4FD4A

Crystal structure of mosquito arylalkylamine n-acetyltransferase like 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
b'SIVLRVARLDELEQVREILHRIYYPEEGITISYVHGKSHTLDDERFSLSFVEQGTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVCGRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEKLGMECISQLALGDYRDEKGEKLFEPLDVHQVIKTCVKLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arylalkylamine N-Acetyltransferase like 5b
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 74
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd4A00
4AG9A 4UWIA 3T90A 5EC4A 1YGHA 2PDOA 2NMTA 2Q7BA 4B5OA 4B5PB 3CXSA 4L89A 4J3GA 4M3SA 5JPHA 1S5KA 2RC4A 4RI1A 1YVKA 2AE6A 2J8MA 1M1DA 3TOBA 2KCWA 1YVOA 2PRBA 3PP9A 1Y7RA 2B5GA 1KUVA 4EVYA 1XMTA 1CJWA 1M4IA 3B8GA 1FY7A 5IX3A 2HUZA 2OZGA 1MK4A 1M4DA 2EUIA 4HNXB 1KZFA 2CNMA 3UY5A 4KLVA 3QB8A 3W6SA 4K30A 4CAWA 5IB0A 2P6EA 1XIXA 3VWEA 3E0KA 4U5YA 3PZJA 4MY3A 4MBUA 1Y9WA 5F49A 2IL4A 3FRMA 5F48A 3EC4A 2BL1A 4HKFA 3K9UA 4AG7A 3H4QA 1M44A 3R95A 5F46A 3GYAA 4JWPA 2BEIA 1IICA 1P0HA 2GIVA 3D3SA 3IWGA 1YK3A 4H6ZA 3TTHA 2Z10A 3PGPA 2BUEA 4KOVA 4BMHA 2FS5A 2D4OA 5DWMA 5JQ4A 4I49A 2K5TA 2FIAA 3D2PA 4KOYA 3QAHA 2JDDA 2FSRA 2X7BA 3LD2A 1SQHA 4XPDB 4U9ZA 3BLNA 5ISVA 5IV0A 1QSNA 3DDDA 4PV6A 2Q44A 2Q0YA 3DNSA 1I21A 3SHPA 3TO6A 2ZXVA 2VI7A 1IB1E 2PR8A 3EFAA 1YLEA 2DXQA 4KORA 1Q2CA 2OB0A 3F0AA 3TT2A 2Y0MA 4XPDC 4PK3A 2PR1A 1S60A 2QIRA 5FVJA 3EO4A 1IIDA 1RXTA 1I12A 1S3ZA 4CS0B 1QSOA 3G3SA 4KVME 3BJ8A 2VZZA 4RS2A 1V0CA 3FIXA 4KZTA 1S7LA 4OLLA 2QECA 1M4GA 3MGDA 4CAXA 4JLYA 4PSWA 3SXOA 3TCVA 4AB7A 4OAEA 2QMLA 4E8OA 1Z4RA 3JUWA 3EXNA 4LX9A 3FXTA 1VKCA 2I00A 1Q2DA 2B5GB 5C82A 4QBJA 2F5IA 4NEXA 4CRZB 4NSQA 2R1IA 3VWDA 3FBUA 5I0CA 5HH1A 3BJ7A 3GY9A 3P2FA 4FD6A 3FYNA 3R96A 1I1DA 4CRYB 4KOXA 2JLMA 1NMTA 3F8KA 2AJ6A 2VBQA 1S7NA 3NE7A 4H89A 3R9GA 1UFHA 2BSWA 3S6KA 3D2MA 2ZW5A 2GANA 2Q4YA 2VQYA 4YRHA 4UA3A 2HQYA 4QVTA 4FD4A 5KTCA 3TOAA 4E2AA 3OWCA 4NXYA 2B3VA 4PSXA 2HV2A 4M85A 4KUBA 1RO5A 3IGRA 4HNWB 4R3LA 2FT0A 1N71A 5J8FA 4AVBA 4MJ8A 5E96A 3DR8A 4GS4A 2FL4A 5H84A 3F5BA 1LRZA 4XPKA 1MJBA 4CAVA 3EY5A 1KUYA 2G3AA 5C88A 2J8NA 1XF8A 2FE7A 3WR7A 3R9FA 1GHEA 4R9MA 4X5KA 3TO7A 2B58A 2D4PA 3D8PA 1P4NA 4F0YA 2P0WA 3FNCA 1B87A 1L0CA 1IYLA 1Z9UA 3I9SA 4HNYB 1B6BA 3CXQA 1Y9KA 2CNSA 2Q04A 4R87A 2WPWA 3S6HA 3W6XA 1PUAA 2ZW4A 4ZBGA 2G0BA 3ZJ0A 3T9YA 3CXPA 2H5MA 1YR0A 2FIWA 1K4JA 2REFA 4QUSA 4YFJA 4B5PA 2ZPAA 1PU9A 2OU2A 1S7KA 4KVOE 4JD6A 5HMNA 5KTDA 2FCKA 2PSWA 2Z11A 3G8WA 4IUSA 4MHDA 4R3KA 2VXKA 2PC1A 3RYOA 2CY2A 2FXFA 2ZW6A 4JXRA 3TO9A 2CNTA 3JVNA 2P6FA 3TE4A 2Z0ZA 4OADA 4E0AA 2B3UA 4F6AA 1YX0A 2G3TA 4NCZA 2ZW7A 5GCNA 3GKRA 2OZUA 1J4JA 4H6UA 4AVCA 1KUXA 4JJXA 5F47A 1CM0A 1Z4EA 2A4NA 5CNPA 4FD7A 1U6MA 1QSMA 2WPXA 2OZHA 4XNHB 2PQ8A 2ARHA 3LODA 4KUAA 2EVNA 3TFYA 4JXQA 3S6GA 4KOWA 1IYKA 4AVAA 1NE9A 4MI4A 2I79A 2R8VA 2VZYA 1NSLA 3ZZIA 4MY0A 4FD5A 4XNHC 3R9EA 4YGOA 1BOBA 1ON0A 4UBRA 1YREA 5DWNA 3SXNA 3S6FA 1TIQA 4L8AA 3V8IA 3N7ZA 1QSTA 2R7HA 4R57A 4DNCA 1QSRA 4ONUA 1XEBA 2ATRA 3KKWA 2C27A 2J8RA 4KOTA 1WK4A 5J8CA 5H86A 2B4DA 3DSBA 4KOUA 5EBVA 4PK2A 4QC6A 2OH1A 2B4BA 3I3GA 2VEZA 3C26A 4NF1A 4II9A 2Q4VA 1XE4A 2B4DB 3DR6A 4IF5A 4KVXA 4Y49B 4UWJA 4XPLA 1WWZA 2GE3A 3FB3A 3W91A 1OZPA 4LUAA 1MJ9A 2JEVA 2REEA 4U9YA 2P6GA 1Q2YA 5KTAA 1R57A 2R98A 1BO4A 1S7FA 4KLWA 2O28A 1MJAA 1VHSA 3P2HA 2JDCA 4QB9A 4KOSA 4Y49C 4ORFA 3R1KA
chains in the Genus database with same CATH superfamily
4AG9A 4P4FA 4UWIA 3T90A 5EC4A 5EMIA 2PJ1A 3WC6A 1YGHA 7CPAA 2BOAA 4OC3A 2PDOA 2NMTA 5LYIA 2Q7BA 4B5OA 4B5PB 3R1KA 3CXSA 4L89A 1Y0YA 2Z3MA 4J3GA 2AFXA 4M3SA 5JPHA 4LQGA 2POKA 1S5KA 2RC4A 5LYFA 4RI1A 1YVKA 2AE6A 3IFEA 2J8MA 1M1DA 1ZG7A 4NGQA 2KCWA 3TOBA 1YVOA 2PRBA 2V8HA 3PP9A 4MCRA 1X12A 1Y7RA 5A27A 2ANPA 2B5GA 3NH4A 1KUVA 3IWEA 5G22A 4EVYA 1BPMA 1XMTA 2AFMA 1VHEA 1CJWA 1M4IA 3B8GA 1FY7A 2Z3OA 5IX3A 2HUZA 5JH9A 4A32A 2OZGA 1MK4A 4F9UA 1M4DA 3GB0A 2EUIA 4ZYQA 4HNXB 1KZFA 3GLJA 4FAIA 4JYWA 2CNMA 3UY5A 4BINA 1IGBA 4UCMA 4KLVA 3MN8A 4C7HA 3QB8A 3ISXA 5HVFA 2OOTA 3W6SA 4K30A 3V38A 4CAWA 4ZI6A 3PB4X 1AYEA 3CPXA 3D7FA 5IB0A 2P6EA 4ZX9A 1XIXA 3VWEA 3E0KA 4U5YA 3PZJA 4MY3A 4MBUA 4OP4A 1Y9WA 1CP6A 5F49A 2IL4A 3FRMA 4CGNA 5K8MA 3FF3A 4P45A 2CTCA 5F48A 2ZEGA 4AXVA 3EC4A 2BL1A 1XRYA 3K9UA 4HKFA 4MRIA 4AG7A 3S9LA 1BAVA 4A37A 1IOFA 2NYQA 2PJ0A 4NJQA 2GLJA 3B7IA 3H4QA 3T8WA 1M44A 4PXBA 1Z2LA 4P4IA 4RN7A 3R95A 2ZEMA 5F46A 5HXDA 1ELMP 3CZXA 3GYAA 4JWPA 2BEIA 2V8DA 4MFKA 1IICA 1P0HA 2GIVA 2ZOGA 3D3SA 3IWGA 1YK3A 3IO1A 4H6ZA 3TTHA 4ZY0A 2Z10A 4MFZA 4MFJA 1TKHA 4UFVA 3PGPA 2BUEA 4KOVA 4BMHA 2FS5A 4EMEA 2RFHA 2D4OA 5DWMA 4A33A 5JQ4A 4I49A 2K5TA 1QMUA 1AMPA 2FIAA 3D2PA 4KOYA 3QAHA 4MHYA 4P4BA 2CIJA 1RTQA 2V8VA 4R76A 2JDDA 4OIWA 2BCOA 1IU8A 2PJ7A 2PJ2A 4TNUA 3WT4A 2FSRA 2X7BA 3LD2A 1SQHA 2G9DA 4XPDB 4U9ZA 3BLNA 5G20A 5ISVA 5IV0A 2EO8A 2JBKA 3D7DA 4CGPA 4CYNA 2EWBA 4UCPA 1QSNA 2EK8A 3DDDA 1HDUA 4PV6A 4P4JA 4R8FA 4B11A 4PXDA 2Q44A 2Q0YA 1I21A 3DNSA 3SHPA 3TO6A 3KGQA 4KSIA 4OC4A 2ZEOA 2ZXVA 2VI7A 4C2XA 1IB1E 2PR8A 5I4MA 5JGFA 5J1QA 3EFAA 1YLEA 2ZEHA 2DXQA 4KORA 4MHZA 1Q2CA 5LRKA 2OB0A 5IB9A 4NGNA 2EK9A 3F0AA 3SI0A 3TC8A 2CTBA 4R6TA 1LAPA 2Y0MA 3TT2A 3BI1A 2PIYA 4XPDC 3B3WA 2DPSA 5DS0A 4PK3A 2PR1A 1S60A 4X2TA 2PCUA 2QIRA 5FVJA 4C2ZA 5HVHA 5K8OA 4B13A 1QQ9A 4KSFA 1IY7A 3EO4A 4A39A 1IIDA 1RXTA 5D29A 4CGMA 1I12A 4ZX8A 4WWVA 4M6GA 1S3ZA 4FBEA 4CS0B 1QSOA 2Q4ZA 4OMEA 4PQAA 1Z8XA 3D68A 3G3SA 4KVME 3BJ8A 3N5FA 2PJ4A 4MCSA 3SJXA 2O53A 2VZZA 1OBRA 4RS2A 1V0CA 2IJZA 3FIXA 4G1PA 3DLJA 4KZTA 1S7LA 4MCPA 4CAEA 5AGEA 2YNEA 4OLLA 2QECA 3VATA 1M4GA 1PYTB 4HPSA 3MGDA 4CAXA 2VL1A 4JLYA 4MCQA 4A31A 3IEHA 4PSWA 2V8GA 3SXOA 3LMSA 1CPSA 3TCVA 4CYQA 4AB7A 2PJCA 4OAEA 1TKJA 4CPAA 2C6CA 2F7VA 4Q7AA 4H2KA 2QMLA 1JWQA 4OIDA 3BHXA 4F0XA 2V77A 4B12A 4E8OA 1KWMA 2GFQA 5K8PA 1Z4RA 4OC2A 3GIUA 1XJOA 3JUWA 3EXNA 4LX9A 3FVLA 4M6IA 1XBUA 3FXTA 1VKCA 4R7MA 4CAFA 2I00A 4ZGYB 3KQZA 4C2YA 1Q2DA 3H8GA 1TF8A 3B3SA 5F09A 4IHMA 2HB6A 2B5GB 3KHZA 1Y0RA 1X10A 2C6GA 3NH5A 2ZEFA 5C82A 2AFSA 4QBJA 2DPTA 2HC9A 4OC0A 2F5IA 3B3TA 4NEXA 4NJRA 5JM6A 2Z3PA 3KI9A 4CRZB 4NSQA 2R1IA 3VWDA 3FBUA 5I0CA 4UFWA 2EBJA 5HH1A 3BJ7A 2AFUA 3D67A 3GY9A 3P2FA 4FD6A 2F8HA 3R96A 3CDXA 4Q38A 1I1DA 2QVPA 4CRYB 3H8EA 3JTKA 4KOXA 2JLMA 1NMTA 3F8KA 2AJ6A 3KHXA 2VBQA 1S7NA 3NE7A 4H89A 4JZ0A 3R9GA 3FEEA 1UFHA 2BSWA 3S6KA 4X3RA 2PVWA 3D2MA 2ZW5A 4MFQA 2GANA 3KR4A 2Q4YA 4A95A 2VQYA 2Z3NA 3B3CA 3IJ3A 2XEIA 2RB7A 3QNVA 2PJAA 4UA3A 2HQYA 2DF5A 2PJ3A 4QVTA 4YRHA 5LYLA 4FD4A 5KTCA 3TOAA 4E2AA 3NFZA 4NGMA 5CPAA 3OWCA 4NXYA 5AG5A 3FECA 2B3VA 4PSXA 4RUHA 2HV2A 3SI2A 2GREA 4M85A 2ZEEA 4KUBA 4PPZA 1RO5A 3SI1A 2Z3LA 3IGRA 1ZO0A 4DYOA 4NGPA 4HNWB 1JQGA 1R3NA 1YW4A 3MRUA 4R3LA 2FT0A 3S9NA 1N71A 5J8FA 5AG7A 1TXRA 2C6PA 5D8NA 4AVBA 4MHPA 2PJ6A 4W9YA 4CYOA 4MHNA 4MJ8A 4YU9A 5E96A 3VH9A 3DR8A 4GS4A 4F9VA 4KSAA 2FL4A 5H84A 4C7IA 3F5BA 1LRZA 2BO9A 4XPKA 1MJBA 4A38A 4PXCA 3JRUA 4OKOA 2ZEPA 4MFLA 3QAYA 4ONWA 4CAVA 1ELLP 3EY5A 3D4UA 1KUYA 2G3AA 5C88A 1Z8WA 1ZG8A 4B6ZA 4O23A 4DUKA 2J8NA 1XF8A 2FE7A 4CGLA 3WR7A 4NFRA 3FX6A 3R9FA 4P10A 1GHEA 4R9MA 4BD9A 4X5KA 3LACA 3TO7A 3KL9A 2B58A 1YSJA 3KQXA 2D4PA 4X8IA 5BWAB 3D8PA 1P4NA 4F0YA 2P0WA 5LRGA 1Z8TA 1VGYA 4A2ZA 1EE3P 3D7GA 3B35A 2AFWA 3FNCA 1B87A 2ABZA 1LOKA 1TF9A 3DGVA 2I3CA 3D66A 4UEZA 2WSAA 1L0CA 2Q51A 1IYLA 4CGOA 1Z9UA 2YNCA 1Q7LA 3I9SA 1CG2A 4HNYB 3H8FA 1B6BA 3CXQA 4B14A 1Y9KA 2CNSA 4P44A 2Q04A 1A2ZA 4ZY1A 4A30A 4R87A 2O4HA 2WPWA 3S6HA 3W6XA 1PUAA 2ZW4A 2Q7SA 4ZBGA 2G0BA 1CX8A 3ZJ0A 3T9YA 3KZWA 3CXPA 4PXEA 2H5MA 1YR0A 1M4LA 3IWWA 5K8NA 2FIWA 1K4JA 2REFA 4QUSA 4YFJA 1BLLE 1UWYA 4P4DA 3PB8X 3PEIA 4B5PA 2IMOA 4FWUA 2ZPAA 1PU9A 1ZLIA 4EFDA 4K3NA 1FT7A 2OU2A 1S7KA 3IU1A 4MMOA 1LANA 5G21A 4KVOE 2ZENA 2IQ6A 3FEDA 3IIBA 4FUUA 2GU2A 4IAVA 1TKFA 2AFZA 3IC1A 4JD6A 5HMNA 5KTDA 2FCKA 3IU2A 2PSWA 2YNCC 3PBBA 2ZEDA 3LWUA 1XFOA 3RZAA 3RNZA 5A28A 2Z11A 3G8WA 4IUSA 4MHDA 4R3KA 2YGWA 2VXKA 3WC7A 1YQEA 2PC1A 4TWEA 3RYOA 2CY2A 2FXFA 2ZW6A 4JXRA 1GYTA 1ZLHA 1LAMA 2OR4A 3ISZA 5AG6A 4ZY2A 3PFOA 2CNTA 4NGSA 5LRJA 1Z8LA 3TO9A 3JVNA 4UF4A 3CPAA 2P6FA 3TE4A 2Z0ZA 4OADA 4E0AA 2XEJA 2B3UA 2YNDA 4UCNA 4F6AA 1YMEA 4UFXA 5THWA 2PJ5A 1YX0A 4EWTA 1H8LA 2G3TA 4A94A 4NCZA 1Y7EA 5HVGA 4WJBA 2ZW7A 2QYVA 5GCNA 4IK2A 2PRQA 3GKRA 4CYPA 2OZUA 1J4JA 1LFWA 4H6UA 4AVCA 1KUXA 4JJXA 4P4EA 2WZNA 5F47A 1CM0A 1Z4EA 2A4NA 5CNPA 2GLFA 4FD7A 1HDQA 1U6MA 1QSMA 4MFPA 2WPXA 2OZHA 1CP7A 3NE8A 2Q43A 4XNHB 2CXAA 3KASA 1XOVA 2PQ8A 2ARHA 4DJLA 1BPNA 3LODA 4KUAA 2EVNA 3SJGA 3TFYA 3BI0A 8CPAA 4JXQA 3FH4A 1HEEA 3K9TA 3S6GA 4KOWA 1IYKA 2JBJA 3SJFA 1AUGA 4AVAA 2C1CA 1ARMA 1NE9A 2PJBA 2XEGA 3L2NA 4MI4A 5CBMA 2I79A 2R8VA 3VARA 2VZYA 3NH8A 1NSLA 2PIZA 3ZZIA 2FVGA 2PVVA 4MY0A 4FD5A 1VIXA 3A9LA 3TX8A 1NSAA 4XNHC 3R9EA 4YGOA 3RBUA 1F57A 4P6YA 4UIBA 1R43A 1YW6A 3RAMA 1BOBA 1ON0A 2Z3KA 3V7ZA 3FMCA 3PB9X 4UBRA 1YREA 1YLOA 5DWNA 3S6FA 1TIQA 3SXNA 4L8AA 4GM5A 2XEFA 3V8IA 3N7ZA 5G1ZA 1QSTA 4KS9A 2R7HA 4R57A 2WYRA 1QSRA 4BBHA 3PRTA 4DNCA 4ONUA 1LCPA 1XEBA 3PBEA 1DE4C 2ATRA 3KKWA 1F2OA 3HUVA 2C27A 2J8RA 2PJ9A 1WK4A 3B3VA 4KOTA 4OC5A 3S9MA 5AG4A 2WUUA 5J8CA 4YWYA 4LQ6A 2PE3A 1CPXA 3K2KA 1ZG9A 1XMBA 4F8ZA 3KR5A 5H86A 3BXMA 2B4DA 3FJUA 1VHOA 3DSBA 3SJEA 4KOUA 5EBVA 3PB6X 4UIAA 4PK2A 4QC6A 2OH1A 2B4BA 3I3GA 2VEZA 3C26A 4UEEA 3RO0A 2CF4A 2NSMA 3WABA 3PB7X 4UEFA 2AFOA 4C68A 4NF1A 4MXUA 5ELYA 4II9A 2Q4VA 1XE4A 2B4DB 3DR6A 4IF5A 4KVXA 4Y49B 4UWJA 4XPLA 1WWZA 2JEWA 2GE3A 1FNOA 6CPAA 3PFEA 3FB3A 3GUXA 3HLPA 3W91A 4NGTA 4NGRA 3WC5A 1IOIA 1OZPA 4OC1A 2DEAA 4M6HA 5LYDA 1MJ9A 2JEVA 3D7HA 1DTDA 2REEA 2P6GA 4LUAA 1Q2YA 3CT9A 4U9YA 4Z65A 5KTAA 1Z5RA 1R57A 2R98A 1BO4A 2ZELA 4GXHA 1CBXA 1ARLA 1S7FA 3B2YA 2QJ8A 3H5ZA 1PCAA 1F2PA 4KLWA 2O28A 1MJAA 2ZOFA 2J9AA 2PJ8A 1VHSA 3I1UA 2JDCA 3P2HA 4QB9A 4B10A 4KOSA 2ODFA 3NA6A 4ORFA 4Y49C 3FYNA 4Q36A
chains in the Genus database with same CATH topology
4AG9A 4UWIA 3T90A 5EC4A 1YGHA 2PDOA 2NMTA 2Q7BA 4B5OA 4B5PB 3CXSA 4L89A 2Z3MA 4J3GA 4M3SA 5JPHA 1S5KA 2RC4A 4RI1A 1YVKA 2AE6A 2J8MA 1M1DA 3TOBA 2KCWA 1YVOA 2PRBA 3PP9A 1Y7RA 5A27A 2B5GA 1KUVA 3IWEA 5G22A 4EVYA 1XMTA 1CJWA 1M4IA 3B8GA 1FY7A 2Z3OA 5IX3A 2HUZA 2OZGA 1MK4A 1M4DA 2EUIA 4HNXB 1KZFA 2CNMA 3UY5A 4UCMA 4KLVA 4C7HA 3QB8A 3W6SA 4K30A 4CAWA 5IB0A 2P6EA 1XIXA 3VWEA 3E0KA 4U5YA 3PZJA 4MY3A 4MBUA 1Y9WA 5F49A 2IL4A 3FRMA 4CGNA 5F48A 3EC4A 2BL1A 4HKFA 3K9UA 4AG7A 3H4QA 1M44A 3R95A 5F46A 3GYAA 4JWPA 2BEIA 4MFKA 1IICA 1P0HA 2GIVA 3D3SA 3IWGA 1YK3A 4H6ZA 3TTHA 2Z10A 4MFZA 4MFJA 4UFVA 3PGPA 2BUEA 4KOVA 4BMHA 2FS5A 2D4OA 5DWMA 4A33A 5JQ4A 4I49A 2K5TA 2FIAA 3D2PA 4KOYA 3QAHA 2JDDA 2FSRA 3LD2A 2X7BA 1SQHA 4XPDB 4U9ZA 3BLNA 5G20A 5ISVA 5IV0A 4CGPA 4CYNA 4UCPA 1QSNA 3DDDA 4PV6A 4B11A 2Q44A 2Q0YA 3DNSA 1I21A 3SHPA 3TO6A 2ZXVA 2VI7A 4C2XA 1IB1E 2PR8A 3EFAA 1YLEA 2DXQA 4KORA 1Q2CA 2OB0A 3F0AA 3TT2A 2Y0MA 4XPDC 2DPSA 4PK3A 2PR1A 1S60A 2QIRA 5FVJA 4C2ZA 4B13A 4KSFA 3EO4A 4CGMA 1IIDA 1RXTA 1I12A 1S3ZA 4CS0B 1QSOA 3G3SA 4KVME 3BJ8A 2VZZA 4RS2A 1V0CA 3FIXA 4KZTA 1S7LA 4CAEA 5AGEA 2YNEA 4OLLA 2QECA 1M4GA 3MGDA 4CAXA 4JLYA 4A31A 4PSWA 3SXOA 3TCVA 4CYQA 4AB7A 4OAEA 2QMLA 4F0XA 4B12A 4E8OA 1Z4RA 3JUWA 3EXNA 4LX9A 3FXTA 4CAFA 1VKCA 4ZGYB 2I00A 4C2YA 1Q2DA 2B5GB 5C82A 4QBJA 2DPTA 2F5IA 4NEXA 2Z3PA 4CRZB 4NSQA 2R1IA 3VWDA 3FBUA 5I0CA 4UFWA 5HH1A 3BJ7A 3GY9A 3P2FA 4FD6A 3FYNA 3R96A 4Q38A 1I1DA 4CRYB 3JTKA 4KOXA 2JLMA 1NMTA 3F8KA 2AJ6A 2VBQA 1S7NA 3NE7A 4H89A 3R9GA 1UFHA 2BSWA 3S6KA 3D2MA 2ZW5A 4MFQA 2GANA 2Q4YA 4A95A 2VQYA 2Z3NA 4YRHA 4UA3A 2HQYA 4QVTA 4FD4A 5KTCA 3TOAA 4E2AA 3OWCA 4NXYA 5AG5A 2B3VA 4PSXA 2HV2A 4M85A 4KUBA 1RO5A 2Z3LA 3IGRA 1ZO0A 4HNWB 4R3LA 2FT0A 1N71A 5J8FA 5AG7A 4AVBA 4CYOA 4MJ8A 5E96A 3DR8A 4GS4A 4KSAA 2FL4A 5H84A 4C7IA 3F5BA 1LRZA 4XPKA 1MJBA 4CAVA 4MFLA 3EY5A 1KUYA 2G3AA 5C88A 2J8NA 1XF8A 2FE7A 4CGLA 3WR7A 3R9FA 1GHEA 4R9MA 4X5KA 3TO7A 2B58A 2D4PA 5BWAB 3D8PA 1P4NA 4F0YA 2P0WA 4A2ZA 3FNCA 1B87A 2WSAA 1L0CA 4CGOA 1IYLA 1Z9UA 2YNCA 3I9SA 4HNYB 1B6BA 3CXQA 4B14A 1Y9KA 2CNSA 2Q04A 4A30A 4R87A 2WPWA 3S6HA 3W6XA 1PUAA 2ZW4A 4ZBGA 2G0BA 3ZJ0A 3T9YA 3CXPA 2H5MA 1YR0A 2FIWA 1K4JA 2REFA 4QUSA 4YFJA 4B5PA 2ZPAA 1PU9A 2OU2A 1S7KA 3IU1A 5G21A 4KVOE 4JD6A 5HMNA 5KTDA 2FCKA 3IU2A 2PSWA 2YNCC 5A28A 3G8WA 2Z11A 4IUSA 4MHDA 4R3KA 2YGWA 2VXKA 2PC1A 3RYOA 2CY2A 2FXFA 2ZW6A 4JXRA 5AG6A 3TO9A 2CNTA 3JVNA 2P6FA 3TE4A 2Z0ZA 4OADA 4E0AA 2B3UA 2YNDA 4UCNA 4F6AA 4UFXA 1YX0A 2G3TA 4NCZA 2ZW7A 5GCNA 3GKRA 4CYPA 2OZUA 1J4JA 4H6UA 4AVCA 1KUXA 4JJXA 5F47A 1CM0A 1Z4EA 2A4NA 5CNPA 4FD7A 1U6MA 1QSMA 4MFPA 2WPXA 2OZHA 4XNHB 2CXAA 2PQ8A 2ARHA 3LODA 4KUAA 2EVNA 3TFYA 4JXQA 3S6GA 4KOWA 1IYKA 4AVAA 1NE9A 4MI4A 2I79A 2R8VA 2VZYA 1NSLA 3ZZIA 4MY0A 4FD5A 3A9LA 4XNHC 3R9EA 4YGOA 1BOBA 1ON0A 2Z3KA 4UBRA 1YREA 5DWNA 3SXNA 3S6FA 1TIQA 4L8AA 3V8IA 3N7ZA 5G1ZA 1QSTA 4KS9A 2R7HA 4R57A 4DNCA 1QSRA 4BBHA 4ONUA 1XEBA 2ATRA 3KKWA 2C27A 2J8RA 4KOTA 1WK4A 5AG4A 2WUUA 5J8CA 5H86A 2B4DA 3DSBA 4KOUA 5EBVA 4PK2A 4QC6A 2OH1A 2B4BA 3I3GA 2VEZA 3C26A 4C68A 4NF1A 4II9A 2Q4VA 1XE4A 2B4DB 3DR6A 4IF5A 4KVXA 4Y49B 4UWJA 4XPLA 1WWZA 2GE3A 3FB3A 3W91A 1OZPA 1MJ9A 2JEVA 4LUAA 2REEA 4U9YA 2P6GA 1Q2YA 5KTAA 1R57A 2R98A 1BO4A 1S7FA 3H5ZA 4KLWA 2O28A 1MJAA 1VHSA 3P2HA 2JDCA 4QB9A 4B10A 4KOSA 4Y49C 4ORFA 4A32A 3R1KA 4Q36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AG9 A;  4UWI A;  3T90 A;  5EC4 A;  1YGH A;  2PDO A;  2NMT A;  2Q7B A;  4B5O A;  4B5P B;  3CXS A;  4L89 A;  4J3G A;  4M3S A;  5JPH A;  1S5K A;  2RC4 A;  4RI1 A;  1YVK A;  2AE6 A;  2J8M A;  1M1D A;  3TOB A;  2KCW A;  1YVO A;  2PRB A;  3PP9 A;  1Y7R A;  2B5G A;  1KUV A;  4EVY A;  1XMT A;  1CJW A;  1M4I A;  3B8G A;  1FY7 A;  5IX3 A;  2HUZ A;  2OZG A;  1MK4 A;  1M4D A;  2EUI A;  4HNX B;  1KZF A;  2CNM A;  3UY5 A;  4KLV A;  3QB8 A;  3W6S A;  4K30 A;  4CAW A;  5IB0 A;  2P6E A;  1XIX A;  3VWE A;  3E0K A;  4U5Y A;  3PZJ A;  4MY3 A;  4MBU A;  1Y9W A;  5F49 A;  2IL4 A;  3FRM A;  5F48 A;  3EC4 A;  2BL1 A;  4HKF A;  3K9U A;  4AG7 A;  3H4Q A;  1M44 A;  3R95 A;  5F46 A;  3GYA A;  4JWP A;  2BEI A;  1IIC A;  1P0H A;  2GIV A;  3D3S A;  3IWG A;  1YK3 A;  4H6Z A;  3TTH A;  2Z10 A;  3PGP A;  2BUE A;  4KOV A;  4BMH A;  2FS5 A;  2D4O A;  5DWM A;  5JQ4 A;  4I49 A;  2K5T A;  2FIA A;  3D2P A;  4KOY A;  3QAH A;  2JDD A;  2FSR A;  2X7B A;  3LD2 A;  1SQH A;  4XPD B;  4U9Z A;  3BLN A;  5ISV A;  5IV0 A;  1QSN A;  3DDD A;  4PV6 A;  2Q44 A;  2Q0Y A;  3DNS A;  1I21 A;  3SHP A;  3TO6 A;  2ZXV A;  2VI7 A;  1IB1 E;  2PR8 A;  3EFA A;  1YLE A;  2DXQ A;  4KOR A;  1Q2C A;  2OB0 A;  3F0A A;  3TT2 A;  2Y0M A;  4XPD C;  4PK3 A;  2PR1 A;  1S60 A;  2QIR A;  5FVJ A;  3EO4 A;  1IID A;  1RXT A;  1I12 A;  1S3Z A;  4CS0 B;  1QSO A;  3G3S A;  4KVM E;  3BJ8 A;  2VZZ A;  4RS2 A;  1V0C A;  3FIX A;  4KZT A;  1S7L A;  4OLL A;  2QEC A;  1M4G A;  3MGD A;  4CAX A;  4JLY A;  4PSW A;  3SXO A;  3TCV A;  4AB7 A;  4OAE A;  2QML A;  4E8O A;  1Z4R A;  3JUW A;  3EXN A;  4LX9 A;  3FXT A;  1VKC A;  2I00 A;  1Q2D A;  2B5G B;  5C82 A;  4QBJ A;  2F5I A;  4NEX A;  4CRZ B;  4NSQ A;  2R1I A;  3VWD A;  3FBU A;  5I0C A;  5HH1 A;  3BJ7 A;  3GY9 A;  3P2F A;  4FD6 A;  3FYN A;  3R96 A;  1I1D A;  4CRY B;  4KOX A;  2JLM A;  1NMT A;  3F8K A;  2AJ6 A;  2VBQ A;  1S7N A;  3NE7 A;  4H89 A;  3R9G A;  1UFH A;  2BSW A;  3S6K A;  3D2M A;  2ZW5 A;  2GAN A;  2Q4Y A;  2VQY A;  4YRH A;  4UA3 A;  2HQY A;  4QVT A;  4FD4 A;  5KTC A;  3TOA A;  4E2A A;  3OWC A;  4NXY A;  2B3V A;  4PSX A;  2HV2 A;  4M85 A;  4KUB A;  1RO5 A;  3IGR A;  4HNW B;  4R3L A;  2FT0 A;  1N71 A;  5J8F A;  4AVB A;  4MJ8 A;  5E96 A;  3DR8 A;  4GS4 A;  2FL4 A;  5H84 A;  3F5B A;  1LRZ A;  4XPK A;  1MJB A;  4CAV A;  3EY5 A;  1KUY A;  2G3A A;  5C88 A;  2J8N A;  1XF8 A;  2FE7 A;  3WR7 A;  3R9F A;  1GHE A;  4R9M A;  4X5K A;  3TO7 A;  2B58 A;  2D4P A;  3D8P A;  1P4N A;  4F0Y A;  2P0W A;  3FNC A;  1B87 A;  1L0C A;  1IYL A;  1Z9U A;  3I9S A;  4HNY B;  1B6B A;  3CXQ A;  1Y9K A;  2CNS A;  2Q04 A;  4R87 A;  2WPW A;  3S6H A;  3W6X A;  1PUA A;  2ZW4 A;  4ZBG A;  2G0B A;  3ZJ0 A;  3T9Y A;  3CXP A;  2H5M A;  1YR0 A;  2FIW A;  1K4J A;  2REF A;  4QUS A;  4YFJ A;  4B5P A;  2ZPA A;  1PU9 A;  2OU2 A;  1S7K A;  4KVO E;  4JD6 A;  5HMN A;  5KTD A;  2FCK A;  2PSW A;  2Z11 A;  3G8W A;  4IUS A;  4MHD A;  4R3K A;  2VXK A;  2PC1 A;  3RYO A;  2CY2 A;  2FXF A;  2ZW6 A;  4JXR A;  3TO9 A;  2CNT A;  3JVN A;  2P6F A;  3TE4 A;  2Z0Z A;  4OAD A;  4E0A A;  2B3U A;  4F6A A;  1YX0 A;  2G3T A;  4NCZ A;  2ZW7 A;  5GCN A;  3GKR A;  2OZU A;  1J4J A;  4H6U A;  4AVC A;  1KUX A;  4JJX A;  5F47 A;  1CM0 A;  1Z4E A;  2A4N A;  5CNP A;  4FD7 A;  1U6M A;  1QSM A;  2WPX A;  2OZH A;  4XNH B;  2PQ8 A;  2ARH A;  3LOD A;  4KUA A;  2EVN A;  3TFY A;  4JXQ A;  3S6G A;  4KOW A;  1IYK A;  4AVA A;  1NE9 A;  4MI4 A;  2I79 A;  2R8V A;  2VZY A;  1NSL A;  3ZZI A;  4MY0 A;  4FD5 A;  4XNH C;  3R9E A;  4YGO A;  1BOB A;  1ON0 A;  4UBR A;  1YRE A;  5DWN A;  3SXN A;  3S6F A;  1TIQ A;  4L8A A;  3V8I A;  3N7Z A;  1QST A;  2R7H A;  4R57 A;  4DNC A;  1QSR A;  4ONU A;  1XEB A;  2ATR A;  3KKW A;  2C27 A;  2J8R A;  4KOT A;  1WK4 A;  5J8C A;  5H86 A;  2B4D A;  3DSB A;  4KOU A;  5EBV A;  4PK2 A;  4QC6 A;  2OH1 A;  2B4B A;  3I3G A;  2VEZ A;  3C26 A;  4NF1 A;  4II9 A;  2Q4V A;  1XE4 A;  2B4D B;  3DR6 A;  4IF5 A;  4KVX A;  4Y49 B;  4UWJ A;  4XPL A;  1WWZ A;  2GE3 A;  3FB3 A;  3W91 A;  1OZP A;  4LUA A;  1MJ9 A;  2JEV A;  2REE A;  4U9Y A;  2P6G A;  1Q2Y A;  5KTA A;  1R57 A;  2R98 A;  1BO4 A;  1S7F A;  4KLW A;  2O28 A;  1MJA A;  1VHS A;  3P2H A;  2JDC A;  4QB9 A;  4KOS A;  4Y49 C;  4ORF A;  3R1K A; 
#chains in the Genus database with same CATH topology
 4AG9 A;  4P4F A;  4UWI A;  3T90 A;  5EC4 A;  5EMI A;  2PJ1 A;  3WC6 A;  1YGH A;  7CPA A;  2BOA A;  4OC3 A;  2PDO A;  2NMT A;  5LYI A;  2Q7B A;  4B5O A;  4B5P B;  3R1K A;  3CXS A;  4L89 A;  1Y0Y A;  2Z3M A;  4J3G A;  2AFX A;  4M3S A;  5JPH A;  4LQG A;  2POK A;  1S5K A;  2RC4 A;  5LYF A;  4RI1 A;  1YVK A;  2AE6 A;  3IFE A;  2J8M A;  1M1D A;  1ZG7 A;  4NGQ A;  2KCW A;  3TOB A;  1YVO A;  2PRB A;  2V8H A;  3PP9 A;  4MCR A;  1X12 A;  1Y7R A;  5A27 A;  2ANP A;  2B5G A;  3NH4 A;  1KUV A;  3IWE A;  5G22 A;  4EVY A;  1BPM A;  1XMT A;  2AFM A;  1VHE A;  1CJW A;  1M4I A;  3B8G A;  1FY7 A;  2Z3O A;  5IX3 A;  2HUZ A;  5JH9 A;  4A32 A;  2OZG A;  1MK4 A;  4F9U A;  1M4D A;  3GB0 A;  2EUI A;  4ZYQ A;  4HNX B;  1KZF A;  3GLJ A;  4FAI A;  4JYW A;  2CNM A;  3UY5 A;  4BIN A;  1IGB A;  4UCM A;  4KLV A;  3MN8 A;  4C7H A;  3QB8 A;  3ISX A;  5HVF A;  2OOT A;  3W6S A;  4K30 A;  3V38 A;  4CAW A;  4ZI6 A;  3PB4 X;  1AYE A;  3CPX A;  3D7F A;  5IB0 A;  2P6E A;  4ZX9 A;  1XIX A;  3VWE A;  3E0K A;  4U5Y A;  3PZJ A;  4MY3 A;  4MBU A;  4OP4 A;  1Y9W A;  1CP6 A;  5F49 A;  2IL4 A;  3FRM A;  4CGN A;  5K8M A;  3FF3 A;  4P45 A;  2CTC A;  5F48 A;  2ZEG A;  4AXV A;  3EC4 A;  2BL1 A;  1XRY A;  3K9U A;  4HKF A;  4MRI A;  4AG7 A;  3S9L A;  1BAV A;  4A37 A;  1IOF A;  2NYQ A;  2PJ0 A;  4NJQ A;  2GLJ A;  3B7I A;  3H4Q A;  3T8W A;  1M44 A;  4PXB A;  1Z2L A;  4P4I A;  4RN7 A;  3R95 A;  2ZEM A;  5F46 A;  5HXD A;  1ELM P;  3CZX A;  3GYA A;  4JWP A;  2BEI A;  2V8D A;  4MFK A;  1IIC A;  1P0H A;  2GIV A;  2ZOG A;  3D3S A;  3IWG A;  1YK3 A;  3IO1 A;  4H6Z A;  3TTH A;  4ZY0 A;  2Z10 A;  4MFZ A;  4MFJ A;  1TKH A;  4UFV A;  3PGP A;  2BUE A;  4KOV A;  4BMH A;  2FS5 A;  4EME A;  2RFH A;  2D4O A;  5DWM A;  4A33 A;  5JQ4 A;  4I49 A;  2K5T A;  1QMU A;  1AMP A;  2FIA A;  3D2P A;  4KOY A;  3QAH A;  4MHY A;  4P4B A;  2CIJ A;  1RTQ A;  2V8V A;  4R76 A;  2JDD A;  4OIW A;  2BCO A;  1IU8 A;  2PJ7 A;  2PJ2 A;  4TNU A;  3WT4 A;  2FSR A;  2X7B A;  3LD2 A;  1SQH A;  2G9D A;  4XPD B;  4U9Z A;  3BLN A;  5G20 A;  5ISV A;  5IV0 A;  2EO8 A;  2JBK A;  3D7D A;  4CGP A;  4CYN A;  2EWB A;  4UCP A;  1QSN A;  2EK8 A;  3DDD A;  1HDU A;  4PV6 A;  4P4J A;  4R8F A;  4B11 A;  4PXD A;  2Q44 A;  2Q0Y A;  1I21 A;  3DNS A;  3SHP A;  3TO6 A;  3KGQ A;  4KSI A;  4OC4 A;  2ZEO A;  2ZXV A;  2VI7 A;  4C2X A;  1IB1 E;  2PR8 A;  5I4M A;  5JGF A;  5J1Q A;  3EFA A;  1YLE A;  2ZEH A;  2DXQ A;  4KOR A;  4MHZ A;  1Q2C A;  5LRK A;  2OB0 A;  5IB9 A;  4NGN A;  2EK9 A;  3F0A A;  3SI0 A;  3TC8 A;  2CTB A;  4R6T A;  1LAP A;  2Y0M A;  3TT2 A;  3BI1 A;  2PIY A;  4XPD C;  3B3W A;  2DPS A;  5DS0 A;  4PK3 A;  2PR1 A;  1S60 A;  4X2T A;  2PCU A;  2QIR A;  5FVJ A;  4C2Z A;  5HVH A;  5K8O A;  4B13 A;  1QQ9 A;  4KSF A;  1IY7 A;  3EO4 A;  4A39 A;  1IID A;  1RXT A;  5D29 A;  4CGM A;  1I12 A;  4ZX8 A;  4WWV A;  4M6G A;  1S3Z A;  4FBE A;  4CS0 B;  1QSO A;  2Q4Z A;  4OME A;  4PQA A;  1Z8X A;  3D68 A;  3G3S A;  4KVM E;  3BJ8 A;  3N5F A;  2PJ4 A;  4MCS A;  3SJX A;  2O53 A;  2VZZ A;  1OBR A;  4RS2 A;  1V0C A;  2IJZ A;  3FIX A;  4G1P A;  3DLJ A;  4KZT A;  1S7L A;  4MCP A;  4CAE A;  5AGE A;  2YNE A;  4OLL A;  2QEC A;  3VAT A;  1M4G A;  1PYT B;  4HPS A;  3MGD A;  4CAX A;  2VL1 A;  4JLY A;  4MCQ A;  4A31 A;  3IEH A;  4PSW A;  2V8G A;  3SXO A;  3LMS A;  1CPS A;  3TCV A;  4CYQ A;  4AB7 A;  2PJC A;  4OAE A;  1TKJ A;  4CPA A;  2C6C A;  2F7V A;  4Q7A A;  4H2K A;  2QML A;  1JWQ A;  4OID A;  3BHX A;  4F0X A;  2V77 A;  4B12 A;  4E8O A;  1KWM A;  2GFQ A;  5K8P A;  1Z4R A;  4OC2 A;  3GIU A;  1XJO A;  3JUW A;  3EXN A;  4LX9 A;  3FVL A;  4M6I A;  1XBU A;  3FXT A;  1VKC A;  4R7M A;  4CAF A;  2I00 A;  4ZGY B;  3KQZ A;  4C2Y A;  1Q2D A;  3H8G A;  1TF8 A;  3B3S A;  5F09 A;  4IHM A;  2HB6 A;  2B5G B;  3KHZ A;  1Y0R A;  1X10 A;  2C6G A;  3NH5 A;  2ZEF A;  5C82 A;  2AFS A;  4QBJ A;  2DPT A;  2HC9 A;  4OC0 A;  2F5I A;  3B3T A;  4NEX A;  4NJR A;  5JM6 A;  2Z3P A;  3KI9 A;  4CRZ B;  4NSQ A;  2R1I A;  3VWD A;  3FBU A;  5I0C A;  4UFW A;  2EBJ A;  5HH1 A;  3BJ7 A;  2AFU A;  3D67 A;  3GY9 A;  3P2F A;  4FD6 A;  2F8H A;  3R96 A;  3CDX A;  4Q38 A;  1I1D A;  2QVP A;  4CRY B;  3H8E A;  3JTK A;  4KOX A;  2JLM A;  1NMT A;  3F8K A;  2AJ6 A;  3KHX A;  2VBQ A;  1S7N A;  3NE7 A;  4H89 A;  4JZ0 A;  3R9G A;  3FEE A;  1UFH A;  2BSW A;  3S6K A;  4X3R A;  2PVW A;  3D2M A;  2ZW5 A;  4MFQ A;  2GAN A;  3KR4 A;  2Q4Y A;  4A95 A;  2VQY A;  2Z3N A;  3B3C A;  3IJ3 A;  2XEI A;  2RB7 A;  3QNV A;  2PJA A;  4UA3 A;  2HQY A;  2DF5 A;  2PJ3 A;  4QVT A;  4YRH A;  5LYL A;  4FD4 A;  5KTC A;  3TOA A;  4E2A A;  3NFZ A;  4NGM A;  5CPA A;  3OWC A;  4NXY A;  5AG5 A;  3FEC A;  2B3V A;  4PSX A;  4RUH A;  2HV2 A;  3SI2 A;  2GRE A;  4M85 A;  2ZEE A;  4KUB A;  4PPZ A;  1RO5 A;  3SI1 A;  2Z3L A;  3IGR A;  1ZO0 A;  4DYO A;  4NGP A;  4HNW B;  1JQG A;  1R3N A;  1YW4 A;  3MRU A;  4R3L A;  2FT0 A;  3S9N A;  1N71 A;  5J8F A;  5AG7 A;  1TXR A;  2C6P A;  5D8N A;  4AVB A;  4MHP A;  2PJ6 A;  4W9Y A;  4CYO A;  4MHN A;  4MJ8 A;  4YU9 A;  5E96 A;  3VH9 A;  3DR8 A;  4GS4 A;  4F9V A;  4KSA A;  2FL4 A;  5H84 A;  4C7I A;  3F5B A;  1LRZ A;  2BO9 A;  4XPK A;  1MJB A;  4A38 A;  4PXC A;  3JRU A;  4OKO A;  2ZEP A;  4MFL A;  3QAY A;  4ONW A;  4CAV A;  1ELL P;  3EY5 A;  3D4U A;  1KUY A;  2G3A A;  5C88 A;  1Z8W A;  1ZG8 A;  4B6Z A;  4O23 A;  4DUK A;  2J8N A;  1XF8 A;  2FE7 A;  4CGL A;  3WR7 A;  4NFR A;  3FX6 A;  3R9F A;  4P10 A;  1GHE A;  4R9M A;  4BD9 A;  4X5K A;  3LAC A;  3TO7 A;  3KL9 A;  2B58 A;  1YSJ A;  3KQX A;  2D4P A;  4X8I A;  5BWA B;  3D8P A;  1P4N A;  4F0Y A;  2P0W A;  5LRG A;  1Z8T A;  1VGY A;  4A2Z A;  1EE3 P;  3D7G A;  3B35 A;  2AFW A;  3FNC A;  1B87 A;  2ABZ A;  1LOK A;  1TF9 A;  3DGV A;  2I3C A;  3D66 A;  4UEZ A;  2WSA A;  1L0C A;  2Q51 A;  1IYL A;  4CGO A;  1Z9U A;  2YNC A;  1Q7L A;  3I9S A;  1CG2 A;  4HNY B;  3H8F A;  1B6B A;  3CXQ A;  4B14 A;  1Y9K A;  2CNS A;  4P44 A;  2Q04 A;  1A2Z A;  4ZY1 A;  4A30 A;  4R87 A;  2O4H A;  2WPW A;  3S6H A;  3W6X A;  1PUA A;  2ZW4 A;  2Q7S A;  4ZBG A;  2G0B A;  1CX8 A;  3ZJ0 A;  3T9Y A;  3KZW A;  3CXP A;  4PXE A;  2H5M A;  1YR0 A;  1M4L A;  3IWW A;  5K8N A;  2FIW A;  1K4J A;  2REF A;  4QUS A;  4YFJ A;  1BLL E;  1UWY A;  4P4D A;  3PB8 X;  3PEI A;  4B5P A;  2IMO A;  4FWU A;  2ZPA A;  1PU9 A;  1ZLI A;  4EFD A;  4K3N A;  1FT7 A;  2OU2 A;  1S7K A;  3IU1 A;  4MMO A;  1LAN A;  5G21 A;  4KVO E;  2ZEN A;  2IQ6 A;  3FED A;  3IIB A;  4FUU A;  2GU2 A;  4IAV A;  1TKF A;  2AFZ A;  3IC1 A;  4JD6 A;  5HMN A;  5KTD A;  2FCK A;  3IU2 A;  2PSW A;  2YNC C;  3PBB A;  2ZED A;  3LWU A;  1XFO A;  3RZA A;  3RNZ A;  5A28 A;  2Z11 A;  3G8W A;  4IUS A;  4MHD A;  4R3K A;  2YGW A;  2VXK A;  3WC7 A;  1YQE A;  2PC1 A;  4TWE A;  3RYO A;  2CY2 A;  2FXF A;  2ZW6 A;  4JXR A;  1GYT A;  1ZLH A;  1LAM A;  2OR4 A;  3ISZ A;  5AG6 A;  4ZY2 A;  3PFO A;  2CNT A;  4NGS A;  5LRJ A;  1Z8L A;  3TO9 A;  3JVN A;  4UF4 A;  3CPA A;  2P6F A;  3TE4 A;  2Z0Z A;  4OAD A;  4E0A A;  2XEJ A;  2B3U A;  2YND A;  4UCN A;  4F6A A;  1YME A;  4UFX A;  5THW A;  2PJ5 A;  1YX0 A;  4EWT A;  1H8L A;  2G3T A;  4A94 A;  4NCZ A;  1Y7E A;  5HVG A;  4WJB A;  2ZW7 A;  2QYV A;  5GCN A;  4IK2 A;  2PRQ A;  3GKR A;  4CYP A;  2OZU A;  1J4J A;  1LFW A;  4H6U A;  4AVC A;  1KUX A;  4JJX A;  4P4E A;  2WZN A;  5F47 A;  1CM0 A;  1Z4E A;  2A4N A;  5CNP A;  2GLF A;  4FD7 A;  1HDQ A;  1U6M A;  1QSM A;  4MFP A;  2WPX A;  2OZH A;  1CP7 A;  3NE8 A;  2Q43 A;  4XNH B;  2CXA A;  3KAS A;  1XOV A;  2PQ8 A;  2ARH A;  4DJL A;  1BPN A;  3LOD A;  4KUA A;  2EVN A;  3SJG A;  3TFY A;  3BI0 A;  8CPA A;  4JXQ A;  3FH4 A;  1HEE A;  3K9T A;  3S6G A;  4KOW A;  1IYK A;  2JBJ A;  3SJF A;  1AUG A;  4AVA A;  2C1C A;  1ARM A;  1NE9 A;  2PJB A;  2XEG A;  3L2N A;  4MI4 A;  5CBM A;  2I79 A;  2R8V A;  3VAR A;  2VZY A;  3NH8 A;  1NSL A;  2PIZ A;  3ZZI A;  2FVG A;  2PVV A;  4MY0 A;  4FD5 A;  1VIX A;  3A9L A;  3TX8 A;  1NSA A;  4XNH C;  3R9E A;  4YGO A;  3RBU A;  1F57 A;  4P6Y A;  4UIB A;  1R43 A;  1YW6 A;  3RAM A;  1BOB A;  1ON0 A;  2Z3K A;  3V7Z A;  3FMC A;  3PB9 X;  4UBR A;  1YRE A;  1YLO A;  5DWN A;  3S6F A;  1TIQ A;  3SXN A;  4L8A A;  4GM5 A;  2XEF A;  3V8I A;  3N7Z A;  5G1Z A;  1QST A;  4KS9 A;  2R7H A;  4R57 A;  2WYR A;  1QSR A;  4BBH A;  3PRT A;  4DNC A;  4ONU A;  1LCP A;  1XEB A;  3PBE A;  1DE4 C;  2ATR A;  3KKW A;  1F2O A;  3HUV A;  2C27 A;  2J8R A;  2PJ9 A;  1WK4 A;  3B3V A;  4KOT A;  4OC5 A;  3S9M A;  5AG4 A;  2WUU A;  5J8C A;  4YWY A;  4LQ6 A;  2PE3 A;  1CPX A;  3K2K A;  1ZG9 A;  1XMB A;  4F8Z A;  3KR5 A;  5H86 A;  3BXM A;  2B4D A;  3FJU A;  1VHO A;  3DSB A;  3SJE A;  4KOU A;  5EBV A;  3PB6 X;  4UIA A;  4PK2 A;  4QC6 A;  2OH1 A;  2B4B A;  3I3G A;  2VEZ A;  3C26 A;  4UEE A;  3RO0 A;  2CF4 A;  2NSM A;  3WAB A;  3PB7 X;  4UEF A;  2AFO A;  4C68 A;  4NF1 A;  4MXU A;  5ELY A;  4II9 A;  2Q4V A;  1XE4 A;  2B4D B;  3DR6 A;  4IF5 A;  4KVX A;  4Y49 B;  4UWJ A;  4XPL A;  1WWZ A;  2JEW A;  2GE3 A;  1FNO A;  6CPA A;  3PFE A;  3FB3 A;  3GUX A;  3HLP A;  3W91 A;  4NGT A;  4NGR A;  3WC5 A;  1IOI A;  1OZP A;  4OC1 A;  2DEA A;  4M6H A;  5LYD A;  1MJ9 A;  2JEV A;  3D7H A;  1DTD A;  2REE A;  2P6G A;  4LUA A;  1Q2Y A;  3CT9 A;  4U9Y A;  4Z65 A;  5KTA A;  1Z5R A;  1R57 A;  2R98 A;  1BO4 A;  2ZEL A;  4GXH A;  1CBX A;  1ARL A;  1S7F A;  3B2Y A;  2QJ8 A;  3H5Z A;  1PCA A;  1F2P A;  4KLW A;  2O28 A;  1MJA A;  2ZOF A;  2J9A A;  2PJ8 A;  1VHS A;  3I1U A;  2JDC A;  3P2H A;  4QB9 A;  4B10 A;  4KOS A;  2ODF A;  3NA6 A;  4ORF A;  4Y49 C;  3FYN A;  4Q36 A; 
#chains in the Genus database with same CATH homology
 4AG9 A;  4UWI A;  3T90 A;  5EC4 A;  1YGH A;  2PDO A;  2NMT A;  2Q7B A;  4B5O A;  4B5P B;  3CXS A;  4L89 A;  2Z3M A;  4J3G A;  4M3S A;  5JPH A;  1S5K A;  2RC4 A;  4RI1 A;  1YVK A;  2AE6 A;  2J8M A;  1M1D A;  3TOB A;  2KCW A;  1YVO A;  2PRB A;  3PP9 A;  1Y7R A;  5A27 A;  2B5G A;  1KUV A;  3IWE A;  5G22 A;  4EVY A;  1XMT A;  1CJW A;  1M4I A;  3B8G A;  1FY7 A;  2Z3O A;  5IX3 A;  2HUZ A;  2OZG A;  1MK4 A;  1M4D A;  2EUI A;  4HNX B;  1KZF A;  2CNM A;  3UY5 A;  4UCM A;  4KLV A;  4C7H A;  3QB8 A;  3W6S A;  4K30 A;  4CAW A;  5IB0 A;  2P6E A;  1XIX A;  3VWE A;  3E0K A;  4U5Y A;  3PZJ A;  4MY3 A;  4MBU A;  1Y9W A;  5F49 A;  2IL4 A;  3FRM A;  4CGN A;  5F48 A;  3EC4 A;  2BL1 A;  4HKF A;  3K9U A;  4AG7 A;  3H4Q A;  1M44 A;  3R95 A;  5F46 A;  3GYA A;  4JWP A;  2BEI A;  4MFK A;  1IIC A;  1P0H A;  2GIV A;  3D3S A;  3IWG A;  1YK3 A;  4H6Z A;  3TTH A;  2Z10 A;  4MFZ A;  4MFJ A;  4UFV A;  3PGP A;  2BUE A;  4KOV A;  4BMH A;  2FS5 A;  2D4O A;  5DWM A;  4A33 A;  5JQ4 A;  4I49 A;  2K5T A;  2FIA A;  3D2P A;  4KOY A;  3QAH A;  2JDD A;  2FSR A;  3LD2 A;  2X7B A;  1SQH A;  4XPD B;  4U9Z A;  3BLN A;  5G20 A;  5ISV A;  5IV0 A;  4CGP A;  4CYN A;  4UCP A;  1QSN A;  3DDD A;  4PV6 A;  4B11 A;  2Q44 A;  2Q0Y A;  3DNS A;  1I21 A;  3SHP A;  3TO6 A;  2ZXV A;  2VI7 A;  4C2X A;  1IB1 E;  2PR8 A;  3EFA A;  1YLE A;  2DXQ A;  4KOR A;  1Q2C A;  2OB0 A;  3F0A A;  3TT2 A;  2Y0M A;  4XPD C;  2DPS A;  4PK3 A;  2PR1 A;  1S60 A;  2QIR A;  5FVJ A;  4C2Z A;  4B13 A;  4KSF A;  3EO4 A;  4CGM A;  1IID A;  1RXT A;  1I12 A;  1S3Z A;  4CS0 B;  1QSO A;  3G3S A;  4KVM E;  3BJ8 A;  2VZZ A;  4RS2 A;  1V0C A;  3FIX A;  4KZT A;  1S7L A;  4CAE A;  5AGE A;  2YNE A;  4OLL A;  2QEC A;  1M4G A;  3MGD A;  4CAX A;  4JLY A;  4A31 A;  4PSW A;  3SXO A;  3TCV A;  4CYQ A;  4AB7 A;  4OAE A;  2QML A;  4F0X A;  4B12 A;  4E8O A;  1Z4R A;  3JUW A;  3EXN A;  4LX9 A;  3FXT A;  4CAF A;  1VKC A;  4ZGY B;  2I00 A;  4C2Y A;  1Q2D A;  2B5G B;  5C82 A;  4QBJ A;  2DPT A;  2F5I A;  4NEX A;  2Z3P A;  4CRZ B;  4NSQ A;  2R1I A;  3VWD A;  3FBU A;  5I0C A;  4UFW A;  5HH1 A;  3BJ7 A;  3GY9 A;  3P2F A;  4FD6 A;  3FYN A;  3R96 A;  4Q38 A;  1I1D A;  4CRY B;  3JTK A;  4KOX A;  2JLM A;  1NMT A;  3F8K A;  2AJ6 A;  2VBQ A;  1S7N A;  3NE7 A;  4H89 A;  3R9G A;  1UFH A;  2BSW A;  3S6K A;  3D2M A;  2ZW5 A;  4MFQ A;  2GAN A;  2Q4Y A;  4A95 A;  2VQY A;  2Z3N A;  4YRH A;  4UA3 A;  2HQY A;  4QVT A;  4FD4 A;  5KTC A;  3TOA A;  4E2A A;  3OWC A;  4NXY A;  5AG5 A;  2B3V A;  4PSX A;  2HV2 A;  4M85 A;  4KUB A;  1RO5 A;  2Z3L A;  3IGR A;  1ZO0 A;  4HNW B;  4R3L A;  2FT0 A;  1N71 A;  5J8F A;  5AG7 A;  4AVB A;  4CYO A;  4MJ8 A;  5E96 A;  3DR8 A;  4GS4 A;  4KSA A;  2FL4 A;  5H84 A;  4C7I A;  3F5B A;  1LRZ A;  4XPK A;  1MJB A;  4CAV A;  4MFL A;  3EY5 A;  1KUY A;  2G3A A;  5C88 A;  2J8N A;  1XF8 A;  2FE7 A;  4CGL A;  3WR7 A;  3R9F A;  1GHE A;  4R9M A;  4X5K A;  3TO7 A;  2B58 A;  2D4P A;  5BWA B;  3D8P A;  1P4N A;  4F0Y A;  2P0W A;  4A2Z A;  3FNC A;  1B87 A;  2WSA A;  1L0C A;  4CGO A;  1IYL A;  1Z9U A;  2YNC A;  3I9S A;  4HNY B;  1B6B A;  3CXQ A;  4B14 A;  1Y9K A;  2CNS A;  2Q04 A;  4A30 A;  4R87 A;  2WPW A;  3S6H A;  3W6X A;  1PUA A;  2ZW4 A;  4ZBG A;  2G0B A;  3ZJ0 A;  3T9Y A;  3CXP A;  2H5M A;  1YR0 A;  2FIW A;  1K4J A;  2REF A;  4QUS A;  4YFJ A;  4B5P A;  2ZPA A;  1PU9 A;  2OU2 A;  1S7K A;  3IU1 A;  5G21 A;  4KVO E;  4JD6 A;  5HMN A;  5KTD A;  2FCK A;  3IU2 A;  2PSW A;  2YNC C;  5A28 A;  3G8W A;  2Z11 A;  4IUS A;  4MHD A;  4R3K A;  2YGW A;  2VXK A;  2PC1 A;  3RYO A;  2CY2 A;  2FXF A;  2ZW6 A;  4JXR A;  5AG6 A;  3TO9 A;  2CNT A;  3JVN A;  2P6F A;  3TE4 A;  2Z0Z A;  4OAD A;  4E0A A;  2B3U A;  2YND A;  4UCN A;  4F6A A;  4UFX A;  1YX0 A;  2G3T A;  4NCZ A;  2ZW7 A;  5GCN A;  3GKR A;  4CYP A;  2OZU A;  1J4J A;  4H6U A;  4AVC A;  1KUX A;  4JJX A;  5F47 A;  1CM0 A;  1Z4E A;  2A4N A;  5CNP A;  4FD7 A;  1U6M A;  1QSM A;  4MFP A;  2WPX A;  2OZH A;  4XNH B;  2CXA A;  2PQ8 A;  2ARH A;  3LOD A;  4KUA A;  2EVN A;  3TFY A;  4JXQ A;  3S6G A;  4KOW A;  1IYK A;  4AVA A;  1NE9 A;  4MI4 A;  2I79 A;  2R8V A;  2VZY A;  1NSL A;  3ZZI A;  4MY0 A;  4FD5 A;  3A9L A;  4XNH C;  3R9E A;  4YGO A;  1BOB A;  1ON0 A;  2Z3K A;  4UBR A;  1YRE A;  5DWN A;  3SXN A;  3S6F A;  1TIQ A;  4L8A A;  3V8I A;  3N7Z A;  5G1Z A;  1QST A;  4KS9 A;  2R7H A;  4R57 A;  4DNC A;  1QSR A;  4BBH A;  4ONU A;  1XEB A;  2ATR A;  3KKW A;  2C27 A;  2J8R A;  4KOT A;  1WK4 A;  5AG4 A;  2WUU A;  5J8C A;  5H86 A;  2B4D A;  3DSB A;  4KOU A;  5EBV A;  4PK2 A;  4QC6 A;  2OH1 A;  2B4B A;  3I3G A;  2VEZ A;  3C26 A;  4C68 A;  4NF1 A;  4II9 A;  2Q4V A;  1XE4 A;  2B4D B;  3DR6 A;  4IF5 A;  4KVX A;  4Y49 B;  4UWJ A;  4XPL A;  1WWZ A;  2GE3 A;  3FB3 A;  3W91 A;  1OZP A;  1MJ9 A;  2JEV A;  4LUA A;  2REE A;  4U9Y A;  2P6G A;  1Q2Y A;  5KTA A;  1R57 A;  2R98 A;  1BO4 A;  1S7F A;  3H5Z A;  4KLW A;  2O28 A;  1MJA A;  1VHS A;  3P2H A;  2JDC A;  4QB9 A;  4B10 A;  4KOS A;  4Y49 C;  4ORF A;  4A32 A;  3R1K A;  4Q36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...