MA 2Q7BA 3I59B 5CVRA 1FXZA 4OADA 3T9YA 2PQQA 3H1YA 2HUZA 2CGPA 1QSMA 3RNSA 3DR8A 2XLGA 2Z2SB 5BPXA 1WWZA 1H1IA 4MGZE 3FRMA 1ZRFA 1Z4EA 1YFWA 3L2HA 4MX3A 4U5YA 4Z07A 5J3UA 2IL4A 4U9YA 4J1XA 5EZWA 4XFFA 2BNOA 1GHEA 4RI1A 3H3ZA 1GQHA 4LLOA 5KHHA 1BOBA 2PAEA 3BJ8A 1O7FA 3NE7A 5FLHA 4ZU7A 3EC4A 2ZW5A 1S3ZA 4QXKA 5JPHA 2XLAA 2Q4SA 3NVCA 5JSPA 1YX0A 2Q4YA 5IX3A 5CADA 2B5HA 2ZKLA 1Y7RA 2CNMA 4LUAA 4KWJA 4MV2A 2KXLA 4QGNA 1BO4A 4L89A 3UKVA 1S7KA 4E2GA 3R6SA 1YFUA 4GS4A 5I8YA 1YVKA 4A2UA 2WC2A 1K4JA 4II9A 5K8SA 2QECA 2V09A 1ZZ8A 1P4NA 2XL9A 4X6QB 2BYVE 5HH1A 5KHIA 4MY0A 4AG7A 3BCWA 2RC4A 4Q0UA 5FPZA 1QSTA 4MZUA 1Q2DA 3MYXA 2VQAA 2G0BA 4J3GA 2BNNA 5I93A 4KVOE 3CEWA 4QMAA 3FX3A 3PVBB 3NSTA 4DINB 1I21A 4FD5A 3CL1A 1O5LA 2CAUA 3WR7A 1FI2A 5FQ0B 3EO6A 4KOYA 4QUSA 4WZCA 1XIXA 5I0CA 4HSLA 3CXPA 3I3GA 2JEVA 3C3VA 4Z82A 5F1RA 3E5UA 2FIWA 2PDOA 3JUWA 3DDDA 4F7ZA 4EVYA 4RD7A 3CF6E 5KTCA 2FXFA 3KGZA 1SFNA 4NXYA 3E6DA 4R87A 4YGOA 3GBFA 5J8FA 4EWEA 2PFWA 2XKPA 1JUHA 4CAWA 3QAHA 3S6FA 5FVJA 3VWEA 4H7LA 4IESA 4B5PB 2H0VA 4KLWA 4I01A 3RYOA 1KZFA 1MJBA 2ATRA 5JCTA 3BALA 4IEPA 1Q2CA 2OA2A 2ZXVA 3T90A 5C88A 3H3UA 2XHKA 1M4GA 4AVCA 3IBMA 4MJ8A 1LR5A 3LWCA 1Y9QA 3D2PA 1M44A 1IPKA 3U11A 3MDPA 4XFCA 2R98A 5AVPA 1TIQA 3EY5A 1ZZ7A 2R8VA 2OYZA 4KORA 5FCCA 2CY2A 1CAXA 3F8KA 1YFXA 3S6KA 1YK3A 4AXOA 1OD5A 2O1QA 4KLVA 5CU1A 2DXQA 2EAAA 3DV8A 1QY4A 1J3QA 1NYWA 3WW1A 1NE4A 4ZU5A 4BMHA 1NE6A 2QJVA 3CLPA 2D5HA 3ROUA 4XFBA 4XPKA 3KGLA 4F6AA 3D0JA 3HIFA 1RGSA 2VZZA 3UKNA 4IEXA 1DGWA 4Q29A 4XPDB 4JTNA 4XPLA 4HN1A 3LA3A 5KHKA 1CAWA 5KTDA 2ZW4A 4PIYA 5CNPA 5JSRA 4XEZA 2OB0A 4JXQA 1SQ4A 2O28A 4PV6A 4QGLA 5C6CA 1PMIA 3CO2A 3OF1A 2F4PA 4KU8A 3LA2A 2VZYA 4JWPA 2NMTA 2PAMA 2Q30A 3MGDA 4L11A 4F0YA 1WLTA 4JLYA 3TFYA 2OZUA 3IWZA 4UBGA 1U12A 1X82A 2Q0AA 3TE4A 1O3TA 5J7MA 3U0ZA 2GH2A 3FYNA 5FLJA 2FQPA 2IXIA 4CAVA 3JZVA 1NZCA 2ZCWA 1B87A 2UYBA 3DN7A 4N9IA 4EV0A 1KUVA 4JJXA 3PZJA 2VI7A 3LZZA 1ZZ6A 3OGJA 1IYKA 1LKNA 4BHPA 1L0CA 2QVSB 2Q04A 4UBHA 3WW2A 3DSBA 1B6BA 1LRZA 1XMTA 3FIXA 3TTHA 4KL1A 4IEOA 4E2SA 4QB9A 4XFHA 1NMTA 1CAVA 4X6RB 3H8UA 3ETQA 1NE9A 3TOBA 3P2HA 5I0UA 4NVPA 2Q4VA 5IB0A 3KSCA 1UD1A 4MUVA 3BLNA 2B4DA 4NSQA 5KHJA 2BEOA 3D3SA 3ES1A 3P2FA 1IYLA 5J8CA 4DNCA 4I09A 4HVRA 4QBJA 3S7IA 2ET1A 2IXKA 5I0TA 1ZZCA 5FLIA 1UCXA 3R9GA 3SMHA 2OZGA 4JD6A 4D7SA 4PIXA 4LX9A 2DCTA 3TNQA 3G8WA 2EA7A 2F5IA 2K5TA 2GIVA 1I12A 4KOWA 4NEXA 4U9ZA 3TNPB 4UXAA 4UA3A 4R52A 2FS5A 5I91A 1DZTA 1YUDA 2PYTA 2ARHA 4HMZA 4MHDA 3FXTA 2HKXA 3HT2A 4FD4A 1DZRA 3LODA 2QNKA 2GAUA 4LUKA 2H6BA 3E0KA 1M4DA 4IUSA 5EBVA 2PC1A 1EY2A 2P0WA 3K9UA 1CAWB 3HT1A 4MBUA 4KUAA 1HW5A 1PUAA 3GY9A 2OZJA 1Q5OA 3ST7A 1P0HA 5KBFA 4FAHA 1S7NA 3CJXA 4M3SA 1IB1E 5HMNA 1O3SA 2Y0MA 2OPKA 4I02A 1X7NA 3D82A 3BB6A 2B5GB 4QVTA 2WFPA 2ET7A 4AQ6A 4XF0A 3BJ7A 1RTVA 4QGMA 3UY5A 4TLFA 1YLEA 2FCKA 2XKOA 2FMYA 1YR0A 3DNSA 5DWNA 4ORFA 3TCVA 2G3AA 4HKFA 2WPWA 2JDCA 1VJ2A 1QSRA 2CNTA 2MPFA 2D4PA 4Q0SA 5BV6A 2B58A 4EWDA 4E2AA 1UPIA 1H1MA 3FJSA 4BH9A 1CAUA 3E97A 2REFA 5LEJA 1M1DA 2JLMA 2IXJA 4XF9A 4MY3A 1YWKA 3CXQA 1CAVB 2BGCA 5E1RA 1QSNA 5EFUA 3FZ3A 3I54A 2Z10A 2IXHA 1WA4A 3EFAA 4X5KA 3HQXA 4XNHC 1L3JA 3MZHA 1ZZ9A 1R57A 2B3UA 2BSWA 4IEWA 2N7GA 1LRHA 1ZRDA 4IEZA 3RDIA 2P17A 1Z4RA 4KOXA 1GQGA 1SEFA 4I0AA 4FD7A 2D4OA 1J1LA 1MK4A 4KWKA 4XFIA 1IICA 3LOIA 3R1KA 3NKTA 2PR8A 3E5XA 3SXWA 4MGYE 3FFQA 2EVXA 2WPXA 5LRRA 4HN0A 1YVOA 2VXKA 1QXRA 2OH1A 4K8FA 1KUYA 1ON0A 4H6UA 4RS2A 1WK4A 3FBUA 1IPJA 1RUOA 1CAUB 4E0AA 4O9GA 4META 2Q44A 3CXSA 3B8GA 4XF4A 2IXLA 4MGKE 1CGPA 1YGHA 2JDDA 2VPVA 3PP9A 2O8QA 3F0AA 4KVXA 2FL4A 2B9UA 4PSXA 1FY7A 2E9QA 4B5OA 3TO6A 3TO7A 5LEKA 1ZRCA 1Q3EA 4KUBA 1ZREA 3ACLA 1N71A 5F49A 2FE7A 4BIFA 1V70A 1M4IA
chains in the Genus database with same CATH superfamily
2WABA 3NV3A 4QX8A 3ZR5A 4PK3A 2J1AA 1N3OA 4BQ5A 5FZ4A 2AACA 4OUMA 3EXNA 1JN2P 2GU9A 1A78A 4C68A 1KS4A 3OUIA 1J3RA 2OU2A 2D3PA 2PTMA 3HN1A 1TVGA 3I2IA 2IXCA 3K4ZA 3USSA 3RZJA 1AJKA 3G6JB 2AC1A 3NW4A 5J96B 3RSJA 4LBKA 4QX3A 5FMDA 3ZDVA 1LCPA 4MXUA 4ONWA 5DAVA 3VZKA 2B7YA 1M4LA 1BHGA 5LA2A 2BV4A 4Z8BA 4IV1A 2PJ0A 2ZGNA 3ZIXA 3ZSLA 1HB4A 2E51A 5J98B 1S5KA 3MO4A 3P3PA 3V0BA 4AFBA 1IGOA 4XXPA 3W5NA 2BL1A 2G4IA 4XABA 2DU1A 2DUOA 4Y1ZA 1H4HA 4OMDA 3RYKA 4CDQA 2J1UA 2Y8KA 2Y6KA 4KWLA 3LACA 5IVEA 3WDVA 4CGPA 4IEQA 1V6IA 2B39A 5SV5A 1CVNA 3W58A 1XE7A 1PZ8A 5HBAA 3IWGA 5DMYA 2IQ6A 3S9NA 1J1TA 2ZEDA 4XXAA 4OHXA 4B7EA 1LGNA 3VBHA 1Q43A 4OFGA 1YMEA 1L7QA 1O4YA 1RUF1 4I0WB 4YRDA 1US3A 1QU0A 5LA0A 3B7MA 2A75A 3DEMA 4LMFA 4Y26A 5HPOA 2ZW6A 3ACIA 4XHBA 4OULA 4Y3OA 2P3JA 4TTGA 3KQ4B 2XGXA 1YI7A 2E6VA 5CZKA 5IWFA 1DGRN 2QJ8A 1QSOA 4LXLA 5T5OA 1RXFA 4MADA 1ND2C 2PJ3A 1RL3A 3WT3A 3ZYBA 1PIV1 2CIJA 5LYIA 2ADDA 2UWBA 3TT2A 1W99A 5K0UC 5TSWA 3VD5A 1I1EA 2YNCC 4SBVA 5FZ6A 1G6NA 1YO8A 4LBMA 3TBDA 4BQXA 1SMVA 1DLCA 4PJYA 3ON7A 1JYVA 1ZX5A 3NH5A 2VMFA 3WW3A 2BNMA 2Q1MA 4HFSA 2ADEA 5FKBA 3H50A 2EWBA 3NNJA 4LBOA 1Y9WA 4YARA 2EIBA 1ZA7A 4YSFA 5C4WC 4UFLA 2XLFA 4IUGA 4WVMB 2VH9A 3H1WA 4JGZC 4BWOA 1VHSA 3T0DA 2BFUS 2WINB 3NO8A 5EC4A 4F8AA 3T90A 1GP5A 1RMU2 4EWAA 5JUVA 3I2OA 2ZOEB 1BVP1 4A4AA 3VD3A 5FO8B 3HLPA 2ZXVA 1OFNA 1XMBA 3CDZB 2RM21 4RS5A 4FPHA 3KLSA 4JXRA 3CU7A 3TO9A 5FYZA 1AR71 4A7KA 1ASJ2 2WZEA 1OQDA 4KU7A 4Q4Y1 3WF2A 3R95A 1ZVFA 3RS6A 3QCWA 1TME3 4H55A 1LHOA 1LB2A 1PU9A 3O1TA 1YEWA 1ZNPA 2NLRA 2ZGLA 3DL3A 3GCXA 4R4ZA 1ULDA 4R9AA 5EYXA 5F3IA 5F5IA 3N7ZA 4KZTA 1VBB3 3N5FA 1RUH2 4CP9B 2PLV1 3BU0A 5F46A 4KOSA 1MPXA 1R093 2QQOA 1FNYA 1RINA 1VR3A 1OHFA 1Y3TA 3AMNA 3K75B 1KUXA 3W6XA 2ARBA 2Y6LA 2GREA 4I49A 2X5IC 1MEC1 1WGPA 4A31A 4I3PA 1XYPA 3AZVA 3B69A 5FZ3A 2X7BA 3L2NA 4B6ZA 4NO4A 5A6XA 1KGYA 4QM8A 1I1DA 3S6GA 4DEQA 1R083 4UOJA 1V9U2 2NQYA 1GANA 5FP8A 1PO12 3KF3A 4UYBA 4DIQA 5ISLA 2W9XA 4MH0E 5HCHA 1F2NA 2JDZA 2WS91 4QXHA 3T4HB 3ZXFA 3I3MA 1S7FA 5KHGA 4C0HA 1AR82 1MZFA 1S0GA 2K0GA 2ZGQA 4K8RB 2H5MA 1CP7A 3QAYA 3VV1A 1K5MC 2HBUA 4RR3B 1OPOA 2ZGTA 4FOWA 4TSVA 1UAIA 2RS12 4AI3A 3FB3A 5A33B 4J25A 3AKPA 5G20A 3BODA 4CVUA 4D7TA 2GH8A 4QQHA 2PHLA 2GP3A 3W5MA 2AE6A 5D8AA 1AJOA 1ODNA 2HWD1 3AZYA 1IPSA 2JE7A 3HNMA 4KWUA 3OGRA 5K7PA 3D8CA 3KGQA 3CHXA 3JB8A 4MCPA 2BEIA 1Q56A 4LHKA 4QKNA 4QHOA 4LKDA 4M4RA 2AFZA 3T9YA 3EJKA 1O5UA 2FMDA 1TF9A 4CDWA 1YW6A 3HJRA 4FTSA 4W9YA 1J59A 1S0EA 2QUOA 2R6QA 4D7YA 3JD73 3NRUA 2VGDA 3BGAA 1ODMA 4OMCA 1VP6A 2JJ6A 2ZEZA 1B35C 3M3EA 2RJLA 1N1VA 3SCHA 1LEMA 1XE8A 4QX5A 5BNOC 1VMFA 2BOIA 1OLMA 3PVEA 4LE4A 5FYYA 1NXMA 3O1SA 3ZZIA 4DXRA 4AFCA 4HNWB 2OVUA 2PHXA 2XWBB 5DUUA 3KHCA 2RDRA 4IE0A 5K0UB 2B3VA 5CFCB 2VZPA 4P9YA 2HC9A 1V9U1 3D6EA 1TNFA 5C33A 4KSFA 2YNEA 2GC3A 4JCKA 2OW4A 2AREA 3BUCA 2NSMA 2K46A 2GC2A 2Q1ZB 4HNXB 3SJEA 2R062 2DCYA 3FC0A 3M3CA 4MHUA 4AAXA 4CDWC 5FR3A 4EJRA 5J09A 1CJWA 2TBVA 4X3RA 2VZRA 4YM3A 4JHTA 4MFQA 2WFF1 3IM0A 3BIEA 3ZX7A 4ZBGA 4B5PA 2GNDA 4P9GA 4QPWA 2PHDA 4NN0A 2J8RA 3N9MA 1PM7A 1ARLA 5JXHA 3LEIA 3RI8A 1EUUA 1SCRA 1KJLA 4MGSA 3T4VA 1LFWA 2DURA 2DV9A 1XU1A 5FIXA 5JI9A 4CDXA 5D1IA 3H8XA 1VIXA 6CPAA 2MHFA 3BKZA 5DABA 1CM0A 5FV3A 2NP0A 5LBFA 2GNBA 3LKJA 1GNZA 1AR72 2WWUA 4LO6B 4BOWA 4NFRA 4L0PA 4ONUA 4XURA 2FD8A 3TN92 4E8CA 5FZ9A 3B00A 4OVEA 2I45A 4DY5A 5JMCA 1F2PA 3DLJA 3IWEA 2RDNA 4ASKA 2V8GA 1KFUL 5FQ0A 1W90A 3IDEA 3KMHA 4LPLA 2JBJA 4GH4A 4ES8A 2XL7A 3D7HA 2WDBA 3SI2A 4DYOA 4YVWB 1UU4A 3D3AA 2B4BA 4PSWA 2DF5A 3RNZA 5FTTC 2ETEA 4BQ4A 1CX1A 1KWMA 5T52A 1D2QA 4ATFA 2ZX0A 1N3PA 2P3KA 4FPKA 3WDUA 1XOVA 5FDBA 1U6MA 2REEA 3M4FA 5CVRA 2JECA 4AZZA 1E5HA 3H8RA 3DR8A 4CYNA 5B4NA 3T2TA 4G3YC 3TEYA 3BOWA 4OKOA 2Z2SB 4JDNA 4YVWC 1OH3A 2WRAA 1UY3A 5BNOB 1ZBA1 4GH4C 3L2HA 4D6RA 2DCZA 5DG1A 4MHRA 5F5CA 5J3UA 1CJPA 1ST8A 2OPWA 5EZWA 1ND2A 3B7IA 2XEIA 3ZSKA 4JGYA 5JGFA 5GLVA 2V8HA 1KDMA 3H3ZA 1BOBA 2PAEA 3POGA 4LHNA 2C6SA 2KA3A 3J4UH 5FLHA 4QPIC 3BI1A 1VBB2 3H42B 4Q4V1 4URAA 3WNNA 1AR81 5A3MA 2Q4SA 1EPWA 1R57A 2V4AA 3NVCA 3FLRA 4AW7A 4BA6A 1CPNA 3ZSMA 1MZEA 1A8DA 2Q4YA 2ZPXA 3O0XA 5DXDA 2PIZA 3IEHA 4BBHA 2WFF2 3KCYA 4UFKA 5T5PA 1ACCA 4XJAA 1PGL2 3JUUA 4MV2A 1LULA 4N43A 2A7AA 3VB9A 1BO4A 1OD3A 4C2YA 1S1AA 3UKVA 1WMEA 2VMIA 2ZA9A 1ZO0A 4PQ9A 5DQ0A 5HVGA 1AR83 1NA1C 1XYOA 1JWQA 4AEKA 2WC2A 1K4JA 3V38A 2WR9A 2J22A 4F0XA 1P4NA 2RE9A 3AZZA 3I49A 3GHNA 4MY0A 3DXUA 3O1PA 4IGQA 1AX0A 3I2DA 4ZY9A 2D6MA 4MZUA 1ASJ1 5K8OA 4PBPA 1ARMA 2G0BA 4P9IA 3MPPG 1DIWA 3N9NA 4F83A 1LOAA 4K6BA 4DINB 1I21A 3WR7A 1MS3A 1Z7S2 1O5LA 1XJAA 3ZM8A 3ZSEA 3GALA 1MS8A 3IT8A 4M6IA 4WZCA 2DUPA 3B9CA 1XIXA 4PPZA 1LOFC 3C3VA 4FPGA 5F39A 5FMCA 1UY0A 3LD8A 2FIWA 4F7ZA 3MIDA 5I4MA 4RD7A 3WG4A 3MIEA 3Q8AA 1RUD1 4Y4RA 1PO13 3WOGA 3U78A 1KJRA 3IMMA 2Z3KA 4NXYA 1DGLA 3UESA 1W3XA 4DRRA 4CP9A 1U0AA 3ABZA 1REDA 5C8CC 3ZYJB 3CQOA 2XEGA 5L9BA 2VMEA 4MOAA 1GZ9A 5H9QA 4OQ8A 3ZFGA 2R061 5IYYA 2BO9A 5HXMA 2QYVA 2B4KA 2ARCA 2PLV3 4AHWA 2R042 4I01A 5E88A 5F37A 4LT5A 1ULOA 1KZFA 2ATRA 1KRIA 3GGLA 5JCTA 5A28A 2NYYA 3ZVXA 1UZVA 1G9FA 1MQTB 3J8F3 4LBJA 4PQAA 4OI0A 1WCDJ 3C26A 3KT4A 5K9YA 5D2AA 1S0JA 1IPKA 3U4SA 1HX6A 1W8TA 2R98A 4IW3A 2R8VA 5DUVA 2EF6A 2EIEA 1CAXA 3F8KA 3MIHA 2DVGA 1YK3A 3PEIA 1RTQA 3OYWB 5F9TA 4KLVA 2EAAA 4OZOA 3BTZA 1QY4A 1IZ3A 1J3QA 1DCSA 4ITCA 5FBZA 3ZN4A 1OA4A 2RMU3 1HXS2 4XFBA 5AG6A 3RMXA 4BM8A 1HIXA 4IV3C 2FCVA 4PHZA 3UKNA 4AEDB 1DGWA 2R16A 4Q29A 5L73A 2R0FA 1HB3A 1FT7A 3SH5A 3LA3A 2ZX2A 1GV9A 5JSRA 3CJIB 4XEZA 4ZHNA 3WHTA 4P5YA 2RS11 2A73B 2YBSA 4QGLA 5A7QA 3B5LB 3VL8A 4DB5A 4Z65A 1PMIA 3OF1A 5A7OA 3RI9A 5LCWL 2XPJA 3B3TA 4JRLA 4YZ3A 3MGDA 1W8WA 4KMQA 1QKQA 3VZOA 4YW2A 2QVPA 2VMHA 3TRSB 4O23A 1X82A 1OH4A 1F5JA 4A42A 1LOKA 1W6PA 2F7VA 2Q43A 1OVPA 2V8VA 2GH2A 3LDKA 3T1MA 3VHNA 4YZ1A 1TF8A 3RWNA 2IXIA 4C91A 3IB3A 1GWMA 3JZVA 3WNOA 3HD8B 2ZCWA 1GQPA 2UYBA 3DN7A 3OPTA 4N9IA 1C8M1 3URFA 4JGZA 4EV0A 1XRYA 3HNYM 1LOEA 1D4VB 5KXEA 1V6OA 1HDQA 4MHZA 1L0CA 3N7MA 3B93A 2NZ9A 4UBHA 5L7OC 1LRZA 1XMTA 4MGQA 4KL1A 4FSJA 2P5BA 4IEOA 4S2GA 2Y64A 3WP3A 4COYA 4Y1XA 1BLLE 1NMTA 2DVFA 3H8UA 3SEEA 2YZ4A 4QWNA 3SI1A 1EUTA 3HBZA 2ZEGA 2Y6GA 3P2HA 3OSDA 2NYQA 4NVPA 4AF9A 4E27A 1C8M3 1PGL1 4UCNA 1G9CA 1SACA 2AZ5A 4NE9A 1FPN2 4F9VA 1UPSA 5F5AA 4BZ4A 3TB0A 2UURA 2B4DA 3BLNA 4NJRA 2YG0A 2AH2A 4S2FA 4CDXB 2CWSA 3D7FA 1W0PA 2DYCA 2OX0A 3S7IA 1MEC3 1OT5A 4YVWA 1ZZCA 1UCXA 3ZN6B 5IVYA 3R9GA 2ARXA 3O0VA 3P6BA 2OZGA 4D7SA 2AFUA 4DY3A 2DCTA 2J1RA 3G8WA 3KVAA 4AHZA 1UKRA 4ASLA 2Z3OA 2K5TA 4CUAA 3RJ2X 5CB7A 5AC93 2EIDA 4BDVB 3WC7A 3OYWA 4QDSA 2BU9A 3AX4A 2QQMA 2X5IA 3MUY1 2WKKA 3FFZA 1RUJ2 2LROA 3PVNA 4NWVA 3RZMA 2FS5A 2BP6A 4K3UA 4OC1A 2ZOFA 2HKXA 1DZRA 3AMPA 4QDRA 4CDUB 3LODA 4LUKA 1A6CA 4GWIA 4RYDA 5FO9B 4PLNA 2QQUA 1CN1A 1N1YA 4RQPB 1B35B 4A41A 3WNPA 1CAWB 3HT1A 2P0WA 2PIYA 2PJ6A 1TG7A 4LLFA 1HW5A 2P6CA 3PGPA 1VALA 1Q5OA 3OGVA 4NPRA 5FZ1A 3KHXA 1ZBA3 5CKMA 1K5MA 3PIGA 2HLEA 2W95A 4FOVA 2DUQA 2XVKA 4YVSA 4N53C 2Y0MA 1Q8OA 4A39A 2C6PA 3K4DA 3BB6A 4A7YA 4FPOB 1Y7BA 2WFPA 3BJ7A 1RTVA 2WJSA 2YV8A 5FYUA 4N90A 1KQRA 2FCKA 3N7KA 1HN0A 3ZN6A 3DNSA 3VBRA 1LHWA 1O59A 5CFDA 2JDCA 1YQ6A 2J1TA 1VJ2A 4HPKB 4A6SA 2R043 1WD4A 4Q0SA 5BV6A 4EWDA 1D0HA 1GFF2 4FPEA 1H1MA 2PJ7A 1YNAA 4HETA 4CSWA 1M1DA 1H9PA 5CKNA 2JENA 4MY3A 3MFCA 3CXQA 3O0WA 1NCQA 2BGCA 3E1F1 2WWJA 3N9QA 1VHOA 2RHPA 2IXHA 2XOMA 5FK7A 4DEVA 5A3UA 1DHKB 2DBNA 2ANPA 3DUIA 3C7EA 2DPSA 1L3JA 4IE4A 1ZZ9A 1FMD1 1LOFA 1W2OA 2P3IA 4PCRA 2QQIA 2W3JA 3AMQA 4IGOA 1A34A 5FYHA 1ZRDA 4NHKA 2FVGA 1Z2LA 4K9SA 3VBRC 4B4QA 3MGUA 4NIAA 4KOXA 1VAVA 3NH8A 1S2EA 2VUDA 3T30A 1MK4A 2AEYA 4RFT0 2NPIA 2WA4A 3LOIA 4XFIA 3NKTA 5ABJA 1G9BA 2PR8A 1DTDA 5A7PA 1T2XA 2WAAA 4HOOA 3ZYPA 2B46X 2EVXA 4COUA 1OBRA 4HN0A 1OF4A 4QPGC 4C90A 4FOQA 1GWKA 2OH1A 4N43B 1PGSA 1FV2A 3B3WA 4RS2A 1HJGA 4FP2A 1IPJA 3L9JT 4IE5A 1BCXA 4XIOA 2ZEHA 4CAFA 1W8UA 4P10A 4O9GA 4BK5A 3B8GA 1CGPA 2IXLA 5A1LA 2JDDA 1UU5A 2VPVA 2O8QA 1X9TA 4JYWA 1GSLA 4XAEA 2FL4A 2B9UA 1FY7A 2E9QA 1Y4WA 4TN7A 2JBKA 3CJIA 2HWB3 4ARXA 4KUBA 1ZREA 3ACLA 5CISA 4UEFA 4A2ZA 2P34A 1V70A 2PHRA 2JDNA 4YFWA 1VBB1 1CQ9A 4IXLA 2OXBA 4DNYA 4C2XA 5JZGC 1DYKA 1RJ8A 1PO22 3RYPA 3GNEA 4FTEA 4Y49B 1IG3A 2QMLA 4A7ZA 4LK7A 2DCJA 5FZCA 3ZKUA 5C5UA 4OZXA 4OP4A 2WBKA 4KNCA 3GJAA 4OC3A 1ZLHA 2PQSA 3I2KA 3QB8A 2VCCA 2XEFA 2P4EA 1WBFA 4ATEA 1YC61 3AB0A 3LSEA 4FAGA 4G4FA 1X8EA 3N7LA 3D7DA 4FP3A 5FZLA 2ZEFA 4MYEA 3W20A 1AL23 4QX0A 2CL2A 1PO23 3THTA 2A6ZA 4XDOA 3WF1A 3QACA 5A1FA 4JDMA 1QJZA 1X36A 2WNVB 3KASA 3A23A 1YRZA 4AVBA 3VUOA 1O4ZA 1AUYA 4Y49C 1OVSA 1RUI3 2VR4A 3DYMA 4IERA 5JIUA 1UFHA 2VBBA 2ZW7A 3N9OA 2AGSA 4JGYC 4BK4A 4CA9A 1OI6A 5JAXA 1HDUA 1XE0A 2BTVC 4O9EA 2WSAA 5FZGA 2R49A 1DQ6A 4CCKA 5LY2A 1OURA 5H84A 1VAMA 1LJ7A 2J7MA 1D4M3 3A0KA 4RSUA 1SBFA 3N3HA 4P4JA 1TME2 3NAPB 3WF4A 1G9AA 5JDBA 1S60A 1BVVA 2ZENA 3JD71 2Y38A 5HCBA 4AEDC 1BYHA 2CDOA 3H9AA 3HAGA 1FMD3 1LOBA 4XZPA 4BISA 3VBSC 2C0ZA 3M3OA 4CYDA 2B5GA 4NJQA 3PTYA 5LRKA 1AR63 2D6OX 3OGSA 3NJZA 1JQGA 4AK3A 1VBA2 4Y22B 3SXOA 2Y0OA 1GICA 1HQLA 5DAPA 5HVHA 1VB2A 1VBC3 2C27A 1FV3A 1W9FA 3Q8BA 2IC1A 4PIZA 4K1ZA 3WSOA 4MG2A 5I0SA 1Z5RA 3S7EA 4CU8A 2ZEPA 3TC8A 3POYA 4LK6A 1V6LA 4GXHA 4GWMA 4Q7AA 1IQAA 2YDEA 4FQ4A 4P4BA 4CGLA 1W3VA 2BUEA 3OTFA 2YU1A 4GM5A 2Q8OA 1J3PA 1F35A 3G7DA 3WF3A 2D5FA 2AENA 2VOXA 2WZ8A 2C6CA 4HK8A 3D8PA 1SBDA 1VBC2 5EV7A 3KV4A 3KQZA 4YM2A 5F47A 2JIJA 2JDYA 2OZHA 1UIKA 5A7WA 5C8CB 4M3CE 3WW4A 4C7HA 4TLGA 4X5KA 4UWJA 5DWMA 4LULA 4P9WA 3ZXDA 2PSWA 1CX4A 3K46A 4Y24A 2RVAA 4NPLA 3TOAA 3H8OA 4DZGA 4IETA 3T09A 4YZ5A 2HWE1 2WQ4A 2DF7A 2VTFA 3ISZA 1PX3A 5CKQA 1OFSA 1ZBA2 2G3TA 2ID4A 4UIAA 1SG3A 4CAXA 3KCCA 4Q0VA 3KKWA 3UGGA 4Q2FA 3VKFC 2Z3MA 4YLZA 3ZIWA 1LAPA 2GE3A 1O4TA 2GC1A 1VBE2 3ES4A 4RR3A 5FZIA 3SCFA 1ELMP 3SJFA 2PRQA 1MVQA 4XQ4A 3UT0A 4ZKTB 2JB4A 1QGLA 3SCGA 3AC0A 2FIAA 4P5HA 2O8OA 2WYSA 3IDCB 4PDWB 2XBO1 2PVVA 4R57A 4WVZA 5LYDA 3IPVA 3S30A 1FOD2 4YRHA 2GNTA 2WZR1 4XPVA 2W92A 4IV3A 4A45A 4C8DA 3FNCA 1JBCA 5EP9A 3FX6A 4UWIA 5J1QA 3B9IA 1LHVA 4H14A 4HZFA 2VD7A 2FDFA 4D94A 4UW6A 4MGIE 2HJIA 4NR1A 3AJYA 3FJUA 2TUNA 2HWC3 4Q38A 3ZKYA 4NGRA 5FP3A 1MZ5A 4CPAA 1YREA 3S5AA 4XNHB 5KTAA 1JW6A 2VNOA 1WMFA 1JH5A 1ULFA 1COV3 3OCPA 1R092 2F4LA 3MLKA 1DGRA 2V4VA 5T54A 2E26A 1CJDA 1LENA 3HBKA 3THPA 4IEYA 5JR2A 4YZ4A 3DKWA 1PIV3 4L2NA 2JIGA 1HQNA 2W0XA 2W2IA 3MEPA 3GBGA 4NIIA 4CCNA 2J8MA 4HT1T 5JLVA 4LO8A 4UEEA 2W46A 4QPIB 1HV0A 1KITA 3QOPA 4AXVA 1OA2A 4Q5OA 1UXXX 1V00A 4QQOA 1VBD2 3G3SA 1RUC1 3KT7A 1YIFA 1N3QA 4MO3M 5IK4A 2Z0ZA 3HR9A 3HOBA 4R76A 1H4GA 1PVC2 3VWDA 2D40A 2VCBA 4AQ2A 5I8TA 3VATA 3BPSA 3PLQA 1W9TA 2YU2A 1LNSA 2H0BA 3OEBA 5E89A 3VZMA 5C3QA 5FPXA 4GA9A 2P2KA 5LWBA 4MI4A 2WO2A 4ZY2A 1OUXA 1X8MA 2BGPA 2WZR2 5HV0A 1LESA 1RUE2 1CESA 3MV01 2X29A 3OBRA 4FT8A 4Q4X2 4M00A 5LATA 4D0QA 3GYAA 3NE8A 4Q4Y3 4B29A 1XEBA 2EICA 3LA7A 4NRPA 5F3GA 4CUGA 1UMZA 3WZ1A 2RM23 1NKGA 1JS9A 1ULEA 4GB32 2OKXA 2Y60A 4WM7A 1YJKA 2YNCA 5F2WA 4W65A 3H5ZA 4RUHA 1X9PA 1QJU1 2KM2A 3OBZA 1DDLA 2WYRA 1W04A 2VTXA 4EMEA 4M85A 4H2AA 4TYSA 2RDQA 5C70A 4FPFA 2BOJA 4BE3A 4CXXA 1XC6A 1Q8PA 2TNFA 3ELNA 4LNVA 4QAWA 2HH9A 3F2ZA 1Q2YA 3AXDA 4QHBA 4CGMA 2UU8A 4AVVA 1S7LA 1PZ9A 2W94A 4YG6A 5FYVA 1ENQA 4IV3B 2IFWA 2VXRA 3O14A 2ORXA 2Y0IA 5FY8A 1T6BX 4XVHA 3FUOA 3Q8CA 2EBJA 1YFYA 2QCSB 1J58A 4M3CB 3H8EA 1EAH3 2ZMLA 5A27A 3O12A 1R091 1AYN3 4CCLA 4NCZA 2I79A 1RIRA 4UCMA 2FDHA 5FPLA 1JTZX 4UFJA 1X50A 3V64A 1H2MA 3ACGA 4XJ9A 4XBQA 5LW9A 1R43A 2EK8A 2JDUA 1QEXA 2BVVA 2ZJCA 4XCAA 4PF1A 1HDKA 4Q4W2 3VBRB 4MMOA 4GAZA 3KHBA 1EAH2 2PJ4A 1XOYA 4X2TA 2R072 1QSMA 4AOCA 4CZSA 1VBA1 2YFZA 3IAPA 4NIGA 1QXPA 2Y6FA 4XE9A 5BPXA 3KVBA 1WWZA 2WUUA 1IS5A 4GKYA 1WLCA 4MHYA 2WA3A 3V7ZA 2PHTA 4BINA 4U5YA 3U37A 1ND3C 4Z07A 2R1DA 2JKXA 4U9YA 4J1XA 4ARYA 5JPMB 2VULA 2X8KA 1QIQA 1H9WA 3AP6A 1QQP1 3PUHA 4HPKA 4P45A 5C3SA 1BQPA 2DFBA 4XMIA 5DZGA 3NQHA 3BJ8A 5THWA 1IOAA 2W1WA 5GLUA 3VKLA 2A6VA 2ZEYA 4NWWA 5AFEA 3EC4A 4QXKA 4XYXA 2XLAA 4QXCA 1UU6A 4A44A 5LRGA 5KC6A 1NCQC 2R1BA 4GWJA 1LAMA 1ZG9A 1YX0A 2D7FA 5FY7A 4CCCA 4UFWA 4QKDA 4XW3A 2UWAA 5LRJA 1AR73 1MS1A 3WQBA 3BYWA 4BB3A 4AG4A 4L9BA 1Y7RA 2CNMA 1M4WA 2IVJA 3P1IA 3QLQA 2EAKA 3JXSA 2ZGSA 2DVBA 1JU4A 2Y6JA 4QGNA 5F5QA 3WY6A 4L89A 4XACA 4JHZA 1B35A 1PM4A 2YB7A 5IW0A 4E2GA 1S7KA 3ZO0B 2EK9A 4U36A 2I74A 5FZ8A 1X33A 2ZXQA 3EB7A 4LHLA 2FCTA 2DDUA 2KR2A 1YVKA 5HXDA 4ES9A 2V09A 1ZZ8A 1T6GC 5IK8A 4FUUA 3TX8A 4X6QB 4B8EA 2W47A 1H8VA 4Q0UA 5FPZA 2AUYA 4YPJA 2W1QA 2CDPA 1HQWA 2IUWA 1Z78A 4ISRA 2A6WA 1G86A 1ZBE3 1US2A 2VQAA 3MYXA 4LKFA 1W9SA 1RITA 3AMHA 4RGKA 4CDQC 3APBA 5DUWA 1AYM3 1IKQA 5I93A 2VQ0A 3FX3A 3PVBB 4QB6A 4RGAA 4FD5A 1VBE1 4QQ2A 3CL1A 2CAUA 2PXJA 3K2KA 3FN9A 4KOYA 1YQEA 3HNBM 4QUSA 5I0CA 1SLBA 1UOGA 1Q7LA 4UBRA 5LK7B 4EVYA 3RQ0A 1JZ6A 1A8MA 5KTCA 2HWE2 3SISA 4CDXC 5C4WB 1H2KA 1SFNA 2QFEA 3THCA 1UF2C 4QU1A 1QNYA 1SBEA 3E6DA 4NGTA 5F09A 2HWD3 4A3ZA 2WO7A 2ZGPA 3R4SA 4KQ7A 3HVDA 1BPMA 3AVSA 3AKQA 1IS4A 1R1A1 2W08A 3ZR6A 5GZEA 2C5DA 4H7LA 5C9AC 1XU2A 5FVJA 1XFOA 4WM7B 4OC0A 3LIGA 2H0VA 2L9LA 5CBLA 3AXEA 1PIV2 4PI0A 4CCDA 5L36A 5L7OB 3O1RA 1K5JA 1HXS3 4FXKB 4UFMA 1MJBA 2EIGA 3D4KA 1UWWA 1KFXL 2C1FA 2RS13 2XWJB 2WNVC 4IEPA 4XDQA 5FZKA 4CP1A 2XHKA 4V2VA 1M4GA 3FUQA 4AVCA 5A1AA 2PHFA 1LR5A 1Y9QA 4QU2A 5DPNA 2BJSA 2HWC1 2A70A 3MDPA 5FY1A 5AVPA 1JUIA 1Z8WA 4DUKA 1Z8XA 2V5YA 2CY2A 2GMMA 1YFXA 4AXOA 1OD5A 4XJ8A 2BERA 1F8VA 2WWSA 3JCIA 4QB2A 5FZDA 1COV1 3WW1A 4GMP0 4EN0A 1PK6A 2D5HA 3ROUA 5ACA3 3WABA 3KGLA 5IB0A 3D0JA 1OC1A 1RGSA 1AXKA 2ZEXA 3KZ4C 3OJBA 4CPBA 4QB1A 2GN7A 4JTNA 5DZEA 1SFPA 4XPLA 2CWMA 5KHKA 2ZW4A 4W50A 4PIYA 4CEYC 5EMIA 1IS6A 2W91A 3WXPA 3VDDC 1LU1A 1W6OA 5BNQA 2AFWA 1QH7A 1SFYA 5K8MA 3SLIA 3CO2A 1NX9A 3VBSA 3VZLA 5FZ0A 5KC5A 2VZYA 2J42A 2NMTA 2BWCA 4F0YA 5JH9A 1WLTA 3FL7A 4LKSA 4AAPA 2DPTA 1SDDB 4AGGA 4B1MA 1RUJ3 4NMIA 5GZDA 5A3OA 2C6GA 3RGBA 4Q36A 1TE1B 2VXJA 5LA9A 4UT5A 1X10A 1O3TA 3OPWA 1HRI2 3U0ZA 1C3HA 3WG3A 5FY4A 2VAUA 4M6HA 3MIFA 3ZFFC 2VMDA 2LTNA 4IGPA 1NAEA 1IOIA 4CAVA 1RHI2 1B87A 2JE9A 2OQ7A 2VBDA 3NNLA 4JJXA 5G04L 2WZNA 4XMAA 3D66A 3LMSA 1LKNA 4YGDA 4AQTA 4B1LA 3DSBA 2AFOA 1YLOA 1JU3A 4IQPA 3FIXA 2D44A 4E2SA 1CAVA 4X6RB 2Q7SA 1A3KA 3FHQA 3WNXA 1AXZA 1BEV3 2QQPA 2LALA 5IJRA 1AYEA 4IAVA 1GZWB 4P9XA 3TOBA 2YC4A 4YW7A 3ZPYA 2XEJA 3VARA 3KF5A 4Y20A 5DUXA 1LOGA 4K40A 2Q4VA 4LBQB 4MUVA 1W8FA 2RMU2 1BEV1 2BEOA 3AZXA 5HVFA 3ES1A 1BPNA 1IYLA 1PCAA 3KR5A 5J8CA 1NG0A 1RYYA 4ZX9A 4L92A 1IY7A 2WQ8A 3LE0A 4P00B 5I0TA 4BMEA 3V0AB 5T50A 5JZGA 1G7YA 4YW1A 3B3SA 3BTAA 5C3OA 2LS6A 3KD4A 4JKKA 5FJKA 1CZTA 3MRUA 2DTWA 1RVF2 4JD6A 2G19A 4CCOA 1AYN1 3TNQA 1VMHA 4YG0A 2EA7A 4CP0A 5FY9A 1PMJX 2VOWA 4FO9A 4FXGB 4JQTA 2D6LX 4N53B 3IC1A 3I3DA 4U9ZA 1PGW2 3O1UA 1WZXA 3J8F1 4UXAA 4XAAA 4BLJA 5DN2A 2OT7A 5I91A 1YUDA 4LQ6A 1E5RA 4OUEA 5A70A 4DS0A 4P4FA 5AG4A 2XG3A 3OB8A 2HWC2 2YYOA 2JXAA 4XJUA 5EPAA 4LE3A 3ZXAC 3E0KA 3INAA 1M4DA 5DDJ2 3ACFA 2ZGKA 2ILMA 2CY6A 1NOVA 1O6UA 1QQP3 1URXA 2WSVA 4OI2A 3ZFFB 1MZ6A 3GZEA 4LIVA 1PUAA 4KUAA 3GY9A 4UF4A 2XR4A 5HXVA 5A7WB 5KBFA 4LIUA 3RVHA 4FAHA 3WHUA 5BNOA 5A3NA 4YWYA 4KGGA 2A3WA 5FPBA 4M4PA 2OPKA 2VQUA 2CTBA 3VBUA 5GALA 3HN3A 3POJA 1XBFA 2B5GB 2ZS6B 5AG7A 3GIUA 4NUBA 1CIYA 1MS0A 4K20A 2XKOA 1RUH3 1YR0A 2DCKA 3TCVA 2SBAA 3NAPA 4HKFA 4CEYB 4GXLA 2CHHA 3L2YA 1W0OA 2B42B 2RS53 2PHUA 5ERLA 5T55A 1S55A 4OQ9A 2CNTA 4TWTA 2D4PA 4KGQA 3JRUA 4WJBA 2JG8A 1WD3A 2R0HA 4JGZB 4URTA 1VBC1 3USUA 3FJSA 2R32A 1CAUA 4M0HA 5GLZA 4BH9A 3VD9A 5LEJA 2JLMA 4PXBA 4XF9A 5DZFA 1U5ZA 3SJXA 2QQWA 1CAVB 5IVFA 2FBEA 1OQEA 2BCOA 3PVOA 1JI6A 1ULPA 3LPFA 5EFUA 3FZ3A 2Q8DA 3WF0A 4Q8KA 1QSNA 4MFLA 3VBFC 4WM8A 3LEKA 3HQXA 4NHMA 3WDYA 2C9AA 3WUCA 4B3NA 4EZHA 2B3UA 4MFKA 2CU5A 2N7GA 3PL0A 5H9PA 3WG1A 4IDZA 4O61A 2RS31 4FFFA 2VUCA 3UETA 1GUIA 5A3PA 1V6MA 3PB6X 4I0AA 1W6QA 2GALA 3ZXEA 2YUEA 3FHAA 1J1LA 4O65A 4DUXA 4KWKA 1ZG7A 4B14A 2XUEA 2ZAAA 3SXWA 4MGYE 2Q8EA 2WPXA 1DBNA 1VRH3 1YVOA 2VXKA 4P44A 2FZ2A 2V72A 5C9AB 1KUYA 2GMPA 1ON0A 2QDNA 4A30A 1C4RA 1K45A 1PNGA 4ISQA 5IVVA 1WK4A 3FBUA 1CAUB 3OUHA 3CIHA 3POSA 1F57A 2WNVA 1W39A 4Z2AA 2Q44A 3KR4A 3PP9A 4XF4A 2VG9A 3NMBA 1QJX3 1AX1A 2D6NA 2CXAA 1ZM1A 3FVLA 4KVXA 1QOTA 4R8FA 4KH9A 5A3TA 5FYCA 4OHYA 4UW4A 4D69A 3ZSJA 3TO7A 3I97A 4B5OA 2VC9A 4R9DA 5F49A 1UZYA 1AL22 4MCQA 1PK6B 3SQOA 2JG9C 5HH1A 4FAIA 4LBNA 5BNPC 1M4IA 4UW5A 3EO4A 1OXCA 2B8MA 5T3NA 2XHNA 3FECA 2Q5TA 1W9WA 5FFOC 2Q8CA 4CDWB 2IZWA 2W1SA 2A71A 2VW2A 3A21A 3A0NA 1HXS1 1K3IA 1W2UA 2D3RA 4N43C 4XQWA 3SHRA 4AVTA 1RUG3 4JZ0A 1W28A 4NHYA 2VOKA 3AM2A 3I7DA 4RL7A 4AGRA 5F3CA 5HCFA 1LTEA 3FLPA 4BQWA 1ND3A 3DPRB 3V8IA 3RYRA 2VUJA 2J9AA 4HNYB 4JQRA 2WNUA 3BPZA 2GC0A 2VVDA 3I59A 3MI8A 1RVF1 2DVAA 5FMBA 3AFKA 2WZPP 3TEXA 3TOJA 4QX7A 5BYNA 3CZJA 1EP0A 2RB7A 3GBWA 4LA3A 4IF5A 1CONA 1MQTC 2JDAA 4CGOA 2QZ3A 2XDVA 5FYTA 2KCWA 5B4XA 4MFPA 4P6YA 1WW4A 2FSRA 4FD6A 4KSAA 1H6YA 4JTOA 1XSRA 3K4AA 4YVSC 1S0CA 3F5BA 1NCQB 1E5SA 3J9SA 1UYXA 2BVBA 2AR6A 4Q0QA 4Q4V2 2FDKA 2YFUA 5D8AB 3DGVA 4NIHA 1RVF3 2HEYF 5FY0A 3RZAA 3WD5A 5IHRA 4IE6A 3KM5A 3CPXA 4YFJA 4GULA 2C24A 4YU9A 1WBLA 2RM22 2WNUB 3UGFA 1RUD2 3IZOA 4UF0B 3EBRA 2A3XA 1ND3B 1UY1A 2P37A 3DPRA 1UX7A 3GZUC 1QJU2 4K7JA 4YFZA 5JIAA 1YHFA 4IL7A 2A1XA 3AP7A 2HV2A 3ZFGC 1DYPA 5LASA 3PUQA 5FOBB 4HLTA 5GM0A 1RXTA 1RXGA 3K3OA 3Q9OA 4I0BA 4YVSB 2A4NA 3R9EA 2VE1A 3ZPOA 3OPZA 1QJFA 1OMIA 4KVME 3PB8X 2HWB1 3MHZA 2P6HA 5T5JA 1O3QA 4H89A 2SLIA 3TEZA 3OY8A 4CEWB 1GP4A 2JICA 1HRV2 1QJU3 1DLLA 2VUAA 3WG2A 5BNNB 5FZBA 1DU3D 1P8JA 2VZQA 1NCRC 1LCLA 1AX2A 1W2NA 1U5IA 2BFUL 2HEVF 4YG3A 2JEWA 3T2PA 4R8HA 1H0BA 2XJUA 3HPNA 4E8OA 3AP5A 4L8QA 3R96A 3OD0A 2JDKA 2BBAA 3KT1A 2PR1A 1PVC1 3P5BA 5FXZA 4AWDA 1JZ5A 2TEPA 4MCRA 1DP0A 1ULGA 4GJZA 1SHWB 2D6KA 2GP5A 5M0TA 3CNAA 2YBPA 2D97A 5JI7A 4NAMA 3GKRA 3I9SA 1VBD1 4AG9A 5C9AA 2POKA 4YM1A 2YHJA 5H86A 4B10A 3RPQA 1YIPA 2EXJA 4JX0A 1PO21 2QBXA 4JV4A 5D8AC 4LEJA 1K12A 3RZZA 5BNPB 3DECA 3CZUA 3JBG2 3U10A 4CUCA 4LA2A 2H6CA 3UK9A 3DYOA 3J7MA 1SLIA 5CNAA 5IAVA 2ZACA 4XPDC 4ZYQA 2QQNA 3FWEA 2PVWA 2CTVA 3IDAA 5I8SA 1D4M2 3RJRA 3SEPA 4CUBA 1RUG1 4A3XA 1BBT2 2Z42A 4H3WA 2VOVA 4GB31 1JZ2A 1RC6A 2WUHA 3RZLA 4KSIA 2RG4A 1O8PA 2RJKA 5FZMA 1IIDA 1ZRRA 2CV6A 3BU7A 1QF3A 3IIAA 5LRSA 5JVVA 2PAKA 4BD9A 1GOHA 3K2OA 1RUE3 1SDWA 4XTPA 4BMBA 1VMJA 3GZAA 1AR62 3FMCA 1DF0A 1RUE1 1NZIA 2DVDA 2XUMA 4W8JA 4PLOA 4CS0B 4A94A 5AC92 1R1A2 4M01A 1ZZBA 3I2FA 1FOD1 4OAEA 4GB33 5L7OA 4OMEA 2BWAA 4CEYA 4BLIA 5FZFA 5JR7B 1LECA 5JXJA 2BOAA 3BXMA 5FYIA 2PA7A 4W6WA 1EYBA 4R9CA 4YW6A 1NLSA 1MACA 3ZLIA 2JG9B 5CA6A 1O3RA 5LBBA 4R6TA 3ZDSA 3THDA 4W6YA 3MIBA 3RRDA 5D8NA 1N1TA 3M3IA 2VEZA 3ILRA 4QC6A 2EXIA 5KXBA 3WP4A 1TQ5A 2PJ9A 3MPBA 4HSJA 2VW1A 1VE0A 2JX9A 4QKFA 3WLUA 5LZ6A 5GZFA 2GANA 2ZPAA 3KCXA 5GCNA 3WQ7A 4CRZB 4C0BA 3U75A 2XB6C 2Z3PA 4CTEA 2W39A 1UYZA 5LK5A 3VBOB 3ZXKA 4L8AA 1AXYA 1WW6A 3C7GA 4EYUA 4LQRA 3S6PA 3WNMA 3W91A 2ZX4A 2VL4A 1BXHA 4CU6A 1ENRA 2IFRA 3ILFA 4NGSA 1I6XA 4CRYB 5CPAA 5C71A 2BRTA 1V6JA 4PXDA 3AKRA 1EV12 3SH4A 1UYYA 3H1MA 3H3LA 3ZJ0A 4A37A 3QH7A 1C5HA 1BZWA 4NPMA 2PQ8A 1OOPB 2WIIB 3GJBA 3GXUA 1WLWA 1BAVA 3LEGA 2HWF1 4IV1B 5BUVA 1VBE3 2LUWA 4AE2A 4ZU4A 2WLPA 5JQ4A 3JU9A 4YNIA 3RMYA 5IVCA 2PJCA 5BNNC 4IEVA 4ZPIA 3U1XA 1HV1A 1EPZA 1HKDA 2F6BA 3VBFB 4Q0PA 1QJX1 4D3WA 3EHKA 2PLV2 1SLAA 4EQVA 1YCIA 2HWB2 2ORZA 2QQVA 2RV9A 5A3LA 1Y9KA 3GB0A 4XZUG 1GLHA 3R4DB 2P6FA 3MLLA 1RO5A 5FP7A 1WKYA 4R3KA 2C4XA 4CCJA 2RJ2A 4N53A 4BYYA 5IAXA 2W52A 3UJQA 1CG2A 1FNOA 4Y5Z0 1VRH1 3B02A 4XFAA 1IGBA 2ZHKA 3O5SA 5FKCA 4OIDA 1WWYA 1QJEA 4ZS2A 3M70A 3S6HA 2Z69A 4OHWA 2VBPA 2WZR3 1E57A 3LDBA 1PZ7A 3MFAA 2GLFA 3V0AA 2F17A 4JZRA 1HJFA 1HB2A 5FXWA 2Q0YA 5E16A 2WLQA 3PU8A 1W6NA 1YSJA 8CPAA 2DTYA 3UKTA 3SKJE 4WWVA 1UO9A 4LBQA 4E2AA 1S4CA 2ZAHA 3LB9A 4COWA 3ZYRA 2QDRA 1NQDA 4LKEA 1S0IA 3I2JA 1PYTB 1QJY1 2HEWF 3OWCA 3D67A 1C1FA 2XQRA 3NNFA 1IKPA 3DR6A 2MEV2 4DUVA 2I00A 1TKFA 4GMP1 5FUPA 1QJY3 4WV8A 4C2ZA 2DEAA 1NT0A 4QD2A 3BN6A 4XILA 3LFMA 5EJ3A 4NJ4A 1CIWA 3BI0A 3MBWA 4G1PA 2Q7BA 2LW8A 2YC2A 1RUH1 4M0NA 2DWRA 3H1YA 3LSDA 1JOBA 4AR2A 2CGPA 2HUZA 3RNSA 3TAYA 2ZEEA 2W5FA 4LO4B 1R3NA 5A6QA 1MEC2 4QPGA 2G9FA 3CBNA 4MGZE 4RFRB 5D21A 3FRMA 2VCAA 1ZRFA 4Q4Y2 2I07B 1LAJA 5AGEA 1ZYBA 5G22A 1GWLA 5FZEA 4GMP3 1GR3A 4EN9B 3UNPA 1GYKA 3WNKA 2IL4A 1YQCA 5HCAA 4XFFA 1JZ7A 1IS3A 1WMXA 2BNOA 4RI1A 4PT6A 1UNBA 2FE7A 4SLIA 3ZYIB 4MHNA 5F2SA 2HWD2 3NE7A 2VZ3A 4JDOA 4FPCA 5C8CA 4FOYA 1RUC3 1TME1 1D0GA 1REFA 2QQLA 1Z0HA 5JSPA 5KWRA 2Z5WA 3PUIA 5DS0A 5IX3A 5CADA 5K8NA 5FREA 2B5HA 2V73A 3WT4A 3A4UA 1TZOA 3N9PA 4FVVA 4LUAA 4KWJA 3ZFEC 2CGNA 2G9ZA 4DPNA 4RS5B 4K3NA 4LITA 1EAH1 2G9DA 3JBG3 1KDKA 2XJPA 4COVA 1NUKA 1PO11 5JPNB 3NV1A 3NNGA 4AB7A 1NLQA 3T0AA 4EE2A 4A2UA 3VBOA 4BQYA 4II9A 2QECA 1KXGA 3WV6A 3M2MA 1YW4A 2XL9A 2BYVE 4UAPA 5IB9A 4B11A 4Y4YA 3WCSA 3BCWA 2RC4A 3KHZA 3ECQA 4AG7A 1QSTA 3S5QA 4DFSA 3AVRA 5HV4A 1Z8LA 4P4EA 1ND2B 3R4UA 5DAQA 1L7LA 4UW3A 3ZN5A 1WUVA 1Q2DA 7CPAA 1H30A 4LO5B 4J3GA 1J83A 4MXVA 2JG9A 4CU7A 4ZGYB 3VDDB 3NSTA 4MGTA 4WM7C 1GNYA 5FQ0B 4KS9A 3F95A 1LODA 1L7RA 2OIIA 1PVC3 3EO6A 4FI9A 3ZYFA 3PB4X 5FUNA 1XQNA 4HSLA 4NIDA 2JEVA 2R30A 4Z82A 3I3GA 3E5UA 4UIBA 4KBBA 3DDDA 1DQ4A 5L9VA 3VHPA 5FWJA 3CF6E 3JD72 5JOWA 3WC6A 3KGZA 1ZRIA 1AF9A 1XNDA 4GKXA 4R87A 4YGOA 1WLDA 3GBFA 5GZGA 1R1ZA 3H0OA 4NAOA 4RA0A 3GLJA 1VRH2 3SNMA 3LQCA 4FPLA 2XKPA 3WNLA 1JUHA 4EWEA 3QAHA 4UFIA 5IK5A 1YYNA 3NJYA 1DFQA 2VVFA 4DUWA 2YC0A 5F48A 4B5PB 3ME2A 2WYFA 5A3WA 1LEDA 1YJLA 5APAA 1AR61 2OUJA 4FTBA 4BJ0A 2ZHNA 1QJX2 3VDBA 3RBUA 1UN1A 3H3UA 1DQ1A 1V6NA 2WNEA 4MJ8A 3LWCA 1UZWA 4BCUA 3AFGA 1QHDA 5CFCA 3KV5A 1M44A 4AGVA 3D2PA 5FUIA 4XFCA 1QQ9A 2JWPA 4RN7A 3IKWA 1TIQA 3PHMA 1RHI1 2WSUA 2OYZA 2ZZJA 4LO7A 5FCCA 3R0RA 1FOD3 3KS7A 3ATGA 1QOOA 2O1QA 3PDQA 5CU1A 3DV8A 3AYEA 5EJ1B 1LHUA 5F6LB 3FEEA 1NE4A 4ZU5A 5F8PA 1NE6A 2QJVA 4BMHA 2V77A 4XPKA 1KEXA 1IU8A 2ZHMA 3HIFA 4L99A 4F6AA 4CPBD 3I2HA 4XPDB 1POV3 3O1VA 4HN1A 4ZY1A 3ZFFA 1CZVA 5CNPA 4UFHA 2JEMA 4JXQA 3OOXA 1ALYA 1UZ0A 5JXGA 2OQ6A 3IMNA 4CE8A 3EMRA 4J6GA 1Y9MA 4F3JA 2OOTA 3T8WA 5C6CA 3KQXA 2VZUA 2HWE3 4HK9A 4NGPA 2R073 2VMGA 4JLYA 1AR92 1DQ2A 1SCSA 3KQRA 5FAXA 3TFYA 2E7QA 4DMIA 3IWZA 4UBGA 2OZUA 1HRV3 5DG2A 2Q0AA 5H9RA 2WQZC 2YXSA 4UF0A 4XHXA 4V1PA 4M3CA 2A5ZA 3B3VA 2FQPA 3LWUA 4AEMA 5AC91 3SI0A 4EN8B 4WZFA 3IIBA 1NCRA 3A9LA 2E53A 4CDUC 1HRV1 3PU3A 4RN5A 4E4ZA 1JYIA 3OGJA 1ZZ6A 3PFEA 4BHPA 3RO0A 2C1CA 3T2QA 1JYTA 1B6BA 2Y33A 5LYFA 5T5LA 2J1SA 3PUSA 1YI9A 3TN91 4B4PA 4MHPA 1AL21 3A22A 4TNUA 1TXRA 3UL2A 2PMWB 1BBT1 1F5FA 4PLMA 3VZJA 2EALA 4B4RA 1M06G 3K9UA 3HWJA 3PFOA 4P4DA 1R64A 3JQWA 4PBOA 4EFDA 3FMGA 3PJYA 4UWDA 1MS9A 5K4LA 1JOJA 3KV9A 1OKOA 1IQDC 4QDQA 3KSCA 5AG5A 4BU2A 1WMDA 4NSQA 5ACA1 4XJWA 3VKMA 4DNCA 4I09A 4HVRA 4QBJA 1F4AA 3DKQA 2IMOA 1QMUA 4YGEA 4P08A 2YGWA 4GWNA 4XTMA 5FLIA 4INDA 4A38A 3ISXA 5ANQA 3D5OA 3SMHA 2F8HA 4PIXA 5JM6A 1CWPA 1HEEA 2F5IA 1XSQA 3M7AA 1QH6A 4V2WA 1FYUA 1I12A 3W21A 2HBTA 2VNVA 4NEXA 3TNPB 3U14A 3A7QA 4UA3A 4R52A 4RQPA 1RMU3 2W68A 4Q27A 2ARHA 2ZX1A 3I4IA 3J7NA 2RR11 5GLWA 3MLJA 2QNKA 2GAUA 5EWSA 4QX1A 2H6BA 3VKOA 2BPA2 1WA6X 3POFA 4Y5TA 4Y5SA 1EY2A 5FRAA 3KWVA 3S57A 2PC1A 4MBUA 1S0BA 2GMEA 2OZJA 1OOPA 5F7UA 3POEA 4HANA 4Y1YA 3ST7A 1LHNA 2E7TA 4JRAA 4WVMA 5C7GA 3C7HA 4YGBA 3BTYA 2PJBA 4N7IA 1S7NA 2D3SA 4HXCA 5FP4A 5FBJA 4AFMA 1V6KA 2XH6A 3PTRB 4MXWB 4DRVA 1IB1E 1O3SA 1I5PA 2CF4A 4M3SA 3B94A 3D82A 1TKHA 1IG0A 4QVTA 1PK6C 2RR13 3VBFA 2DBIA 3PMSA 4XF0A 2Y6HA 4AQ6A 2EO8A 1H2NA 1W2TA 4LR4A 3IU2A 4TLFA 2VO5A 3T1LA 3VBOC 2CYFA 1W6QB 1UX6A 3CJIC 4ORFA 3RZGA 2PJ8A 2WPWA 1F31A 1TEIA 1W6MA 2XMLA 5FZOA 3QBQA 1F9KA 3U07A 2REFA 4JKLA 1CPMA 1SPPA 2IXJA 1WCKA 5CIRA 2YGLA 4FFIA 1YWKA 4NGQA 4PDWA 1POV0 4X8IA 5ELYA 5IK7A 5EJZB 1UOFA 3VZNA 5A6ZA 4HONA 5JXIA 3LPGA 4CDQB 1WA4A 3EFAA 3WDWA 1Y43B 1POQA 4P9LA 3J7LA 2O53A 2XJSA 2Q51A 5ABJB 2BSWA 4XNHC 4IEWA 2PELA 4GIQA 1BLZA 1COV2 3RDIA 2ZTNA 3W9AA 4A6OA 4ET7A 4Z2WA 1S2KA 4KBZA 1IICA 3PB7X 3ORJA 4NHXA 1BBT3 1ONAA 1NCRB 1W6PB 2J1VA 4Q1PA 3W59A 2R041 3WP6A 1LGBA 1BKZA 3SKVA 2NMNA 1EV13 3AK0A 3BIWE 3FFQA 5LRRA 4UFXA 5AFBA 4XBLA 4MFJA 4K8FA 1DGWX 5A32B 5A6YA 4DOUA 4E0AA 2I2SA 1DQ5A 5GLTA 4META 3CXSA 2WNOA 1KD7A 5JMOA 4MGKE 3DF0A 3S9LA 1S2BA 2ZABA 4K1YA 3F0AA 3IJ3A 1AHSA 3TWIA 5CG8A 3EYPA 3TO6A 3I1UA 4I3GA 4AEDA 5FK8A 5JOXA 5LEKA 2WNUC 1Q3EA 3CDXA 1OPMA 2QTWB 4BIFA 4AYUA 1CBXA 4S2HA 3GYDA 1MR5A 3K9TA 1XE4A 4N7UA 1WCUA 4BXSV 2NMOA 2UWCA 3M1HA 5FP9A 1RMU1 2IVIB 3IGRA 4MFZA 1CAXB 3N35A 3POBA 4NRQA 5EYYA 2R7HA 1BJQA 5IV0A 2XQXA 3JB4C 1RUJ1 3J26N 4CRQA 3I3EA 4QX2A 5JZGB 1XBUA 1GU3A 4B12A 2XONA 2FCUA 3EXUA 3MIGA 3OD4A 2ZEMA 3WC5A 1POV1 4FWUA 2EVNA 1NA1B 2PHWA 2RS32 4ZS3A 4R9MA 4D8MA 3W6SA 5LB6A 2PN5A 4IEUA 4JVAA 1Y7EA 1CZSA 1UZZA 1FX5A 3C2UA 3VDCA 4OC2A 1RUD3 1UXZA 3LEMA 4XF1A 3CT9A 2VQYA 2X09A 3ZFGB 2R1IA 3R9FA 2HWF2 3DPRC 4XF3A 3PBEA 4TWEA 3V56A 3FE5A 5C88A 2ES3A 4Y22A 1AZDA 1IHMA 3PNAA 2WS93 5JWPA 2HYXA 2ZBJA 1WW7A 2AYHA 4AVAA 2EUIA 4IK2A 1CD3G 1QWRA 4PQQA 3TEWA 4N8MA 4LTAA 4PI2A 5I0DA 2VZSA 1A2ZA 1JMUB 4CEWA 3O1OA 1N1SA 2EXKA 3ZFEA 3KZWA 2HQYA 3VKNA 1NSLA 2MNGA 2JB8A 1W6NB 2OZ6A 1CPSA 3IIIA 2QZ2A 4RGGA 2B4DB 3NJVA 5ACA2 4KOUA 3S6FA 2HWF3 3RZKA 2R063 1I5ZA 3NV2A 4UI9L 1JYXA 1W8HA 3U4XA 5ISVA 1Z9UA 2VQTA 2JG8C 5DAXA 3RAMA 5LYLA 2J8NA 1HB1A 1PVXA 1VLNA 2V5DA 4EN7B 2BQPA 5EHDA 3T2OA 1C8M2 3EQEA 1UMIA 3HEIA 3VGIA 3D2MA 3LDRA 5F3EA 2EXHA 3LD2A 4WM8C 4BXFA 5FXXA 2YMZA 1F15A 2XJQA 4FQZA 4WVVA 2K9ZA 1JYCA 1QDOA 1UYPA 4CXWA 5L19A 4K30A 2E7AA 1I3HA 4ZZ8A 1SLCA 1JOPA 5J36A 1Y9GA 1NSAA 3D0SA 3RZHA 3TN93 1FMD2 4KOTA 4C7IA 2B45X 4H7MA 3RG0A 3E6BA 1GNHA 2CTCA 5FJHA 4AVSA 1VIWB 5BY5A 4N9HA 3S0MA 2P6GA 3ALQA 5FZHA 1VKCA 2PRBA 4IHMA 4FFHA 4XUQA 3P3NA 3PIJA 5KXDA 2BDRA 1REEA 5J48A 4UCPA 1JHNA 4ZXKA 3SC7X 1XYNA 4KOVA 3NL1A 1STMA 4P02B 1GZTA 1OF3A 1RUI1 3KB5A 3ACHA 3GF6A 1ZLIA 2YY1A 3T0BA 1J4JA 1SQHA 2Z79A 3IO1A 1NXD1 1E5IA 2VMCA 4WBBA 2DFCA 2G1MA 2NM1A 1GKBA 2O0OA 3POWA 3WVJA 1BMV1 5I0RA 4ZY0A 2HB6A 1N47A 1BEV2 1YQ5A 4R9BA 4IE7A 1PNFA 3H7JA 4J1WA 3GCWA 3IDBB 2D98A 5GZCA 1OZPA 4JGYB 4AQSA 5AVAA 5JSOA 4DXSA 5G1ZA 5B2GB 2ZGMA 3C7OA 1JYWA 1V9U3 3NV4A 4AFAA 3N9LA 3NWKA 3DYPA 3MW3A 4KI5M 4LUMA 2G9GA 4QM9A 5EXOA 2FDIA 4HBNA 4YW4A 2CAVA 1UWYA 1NY72 4E9KA 1W03A 4AI1A 3ZYHA 1MS4A 3WDTA 1W2AX 1QNWA 4DQAA 3O1MA 4Y1UA 4QPGB 2YBKA 4HKWA 3NFZA 3TE4A 3M8LA 4B7KA 4YGCA 4LOTA 5E6HA 2VM9A 1JZ8A 2Z3NA 1XRUA 4JC1A 4GJYA 4E4HA 1ASJ3 2GZWA 4YYOA 4NROA 5CFDB 2WFF3 3C7FA 4RHV1 4WM8B 5KR7A 4PDWC 1WCQA 3MF9A 1I9RA 2ZGOA 4FCAA 1FT9A 4QXBA 4RHV3 2FHRA 1UOBA 5DDJ3 2ZGUA 3J7HA 4C1XA 2QQJA 1AUGA 2ENRA 3B3QE 3MW4A 4FPYA 4R4XA 3GHMA 3T08A 2LM3A 1Q8QA 1X12A 2JG8B 4PK2A 1DYOA 1LOCA 2VCMA 2JE8A 3QH6A 3VHRA 4CYOA 2ATFA 4BQ1A 3IWWA 4PXEA 5C82A 3DGTA 2BZDA 4EROA 2PE3A 2D43A 4TXWA 1MJAA 3RFRA 2ZMNA 3AL5A 2X05A 1XNTA 3PRTA 4XFGA 4COZA 3BTXA 2VNRA 3BOPA 4CDUA 2FZ1A 5LA1A 2V8DA 2XJRA 4H6ZA 1UIJA 4ZXEA 3SHPA 1JHJA 5A7SA 5JOZA 2R7EB 2CNSA 3I3QA 4OHVA 4QPYA 3LIHA 5C5TA 1W05A 2PJAA 3JBG1 2K2SA 5C8WA 4I2OA 4Q4W1 4BQ3A 2GU2A 4XETA 1K5MB 2UY9A 4RR3C 3FHIB 1C5IA 1VPHA 4OUSA 1H8TC 1NQJA 1XNBA 2AEZA 4XCBA 2UY8A 2CNAA 4FBFA 4CU9A 4R3LA 1WCSA 1VBD3 3I8TA 3NNMA 4HVOA 1PMHX 1XNCA 2WS92 4CP2A 1XF8A 3N4MA 5SV8A 5DAWA 4HVQA 2IJZA 5G21A 1ENSA 2UYAA 1DG6A 1UQXA 2XVGA 3LAGA 4KG8A 4YW5A 1RB8G 2VW0A 3H7YA 5E96A 2YPDA 3HQRA 4AI0A 4XUOA 1H8TB 5FMOS 2Z11A 2X5IB 4LOSA 1G8WA 4OHZA 3AMMA 2D6PA 4P9JA 4I30A 2BUKA 1OLRA 4LJHA 2XXZA 3FH4A 4OLLA 3IFEA 2ZKNA 4AFDA 1XB9A 1QXJA 3MZHA 1RUNA 2D93A 3PJQA 2VBQA 2VL1A 2HYKA 2AFSA 2O14A 2AJ6A 2QIRA 3VN4A 1OUSA 4M3CF 1V0CA 3KL9A 1HRI3 4E2QA 1D7PM 4FFGA 4Z92B 2VECA 2E63A 2B9VA 5FMOL 1FNZA 5L9RA 1VBA3 5K8PA 3VH9A 3KV6A 3E5QA 1SLLA 3OUJA 3E6CC 4LBLA 1JXNA 4NF1A 2WL1A 2WT0A 1C57A 3M3QA 5H9SA 1RUI2 2FDJA 3AP4A 1YLLA 5HI0A 3H4QA 3PB9X 1S0FA 3IAQA 5A32A 3MICA 2BW8A 1QDCA 5BXXA 3SXNA 2P6EA 1UW8A 1XNAA 2X53S 3WEZA 3VHOA 2XVLA 3O7OA 4MSVA 4RQPC 2A6XA 4DJLA 3OBAA 1GOFA 4H2KA 4YM0A 4U2AA 1JYNA 1Y0RA 4CAEA 4EWTA 1NLRA 2WO1A 2WN2A 1H8LA 1DE4C 3I59B 1OOPC 1FXZA 1H1AA 2JDMA 2VY0A 4Y20B 2PQQA 2GFQA 4OADA 1D2SA 5D29A 3LF7A 5DDJ1 1GP6A 4FBEA 1GZWA 3ILNA 2XLGA 1RUC2 2ZEWA 5IFPA 4IV1C 4E4SA 1H1IA 1UMHA 4AHYA 2ODFA 3V65A 1MVEA 3OEAA 2A3YA 5CEHA 1Z4EA 4NGMA 2W1UA 2CSGA 1YFWA 1WW5A 4MX3A 4XUNA 1PGW1 2VZOA 1RUF2 1ZBE1 1YQ2A 3HUVA 1PHMA 4AI2A 2ZZQA 3SH3A 3K3NA 5LBCA 1GHEA 1W6MB 2WN3A 3I2GA 1GQHA 4HL0A 4LLOA 3AYDA 5KHHA 5EIYB 5F32A 2ZX3A 1B09A 4Y1VA 1O7FA 4NRMA 3VL9A 5FXVA 4ZU7A 1F4HA 2ZW5A 4JKMA 2VVEA 1S3ZA 2W87A 4LBQD 3WINE 4DXTA 1AMPA 5JPHA 5BNPA 4XIKA 2VZZA 2VOTA 4HKOA 3DXTA 5E8AA 3VBHC 1EE3P 4P4IA 3FBMA 2GNMA 2X10A 2ZKLA 2Z3LA 1ELLP 4OC5A 2GN3A 4BQ2A 1O8SA 5FY5A 1W9YA 2KXLA 1OKQA 2ZMKA 4S2DA 3SITA 3HQUA 1G9DA 5FO7B 3ZYGA 1OLQA 2E33A 4X8NA 3R6SA 3BI3A 2AFMA 2LRPA 1YFUA 4RHV2 5I8YA 3LOBA 4GS4A 4Q4X1 5IVBA 3IU1A 4Q8LA 4XJZA 5K8SA 4HPSA 5BNNA 1XJOA 3CZXA 5KHIA 1W8ZA 3OY8B 3FF3A 1GYTA 1MQTA 4CCMA 1CR7A 3ZFEB 1D4M1 3UYJA 1W8NA 1PX4A 5IFTA 2VZ1A 3AL6A 5LBEA 1HN1A 4L97A 5FWEA 2WAOA 3MN8A 2BNNA 3ASIA 1SZBA 3CEWA 3AYCA 4QMAA 3B35A 4KVOE 5J37A 3GZTB 2Q4ZA 3JTKA 4CGNA 3JVNA 1LU2A 1FI2A 1UOJA 5ANNA 2GSYA 1OLME 4GD4A 3Q8FA 3B2YA 3CXPA 5FZ7A 5C4WA 4G9SB 4NHLA 5F1RA 2PDOA 3JUWA 3PZJA 3USUB 2NN8A 3WR0A 3FEDA 2ERFA 1YXWA 2ABZA 2JDHA 2FXFA 3K77A 3ZXGA 4OIWA 5BWAB 1ZBE2 4B13A 2AFXA 3JQXA 1AR93 2DU0A 3Q8EA 4CYPA 4YZ2A 1BMV2 1GZCA 1V0AA 2C9KA 3X29B 5J8FA 3K48A 1ENXA 2PFWA 4AL9A 4CAWA 3S9MA 3VWEA 1CPXA 3B3CA 4IESA 2RS33 3MUZ1 2YPJA 3CPAA 4KLWA 2RS51 3VD4A 1W06A 2JKBA 1SLTA 3RYOA 2OR4A 5A7NA 3BALA 5CYYA 5IT6A 1Q2CA 2OA2A 1QOSA 3IBMA 3N7JA 4MLOA 4QQLA 4W6XA 4EN6B 3MW2A 1CX8A 3H8FA 4MRIA 5EBVA 5IUQA 1TMF3 2E32A 2YGMA 3U11A 4BIOA 4CEWC 1LGCA 3FLTA 4HKLA 4WVWA 4M6GA 1TNRA 4AHXA 3EY5A 1ZZ7A 4UEZA 4KORA 4C1WA 1H6XA 3S6KA 5KXCA 3T3YA 3LFIA 4LHSA 2WO3A 2DXQA 1JODA 3D4UA 3MF6A 1NYWA 3VLBB 1VHEA 3PUAA 3ETPA 4LQGA 3CLPA 4ZI6A 2VNGA 1H8TA 1GOGA 4XUTA 4Z1VA 4IEXA 2I3CA 3AP9A 4PXCA 3J8F2 1BK0A 2VZVA 1TMF1 1VRBA 3OG2A 4HG6B 3HMYA 2C26A 2MEV3 3R05A 1CAWA 2QQKA 4TZDA 2VU9A 2O4HA 2ZOGA 5KTDA 1R081 2OB0A 1F2OA 1AYN2 1SQ4A 2YROA 1LANA 1ULCA 4GQ7A 4XQDA 2O28A 4PV6A 1UY2A 2WT1A 3LCPA 1HLCA 2FDGA 2F4PA 4KU8A 1C28A 3LA2A 4JWPA 2PAMA 2Q30A 2YNDA 3BHXA 4L11A 2XBO3 4Q4W3 2PCUA 4XUPA 3PMEA 3NKGA 4OI1A 1U12A 3I3BA 4GH4B 4OI4A 1FPN1 2JD9A 5J7MA 3FYNA 5FLJA 1FAYA 3AZWA 3K51A 1U5XA 2E31A 3POIA 3SJGA 1NZCA 1FPN3 2GDFA 1FATA 3TYJA 2GLJA 4Q4V3 2ARAA 3ITQA 3ZXLA 1APNA 3GDBA 3WDXA 1KUVA 2ZELA 4E4DX 1C1LA 2XBO2 1RUF3 2Y34A 3LZZA 4JAAA 5ABJC 1IYKA 2VI7A 1RJ7A 2Q04A 2QVSB 3WW2A 4ZONA 3TTHA 3VD7A 4QB9A 5CFDC 4XFHA 3VBUC 1OQ1A 3ZXJA 5C3PA 3B01A 1AL0G 2VJXA 3ETQA 4EZ4A 1RHI3 1NE9A 5I0UA 1TKJA 4MXWA 5FOJB 3QD6A 5FYBA 3GUXA 4A32A 3VBHB 1VGYA 2IWGB 1UD1A 4Q26A 1UL9A 1QJY2 4YW3A 4GZ9A 5KHJA 3D3SA 3P2FA 3WP5A 3OGGA 3C8XA 4NOTA 4X8PA 4F8ZA 1CP6A 1GBGA 2ET1A 2IXKA 4XDPA 5K0UA 4UFVA 2BGOA 1XNKA 2OUHA 1QMJA 3QNVA 1DQ0A 1W8OA 3VDDA 4AEJA 2P3YA 4QT6A 3MV11 5GKAC 4LX9A 1QQP2 2CGOA 1SPPB 1Z7S1 5CG9A 3VBUB 2P1BA 3V0BB 1UKGA 2GIVA 4O7XA 1AVBA 4KOWA 3AKTA 3IN9A 2BBVA 5J1XA 1J84A 3LGRA 5FZOB 5C3RA 2RR12 2PJ5A 1DZTA 2PYTA 4MHDA 1Z7S3 4HMZA 4CYQA 1Z8TA 3FXTA 4XC9A 3HT2A 4FD4A 5G05L 1AYM2 1JZ4A 2Q1FA 4MCSA 1XXNA 4IUSA 2R071 5CFCC 1Q8VA 2PJ2A 4OC4A 2WT2A 3N36A 2A6YA 4RS5C 3PURA 1AYM1 4XBNA 1OSGA 1P0HA 2RS52 1C8NA 3AJZA 3H8GA 3PBBA 3CJXA 3WCRA 5HMNA 2MEV1 1X7NA 4I02A 4A33A 5FPUA 4NGNA 4YWAA 2J1EA 2RDSA 2PJ1A 2ET7A 1K42A 2XJTA 1XPWA 4FPJA 4QGMA 4ZZ5A 5F6KA 4R7MA 1YLEA 3UY5A 2RMU1 4F9UA 2FMYA 3UV9A 5DWNA 5CBMA 2XJVA 5JOYA 1YQ8A 2G3AA 4PF5A 4Q1RA 2RFHA 1EV11 1VAKA 1QSRA 4OYUA 2MPFA 3VDAA 4ASMB 2B58A 1O91A 1ZA4A 4MVTA 1Q8SA 4QQPA 4ZX8A 1UPIA 1R1A3 3DCQA 3E97A 3NA6A 2ZHLA 5A33A 4P14A 1R082 4BPZA 1ZG8A 3CMGA 1GMMA 5E1RA 3CKHA 5GJ6A 1TMF2 3I54A 2Z10A 1H2LA 1U5YA 4Q4X3 2VZTA 3WQ1A 5LY1A 4A95A 4GALA 1LRHA 4QPIA 4IEZA 4OCTA 1MS5A 5CAZA 2P17A 3WX5A 4QHZA 5FZAA 3WUDA 5FYSA 1Z4RA 4DXZA 1GQGA 1SEFA 2QE3A 1KS5A 3AYAA 3IPVB 1OA3A 4QKBA 4XOGA 1HRI1 3UJOA 4CXYA 1IOFA 2D4OA 4FD7A 4LORA 3ZMNA 1NA1A 2JDPA 1OBNA 1NY71 1JZ3A 2VTXJ 1MJ9A 3R1KA 3E5XA 3ENRA 5IATA 2Z4FA 3AKSA 5FYMA 1AR91 3WQ0A 5FPAA 3ZOIA 3NJXA 4DO0A 1DZQA 3NH4A 4AI9A 3UGHA 3ZMOA 1QXRA 1BK1A 2OS2A 4KG0A 1Y0YA 1W0NA 5IVJA 3BVCA 3GM8A 5FPVA 4H6UA 2QKDA 4D6QA 1RUOA 3D68A 4Y33A 3D7GA 2ZEOA 1YGHA 5A80A 1S0DA 2KD7A 3RWKX 1UY4A 3VBSB 4K21A 4D6SA 1RUG2 1W6OB 4PSXA 2JD4A 4W4ZA 4CCEA 5EQUA 3NAPC 4E8DA 1ZRCA 2Y26A 3KI9A 4AI8A 1N71A 3FBYA 3OBTA 1VB4A 2ZGRA 2FT0A
chains in the Genus database with same CATH topology
3NV3A 4PK3A 1N3OA 4OUMA 3EXNA 1JN2P 2GU9A 1A78A 4C68A 1KS4A 1J3RA 2OU2A 2D3PA 2PTMA 3HN1A 3USSA 2IXCA 1AJKA 3G6JB 3NW4A 5J96B 3RSJA 4LBKA 3VZKA 2B7YA 4Z8BA 4IV1A 2ZGNA 3ZIXA 3ZSLA 2E51A 5J98B 1S5KA 3P3PA 3V0BA 4AFBA 1IGOA 4XXPA 2BL1A 2G4IA 2DU1A 2DUOA 4Y1ZA 1H4HA 3RYKA 4CDQA 4KWLA 3WDVA 4IEQA 1V6IA 2B39A 5SV5A 1CVNA 3W58A 1XE7A 1PZ8A 5HBAA 3IWGA 1J1TA 4XXAA 4OHXA 4B7EA 1LGNA 3VBHA 1Q43A 4OFGA 1O4YA 1RUF1 4I0WB 4YRDA 1QU0A 3B7MA 2A75A 4Y26A 2ZW6A 4XHBA 4OULA 2P3JA 2XGXA 1YI7A 2E6VA 1DGRN 1QSOA 5T5OA 1ND2C 1RL3A 3WT3A 1PIV1 2UWBA 3TT2A 5K0UC 1I1EA 5TSWA 4SBVA 1G6NA 1YO8A 4LBMA 3TBDA 1SMVA 4PJYA 1ZX5A 3WW3A 2BNMA 2Q1MA 4HFSA 3H50A 4LBOA 1Y9WA 4YARA 4YSFA 5C4WC 2XLFA 4WVMB 2VH9A 3H1WA 4JGZC 4BWOA 1VHSA 2BFUS 2WINB 3NO8A 5EC4A 4F8AA 3T90A 1RMU2 4EWAA 2ZOEB 1BVP1 5FO8B 1OFNA 4RS5A 2RM21 4FPHA 3KLSA 4JXRA 3CU7A 3TO9A 4A7KA 1AR71 1ASJ2