4FD4A

Crystal structure of mosquito arylalkylamine n-acetyltransferase like 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
SIVLRVARLDELEQVREILHRIYYPEEGITISYVHGKSHTLDDERFSLSFVEQGTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVCGRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEKLGMECISQLALGDYRDEKGEKLFEPLDVHQVIKTCVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arylalkylamine N-Acetyltransferase like 5b
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 74
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd4A00
1VHSA 1I12A 2CY2A 4AVCA 2B5GA 2ZW6A 4MY3A 4UWIA 4LUAA 3LD2A 2CNSA 4FD5A 3BJ7A 2OZGA 2X7BA 3NE7A 1P0HA 4X5KA 3S6FA 3EC4A 2HV2A 5DWNA 3ZJ0A 3F8KA 2G3TA 4Y49B 5C82A 4FD6A 4U9YA 4JD6A 2QIRA 3G3SA 4B5PA 2P6EA 4XPLA 2I79A 1VKCA 4UBRA 3BJ8A 1PU9A 1KZFA 4KORA 4GS4A 3N7ZA 2B3UA 4YGOA 5C88A 2JDCA 3KKWA 1IIDA 4DNCA 1Q2YA 1WWZA 2Q0YA 1WK4A 2GANA 3R9FA 3TT2A 3GYAA 1M4GA 2FSRA 3TOAA 1YREA 2OZUA 3CXQA 3IGRA 4MHDA 4R3KA 3V8IA 2OU2A 1KUVA 5I0CA 2ATRA 4CAVA 1LRZA 1Z9UA 3DR8A 2ARHA 2ZW5A 1QSMA 2B4BA 2A4NA 4U9ZA 2ZPAA 3EXNA 3P2HA 1S5KA 1KUYA 4KLWA 2Z0ZA 4RS2A 4JWPA 1QSNA 4KOTA 4QC6A 4K30A 3B8GA 2Q4YA 4MJ8A 3FYNA 3I3GA 2H5MA 2PDOA 5JQ4A 1ON0A 3W6XA 4XPKA 2CNTA 4HNYB 4KOUA 2QECA 3JUWA 4QBJA 1YK3A 5F48A 5H84A 2PR1A 2VZZA 5KTAA 1IICA 1IYLA 3D8PA 5HMNA 1YLEA 1QSOA 2BUEA 2Q7BA 5GCNA 3GY9A 5CNPA 4OLLA 5H86A 1NSLA 2J8NA 1Y9WA 4JXRA 3D3SA 2FS5A 4KZTA 1S7FA 2OH1A 2D4PA 1S7LA 4XPDB 3PGPA 2PR8A 3K9UA 4R3LA 3TO6A 3I9SA 4E2AA 1BO4A 2R98A 3TE4A 5EC4A 1B6BA 3VWEA 2FXFA 4JJXA 4U5YA 4KOWA 2Q44A 5F46A 1KUXA 2B5GB 3QAHA 5KTDA 1R57A 3S6KA 4R57A 2AE6A 4LX9A 2FCKA 2R1IA 3SXOA 3W6SA 4JXQA 3CXSA 5J8FA 4QB9A 1MJAA 2HUZA 5IV0A 4H89A 4NF1A 4B5PB 2G3AA 5J8CA 3R9EA 3D2PA 3EFAA 4HNXB 4L89A 4NEXA 4ONUA 1YVOA 3IWGA 3PZJA 2FIAA 3WR7A 1YX0A 1QSTA 4F0YA 4CRZB 1PUAA 4KVXA 2PC1A 1Q2CA 3TTHA 3TO9A 4KVOE 4OAEA 5HH1A 1N71A 2OZHA 2Y0MA 2P6GA 1UFHA 4M3SA 1K4JA 4ZBGA 1MK4A 4QUSA 1V0CA 4H6ZA 2IL4A 2PRBA 3E0KA 2ZW4A 3FBUA 1U6MA 2ZXVA 5E96A 1IYKA 4KUBA 4PK3A 2J8RA 3R95A 4FD7A 2KCWA 5JPHA 2B3VA 2NMTA 1M4IA 1YGHA 4KOXA 2BEIA 1P4NA 3R96A 1RO5A 2P0WA 3CXPA 4KUAA 2B58A 3FXTA 4KOYA 2G0BA 1S7NA 4YFJA 3GKRA 2JLMA 1S3ZA 3QB8A 5DWMA 4AVAA 4AVBA 4PK2A 1QSRA 4L8AA 2D4OA 4PSWA 4M85A 4XNHC 5FVJA 2VXKA 2O28A 4AG7A 2VBQA 3R1KA 2PQ8A 4II9A 2WPWA 1YR0A 4KLVA 4E8OA 4BMHA 4IF5A 3LODA 1S7KA 1MJ9A 3MGDA 4R9MA 1L0CA 3F5BA 4AB7A 1CJWA 4CAXA 2DXQA 5KTCA 3JVNA 5ISVA 4NXYA 1RXTA 2B4DA 2Q4VA 4H6UA 2GIVA 2VZYA 2WPXA 3FB3A 4OADA 4R87A 5IB0A 4E0AA 2Q04A 3DR6A 4UA3A 1XEBA 2B4DB 2P6FA 2FT0A 3FRMA 4RI1A 4XNHB 3FNCA 2Z10A 2HQYA 3T9YA 4CAWA 2JEVA 2QMLA 3DDDA 4UWJA 1IB1E 1B87A 2EUIA 2EVNA 3SHPA 3F0AA 1MJBA 1GHEA 2VEZA 4KVME 1XE4A 3FIXA 1Y9KA 3PP9A 3DNSA 4QVTA 3TOBA 2PSWA 2REEA 5F47A 1I21A 3C26A 2CNMA 3BLNA 3T90A 3UY5A 4MY0A 1Y7RA 4MBUA 4F6AA 3DSBA 1I1DA 2R8VA 2K5TA 3ZZIA 1M44A 3TFYA 1OZPA 2ZW7A 1YVKA 4NSQA 3SXNA 5EBVA 3S6GA 2F5IA 2VI7A 4ORFA 3RYOA 2FIWA 1XIXA 4MI4A 1J4JA 4PV6A 1S60A 3VWDA 4HNWB 1Z4RA 2BSWA 3R9GA 2RC4A 4NCZA 3TCVA 1M1DA 1FY7A 3G8WA 3EO4A 2VQYA 5IX3A 3EY5A 4CRYB 1Z4EA 2Z11A 5F49A 1NMTA 3S6HA 3P2FA 2REFA 4XPDC 1BOBA 2OB0A 2FL4A 4YRHA 3H4QA 4IUSA 4HKFA 2C27A 1XF8A 1Q2DA 2J8MA 2R7HA 2I00A 4I49A 2GE3A 3OWCA 4Y49C 2AJ6A 4EVYA 4J3GA 4B5OA 1XMTA 2JDDA 4KOSA 1SQHA 3TO7A 1M4DA 1NE9A 1CM0A 4CS0B 4AG9A 4FD4A 4PSXA 2FE7A 3D2MA 4KOVA 3W91A 1TIQA 2BL1A 4JLYA
chains in the Genus database with same CATH superfamily
4CGOA 1VHSA 1I12A 2CY2A 2PJAA 4JZ0A 4AVCA 3B35A 2B5GA 2ZW6A 4Q38A 2AFOA 4MY3A 4MFJA 4UWIA 1F2OA 5LRJA 2NYQA 3WABA 4LUAA 4PXCA 3LD2A 2CNSA 1ARLA 3GB0A 4FD5A 3BJ7A 2OZGA 1JWQA 2X7BA 2ZOFA 4OC0A 3NE7A 1P0HA 4X5KA 3S6FA 3EC4A 2HV2A 5DWNA 3ZJ0A 3F8KA 2G3TA 4Y49B 1XMBA 5C82A 5JGFA 4FD6A 4MMOA 4U9YA 4JD6A 2QIRA 3G3SA 2RFHA 4B5PA 4B14A 2P6EA 2EBJA 1IOFA 2IQ6A 4XPLA 2I79A 1VKCA 4P10A 3RNZA 2O4HA 4PQAA 3D7HA 4UBRA 3BJ8A 1PU9A 1KZFA 3KHXA 4KORA 2WYRA 4GS4A 3N7ZA 2B3UA 4CGNA 4LQ6A 4YGOA 3RO0A 4BBHA 1ZG8A 2JDCA 3CPAA 3KKWA 2C6PA 4UEFA 1IIDA 2PJ7A 1CP7A 4UF4A 1Q2YA 4MFPA 4DNCA 1WWZA 1VGYA 3QNVA 2Z3PA 4P4JA 4PPZA 2AFSA 2Q0YA 1WK4A 3NH4A 4ZY1A 2GANA 2I3CA 3R9FA 3TT2A 3GYAA 2AFXA 3PFEA 1Y7EA 3CPXA 1M4GA 2FSRA 2Z3NA 3TOAA 4RUHA 3WT4A 1YREA 1AYEA 2ODFA 1KWMA 3PEIA 4MFZA 4DUKA 1XOVA 2OZUA 2CIJA 3CXQA 3IGRA 4MHDA 4R3KA 3V8IA 1ELLP 5D29A 2OU2A 1KUVA 5I0CA 4NFRA 2ATRA 5DS0A 4CAVA 1LRZA 1Z9UA 3DR8A 4UEZA 4EMEA 2CTBA 4A2ZA 2ARHA 2ZW5A 1QSMA 4CAFA 2B4BA 2A4NA 4Q36A 1X10A 4U9ZA 2Z3MA 1CPSA 4CPAA 4IAVA 4MHZA 2VL1A 1AMPA 2ZPAA 3EXNA 3P2HA 1S5KA 1KUYA 3PB4X 2XEFA 1OBRA 3JRUA 4KLWA 2Z0ZA 2V8VA 5LYIA 4P4EA 4RS2A 4JWPA 1QSNA 4KOTA 4QC6A 4K30A 4MFKA 3B8GA 3K9TA 3PBEA 2ZEFA 4CGPA 2Q4YA 5BWAB 1BPNA 4B11A 4MJ8A 5K8MA 3FYNA 3I3GA 2H5MA 2PDOA 5LRKA 2ANPA 1ON0A 5JQ4A 3NH8A 4B12A 3W6XA 4F9UA 4XPKA 2CNTA 4HNYB 4KOUA 4MCPA 2QECA 3JUWA 2QVPA 4KSAA 4OC2A 4QBJA 1YK3A 2WUUA 2GLJA 4NGNA 5F48A 4FWUA 3FVLA 2AFMA 4R8FA 5H84A 3IU2A 4YU9A 2PR1A 3FX6A 1Z8LA 2VZZA 5KTAA 1IICA 1JQGA 1IYLA 1R3NA 4A95A 3D8PA 2PVWA 3S9NA 5HMNA 1YLEA 1QSOA 2BUEA 2Q7BA 3KGQA 3D7DA 4NGPA 5K8PA 2PVVA 5GCNA 4A94A 3GY9A 3IJ3A 3N5FA 4IHMA 5LRGA 4ONWA 2EO8A 2RB7A 2Z3OA 5CNPA 4OLLA 8CPAA 3KR5A 5H86A 1ELMP 4UCPA 1NSLA 2J8NA 1Y9WA 1CPXA 4JXRA 3D3SA 2FS5A 4KZTA 1S7FA 4PXDA 2BOAA 2OH1A 1Z8TA 1VHEA 5A27A 2D4PA 1S7LA 2GREA 2Z3LA 1ZO0A 4MHPA 4TWEA 3PGPA 4XPDB 3SJEA 4F8ZA 2PR8A 3K9UA 3K2KA 4R3LA 3TO6A 4EWTA 4ZGYB 3I9SA 2GFQA 4NGRA 1BO4A 2R98A 4E2AA 3TE4A 4UCNA 1B6BA 5EC4A 1LFWA 1Z8WA 2Q43A 1IOIA 2AFZA 3VATA 3VWEA 2FXFA 1H8LA 3IIBA 4JJXA 4X3RA 5CBMA 4U5YA 3KI9A 2PIZA 3FEEA 4KOWA 4A31A 3H8GA 3PB8X 5HVFA 3BXMA 2Q44A 5F46A 1TXRA 3CDXA 1F57A 3FF3A 1KUXA 2B5GB 3QAHA 4PXBA 3D67A 1PCAA 2C1CA 5KTDA 1R57A 3S6KA 2CXAA 3ISZA 4FUUA 4R57A 2AE6A 4LX9A 4YWYA 2FCKA 2R1IA 3SXOA 3W6SA 5A28A 1YQEA 2PJCA 1AUGA 4JXQA 1M4LA 3CXSA 5J8FA 4QB9A 1MJAA 4LQGA 3WC6A 2HUZA 3IC1A 5IV0A 2PJ8A 4MFLA 4B13A 1VIXA 4H89A 4MFQA 4NF1A 4MCSA 4B5PB 5K8NA 4GXHA 2G3AA 4ZYQA 5J8CA 3NFZA 4A37A 1ZG7A 3A9LA 2PJ9A 3LWUA 3R9EA 3D2PA 3EFAA 1IY7A 1YMEA 5J1QA 4UIBA 4HNXB 3MRUA 4L89A 1HEEA 2ZEOA 4NEXA 4ONUA 4P44A 4ZX8A 3BHXA 4C68A 4OP4A 1YVOA 2C6CA 2POKA 3IWGA 5I4MA 3PZJA 2FIAA 2YGWA 4W9YA 3WR7A 1YX0A 1QSTA 3H8EA 4CRZB 1PUAA 1XBUA 3KHZA 4KVXA 4OC4A 4UFWA 5D8NA 4F0YA 3PB7X 2PC1A 1Q2CA 1XRYA 4WWVA 3TTHA 3TO9A 4KVOE 4OAEA 1DE4C 2V8HA 1LAMA 5IB9A 3NA6A 4MHYA 2FVGA 3CZXA 5HH1A 1N71A 4RN7A 4UCMA 2Q7SA 5ELYA 2OZHA 2Y0MA 3DLJA 1YW6A 2AFWA 2P6GA 1UFHA 3H5ZA 4M3SA 1K4JA 4ZBGA 4M6GA 3SI1A 1MK4A 4IK2A 4CYPA 3FH4A 3HUVA 4QUSA 2CF4A 2F7VA 3S9MA 3SI2A 1V0CA 1YSJA 1Q7LA 2ZENA 5JH9A 4H6ZA 2IL4A 2PRBA 2HC9A 3E0KA 2EK9A 1FT7A 2ZW4A 3NH5A 4ZI6A 1U6MA 3FBUA 5F09A 2ZXVA 5E96A 1IYKA 2QYVA 3D7GA 4KUBA 2PJ6A 4PK3A 3RBUA 1YLOA 1QQ9A 2J8RA 1Y0YA 3B7IA 3GIUA 2ABZA 1TKHA 3R95A 4FD7A 3S9LA 4A32A 2KCWA 3DGVA 5LYDA 2GLFA 2B3VA 5CPAA 5JPHA 2NMTA 2YNCC 1M4IA 1YGHA 3CT9A 4KOXA 5LYFA 2BEIA 1P4NA 3R96A 1RO5A 2P0WA 2QJ8A 3CXPA 2B58A 4KUAA 3PFOA 3FXTA 3H8FA 4KOYA 3FECA 2EK8A 2G0BA 3PB9X 1S7NA 1HDQA 2O53A 4YFJA 3IEHA 3GKRA 2JLMA 1S3ZA 2DEAA 1ZG9A 3NE8A 2XEIA 1NSAA 2WSAA 2YNDA 3MN8A 3QB8A 1VHOA 4X2TA 2IMOA 1BAVA 4OIDA 4AVBA 4AVAA 3LMSA 3PRTA 4PK2A 4A39A 1QSRA 4O23A 4L8AA 2D4OA 2JEWA 4PSWA 3HLPA 1YW4A 1Z8XA 2ZEHA 4M85A 2ZEMA 4NGMA 4BINA 4C7HA 4DYOA 4XNHC 5FVJA 2VXKA 2YNCA 3KQXA 2IJZA 2O28A 4AG7A 2VBQA 3R1KA 1CX8A 2PQ8A 4II9A 1BLLE 2HB6A 2WPWA 4B10A 1YR0A 1ZLIA 4KLVA 4E8OA 4R6TA 1HDUA 3SJGA 2PE3A 1CBXA 3D66A 4OIWA 1QMUA 5THWA 3B3SA 4BMHA 4NGQA 2PJ3A 4C2XA 2C6GA 3RAMA 4IF5A 3LODA 2ZELA 1S7KA 1MJ9A 3MGDA 2PJBA 4R9MA 1L0CA 2YNEA 3F5BA 1CJWA 2EWBA 2DXQA 4AB7A 3JVNA 4CAXA 5KTCA 5ISVA 2DPTA 2XEJA 4NXYA 1RXTA 3BI0A 2B4DA 4UFXA 4NJRA 2Q4VA 1IGBA 5AG7A 4OKOA 2ZEDA 4H6UA 2GIVA 4X8IA 3PBBA 2VZYA 2WPXA 3FB3A 3KQZA 4OADA 4R87A 4Z65A 5IB0A 3WC5A 4E0AA 2OR4A 3T8WA 2Q04A 1F2PA 3DR6A 3KZWA 3B2YA 4UA3A 1XEBA 2B4DB 2P6FA 2FT0A 3BI1A 1LANA 3FEDA 3FRMA 4OC1A 4RI1A 1TKFA 4XNHB 5G20A 5G22A 1R43A 1TKJA 4GM5A 4NGTA 3FNCA 2Z10A 2HQYA 4G1PA 3T9YA 4CAWA 1CG2A 4A30A 4ZX9A 4C7IA 2V8DA 4Q7AA 2JEVA 2PIYA 2QMLA 3DDDA 1IB1E 4P4FA 4UWJA 3SJFA 2G9DA 2ZEEA 5HXDA 1B87A 2EUIA 2JBKA 2EVNA 4CAEA 2Q4ZA 4MXUA 3SHPA 5JM6A 1Z2LA 3RZAA 4A38A 1RTQA 3F0AA 3V7ZA 5G1ZA 5AG4A 5HVGA 3WC7A 2AFUA 3I1UA 4ZY2A 4MRIA 4CYOA 1MJBA 1X12A 4NJQA 1GHEA 2VEZA 3B3CA 4KVME 5HVHA 3TC8A 1XE4A 2PJ1A 3FIXA 1Y9KA 3PP9A 4FBEA 3DNSA 1EE3P 4QVTA 3TOBA 3D4UA 4TNUA 2PSWA 2REEA 5F47A 1I21A 3C26A 2WZNA 4FAIA 2CNMA 4M6HA 3BLNA 4KS9A 2OOTA 3VARA 2JBJA 5EMIA 3T90A 3UY5A 4UEEA 4MY0A 2ZEGA 1Y7RA 4MBUA 4F6AA 3DSBA 3KASA 1I1DA 2R8VA 3KR4A 2K5TA 2V77A 1M44A 4UIAA 3ZZIA 3TFYA 1XJOA 2Z3KA 3GLJA 1OZPA 2ZW7A 1CP6A 4CYNA 3V38A 4K3NA 2ZOGA 3ISXA 1YVKA 4NSQA 5AG6A 3SXNA 5EBVA 3GUXA 2F5IA 3S6GA 1A2ZA 2GU2A 2VI7A 2DPSA 3B3VA 4ORFA 3RYOA 2FIWA 2V8GA 1XIXA 1Z5RA 2J9AA 1LAPA 4C2ZA 1TF9A 4M6IA 4MI4A 2PCUA 1J4JA 3SI0A 4PV6A 7CPAA 1S60A 3VWDA 2CTCA 1Z4RA 4HNWB 1ZLHA 4OC5A 2BSWA 3R9GA 2RC4A 5K8OA 4NCZA 4BD9A 3TCVA 4B6ZA 1M1DA 1FY7A 3G8WA 3EO4A 4AXVA 4P4DA 4MCQA 4A33A 1DTDA 2PJ0A 2VQYA 3IO1A 2F8HA 1FNOA 4JYWA 4F0XA 5IX3A 4MCRA 3EY5A 4CRYB 1BPMA 1Z4EA 3IWEA 1IU8A 2Z11A 3L2NA 3IWWA 5F49A 1NMTA 3JTKA 3TX8A 3S6HA 3P2FA 2REFA 3IU1A 1LOKA 4NGSA 2PJ4A 4XPDC 2BO9A 1BOBA 3LACA 2OB0A 2FL4A 5DWMA 4YRHA 4ZY0A 3KL9A 2NSMA 3B3TA 3IFEA 3H4QA 4KSIA 2Q51A 4IUSA 4HKFA 2C27A 1XF8A 2DF5A 4PXEA 3SJXA 2PRQA 1Q2DA 4MHNA 2J8MA 5LYLA 2R7HA 2I00A 4I49A 1Y0RA 4P6YA 2ZEPA 5AG5A 3FJUA 2GE3A 3OWCA 3PB6X 4OMEA 2AJ6A 4WJBA 4Y49C 5AGEA 4EVYA 3VH9A 4P4BA 6CPAA 4J3GA 4B5OA 1XMTA 2JDDA 2BCOA 3QAYA 4HPSA 3B3WA 1ARMA 4CGLA 4C2YA 3D7FA 4KOSA 1SQHA 4P4IA 4UFVA 3TO7A 1LCPA 4CYQA 4EFDA 1M4DA 3D68A 1XFOA 4H2KA 1NE9A 1CM0A 2XEGA 4R7MA 4CS0B 4AG9A 2PJ2A 4FD4A 4CGMA 4DJLA 5C88A 4KSFA 4P45A 4OC3A 5G21A 1GYTA 1PYTB 2FE7A 4PSXA 4R76A 3D2MA 4KOVA 1TF8A 2PJ5A 1UWYA 3W91A 1TIQA 2BL1A 4F9VA 3FMCA 4JLYA
chains in the Genus database with same CATH topology
4CGOA 1VHSA 1I12A 2CY2A 4AVCA 2B5GA 2ZW6A 4Q38A 4MY3A 4MFJA 4UWIA 4LUAA 3LD2A 2CNSA 4FD5A 3BJ7A 2OZGA 2X7BA 3NE7A 1P0HA 4X5KA 3S6FA 3EC4A 2HV2A 5DWNA 3ZJ0A 3F8KA 2G3TA 4Y49B 5C82A 4FD6A 4U9YA 4JD6A 2QIRA 3G3SA 4B14A 4B5PA 2P6EA 4XPLA 2I79A 1VKCA 4UBRA 3BJ8A 1PU9A 1KZFA 4KORA 4GS4A 3N7ZA 2B3UA 4CGNA 4YGOA 4BBHA 5C88A 2JDCA 3KKWA 1IIDA 4DNCA 1Q2YA 4MFPA 1WWZA 2Z3PA 2Q0YA 1WK4A 2GANA 3R9FA 3TT2A 3GYAA 1M4GA 2FSRA 2Z3NA 3TOAA 1YREA 4MFZA 2OZUA 3CXQA 3IGRA 4MHDA 4R3KA 3V8IA 2OU2A 1KUVA 5I0CA 2ATRA 4CAVA 1LRZA 1Z9UA 3DR8A 4A2ZA 2ARHA 2ZW5A 1QSMA 4CAFA 2B4BA 2A4NA 4Q36A 4U9ZA 2Z3MA 2ZPAA 3EXNA 3P2HA 1S5KA 1KUYA 4KLWA 2Z0ZA 4RS2A 4JWPA 1QSNA 4KOTA 4QC6A 4K30A 4MFKA 3B8GA 4CGPA 2Q4YA 5BWAB 4B11A 4MJ8A 3FYNA 3I3GA 2H5MA 2PDOA 5JQ4A 1ON0A 4B12A 3W6XA 4XPKA 2CNTA 4HNYB 4KOUA 2QECA 3JUWA 4KSAA 4QBJA 1YK3A 2WUUA 5F48A 5H84A 3IU2A 2PR1A 2VZZA 5KTAA 1IICA 1IYLA 4A95A 3D8PA 5HMNA 1YLEA 1QSOA 2BUEA 2Q7BA 5GCNA 3GY9A 2Z3OA 5CNPA 4OLLA 5H86A 4UCPA 1NSLA 2J8NA 1Y9WA 4JXRA 3D3SA 2FS5A 4KZTA 1S7FA 2OH1A 5A27A 2D4PA 1S7LA 2Z3LA 1ZO0A 4XPDB 3PGPA 2PR8A 3K9UA 4R3LA 3TO6A 4ZGYB 3I9SA 4E2AA 1BO4A 2R98A 3TE4A 4UCNA 1B6BA 5EC4A 3VWEA 2FXFA 4JJXA 4U5YA 4KOWA 4A31A 2Q44A 5F46A 1KUXA 2B5GB 3QAHA 5KTDA 1R57A 3S6KA 2CXAA 4R57A 2AE6A 4LX9A 2FCKA 2R1IA 3SXOA 3W6SA 5A28A 4JXQA 3CXSA 5J8FA 4QB9A 1MJAA 2HUZA 5IV0A 4MFLA 4B13A 4H89A 4MFQA 4NF1A 4B5PB 2G3AA 5J8CA 3A9LA 3R9EA 3D2PA 3EFAA 4HNXB 4L89A 4NEXA 4ONUA 4C68A 1YVOA 3IWGA 3PZJA 2FIAA 2YGWA 3WR7A 1YX0A 1QSTA 4F0YA 4CRZB 1PUAA 4KVXA 4UFWA 2PC1A 1Q2CA 3TTHA 3TO9A 4KVOE 4OAEA 5HH1A 1N71A 4UCMA 2OZHA 2Y0MA 2P6GA 1UFHA 3H5ZA 4M3SA 1K4JA 4ZBGA 1MK4A 4CYPA 4QUSA 1V0CA 4H6ZA 2IL4A 2PRBA 3E0KA 2ZW4A 3FBUA 1U6MA 2ZXVA 5E96A 1IYKA 4KUBA 4PK3A 2J8RA 3R95A 4FD7A 4A32A 2KCWA 5JPHA 2B3VA 2NMTA 2YNCC 1M4IA 1YGHA 4KOXA 2BEIA 1P4NA 3R96A 1RO5A 2P0WA 3CXPA 4KUAA 2B58A 3FXTA 4KOYA 2G0BA 1S7NA 4YFJA 3GKRA 2JLMA 1S3ZA 3QB8A 2WSAA 5DWMA 2YNDA 4AVAA 4AVBA 4PK2A 1QSRA 4L8AA 2D4OA 4PSWA 4M85A 4C7HA 4XNHC 5FVJA 2VXKA 2YNCA 2O28A 4AG7A 2VBQA 3R1KA 2PQ8A 4II9A 2WPWA 4B10A 1YR0A 4KLVA 4E8OA 4BMHA 4C2XA 4IF5A 3LODA 1S7KA 1MJ9A 3MGDA 4R9MA 1L0CA 2YNEA 3F5BA 1CJWA 4AB7A 2DXQA 4CAXA 3JVNA 5KTCA 5ISVA 2DPTA 4NXYA 1RXTA 2B4DA 4UFXA 2Q4VA 5AG7A 4H6UA 2GIVA 2VZYA 2WPXA 3FB3A 4OADA 4R87A 5IB0A 4E0AA 2Q04A 3DR6A 4UA3A 1XEBA 2B4DB 2P6FA 2FT0A 3FRMA 4RI1A 4XNHB 5G20A 5G22A 3FNCA 2Z10A 2HQYA 3T9YA 4CAWA 4A30A 4C7IA 2JEVA 2QMLA 3DDDA 4UWJA 1IB1E 1B87A 2EUIA 4CAEA 2EVNA 3SHPA 3F0AA 5G1ZA 5AG4A 4CYOA 1MJBA 1GHEA 2VEZA 4KVME 1XE4A 3FIXA 1Y9KA 3PP9A 3DNSA 4QVTA 3TOBA 2PSWA 2REEA 5F47A 1I21A 3C26A 2CNMA 3BLNA 4KS9A 3T90A 3UY5A 4MY0A 1Y7RA 4MBUA 4F6AA 3DSBA 1I1DA 2R8VA 2K5TA 3ZZIA 1M44A 3TFYA 2Z3KA 1OZPA 2ZW7A 4CYNA 1YVKA 4NSQA 5AG6A 3SXNA 5EBVA 3S6GA 2F5IA 2VI7A 2DPSA 4ORFA 3RYOA 2FIWA 1XIXA 4C2ZA 4MI4A 1J4JA 4PV6A 1S60A 3VWDA 4HNWB 1Z4RA 2BSWA 3R9GA 2RC4A 4NCZA 3TCVA 1M1DA 1FY7A 3G8WA 3EO4A 4A33A 2VQYA 4F0XA 5IX3A 3EY5A 4CRYB 1Z4EA 3IWEA 2Z11A 5F49A 1NMTA 3JTKA 3S6HA 3P2FA 2REFA 3IU1A 4XPDC 1BOBA 2OB0A 2FL4A 4YRHA 3H4QA 4IUSA 4HKFA 2C27A 1XF8A 1Q2DA 2J8MA 2R7HA 2I00A 4I49A 5AG5A 2GE3A 3OWCA 4Y49C 2AJ6A 5AGEA 4EVYA 4J3GA 4B5OA 1XMTA 2JDDA 4CGLA 4C2YA 4KOSA 1SQHA 4UFVA 3TO7A 4CYQA 1M4DA 1NE9A 1CM0A 4CS0B 4AG9A 4FD4A 4CGMA 4KSFA 5G21A 4PSXA 2FE7A 3D2MA 4KOVA 3W91A 1TIQA 2BL1A 4JLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHS A;  1I12 A;  2CY2 A;  4AVC A;  2B5G A;  2ZW6 A;  4MY3 A;  4UWI A;  4LUA A;  3LD2 A;  2CNS A;  4FD5 A;  3BJ7 A;  2OZG A;  2X7B A;  3NE7 A;  1P0H A;  4X5K A;  3S6F A;  3EC4 A;  2HV2 A;  5DWN A;  3ZJ0 A;  3F8K A;  2G3T A;  4Y49 B;  5C82 A;  4FD6 A;  4U9Y A;  4JD6 A;  2QIR A;  3G3S A;  4B5P A;  2P6E A;  4XPL A;  2I79 A;  1VKC A;  4UBR A;  3BJ8 A;  1PU9 A;  1KZF A;  4KOR A;  4GS4 A;  3N7Z A;  2B3U A;  4YGO A;  5C88 A;  2JDC A;  3KKW A;  1IID A;  4DNC A;  1Q2Y A;  1WWZ A;  2Q0Y A;  1WK4 A;  2GAN A;  3R9F A;  3TT2 A;  3GYA A;  1M4G A;  2FSR A;  3TOA A;  1YRE A;  2OZU A;  3CXQ A;  3IGR A;  4MHD A;  4R3K A;  3V8I A;  2OU2 A;  1KUV A;  5I0C A;  2ATR A;  4CAV A;  1LRZ A;  1Z9U A;  3DR8 A;  2ARH A;  2ZW5 A;  1QSM A;  2B4B A;  2A4N A;  4U9Z A;  2ZPA A;  3EXN A;  3P2H A;  1S5K A;  1KUY A;  4KLW A;  2Z0Z A;  4RS2 A;  4JWP A;  1QSN A;  4KOT A;  4QC6 A;  4K30 A;  3B8G A;  2Q4Y A;  4MJ8 A;  3FYN A;  3I3G A;  2H5M A;  2PDO A;  5JQ4 A;  1ON0 A;  3W6X A;  4XPK A;  2CNT A;  4HNY B;  4KOU A;  2QEC A;  3JUW A;  4QBJ A;  1YK3 A;  5F48 A;  5H84 A;  2PR1 A;  2VZZ A;  5KTA A;  1IIC A;  1IYL A;  3D8P A;  5HMN A;  1YLE A;  1QSO A;  2BUE A;  2Q7B A;  5GCN A;  3GY9 A;  5CNP A;  4OLL A;  5H86 A;  1NSL A;  2J8N A;  1Y9W A;  4JXR A;  3D3S A;  2FS5 A;  4KZT A;  1S7F A;  2OH1 A;  2D4P A;  1S7L A;  4XPD B;  3PGP A;  2PR8 A;  3K9U A;  4R3L A;  3TO6 A;  3I9S A;  4E2A A;  1BO4 A;  2R98 A;  3TE4 A;  5EC4 A;  1B6B A;  3VWE A;  2FXF A;  4JJX A;  4U5Y A;  4KOW A;  2Q44 A;  5F46 A;  1KUX A;  2B5G B;  3QAH A;  5KTD A;  1R57 A;  3S6K A;  4R57 A;  2AE6 A;  4LX9 A;  2FCK A;  2R1I A;  3SXO A;  3W6S A;  4JXQ A;  3CXS A;  5J8F A;  4QB9 A;  1MJA A;  2HUZ A;  5IV0 A;  4H89 A;  4NF1 A;  4B5P B;  2G3A A;  5J8C A;  3R9E A;  3D2P A;  3EFA A;  4HNX B;  4L89 A;  4NEX A;  4ONU A;  1YVO A;  3IWG A;  3PZJ A;  2FIA A;  3WR7 A;  1YX0 A;  1QST A;  4F0Y A;  4CRZ B;  1PUA A;  4KVX A;  2PC1 A;  1Q2C A;  3TTH A;  3TO9 A;  4KVO E;  4OAE A;  5HH1 A;  1N71 A;  2OZH A;  2Y0M A;  2P6G A;  1UFH A;  4M3S A;  1K4J A;  4ZBG A;  1MK4 A;  4QUS A;  1V0C A;  4H6Z A;  2IL4 A;  2PRB A;  3E0K A;  2ZW4 A;  3FBU A;  1U6M A;  2ZXV A;  5E96 A;  1IYK A;  4KUB A;  4PK3 A;  2J8R A;  3R95 A;  4FD7 A;  2KCW A;  5JPH A;  2B3V A;  2NMT A;  1M4I A;  1YGH A;  4KOX A;  2BEI A;  1P4N A;  3R96 A;  1RO5 A;  2P0W A;  3CXP A;  4KUA A;  2B58 A;  3FXT A;  4KOY A;  2G0B A;  1S7N A;  4YFJ A;  3GKR A;  2JLM A;  1S3Z A;  3QB8 A;  5DWM A;  4AVA A;  4AVB A;  4PK2 A;  1QSR A;  4L8A A;  2D4O A;  4PSW A;  4M85 A;  4XNH C;  5FVJ A;  2VXK A;  2O28 A;  4AG7 A;  2VBQ A;  3R1K A;  2PQ8 A;  4II9 A;  2WPW A;  1YR0 A;  4KLV A;  4E8O A;  4BMH A;  4IF5 A;  3LOD A;  1S7K A;  1MJ9 A;  3MGD A;  4R9M A;  1L0C A;  3F5B A;  4AB7 A;  1CJW A;  4CAX A;  2DXQ A;  5KTC A;  3JVN A;  5ISV A;  4NXY A;  1RXT A;  2B4D A;  2Q4V A;  4H6U A;  2GIV A;  2VZY A;  2WPX A;  3FB3 A;  4OAD A;  4R87 A;  5IB0 A;  4E0A A;  2Q04 A;  3DR6 A;  4UA3 A;  1XEB A;  2B4D B;  2P6F A;  2FT0 A;  3FRM A;  4RI1 A;  4XNH B;  3FNC A;  2Z10 A;  2HQY A;  3T9Y A;  4CAW A;  2JEV A;  2QML A;  3DDD A;  4UWJ A;  1IB1 E;  1B87 A;  2EUI A;  2EVN A;  3SHP A;  3F0A A;  1MJB A;  1GHE A;  2VEZ A;  4KVM E;  1XE4 A;  3FIX A;  1Y9K A;  3PP9 A;  3DNS A;  4QVT A;  3TOB A;  2PSW A;  2REE A;  5F47 A;  1I21 A;  3C26 A;  2CNM A;  3BLN A;  3T90 A;  3UY5 A;  4MY0 A;  1Y7R A;  4MBU A;  4F6A A;  3DSB A;  1I1D A;  2R8V A;  2K5T A;  3ZZI A;  1M44 A;  3TFY A;  1OZP A;  2ZW7 A;  1YVK A;  4NSQ A;  3SXN A;  5EBV A;  3S6G A;  2F5I A;  2VI7 A;  4ORF A;  3RYO A;  2FIW A;  1XIX A;  4MI4 A;  1J4J A;  4PV6 A;  1S60 A;  3VWD A;  4HNW B;  1Z4R A;  2BSW A;  3R9G A;  2RC4 A;  4NCZ A;  3TCV A;  1M1D A;  1FY7 A;  3G8W A;  3EO4 A;  2VQY A;  5IX3 A;  3EY5 A;  4CRY B;  1Z4E A;  2Z11 A;  5F49 A;  1NMT A;  3S6H A;  3P2F A;  2REF A;  4XPD C;  1BOB A;  2OB0 A;  2FL4 A;  4YRH A;  3H4Q A;  4IUS A;  4HKF A;  2C27 A;  1XF8 A;  1Q2D A;  2J8M A;  2R7H A;  2I00 A;  4I49 A;  2GE3 A;  3OWC A;  4Y49 C;  2AJ6 A;  4EVY A;  4J3G A;  4B5O A;  1XMT A;  2JDD A;  4KOS A;  1SQH A;  3TO7 A;  1M4D A;  1NE9 A;  1CM0 A;  4CS0 B;  4AG9 A;  4FD4 A;  4PSX A;  2FE7 A;  3D2M A;  4KOV A;  3W91 A;  1TIQ A;  2BL1 A;  4JLY A; 
#chains in the Genus database with same CATH topology
 4CGO A;  1VHS A;  1I12 A;  2CY2 A;  2PJA A;  4JZ0 A;  4AVC A;  3B35 A;  2B5G A;  2ZW6 A;  4Q38 A;  2AFO A;  4MY3 A;  4MFJ A;  4UWI A;  1F2O A;  5LRJ A;  2NYQ A;  3WAB A;  4LUA A;  4PXC A;  3LD2 A;  2CNS A;  1ARL A;  3GB0 A;  4FD5 A;  3BJ7 A;  2OZG A;  1JWQ A;  2X7B A;  2ZOF A;  4OC0 A;  3NE7 A;  1P0H A;  4X5K A;  3S6F A;  3EC4 A;  2HV2 A;  5DWN A;  3ZJ0 A;  3F8K A;  2G3T A;  4Y49 B;  1XMB A;  5C82 A;  5JGF A;  4FD6 A;  4MMO A;  4U9Y A;  4JD6 A;  2QIR A;  3G3S A;  2RFH A;  4B5P A;  4B14 A;  2P6E A;  2EBJ A;  1IOF A;  2IQ6 A;  4XPL A;  2I79 A;  1VKC A;  4P10 A;  3RNZ A;  2O4H A;  4PQA A;  3D7H A;  4UBR A;  3BJ8 A;  1PU9 A;  1KZF A;  3KHX A;  4KOR A;  2WYR A;  4GS4 A;  3N7Z A;  2B3U A;  4CGN A;  4LQ6 A;  4YGO A;  3RO0 A;  4BBH A;  1ZG8 A;  2JDC A;  3CPA A;  3KKW A;  2C6P A;  4UEF A;  1IID A;  2PJ7 A;  1CP7 A;  4UF4 A;  1Q2Y A;  4MFP A;  4DNC A;  1WWZ A;  1VGY A;  3QNV A;  2Z3P A;  4P4J A;  4PPZ A;  2AFS A;  2Q0Y A;  1WK4 A;  3NH4 A;  4ZY1 A;  2GAN A;  2I3C A;  3R9F A;  3TT2 A;  3GYA A;  2AFX A;  3PFE A;  1Y7E A;  3CPX A;  1M4G A;  2FSR A;  2Z3N A;  3TOA A;  4RUH A;  3WT4 A;  1YRE A;  1AYE A;  2ODF A;  1KWM A;  3PEI A;  4MFZ A;  4DUK A;  1XOV A;  2OZU A;  2CIJ A;  3CXQ A;  3IGR A;  4MHD A;  4R3K A;  3V8I A;  1ELL P;  5D29 A;  2OU2 A;  1KUV A;  5I0C A;  4NFR A;  2ATR A;  5DS0 A;  4CAV A;  1LRZ A;  1Z9U A;  3DR8 A;  4UEZ A;  4EME A;  2CTB A;  4A2Z A;  2ARH A;  2ZW5 A;  1QSM A;  4CAF A;  2B4B A;  2A4N A;  4Q36 A;  1X10 A;  4U9Z A;  2Z3M A;  1CPS A;  4CPA A;  4IAV A;  4MHZ A;  2VL1 A;  1AMP A;  2ZPA A;  3EXN A;  3P2H A;  1S5K A;  1KUY A;  3PB4 X;  2XEF A;  1OBR A;  3JRU A;  4KLW A;  2Z0Z A;  2V8V A;  5LYI A;  4P4E A;  4RS2 A;  4JWP A;  1QSN A;  4KOT A;  4QC6 A;  4K30 A;  4MFK A;  3B8G A;  3K9T A;  3PBE A;  2ZEF A;  4CGP A;  2Q4Y A;  5BWA B;  1BPN A;  4B11 A;  4MJ8 A;  5K8M A;  3FYN A;  3I3G A;  2H5M A;  2PDO A;  5LRK A;  2ANP A;  1ON0 A;  5JQ4 A;  3NH8 A;  4B12 A;  3W6X A;  4F9U A;  4XPK A;  2CNT A;  4HNY B;  4KOU A;  4MCP A;  2QEC A;  3JUW A;  2QVP A;  4KSA A;  4OC2 A;  4QBJ A;  1YK3 A;  2WUU A;  2GLJ A;  4NGN A;  5F48 A;  4FWU A;  3FVL A;  2AFM A;  4R8F A;  5H84 A;  3IU2 A;  4YU9 A;  2PR1 A;  3FX6 A;  1Z8L A;  2VZZ A;  5KTA A;  1IIC A;  1JQG A;  1IYL A;  1R3N A;  4A95 A;  3D8P A;  2PVW A;  3S9N A;  5HMN A;  1YLE A;  1QSO A;  2BUE A;  2Q7B A;  3KGQ A;  3D7D A;  4NGP A;  5K8P A;  2PVV A;  5GCN A;  4A94 A;  3GY9 A;  3IJ3 A;  3N5F A;  4IHM A;  5LRG A;  4ONW A;  2EO8 A;  2RB7 A;  2Z3O A;  5CNP A;  4OLL A;  8CPA A;  3KR5 A;  5H86 A;  1ELM P;  4UCP A;  1NSL A;  2J8N A;  1Y9W A;  1CPX A;  4JXR A;  3D3S A;  2FS5 A;  4KZT A;  1S7F A;  4PXD A;  2BOA A;  2OH1 A;  1Z8T A;  1VHE A;  5A27 A;  2D4P A;  1S7L A;  2GRE A;  2Z3L A;  1ZO0 A;  4MHP A;  4TWE A;  3PGP A;  4XPD B;  3SJE A;  4F8Z A;  2PR8 A;  3K9U A;  3K2K A;  4R3L A;  3TO6 A;  4EWT A;  4ZGY B;  3I9S A;  2GFQ A;  4NGR A;  1BO4 A;  2R98 A;  4E2A A;  3TE4 A;  4UCN A;  1B6B A;  5EC4 A;  1LFW A;  1Z8W A;  2Q43 A;  1IOI A;  2AFZ A;  3VAT A;  3VWE A;  2FXF A;  1H8L A;  3IIB A;  4JJX A;  4X3R A;  5CBM A;  4U5Y A;  3KI9 A;  2PIZ A;  3FEE A;  4KOW A;  4A31 A;  3H8G A;  3PB8 X;  5HVF A;  3BXM A;  2Q44 A;  5F46 A;  1TXR A;  3CDX A;  1F57 A;  3FF3 A;  1KUX A;  2B5G B;  3QAH A;  4PXB A;  3D67 A;  1PCA A;  2C1C A;  5KTD A;  1R57 A;  3S6K A;  2CXA A;  3ISZ A;  4FUU A;  4R57 A;  2AE6 A;  4LX9 A;  4YWY A;  2FCK A;  2R1I A;  3SXO A;  3W6S A;  5A28 A;  1YQE A;  2PJC A;  1AUG A;  4JXQ A;  1M4L A;  3CXS A;  5J8F A;  4QB9 A;  1MJA A;  4LQG A;  3WC6 A;  2HUZ A;  3IC1 A;  5IV0 A;  2PJ8 A;  4MFL A;  4B13 A;  1VIX A;  4H89 A;  4MFQ A;  4NF1 A;  4MCS A;  4B5P B;  5K8N A;  4GXH A;  2G3A A;  4ZYQ A;  5J8C A;  3NFZ A;  4A37 A;  1ZG7 A;  3A9L A;  2PJ9 A;  3LWU A;  3R9E A;  3D2P A;  3EFA A;  1IY7 A;  1YME A;  5J1Q A;  4UIB A;  4HNX B;  3MRU A;  4L89 A;  1HEE A;  2ZEO A;  4NEX A;  4ONU A;  4P44 A;  4ZX8 A;  3BHX A;  4C68 A;  4OP4 A;  1YVO A;  2C6C A;  2POK A;  3IWG A;  5I4M A;  3PZJ A;  2FIA A;  2YGW A;  4W9Y A;  3WR7 A;  1YX0 A;  1QST A;  3H8E A;  4CRZ B;  1PUA A;  1XBU A;  3KHZ A;  4KVX A;  4OC4 A;  4UFW A;  5D8N A;  4F0Y A;  3PB7 X;  2PC1 A;  1Q2C A;  1XRY A;  4WWV A;  3TTH A;  3TO9 A;  4KVO E;  4OAE A;  1DE4 C;  2V8H A;  1LAM A;  5IB9 A;  3NA6 A;  4MHY A;  2FVG A;  3CZX A;  5HH1 A;  1N71 A;  4RN7 A;  4UCM A;  2Q7S A;  5ELY A;  2OZH A;  2Y0M A;  3DLJ A;  1YW6 A;  2AFW A;  2P6G A;  1UFH A;  3H5Z A;  4M3S A;  1K4J A;  4ZBG A;  4M6G A;  3SI1 A;  1MK4 A;  4IK2 A;  4CYP A;  3FH4 A;  3HUV A;  4QUS A;  2CF4 A;  2F7V A;  3S9M A;  3SI2 A;  1V0C A;  1YSJ A;  1Q7L A;  2ZEN A;  5JH9 A;  4H6Z A;  2IL4 A;  2PRB A;  2HC9 A;  3E0K A;  2EK9 A;  1FT7 A;  2ZW4 A;  3NH5 A;  4ZI6 A;  1U6M A;  3FBU A;  5F09 A;  2ZXV A;  5E96 A;  1IYK A;  2QYV A;  3D7G A;  4KUB A;  2PJ6 A;  4PK3 A;  3RBU A;  1YLO A;  1QQ9 A;  2J8R A;  1Y0Y A;  3B7I A;  3GIU A;  2ABZ A;  1TKH A;  3R95 A;  4FD7 A;  3S9L A;  4A32 A;  2KCW A;  3DGV A;  5LYD A;  2GLF A;  2B3V A;  5CPA A;  5JPH A;  2NMT A;  2YNC C;  1M4I A;  1YGH A;  3CT9 A;  4KOX A;  5LYF A;  2BEI A;  1P4N A;  3R96 A;  1RO5 A;  2P0W A;  2QJ8 A;  3CXP A;  2B58 A;  4KUA A;  3PFO A;  3FXT A;  3H8F A;  4KOY A;  3FEC A;  2EK8 A;  2G0B A;  3PB9 X;  1S7N A;  1HDQ A;  2O53 A;  4YFJ A;  3IEH A;  3GKR A;  2JLM A;  1S3Z A;  2DEA A;  1ZG9 A;  3NE8 A;  2XEI A;  1NSA A;  2WSA A;  2YND A;  3MN8 A;  3QB8 A;  1VHO A;  4X2T A;  2IMO A;  1BAV A;  4OID A;  4AVB A;  4AVA A;  3LMS A;  3PRT A;  4PK2 A;  4A39 A;  1QSR A;  4O23 A;  4L8A A;  2D4O A;  2JEW A;  4PSW A;  3HLP A;  1YW4 A;  1Z8X A;  2ZEH A;  4M85 A;  2ZEM A;  4NGM A;  4BIN A;  4C7H A;  4DYO A;  4XNH C;  5FVJ A;  2VXK A;  2YNC A;  3KQX A;  2IJZ A;  2O28 A;  4AG7 A;  2VBQ A;  3R1K A;  1CX8 A;  2PQ8 A;  4II9 A;  1BLL E;  2HB6 A;  2WPW A;  4B10 A;  1YR0 A;  1ZLI A;  4KLV A;  4E8O A;  4R6T A;  1HDU A;  3SJG A;  2PE3 A;  1CBX A;  3D66 A;  4OIW A;  1QMU A;  5THW A;  3B3S A;  4BMH A;  4NGQ A;  2PJ3 A;  4C2X A;  2C6G A;  3RAM A;  4IF5 A;  3LOD A;  2ZEL A;  1S7K A;  1MJ9 A;  3MGD A;  2PJB A;  4R9M A;  1L0C A;  2YNE A;  3F5B A;  1CJW A;  2EWB A;  2DXQ A;  4AB7 A;  3JVN A;  4CAX A;  5KTC A;  5ISV A;  2DPT A;  2XEJ A;  4NXY A;  1RXT A;  3BI0 A;  2B4D A;  4UFX A;  4NJR A;  2Q4V A;  1IGB A;  5AG7 A;  4OKO A;  2ZED A;  4H6U A;  2GIV A;  4X8I A;  3PBB A;  2VZY A;  2WPX A;  3FB3 A;  3KQZ A;  4OAD A;  4R87 A;  4Z65 A;  5IB0 A;  3WC5 A;  4E0A A;  2OR4 A;  3T8W A;  2Q04 A;  1F2P A;  3DR6 A;  3KZW A;  3B2Y A;  4UA3 A;  1XEB A;  2B4D B;  2P6F A;  2FT0 A;  3BI1 A;  1LAN A;  3FED A;  3FRM A;  4OC1 A;  4RI1 A;  1TKF A;  4XNH B;  5G20 A;  5G22 A;  1R43 A;  1TKJ A;  4GM5 A;  4NGT A;  3FNC A;  2Z10 A;  2HQY A;  4G1P A;  3T9Y A;  4CAW A;  1CG2 A;  4A30 A;  4ZX9 A;  4C7I A;  2V8D A;  4Q7A A;  2JEV A;  2PIY A;  2QML A;  3DDD A;  1IB1 E;  4P4F A;  4UWJ A;  3SJF A;  2G9D A;  2ZEE A;  5HXD A;  1B87 A;  2EUI A;  2JBK A;  2EVN A;  4CAE A;  2Q4Z A;  4MXU A;  3SHP A;  5JM6 A;  1Z2L A;  3RZA A;  4A38 A;  1RTQ A;  3F0A A;  3V7Z A;  5G1Z A;  5AG4 A;  5HVG A;  3WC7 A;  2AFU A;  3I1U A;  4ZY2 A;  4MRI A;  4CYO A;  1MJB A;  1X12 A;  4NJQ A;  1GHE A;  2VEZ A;  3B3C A;  4KVM E;  5HVH A;  3TC8 A;  1XE4 A;  2PJ1 A;  3FIX A;  1Y9K A;  3PP9 A;  4FBE A;  3DNS A;  1EE3 P;  4QVT A;  3TOB A;  3D4U A;  4TNU A;  2PSW A;  2REE A;  5F47 A;  1I21 A;  3C26 A;  2WZN A;  4FAI A;  2CNM A;  4M6H A;  3BLN A;  4KS9 A;  2OOT A;  3VAR A;  2JBJ A;  5EMI A;  3T90 A;  3UY5 A;  4UEE A;  4MY0 A;  2ZEG A;  1Y7R A;  4MBU A;  4F6A A;  3DSB A;  3KAS A;  1I1D A;  2R8V A;  3KR4 A;  2K5T A;  2V77 A;  1M44 A;  4UIA A;  3ZZI A;  3TFY A;  1XJO A;  2Z3K A;  3GLJ A;  1OZP A;  2ZW7 A;  1CP6 A;  4CYN A;  3V38 A;  4K3N A;  2ZOG A;  3ISX A;  1YVK A;  4NSQ A;  5AG6 A;  3SXN A;  5EBV A;  3GUX A;  2F5I A;  3S6G A;  1A2Z A;  2GU2 A;  2VI7 A;  2DPS A;  3B3V A;  4ORF A;  3RYO A;  2FIW A;  2V8G A;  1XIX A;  1Z5R A;  2J9A A;  1LAP A;  4C2Z A;  1TF9 A;  4M6I A;  4MI4 A;  2PCU A;  1J4J A;  3SI0 A;  4PV6 A;  7CPA A;  1S60 A;  3VWD A;  2CTC A;  1Z4R A;  4HNW B;  1ZLH A;  4OC5 A;  2BSW A;  3R9G A;  2RC4 A;  5K8O A;  4NCZ A;  4BD9 A;  3TCV A;  4B6Z A;  1M1D A;  1FY7 A;  3G8W A;  3EO4 A;  4AXV A;  4P4D A;  4MCQ A;  4A33 A;  1DTD A;  2PJ0 A;  2VQY A;  3IO1 A;  2F8H A;  1FNO A;  4JYW A;  4F0X A;  5IX3 A;  4MCR A;  3EY5 A;  4CRY B;  1BPM A;  1Z4E A;  3IWE A;  1IU8 A;  2Z11 A;  3L2N A;  3IWW A;  5F49 A;  1NMT A;  3JTK A;  3TX8 A;  3S6H A;  3P2F A;  2REF A;  3IU1 A;  1LOK A;  4NGS A;  2PJ4 A;  4XPD C;  2BO9 A;  1BOB A;  3LAC A;  2OB0 A;  2FL4 A;  5DWM A;  4YRH A;  4ZY0 A;  3KL9 A;  2NSM A;  3B3T A;  3IFE A;  3H4Q A;  4KSI A;  2Q51 A;  4IUS A;  4HKF A;  2C27 A;  1XF8 A;  2DF5 A;  4PXE A;  3SJX A;  2PRQ A;  1Q2D A;  4MHN A;  2J8M A;  5LYL A;  2R7H A;  2I00 A;  4I49 A;  1Y0R A;  4P6Y A;  2ZEP A;  5AG5 A;  3FJU A;  2GE3 A;  3OWC A;  3PB6 X;  4OME A;  2AJ6 A;  4WJB A;  4Y49 C;  5AGE A;  4EVY A;  3VH9 A;  4P4B A;  6CPA A;  4J3G A;  4B5O A;  1XMT A;  2JDD A;  2BCO A;  3QAY A;  4HPS A;  3B3W A;  1ARM A;  4CGL A;  4C2Y A;  3D7F A;  4KOS A;  1SQH A;  4P4I A;  4UFV A;  3TO7 A;  1LCP A;  4CYQ A;  4EFD A;  1M4D A;  3D68 A;  1XFO A;  4H2K A;  1NE9 A;  1CM0 A;  2XEG A;  4R7M A;  4CS0 B;  4AG9 A;  2PJ2 A;  4FD4 A;  4CGM A;  4DJL A;  5C88 A;  4KSF A;  4P45 A;  4OC3 A;  5G21 A;  1GYT A;  1PYT B;  2FE7 A;  4PSX A;  4R76 A;  3D2M A;  4KOV A;  1TF8 A;  2PJ5 A;  1UWY A;  3W91 A;  1TIQ A;  2BL1 A;  4F9V A;  3FMC A;  4JLY A; 
#chains in the Genus database with same CATH homology
 4CGO A;  1VHS A;  1I12 A;  2CY2 A;  4AVC A;  2B5G A;  2ZW6 A;  4Q38 A;  4MY3 A;  4MFJ A;  4UWI A;  4LUA A;  3LD2 A;  2CNS A;  4FD5 A;  3BJ7 A;  2OZG A;  2X7B A;  3NE7 A;  1P0H A;  4X5K A;  3S6F A;  3EC4 A;  2HV2 A;  5DWN A;  3ZJ0 A;  3F8K A;  2G3T A;  4Y49 B;  5C82 A;  4FD6 A;  4U9Y A;  4JD6 A;  2QIR A;  3G3S A;  4B14 A;  4B5P A;  2P6E A;  4XPL A;  2I79 A;  1VKC A;  4UBR A;  3BJ8 A;  1PU9 A;  1KZF A;  4KOR A;  4GS4 A;  3N7Z A;  2B3U A;  4CGN A;  4YGO A;  4BBH A;  5C88 A;  2JDC A;  3KKW A;  1IID A;  4DNC A;  1Q2Y A;  4MFP A;  1WWZ A;  2Z3P A;  2Q0Y A;  1WK4 A;  2GAN A;  3R9F A;  3TT2 A;  3GYA A;  1M4G A;  2FSR A;  2Z3N A;  3TOA A;  1YRE A;  4MFZ A;  2OZU A;  3CXQ A;  3IGR A;  4MHD A;  4R3K A;  3V8I A;  2OU2 A;  1KUV A;  5I0C A;  2ATR A;  4CAV A;  1LRZ A;  1Z9U A;  3DR8 A;  4A2Z A;  2ARH A;  2ZW5 A;  1QSM A;  4CAF A;  2B4B A;  2A4N A;  4Q36 A;  4U9Z A;  2Z3M A;  2ZPA A;  3EXN A;  3P2H A;  1S5K A;  1KUY A;  4KLW A;  2Z0Z A;  4RS2 A;  4JWP A;  1QSN A;  4KOT A;  4QC6 A;  4K30 A;  4MFK A;  3B8G A;  4CGP A;  2Q4Y A;  5BWA B;  4B11 A;  4MJ8 A;  3FYN A;  3I3G A;  2H5M A;  2PDO A;  5JQ4 A;  1ON0 A;  4B12 A;  3W6X A;  4XPK A;  2CNT A;  4HNY B;  4KOU A;  2QEC A;  3JUW A;  4KSA A;  4QBJ A;  1YK3 A;  2WUU A;  5F48 A;  5H84 A;  3IU2 A;  2PR1 A;  2VZZ A;  5KTA A;  1IIC A;  1IYL A;  4A95 A;  3D8P A;  5HMN A;  1YLE A;  1QSO A;  2BUE A;  2Q7B A;  5GCN A;  3GY9 A;  2Z3O A;  5CNP A;  4OLL A;  5H86 A;  4UCP A;  1NSL A;  2J8N A;  1Y9W A;  4JXR A;  3D3S A;  2FS5 A;  4KZT A;  1S7F A;  2OH1 A;  5A27 A;  2D4P A;  1S7L A;  2Z3L A;  1ZO0 A;  4XPD B;  3PGP A;  2PR8 A;  3K9U A;  4R3L A;  3TO6 A;  4ZGY B;  3I9S A;  4E2A A;  1BO4 A;  2R98 A;  3TE4 A;  4UCN A;  1B6B A;  5EC4 A;  3VWE A;  2FXF A;  4JJX A;  4U5Y A;  4KOW A;  4A31 A;  2Q44 A;  5F46 A;  1KUX A;  2B5G B;  3QAH A;  5KTD A;  1R57 A;  3S6K A;  2CXA A;  4R57 A;  2AE6 A;  4LX9 A;  2FCK A;  2R1I A;  3SXO A;  3W6S A;  5A28 A;  4JXQ A;  3CXS A;  5J8F A;  4QB9 A;  1MJA A;  2HUZ A;  5IV0 A;  4MFL A;  4B13 A;  4H89 A;  4MFQ A;  4NF1 A;  4B5P B;  2G3A A;  5J8C A;  3A9L A;  3R9E A;  3D2P A;  3EFA A;  4HNX B;  4L89 A;  4NEX A;  4ONU A;  4C68 A;  1YVO A;  3IWG A;  3PZJ A;  2FIA A;  2YGW A;  3WR7 A;  1YX0 A;  1QST A;  4F0Y A;  4CRZ B;  1PUA A;  4KVX A;  4UFW A;  2PC1 A;  1Q2C A;  3TTH A;  3TO9 A;  4KVO E;  4OAE A;  5HH1 A;  1N71 A;  4UCM A;  2OZH A;  2Y0M A;  2P6G A;  1UFH A;  3H5Z A;  4M3S A;  1K4J A;  4ZBG A;  1MK4 A;  4CYP A;  4QUS A;  1V0C A;  4H6Z A;  2IL4 A;  2PRB A;  3E0K A;  2ZW4 A;  3FBU A;  1U6M A;  2ZXV A;  5E96 A;  1IYK A;  4KUB A;  4PK3 A;  2J8R A;  3R95 A;  4FD7 A;  4A32 A;  2KCW A;  5JPH A;  2B3V A;  2NMT A;  2YNC C;  1M4I A;  1YGH A;  4KOX A;  2BEI A;  1P4N A;  3R96 A;  1RO5 A;  2P0W A;  3CXP A;  4KUA A;  2B58 A;  3FXT A;  4KOY A;  2G0B A;  1S7N A;  4YFJ A;  3GKR A;  2JLM A;  1S3Z A;  3QB8 A;  2WSA A;  5DWM A;  2YND A;  4AVA A;  4AVB A;  4PK2 A;  1QSR A;  4L8A A;  2D4O A;  4PSW A;  4M85 A;  4C7H A;  4XNH C;  5FVJ A;  2VXK A;  2YNC A;  2O28 A;  4AG7 A;  2VBQ A;  3R1K A;  2PQ8 A;  4II9 A;  2WPW A;  4B10 A;  1YR0 A;  4KLV A;  4E8O A;  4BMH A;  4C2X A;  4IF5 A;  3LOD A;  1S7K A;  1MJ9 A;  3MGD A;  4R9M A;  1L0C A;  2YNE A;  3F5B A;  1CJW A;  4AB7 A;  2DXQ A;  4CAX A;  3JVN A;  5KTC A;  5ISV A;  2DPT A;  4NXY A;  1RXT A;  2B4D A;  4UFX A;  2Q4V A;  5AG7 A;  4H6U A;  2GIV A;  2VZY A;  2WPX A;  3FB3 A;  4OAD A;  4R87 A;  5IB0 A;  4E0A A;  2Q04 A;  3DR6 A;  4UA3 A;  1XEB A;  2B4D B;  2P6F A;  2FT0 A;  3FRM A;  4RI1 A;  4XNH B;  5G20 A;  5G22 A;  3FNC A;  2Z10 A;  2HQY A;  3T9Y A;  4CAW A;  4A30 A;  4C7I A;  2JEV A;  2QML A;  3DDD A;  4UWJ A;  1IB1 E;  1B87 A;  2EUI A;  4CAE A;  2EVN A;  3SHP A;  3F0A A;  5G1Z A;  5AG4 A;  4CYO A;  1MJB A;  1GHE A;  2VEZ A;  4KVM E;  1XE4 A;  3FIX A;  1Y9K A;  3PP9 A;  3DNS A;  4QVT A;  3TOB A;  2PSW A;  2REE A;  5F47 A;  1I21 A;  3C26 A;  2CNM A;  3BLN A;  4KS9 A;  3T90 A;  3UY5 A;  4MY0 A;  1Y7R A;  4MBU A;  4F6A A;  3DSB A;  1I1D A;  2R8V A;  2K5T A;  3ZZI A;  1M44 A;  3TFY A;  2Z3K A;  1OZP A;  2ZW7 A;  4CYN A;  1YVK A;  4NSQ A;  5AG6 A;  3SXN A;  5EBV A;  3S6G A;  2F5I A;  2VI7 A;  2DPS A;  4ORF A;  3RYO A;  2FIW A;  1XIX A;  4C2Z A;  4MI4 A;  1J4J A;  4PV6 A;  1S60 A;  3VWD A;  4HNW B;  1Z4R A;  2BSW A;  3R9G A;  2RC4 A;  4NCZ A;  3TCV A;  1M1D A;  1FY7 A;  3G8W A;  3EO4 A;  4A33 A;  2VQY A;  4F0X A;  5IX3 A;  3EY5 A;  4CRY B;  1Z4E A;  3IWE A;  2Z11 A;  5F49 A;  1NMT A;  3JTK A;  3S6H A;  3P2F A;  2REF A;  3IU1 A;  4XPD C;  1BOB A;  2OB0 A;  2FL4 A;  4YRH A;  3H4Q A;  4IUS A;  4HKF A;  2C27 A;  1XF8 A;  1Q2D A;  2J8M A;  2R7H A;  2I00 A;  4I49 A;  5AG5 A;  2GE3 A;  3OWC A;  4Y49 C;  2AJ6 A;  5AGE A;  4EVY A;  4J3G A;  4B5O A;  1XMT A;  2JDD A;  4CGL A;  4C2Y A;  4KOS A;  1SQH A;  4UFV A;  3TO7 A;  4CYQ A;  1M4D A;  1NE9 A;  1CM0 A;  4CS0 B;  4AG9 A;  4FD4 A;  4CGM A;  4KSF A;  5G21 A;  4PSX A;  2FE7 A;  3D2M A;  4KOV A;  3W91 A;  1TIQ A;  2BL1 A;  4JLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...