4ORFA

Camp-binding acyltransferase from mycobacterium smegmatis, mutant r95k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
332
structure length
319
Chain Sequence
AELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIEPGLIIGEIALLRDAPKTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTSETLYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 96
structure length 319
sequence length 332
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4orfA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4orfA02
4II9A 2QCSB 4NEXA 3TO9A 2Q0YA 1BO4A 1G6NA 2PAEA 2FCKA 4EV0A 3H1YA 2BYVE 4XF9A 4XF0A 3ST7A 4R9MA 4XFAA 5F47A 4E2QA 1Q2YA 1J58A 4ONUA 2HKXA 4JJXA 3TOAA 5JQ4A 1I5ZA 1Q2DA 3RNSA 4CRYB 1NXMA 2NMTA 3SMHA 1VKCA 1DGRA 4OFGA 2VXKA 3CXSA 3R1KA 4B5PB 4PJYA 3H7YA 3IWZA 1VJ2A 1B87A 4L2NA 3KGLA 1NSLA 3R9FA 3TE4A 2GC3A 4ZU7A 3QACA 5GCNA 1QY4A 2PFWA 3IIAA 5HI0A 2GZWA 1OMIA 2P6EA 3F8KA 3LA3A 5LRRA 2B9UA 2C0ZA 2UYAA 4HVRA 4J1WA 1YVKA 5H86A 4HLTA 2P17A 4P9GA 1M4GA 3VWDA 3MDPA 2IXIA 2CNTA 5I8SA 4QB9A 4J3GA 4IESA 3U10A 2FQPA 3BJ8A 1ON0A 2O28A 3SCGA 3FBUA 2BEOA 1O5LA 2BSWA 4FD7A 3V8IA 2OH1A 1JUHA 2J8NA 3H4QA 1S7KA 3LWCA 4NXYA 3EQEA 2JLMA 2KCWA 5JPHA 1ZRDA 3F5BA 2ZKLA 3R95A 1Q43A 2IXKA 4L8AA 2QJVA 5KTAA 2PAKA 1S7FA 3CXPA 2H6BA 3H8UA 4HVQA 4AB7A 2Q0AA 1TIQA 4DINB 4K8FA 4IF5A 1OZPA 3S6GA 2GU9A 1O7FA 2VPVA 2XHKA 1EYBA 2XL9A 4QGNA 4B5OA 2VBQA 1YVOA 2BNOA 3OWCA 5HH1A 1QSOA 4EWEA 2GAUA 4H6ZA 2QMLA 4WVZA 3N7ZA 3SXNA 3I7DA 4NSQA 4KU7A 3H50A 4KOXA 1GQGA 1P4NA 1ZRFA 2OU2A 4FBFA 3GYDA 1YWKA 2IXHA 3E6DA 3M3IA 4XFHA 1MJAA 3BLNA 4IERA 5E16A 4H7LA 3T9YA 3GKRA 2PRBA 1LRZA 1YUDA 2OZGA 4IUSA 5FPZA 3CL1A 3LODA 1J3RA 2ATFA 4FT8A 4JXQA 3W91A 3RYPA 3MGDA 2Q4SA 3FYNA 1XEBA 2BUEA 1QXRA 4META 3PLQA 2B5GA 2XKPA 4MUVA 1PU9A 4K30A 2I00A 1NE6A 2Z2SB 3BB6A 4MI4A 1YFUA 1M1DA 1CAUA 2RC4A 5C82A 2XLFA 3S0MA 2P6GA 1RXTA 3H7JA 2G0BA 1YR0A 1WWZA 3JZVA 4I01A 1NE9A 3CLPA 3FIXA 2OZJA 3LA2A 4O9GA 3W6XA 4PIYA 3NE7A 2MNGA 2B5HA 2ZCWA 3NL1A 1ZRCA 2HQYA 5DWNA 4BMHA 1FT9A 2D5FA 4HSLA 3SXWA 3SHPA 3IDCB 1GQHA 1TQ5A 1Q5OA 2PDOA 2D93A 1OFNA 5C6CA 5FVJA 4JD6A 4R3LA 1H1IA 4IEVA 3FJSA 4MZUA 2FT0A 4F0YA 3NVCA 3E6BA 5LRSA 2VEZA 3CXQA 1M4DA 2B4DB 2R98A 2ZW7A 4KOYA 3H3ZA 1UPIA 1XMTA 5E1RA 3FE5A 1J59A 4L89A 2XLGA 5C8WA 2ZW5A 4ZU5A 4IETA 5C88A 4IEUA 3BJ7A 3D0SA 1O3SA 1UIJA 4XFFA 3EBRA 2B8MA 3GY9A 1CGPA 1S3ZA 3KKWA 1Y9QA 4B5PA 2REEA 2VECA 3ES1A 1YK3A 5BUVA 1X8MA 4AG7A 4IEZA 4RS2A 3UY5A 3F0AA 3EC4A 4CAXA 4DNCA 1XE8A 5CADA 2VI7A 1U6MA 2I79A 3S6KA 4AVAA 4HNYB 4ZBGA 2Q7BA 5EZWA 2QECA 4H6UA 5KHKA 4U9ZA 3B8GA 4CS0B 3U0ZA 2CAUA 4QUSA 4RD7A 1RUNA 4CYDA 4YRDA 4FD5A 3EJKA 2ET1A 4XFCA 2OA2A 5BPXA 1S7LA 4MY3A 2QVSB 4JLYA 3DL3A 3DKWA 2EVXA 3TNPB 2CGPA 4M3SA 4R3KA 2IXLA 4HZFA 1Y3TA 5I93A 1PUAA 3T90A 1Y7RA 3ZZIA 4KLVA 4MJ8A 4EROA 1IB1E 3FX3A 4KWLA 2K9ZA 4Q0QA 4BH9A 3FB3A 4LUKA 1M44A 5I0UA 3RYOA 1MJ9A 3BCWA 5BY5A 4N9HA 5I8TA 2ZW4A 3FRMA 4TLFA 3WW3A 3I9SA 3LD2A 4KUBA 1VHSA 3S6HA 3I59B 4KLWA 4CRZB 4JTOA 2REFA 2XKOA 2VZYA 4NCZA 4OAEA 2EAAA 2MHFA 3VHRA 5FLHA 4KOTA 3O14A 4QVTA 3KCCA 4I09A 1I6XA 2B4BA 3G7DA 4QM9A 4YGOA 3P2HA 2WFPA 5BV6A 1FI2A 1IICA 4I49A 1CX4A 3NW4A 4UA3A 4CAWA 1CJWA 4F7ZA 3DV8A 3LZZA 2QNKA 1SQHA 4E8OA 2IXCA 4IEOA 1S60A 4MHDA 4XPDB 3TOBA 3LAGA 1QXJA 4NF1A 4BIFA 1PMIA 3RDIA 3S7EA 1YFXA 2D4OA 4EWDA 5EFUA 4XFBA 1BOBA 4YYOA 4F8AA 1V0CA 4KOVA 2WPXA 4I2OA 2WPWA 5IX3A 1QWRA 1WA4A 4R8HA 3CEWA 1ZREA 3QB8A 2ET7A 1VR3A 1DZTA 1VP6A 1RUOA 1P0HA 2EA7A 4QXKA 3WW4A 4YSFA 4PK2A 5F46A 2H5MA 1YLLA 1Z4RA 4UBHA 1B6BA 4MH0E 1KUVA 2PR1A 5AVPA 4XNHB 2Z0ZA 2ZXVA 2PYTA 4MV2A 3QOPA 4XF4A 4HN1A 3C3VA 2OZ6A 3MYXA 1Y9WA 3EHKA 4UBRA 4FAHA 3EXNA 2CAVA 4J1XA 5J3UA 2BNMA 3E0KA 1MJBA 2HV2A 2IXJA 2UY8A 2E9QA 4LA3A 1CAVB 3TNQA 5JSOA 4LULA 4Y49B 2KXLA 3WR7A 2Q4YA 3KSCA 4D7TA 3D3SA 4PK3A 1IPJA 2B4DA 2J8RA 1UIKA 4GULA 5IV0A 4IEQA 4YFJA 4R57A 4KVOE 1KUXA 1UW8A 3S7IA 2PQ8A 3M70A 3DNSA 1I12A 3TO6A 3R96A 5KTCA 1IYKA 4X6QB 1XF8A 4AG9A 1I1DA 5J8CA 3OF1A 1ZVFA 1J1LA 4JWPA 1LB2A 2V09A 3UKNA 4LX9A 4UBGA 5JSRA 4EVYA 2UY9A 2GANA 3UKVA 2XLAA 3SHRA 5KTDA 5FCCA 4PIXA 2XL7A 4N9IA 5BXXA 3NSTA 4XEZA 2FXFA 5CVRA 4M85A 1QSTA 3IGRA 3GYAA 2D4PA 2N7GA 4UXAA 3OTFA 2F4PA 1YX0A 3ACLA 5D1IA 4KORA 1DGWA 2VQAA 1S5KA 2Z10A 3G3SA 1Q3EA 1OD5A 2OYZA 5I8YA 1RGSA 2FE7A 2G3AA 1YREA 3PZJA 1PM7A 3ZDSA 3E5UA 5JAXA 2WC2A 2BNNA 3U11A 5LEJA 2GE3A 1YHFA 4AQ2A 5K8SA 2CY2A 5E96A 2JDCA 4HSJA 5I0SA 5ISVA 5KBFA 1QSMA 4XPDC 3PVBB 5FQ0A 3SCHA 4JXRA 4BYYA 4KWJA 1X7NA 2R1IA 2F5IA 3ETQA 2G3TA 5J8FA 3FWEA 3R6SA 3I59A 4IEWA 4HVOA 2CNSA 4I0BA 4Z82A 5I91A 3PP9A 3R9EA 2B3VA 4ORFA 5JSPA 4KL1A 1O3RA 4HBNA 3SXOA 1SFNA 4PSWA 3CF6E 5CU1A 1V70A 3EFAA 4KWKA 1LR5A 2HJIA 3QAHA 3RYKA 3NKTA 4Q0SA 4FAGA 3H1MA 2PA7A 2FIAA 3HT1A 3LA7A 4LLOA 2P0WA 3ZJ0A 2ETEA 2I45A 3DR8A 3DN7A 4XNHC 1QSNA 2DCTA 3NJZA 2GC0A 3SCFA 3MZHA 3BALA 4L11A 2BL1A 3E97A 4E2AA 2R8VA 3H9AA 4I0AA 3BU7A 4QMAA 4KVXA 3E5QA 2PTMA 2GC1A 4YARA 3N4MA 2JEVA 1YLEA 3C26A 4KVME 5FQ0B 1NMTA 1Y9KA 4LUMA 4BHPA 2H6CA 1R57A 2B58A 4JTNA 1L0CA 1ZZBA 2ZPAA 3TFYA 3OGJA 3KGZA 1L3JA 3DDDA 2X7BA 1RL3A 4Y49C 4ZU4A 1LKNA 1O3TA 2PSWA 4D7SA 4OLLA 1Z9UA 2XGXA 4Q29A 1DZRA 4LTAA 5I0CA 2UYBA 3RPQA 4QX5A 3DR6A 4WZCA 4B29A 4KOUA 4MY0A 3E6CC 4QGMA 5I0TA 3IBMA 4YRHA 4F6AA 1X82A 2OZUA 1ZNPA 2IL4A 1IYLA 2P6FA 1Z4EA 1XE4A 5LEKA 1CAXB 1NE4A 1CAVA 4RI1A 3OD0A 4KOWA 2ATRA 3S6FA 5FLIA 1EP0A 1CAWB 2A4NA 1O3QA 1NZCA 1CAUB 2ARHA 1LRHA 3ES4A 4I3PA 1N71A 3GBFA 4FD6A 3JUWA 1K4JA 3L2HA 2CNMA 1J3QA 4AVBA 5J48A 4XPKA 1FXZA 1XE7A 1GHEA 4AQ6A 5CNPA 3W6SA 3D2PA 4PV6A 2QDRA 5FPXA 5F49A 1KZFA 4E2GA 4HNXB 4NVPA 2FL4A 4R52A 3E5XA 4O9EA 2B3UA 4MGIE 3EY5A 1RTVA 4I02A 1J4JA 4IEYA 1ZZ7A 1I21A 2C27A 2K5TA 3G8WA 2FS5A 5IB0A 3WW1A 4Q0UA 4HKFA 3HQXA 1O4TA 2Q1ZB 1FY7A 2FIWA 4Q0VA 1SEFA 3PNAA 4PIZA 3H1WA 1NYWA 3TO7A 5JR7B 1WGPA 5KHJA 4KOSA 3FFQA 5J7MA 1M4IA 3BPZA 5I0RA 3UKTA 1YFWA 3HT2A 3MPBA 4XPLA 3H3UA 4HNWB 4WBBA 4JV4A 4LEJA 1OI6A 1U12A 1ZZ9A 3I54A 3CO2A 5EBVA 4EWAA 4QGLA 1J3PA 2Q30A 2PHDA 4AXOA 3IWGA 4UWJA 4Z07A 1RC6A 4IEXA 2FSRA 2Q44A 4MBUA 1X8EA 3P2FA 4CAVA 3RYRA 3B02A 3D2MA 4E0AA 4H89A 2CV6A 2GC2A 4KU8A 4MX3A 1XRUA 5FDBA 2J8MA 2Y0MA 5F1RA 3PGPA 3HIFA 4E2SA 4U9YA 1UCXA 5DWMA 4LUAA 1ZX5A 3ELNA 3FXTA 1EPZA 3TCVA 1HW5A 4MGZE 4FD4A 3TTHA 1H1MA 3KMHA 3FNCA 2Q4VA 2BGCA 4PSXA 5HMNA 4KUAA 2PR8A 4OADA 1UFHA 5JCTA 5FLJA 3LOIA 4IEPA 2Z11A 1WLTA 1S7NA 5KHGA 2HUZA 2MPFA 3R9GA 1RO5A 5T3NA 1XIXA 2IC1A 2K0GA 4A2UA 1ZZ6A 4MGYE 4XF3A 2ZW6A 3D0JA 4XF1A 4XFGA 3JVNA 4Q0PA 2H0VA 1ZZ8A 4LA2A 4YNIA 1QSRA 3K9UA 4QC6A 2PAMA 2QIRA 2D5HA 1MK4A 2EUIA 2FMYA 5KHHA 1YFYA 1EY2A 4KZTA 1UD1A 3OCPA 4HMZA 3D8PA 2O8QA 3TT2A 2OZHA 1SQ4A 1ZRRA 4QBJA 1IPKA 3ROUA 3USSA 2VQYA 3IDBB 5F48A 2O1QA 2PQQA 3I3GA 4U5YA 2R7HA 3RZZA 1CM0A 2B5GB 5EC4A 2Q04A 4XETA 2GIVA 3D82A 2EVNA 4GS4A 5H84A 4HN0A 1ZZCA 2D40A 3CJXA 3FZ3A 1YGHA 2DXQA 2JDDA 3VWEA 4X5KA 1KUYA 3DSBA 4XFIA 2AJ6A 4UWIA 4MGKE 1IIDA 2PC1A 2GH2A 4R87A 4X6RB 5KHIA 1O5UA 1Q2CA 3EO4A 2Z69A 3EO6A 1CAXA 4AVCA 2VZZA 4JVAA 2Y0OA 2OPKA 3FHIB 2AE6A 1CAWA 1WK4A 2BEIA 2PHLA 4QM8A 3WW2A 2OB0A
chains in the Genus database with same CATH superfamily
2FZ2A 1KXGA 5CFDB 2AYHA 3O1RA 4BISA 2A73B 2RM23 3NMBA 5IVFA 4U2AA 1EAH3 2JE7A 4ZHNA 1QY4A 1XU2A 2WZR3 3O1VA 4HLTA 3LPFA 3QNVA 3UT0A 4D69A 4JGZA 4NRMA 3WNNA 4K9SA 4NXYA 2C6SA 1WMEA 3F5BA 5DAVA 4Y4YA 1JYTA 2FDFA 5IW0A 4CXWA 3V0BB 1QSOA 4EWEA 4QKNA 3ON7A 1OOPA 3GKRA 1E5SA 2KA3A 4G4FA 2TNFA 3JUUA 3DUIA 3T3YA 1JN2P 4MUVA 1QJZA 1FYUA 1NE6A 5EMIA 2V8VA 4BQWA 1I3HA 1HV1A 4XDQA 3VZNA 4V2VA 2ZHKA 4DIQA 4NGMA 2R16A 4NHKA 3ZSEA 4N90A 4BLJA 1W9WA 2AR6A 5JI9A 2W47A 1VBD1 3UESA 4AFMA 1NA1C 1MQTB 4NIDA 3MPPG 2VW2A 3IJ3A 1BK0A 4NHYA 3B01A 4U36A 3AMMA 5L7OC 1GWLA 2WNVC 4B4PA 3F0AA 1Z8TA 4XQDA 5CADA 2PHXA 4Q27A 4XQ4A 3EJKA 5LZ6A 2E63A 3FBYA 2K9ZA 2PLV3 2DWRA 1AXYA 3D8CA 2DUOA 3FRMA 4COWA 4KLWA 3VBUA 2Z3NA 3VHRA 3HQRA 5FLHA 1OH4A 2ZEFA 1IICA 3WDTA 1SQHA 5IVJA 2RG4A 1S60A 4XPDB 2AGSA 2P3YA 2JDMA 5LY1A 5IX3A 2EF6A 1MR5A 3B3CA 2YC0A 3UJQA 1S0EA 3KF3A 3WC7A 2LS6A 3JXSA 1FT7A 2PJ8A 4LHKA 4DB5A 1GNYA 2D6KA 3S6PA 1ZA4A 3WF1A 2FDHA 2YNCC 3KS7A 3EMRA 3S7IA 1X9PA 1I12A 4AG9A 4X2TA 1I1DA 1WCSA 4BQ3A 2GANA 3A0NA 2XLAA 5KTDA 2OQ6A 4FTEA 2FXFA 4CDXB 2BVVA 4IK2A 1C57A 1A8MA 2Z10A 3JU9A 5E96A 3VKFC 3T0BA 5KXEA 2PMWB 3KT1A 3BUCA 3SCHA 3WNXA 5J8FA 4FPLA 1HIXA 3HVDA 1W8WA 1L7LA 1QJX3 4Y24A 5CU1A 3CDXA 2D3PA 4KWKA 2EXHA 2WFF3 3E97A 4QMAA 3AVRA 2JICA 3MW2A 1CPSA 1HKDA 1MZ5A 4QU2A 3PJQA 3RMXA 3D7FA 2X5IB 3HWJA 1GWKA 4K6BA 4P4JA 2VUJA 1UAIA 4FTBA 5A7NA 4LHSA 3KVBA 4NGTA 1BLLE 1DQ1A 3Q8FA 3KD4A 4QX2A 3MW3A 1SLLA 4A45A 2G1MA 1J3QA 2DPTA 5F5CA 5LATA 2YGMA 2D98A 4R52A 1YQ2A 4CU8A 4OC0A 2K5TA 3G8WA 2K2SA 4OI0A 1RUC3 4CYOA 4KMQA 1FOD3 3FFQA 2EICA 4EN0A 4JV4A 1OI6A 5CA6A 5DZFA 1WMDA 4AXOA 5C4WB 4XMIA 4LJHA 5JOXA 4JDNA 4RYDA 3WOGA 1X8EA 3B02A 4MX3A 1B35C 2XBO1 3HIFA 2RS53 3FXTA 3TCVA 4LMFA 4A7KA 4LO4B 1UFHA 5JCTA 1D4M2 2Z11A 3HUVA 2HWB3 4JQTA 3HNBM 2J1EA 4KZTA 3K3OA 1SDWA 2VTXA 3PVEA 3ZDVA 2VR4A 3RMYA 3UGGA 2GLJA 4XETA 5EIYB 1UU5A 2W39A 1KJLA 5LYLA 5H9SA 2QZ3A 4CCNA 5DAPA 1BO4A 2PIYA 4XFAA 5L9RA 3IU1A 1J58A 4ONUA 1XNKA 3UYJA 5FBZA 1W0PA 1VJ2A 2PFWA 2DVDA 5H86A 2VVEA 3CZXA 2ABZA 4EFDA 4N43C 2GU2A 2WAOA 3WDXA 1XRYA 3ISZA 5A1LA 2PAKA 5GKAC 2XWJB 5F37A 2D44A 4C90A 4Q4V1 3FEDA 3N7ZA 3WP5A 4WM7B 2GN3A 4R8FA 1NY72 3WF4A 4OP4A 4XFHA 2OZGA 1V9U2 4B12A 5FPZA 2Y6FA 4WV8A 5B4NA 1XEBA 1UYXA 1H8LA 4ARXA 2XKPA 4P9YA 3BB6A 1D4VB 2XLFA 3S0MA 5ISLA 2G0BA 1DQ2A 1YR0A 2JDAA 4AVVA 1WD3A 4P5HA 3VDDB 4D6RA 5FYIA 3IFEA 3NVCA 4EZ4A 1XMBA 4OCTA 1Z7S2 5FY8A 2IUWA 2ZW5A 2B8MA 4QXHA 4QKDA 3NAPA 1OPOA 1RUE1 4YVWA 4ZBGA 3KQXA 2RMU2 1F9KA 2DURA 4YRDA 4G1PA 3DKWA 2IXLA 1PUAA 1H8VA 1W2OA 1JWQA 2RDRA 4CUAA 1IB1E 4KNCA 5G05L 4BCUA 1WW6A 1VHSA 5F39A 4GMP0 4YW5A 1W05A 1I6XA 4UCMA 3P2HA 3SISA 3CT9A 3DV8A 3NNGA 4E8OA 1Q8VA 3LMSA 2IXCA 3TOBA 4CDUC 2KD7A 1AR71 2PVWA 1W8HA 4CUCA 1MZ6A 4JKLA 2DFBA 1H8TA 4GB33 1BBT3 4W6WA 4AGGA 4A6OA 3K46A 2ZELA 5L9BA 3EHKA 4I0WB 3T09A 4E8DA 2HV2A 4LBQB 2E9QA 3KV9A 4QQPA 1COV1 2XG3A 4PK3A 2BV4A 4MXVA 5IWFA 3B7IA 5EJ3A 5JVVA 4UFXA 4A95A 1OUXA 4EVYA 4LX9A 3S30A 2B7YA 3AXDA 1JZ6A 3PB6X 1DGWA 3PZJA 4ZY0A 4XAEA 5KC6A 3PVNA 1UOFA 2LM3A 3EYPA 4HSJA 5I0SA 1VRH3 2UURA 1K42A 1R1A3 4HVOA 4AYUA 1UY2A 4JGYA 2PJ2A 4OULA 5HBAA 3M8LA 4LBJA 3TC8A 4RS5B 2IFWA 3NJZA 2R8VA 3DPRB 3H9AA 3BU0A 2PTMA 1DP0A 3SITA 4L0PA 3VL9A 2BJSA 3ITQA 4AW7A 2EK8A 3N7LA 3TN91 2ZEEA 3I1UA 2G19A 1W6QA 3N7JA 1VRBA 3USUA 4ZU4A 1AYM2 4RHV2 4QX5A 3VDBA 4MHPA 1GOGA 2WBKA 3CU7A 3V38A 2XEGA 1ZNPA 2P6FA 4GQ7A 5FZMA 3LSDA 2ATRA 4P4FA 4Q4Y1 3B93A 3HAGA 4I3PA 1N71A 2XH6A 4AVBA 1ENRA 3PUQA 4D0QA 4S2GA 1AXZA 2Q8EA 5F49A 4XMAA 1KZFA 1AR63 1ZBA1 1VALA 4XJUA 1CPNA 1XNAA 2ORXA 5FZ1A 2V8HA 5HXVA 3PMEA 4W65A 5EBVA 1YSJA 4TZDA 2EWBA 2PHTA 5C3PA 2JG9C 2Y0MA 1PGSA 3T1LA 5DDJ3 4OQ9A 2IMOA 1DZQA 1H2MA 2V77A 4FPOB 4XJWA 3RSJA 4B13A 3BVCA 4NO4A 4NOTA 5DMYA 3ZO0B 2ODFA 3B69A 2D5HA 2EUIA 1ZYBA 5FYTA 2HWC1 2P4EA 1JYIA 4IV1B 4QXCA 2BCOA 3POIA 4DO0A 1OD3A 2GIVA 1GU3A 2AJ6A 3A7QA 1N1VA 1Q2CA 4EN8B 2W95A 3WCRA 3NH8A 3KZWA 2Q0YA 1G6NA 4EV0A 1CG2A 5FZ6A 2XONA 1PNFA 1OSGA 1KS4A 5JQ4A 1I5ZA 2DEAA 2VXKA 2Y64A 3VBFC 4LNVA 3QACA 4A7YA 5LRRA 1FPN2 4J1WA 1YVKA 2VNVA 2P17A 4BOWA 1QOSA 4HKOA 4L92A 3PMSA 1W9FA 4L9BA 3LIGA 2QJVA 2ZMKA 1LNSA 1URXA 3TEXA 4DINB 1SFYA 5T50A 4K8FA 4IF5A 4K1YA 3FMGA 2QQNA 3SXNA 4ZZ5A 3DCQA 1EAH1 5CKMA 4FBFA 4NGRA 1JYNA 5DAXA 3N9QA 4MLOA 5KXBA 4CPBD 3FYNA 2IVJA 5ACA1 1VBC2 2P3KA 3I2HA 4MCRA 4NIAA 2I00A 3JBG2 3SKJE 2VD7A 3ZFFC 1W2NA 4PIYA 4W9YA 4Q5OA 5A6QA 1TQ5A 2VULA 2YY1A 1Q8SA 5CAZA 4R3LA 1YXWA 3P1IA 5D2AA 2B4DB 3H3ZA 1AX1A 4L89A 4CDQB 3U37A 4B4RA 4QQOA 1X50A 1OFSA 3EBRA 4CCCA 3ZSLA 4UEFA 3H8RA 1FV3A 3IAPA 3KM5A 3NNMA 5IVCA 2BERA 4R9DA 2HH9A 1W6OA 2DTYA 2ET1A 4MY3A 1F8VA 3FHAA 2DBIA 4QWNA 5GZCA 2ILMA 4LUKA 1ODMA 2ZEZA 5GLUA 2A5ZA 2Q1FA 1HXS3 2VZYA 1DYPA 3V0AB 1DDLA 3AL5A 4CEYC 3GXUA 4UA3A 4CAWA 5JZGC 2P6HA 4YZ2A 5ABJB 2XDVA 3N36A 1V0CA 4QQ2A 1ZREA 1RUOA 1C8M3 3AL6A 4MH0E 1KUVA 5AVPA 4XNHB 1R081 5JLVA 2ZXVA 2YUEA 1Z8XA 2OVUA 4Y49B 4RQPA 5IV0A 4IEQA 4QT6A 3DNSA 1ZVFA 4WVMB 3IM0A 3I97A 2UY9A 3VBHB 1AR93 4XEZA 5FWEA 5CVRA 1ZBE1 1FV2A 4YG3A 4QB6A 5A7WA 2CWSA 1GP4A 3VN4A 5KBFA 3PVBB 4LO8A 4CEWA 2XJQA 1H1AA 2CWMA 2B3VA 4A32A 2X5IA 4DZGA 5ERLA 5M0TA 4KGGA 3H1MA 3I2DA 1OLMA 3GBGA 3BI1A 3W21A 3J7LA 5JOYA 4IE6A 4QX1A 5C5UA 1O3TA 3BOWA 4D7SA 1CIYA 1IKPA 4P5YA 2VMCA 5IFTA 1CJPA 1CAVA 5LA0A 3GIUA 4AI8A 1W8TA 1GHEA 4OIWA 3K2KA 4AGRA 5FPXA 5DUUA 2FL4A 1ARMA 2GMPA 2HBTA 1DG6A 4Q0UA 5CG9A 4ZX8A 2ARAA 2R32A 1NYWA 2ZGRA 4D6QA 4LPLA 3UKTA 4L97A 4QHOA 1F5FA 3I54A 4Q4X2 1J3PA 2CIJA 3OEAA 5FDBA 2J8MA 5DAQA 3OEBA 1FNYA 4FD4A 1ND2C 3LF7A 5FZKA 4X8IA 2E7TA 1LTEA 1QDOA 5T3NA 2WZ8A 2ZKNA 2RV9A 2PAMA 1KFXL 4MXWA 3N9PA 2A3WA 2PXJA 4XIKA 4LT5A 3IDBB 1UN1A 1ULPA 2O1QA 5LBCA 4BXSV 2EIDA 4LR4A 4IDZA 2GP5A 5H84A 5FP8A 2D40A 1W2UA 2J1UA 3WZ1A 5FZBA 1YO8A 1MS8A 2RS51 4MGKE 1LHUA 3O1SA 2PC1A 3EO6A 4JVAA 2IJZA 2WJSA 1TE1B 2CNTA 1RUG1 5F3CA 1UX7A 3DYPA 2EXJA 1Q2YA 3VL8A 4CRYB 1V6NA 4OFGA 3ZSMA 2WWSA 4E4DX 3CXSA 4OHVA 2BWCA 2ZGSA 4WM8B 3R9FA 3IIAA 2GZWA 4GXLA 4P9GA 1EE3P 3JD71 4NAMA 3MDPA 4WM7A 1CJDA 1BZWA 3H4QA 3EQEA 5BNPC 4QPIB 4G9SB 3GLJA 3IC1A 2JB4A 4XPVA 3NJXA 1ASJ2 4ZS3A 4N7IA 1O7FA 4OQ8A 1CBXA 1GSLA 1UY3A 4YZ1A 4H7LA 3D7GA 5CISA 3RZKA 3OGVA 3CL1A 3BPSA 3W91A 1VE0A 4YW1A 3SKVA 3SI2A 2WIIB 1BMV2 2PHWA 4LIVA 4QPGA 3GALA 3KHCA 3FIXA 3KL9A 2MNGA 1S2KA 4BMHA 1FT9A 4OUSA 3POSA 4MZUA 3CXQA 5F2WA 1LOKA 2C6PA 2VJXA 1D0HA 3ZYBA 3OPWA 5E1RA 1UIJA 2W08A 2WAAA 2VECA 4HOOA 5EYYA 2JE9A 1XE8A 4UFHA 3WSOA 3KB5A 2FHRA 1UKGA 3KV6A 4CYDA 2E6VA 4YZ3A 1H4HA 4Q4W2 3VH9A 3K48A 1Y7RA 2ZEPA 5FJKA 4BH9A 2FDIA 1GNZA 1ENXA 4TN7A 4NCZA 4OAEA 2G9GA 2ARXA 1YI9A 3KR4A 3AC0A 1VAMA 4AQSA 1AUYA 2CTBA 2QNKA 3D7DA 1YQ6A 4IEOA 1GOHA 2D4OA 1VIXA 4WJBA 5A70A 1ULGA 3CEWA 2PVVA 3FL7A 1U5IA 3B3VA 1ZLHA 2W52A 4XF4A 2OZ6A 2D3RA 4CPAA 3TBDA 5KC5A 4OMDA 1IOIA 1Y0YA 5AC91 1MJBA 3L2YA 5GLTA 4HXCA 4LBNA 2RR11 3LE0A 1X33A 2W5FA 4NROA 1D4M3 4QB2A 5T5OA 3VBOA 3JB8A 2WYFA 5BNNC 4HETA 3AMNA 3LCPA 3PUHA 4CCOA 3B9CA 3ACLA 2WYRA 4WWVA 3FX6A 4CU6A 3LFMA 3E5UA 2F6BA 2WC2A 3OYWA 4Q2FA 2PIZA 3U11A 4LHNA 5FP9A 3CJIC 5C9AC 1PHMA 3DPRA 2TBVA 4GMP1 1GZCA 1NCRA 1WCQA 5LRGA 4IV3B 5I91A 4P4BA 1R091 1PZ7A 1S0GA 2ARCA 1UOGA 4FPKA 1UKRA 3DR8A 3SCFA 3U4SA 5JXHA 4KVXA 1UPSA 5FQ0B 2B58A 1W8ZA 3MLKA 4BK5A 4QX7A 5JUVA 1ULEA 2HWE2 2D7FA 4YM3A 4OLLA 2R1BA 4DUKA 5I0TA 1E5IA 4FXKB 5CFCC 3ZKYA 5FY9A 5LEKA 2X05A 4K7JA 1LECA 1K4JA 4YW6A 4XUOA 5D8NA 1GWMA 1Z78A 2VZ1A 3E5XA 3OD4A 5G1ZA 1V9U3 2WSAA 1UOJA 4HKLA 1BEV2 4CDWC 4AEDC 1RUH2 2XEIA 1ZG7A 2D6OX 4LEJA 1UZVA 5A28A 4UF4A 4IEXA 1XYOA 1JQGA 5JPNB 4IAVA 1UCXA 4HL0A 4IV1A 5BNOB 3ELNA 1W39A 1G9BA 4KUAA 1Z7S3 4Z2WA 5FO9B 1UX6A 4IEPA 1S7NA 1VBA1 5A6XA 2IC1A 4SLIA 1XJAA 1YFYA 5FUIA 2E32A 2PRQA 2JDHA 2RMU3 3FMCA 1XFOA 1O59A 3RZZA 4COUA 2B5GB 2JG8A 3CNAA 1OA4A 1ZZCA 3SJXA 1YGHA 1DQ6A 1LESA 1IS6A 1PM4A 3OUHA 4AVCA 2Q43A 4QKBA 4C2XA 4IE7A 2ES3A 2QCSB 3K3NA 1HRV2 1STMA 5APAA 5C8CB 2RS12 1UWWA 1GP6A 2HKXA 4XXAA 3M7AA 4MGQA 3KI9A 5FTTC 3GZTB 3MV11 3APBA 5FZ8A 4NPMA 4HPKA 1NSLA 3ACGA 1VBB3 1OMIA 1UU4A 2ZHLA 1MEC2 4PLMA 4M6HA 1RYYA 2VOTA 1WMXA 5CEHA 3ISXA 1V0AA 2BSWA 2W91A 1Z5RA 2CF4A 1W0NA 2C6GA 1Q43A 1F15A 2R062 2XOMA 4HVQA 3WF0A 3KR5A 3SH5A 1GZWA 3ZOIA 1FATA 2J1SA 3MUY1 3PUAA 4QB1A 3VARA 4XVHA 2XXZA 1LRZA 4GH4C 3O7OA 4EWTA 5IUQA 3RJRA 5FZEA 3CZJA 4C1XA 1M1DA 3HNYM 3IZOA 2JECA 1XOVA 5GZEA 2HLEA 3ZPYA 1H2LA 3GHNA 3ZIXA 5C7GA 2FZ1A 5C6CA 5K0UA 4JD6A 1MVQA 4JKKA 4UEEA 5LB6A 2ZHNA 4AFDA 1M4DA 1V6LA 3OGGA 2WNUB 1W8NA 4IETA 3T08A 1O3SA 5FO7B 3N3HA 1X12A 3R05A 4UW4A 1PVC1 3UY5A 4P6YA 3AX4A 2VI7A 1S2BA 4W8JA 3V0AA 1JOJA 5IK7A 1OPMA 1AYM3 3IAQA 4QUSA 3ZFEA 4RHV3 3AM2A 4L99A 4LOTA 5A3UA 4AE2A 1QQP2 2EVXA 1S0JA 2ZX4A 4HZFA 4XTMA 3ZYPA 1VHOA 4P4EA 3FX3A 1V6JA 5F9TA 3BCWA 1HJFA 1HQWA 2QQJA 4M01A 4KOTA 1JU3A 2VGDA 4YGOA 5IJRA 1CIWA 3LZZA 2RE9A 4QX3A 1W6MA 1BK1A 4BIFA 2JDYA 4YM0A 3K2OA 5IT6A 1LOFC 1WA4A 4CP9A 4LORA 1LGCA 1PK6C 2EA7A 2H5MA 1W6NB 4FOYA 5D8AA 4AEJA 2RJLA 4WVMA 4F9VA 5IK5A 3C3VA 3PBBA 2J1TA 2XWBB 1TME1 5FXXA 5FYUA 4DXTA 3TNQA 1PO11 1VIWB 2Q4YA 4TSVA 4MOAA 3WUCA 1UY4A 2ZEWA 2XPJA 2W9XA 1HQNA 5JOZA 1C5HA 3Q8EA 2JIJA 3UKNA 5BXXA 1IKQA 1V6OA 2JEMA 1QSTA 2D4PA 5FY0A 4BQYA 2YROA 1SFPA 1HEEA 2BNNA 3VHOA 1DBNA 4MHRA 4AFCA 3ZFGB 4X8PA 5GLVA 4Z8BA 3IWWA 2CTVA 3FWEA 4JRLA 2D3SA 4NE9A 5LBBA 3ZLIA 5FYZA 4Q38A 2FIAA 1AR91 3QH7A 4Q8KA 3N7MA 2FCTA 2YDEA 2QQMA 5FPLA 1FPN3 3KGZA 4ES8A 3C7OA 2ZGOA 3ETPA 1BCXA 1LGNA 2DUQA 4FWUA 3K4AA 1HJGA 2Q8CA 5DQ0A 4MHUA 1S0FA 3UJOA 2V5DA 2W2IA 1NE4A 4CPBA 1CAWB 1NZCA 2OOTA 5FZOA 3GBFA 3ZXJA 2D6LX 2MEV1 4JHTA 5AGEA 4PT6A 4HNXB 5F5QA 4ZY2A 2WT0A 1RTVA 2JWPA 3T4VA 4MCQA 5FZ0A 1VBC3 3TO7A 5FK8A 2W1WA 3JBG3 1M4IA 1XNDA 3WABA 1YFWA 5KWRA 2VZPA 3ZN6A 4JGZB 4XUQA 5IVYA 2ZGPA 1WA6X 4SBVA 3NE8A 1VBD2 4K3NA 3H8XA 3J4UH 5HVGA 2Z4FA 5HMNA 3LEIA 2C9AA 3WNKA 2WSVA 3KGQA 3N9NA 3OJBA 4LA2A 4Q0PA 1OOPB 1CR7A 2OZHA 3ROUA 3GB0A 1KDKA 2LTNA 1R43A 1RVF1 1RUJ1 3LEMA 5JWPA 4O65A 3CIHA 1YW4A 2PCUA 2DXQA 1JMUB 2VW0A 2QE3A 4YVSA 4XILA 4IL7A 2Y6KA 2YFZA 3RI9A 1Y0RA 2PHLA 3MF9A 4NEXA 1YEWA 1W03A 3AYAA 5F47A 3AMHA 1Q2DA 4YFWA 4R9CA 1VBE1 3IWZA 4XHXA 4CAFA 2P2KA 1JTZX 4HG6B 2B9UA 1IY7A 2IXIA 5LRJA 4ET7A 1NX9A 3WP6A 3V8IA 1MZFA 2KCWA 3TEZA 5A3OA 3FHQA 3H8UA 3LSEA 4W6YA 3VBUB 3I2JA 4PPZA 4H3WA 2VPVA 4QGNA 4B5OA 4CCDA 3TB0A 4FBEA 3KCXA 4P9XA 2QQVA 3GYDA 2VVFA 3DGTA 2ATFA 1QOOA 1QXRA 1OA3A 1PU9A 1ZRIA 2RC4A 4IGQA 2QQWA 3RNZA 2OZJA 2DV9A 2VO5A 4FPGA 1A34A 2XHNA 5FVJA 2FBEA 3THPA 1YJKA 3BODA 2P5BA 5C8WA 4IEUA 1TMF1 2QQOA 4N53C 3DYMA 2J1VA 3JB4C 1RUF1 4FP3A 5EZWA 1LJ7A 2YHJA 3SI1A 3FLRA 1QNYA 1KS5A 1PNGA 1NA1A 2OA2A 2QVSB 3PVOA 5FZAA 4EN7B 4A37A 4KLVA 5L7OA 4HPSA 2WNVA 4KWLA 3FB3A 1W3XA 3I3DA 4RR3C 3T4HB 2REFA 1JODA 3LQCA 4NN0A 4QM9A 4GXHA 2Y6GA 1N3OA 2VCMA 4OZOA 2ZA9A 4MHDA 5FXVA 1CX1A 4YYOA 2BQPA 4LOSA 1QH7A 3MLLA 2GNMA 4PXDA 3O5SA 4FCAA 3KQ4B 5CIRA 2FCVA 4M6IA 2XBO2 2RB7A 1XBUA 4Q4X3 4UBHA 3I2FA 5FYCA 1YYNA 2JDNA 4MV2A 3MYXA 4B10A 3SQOA 4UBRA 1W06A 1I5PA 3OGSA 1RUI1 4QD2A 2IXJA 1HN1A 3WR7A 4D7TA 3LD8A 3R4SA 1DGWX 4URTA 4X6QB 1A2ZA 1YIPA 4JWPA 2V09A 3OY8A 1WD4A 5FCCA 1H2KA 4P08A 3NSTA 2WZEA 5DN2A 3SEPA 4M85A 4AQTA 3ZMOA 4OI4A 1YX0A 2YNCA 4ATEA 1O6UA 1OD5A 3KASA 4ZPIA 3GJBA 3KHBA 5LEJA 4AQ2A 3VD4A 1POV3 3IMMA 5FQ0A 3NRUA 4KWJA 4F3JA 3BTYA 3ACFA 1PIV1 1SFNA 5AG6A 1LR5A 3IDAA 1NQDA 4Q0SA 3HT1A 1SDDB 5DPNA 3AZZA 1SBDA 4RA0A 4RGGA 3RFRA 7CPAA 4GD4A 1X36A 4LUMA 4M0HA 1F4HA 4E27A 1H8TC 3D3AA 4Q4V2 1BVVA 4XACA 1NCQC 1ASJ3 4BQ1A 4WVVA 4FD6A 2HC9A 4DUXA 3AZWA 3HPNA 2BGPA 4DQAA 4PV6A 1N1YA 4NVPA 4MGIE 1AL21 4P9IA 4EJRA 3WW1A 1FY7A 4YPJA 5JIAA 3N9LA 3KV5A 5FXWA 2ZMNA 4K20A 5T5JA 1SHWB 4CGOA 4AGVA 3A4UA 1RC6A 2FSRA 3VZLA 3WEZA 2J42A 3D2MA 3UETA 1F35A 5A27A 4LUAA 1ZX5A 1HW5A 1H1MA 1AR83 1LEDA 2HWD1 2CDPA 3LOIA 1RUE2 3T2OA 4B7KA 5L9VA 2JX9A 5AVAA 4A2UA 1ZZ6A 1OT5A 2BP6A 3ZM8A 1B35A 3K9UA 4DUWA 1TXRA 4K40A 2A3YA 4A31A 2JBJA 4U5YA 1H9WA 2Q04A 2E53A 2JD9A 4GS4A 4HN0A 4Q4W3 1LANA 4XFIA 4UWIA 1CAXA 2OPKA 4LBOA 4QM8A 2OB0A 4NWVA 1AR72 3GGLA 2NPIA 3LGRA 1NXD1 2ZXQA 2VVDA 4UOJA 3RNSA 1MS5A 2HWF1 2V8GA 2GP3A 2BTVC 3ME2A 3NAPB 5A3MA 4OMCA 5HI0A 3WNOA 4YVWB 5KR7A 3VBSC 3OB8A 1M4GA 4J3GA 5FZGA 4AG4A 3SCGA 4KG8A 1O5LA 4DY3A 1COV2 1YQCA 2JLMA 2AC1A 5KXDA 3W58A 3HBKA 2BOAA 3AZVA 2I07B 4N43A 1JHNA 4XJ9A 2LUWA 4KU7A 4E4SA 3N9MA 2OU2A 3M3IA 4MHYA 1VBB1 3AB0A 4IUSA 5DUVA 1U0AA 1AF9A 4XCBA 1MS9A 2BUEA 5CFDC 1HRI1 2QJ8A 1RXTA 5G04L 1Q7LA 1LOEA 3UNPA 1VPHA 4DY5A 2D5FA 2Y33A 1TZOA 3MHZA 1OFNA 2VNGA 3MIEA 4F0YA 2VEZA 2YPJA 4DUVA 3TN92 2X8KA 3CQOA 2ZMLA 2XLGA 4E4ZA 4AXVA 2C1FA 3T0AA 1Y9QA 4UF0A 5HCAA 4GWIA 2Q7BA 3U0ZA 4DEVA 1F4AA 1JH5A 3MIGA 2DTWA 4JLYA 2WRAA 4Q4Y2 1XYNA 4FFGA 2PHRA 1S0DA 4DNYA 3GCWA 3L9JT 5BY5A 3LD2A 3MIHA 4CRZB 4YLZA 4JGYB 3VKOA 1ZBA2 4JYWA 4LQGA 5FUNA 5BV6A 3NV4A 5FXZA 1CJWA 2PJ0A 3ZSJA 3C7FA 4TWTA 3NV1A 3LAGA 1O4ZA 3D68A 1DIWA 1KD7A 4A41A 5K7PA 2NSMA 1GBGA 2ZGMA 1W6QB 3USUB 2WL1A 2E26A 2Z3MA 4CDUA 4X3RA 1MQTC 2BRTA 3B94A 5K8NA 2Y38A 3INAA 1WBFA 1UIKA 2J8RA 4JZRA 4JZ0A 3I2IA 2HWC2 2R30A 1LOGA 2DU1A 4RFRB 4GKXA 3K4DA 2N7GA 5D1IA 3PB9X 4S2FA 2VQAA 1GNHA 1QHDA 5LASA 1OQ1A 3MRUA 3F2ZA 4XPDC 1JU4A 1LCLA 3ILNA 4G3YC 2P1BA 2F8HA 3R6SA 3I59A 2Q8DA 4A44A 1HRV3 5JSPA 1TF8A 2RS13 1YI7A 3RYKA 1M4LA 2CYFA 3GZUC 1N3PA 4NGSA 5L73A 3KT4A 2I45A 4L11A 2XVKA 1UF2C 4E2AA 1W8OA 2VTFA 1G8WA 4TYSA 3KT7A 2H6CA 2WSUA 5IATA 1MEC3 4CGMA 1LOBA 1LKNA 2D6MA 3M1HA 4Q29A 2ZTNA 3RPQA 3DR6A 4CCMA 2B45X 4F9UA 4YWAA 1ODNA 4OC1A 1RTQA 2IL4A 3TX8A 4DJLA 3CDZB 1EAH2 4BK4A 4CDXC 2CU5A 2DYCA 1YLOA 4XDOA 4XJ8A 2ZEHA 1UYPA 5ACA2 3Q9OA 5IVEA 2BO9A 2JE8A 4I02A 3U75A 1J4JA 3B35A 3RZJA 4BJ0A 2ZBJA 1SACA 2XJRA 4OI2A 5JR7B 3BKZA 3LB9A 3H3UA 3DLJA 2QQKA 2LROA 2Q30A 2PHDA 1R3NA 4Z07A 3ALQA 4H89A 3W9AA 1XRUA 2Z3PA 2I3CA 1JS9A 1HB2A 4PXBA 2WN3A 1YQ8A 2Q4VA 2X5IC 3POWA 2BZDA 2AUYA 2VH9A 2ZW6A 4XFGA 2JG9A 2QVPA 2AFUA 3J7NA 4FFHA 3TT2A 1OVPA 5CYYA 1FMD3 4ZGYB 4N7UA 5CPAA 1PO21 1ND3B 2OR4A 1QQP3 3WQ1A 1IIDA 1UYZA 3WDYA 5ANNA 2J22A 2WINB 4AI0A 1BJQA 3DEMA 1CAUA 4BU2A 3WW2A 2BYVE 4XJAA 4BMBA 4KSFA 1OKQA 3B7MA 1OBRA 1OQEA 1AYN3 5C4WC 3VD5A 4ZKTB 1R082 3MV01 4BBHA 3BGAA 1BVP1 3HJRA 5A3PA 4EMEA 1NZIA 2Y6HA 5I8SA 2OKXA 1W6OB 2FQPA 4LBLA 3BTXA 4A30A 3FBUA 2R49A 3VBFA 1OLME 1A78A 4B1MA 1KITA 1PVXA 2ZAAA 3ZR6A 1TIQA 4ES9A 1WW4A 1MS0A 5HH1A 1QMJA 3C2UA 4COZA 1ZBE2 4D3WA 2XVGA 3QD6A 3SH3A 3OBTA 3D66A 2NZ9A 3T9YA 4PDWC 1B09A 3WC5A 1V6IA 4CAEA 3WV6A 4MFJA 2VUDA 1NE9A 3W6XA 1RUD1 3A22A 4HSLA 2R071 3WDVA 1PX3A 2GNBA 3V56A 4IEVA 5EQUA 1QJY1 5HCBA 2WS91 4RQPB 4QDSA 3ZFFA 5FMOL 1UPIA 2P3IA 4UFJA 1N1TA 2NP0A 3WNLA 3H8EA 3ZYGA 5A7SA 1RMU1 3Q8AA 4AG7A 4RS2A 5A6YA 3B3SA 1KQRA 2VNRA 1NQJA 4H6UA 4CS0B 2IWGB 4RD7A 1RUNA 5A7WB 1S7LA 1BKZA 3LPGA 1YRZA 3KHXA 3KCYA 4WM7C 3PTYA 3MIBA 1VHEA 2B42B 2CY6A 5LBEA 5LA2A 2ADDA 4KUBA 4CEWB 3I9SA 1SLIA 3O1OA 2C4XA 1TNFA 1DLLA 1LHNA 1QQ9A 1XYPA 4NF1A 1K5JA 4P45A 3F95A 5F09A 4I2OA 3VDDC 3OUIA 1YQ5A 2ADEA 2RDQA 4IUGA 4CEYA 1GR3A 6CPAA 5CBMA 5JZGA 1B6BA 1SPPA 3LEGA 4ISQA 3VBRB 4E8CA 2ZX2A 1FNZA 5JH9A 3TEYA 1VBD3 1JYVA 3WP4A 1CAVB 2VZQA 2P6CA 2KXLA 4B1LA 1IS3A 1IGOA 3T0DA 1CESA 1PMHX 2JDKA 5C3SA 4Y1XA 5EJ1B 1CZSA 1PCAA 4GM5A 2RS52 3AKRA 2AFZA 2G3AA 1DF0A 5JAXA 4LIUA 4XUTA 1CZVA 1RUG2 2JDCA 3FFZA 1X7NA 2NQYA 3WLUA 4ORFA 4KL1A 5B2GB 1W90A 3SXOA 3CF6E 4Z1VA 4UI9L 1JZ3A 1W0OA 1CZTA 2CDOA 4ZZ8A 3RZLA 4LXLA 2BL1A 3JD72 1UXZA 2W1SA 4MXWB 4OHWA 2D6PA 3T2PA 2ANPA 3TFYA 1ZZBA 1Y7BA 3OOXA 3ZMNA 2X7BA 1Z9UA 5C3OA 2B9VA 4B29A 3BI3A 4YG6A 4NUBA 2VE1A 1XSQA 1PGW1 1HDQA 2OZUA 3A23A 3U1XA 4M4PA 1QJU3 2FCUA 3S6FA 3J7MA 2C9KA 5JDBA 1W6PA 4A38A 1PX4A 1C3HA 5CKNA 1GYTA 4DOUA 4YW7A 1RB8G 1UWYA 2POKA 4PQQA 5IK8A 1EV11 4FOVA 1DYOA 3JQWA 2E51A 4RS5C 4C2YA 4F8ZA 4UWJA 4MFLA 2VOWA 4E0AA 3DPRC 3T8WA 1ZG8A 3MO4A 1XBFA 4JDMA 4LQ6A 3PUSA 2WN2A 2ZX3A 4BPZA 2WQ4A 2PR8A 3W5MA 4K8RB 3QBQA 2VOXA 1RITA 3D8PA 1SQ4A 1ND2A 2VQYA 4J6GA 4YU9A 5JXIA 1G9CA 1WW5A 4QPGB 1GICA 3ZXFA 1AR81 4CP0A 4K1ZA 5A33B 3H1YA 4XF0A 4COVA 3ST7A 2PELA 5GLZA 1VB4A 5C71A 4NRPA 2A6WA 1MS1A 5AFEA 4DRVA 2XEJA 5GCNA 2PJBA 1UU6A 3AP9A 1RHI1 3NJVA 4DXSA 3GF6A 2GNDA 2XBO3 5AC92 3DXTA 2EO8A 4OHYA 1AX0A 4IESA 3U10A 5JR2A 1KJRA 2RR12 2OH1A 4CGNA 5IAVA 1C28A 3LWCA 5JPHA 2R0FA 1ZRDA 5KTAA 2NM1A 1S7FA 2AREA 1US2A 4IV1C 2RS31 2XHKA 1IGBA 1C1FA 5BNPA 4A6SA 4XCAA 4NIIA 4PBPA 2ZAHA 3HOBA 1YUDA 2A75A 1DGLA 2EXKA 5GZGA 4JXQA 4LQRA 2BPA2 1TEIA 4META 3D4UA 1BLZA 1YFUA 3I4IA 2YBKA 3DGVA 1R092 2JXAA 4MMOA 3C7EA 2ZCWA 3NL1A 3AYCA 3IDCB 2HBUA 4GKYA 2QQUA 2XB6C 2Q7SA 1P8JA 2GMMA 4UEZA 3CKHA 1GUIA 2R98A 3VBOB 2ZENA 4M00A 4A2ZA 2X10A 3BJ7A 3ECQA 1XNTA 4MO3M 3GY9A 1K3IA 1UOBA 1QU0A 1G9AA 4B5PA 4BD9A 4IEZA 4DNCA 1U6MA 4FOQA 5BPXA 3OYWB 4YG0A 3ASIA 4NAOA 2EBJA 2JDUA 1YNAA 4B3NA 2DVBA 5FY1A 1L7QA 1NCRB 2FVGA 3S6HA 4NPLA 4B6ZA 2EAAA 3IIIA 1Y7EA 1IG3A 3H5ZA 2WWUA 1QWRA 5H9RA 4XW3A 4YSFA 1CQ9A 2DCKA 1Z4RA 2Q5TA 2KR2A 4CDQC 1S1AA 4FAHA 3CHXA 2QFEA 4ONWA 4XIOA 1VBA2 4DXRA 3KSCA 4MRIA 4QX8A 1RUE3 2GALA 1BXHA 1CPXA 4FVVA 3OF1A 3CBNA 3FJUA 2Y26A 2PQSA 2CL2A 2A7AA 4N9IA 3WUDA 4OUEA 4NGNA 2PJ4A 2WDBA 1YMEA 5LCWL 3GHMA 1Q3EA 5I8YA 2FE7A 5AG5A 1PM7A 3VUOA 5F6KA 2V4AA 5BNNA 2R041 2AZ5A 2ZEXA 1KRIA 5ABJC 1HB4A 5A3WA 4XZPA 1TKJA 1AR73 3PP9A 3IU2A 5JOWA 3FEEA 4HK8A 3CJIA 5C9AA 2PA7A 4XNHC 2DCTA 2GC0A 5FWJA 4BZ4A 4I0AA 3MLJA 3C26A 1ENSA 3LACA 3OGJA 3MGUA 4MXUA 1GZ9A 1F57A 5FREA 4Y49C 5A32A 2PSWA 1ACCA 2JG8B 4LTAA 4IE0A 3J8F1 5LYDA 1COV3 5EPAA 1QH6A 3Q8BA 1K12A 1YC61 1JZ2A 1X82A 3VBHC 4N8MA 1XE4A 3OD0A 4XC9A 2ARHA 1TVGA 2CNMA 4OHXA 4DYOA 1LAJA 2BWAA 2XQRA 5CFCA 3P3PA 3GDBA 1ZZ7A 2VG9A 2FS5A 5HCFA 1KWMA 4HPKB 2RM21 2WUHA 5FMOS 3G6JB 4UW3A 3BPZA 2FDKA 4XPLA 4EN6B 3CO2A 3U4XA 2I74A 1Y9MA 2WZR1 3D7HA 1AJOA 3O1PA 4A3ZA 4CDWA 4AEDA 5C3RA 5A7OA 5A6ZA 1EPZA 1S55A 1NT0A 1ND3A 4BQXA 1PVC2 1GZWB 1JUIA 2XJVA 5AG4A 1G9FA 1XE0A 2WT1A 3WG1A 5FZFA 4NMIA 4HMZA 2PQQA 3P5BA 2R7HA 1XC6A 3A21A 2ORZA 4Q4Y3 3RWNA 4CU7A 3IPVA 3ZN5A 4Q1RA 4LE4A 3UV9A 1O5UA 4P4DA 5F6LB 1WK4A 4II9A 5EV7A 4BWOA 3FLPA 5K0UB 2JJ6A 4AFBA 4UFKA 4A4AA 4FSJA 3MFCA 2PJAA 4CA9A 1OVSA 1REDA 4PI0A 2A1XA 3VHNA 4KS9A 1FMD1 2YXSA 1JZ8A 2CXAA 3EB7A 4C1WA 1SCSA 2EAKA 1OBNA 4OVEA 3LDRA 1TME2 3ZFEB 4ISRA 4XBLA 2O28A 4CSWA 3NO8A 1PO12 2PJ5A 1H4GA 3WD5A 1JUHA 1S7KA 3FVLA 2UU8A 3MI8A 3M2MA 2V73A 1CD3G 4P9LA 2HWC3 1AYN1 2QMLA 5D21A 2PLV1 3I7DA 4KWUA 5AG7A 4YFZA 4NHMA 1W6MB 3H8GA 1DCSA 3X29B 1J3RA 3S57A 2W87A 2Q4SA 4CP9B 2RHPA 3WHTA 5D8AB 3L2NA 1XB9A 3S9LA 3KZ4C 1UY0A 3WQBA 2ZEMA 4GH4A 4XXPA 3SXWA 5J36A 1AR92 4WM8C 3RG0A 1IG0A 4QHBA 2AACA 2WWJA 1GKBA 1WW7A 5C3QA 4KGQA 2DU0A 5C88A 4JAAA 4QXBA 5FZHA 4ASKA 4ITCA 4MFQA 4CU9A 3EC4A 4QPIC 4AHYA 4XQWA 2Z3LA 3WP3A 2BU9A 1W2AX 4R9AA 4XFCA 1ZA7A 3VGIA 4BQ2A 4MVTA 1F2OA 2CGOA 1WKYA 3TYJA 4MJ8A 2MEV2 3I3EA 4AAXA 3AJYA 5I0UA 4DXZA 1VAVA 4N9HA 2ZW4A 1FNOA 4P14A 2ZGLA 5FRAA 1Z8WA 2MHFA 4XHBA 4CCKA 3THCA 4AEMA 5ACA3 1CX4A 3VKNA 3VBRA 2KM2A 2DFCA 5E88A 3ZYHA 1GZTA 1QJX1 4EWDA 3O1MA 3GCXA 2GMEA 1DZTA 1GQPA 4HK9A 2WFF1 1YLLA 5LBFA 3QOPA 4MSVA 1LOFA 3E0KA 2TEPA 1QJFA 3NJYA 1PK6A 2WO7A 5BYNA 1NLQA 5FZOB 1QXPA 4YFJA 3PB4X 2DVAA 3WVJA 3D5OA 1IYKA 1K45A 1RVF2 4XYXA 4LKEA 3VDCA 1RUJ2 4YGEA 3LDBA 3T2TA 5JI7A 3OBAA 2W46A 2GDFA 1ZG9A 3H3LA 4LK7A 2JEWA 3ZN6B 3RZAA 1SG3A 1WLDA 1RUC1 1O8SA 1FOD1 1QSMA 2XEFA 4OC3A 4I0BA 4Z82A 1J83A 1O3RA 5E89A 4PSWA 4IW3A 1VBE2 4LHLA 3QAHA 3PEIA 1OA2A 5KXCA 1QSNA 3POFA 1R083 4YARA 2EXIA 1O4YA 2BGOA 1R57A 2HWB1 4IGOA 1S0IA 3S5AA 1L3JA 1SLTA 3PFOA 1T2XA 2QZ2A 4PI2A 2O8OA 4YVSB 3WDUA 3RI8A 3ZX7A 1Z4EA 1UZYA 4HKWA 4CCEA 4E4HA 4FPFA 1R1ZA 3JTKA 1ZBE3 1WMFA 3W6SA 5CZKA 5F8PA 1UMZA 4GWNA 3PL0A 5FMCA 5DG2A 5HXDA 3OBZA 4B4QA 1MPXA 5FZ3A 4IV3C 3HEIA 1OLRA 5J7MA 2DPSA 5I0RA 2HEWF 1GANA 1UZ0A 4QQLA 1NLRA 4QGLA 3IWGA 4C91A 1QJU1 4MHZA 1JOBA 2I2SA 5F1RA 2JKBA 1TMF2 1O91A 1POQA 1QIQA 2Q51A 3KMHA 1DU3D 2DCJA 2AEZA 5FLJA 1D0GA 4MFZA 2ZOGA 4L8QA 1RUF2 2XUMA 3JVNA 2D97A 1ALYA 2FMYA 5KHHA 1EY2A 3OCPA 5A33A 1IPKA 1UZZA 1JZ5A 2AFOA 3TRSB 3VD7A 2P34A 5IFPA 4H55A 3ZPOA 1KUYA 1ULFA 2QKDA 4R87A 2AFMA 2Z69A 4DS0A 2VZZA 4QDQA 4Y20A 3PU3A 2GSYA 3D6EA 3VATA 5IAXA 4OC4A 4E2QA 4A33A 4JJXA 2OX0A 1DGRA 3R1KA 1GOFA 3KGLA 4XUPA 5BNOC 3MICA 3AVSA 3AFGA 1RUI2 1EUTA 3DECA 1ON0A 1NA1B 2BDRA 2G9FA 4LO5B 1U5XA 3KQZA 5A7QA 5L7OB 1T6GC 3WNPA 2WNVB 5DUWA 3KLSA 1H9PA 1GV9A 4AB7A 1E5RA 3SNMA 2ZZJA 1BPMA 4NGPA 2XL9A 3NV3A 2GAUA 4KOXA 1ZRFA 4BQ4A 4LBQD 3GBWA 4LBKA 1S4CA 5J98B 3KWVA 5C82A 5C8CC 1YIFA 1RUG3 1PIV2 4O9GA 3ACHA 2W1UA 3URFA 4NWWA 4PQAA 4GB31 1BBT1 1H1IA 1LEMA 2AH2A 2JIGA 3ZXDA 3RZMA 4TWEA 1XMTA 4ZU5A 4DMIA 3JD73 4ZX9A 3OY8B 3KKWA 4PDWB 2OPWA 3NNJA 1QKQA 3K75B 1F2NA 1X9TA 2ZOFA 2VZVA 1ZM1A 2ZEOA 1XXNA 4M3SA 1MZEA 3IT8A 4EROA 4N53A 1F5JA 1M44A 1W3VA 5E6HA 1UMHA 2YYOA 1ELMP 2VBPA 1AL22 4O61A 1VRH1 2WFPA 1R1A1 4I49A 4CUBA 1LAMA 5J37A 4RR3A 1RJ7A 4F8AA 2YNDA 2WPXA 1DYKA 4OHZA 4AI2A 4BMEA 1Y9WA 2WNUC 2HWD2 4UAPA 3AKQA 3P6BA 2BW8A 2YNEA 5FV3A 4CE8A 4WZFA 5BNQA 2GFQA 4NIHA 3WC6A 3VD3A 2OS2A 3T30A 4Z2AA 3R96A 5KTCA 2WNOA 2P37A 4M3CA 3UKVA 3RQ0A 4ASLA 2X53S 3B5LB 3W20A 1OQDA 1Z2LA 1ENQA 1YREA 4ZY1A 2VAUA 2ZOEB 1AR61 4J25A 3QLQA 4A42A 2GE3A 1YHFA 5ISVA 4PCRA 5FY4A 2F5IA 2XJPA 2FDJA 2CNSA 4NFRA 2HWF2 4MHNA 3AP4A 3EFAA 4Q1PA 3FUQA 3WINE 5HVFA 1X10A 3DXUA 3BALA 5DDJ1 2QUOA 4CP1A 3PB8X 1B35B 1ELLP 2GC1A 5LY2A 1YLEA 3K9TA 4OYUA 5FMBA 5AC93 3DDDA 5LK5A 2VUCA 2RR13 1I9RA 2PJ1A 3LDKA 3VZKA 4QGMA 2NYYA 2WABA 2Y6LA 1CAXB 1LCPA 3J7HA 4OIDA 1VBB2 4GJZA 2BOIA 3UGFA 4XPKA 5CNPA 4AQ6A 3VD9A 4F83A 2X09A 3A0KA 2B3UA 1NCQA 4CYNA 1HRI2 3ZFGC 2QQLA 5FYHA 4HFSA 1SEFA 3PNAA 4GMP3 1LFWA 3AZXA 5KHJA 1H6YA 4CVUA 3O1TA 4FTSA 3B3WA 1AXKA 1PGL1 4AOCA 4HNWB 1U12A 1R093 4EWAA 2LRPA 1W8FA 3RYRA 3PGPA 2JENA 5CKQA 4E2SA 1K5MC 3JQXA 4MGZE 1VB2A 5LYIA 1MVEA 4N43B 5KHGA 2HUZA 5H9QA 3TAYA 3AKTA 1PMJX 2QTWB 4QX0A 5DUXA 1ZZ8A 1QSRA 5GZFA 1MK4A 3O12A 3N7KA 3LOBA 5FBJA 1AVBA 2OIIA 3FUOA 1PZ8A 3D82A 1WCDJ 2XMLA 5FZLA 1BPNA 5ELYA 4Z92B 4GZ9A 3OSDA 1GYKA 1ULDA 1TKFA 2A6VA 3DYOA 3IB3A 4MCPA 4JGZC 2NMTA 1VKCA 4YWYA 3SJEA 4UF0B 3SJFA 3LA3A 4KBZA 1KDMA 2A6XA 2ENRA 4P44A 3LFIA 2P3JA 3NH5A 1ST8A 2V5YA 2RJ2A 4S2DA 2W94A 3BJ8A 1OHFA 2B46X 2GH8A 2BEOA 4RFT0 3O0XA 1ZO0A 4BM8A 2IQ6A 1VBA3 1JI6A 1OOPC 4HT1T 4L8AA 3I2KA 5EYXA 3VBSA 4LKDA 3I3BA 1OZPA 2E31A 1W2TA 1Q8PA 4WVZA 3WT3A 4MFPA 3V7ZA 3LEKA 2ZEYA 1HXS1 5HCHA 5SV8A 2ZABA 4FQ4A 2PRBA 5EP9A 1V6MA 2VY0A 1CVNA 4CTEA 1UMIA 5BWAB 4OC2A 3H7JA 4CDUB 1FX5A 3NKGA 1HB1A 2JKXA 2Y6JA 2B5HA 2R7EB 2HQYA 5DWNA 4GJYA 1C8M1 2C1CA 2VZUA 3SHPA 4V1PA 5CFDA 5FOBB 5FR3A 4KOYA 4BE3A 1A3KA 2BBAA 3FE5A 4PHZA 1IQAA 3NQHA 4I3GA 1DQ0A 3ES1A 1YK3A 2YBSA 3B3QE 4HNYB 4U9ZA 4LK6A 4R6TA 3FBMA 3VBUC 4RL7A 4RGAA 4UW6A 4C68A 5IVBA 1Y3TA 5I93A 2QDNA 3ZZIA 4LO6B 5LA9A 5FUPA 4Q0QA 3ACIA 4UCNA 4ZY9A 1AL0G 1RIRA 3NV2A 4EZHA 5I8TA 3WW3A 2W3JA 2GLFA 3I59B 2CHHA 1XNCA 2O0OA 3V0BA 5CBLA 2F17A 4M0NA 2PJ7A 5SV5A 4X8NA 1QJEA 1QF3A 4AHZA 1PMIA 3S7EA 1YFXA 4XFBA 4KOVA 3AMPA 4AAPA 1XOYA 2ET7A 1VP6A 3IDEA 2FDGA 3VZOA 3WW4A 1HN0A 8CPAA 3AP6A 2SLIA 4HN1A 3UGHA 4AVSA 1Q8OA 3PRTA 1YCIA 3A9LA 5F7UA 4YW3A 1W04A 1A8DA 4LULA 3N35A 1PVC3 5FO8B 2BBVA 4CZSA 4XZUG 1KUXA 3AKSA 1MQTA 4UBGA 5JSRA 1PO22 4YGBA 3LIHA 4LBMA 5IYYA 1C8NA 4W6XA 2R6QA 4UXAA 3R4UA 2FD8A 2WT2A 1CONA 3ZDSA 5TSWA 2W68A 2HYXA 1HX6A 4DFSA 5T54A 5DZGA 1VGYA 4C0BA 2V72A 4BYYA 3ETQA 1YW6A 1ONAA 4IEWA 5FZ7A 2BFUL 2DVFA 3HD8B 1V70A 3I49A 2JB8A 4FAGA 2VXJA 4LLOA 2P0WA 3MEPA 5A3LA 2JG9B 3POJA 3E5QA 3N4MA 4NGQA 5JXJA 4PQ9A 1J84A 4RUHA 4XJZA 5FPBA 1TME3 3WG3A 3ZYIB 4P00B 4R7MA 1PO13 2UYBA 4URAA 4MGSA 3E6CC 4F6AA 1GLHA 2G4IA 4FPEA 4CGPA 3MN8A 4RI1A 1SBFA 5FLIA 1EP0A 2A4NA 3AYDA 1CAUB 1QOTA 3JUWA 5J48A 4FPCA 3PIJA 1CP6A 4TLGA 2QDRA 2WYSA 1JYWA 2Y34A 4CDXA 3VKMA 2VL1A 1W9YA 3H1WA 3ILRA 3W59A 4KOSA 3S9NA 1RUD2 1SLAA 5C33A 2RDNA 2R072 3ZN4A 5G21A 4INDA 4AR2A 3MBWA 4HANA 4CAVA 1QJY2 3VBFB 2WS92 1QEXA 4YZ4A 2GC2A 2VTXJ 4U9YA 5DWMA 4M6GA 2WR9A 4FUUA 1RINA 2PHFA 5EHDA 1RMU2 2VQUA 4PXEA 2F4LA 3R9GA 3JCIA 1S2EA 1H6XA 1OH3A 4Y5TA 3D0JA 2UWBA 2H0VA 4AFAA 4UFMA 2QIRA 2ZEDA 1V6KA 3VHPA 4DPNA 3ZXEA 5F48A 2VBBA 5FY7A 1REEA 1CM0A 5L19A 4D7YA 5EC4A 3MW4A 5DZEA 2EVNA 2H0BA 2JDDA 5FYBA 3DSBA 4QKFA 1HV0A 2MEV3 2GH2A 1JZ4A 1IS4A 4EE2A 1N3QA 4UFWA 1PYTB 3RAMA 2BEIA 2J1RA 4LO7A 1VMFA 2YGWA 4K21A 5FPUA 3VDAA 4D8MA 3ZFFB 3WCSA 3SMHA 1S0BA 3DKQA 3H7YA 5EXOA 3TE4A 4ZU7A 3AFKA 2C0ZA 2YV8A 2UYAA 3I3QA 2RJKA 3VWDA 5GALA 4KI5M 5C4WA 4FD7A 5FPAA 3RRDA 4UIAA 2A3XA 2AENA 2H6BA 2Q0AA 5T55A 3IMNA 2IFRA 2GU9A 1YVOA 4AHXA 4GIQA 3KHZA 4NSQA 4CXXA 3ENRA 1UL9A 1SMVA 4LKFA 1Z0HA 1RVF3 1LHVA 1RUJ3 1YWKA 1POV0 4KQ7A 2VC9A 2WLQA 3K51A 5E16A 1YQEA 2YC2A 3AXEA 1U5ZA 1IPSA 3RYPA 4MFKA 4CEYB 2P6GA 5JZGB 1BYHA 4UCPA 1SPPB 1N1SA 4PDWA 4NJRA 3VZMA 3NE7A 1ZRCA 4FOWA 4W4ZA 3NAPC 1Q5OA 5CB7A 5FKBA 1VBE3 2YB7A 4YVWC 4TXWA 2ZW7A 3I8TA 5HV4A 4C2ZA 3PB7X 1WCKA 1S3ZA 1D4M1 4H14A 2Z42A 3PHMA 2GN7A 1PGW2 3VKLA 1U5YA 5FFOC 2VZTA 4FD5A 5A3TA 3DL3A 4R3KA 2B4KA 1DHKB 4YW2A 3HR9A 4AK3A 1IOAA 1MJ9A 2C26A 4D6SA 4JTOA 2XKOA 1NG0A 3O14A 4QVTA 4Q7AA 2WZPP 4CXYA 2DVGA 4ASMB 2B4BA 3NW4A 4F7ZA 1VMJA 3WNMA 4EN9B 1EV12 3NFZA 3QB8A 3MIDA 1ZLIA 2JBKA 2VMGA 1XSRA 1H30A 5IK4A 4PF1A 4EQVA 4J1XA 5J3UA 2BNMA 3VDDA 1TMF3 4LA3A 1LULA 3WHUA 4GULA 4R57A 2PQ8A 1RUF3 1UYYA 4KH9A 1XF8A 5J8CA 1W6PB 2Z5WA 1LB2A 4ZONA 3M3QA 3SHRA 4Y33A 4YM2A 2XL7A 3QH6A 2F4PA 3ZXLA 1NY71 2OYZA 4JGYC 1AR82 4IE4A 3H0OA 1DFQA 5F32A 1V9U1 3NH4A 3PTRB 3NWKA 2AFSA 4CCJA 4Y1UA 4B11A 1WLWA 4JKMA 2R1IA 3GZEA 3POYA 3O0VA 3R9EA 3U78A 5FAXA 2OW4A 2BOJA 3ABZA 4JQRA 4YZ5A 2PJ6A 1RHI2 2ZS6B 2WA4A 4MG2A 2ZZQA 2PE3A 3GJAA 3RZHA 1Z7S1 3ZYFA 5LW9A 3WF3A 5FP3A 1ND2B 3B00A 2VCBA 5LA1A 3H8FA 3T1MA 1RUI3 5LYFA 5GLWA 2QQIA 1IHMA 1WCUA 1BHGA 2ZGQA 2RS32 3IBMA 4YRHA 2RMU1 4RN5A 4YM1A 5HXMA 5L36A 1IYLA 2VW1A 4LBQA 1JYCA 4KOWA 3ZVXA 5THWA 1LRHA 3LWUA 1XE7A 2VMIA 4JX0A 4KSAA 1I1EA 2C27A 4D94A 1O4TA 2HYKA 2Q1ZB 2FIWA 5JGFA 3RZGA 4PIZA 5FZIA 2DBNA 1GFF2 4FAIA 4Y4RA 2ZGUA 4S2HA 1PIV3 2Z3OA 2ZX1A 2WO1A 3PU8A 2PN5A 2WLPA 2YZ4A 3D4KA 3TTHA 3FNCA 2BGCA 4OADA 2EIGA 3AYEA 4RS5A 4MGTA 1RO5A 1ARLA 2K0GA 4XF3A 4MGYE 4QBJA 5BNPB 1XNBA 1ZRRA 3USSA 2VMFA 4UT5A 2AEYA 4H7MA 3POBA 1M4WA 1LOAA 3PURA 1XJOA 1LOCA 1JOPA 4JDOA 2BVBA 2Y60A 3EO4A 2RVAA 4O23A 1AL23 2NMOA 2HWE3 3ILFA 3TO9A 4XF9A 1Y9GA 4R9MA 5K8OA 4GALA 1NXMA 3J9SA 3FH4A 4R4XA 4B5PB 4L2NA 5IVVA 2HB6A 3F8KA 3ZIWA 1H2NA 5FKCA 3NNFA 4TNUA 3M3OA 3GNEA 3ZR5A 3RS6A 4FPJA 2HWD3 1R64A 1AYM1 3ZYJB 1BEV3 2IZWA 4RHV1 3MUZ1 1HQLA 5J1XA 3O0WA 1AX2A 1RUH3 3AKPA 2AFXA 1TG7A 4IQPA 3S6GA 4H6ZA 1ND3C 3RO0A 3H50A 4IHMA 5FPVA 3E6DA 2BFUS 1RJ8A 2R042 3PDQA 1NSAA 5HPOA 3PLQA 5DABA 4K30A 4MI4A 2YU2A 2Z2SB 4AI3A 1UY1A 3RGBA 1WWZA 4I01A 1JXNA 5FP7A 5T52A 1SLCA 1W28A 4P9JA 4CCLA 2G9ZA 2RDSA 3FC0A 2HWF3 2DCYA 2FT0A 3FJSA 3E6BA 4MCSA 5FZDA 4LITA 3AK0A 1J59A 1E57A 2HEVF 4R76A 1XPWA 4Z65A 5FOJB 4FI9A 3WQ7A 3HNMA 3OUJA 4CGLA 5BUVA 1X8MA 3J8F2 4CAXA 4W50A 3S6KA 2I79A 2VU9A 2WKKA 3BTAA 1SBEA 1JW6A 1LGBA 2W1QA 3B8GA 1HDKA 1DTDA 5J09A 4XOGA 4UFIA 2XR4A 3NNLA 3TNPB 5BNNB 2QYVA 3ZXAC 1S0CA 4Q26A 2EIBA 3RYOA 2YC4A 5H9PA 3SEEA 5DG1A 4AI9A 4AHWA 1V00A 4OUMA 4CUGA 4I09A 4A3XA 5T5PA 3CJIB 2RM22 5C9AB 4XURA 1F31A 4RN7A 1HRI3 1C5IA 3RDIA 2R063 1IQDC 1LU2A 2XJUA 4YW4A 5CG8A 2HEYF 2WZR2 1HLCA 4QXKA 2XUEA 3BN6A 5A32B 2YBPA 5AFBA 3SC7X 2Z0ZA 4RQPC 2PYTA 4NJQA 5A3NA 1J1TA 1FPN1 5FJHA 3EXNA 2CAVA 1OXCA 4LLFA 1UO9A 5HVHA 3OG2A 3TEWA 2VM9A 1IPJA 2B4DA 5JPMB 3M70A 4CDQA 1M06G 5CFCB 4RGKA 3WF2A 4PIXA 4TTGA 2VL4A 3GYAA 3MIFA 4CEWC 1S5KA 5LRKA 4WVWA 4F0XA 5K9YA 1YJLA 2YPDA 2CY2A 4A39A 1VBC1 5JIUA 4JXRA 2BUKA 3JBG1 3KQRA 3AZYA 2ZPXA 4CDWB 4AEDB 4GWMA 1FMD2 3JRUA 2ZJCA 2NMNA 1DGRN 3DN7A 2VUAA 3IWEA 3PBEA 5ABJA 3FLTA 3VBRC 4KVME 1BAVA 1NMTA 1Y9KA 4ZYQA 4JTNA 5LWBA 1DLCA 3M4FA 1C4RA 4V2WA 5I0CA 3IPVB 2V4VA 2DDUA 3V65A 5I0DA 1AYN2 2PLV2 1NLSA 4UFLA 4C7HA 4XBQA 3ZKUA 5K4LA 2OUJA 3D2PA 4R4ZA 1L7RA 3THTA 1AYEA 4E2GA 3VBHA 4AWDA 4IEYA 3B9IA 4Q0VA 4NHXA 5C5TA 1SLBA 4WBBA 1A6CA 1W8UA 2Q44A 4OC5A 3P2FA 4Y22B 2DF5A 2CV6A 2WA3A 4KU8A 4OKOA 2OQ7A 3IN9A 4P10A 1CX8A 1WLTA 2D43A 4XABA 2ZX0A 1XIXA 3S5QA 2ZHMA 2FMDA 4XF1A 3D67A 2ZEGA 3UK9A 3TWIA 3LKJA 2JD4A 3PJYA 4QHZA 2R0HA 4HONA 3CJXA 2F7VA 4JHZA 4A94A 1SZBA 4QAWA 4DEQA 4A7ZA 4GH4B 3QCWA 3IIBA 1K5MB 3N5FA 5FYYA 2FCKA 3I2GA 3GUXA 3ZYRA 1QJX2 1NUKA 1TNRA 1WZXA 5T5LA 5CNAA 2WFF2 1LHOA 2VXRA 4UIBA 1B87A 2GC3A 3ZSKA 2P6EA 2PJ3A 1VAKA 4C7IA 3MF6A 1N47A 2ZGNA 1LAPA 1EPWA 1VLNA 4GWJA 3R95A 1CWPA 2SBAA 3H42B 3CXPA 4OZXA 4YGCA 4FPYA 3OWCA 3RBUA 4QQHA 4FO9A 1GQGA 1P4NA 1PO23 4QPGC 3IKWA 2IXHA 1ULCA 1MJAA 4IERA 2ARBA 4PBOA 4NR1A 4FT8A 1RUC2 1OKOA 1C1LA 1FOD2 3AP5A 4XTPA 5K8MA 4Y5Z0 4QDRA 3JZVA 3CLPA 4MYEA 5EWSA 1JBCA 1NOVA 1G9DA 2LALA 1GQHA 4Q4X1 1PK6B 2D93A 2PDOA 3M3CA 2C24A 1OC1A 3B2YA 3M3EA 5LRSA 4PLNA 2HWB2 3D0SA 4XFFA 4WM8A 2IVIB 3V64A 2QECA 4C8DA 1SCRA 1G7YA 1AZDA 2WO3A 2YGLA 5G20A 2NYQA 4QPIA 1Z8LA 5IHRA 1KGYA 3KV4A 4TLFA 2AFWA 4CRQA 3N9OA 2CGNA 2VNOA 3KCCA 1POV1 2PHUA 3G7DA 4JCKA 2Q8OA 5FIXA 4IGPA 2VQTA 3VLBB 4RSUA 1Y43B 4XDPA 5EFUA 2WQ8A 4AZZA 2WPWA 4R8HA 1WBLA 1RUD3 1QJU2 5JM6A 2R073 5F46A 4PK2A 2PR1A 3U14A 1QJY3 3VBOC 4FPHA 2WS93 3VZJA 1JYXA 4UYBA 1NAEA 1AHSA 2UY8A 1QNWA 2Z79A 1OLQA 1AJKA 5JSOA 1MS4A 1RMU3 5GJ6A 2UWCA 4KVOE 1UW8A 3VV1A 1ASJ1 3POEA 2WO2A 2ZGTA 1NCRC 4IXLA 3OTFA 2ZGKA 3TOJA 4KORA 3B3TA 3J26N 2CSGA 1MS3A 3HQUA 2YMZA 4YGDA 3PUIA 3FECA 2XJTA 1BMV1 4MADA 2G3TA 4NJ4A 3HN3A 3BIWE 3ORJA 4HBNA 4ZXEA 3W5NA 2PJ9A 3AMQA 1PZ9A 4ATFA 3I3MA 4NPRA 3VB9A 3MZHA 4GAZA 2JEVA 1D7PM 2J7MA 3HBZA 5GZDA 4I30A 3WX5A 5FMDA 1Q56A 4Q8LA 1DZRA 2ID4A 2VZOA 4WZCA 4KOUA 4ZI6A 5A80A 4P9WA 4DRRA 1UXXX 4ZXKA 3BOPA 4K3UA 1KEXA 3AJZA 4NRQA 1IU8A 1TF9A 2A6YA 2VQ0A 1O3QA 4Y20B 4Q4W1 3RWKX 3L2HA 3U07A 3IO1A 1E5HA 5I4MA 4H2KA 4CYPA 1FAYA 3HQXA 1US3A 2DCZA 3E1F1 4OMEA 5J96B 3HT2A 3MPBA 5FY5A 2VMHA 1Y4WA 4FFFA 4GB32 1BBT2 2C5DA 3RJ2X 4Y1ZA 4MBUA 5F3EA 4O7XA 1IS5A 1CPMA 1H0BA 4IV3A 1OURA 3WY6A 2R1DA 1WUVA 4E9KA 1OF4A 2MPFA 2JG8C 4AVTA 2ERFA 5FK7A 2CTCA 4P4IA 4QC6A 3SH4A 2O8QA 4FP2A 4GA9A 4M4RA 2O4HA 2EK9A 3OGRA 2V8DA 3I3GA 5JMOA 2VOKA 4BIOA 4LKSA 4BDVB 1VMHA 3NA6A 3VWEA 1KFUL 4X5KA 5A7PA 4X6RB 1VRH2 4M3CE 1R1A2 5FYSA 2AE6A 4NIGA 3UL2A 2PAEA 1NKGA 2VBDA 4JRAA 3HN1A 1D2QA 4B8EA 2RFHA 4FXGB 3I2OA 1CN1A 2L9LA 5A1FA 4Q4V3 3ATGA 3C8XA 2Y0IA 1EV13 2B39A 3THDA 3CMGA 3KVAA 4PJYA 2PJCA 3K4ZA 3WT4A 4XBNA 3WR0A 5HV0A 4HVRA 5F5IA 4LE3A 2A6ZA 4QB9A 3SLIA 3WDWA 1JHJA 4XUNA 2W0XA 5FYMA 2J8NA 3QAYA 4N53B 3POGA 2HWE1 3PIGA 2ZKLA 5BNOA 2IXKA 4IE5A 2VCAA 4PF5A 1T6BX 3ZXKA 1XQNA 3EXUA 1EYBA 2VBQA 2BNOA 4Y3OA 3OBRA 1DQ4A 5K8PA 1IZ3A 3BLNA 2E7AA 4Y1VA 4RR3B 1AR62 3LODA 5GM0A 3MGDA 2B5GA 5K0UC 3KF5A 4P02B 2J1AA 2WZNA 3ZXGA 3LA2A 1BEV1 1LENA 3OPZA 1RUH1 4M3CF 3FN9A 1RXGA 2Q1MA 1LODA 5F2SA 1QMUA 5DDJ2 5A1AA 1CP7A 1UQXA 5C8CA 3BIEA 2VMDA 5F3GA 4FFIA 1RHI3 3ZFEC 4KG0A 1TKHA 1REFA 1DE4C 2QBXA 3AP7A 2XVLA 1LHWA 4M3CB 1CGPA 2REEA 4UWDA 2NN8A 2EALA 4XE9A 4AVAA 2ZACA 5KHKA 2YFUA 3HMYA 4PLOA 2CAUA 1HB3A 2OXBA 1IOFA 1GP5A 5FP4A 3R0RA 4QU1A 2CGPA 2RS33 2VMEA 3T90A 1HDUA 2J9AA 4CP2A 3CZUA 4ZS2A 2DUPA 1ULOA 3MFAA 2A70A 5G22A 3GM8A 2CNAA 2O14A 2Q4ZA 4BLIA 3P3NA 4AEKA 5JMCA 5LK7B 1FI2A 3K77A 5D8AC 5IB9A 4EYUA 5C70A 1APNA 1QXJA 4BB3A 3WG2A 1HRV1 1PGL2 2GREA 1BOBA 2RS11 4B7EA 1VR3A 2JDPA 4JC1A 1P0HA 1RXFA 3S9MA 5F5AA 4BINA 2XQXA 4UW5A 1MEC1 4AL9A 4C0HA 2W92A 4KBBA 1BQPA 3D3SA 5DAWA 2DF7A 1H8TB 1QDCA 3TO6A 2WNUA 2R061 2YG0A 2VOVA 1J1LA 1W9SA 4PXCA 1NCQB 4Y5SA 4Q36A 3O1UA 2OUHA 3IGRA 1W99A 2G9DA 3G3SA 1RGSA 1W9TA 1D2SA 3TN93 1Q8QA 1O8PA 4AI1A 1F2PA 5ANQA 2UWAA 2VZRA 5K8SA 5J1QA 4KSIA 4B14A 1UNBA 2WQZC 3C7GA 5FZ9A 2EIEA 3SJGA 1UZWA 2HJIA 4H2AA 3NKTA 2A71A 3ZJ0A 4QPWA 3LA7A 2ETEA 2NLRA 3BU7A 2VCCA 4COYA 5JXGA 4BHPA 3H8OA 1L0CA 2ZPAA 1ZBA3 1WWYA 2GNTA 5B4XA 1W6NA 1RL3A 2WNEA 3IEHA 4BXFA 2XGXA 1DQ5A 3BTZA 1OF3A 4OI1A 2XJSA 2X29A 4MY0A 1MACA 1AMPA 4ARYA 5D29A 3CPAA 3BYWA 1QQP1 1HXS2 3ES4A 4FQZA 3BI0A 3C7HA 1G86A 2LW8A 1FXZA 1GMMA 2YU1A 3DF0A 3R4DB 3FF3A 2E7QA 3RVHA 2Z3KA 4BQ5A 3SI0A 4Y22A 4O9EA 1XU1A 2TUNA 2VZ3A 3WQ0A 3EY5A 4UFVA 1I21A 2QQPA 5IB0A 2R043 4HKFA 1EUUA 2O53A 3BXMA 1WGPA 1OUSA 4XAAA 1AUGA 5DXDA 3HLPA 1C8M2 1ZZ9A 5FZCA 3ZFGA 2D6NA 1WLCA 5E8AA 2C6CA 1JZ7A 3T2QA 3GZAA 3VBSB 4PSXA 4NHLA 2K46A 4Y1YA 3Q8CA 2WUUA 5FYVA 3WG4A 4QPYA 3BHXA 3TOAA 3WXPA 2Y8KA 5EJZB 4YNIA 2JDZA 4BA6A 3J8F3 4R9BA 1UD1A 3OPTA 4YVSC 1K5MA 4AF9A 2VZSA 1LU1A 5F3IA 5FZ4A 2OT7A 4Y26A 2E33A 5DS0A 1QGLA 3FZ3A 3PFEA 3CPXA 5KHIA 4CYQA 2Y0OA 3FHIB 1CAWA
chains in the Genus database with same CATH topology
2ES3A 2QCSB 2FZ2A 1KXGA 3H1YA 4XF0A 4COVA 1HRV2 2AYHA 5CFDB 3ST7A 4K21A 2YGWA 2PELA 5C8CB 2A73B 2RM23 2RS12 5GLZA 1VB4A 2HKXA 4XXAA 3ZFFB 2A6WA 3WCSA 1MS1A 3M7AA 5AFEA 3SMHA 1S0BA 4DRVA 4U2AA 5FTTC 3GZTB 3APBA 3H7YA 1EAH3 5EXOA 4HPKA 1NSLA 3TE4A 2JE7A 4ZU7A 5GCNA 1QY4A 1VBB3 1OMIA 1UU6A 1XU2A 3AP9A 3AFKA 2WZR3 1RHI1 2C0ZA 2YV8A 2UYAA 3GF6A 2GNDA 1UU4A 2XBO3 2ZHLA 4HLTA 5AC92 1MEC2 2RJKA 3VWDA 5GALA 4OHYA 4PLMA 1AX0A 4IESA 3U10A 4D69A 4JGZA 1KJRA 5C4WA 2RR12 4FD7A 2BSWA 2OH1A 4CGNA 1C28A 4K9SA 3LWCA 4NXYA 5JPHA 1WMEA 3RRDA 2R0FA 1ZRDA 3F5BA 1Q43A 5KTAA 2NM1A 2R062 1S7FA 2A3XA 2AENA 2H6BA 4HVQA 2Q0AA 2AREA 5T55A 3IMNA 4IV1C 2IFRA 4Y4YA 2RS31 2GU9A 2XHKA 3SH5A 1GZWA 1YVOA 4AHXA 3V0BB 4GIQA 1QSOA 4EWEA 1C1FA 1FATA 4NSQA 3ENRA 1UL9A 1SMVA 1Z0HA 1RVF3 1LHVA 5BNPA 1RUJ3 1YWKA 1POV0 1OOPA 4PBPA 4KQ7A 2WLQA 5E16A 2ZAHA 3K51A 3GKRA 1LRZA