4ORFA

Camp-binding acyltransferase from mycobacterium smegmatis, mutant r95k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
319
Chain Sequence
b'AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIEPGLIIGEIALLRDAPKTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTSETLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 96
structure length 319
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4orfA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4orfA02
4QM8A 3ELNA 1P4NA 1Q2CA 2FCKA 4NXYA 1I21A 2GANA 2BNMA 2PFWA 2HUZA 4BH9A 5KHGA 3E0KA 3I59A 3RYRA 2OU2A 4FD6A 5JPHA 2REFA 1LKNA 4IERA 5FQ0A 3WW4A 1S5KA 4WZCA 5CU1A 1Y3TA 3DR8A 4JXQA 4B5PA 3EHKA 4KWKA 3RDIA 1S60A 5K8SA 3B02A 4BYYA 1NSLA 2Z10A 3HT2A 2GIVA 3UY5A 1RL3A 2H0VA 4PIXA 1QSRA 1SQHA 3I7DA 1I5ZA 5I8SA 4IEUA 5JSRA 2ZKLA 2BGCA 3EO6A 4LEJA 2P6EA 1S7FA 3H4QA 3UKTA 4YRHA 2ETEA 2PAEA 3I3GA 2PQQA 3SXNA 4A2UA 5IX3A 1GQGA 4XPDC 1O7FA 3ZZIA 2H5MA 2NMTA 3D82A 4F8AA 2Q44A 4LA3A 5E16A 1YREA 3FNCA 2CNTA 2RC4A 3IWGA 2J8NA 4JXRA 4NF1A 4B5OA 4E2GA 4LUAA 2XLFA 3R6SA 3FJSA 1ZZ6A 1IIDA 2G3TA 1SFNA 2N7GA 3FRMA 2IXCA 4YFJA 1S7KA 2PRBA 2QNKA 3LA2A 1I12A 2BEOA 2ZW6A 3I54A 2XKOA 4QVTA 1O5UA 3R9FA 5KTDA 4KZTA 4MZUA 5KHJA 5BUVA 4H6UA 4XF9A 2B3UA 2CY2A 3D2MA 3DV8A 3WW3A 3PGPA 5I0CA 2QECA 5F47A 2VPVA 1YFYA 2VQYA 4KUAA 5JAXA 2ATRA 4HNXB 2MPFA 1M44A 2OZJA 1YVKA 4QGLA 3MYXA 4Q29A 5T3NA 5BY5A 4QC6A 2R8VA 1ZZCA 4XFAA 1LR5A 3NW4A 1O4TA 4EWEA 5F48A 1V70A 2PA7A 2FIAA 1ZREA 4QBJA 5IV0A 4AVAA 4QX5A 1GHEA 4KLWA 4PJYA 3LOIA 2Q4SA 4XF4A 4XNHC 4H89A 3FYNA 3TFYA 5KTCA 5JCTA 1NYWA 4LTAA 5FLHA 3E6BA 4O9EA 4B29A 3S0MA 4AXOA 3PP9A 3NJZA 1PMIA 3GKRA 4OADA 4KOXA 1H1IA 2I79A 3IIAA 4QMAA 2ZPAA 4BMHA 3SMHA 2KXLA 1J1LA 4O9GA 4AVCA 1J3QA 3PVBB 2IXKA 1WLTA 5I91A 3U0ZA 3CXQA 4R57A 2FQPA 3TO6A 1EY2A 1DGRA 1ZZ7A 1ZRCA 5KTAA 4N9HA 2VBQA 3KGLA 2IL4A 4ZU5A 3BU7A 3QB8A 4YYOA 1VKCA 3S6HA 1J3RA 2MHFA 4FAGA 1LRZA 2Z69A 2BL1A 3F8KA 3USSA 4YNIA 5CADA 4LA2A 1XRUA 1VJ2A 4OLLA 4I0AA 3KMHA 4UBRA 4Y49C 3VWEA 1Q2YA 5EFUA 2UY9A 2QVSB 4CAWA 3H9AA 3JVNA 5AVPA 3G3SA 3MGDA 2XGXA 4HVOA 1NE9A 2IXIA 4H7LA 4H6ZA 2OB0A 3PNAA 1P0HA 2P6FA 3RYOA 4CAXA 2ET1A 4META 2FSRA 2BSWA 5IB0A 3HT1A 3SHRA 5I8TA 4AQ6A 3GYAA 3G8WA 4CRZB 3R95A 5J8CA 3G7DA 2EVXA 1Q43A 3VHRA 3LA3A 2REEA 3IDBB 1OZPA 2R7HA 3D8PA 2ZCWA 4AQ2A 1KUVA 4KL1A 3OD0A 4EWDA 1MJAA 2ZW5A 3D0SA 1I1DA 1JUHA 1CX4A 1GQHA 1ZRRA 2GZWA 1XE8A 4Q0UA 1U6MA 3TE4A 4IETA 1RC6A 3E97A 4NVPA 3RPQA 3CJXA 5FDBA 4JWPA 2IC1A 4R8HA 1Y9QA 3H7YA 3NL1A 1XIXA 3KKWA 4YRDA 3F0AA 5J3UA 4E2AA 2B3VA 3E5QA 2ZW4A 1N71A 4CS0B 1UFHA 2DCTA 3ETQA 2UYAA 2K0GA 3EXNA 2B4DB 3M3IA 4FD5A 4EV0A 2AE6A 2FMYA 2FIWA 2EVNA 2ET7A 3U11A 2B9UA 3PLQA 3D2PA 2QDRA 2AJ6A 4IESA 2HJIA 3H7JA 4KU8A 5I0TA 3SXOA 2CAUA 4RD7A 3TTHA 4TLFA 5I0UA 1ZNPA 1Z4EA 3EJKA 3FFQA 1Z4RA 1ON0A 1NXMA 5F1RA 2R1IA 1ZVFA 1MJBA 2Q4VA 1YFWA 3OCPA 1LB2A 3LODA 4IEVA 2Q4YA 4HNYB 3EO4A 5FLIA 2Z11A 1WA4A 3CXSA 4XFFA 4PSXA 2ZXVA 3CLPA 3FZ3A 4XF3A 3LD2A 4WBBA 2HQYA 5LRSA 1U12A 2CV6A 1DZTA 3CEWA 4IF5A 1V0CA 3BJ7A 4KWJA 4MH0E 4MGYE 4ORFA 1H1MA 2GU9A 3KSCA 4LLOA 3WW2A 2G3AA 2X7BA 4F6AA 1ZZ9A 4KOSA 3LA7A 1CAUB 3BJ8A 3FXTA 4IEOA 4F7ZA 4MY3A 1QXJA 3D0JA 2B5GB 2ZW7A 2XL9A 2GC3A 1IICA 3FBUA 2B4DA 2UY8A 4HMZA 2PHLA 1YWKA 1Q5OA 4L11A 4HSLA 3RYPA 1EPZA 2FT0A 1VR3A 2B5HA 1FI2A 2C0ZA 2D5HA 4JVAA 1Y9KA 3JUWA 4XPLA 2Z2SB 2GC1A 4R3KA 1XEBA 2FE7A 4HZFA 2O1QA 1MK4A 3KCCA 3FWEA 2ATFA 3IWZA 5BV6A 4KVME 1HW5A 4X6RB 4JJXA 4PIYA 2O28A 4MGKE 4AG7A 4XETA 4JLYA 4Z07A 4D7SA 4KOUA 4HVRA 4XF0A 4NCZA 3DN7A 1EYBA 3R96A 4UWJA 3E5UA 1UCXA 2QMLA 1M4DA 5F49A 2O8QA 4MGZE 4HN1A 1IYKA 2HV2A 3T90A 3TT2A 5JQ4A 4II9A 4Q0SA 1B87A 3FHIB 3C3VA 3OF1A 3TNQA 1IB1E 4I2OA 4DINB 1CM0A 2GAUA 3C26A 4IEWA 3UKVA 4UWIA 4XPDB 1UIKA 3WR7A 3CF6E 4U9YA 3CL1A 3BLNA 4FD7A 5CNPA 4E2SA 2EUIA 4RS2A 1O3RA 2D40A 1FXZA 2KCWA 4E8OA 1RGSA 1CAUA 4LUMA 2E9QA 3SXWA 3P2HA 1X82A 4JTOA 4KOTA 3S6FA 2B5GA 1IPKA 2Z0ZA 4IEQA 4AVBA 2PC1A 2MNGA 4N9IA 4WVZA 2VXKA 1QSTA 5HI0A 1ZZBA 3N7ZA 2VZYA 3DL3A 4ONUA 3BB6A 4JTNA 1CAXB 3KGZA 3V8IA 4KORA 4Q0VA 2DXQA 2EAAA 4HNWB 4MY0A 4K8FA 2J8MA 1PUAA 2XLAA 4L8AA 4XFIA 5EZWA 5KBFA 1ZRDA 4YSFA 4IEYA 4Q0QA 1CAVB 2Q0YA 2JDCA 2JLMA 2IXJA 5CVRA 1RO5A 4KVXA 2D5FA 2H6BA 2GH2A 3H3ZA 1OD5A 3FE5A 4MUVA 1UD1A 1WK4A 4BIFA 3RNSA 4P9GA 4PIZA 1NE4A 1X8MA 3O14A 2P0WA 1M1DA 1QSMA 4L2NA 1O3QA 4I01A 2FXFA 5HMNA 1YX0A 4FBFA 3SCFA 5I0SA 2XHKA 1Z9UA 2BEIA 4JV4A 4XNHB 2H6CA 4ZU7A 1Y9WA 2FL4A 5GCNA 3DDDA 3R9GA 5J7MA 3RYKA 3S7IA 1BOBA 2OPKA 2VI7A 4MV2A 3QOPA 2C27A 2PTMA 1X7NA 2JDDA 3DSBA 3T9YA 4MGIE 3EQEA 1BO4A 3W91A 1CAWB 4X6QB 4MI4A 2P17A 4KOWA 1NZCA 1CAXA 2I00A 1CGPA 4LULA 3PZJA 3EC4A 1EP0A 2HKXA 3IGRA 3LZZA 2EA7A 4EROA 2BNNA 1X8EA 3ZDSA 1CAVA 4UXAA 3SCHA 1O3SA 3FIXA 4GULA 4IEXA 4QGNA 3TOAA 2WC2A 1UW8A 2Y0MA 4FT8A 4D7TA 4U5YA 3UKNA 4KUBA 3IDCB 1YK3A 3BPZA 1QSNA 3E5XA 2VZZA 4KOYA 1OMIA 1YHFA 5D1IA 3ZJ0A 2VECA 1CJWA 3F5BA 4LX9A 5J48A 4E2QA 1J3PA 4R52A 3H8UA 5FCCA 1PU9A 4KOVA 3D3SA 1YUDA 4HN0A 4DNCA 4XPKA 3BALA 2QCSB 3DNSA 1KZFA 1DGWA 2XLGA 4CYDA 3QACA 2WPWA 2FS5A 4QXKA 4PSWA 1CAWA 1SQ4A 2PAKA 2Y0OA 1YFXA 2P6GA 1QSOA 1B6BA 1XE4A 2I45A 3TCVA 3K9UA 1QY4A 3IBMA 1Y7RA 4UA3A 1S7LA 4LUKA 4NEXA 1FY7A 1NE6A 3CXPA 5BPXA 3LWCA 5LEJA 2VEZA 4X5KA 2OA2A 3QAHA 4M3SA 4FAHA 5DWNA 5I93A 5BXXA 4J3GA 4KVOE 3FX3A 3DR6A 2XKPA 3H1YA 3GY9A 3RZZA 2CGPA 5FPXA 2OZUA 4I49A 3JZVA 5JSPA 1RTVA 2B4BA 3ST7A 3VWDA 5C82A 4NSQA 1J59A 4CAVA 4QM9A 4KWLA 1RXTA 2D4OA 3H3UA 5LRRA 1FT9A 3FB3A 3TO9A 2PHDA 1XF8A 5C8WA 4MJ8A 3EFAA 2F4PA 2GC0A 4HBNA 5H84A 4QB9A 3WW1A 5EC4A 5F46A 4JD6A 3H1WA 1DZRA 4XFBA 1O5LA 4YARA 5KHHA 2JEVA 1YVOA 3U10A 4KU7A 3R1KA 1NMTA 4OAEA 5H86A 3EBRA 3H1MA 2V09A 5C6CA 1ZX5A 1LRHA 5KHIA 3OWCA 1L0CA 3GYDA 4MHDA 5ISVA 3TNPB 1YLEA 3NE7A 3E6CC 4QGMA 4KLVA 4PK2A 4R3LA 5HH1A 2XL7A 2PYTA 3M70A 1RUOA 1Q2DA 4YGOA 1TIQA 2GC2A 2BNOA 1YGHA 4UBHA 3P2FA 5C88A 1PM7A 1IYLA 2A4NA 3HIFA 3H50A 4RI1A 4BHPA 5FVJA 2PSWA 2Q0AA 3DKWA 3S6GA 4I02A 4R87A 1QWRA 4CRYB 4OFGA 2D4PA 4F0YA 3L2HA 2PDOA 1K4JA 3MZHA 3TOBA 4XFGA 1OFNA 2G0BA 4Q0PA 1XE7A 1R57A 1YR0A 1UPIA 4QUSA 4IUSA 1SEFA 1IPJA 4IEPA 1Q3EA 5E1RA 4UBGA 4ZU4A 2GE3A 4E0AA 3NVCA 2PR1A 2Q7BA 1O3TA 3NSTA 2WFPA 3ACLA 5FPZA 4EWAA 3I9SA 2Q1ZB 4EVYA 4I09A 5DWMA 2BYVE 2CNSA 1L3JA 4AG9A 4I0BA 4J1XA 4U9ZA 1S3ZA 4L89A 3HQXA 1I6XA 4M85A 4AB7A 3SCGA 4HVQA 4PK3A 1S7NA 2K5TA 2F5IA 1TQ5A 3E6DA 4MX3A 1YFUA 3W6XA 3BCWA 4MBUA 3NKTA 3W6SA 4Z82A 1MJ9A 4XF1A 5JSOA 3I59B 2Q04A 1M4IA 2WPXA 2CAVA 5FLJA 1ZRFA 5JR7B 3ES1A 3ROUA 5FQ0B 5J8FA 5E96A 1G6NA 2QJVA 1KUYA 4HKFA 4HSJA 1XMTA 2PQ8A 5LEKA 2K9ZA 1OI6A 1UIJA 3B8GA 3EY5A 3TO7A 4B5PB 2IXHA 1KUXA 2B58A 1RUNA 2OZHA 3OTFA 4XFHA 2OYZA 2CNMA 4ZBGA 4R9MA 1YLLA 3CO2A 3MDPA 3S7EA 1M4GA 2BUEA 3S6KA 3ES4A 2OH1A 4GS4A 3GBFA 1J4JA 2B8MA 4XEZA 1ZZ8A 4XFCA 2ARHA 1QXRA 2D93A 1VHSA 2OZ6A 2J8RA 5KHKA 1WGPA 2PR8A 2UYBA 4FD4A 2QIRA 4PV6A 1VP6A 2PAMA 3MPBA 3N4MA 1J58A 4IEZA 2R98A 4I3PA 2Q30A 4J1WA 5I0RA 2OZGA 3R9EA 3LAGA 3OGJA 2IXLA 1WWZA 4HLTA 4K30A 4Y49B 3SHPA 2VQAA 5EBVA 5I8YA
chains in the Genus database with same CATH superfamily
5FYZA 2WBKA 1NCQC 3Q9OA 4FOWA 4BK4A 4Q4X1 1ELLP 4CGNA 3RYRA 3AL5A 1LKNA 3G6JB 3CT9A 4JAAA 1Z7S1 3UY5A 1DYPA 2LM3A 3R4SA 2Y38A 3BVCA 2RMU3 2A5ZA 4OI1A 3POEA 4B5OA 3L9JT 4E2GA 1FOD1 4A3ZA 1IIDA 1U5XA 1S7KA 2ORZA 4QKBA 4XYXA 2B3UA 2ZAHA 3PGPA 4I3GA 1QJZA 3KVBA 1F5JA 3OUIA 1HLCA 4R9AA 4FO9A 4XFAA 2FIAA 2JDNA 4QX5A 4H89A 2ZOEB 3NJZA 1OUXA 2JDZA 3QH7A 3VBFB 5FRAA 1TEIA 1D4M1 2IL4A 4OHXA 4QQOA 2ZOFA 3S6HA 5GZCA 4OZOA 1ZG9A 2BL1A 1QF3A 2VBPA 1MS8A 3RMYA 2J1SA 3PEIA 2J1TA 5EFUA 5GM0A 4YGDA 2YXSA 3NWKA 4H6ZA 4YZ1A 2W1SA 1DHKB 3GYAA 5F9TA 1TVGA 1XYPA 2HH9A 4URAA 5C9AB 1HQLA 4DXZA 3O0VA 4L8QA 4BINA 4EWTA 3GHNA 4N7IA 4JDMA 5BNNA 1BK0A 2ID4A 3JB4C 3U11A 4XMIA 2CAUA 1RIRA 1H1AA 2Y0IA 4RQPB 2GMEA 1Y0RA 1NQJA 1ND2C 4YVSA 2XUEA 3O1MA 4IF5A 3V0BA 4HXCA 1S2EA 2WZ8A 5HV0A 1QNWA 1MPXA 2A1XA 4NRPA 4L11A 3RYPA 4BQ1A 2PHTA 3IWZA 4JJXA 2D6OX 1LGNA 5CEHA 4B8EA 4B4QA 2V8GA 3KLSA 3F95A 3MEPA 3AVSA 3C3VA 4IEWA 3AYAA 4HT1T 3HNYM 4UW4A 4E8OA 4JTOA 1QHDA 3GCWA 1QSTA 1VAKA 3DPRB 3KGZA 2W87A 3WOGA 1U0AA 2JKBA 1UU4A 4RN5A 4QPWA 1DZQA 4R4ZA 1EAH1 1CQ9A 3WXPA 2X29A 2C9KA 1JI6A 4AEDB 4AFBA 3S7IA 3VBFA 2HWC1 4BU2A 4C2XA 2W95A 4CCEA 1V6JA 3WF3A 3PZJA 4YW1A 3GZUC 2JDHA 2JE8A 3VDAA 1H2LA 5D8AA 3N9PA 4BQ4A 5FMOS 2OQ7A 2WC2A 5CAZA 5IWFA 1OBNA 3KD4A 4QWNA 1JZ3A 5L9RA 4UFXA 2VQTA 5CFDA 2E7QA 3ZMOA 2Z3MA 4DNCA 5FY9A 1KZFA 5GLUA 1W6NA 2YBPA 2YB7A 1B6BA 4G9SB 3ZVXA 2XVLA 4YW5A 3FLTA 2Y6LA 3LB9A 2D97A 5BNOA 4XURA 1AYN3 1D4VB 4FAHA 3DR6A 4JZ0A 1JYXA 1XPWA 2B4BA 5F2SA 4R9DA 3C7HA 4Y5TA 1XC6A 4A41A 2D3SA 3R1KA 2PLV3 3KV5A 4NFRA 1W6MB 4YZ5A 2UWCA 2ZX4A 3W5MA 3WCRA 1YLEA 4QGMA 4XTPA 2Z42A 4JX0A 4NGQA 1PM7A 5CNAA 3N3HA 1ULEA 1PZ7A 2JECA 5SV5A 1QWRA 1PM4A 4RSUA 5H9QA 1PGL1 1O3TA 1VBB3 2AEZA 5FYIA 4I09A 4JGZC 1KQRA 5HCFA 5C5UA 1HRI1 1AZDA 1RUC2 5E8AA 2RHPA 5JOYA 3KV9A 2OZHA 4FCAA 1G9DA 3S6KA 1M4GA 1Z8LA 2GDFA 2WINB 2B8MA 1BZWA 5A3NA 4XFCA 2J8RA 1H6XA 2X53S 1WGPA 2PQSA 4XAAA 3RZJA 1DQ6A 1V6KA 4JC1A 4CDWC 5I0RA 4CUCA 3PBEA 3OGJA 2ZAAA 1RXFA 2C4XA 3TEWA 4FFFA 3I59A 1UZZA 1RMU2 2R043 4R4XA 1Y3TA 2D6KA 3HT2A 3LACA 5D8NA 4XOGA 5JSRA 2ETEA 2HBUA 4M6IA 1GUIA 1TMF2 5CKMA 3NKGA 4LKEA 5JVVA 4RS5A 1V6OA 2QQVA 1NG0A 2GP3A 4COVA 4C90A 1T6GC 3AMPA 3KQZA 1S0JA 2OZJA 1ND2B 2DDUA 2R8VA 3NW4A 1AYM2 2DUPA 4PJYA 3RI9A 3VHNA 2VCMA 5JCTA 4PDWA 3VKMA 2RM23 3VD9A 5JXHA 3JTKA 3OY8B 4IK2A 2ZPAA 1EE3P 1DLCA 1XNAA 5JH9A 3AP7A 1TME1 3RRDA 1BBT3 3LIHA 5DMYA 3QB8A 4UYBA 2WT2A 2BPA2 2JBKA 2NM1A 2VBBA 4GB33 1W2TA 1HDQA 1K12A 3QAYA 4DPNA 2R062 4RHV1 4XHXA 2VZRA 4NIAA 1GSLA 3D0SA 1GQHA 1ZRRA 5ANQA 1NAEA 5ISLA 2AR6A 2AFXA 4TXWA 1C4RA 2WJSA 3MIFA 2ZW4A 1ODMA 2OX0A 4FPEA 5FKBA 3WUDA 2CIJA 3TOJA 2AE6A 3PLQA 4MVTA 2Q4VA 3ALQA 1F15A 1NA1C 5JXIA 5F7UA 4NR1A 4FFHA 5K0UA 2ZXVA 1LOBA 2F8HA 2HQYA 2X7BA 1JXNA 1C1LA 4KOSA 2DBNA 5T55A 2ZW7A 2GC3A 1NXD1 2B4DA 1N3OA 2BWAA 1PO13 1VR3A 3AX4A 4XPLA 1Y9KA 1BVVA 1IKPA 2GC1A 2O1QA 2A6WA 4A45A 1YQEA 5C3PA 4MGKE 5HVFA 1E5RA 1EYBA 1KS4A 4UWJA 2WNVC 3LSDA 3ACHA 1SLLA 4MFZA 2HWD1 5T5OA 2GAUA 4P4IA 4UW6A 2WAOA 4NHXA 2QZ2A 3ECQA 3MLLA 3OBTA 3HR9A 3MW2A 1X82A 1RUF1 2MEV3 4WVZA 1ZZBA 4Q7AA 4HNWB 3N5FA 1W8WA 5THWA 4UT5A 5IVFA 4P9GA 5A3WA 1EV11 1DQ4A 2JG9C 4QB6A 2VMEA 1VB2A 1YX0A 5I0SA 2OPKA 4Y5Z0 3MUY1 3PIGA 5DDJ2 1N1TA 3W91A 2SLIA 4JGZB 3WLUA 4QDRA 3D5OA 4FPLA 4IEXA 3POJA 5D1IA 1QMJA 4Y1YA 4Q4Y1 3MV01 2P3KA 2VMDA 1LCLA 4CYDA 3MLKA 4KGGA 2ZX1A 4D6QA 1IZ3A 3AXEA 4YZ3A 1PO23 1F2PA 3CBNA 1VIWB 3N7JA 1VBE1 5G20A 4CXYA 2WN3A 3M3OA 4M3SA 4MCPA 2J1VA 2X09A 1OQDA 4QDQA 1RXTA 2RS33 1IPSA 1OUSA 4Q4V1 4Y4YA 4CGOA 4QD2A 4KU7A 2X5IC 2WAAA 2AFZA 2VR4A 5HH1A 5DUXA 1AF9A 2GC2A 2BNOA 4UBHA 1IYLA 3B9IA 2Q0AA 2XWJB 4OFGA 5T5PA 5F09A 2YYOA 1RUJ1 1QOSA 2A3WA 4GH4A 2YMZA 4YLZA 1LOFC 4ZU4A 2GE3A 4TWEA 1SBEA 4H14A 3DF0A 4CRQA 1W04A 2Y6HA 3SISA 3MIBA 2ERFA 4J1XA 3AMHA 3VBOA 3BOWA 4E8DA 4LQGA 4M85A 4AEMA 3JD73 3W6XA 1SPPA 3CJIC 4JGYC 3LE0A 5FLJA 1W8TA 5E96A 4B5PB 3TO7A 1JUIA 1FPN1 2BUEA 2IQ6A 1LHOA 4M3CB 3I2DA 1JH5A 4NHKA 4PI0A 4K8RB 1RITA 4KI5M 1VAVA 2ZX3A 4RR3C 4P08A 2VQAA 3WY6A 2C5DA 1BEV2 4O23A 4X3RA 4BPZA 1QJY1 4ONWA 5CYYA 1CPNA 4NGTA 2XPJA 1GR3A 4ES9A 3B02A 2ADEA 3N9NA 2R072 4MFPA 2VQUA 1V9U3 5EYXA 1WMDA 3BN6A 2WS92 4NN0A 4YRHA 3OUHA 5J36A 1WW7A 1X10A 5E16A 1AL23 1ZZ6A 1V00A 1OPOA 2Z3OA 5BUVA 4QPIA 4XTMA 3H42B 5D8AC 4KUAA 3TEXA 3S6PA 1DQ1A 5BY5A 2WFF2 2VVDA 4Q5OA 2PA7A 4XHBA 2ZPXA 3IAQA 3JU9A 3S0MA 3PP9A 3U75A 4OADA 1H1IA 1OD3A 3SMHA 4QAWA 3PVBB 4R57A 4N9HA 5BNOC 1CVNA 2VOTA 4FAGA 2Z69A 4YNIA 3BTYA 5DS0A 1WCKA 4I0WB 5AVPA 1UN1A 4Q38A 2A7AA 4BE3A 2NZ9A 4OMCA 5J37A 5C3SA 3CJXA 2JG9B 2PE3A 2WABA 1GP6A 2ARCA 1Q8QA 1POV1 1JHNA 1US3A 2K0GA 3HQRA 4ZY2A 5EYYA 4M3CA 3M3QA 4Y4RA 5LCWL 3LMSA 5C3OA 2RG4A 4JQRA 5FZOA 3EO4A 2ARAA 1K5MC 4XFFA 4IE5A 3LD2A 2B7YA 4WBBA 3IO1A 1ASJ3 4UAPA 2VNOA 2A3XA 2JDAA 3PTYA 4MJ8A 4RYDA 2FE7A 4NROA 3KCCA 1Z0HA 3LDRA 2WUHA 3MPPG 3D7HA 1QDCA 4Q0SA 4IDZA 3TNQA 1XU1A 2C24A 4Y5SA 3UYJA 4MXWB 4EN7B 4A6SA 3JB8A 5G22A 5FZFA 2Z0ZA 3VH9A 3POWA 4ZHNA 2FD8A 3J8F3 4K8FA 2X5IB 4F83A 1LOAA 4R9CA 1R1A1 2LS6A 2YNCC 2JLMA 3VHOA 4Z2WA 1RUD1 5G04L 4YGCA 1VIXA 4BLIA 2PN5A 1GOGA 1O6UA 4OUSA 4W9YA 2BZDA 2XJRA 2H6CA 4FOYA 2ZGQA 4DRRA 4XXAA 3I3BA 1IHMA 1QJX2 3I2KA 3NV2A 1OLME 1TKJA 4XJAA 3M2MA 3DLJA 1OURA 3PB4X 3AFKA 3K51A 2BNNA 4DEVA 4XJWA 3HQUA 5FWJA 3CJIB 1W03A 3BPZA 3LCPA 4JGYB 4PDWC 1GLHA 1HJFA 3H8UA 2V8VA 1WD4A 4CU9A 2W47A 2ZEFA 5AC92 2WPWA 3LEKA 1ALYA 3KT4A 5IFTA 2VW0A 3LWCA 2QQWA 4M0NA 3HNMA 3ZSLA 1NY72 2WT0A 3EMRA 3VWDA 1REDA 5IVVA 3TO9A 4GMP3 5LA2A 1X36A 3F2ZA 1UZVA 3T0DA 4P5YA 5F3IA 2ZEHA 1NCRA 5KHIA 3N9OA 4PLMA 3TNPB 5GLVA 5KXCA 2DPSA 3D7GA 3O5SA 4MO3M 4CA9A 4LIUA 2W68A 4XUPA 4N53B 3N9MA 3VKNA 3SH5A 1FATA 4QUSA 4UBGA 1QQP3 2WFPA 4M6HA 4OI0A 4EWAA 4NJQA 2Q1ZB 1IKQA 5FFOC 2BYVE 3PJQA 2QQUA 2PJ2A 1QMUA 4ASMB 4L89A 3HQXA 4E4ZA 4MX3A 1PK6A 4ZPIA 3AXDA 1YQ2A 4TLGA 5JSOA 2HWE2 5GALA 4HSJA 5A7WA 3MLJA 4Z2AA 3OTFA 2HWB2 3GBFA 4BQXA 1JODA 3P3NA 4A39A 3N4MA 1XXNA 1DQ5A 1FNOA 1QSMA 1ZRIA 4YM0A 1ST8A 4MFJA 3UV9A 4LKFA 1XOVA 1GZ9A 3L2YA 3ZLIA 1CJDA 1WW4A 4JXQA 3OBAA 1SQHA 1PIV3 5L73A 4IL7A 2FZ1A 1G86A 4COWA 5L36A 3B93A 3AKQA 2PCUA 4AQTA 1CZSA 1ZYBA 2G3TA 2PJ7A 2N7GA 3BHXA 1VBC3 4YFJA 2ZW6A 2WKKA 1LHWA 1I3HA 1UXXX 1REEA 4LHNA 1JW6A 2Z79A 1S0IA 1K5MB 1VE0A 4MSVA 4AEJA 1LESA 4Q4X3 4NRMA 1LR5A 1O4TA 2AUYA 4XDOA 4LTAA 4FVVA 4O9EA 2A6YA 4YVWC 2BOJA 1PMIA 3IDAA 4BWOA 1LAPA 5LB6A 1HQWA 2IXKA 1HIXA 1NUKA 2E31A 4CAFA 1ZZ7A 1MS3A 4UFKA 1ZA4A 3KCYA 5A6ZA 3KGQA 2DU0A 5DAVA 5FZ4A 5F3CA 1H30A 3SI0A 1TNRA 2DUOA 2W2IA 2JXAA 4NWWA 5FZMA 3ZM8A 3H9AA 1NE9A 3ZYRA 2J1RA 1OKOA 2BJSA 3HBZA 2C26A 3D8PA 3ZN5A 4BM8A 2RR13 1JUHA 3NV1A 1AX2A 2A6XA 5FDBA 2GU2A 4FQZA 1C5IA 2I74A 5A7QA 4GH4C 1D4M3 2B9UA 2QDRA 2YNDA 1XRYA 4CP9B 2YPDA 5HXMA 1RVF2 3VBOC 1QJU1 5BNPA 3GALA 3J26N 3T4HB 3OOXA 2WQZC 3AP5A 5KWRA 3ACIA 2P1BA 3GXUA 4CDUB 1OH3A 5ANNA 4MY3A 2B5GB 4LPLA 2OXBA 1IICA 4JVAA 2J1AA 2D5HA 3I3EA 1W90A 4R3KA 4HZFA 4KVME 2LW8A 4CE8A 1NOVA 3B00A 3PB7X 4I30A 2V5DA 1MZFA 1PX3A 2W08A 4EN6B 1F9KA 3AMNA 3M4FA 1O3RA 1D2SA 4N9IA 4LQRA 4WV8A 3IM0A 4Q0VA 4GZ9A 2J8MA 4DXTA 4CU6A 1CAVB 4Q26A 3HN1A 1OVSA 5FYVA 2B9VA 5ACA1 1KRIA 5A3UA 4WVWA 2Y6FA 3RNSA 5FR3A 5A7NA 4CDXA 1O8PA 3WNOA 5AG7A 1RUH1 4QPIC 1BOBA 1ENQA 3K75B 3OUJA 3M8LA 1BK1A 3Q8AA 2EO8A 1CAWB 1CGPA 1W28A 2VTXJ 3BGAA 3LFMA 1ARMA 1AVBA 3AMQA 2Y33A 3BIEA 3GLJA 4CCNA 3TOAA 1VHOA 4FFIA 4D7TA 5DZFA 4D8MA 4NGNA 4BQ3A 2KR2A 1QGLA 5FIXA 2D6MA 4AI2A 4OMEA 3VDBA 3WNMA 4ET7A 3UK9A 4QPGC 4CGPA 1DQ0A 3OPWA 3LDKA 5GLTA 2VTFA 3QACA 1VAMA 1EAH3 1UYPA 2Y0OA 3FUOA 5FJKA 1XYNA 3OYWB 2WQ8A 1T6BX 4OUEA 2BBAA 1FNZA 5DWNA 5JXJA 1Z78A 3RZZA 4OULA 2DTYA 4WM7A 1VLNA 1YW6A 1AYM1 2ZMLA 3KASA 4YU9A 2XJPA 4CP9A 5LYFA 5F46A 5EC4A 4JD6A 2FDIA 1O5LA 5A32A 1YVOA 1UX7A 1KITA 4ZI6A 3IIBA 3VDDA 1YI9A 1LRHA 4F9VA 3NE7A 5T52A 3ZYHA 3E6CC 5K8OA 4YGOA 3TWIA 3H50A 5F5AA 1HV0A 4ISQA 5A3LA 1U5YA 1XE7A 3H0OA 2Q7BA 2VUAA 3RZKA 1FNYA 2XWBB 4U9ZA 5F5IA 1PVC1 3KS7A 1IQAA 4OQ8A 4YVWB 3ILNA 1MJ9A 3U4XA 5EQUA 1W8ZA 2D6PA 1WZXA 2K9ZA 3B8GA 2DF7A 2B58A 1AXZA 4OC2A 4A30A 1W6OA 2ZGLA 1XJOA 2AEYA 4AI0A 3SI2A 8CPAA 1N1YA 5F2WA 2ZGSA 1C1FA 3R9EA 1UO9A 2ORXA 2JBJA 5JOXA 1BHGA 4J25A 4LT5A 4NXYA 2CDPA 3SEEA 5KHGA 1B35A 3WW4A 4DJLA 1IY7A 4YG0A 2Q5TA 1RL3A 2D6LX 1HRI3 4PIXA 1QSRA 5HV4A 1OLMA 1MZ5A 4LEJA 1JWQA 5AVAA 1A6CA 3VZOA 4XPDC 1O7FA 4YM2A 1NSAA 2Q44A 1BLLE 3HEIA 3K2OA 2XLFA 4JHZA 4PF5A 4CCMA 4BD9A 4LK6A 4KZTA 1CIYA 2UWBA 4GJYA 4CEWB 1KDMA 2Z3LA 5JAXA 5FZLA 4XC9A 1JZ2A 4YGBA 2VMGA 1R64A 1GOHA 5FWEA 4NJ4A 4Q36A 2HEYF 3VHPA 1C28A 3LEGA 1S0CA 2VZ3A 1PZ9A 5FZ1A 1EY2A 3NMBA 2ZTNA 1R083 3KGLA 5DDJ1 2JKXA 1Q2YA 1ULOA 5A7PA 3H8OA 5CZKA 2R6QA 4QDSA 4WZFA 1NKGA 3T09A 5I8TA 1V6IA 3VHRA 2PVWA 1NCRC 3BXMA 1GYKA 2QQLA 4HFSA 3AFGA 3ZSMA 1AYN2 4NGPA 3NV4A 2GREA 5J3UA 2BTVC 2IZWA 2VD7A 4TWTA 4IGPA 5JGFA 4ZY0A 2DTWA 1TME3 5FZ8A 3HMYA 4UCPA 2AFWA 2PLV2 5I0UA 4LBQB 3FFQA 4GIQA 1ZVFA 2EXJA 5LBFA 3GDBA 5F39A 1PK6C 3ACGA 3FEDA 3FZ3A 1F4AA 3I2GA 5LRSA 3CEWA 1DZTA 1JYTA 1PVXA 4RHV3 1ZZ9A 2WSAA 4QPGB 3FXTA 4F7ZA 4PQAA 1Y7EA 3D0JA 1MQTA 4Q4W2 3O1TA 1Q5OA 3Q8EA 4KQ7A 4UW3A 5LRKA 5C7GA 1NLSA 4HK9A 2PRQA 3W5NA 3IAPA 4LBKA 4FAIA 2W1UA 2AFUA 1OOPC 2YBSA 5DUVA 3C26A 2NLRA 3AK0A 3IPVA 5CBMA 4R9BA 3Q8FA 2HWF3 5HVHA 1YJLA 1JQGA 2CXAA 4HKWA 2EAAA 2XLAA 3GCXA 5EZWA 5KBFA 2FVGA 4L9BA 5J09A 1LAMA 3I2OA 2CYFA 2NN8A 4N8MA 1MEC1 3DDDA 1HN1A 5I0DA 2R042 1I1EA 2EALA 3EQEA 1BEV1 1JZ7A 2PJ0A 2EA7A 2ZJCA 1X8EA 4KS9A 4S2HA 5EHDA 2HC9A 4XUOA 1OKQA 1ZLHA 4QHOA 4P00B 4KOYA 1DDLA 2WS91 3KQRA 4JKKA 2JDUA 2E63A 2JB8A 5CKQA 4AHYA 3BALA 4DUKA 2WR9A 3ILRA 3IBMA 3A21A 4NHMA 3B3TA 4OHZA 2VEZA 2ZGRA 2ZXQA 1OXCA 2UU8A 2XKPA 3GY9A 5FPXA 4XBLA 3TEZA 1MZ6A 4D69A 3ST7A 2WFF1 1F31A 2JIGA 2HB6A 5FZ7A 5LRRA 3BI0A 5DZGA 4NRQA 4LBQD 2VCCA 4CYNA 2JWPA 4FSJA 3WNLA 1BBT2 3BUCA 2R30A 3THDA 3OWCA 1PGW2 2CSGA 4R3LA 4Q4Y3 2F7VA 4LK7A 5FVJA 4GB32 4I02A 4L92A 3ZSJA 3MHZA 1A3KA 4RL7A 1SEFA 4IXLA 4PCRA 5J98B 1W6QA 3NSTA 1OH4A 5BNPC 1VBE3 4QB1A 3I9SA 3VBHB 2CNSA 4E8CA 4UEFA 3NKTA 4YG6A 4IGOA 3ZFEB 3MW3A 3ES1A 4HKFA 4PHZA 1UIJA 2CNMA 4ZBGA 3CO2A 1PMJX 4UCMA 3ES4A 3B2YA 4FTBA 2D93A 3WX5A 5DAQA 1C57A 1DFQA 1UMZA 1UZYA 3J7LA 4OIWA 4NIDA 5C4WA 3I2JA 5EV7A 4COZA 1UOBA 4CXXA 3LAGA 4K3UA 1WWZA 1RUJ3 4BQ5A 3GZAA 2FCKA 4IV1B 1YIFA 1KS5A 1PO12 2YGLA 2JD4A 3PVNA 3TN93 1W39A 5GKAC 5K8SA 3INAA 2JIJA 2OR4A 4H2KA 2C6SA 3ZN6B 4IEUA 4CPBA 4CPBD 2P6EA 2PJBA 3WT3A 4IE7A 3D82A 3OPZA 4LA3A 2A73B 1YREA 1M06G 5L9BA 2MEV2 1HB1A 4Y22B 1V6MA 4XQDA 3VBSA 4GKXA 2Z4FA 3VDCA 4DZGA 4XF9A 4PXCA 1N1VA 3UGFA 4LBLA 3LQCA 3NNMA 2ATRA 1YVKA 2ZEDA 4QGLA 4FXGB 2ANPA 2QUOA 3SJXA 1GP4A 1WMXA 2AREA 4QQLA 3HOBA 3APBA 1Y7BA 5JOWA 4P4BA 2YPJA 2FDKA 5KTAA 1QJX1 2ZA9A 1HB2A 4KH9A 1V6NA 1OOPB 2WSUA 4OQ9A 4AFMA 1AR61 5LY1A 1J84A 3WZ1A 1Z5RA 1UMIA 4H7MA 4ARYA 2OB0A 4Q1PA 4K40A 3HJRA 1UY4A 4B1MA 1CR7A 3SQOA 1WA6X 1RYYA 3MFAA 5J8CA 3G7DA 5JZGA 2REEA 1UL9A 5FZ0A 5B4XA 3VDDC 3T2TA 1PO22 4KL1A 1MJAA 2VOWA 1U6MA 1S0GA 2IC1A 2X05A 5L7OC 2PJ4A 3KV6A 2RS32 3KB5A 4CEYA 3W21A 4RGAA 1S1AA 1NY71 2AJ6A 2WNUA 1G9CA 3TTHA 2RJKA 1ZNPA 1I9RA 3EJKA 1NXMA 2RE9A 2ZEGA 2I07B 3IIIA 1XNKA 3AZZA 4HG6B 2G3AA 3A7QA 4KG0A 2VW2A 4F6AA 4A32A 1RJ8A 5CFCA 3PUIA 4QQPA 3PL0A 1F4HA 5DWMA 2WRAA 4TTGA 3D6EA 4BQ2A 2AFMA 1AR92 4RN7A 2ATFA 4X6RB 1AX1A 3RI8A 4AGGA 2DV9A 2XHNA 4HVRA 2FDGA 2BV4A 3JD72 2RVAA 1POV3 4HN1A 3TT2A 1WWYA 2JDMA 2ZGNA 2ZEWA 2XMLA 3TBDA 3WF4A 3ZOIA 2KCWA 4LUMA 4MFLA 5GZEA 3DL3A 5FZHA 4JTNA 2HWE1 1JZ5A 3UESA 2KA3A 1UQXA 4RUHA 2HWB1 4KVXA 2D5FA 2H6BA 4D0QA 4BIFA 1POQA 4L2NA 4IE4A 4QX1A 1F57A 5GCNA 1Y9WA 4ZU7A 3RNZA 1O59A 3RYKA 2C27A 2ZOGA 5F37A 1NZIA 2I00A 1V9U2 2HKXA 3WC5A 2V72A 3FIXA 3EYPA 5IVEA 3ZFGA 1YEWA 1MS0A 1AL22 1Q8SA 3PUSA 4UIBA 2ZX2A 3RGBA 1Q8PA 2RS52 5CG9A 3B3WA 2CTCA 2XLGA 4ASKA 1RUD3 2XG3A 3LFIA 1Y7RA 5BWAB 2ZBJA 1S7LA 3I2IA 4CCKA 4KSFA 4J3GA 3GBWA 5GJ6A 4UF0B 1W9TA 2RV9A 1TF8A 4CCCA 2YZ4A 3FB3A 3HD8B 2XH6A 4RFRB 4XJ9A 3WW1A 3WP4A 2O53A 1DZRA 2O4HA 4XFBA 5GLZA 1ULDA 2V09A 3H1MA 4V2VA 4NGMA 5HXDA 4NMIA 5ABJC 1YGHA 4K20A 3FLPA 3MIEA 4Z92B 3WP6A 3P5BA 3S30A 3CZXA 4IEPA 4EQVA 1FT7A 3AZVA 4QQ2A 2PR1A 2VZ1A 1WLDA 1RUE1 2UURA 2WN2A 4ZX8A 2CTBA 2XEIA 3BI1A 4AI8A 1BXHA 5JIAA 2K5TA 3VBRA 1Y43B 2VOKA 3HBKA 1MACA 1MQTC 2I3CA 4A44A 2Q04A 3IDEA 1AR72 2XOMA 2R0FA 4A4AA 2IXHA 3FC0A 1NLQA 4R9MA 3MDPA 2Y6JA 2ARHA 2BGOA 2H0BA 1R43A 4ZX9A 1ASJ2 1RVF1 2OZGA 1DU3D 3S57A 3CHXA 2PJ6A 4QBJA 4KSAA 5I8YA 5LA0A 1RUI1 1W0OA 1TKHA 4Q1RA 3BPSA 4BH9A 4QKDA 2CGOA 4FP3A 5G05L 4C7IA 2ZGOA 5KC6A 4UI9L 4IV3C 5FZ6A 2V73A 1QKQA 4XDQA 5L7OB 1GQGA 3FBYA 4DXSA 1UY3A 3QBQA 4XIOA 1SFNA 3VKOA 3RFRA 3J8F2 2GNTA 3DUIA 3A9LA 5FOBB 5JI7A 2VPVA 2BP6A 4RA0A 4B14A 2V4VA 4FPGA 1NYWA 1OF4A 4XABA 4QPYA 2I79A 3HPNA 3KHBA 3AKPA 3IN9A 4QMAA 1J1LA 2F6BA 1C8NA 2Q8OA 4XXPA 3SC7X 3VD7A 3ISZA 2Q43A 4PF1A 1IOFA 1XRUA 3POIA 2DCKA 4I0AA 3AKSA 1H8TB 2P6FA 3RYOA 4CAXA 5EP9A 3SHRA 1UY2A 4XCBA 3LA3A 1BYHA 5C8CC 2YV8A 4LBOA 3ENRA 1D0HA 2YY1A 1JYIA 2X10A 1VRBA 4IETA 3CIHA 3NH4A 1FYUA 3HAGA 5J1XA 1W0NA 4R8HA 3KKWA 1G8WA 2R32A 1QNYA 4HETA 1ZBE3 5FZGA 1APNA 1O4ZA 5I0TA 1LHVA 3MFCA 5H9PA 3B3VA 3K77A 4LR4A 4BXSV 1YLOA 4B12A 4CZSA 4XPVA 2D43A 1V0CA 5A33A 1HB4A 3PRTA 1D0GA 2VH9A 2XL9A 4HSLA 1QQP2 4IAVA 3NNGA 5AG5A 3FL7A 4PIYA 2O28A 1COV3 4LJHA 4LITA 2XJVA 4N90A 2CDOA 4YW7A 1WW6A 2QQNA 1CBXA 5DABA 4II9A 3BTZA 1ACCA 3WR7A 1BVP1 2J7MA 4BJ0A 2E26A 1VHEA 2OQ6A 1FXZA 3WNKA 4KOTA 4GWJA 3P2FA 4AVBA 1QJU3 4OP4A 4Y3OA 2POKA 4MG2A 4OC1A 3H8GA 5E6HA 5A80A 4IE6A 4AG4A 2NYQA 5ABJB 3H3ZA 2Q8EA 4AI1A 2PHXA 2HEWF 1W06A 2WZNA 4W65A 1DF0A 2JEWA 5JR2A 1M1DA 1OSGA 4FBFA 4JV4A 1XFOA 3GF6A 1UMHA 3KHXA 2Y8KA 1AXKA 3AYEA 2XEJA 3BKZA 1PIV2 1S0EA 4A7KA 4X8PA 4UWDA 4EROA 3RZGA 2QFEA 4QGNA 3MIDA 3THCA 5JOZA 2ZZJA 1VBC2 4EJRA 4QU2A 4U2AA 2VOXA 4DUWA 4UW5A 4ZZ5A 4HN0A 4OHWA 4UEZA 4QKNA 5ACA3 3GHMA 3USUB 3TCVA 2VQ0A 3B5LB 1QY4A 2DBIA 4Q4X2 1JOPA 2ZACA 3QAHA 1RUH3 2BFUS 3FX3A 1JYWA 3NH5A 3JZVA 3V0AB 4IGQA 5C82A 3SH4A 4CAVA 3OGGA 2D4OA 2J1EA 2RS13 2QQMA 2F4PA 2ZGKA 2VZVA 4FOVA 5A3TA 4IV3B 3SKVA 2V8HA 3ZIXA 2A6VA 3ZSEA 5FPAA 3GYDA 1H9WA 1DP0A 4LHLA 3ZFFA 1P8JA 1RUOA 2G9DA 2YU2A 5A7SA 4BHPA 4CEYC 4CDQC 1H4GA 2D4PA 2LRPA 2I2SA 4JRLA 2YFUA 3ZDVA 2BVVA 3T2QA 2RR12 2J9AA 1C5HA 5LW9A 2PHWA 2DVFA 4MXUA 1OA4A 1O8SA 4AG9A 3FH4A 1GZWB 1S7NA 1TQ5A 4MGTA 5CFCC 2OW4A 4OHVA 4XF1A 1UYZA 1ZRFA 5FQ0B 3JBG1 4AGVA 4B6ZA 4PI2A 1SDWA 4QHZA 2OH1A 1YMEA 3VBUA 3WV6A 4J1WA 1JU3A 4HLTA 3SHPA 4EN9B 3CU7A 2VZTA 2BNMA 5FO8B 3E0KA 1RB8G 1S5KA 3M3EA 3KT1A 1CZTA 5FMOL 2VZOA 5C8CB 3EHKA 1PVC3 4Q4W1 2GIVA 4WVMB 2ZKLA 4NHYA 4N43B 1XU2A 2IWGB 3KI9A 4LBMA 4LLFA 4YGEA 4X8NA 4F8AA 1IOAA 3IWGA 4CCDA 1GWKA 3C7EA 2IXCA 2B45X 1CX1A 3QLQA 4Q2FA 2DFCA 2X8KA 4FUUA 4BCUA 2CY2A 1GFF2 3FMGA 4HKOA 1SLCA 3W58A 2R49A 1RHI3 3RJ2X 5DUWA 4AWDA 4C2ZA 2DWRA 2ZHNA 4GWMA 1OLRA 3TFYA 2GSYA 3NAPC 2P3YA 2VCBA 3ACFA 4KOXA 3PDQA 1ZLIA 1IS3A 1J3QA 5J96B 2R041 3D3AA 2D3RA 3AP4A 5LBEA 1CESA 1ODNA 3FFZA 3T8WA 2YDEA 4CVUA 4HVOA 1ND3B 1GKBA 5IB0A 4A2ZA 1EAH2 3OD4A 3D7FA 2ZMKA 3ZKUA 1H4HA 2F4LA 4M0HA 1RC6A 1XIXA 2PJ3A 1BJQA 2AACA 1NLRA 3AM2A 2WUUA 2P37A 3GIUA 4FD5A 5DDJ3 4A31A 1H6YA 1LB2A 1X12A 3K4AA 5C9AA 5FK7A 4E4HA 1BBT1 3CXSA 3VBRC 1WMEA 1PGW1 3GUXA 1LHNA 4LLOA 1CAUB 1NCQB 5FPLA 2PHLA 4GB31 1OQEA 4QXBA 5BV6A 1WCDJ 1S55A 4RQPA 2ENRA 2E53A 2EIDA 5FREA 4AG7A 2EK8A 4Z07A 3WG1A 5IK4A 2JG8C 1ZO0A 5F49A 4M4PA 3KVAA 3MF9A 1CONA 1Q8OA 1IYKA 1JZ6A 5FXZA 3BLNA 5CNPA 4A7ZA 4TN7A 3H8FA 4IEQA 4URTA 1N3QA 3T08A 2VZYA 4V2WA 1CAXB 2PELA 3SNMA 3WNPA 2D3PA 2VU9A 4FPHA 4LHSA 1V0AA 1UD1A 1PGL2 4CDQB 4QQHA 4WM8C 5F3GA 1X8MA 3WG4A 4ZZ8A 4AHWA 3WDVA 4M3CE 2VUDA 3DPRA 4X6QB 1HRI2 3RZAA 2E7AA 3LZZA 4C7HA 1DIWA 2ZEYA 4UXAA 1W3VA 4AQSA 4U5YA 2YGWA 4KUBA 3IDCB 1QSNA 3KCXA 5AG6A 4FBEA 1HRV1 2W3JA 4BB3A 4AEDA 3FJUA 4XPKA 2MEV1 3ASIA 2FS5A 4OVEA 2XJSA 2GNMA 3K9UA 3BI3A 4LQ6A 3S9LA 1NE6A 1MEC3 4BK5A 5LEJA 2ARXA 3IFEA 5BXXA 3H1YA 2CGPA 4CP1A 5JSPA 4CP0A 2EIBA 4BBHA 4NSQA 2NYYA 1W8FA 3K48A 3O0WA 3C7GA 2FZ2A 2OIIA 2B46X 2AZ5A 3WUCA 4CUAA 1R082 4YARA 2WZR3 4OAEA 1NMTA 3EBRA 3OEAA 5FYTA 5FY1A 4KLVA 3IMNA 2DUQA 1C8M1 1K42A 2D98A 2Y60A 1ENRA 3MZHA 5GZFA 1R57A 1YR0A 4LO8A 3NVCA 3T4VA 3B01A 2ADDA 5FZIA 1GNZA 5JWPA 3ATGA 1U5ZA 3JRUA 4B1LA 5AFBA 1W6MA 1VBD1 2PJ1A 3LGRA 3SCGA 1CPXA 2IMOA 1N47A 1SCSA 1GNYA 1TME2 2TEPA 3D7DA 3CMGA 1LEDA 2XBO1 1M4IA 1XNTA 5LK5A 3BODA 1KUYA 4NAMA 2ZEEA 2RS31 2LTNA 1VHSA 3ZYPA 4JQTA 1S0FA 3N35A 5E89A 3JUUA 4RHV2 3ELNA 1RUG1 1TE1B 3U1XA 4M00A 4B4RA 5JPHA 4E4SA 4WZCA 2YC0A 1GANA 2BWCA 3LEMA 1IS5A 3WD5A 2CHHA 5CPAA 3ZYIB 2H0VA 4EMEA 1AR91 5JPNB 2G9FA 4Q8KA 1LEMA 5JXGA 3OGSA 4Y1ZA 2NQYA 2HWF2 4B7EA 2XVKA 3FNCA 4A38A 5CBLA 4B13A 5JDBA 4LUAA 3FJSA 1EUTA 3WF1A 3FRMA 2C6CA 1I12A 2EXHA 2XKOA 5FBZA 3VD3A 3D4UA 3AP9A 4L97A 3D2MA 3P3PA 4HNXB 4G1PA 4C1XA 2PHRA 4QC6A 4DB5A 1R091 1REFA 4XNHC 4B29A 3LIGA 4O65A 3A22A 2KXLA 2FQPA 4MCSA 4MLOA 2JG8B 3BU7A 2DFBA 2HEVF 2CWSA 1VKCA 1ND2A 5JI9A 5DAPA 2MHFA 2CF4A 3MI8A 1LRZA 3F8KA 3KR5A 3USSA 4G4FA 4XIKA 4CCLA 3T1MA 4A3XA 3POGA 1POV0 2ET1A 3B69A 4META 3URFA 3HT1A 2WZPP 2E6VA 3OY8A 1W6PB 1OZPA 3IU1A 2RS51 3WHUA 1I1DA 4P9JA 2W94A 4GKYA 4CUGA 4NVPA 4WM8B 3OSDA 3F0AA 4K21A 2WL1A 2GMPA 5FPBA 2ET7A 1WBLA 2R1BA 3SXOA 2SBAA 1FV3A 4Y20B 1E5IA 3PURA 2Q4YA 1AR63 4Q4Y2 3WT4A 4FOQA 3CLPA 1UZ0A 4CDWB 4KBZA 3VUOA 3V38A 5T5LA 1X50A 3IU2A 1CJPA 1MK4A 5A27A 3AP6A 4EYUA 4KOUA 5LASA 3KWVA 2O8QA 1Q7LA 3OG2A 3RO0A 4PBOA 5IJRA 5BNNC 4RS2A 1BPNA 4F0YA 4YW2A 2E33A 2E9QA 3OBRA 3DEMA 4KORA 1AR71 3V7ZA 3GJBA 5JMOA 4IEYA 4Q0QA 1HJGA 1GBGA 4NUBA 1RUJ2 3UT0A 2W0XA 4YVSC 5KXDA 1WK4A 3U14A 2NSMA 3UJQA 2QQIA 5FZ9A 5K7PA 3I1UA 3GGLA 2XHKA 3FMCA 2AFSA 3TN92 3MO4A 4Z65A 1OA3A 3RZMA 2PTMA 4A94A 4QX2A 2XQXA 4G3YC 3OBZA 1MVEA 3LDBA 4CGLA 1UYYA 5FY5A 3JCIA 3ZIWA 1QU0A 3D3SA 3DYMA 4FTSA 3DNSA 5IB9A 2JJ6A 4HPKB 2HWB3 2VMIA 5FMCA 3J8F1 1XE4A 2I45A 1BKZA 4JGZA 3TAYA 2WYFA 5BPXA 4C0BA 1YQ8A 3VZKA 3I3MA 4UFWA 3J7NA 4NPMA 2GC0A 3VBFC 2A3YA 1VMHA 4QX7A 3SJEA 4GXHA 4MHNA 3U10A 1LJ7A 1ZX5A 5FO7B 5EWSA 2JENA 4GD4A 1NA1B 3ZMNA 3NJXA 4CAEA 2EF6A 4XFGA 1OHFA 4LHKA 5FJHA 5CFDC 2XJUA 4E0AA 4HL0A 1Z2LA 5ERLA 1WCQA 1VBA2 2D44A 3RS6A 3LF7A 2GALA 4UFHA 4I0BA 5FMBA 2WNVB 2WO1A 2K2SA 2LALA 3R05A 5J8FA 2QJVA 4KGQA 2VMFA 1KUXA 3KQ4B 2GP5A 4RQPC 4GMP1 1QH6A 2XVGA 3WR0A 1KXGA 1KFUL 3TRSB 2B4KA 4A33A 2UYBA 2CY6A 1SLIA 3RG0A 3POYA 2PVVA 1J58A 2VVFA 5T50A 2RB7A 3NH8A 5IATA 4P6YA 2ZGTA 4P14A 4GWIA 4MFQA 2P4EA 5APAA 1RUE3 3M7AA 4UFVA 4B5PA 1AR83 1NSLA 3AZYA 3I4IA 3PTRB 1UWWA 4GA9A 1UU5A 5I8SA 7CPAA 3PHMA 3ZKYA 4BXFA 1JN2P 5IW0A 2C1FA 5M0TA 2CNTA 2BW8A 2J8NA 4QX8A 1TG7A 2HYXA 3B7IA 1N1SA 2G19A 3I54A 1O5UA 4MZUA 2ZEPA 5I4MA 1SLAA 5CG8A 4IE0A 5K8NA 2MPFA 1M44A 1UZWA 5A6QA 2BERA 2ZABA 1RUI3 4Q29A 5T3NA 1GHEA 2F17A 3I3DA 4AEDC 4RGKA 5EMIA 2AGSA 1OA2A 5IAXA 3U0ZA 5I91A 3TO6A 3I2FA 1ZRCA 1LHUA 2VBQA 4XUNA 3T1LA 4YYOA 4YW4A 5CADA 1ENXA 3ZXKA 3KQXA 4KG8A 5D21A 5BNNB 1CG2A 1LOEA 1XSRA 2XGXA 4H7LA 2WLQA 3LKJA 1RUD2 1YCIA 3RZHA 2ZX0A 4RS5C 2KM2A 2J22A 1VBC1 3G8WA 4ZGYB 1LECA 2JDPA 2BU9A 3EB7A 1OLQA 4NPLA 3HN3A 1F5FA 3S9MA 1GZCA 1QOOA 4YVSB 4AFAA 3CZJA 2JDKA 3V0BB 2PJ5A 5HBAA 3OEBA 1YQ5A 2FIWA 4COUA 2VE1A 3MUZ1 4IESA 2HJIA 2QJ8A 3H7JA 3HLPA 4GQ7A 2QQKA 4ITCA 4AEKA 4IEVA 1KJRA 3SITA 5FLIA 5JMCA 3E1F1 5A6XA 4XF3A 1H0BA 4RR3B 4HKLA 1E5HA 2JG9A 3ZR6A 3LA7A 3BJ8A 5B4NA 3O1VA 1NQDA 3AMMA 3NFZA 4HMZA 2FT0A 4NOTA 3VZNA 4JYWA 3FWEA 2VNGA 3NQHA 3FHAA 4D7SA 5F6LB 2RR11 3AKRA 1ELMP 4MGZE 5JQ4A 1ZM1A 5J1QA 1B87A 1UIKA 3CF6E 1STMA 4OIDA 1HXS3 3SXWA 2PC1A 2VXKA 1OC1A 2ZEMA 4P9XA 4DO0A 5D8AB 2E7TA 1ZG7A 5K0UC 1UKRA 4NJRA 4PIZA 1I5PA 3PMEA 4MXWA 4R76A 5CFDB 4W50A 3LPGA 4Z1VA 1W6NB 4BISA 2W91A 1QEXA 4MGIE 3WF2A 5A1FA 4P44A 3NJYA 2P17A 2ILMA 2X5IA 5JM6A 4NO4A 3KF5A 5BNOB 5LYLA 4IHMA 4EZHA 1UW8A 1RJ7A 2VECA 1J3PA 1PU9A 2CNAA 4KOVA 1LOFA 3ZYFA 4P4EA 2FDHA 2RDRA 5EPAA 3WCSA 2P6CA 2B39A 4BOWA 4UA3A 4DY5A 3W9AA 4PXEA 3D67A 2OA2A 2CL2A 1UF2C 3CJIA 1VRH2 4JGYA 2QQOA 3NNLA 4XCAA 3OJBA 4QM9A 5G1ZA 4HBNA 1PHMA 2HBTA 2JEVA 2WT1A 4MOAA 4MRIA 3WNNA 1FMD3 5H86A 5C6CA 5D29A 3A0NA 4XUTA 2P3JA 4YFZA 4DUXA 4RR3A 2XJQA 1BCXA 1TIQA 1CPMA 3I3QA 2PSWA 1PNGA 3B35A 2PMWB 4CRYB 2UWAA 3OGRA 1Z7S3 1ZBA2 1SLTA 2NMNA 4FPCA 4V1PA 1SHWB 2ZHLA 3PIJA 1IS4A 1F8VA 4WVVA 4OUMA 5KXBA 2GN7A 3H8RA 4X8IA 2F5IA 3S5QA 1ZBE2 1FOD3 3VL9A 4Z82A 1HV1A 3I59B 4AFCA 5DXDA 4N53A 3O1UA 4E9KA 3MRUA 1XNBA 4P4JA 5CKNA 4K3NA 4HANA 3AZXA 2A6ZA 4FD4A 1W8NA 1VP6A 2QZ3A 2PAMA 1ULPA 2R98A 4BMEA 2IUWA 3ITQA 4QM8A 5IT6A 1XBUA 3R4DB 2GANA 5A70A 5FP7A 2DCJA 3CDXA 4AVTA 4RS5B 2REFA 1WUVA 3VV1A 2VL1A 4GWNA 1COV2 1QIQA 1OBRA 1TKFA 3I49A 2YU1A 3TEYA 1S7FA 1BMV2 4D94A 4BQWA 4QHBA 3JBG3 4Y1XA 4O61A 4PDWB 1QJU2 1R1ZA 3ZPYA 2VZSA 2PRBA 3NO8A 3LA2A 1G9AA 1WCUA 1US2A 4B3NA 5I0CA 2E51A 5C3QA 1W99A 1V70A 2EK9A 4KLWA 4JHTA 2K46A 2XB6C 4Q4W3 2AYHA 3GKRA 5FYMA 1YO8A 4MHYA 4AZZA 2WZEA 3ZSKA 2WWUA 1RUC1 2VZPA 1K5MA 3ZXGA 1VJ2A 5L19A 1UKGA 2UY9A 4CAWA 3O1RA 2P5BA 5IVCA 3ZXAC 3PNAA 4YW3A 2Z5WA 5ACA2 3WABA 3KR4A 5C5TA 3R95A 1LENA 1Q43A 4AQ2A 2FCUA 1XE8A 3ORJA 3TE4A 1YIPA 5K0UB 1RUH2 2W52A 1RMU1 1Y9QA 3NNFA 2GNDA 3N7LA 4F8ZA 2RMU2 2RS12 2WIIB 2B4DB 1O4YA 1W9SA 1YYNA 4OC3A 4EN0A 3D2PA 4ZY9A 4CGMA 1TMF1 3ZXJA 2YNCA 4SBVA 2RDNA 2FHRA 4HNYB 1R081 3N36A 5T54A 2P2KA 4LE4A 3WQBA 2GNBA 1H1MA 2D6NA 2GU9A 3KSCA 5FZEA 1CD3G 4AHZA 4IEOA 2HWC3 4TZDA 2VL4A 2Z10A 2VGDA 5A3PA 3KL9A 3I97A 2E32A 5IVYA 3WDTA 3LEIA 1K3IA 3N9QA 1UCXA 2QMLA 5CIRA 3NA6A 3T90A 5FYSA 2JE7A 1CM0A 3DECA 2XEFA 3CL1A 5A7OA 4CDUA 4E2SA 2B5GA 2BCOA 3IZOA 5HCAA 4ONUA 3BB6A 1GYTA 4XFIA 3IWEA 1ZRDA 3WP3A 4PXDA 2R061 1L7RA 5FYHA 1NE4A 1WCSA 3ZN4A 4DMIA 5DZEA 4FXKB 1E5SA 1DLLA 1PVC2 5FZCA 2PIZA 3LD8A 1BO4A 4KOWA 1NZCA 2A70A 3POBA 1WBFA 4MFKA 4CP2A 5LYDA 2DCZA 4IQPA 4MMOA 1CAVA 3D4KA 1YC61 4PT6A 1W2AX 2TUNA 4ZXKA 2HWF1 4B7KA 4LBNA 2DEAA 2WYRA 2QCSB 1CAWA 1RHI2 4QXCA 4QT6A 2W39A 4LUKA 4UFJA 3ZO0B 3I2HA 2ZEXA 4GM5A 1S4CA 4P9IA 4E27A 3AZWA 3ZYBA 3AL6A 5T5JA 3K46A 4AOCA 3V56A 5DN2A 5DQ0A 4GH4B 4P45A 2PHDA 1XF8A 5C8WA 3ZR5A 5H84A 4YW6A 1WMFA 1MS9A 1LODA 2IJZA 4LO6B 5FAXA 4S2GA 2IVJA 1RTQA 3VBOB 1AL0G 2VNVA 1HRV3 3OYWA 4CPAA 3AJZA 1SPPB 4EN8B 2A4NA 1QJFA 2W46A 2BOIA 3S6GA 4P4FA 3L2HA 4ASLA 2R16A 2PIYA 1UPIA 4AF9A 1Q3EA 5FO9B 4DRVA 2ZGPA 4XQWA 3ACLA 5FPZA 5GZGA 1OQ1A 4MGSA 5HVGA 2WO3A 3THPA 5KC5A 2C9AA 1A78A 3NJVA 1YFUA 1IU8A 3RVHA 1ULGA 1XYOA 3J9SA 2BBVA 5JPMB 3KF3A 1E57A 3S7EA 4AW7A 3WSOA 1M4WA 2Y6KA 4P02B 1C8M3 1CP7A 1SACA 4ZS2A 2IXLA 1AX0A 3CNAA 3LPFA 2L9LA 3VGIA 5FZBA 4YVWA 1LULA 4ZYQA 4XW3A 1Q8VA 2QBXA 1PX4A 3GZEA 3EXUA 4QPIB 4XUQA 4AXVA 1SLBA 1VBD3 3PUQA 4LOSA 4M4RA 5FV3A 2XBO3 3O7OA 2NMTA 1B09A 3B94A 4NF1A 5FY7A 4DUVA 4JCKA 5IVJA 1GNHA 2LROA 5FKCA 5KHJA 4AYUA 3KM5A 4P10A 4N7UA 1VBB2 2RDQA 1RUG3 3RSJA 1JMUB 1NX9A 3ME2A 2Q4SA 3PJYA 4ZKTB 1JYCA 5IUQA 4YZ4A 1AR93 1LTEA 3FVLA 4LBJA 4AVCA 1ON0A 4O9GA 3TN91 1F2OA 4Y33A 5FUPA 3QNVA 1UU6A 4CEWA 3ILFA 1W2UA 2WLPA 3RQ0A 4Y49C 3UL2A 2BDRA 4FPYA 1KD7A 2IXIA 2YUEA 4GJZA 3M3CA 4AQ6A 3CPXA 3WP5A 3B3SA 3WF0A 4FTEA 1R093 3OD0A 5FZOB 1L7LA 3ZXDA 2GZWA 1MEC2 2HWD3 3E97A 3GNEA 2JEMA 2R071 1W3XA 3E5QA 2DCTA 4UF4A 2UYAA 4QXHA 4YPJA 1RUF3 3EXNA 1DYOA 4KWUA 1VALA 4PXBA 1W8UA 2WZR2 5C33A 1Z4RA 4LOTA 1H2MA 1MJBA 1YFWA 3ZX7A 3AYDA 1WW5A 3BYWA 2R7EB 3J7MA 1LAJA 1WA4A 3BOPA 3FX6A 4Y24A 5A1AA 1YSJA 1EV13 4KWJA 2RDSA 2XUMA 4XMAA 1LANA 3N7KA 4N53C 4OI4A 5CA6A 1QXJA 5FTTC 3WG2A 2RS53 4LO5B 2RM22 1FI2A 1YI7A 3PFEA 2AH2A 2AENA 1DCSA 4COYA 4LBQA 4XETA 5HXVA 1UY0A 3QH6A 4XF0A 4XACA 4MYEA 1VBA1 3H5ZA 3MF6A 4C1WA 1JYVA 2W5FA 1NT0A 3OF1A 2JICA 4DINB 3ZXLA 1AUGA 4XPDB 4UWIA 4ZY1A 1F2NA 4FD7A 3RMXA 5DG2A 5FYYA 1XSQA 4A7YA 4QPGA 2MNGA 2VAUA 4EE2A 3RAMA 3AB0A 3N7MA 3K9TA 3X29B 4CYOA 3BTAA 2GH2A 1OD5A 2Q51A 2OVUA 1UAIA 1UPSA 2P0WA 1YXWA 3SCFA 2BUKA 1IS6A 4Q4V3 3WDUA 1UX6A 3B3QE 1HB3A 4YFWA 1PZ8A 4LULA 2V4AA 4S2DA 2QQPA 4GULA 2Y0MA 1DTDA 1YHFA 4M6GA 3PBBA 1AR73 3JXSA 5J48A 4LX9A 2J42A 1KDKA 3PMSA 1YUDA 2DU1A 1MS5A 2GH8A 1NCRB 4Z8BA 4MGQA 3ZYGA 5A3MA 3T2OA 4KVOE 2FBEA 4CDXC 4OHYA 2XDVA 5FXXA 3LSEA 2Z3NA 3H3UA 1FPN3 2JX9A 4QB2A 1KWMA 5HPOA 1YRZA 3ZXEA 4GALA 5FZKA 3WEZA 1GWLA 2XEGA 5JLVA 1Y9MA 3VLBB 1OFSA 5BNQA 2WQ4A 4W4ZA 2VMCA 1PK6B 5DPNA 2EICA 4BQYA 3O1PA 3DKWA 3CDZB 1QJY3 3S9NA 4CYQA 5A7WB 2G0BA 2JDYA 4IUSA 5E1RA 2VOVA 3VZLA 1AUYA 4HONA 3RBUA 2ARBA 2ABZA 4JKMA 3DGVA 4ARXA 3BIWE 5FXWA 1I6XA 4HVQA 3E6DA 2VZUA 2G4IA 2PJAA 4WM7C 5IHRA 2CAVA 3IMMA 3T2PA 1OI6A 2NMOA 1YLLA 4F3JA 4BDVB 3NE8A 1AR62 3VBHA 5DUUA 5LK7B 2YGMA 3MPBA 3T0BA 4Y49B 5AC91 4CDUC 5EBVA 2FCTA 1P4NA 1BAVA 1BPMA 4OI2A 1PYTB 3ZFEA 1SG3A 3A23A 4FD6A 1UY1A 1JU4A 4IERA 1AJKA 3ZYJB 4W6WA 1DG6A 3DR8A 5F8PA 2G9ZA 1DYKA 3FEEA 5KR7A 2YG0A 2FDJA 2PAEA 3I3GA 4A2UA 3ZZIA 2H5MA 5GZDA 2W92A 4IV1A 1Q56A 4DOUA 4D6RA 4AVVA 2RJ2A 5FBJA 3J4UH 2OT7A 2QECA 5CISA 5F47A 2VQYA 2VTXA 3ZN6A 1VPHA 4MHRA 1K5JA 4HOOA 1ZZCA 4DQAA 5IV0A 3LOIA 3FYNA 5FY4A 2HLEA 4AXOA 5IAVA 2EXIA 1PCAA 4Y22A 1B35C 2VW1A 5F3EA 3IIAA 3A0KA 4LE3A 3SLIA 4XBQA 4MCQA 1J3RA 3CZUA 2EBJA 3KMHA 4XZPA 3TX8A 3MGDA 5LBCA 4SLIA 2OUJA 2FSRA 2WSVA 5BYNA 4AAPA 4AFDA 2HYKA 1KUVA 3OPTA 2ZW5A 5BNPB 4Q0UA 5IVBA 4JRAA 4L0PA 2WNOA 3AJYA 3RPQA 1OOPA 3H7YA 3UJOA 3JQXA 3HNBM 3VZMA 1UFHA 3VB9A 3ETQA 5LA1A 5F32A 3M3IA 1VRH1 5FP3A 2FMYA 2EVNA 3PUHA 3FBMA 1R1A3 1DGRN 2R1IA 2Y26A 3T3YA 2CGNA 1T2XA 1ARLA 2Z11A 4NGSA 5C70A 1A8MA 4INDA 3RWKX 3H8EA 4JDOA 2UY8A 1YWKA 3IKWA 2C0ZA 2P6HA 4ATFA 3WG3A 4LO7A 5A28A 3PB8X 4UFIA 1XMBA 1ZBA1 4EZ4A 3L2NA 1OVPA 1PGSA 1QQ9A 2FDFA 3U78A 3U07A 1IB1E 4CDXB 4I2OA 3D8CA 3UKVA 3SJGA 2EUIA 3P2HA 1S2KA 1ZBE1 2DXQA 1QXPA 2V77A 5E88A 1TF9A 5F5CA 4CCJA 2Q0YA 1QDOA 1XNDA 5CVRA 1RO5A 3O14A 1GMMA 4I01A 3IEHA 5HMNA 1RUE2 5AG4A 4YWYA 5J7MA 3QOPA 1AR82 4P9YA 2Z3PA 3C7OA 1JZ8A 3K4ZA 3SH3A 3EC4A 3B3CA 1COV1 1H9PA 3DXTA 3O1SA 4R8FA 3SCHA 2YBKA 4YWAA 4FT8A 4WM7B 1BMV1 1FX5A 3ZJ0A 4TNUA 4PQQA 4R52A 2ZEOA 1IOIA 1J1TA 4BA6A 1H8VA 1D2QA 1RXGA 4QXKA 5A32B 4DIQA 4CEWC 5IK5A 1QSOA 3CKHA 4PBPA 3VDDB 3LOBA 1RUI2 4L99A 1JHJA 1UOGA 5FZ3A 2CWMA 3DGTA 1AHSA 1ZA7A 4MHUA 1J59A 2NPIA 1FT9A 3J7HA 3FUQA 1GICA 3H1WA 1CZVA 5KHHA 4OCTA 4OC5A 4XQ4A 4P9WA 4D7YA 5ISVA 4PK2A 2XL7A 4WJBA 5EXOA 5C88A 4LXLA 4UF0A 2PDOA 3TOBA 4W6YA 2ODFA 4NHLA 1W6OB 4FPOB 1W2NA 1JYNA 4ZXEA 3IWWA 4LIVA 4XBNA 3W6SA 1VGYA 5IK8A 4A95A 5FP8A 4CU8A 2ZEZA 1CX8A 3T0AA 1B35B 4DFSA 2RMU1 5LEKA 2RS11 4Q27A 3BTXA 1RUNA 1X33A 4DY3A 2IFRA 1M4LA 4ZONA 2OZ6A 3POSA 5KHKA 2PR8A 2QIRA 2FCVA 2XQRA 5LRJA 4IEZA 2Q30A 2TBVA 2QTWB 1I21A 4QX0A 2PFWA 1HX6A 2OU2A 2CU5A 2DCYA 1UWYA 3M1HA 1I5ZA 2VJXA 5KXEA 3AC0A 2PJ9A 5IX3A 4ATEA 2AC1A 1HXS2 2RJLA 1MS4A 1HKDA 3AYCA 1C3HA 3R6SA 5IFPA 2DVBA 1W8OA 2Y64A 1YW4A 5D2AA 5FP9A 3DV8A 3WW3A 2BFUL 4DYOA 2DF5A 1YFYA 5FUNA 3SEPA 2YHJA 5C4WC 3MYXA 3NV3A 4MADA 1ZREA 5L7OA 4AVAA 1G9FA 5KTCA 2ZGMA 2VO5A 1JOBA 1TXRA 3WDXA 2G1MA 2A71A 4BZ4A 1TNFA 4BMBA 3DYOA 3VWEA 2QVSB 1LU1A 2BSWA 3VBSC 3IDBB 1H2NA 2ZCWA 3RZLA 5C3RA 4LKSA 4EWDA 4W6XA 1Z8TA 3FECA 4NWVA 3K3OA 4JZRA 2GMMA 1RHI1 4JWPA 4TSVA 4XILA 4F0XA 1GP5A 3KV4A 4E2AA 2WNEA 4OMDA 1MQTB 4AL9A 4DNYA 4EV0A 1AJOA 1H8TA 2PXJA 1RUC3 3SKJE 4KU8A 5FY0A 2VUCA 1SCRA 1Z4EA 3DCQA 1FMD2 2ZZQA 4UOJA 4B11A 5H9RA 1XQNA 2PJ8A 3IPVB 5DAWA 1W8HA 4R6TA 3BJ7A 3KT7A 2VY0A 4MGYE 2YC2A 1TZOA 1Z7S2 3T30A 2ES3A 1EPZA 1XB9A 4CCOA 2Z2SB 3UNPA 3V65A 5JZGC 3VBHC 1HW5A 1KFXL 1RMU3 4ZS3A 4XZUG 1HEEA 4IUGA 3DN7A 3E5UA 1L7QA 1FOD2 3FHIB 2KD7A 3ZFEC 4U9YA 4FWUA 5EJZB 2FMDA 4HK8A 1RGSA 1TMF3 4AAXA 3S6FA 3PB6X 4MHZA 5HI0A 3N7ZA 4CSWA 2WNUC 4W8JA 4MY0A 2WWSA 3WVJA 1Y9GA 1PUAA 3UGHA 4YSFA 3GM8A 1W9YA 5LA9A 4H2AA 4IV1C 5K9YA 4P4DA 1S0DA 1AYM3 1Z9UA 5FPUA 2DYCA 1AYN1 3JQWA 4MV2A 1IQDC 1X7NA 3T9YA 1D4M2 2W9XA 2VUJA 1AXYA 1OF3A 2DURA 5K8PA 2YNEA 3VZJA 3JBG2 3BU0A 4Y26A 5ABJA 2EXKA 4YZ2A 2PLV1 1YK3A 1IG0A 2R1DA 2V8DA 3K4DA 2BQPA 3ZXFA 5FCCA 4K7JA 3ZPOA 2YROA 1DGWA 4MCRA 4E4DX 1EUUA 4LO4B 2R063 2OS2A 1YFXA 1OPMA 2PJCA 1KGYA 2VZQA 1YQCA 4NEXA 3CXPA 1VBB1 3KHCA 4RGGA 5I93A 2OZUA 4I49A 1RTVA 1DGWX 1W6QB 4OYUA 2EAKA 1D7PM 3C2UA 3W59A 4OC4A 4XAEA 3USUA 5AFEA 2Q7SA 2PYTA 3ZFGC 2JB4A 3HIFA 1UOJA 1HDUA 4R87A 5FXVA 3V0AA 1SMVA 2R0HA 3O0XA 1K4JA 2ZHKA 3KHZA 5HCBA 1ULCA 5EJ1B 4IV3A 1XJAA 5DG1A 3ETPA 1VMJA 4IW3A 5C4WB 2Y34A 3HWJA 1L3JA 4CYPA 4PK3A 4K1ZA 5JUVA 4R7MA 1Y4WA 5LATA 2IFWA 3AVRA 5EIYB 1XMTA 3PU8A 2BO9A 3P1IA 1ENSA 4GS4A 5ELYA 1GZTA 2XR4A 3RJRA 2WZR1 4PV6A 2BGPA 2V5YA 4LMFA 1GZWA 1Q2CA 1O91A 2HWC2 3H3LA 2O14A 4BIOA 3UGGA 3VBSB 5FQ0A 4Y1VA 5CU1A 5FOJB 4QU1A 1S60A 4KWKA 4BYYA 3K3NA 4YM3A 2RM21 4FFGA 3I7DA 3EO6A 2WA3A 3H4QA 1WD3A 3WDWA 4ISRA 4AK3A 3VKFC 3HVDA 3PB9X 2RC4A 1FAYA 4JXRA 5K8MA 5CB7A 3WC7A 2WWJA 2WO2A 2QYVA 2QNKA 5LYIA 2BEOA 3R9FA 3QCWA 3VARA 1QJEA 4H6UA 5C8CA 3K2KA 5DAXA 1LU2A 1GWMA 4WVMA 2AFOA 4JKLA 3POFA 1LGCA 4N43A 1LGBA 5GLWA 2VNRA 5F48A 3R0RA 3WDYA 3MGUA 4D3WA 3DXUA 3UETA 5JZGB 1W05A 5A3OA 3TYJA 2XJTA 3GZTB 4ZU5A 1JBCA 5TSWA 4CXWA 2Q8DA 5A1LA 3MN8A 2Q8CA 4LA2A 2VC9A 1Y0YA 4OLLA 3OGVA 4DEQA 4CEYB 4FQ4A 1QOTA 1MVQA 3D68A 2WNUB 2ZMNA 4O7XA 4CRZB 4CUBA 1CX4A 1PO11 4XDPA 3FHQA 4AI9A 1UOFA 4K6BA 1SFYA 3NL1A 1PNFA 2B3VA 5CFCB 1N71A 4CS0B 1LNSA 2EWBA 4LKDA 2WYSA 1ND3A 4RD7A 4TLFA 3NRUA 5F1RA 1GQPA 1SBFA 3OCPA 2Q1MA 1HRV2 3LODA 4PSXA 4PLOA 1N3PA 4QKFA 2CV6A 4MH0E 4ORFA 3WC6A 4MHPA 1HDKA 4NAOA 3FBUA 2YFZA 2B5HA 1BEV3 3O12A 1HN0A 5IYYA 1XEBA 1G9BA 3W20A 4QX3A 2OPWA 2R073 2LUWA 3R96A 1YQ6A 5FYUA 3KZWA 3P6BA 4C8DA 2ZHMA 2O0OA 3B7MA 5FYCA 1JTZX 2WS93 3D66A 2D40A 1CAUA 4M3CF 1NCQA 1SFPA 3WQ0A 1Z8XA 3V8IA 4UIAA 4ES8A 4L8AA 1C8M2 2QQJA 3I8TA 4CU7A 3FN9A 3ZFGB 2VXRA 2RFHA 3FE5A 1UXZA 1KJLA 1X9PA 3C7FA 3RWNA 1PO21 2WFF3 2C6GA 1UNBA 2FXFA 4AGRA 3KZ4C 3R9GA 2FL4A 3NAPB 2VI7A 2GFQA 1VBD2 3DSBA 4MI4A 1VBA3 1CAXA 4YG3A 5AGEA 3IGRA 1Z8WA 2XBO2 4H3WA 3ZDSA 3MIHA 5FY8A 2C6PA 4AI3A 1ULFA 4PPZA 3E5XA 4CDQA 4WWVA 4FP2A 1OMIA 2DVDA 2VM9A 2C1CA 1U5IA 4E2QA 1CP6A 5EJ3A 1ZG8A 4A37A 4PSWA 2VXJA 2PAKA 1RUG2 1A8DA 4B10A 2QDNA 1FY7A 1GV9A 4PLNA 4Y1UA 2OKXA 4S2FA 3PUAA 5FZDA 1PMHX 5FUIA 1LFWA 1WKYA 4KWLA 3JD71 3EFAA 1W9FA 3VKLA 1YNAA 3B9CA 3CQOA 2XXZA 4KNCA 3VD5A 4D6SA 4MHDA 5L9VA 2P3IA 2EIEA 3M70A 1UYXA 3VBRB 4X2TA 4C2YA 1H8TC 3GJAA 4Q0PA 1DE4C 1LOGA 5B2GB 1IPJA 3N9LA 1R092 3A4UA 4KSIA 4GMP0 4XJ8A 3AKTA 4EVYA 4P5HA 1G7YA 2HWD2 4K9SA 3TB0A 2ZS6B 3ABZA 2PHFA 4XJUA 3WNXA 5A6YA 2ZENA 4DXRA 1J83A 1CN1A 4RFT0 3BCWA 4MBUA 1V9U1 1RUF2 3THTA 1DGLA 2WPXA 2Z3KA 5JR7B 3ROUA 1G6NA 2PQ8A 2QE3A 1QH7A 3EY5A 5FMDA 4XFHA 4NIGA 1AL21 1J4JA 4XEZA 1ZZ8A 3V64A 4A42A 1IG3A 1EV12 1GU3A 4FPJA 3ZFFC 4K30A 3Q8CA 2O8OA 1MR5A 1FV2A 3NAPA 2HUZA 1IGOA 1SDDB 4KMQA 5FZAA 5LWBA 4FPKA 3RDIA 1QJX3 1S2BA 1RINA 4XJZA 4NPRA 2P34A 2BGCA 1SZBA 3O1OA 3UKTA 1DBNA 2PQQA 4OZXA 3SXNA 3MW4A 4FI9A 1S0BA 3GB0A 4P9LA 5C71A 2VULA 4K1YA 4C68A 3MIGA 5SV8A 4HPSA 3FF3A 4QVTA 5LZ6A 1VB4A 3WINE 5KTDA 2OUHA 3LWUA 5F6KA 2ZELA 1VBE2 5AC93 2J1UA 4NIHA 3VBUC 2JD9A 1V6LA 4EWEA 2GN3A 1KEXA 4XF4A 3GBGA 1W0PA 5FLHA 3E6BA 3SJFA 4Q4V2 4C91A 4Q8LA 5F5QA 1WLTA 3CXQA 2W1QA 3CPAA 4GAZA 1AR81 1DGRA 2ZKNA 1CIWA 5FYBA 2VMHA 3SI1A 3U4SA 4A6OA 2BVBA 4UBRA 3MV11 3JVNA 3G3SA 2XONA 1P0HA 1ASJ1 2VG9A 4M01A 1F35A 2EVXA 4AR2A 2R7HA 1DQ2A 2QKDA 5LBBA 5FP4A 3ISXA 2JG8A 2Q1FA 2Y6GA 5A33B 4YRDA 1A2ZA 4CTEA 4H55A 4UEEA 1FPN2 2GLFA 5H9SA 2HWE3 1AMPA 4AVSA 5IK7A 1W9WA 2DVGA 1H2KA 3IB3A 3U37A 5K4LA 3TC8A 3WQ7A 1W6PA 1XOYA 2VVEA 3PVEA 4OKOA 1WLCA 3QD6A 3H8XA 4AHXA 3ON7A 2GLJA 1GOFA 2WDBA 4F9UA 4WM8A 1U12A 1QJY2 3WW2A 1CWPA 1CPSA 4BMHA 3JUWA 2WO7A 2A75A 1XBFA 1K45A 3IJ3A 4EFDA 4FPFA 4JLYA 4Y20A 3FLRA 4NCZA 3VL8A 1MS1A 3PFOA 1LOKA 1XNCA 4JDNA 1M4DA 2HV2A 2VBDA 1VRH3 2D7FA 4CDWA 3Q8BA 1W2OA 3VATA 1IPKA 3PU3A 3MBWA 4XE9A 2VCAA 1HQNA 2JDCA 2IXJA 2TNFA 5C9AC 1X9TA 2YC4A 1A34A 4MUVA 2NP0A 5LY2A 2PHUA 1O3QA 4XNHB 3PVOA 2BEIA 2BRTA 4XVHA 2W1WA 2B42B 3R4UA 1XE0A 3MICA 5FK8A 5G21A 4GXLA 2JDDA 1ZBA3 1EP0A 4UFLA 4N43C 1O3SA 4UFMA 3UKNA 1JZ4A 2VZZA 3IT8A 1CJWA 1SBDA 3F5BA 2BOAA 1YJKA 4TYSA 1HXS1 1ONAA 4C0HA 4U36A 4UCNA 3WQ1A 4J6GA 1JS9A 1SQ4A 1VMFA 2P6GA 5HCHA 5LRGA 3ZFFB 1QQP1 4X5KA 2IVIB 3WHTA 4LORA 1BQPA 1IGBA 1BLZA 4QB9A 1WLWA 1AYEA 3DPRC 4HPKA 5FPVA 1JOJA 2OOTA 4B4PA 4NGRA 1RVF3 3VD4A 1L0CA 6CPAA 2DVAA 2Q4ZA 1Q2DA 3NNJA 2WA4A 2EIGA 4RI1A 3VN4A 1ND3C 1OFNA 1H8LA 4DS0A 2DPTA 1URXA 3DKQA 2G9GA 1LCPA 2CTVA 1OT5A 3VBUB 1S3ZA 2QVPA 1NA1A 4AB7A 4KBBA 3IC1A 1PIV1 4YM1A 3C8XA 4AE2A 4OC0A 2JE9A 1R1A2 2OYZA 2ZGUA 5JIUA 1R3NA 4LNVA 3OB8A 1LOCA 4PQ9A 3S5AA 1QXRA 1MZEA 4BLJA 4NE9A 1FMD1 1EPWA 4NIIA 4I3PA 3HUVA 3DYPA 4MXVA 2WNVA
chains in the Genus database with same CATH topology
3ELNA 5JOXA 1P4NA 1RUG1 1TE1B 4LT5A 4NXYA 1NCQC 3Q9OA 4FOWA 4OI2A 3ZFEA 5KHGA 4M00A 4Q4X1 4CGNA 3RYRA 4B4RA 4FD6A 5JPHA 1B35A 1LKNA 3G6JB 4IERA 3WW4A 1AJKA 4E4SA 4YG0A 2Q5TA 3ZYJB 4W6WA 4WZCA 2YC0A 1DG6A 1GANA 3DR8A 2BWCA 4JAAA 1IS5A 3WD5A 1Z7S1 1DYKA 3UY5A 1RL3A 2D6LX 3ZYIB 1DYPA 1HRI3 2H0VA 2LM3A 4PIXA 1QSRA 3R4SA 1AR91 1MZ5A 4LEJA 2Y38A 5JPNB 2G9FA 4Q8KA 5AVAA 1LEMA 2PAEA 3I3GA 1A6CA 4A2UA 3VZOA 4Y1ZA 2NQYA 4XPDC 2HWF2 1O7FA 3ZZIA 2H5MA 2RMU3 2A5ZA 4YM2A 4B7EA 2Q44A 2XVKA 4OI1A 3FNCA 5CBLA 5GZDA 4B13A 4B5OA 3L9JT 5JDBA 4E2GA 4LUAA 2XLFA 1FOD1 4IV1A 4PF5A 3FJSA 1IIDA 1U5XA 3FRMA 1Q56A 1S7KA 4DOUA 1I12A 2EXHA 2XKOA 5FBZA 4KZTA 4AVVA 3AP9A 3J4UH 4L97A 4XYXA 2B3UA 3D2MA 3P3PA 2ZAHA 3PGPA 2UWBA 2QECA 4I3GA 5F47A 2VQYA 4CEWB 1KDMA 2Z3LA 3ZN6A 5JAXA 4HNXB 1QJZA 1F5JA 1HLCA 4R9AA 2PHRA 4YGBA 4C1XA 2VMGA 4QC6A 4FO9A 4DB5A 1ZZCA 1R091