4FD4A

Crystal structure of mosquito arylalkylamine n-acetyltransferase like 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
SIVLRVARLDELEQVREILHRIYYPEEGITISYVHGKSHTLDDERFSLSFVEQGTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVCGRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEKLGMECISQLALGDYRDEKGEKLFEPLDVHQVIKTCVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords arylalkylamine N-Acetyltransferase like 5b
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
total genus 74
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd4A00
1MJBA 4CAXA 2I79A 1S60A 4CRZB 1Y7RA 3NE7A 4FD5A 4HKFA 2P6EA 3P2FA 4MY0A 1YGHA 3G8WA 1XMTA 3KKWA 3TE4A 4KZTA 1S7LA 4GS4A 1IICA 4YFJA 3G3SA 2KCWA 3FYNA 2ZW5A 2BUEA 3BLNA 4XNHB 3DR6A 1ON0A 1S7FA 3SXOA 4B5PA 4YRHA 2WPWA 2QIRA 2Y0MA 3EXNA 4AVCA 3TO7A 3S6FA 2QMLA 4KOTA 3CXSA 2ATRA 5E96A 4LX9A 3R9FA 3ZJ0A 5JQ4A 3GY9A 2BL1A 1Q2CA 4YGOA 4H6UA 2ZW6A 4OAEA 2OZGA 3DDDA 5DWNA 3OWCA 1VKCA 4NXYA 4E2AA 4KOSA 2FE7A 3FB3A 4R87A 5C88A 3I9SA 4KVME 4XNHC 4AVAA 3E0KA 4KOYA 4U9ZA 2P6GA 5F47A 1P0HA 1YLEA 3F8KA 2J8RA 3FRMA 2R8VA 3D8PA 4KVOE 2PR1A 1V0CA 4AVBA 4QUSA 4KORA 2R1IA 2VI7A 3T9YA 2ZW7A 3RYOA 4FD4A 4IF5A 1M4GA 3VWEA 2O28A 4JLYA 1GHEA 2HQYA 2Q4YA 3MGDA 5F46A 1B6BA 1XIXA 3T90A 2B5GA 2K5TA 4AB7A 1P4NA 3FXTA 4Y49B 4R3LA 1M4IA 3W6XA 1TIQA 3F0AA 4MJ8A 1QSNA 4NCZA 1SQHA 3JUWA 4EVYA 3FBUA 2FT0A 4KVXA 3GKRA 4KOVA 2FXFA 3TFYA 3S6HA 2JDCA 2VEZA 2AE6A 2OH1A 4KOWA 3DR8A 3K9UA 1S7NA 4ZBGA 4JXRA 2PC1A 1QSRA 3PP9A 2B3UA 4UWIA 4X5KA 2Q4VA 1Z4RA 3SHPA 1R57A 1YVKA 1QSMA 3D2MA 2Q44A 2VZZA 4PSWA 2D4PA 1FY7A 2FCKA 1PU9A 2NMTA 4AG7A 4CAVA 3TOAA 4HNXB 3I3GA 4H89A 1CJWA 3R95A 4II9A 4R57A 2Q7BA 2J8NA 3TOBA 2EVNA 1S7KA 1XE4A 4HNYB 3IGRA 2R7HA 4KOUA 1YREA 1CM0A 2FIWA 1NMTA 3PGPA 5F49A 3GYAA 2I00A 4XPDB 5JPHA 1YX0A 4RI1A 4B5OA 4M3SA 3LD2A 2HUZA 1MJ9A 4PK3A 4I49A 4E8OA 2REEA 2F5IA 3R96A 2H5MA 2FIAA 4B5PB 1N71A 2PDOA 4QB9A 3D2PA 2B4DA 4OLLA 2R98A 2CNMA 3TCVA 3WR7A 5IB0A 4AG9A 2FSRA 4XPDC 4E0AA 5ISVA 2OU2A 2G3AA 4U5YA 4F0YA 5EC4A 1PUAA 2PRBA 4NSQA 5KTAA 1XEBA 1KZFA 3DNSA 4CS0B 5CNPA 2X7BA 2EUIA 4DNCA 2PQ8A 3N7ZA 2CY2A 1J4JA 3P2HA 2CNSA 3B8GA 2ZW4A 1VHSA 3D3SA 3FNCA 3EO4A 4XPLA 1IB1E 1RXTA 2WPXA 3IWGA 2JEVA 3W91A 4R9MA 1YR0A 1UFHA 2VQYA 5H84A 3TTHA 2B5GB 4RS2A 4LUAA 5FVJA 4KLWA 3ZZIA 4Y49C 4KUAA 2FS5A 3LODA 2ZPAA 1OZPA 4XPKA 4QBJA 1M44A 3BJ8A 2P0WA 2RC4A 4H6ZA 4PV6A 1Z9UA 2CNTA 4L8AA 5GCNA 2Z11A 1LRZA 2J8MA 1MK4A 2VZYA 4KUBA 4L89A 4FD7A 1S3ZA 2VBQA 1I21A 3TO6A 1YK3A 2ZXVA 4MHDA 4CAWA 1YVOA 4UA3A 1M1DA 2G3TA 4CRYB 1WK4A 1Q2DA 4NEXA 1M4DA 3V8IA 2AJ6A 2BEIA 4UBRA 4PK2A 5EBVA 4OADA 3CXQA 3TT2A 5F48A 4FD6A 5DWMA 1Z4EA 3UY5A 1Y9KA 1U6MA 1Y9WA 4F6AA 5IV0A 4R3KA 2OZUA 1KUYA 2Q04A 4MBUA 5C82A 1I12A 4MI4A 3S6KA 2B4BA 3QAHA 4KOXA 4UWJA 3VWDA 3PZJA 1RO5A 3EC4A 3R1KA 2A4NA 3FIXA 1Q2YA 3DSBA 2C27A 3EY5A 2IL4A 2ARHA 2GANA 1MJAA 3SXNA 4PSXA 5KTCA 1K4JA 1I1DA 2REFA 3R9EA 1IYLA 2Q0YA 4QC6A 2FL4A 3S6GA 1KUVA 1WWZA 5I0CA 4NF1A 3W6SA 3CXPA 3H4QA 4QVTA 3C26A 4K30A 4JD6A 1NSLA 3F5BA 2B4DB 1BOBA 1BO4A 2JDDA 2VXKA 2P6FA 3BJ7A 2D4OA 1S5KA 1IIDA 1QSTA 2B3VA 5IX3A 1QSOA 2Z10A 3TO9A 4J3GA 5H86A 5KTDA 4KLVA 4M85A 2BSWA 4JXQA 1XF8A 4HNWB 4U9YA 5HH1A 5J8FA 2QECA 1NE9A 2G0BA 2GIVA 3EFAA 4ORFA 2DXQA 4MY3A 1KUXA 2PSWA 3QB8A 4IUSA 2GE3A 4JJXA 3R9GA 5HMNA 2OB0A 2HV2A 3JVNA 2PR8A 1L0CA 1B87A 2JLMA 2OZHA 5J8CA 4JWPA 1IYKA 2B58A 4BMHA 4ONUA 2Z0ZA
chains in the Genus database with same CATH superfamily
1MJBA 4MFLA 5THWA 4CAXA 2I79A 4P4IA 4UEEA 4P4DA 1S60A 2PJ4A 2I3CA 4CRZB 3SJGA 1Y7RA 2PJ2A 3NE7A 4JYWA 3D4UA 4FD5A 4CAFA 4HKFA 2P6EA 3D7GA 3P2FA 3IO1A 4MY0A 1YGHA 2IJZA 4UFXA 5LRJA 3G8WA 1IU8A 5LRGA 1XMTA 3KKWA 3NH4A 5G21A 4Q7AA 3HLPA 3TE4A 4ZY2A 4CGMA 4KZTA 4DUKA 1S7LA 3JTKA 2Z3PA 4GS4A 2PJ1A 1IICA 1PCAA 4YFJA 4P44A 3G3SA 3LACA 2KCWA 5D29A 3D7DA 3FJUA 2DPTA 3FYNA 3NH5A 3K2KA 2ZW5A 2BUEA 3BLNA 4XNHB 4FBEA 2ZEGA 1ON0A 1S7FA 3DR6A 3SXOA 4B5PA 2JEWA 2ZEEA 4YRHA 2WPWA 5G22A 1CPSA 4P4EA 2QIRA 2Y0MA 4F9UA 3EXNA 4KS9A 2Q7SA 3KR5A 3ISXA 4AVCA 3TO7A 3S6FA 3CT9A 2QMLA 4KOTA 1ZLIA 4CAEA 3CXSA 3NE8A 4A33A 2ATRA 5AGEA 5G20A 2ZEDA 2GLJA 5E96A 4LX9A 1HDUA 3IFEA 2EBJA 3R9FA 3ZJ0A 3H5ZA 5JQ4A 3GY9A 4C2XA 2BL1A 2V8GA 4X2TA 1Q2CA 4YGOA 3SJFA 4H6UA 2ZW6A 4B11A 1UWYA 2XEGA 4OAEA 2OZGA 3DDDA 5DWNA 3OWCA 2WSAA 1VKCA 2PJ8A 4NXYA 4ONWA 4KOSA 5LYDA 2FE7A 4E2AA 4EWTA 4MFQA 3FB3A 4R87A 2EK9A 2YGWA 5C88A 3I9SA 3SJEA 4KVME 4XNHC 1HDQA 1ELMP 2IQ6A 4AVAA 3ISZA 3E0KA 4KOYA 1XRYA 4NGSA 4U9ZA 2P6GA 5F47A 1M4LA 4AXVA 4X8IA 3KHXA 4OC0A 5JH9A 2ZEPA 1P0HA 5K8NA 3FECA 5JGFA 1YLEA 3F8KA 1TF9A 2JBKA 1IOIA 1TXRA 4A95A 2J8RA 1Y0YA 3FRMA 1TKJA 2R8VA 3D8PA 1Z8LA 3D66A 4KVOE 2PR1A 4MCSA 4B6ZA 1V0CA 4AVBA 4A38A 4QUSA 2YNDA 5AG7A 4KORA 2R1IA 2VI7A 2ODFA 2G9DA 3T9YA 2ZW7A 3RYOA 4FD4A 4IF5A 2GU2A 2Z3LA 3GB0A 3SI2A 1M4GA 3VWEA 1FNOA 1YW6A 2O28A 3CPXA 4JLYA 1IY7A 1GHEA 4OC3A 1RTQA 2HQYA 2Q4YA 3MGDA 3D67A 2V77A 1B6BA 2OOTA 5F46A 4KSFA 1XIXA 3T90A 2B5GA 2K5TA 3LWUA 2NYQA 4NFRA 2PVWA 5AG6A 1P4NA 3FXTA 4AB7A 4MXUA 4Y49B 4R3LA 4F8ZA 2YNCA 2PCUA 4CYQA 1M4IA 3PRTA 3W6XA 1TIQA 2GFQA 3F0AA 2JBJA 4MJ8A 1FT7A 1QSNA 1CBXA 4NCZA 1KWMA 1XJOA 4PPZA 1SQHA 4NGTA 3JUWA 1TKHA 4MCRA 4C2ZA 4EVYA 3FBUA 2FT0A 2EO8A 3GKRA 4KVXA 4FAIA 2C6GA 4KOVA 2FXFA 3TFYA 2ZELA 3BHXA 3S6HA 4WWVA 2JDCA 2VEZA 3PFEA 4K3NA 1VHOA 2AE6A 2OH1A 2ZENA 3D68A 4KOWA 5HVHA 1Z8TA 3KHZA 4KSIA 3DR8A 2PJ0A 2DF5A 4NGNA 3K9UA 1YSJA 3WC6A 1S7NA 5G1ZA 4ZBGA 4A2ZA 3CDXA 4JXRA 4C2YA 2O4HA 1QSRA 2PC1A 3PP9A 5DS0A 2B3UA 4UWIA 4X5KA 2Q4VA 1Z4RA 3SHPA 3B3VA 1GYTA 1R57A 1YVKA 4GM5A 1QSMA 2PJ7A 3D2MA 2Q44A 5A28A 2VZZA 4M6GA 4PSWA 3QAYA 2D4PA 4UCMA 1FY7A 1XMBA 2FCKA 1PU9A 2NMTA 4FUUA 4CGNA 4AG7A 2Z3NA 3TOAA 2PJ9A 3KI9A 4CAVA 4ZI6A 2ZEMA 4HNXB 3I3GA 4H89A 2XEFA 1CJWA 4UIBA 2CIJA 6CPAA 3H8EA 3BI0A 3R95A 2Q4ZA 1BPNA 1LANA 2RB7A 4MFPA 2AFZA 4II9A 3B3CA 5LYIA 4R57A 4NGMA 1QMUA 2Q7BA 3GUXA 2J8NA 2Z3KA 3TOBA 2EVNA 5A27A 3DLJA 4B10A 2ANPA 4F0XA 3B35A 4KSAA 1S7KA 3FF3A 3IC1A 1XE4A 1X12A 1XFOA 4HNYB 5JM6A 3KZWA 2PJ5A 5K8OA 3IGRA 3WABA 2R7HA 4OC4A 4KOUA 1X10A 1ELLP 1YREA 1CM0A 3IU2A 2QVPA 4IHMA 2FIWA 1NMTA 2BOAA 4OMEA 3PGPA 1BAVA 2PJ3A 5F49A 3SI0A 3GYAA 2I00A 4XPDB 5JPHA 1YX0A 4ZX9A 4A39A 3A9LA 2WUUA 4RI1A 3RBUA 4BBHA 4DJLA 4MCPA 4B5OA 4OC2A 5F09A 4M3SA 3LD2A 1TKFA 1DE4C 2HUZA 4B12A 1MJ9A 4MFKA 1LAPA 1LAMA 4PK3A 3NH8A 4R76A 2ZOGA 4DYOA 4I49A 4E8OA 1ZO0A 2REEA 4A30A 4C7HA 2F5IA 3R96A 4ZY0A 2H5MA 1F57A 2FIAA 5IB9A 4B5PB 2PJCA 1BPMA 1AMPA 1N71A 4FWUA 2PDOA 4OIDA 2ABZA 4ZX8A 4QB9A 3RZAA 3D2PA 2B4DA 2PE3A 1PYTB 3WT4A 4OLLA 2R98A 2CNMA 2GLFA 3B3SA 1QQ9A 3TCVA 3WR7A 4M6HA 4BINA 5IB0A 3PFOA 4AG9A 3T8WA 1LCPA 2FSRA 4XPDC 4OC1A 4E0AA 4ZGYB 4LQGA 1CP7A 5ISVA 2OU2A 4A32A 1CX8A 5AG4A 2G3AA 3VATA 4CGPA 1BLLE 2PIYA 4U5YA 4G1PA 2Z3MA 1NSAA 4F0YA 2AFOA 1YMEA 3IU1A 5EC4A 1PUAA 2PRBA 4NSQA 2DEAA 4R7MA 5KTAA 1A2ZA 5LRKA 1XEBA 1KZFA 3LMSA 5AG5A 3DNSA 4MHZA 4MRIA 3PBBA 3KQXA 1IOFA 1LFWA 3KASA 4MMOA 5CNPA 2X7BA 4CS0B 4EMEA 2EUIA 4DNCA 4Z65A 2PIZA 2PQ8A 3N7ZA 2CY2A 1YLOA 4ZY1A 1J4JA 3P2HA 2CNSA 3B8GA 2ZW4A 2YNEA 1VHSA 3D3SA 2AFMA 3FNCA 1HEEA 3CPAA 3EO4A 4XPLA 1H8LA 4C68A 2VL1A 4CPAA 1IB1E 4MHPA 1RXTA 3D7HA 3I1UA 2WPXA 1EE3P 1ARMA 4CYPA 3IWGA 2JEVA 3MN8A 4IK2A 3W91A 4R9MA 3PBEA 1YR0A 1UFHA 4NJQA 1ZLHA 4B14A 4UIAA 1Z2LA 3S9MA 2VQYA 4MFZA 2AFSA 4Q36A 3KR4A 3D7FA 5H84A 3BI1A 2PJBA 4P6YA 2B5GB 3TTHA 5D8NA 4RS2A 1JWQA 4LUAA 3S9LA 5CBMA 4H2KA 5FVJA 4KLWA 2J9AA 3HUVA 5EMIA 4A37A 3ZZIA 4MHYA 5K8PA 2Q43A 4Y49C 4KUAA 2FS5A 3LODA 4OP4A 2ZPAA 3CZXA 5HVFA 3FX6A 2DPSA 1OZPA 2Z3OA 3PB8X 4TNUA 3K9TA 4XPKA 4QBJA 3FMCA 2XEJA 4NGQA 3B3WA 3TC8A 1M44A 5K8MA 4RN7A 3BJ8A 3IWEA 2EK8A 2P0WA 5BWAB 2RC4A 1AYEA 4H6ZA 4WJBA 5LYFA 4PV6A 2BCOA 1Z9UA 2CNTA 4L8AA 4PXDA 2RFHA 1F2PA 5GCNA 2Z11A 4P45A 5I4MA 2CTCA 4UEFA 1LRZA 1TF8A 2J8MA 3FEEA 4PXEA 1MK4A 2VZYA 4OKOA 1OBRA 2CTBA 2QJ8A 4KUBA 4L89A 4FD7A 4CYNA 1S3ZA 2VBQA 1I21A 3TO6A 4OIWA 3L2NA 1CG2A 1YK3A 2ZXVA 4MHDA 4CAWA 2FVGA 1YVOA 4UA3A 1M1DA 2G3TA 4A94A 4CRYB 1WK4A 2IMOA 2HB6A 2WZNA 1LOKA 2YNCC 2ZEOA 1Q2DA 2PVVA 1F2OA 1M4DA 4NEXA 4Q38A 3TX8A 3V8IA 1VGYA 2AJ6A 2Q51A 2BEIA 3H8FA 4UBRA 1Z8XA 4YU9A 4HPSA 1R3NA 4PK2A 3FVLA 3MRUA 5EBVA 4CGLA 4OADA 3CXQA 4P4BA 4JZ0A 3JRUA 5F48A 2BO9A 4FD6A 1XOVA 5ELYA 3TT2A 5DWMA 1Y0RA 1Z5RA 3KL9A 2POKA 1Z4EA 3UY5A 1Y9KA 3RNZA 1ZG7A 1U6MA 1Y9WA 4P4FA 4F6AA 5IV0A 3BXMA 3PB4X 1AUGA 3NA6A 4R3KA 3B2YA 1YW4A 4M6IA 1VIXA 3FEDA 3VARA 2OZUA 1KUYA 2Q04A 4IAVA 2AFUA 4MBUA 4UF4A 3V38A 5C82A 1I12A 2WYRA 3B3TA 4MI4A 5LYLA 3S6KA 2B4BA 4MHNA 3QAHA 4KOXA 4UWJA 1DTDA 3IJ3A 2PJ6A 2V8HA 1Q7LA 3VWDA 1ZG9A 3PZJA 1RO5A 3EC4A 2AFWA 3R1KA 2A4NA 3RAMA 3FIXA 1JQGA 2HC9A 1Q2YA 3DSBA 2C27A 3EY5A 4PXBA 4MFJA 2IL4A 5J1QA 2ARHA 2F8HA 3PB7X 4LQ6A 1Y7EA 2GANA 2C6PA 1MJAA 3SXNA 3PB9X 1R43A 3GIUA 3VH9A 1IGBA 2OR4A 4PSXA 2EWBA 5KTCA 5HXDA 1K4JA 1I1DA 2REFA 1YQEA 3R9EA 3GLJA 1IYLA 2Q0YA 4UCPA 4QC6A 7CPAA 2FL4A 1ARLA 3S6GA 1KUVA 4TWEA 3IWWA 1WWZA 3KQZA 4GXHA 5I0CA 4NF1A 4R6TA 4R8FA 3W6SA 3CXPA 4CGOA 4P10A 4OC5A 3H4QA 4UFWA 4QVTA 3C26A 4K30A 4W9YA 3PEIA 2CXAA 2GREA 4JD6A 1NSLA 3F5BA 3PB6X 2B4DB 2PJAA 3WC5A 1VHEA 3S9NA 1BOBA 4P4JA 4MCQA 1BO4A 2JDDA 2ZEHA 3WC7A 2XEIA 2VXKA 2C1CA 2P6FA 2CF4A 3BJ7A 2D4OA 1S5KA 3IEHA 3SI1A 1IIDA 3SJXA 2NSMA 1QSTA 5CPAA 4X3RA 4RUHA 2B3VA 5IX3A 1QSOA 2ZEFA 2Z10A 3TO9A 3N5FA 8CPAA 4PQAA 1Z8WA 2O53A 4J3GA 4NJRA 4YWYA 5H86A 5KTDA 4CYOA 4KLVA 2V8DA 3DGVA 2PRQA 4M85A 4NGPA 2AFXA 4NGRA 2BSWA 4JXQA 4A31A 4F9VA 3QNVA 4UEZA 4ZYQA 3FH4A 1XF8A 4UCNA 4HNWB 3RO0A 4U9YA 5HH1A 5J8FA 2QECA 1NE9A 2G0BA 4UFVA 2V8VA 2ZOFA 2GIVA 3EFAA 2C6CA 1ZG8A 5HVGA 4ORFA 2DXQA 4MY3A 2Z0ZA 1KUXA 1CP6A 3H8GA 3NFZA 2PSWA 3B7IA 4PXCA 3QB8A 4IUSA 4EFDA 2F7VA 3KGQA 2GE3A 4JJXA 3R9GA 4C7IA 2OB0A 2HV2A 3JVNA 3IIBA 2PR8A 3V7ZA 5HMNA 1L0CA 1B87A 1XBUA 2JLMA 2OZHA 4O23A 5J8CA 4JWPA 4BD9A 1IYKA 2B58A 4B13A 4BMHA 4ONUA 1CPXA 2QYVA
chains in the Genus database with same CATH topology
1MJBA 4MFLA 4CAXA 2I79A 1S60A 4CRZB 1Y7RA 3NE7A 4FD5A 4CAFA 4HKFA 2P6EA 3P2FA 4MY0A 1YGHA 4UFXA 3G8WA 1XMTA 3KKWA 5G21A 3TE4A 4CGMA 4KZTA 1S7LA 3JTKA 2Z3PA 4GS4A 1IICA 4YFJA 3G3SA 2KCWA 2DPTA 3FYNA 2ZW5A 2BUEA 3BLNA 4XNHB 3DR6A 1ON0A 1S7FA 3SXOA 4B5PA 5G22A 4YRHA 2WPWA 2QIRA 2Y0MA 3EXNA 4KS9A 4AVCA 3TO7A 3S6FA 2QMLA 4KOTA 4CAEA 3CXSA 4A33A 2ATRA 5AGEA 5G20A 5E96A 4LX9A 3R9FA 3ZJ0A 3H5ZA 5JQ4A 3GY9A 4C2XA 2BL1A 1Q2CA 4YGOA 4H6UA 2ZW6A 4B11A 4OAEA 2OZGA 3DDDA 5DWNA 3OWCA 2WSAA 1VKCA 4NXYA 4E2AA 4KOSA 2FE7A 4MFQA 3FB3A 4R87A 2YGWA 5C88A 3I9SA 4KVME 4XNHC 4AVAA 3E0KA 4KOYA 4U9ZA 2P6GA 5F47A 1P0HA 1YLEA 3F8KA 4A95A 2J8RA 3FRMA 2R8VA 3D8PA 4KVOE 2PR1A 1V0CA 4AVBA 4QUSA 2YNDA 5AG7A 4KORA 2R1IA 2VI7A 3T9YA 2ZW7A 3RYOA 4FD4A 4IF5A 2Z3LA 1M4GA 3VWEA 2O28A 4JLYA 1GHEA 2HQYA 2Q4YA 3MGDA 5F46A 1B6BA 4KSFA 1XIXA 3T90A 2B5GA 2K5TA 5AG6A 1P4NA 3FXTA 4AB7A 4Y49B 4R3LA 2YNCA 4CYQA 1M4IA 3W6XA 1TIQA 3F0AA 4MJ8A 1QSNA 4NCZA 1SQHA 3JUWA 4EVYA 4C2ZA 3FBUA 2FT0A 4KVXA 3GKRA 4KOVA 2FXFA 3TFYA 3S6HA 2JDCA 2VEZA 2AE6A 2OH1A 4KOWA 3DR8A 3K9UA 1S7NA 5G1ZA 4ZBGA 4A2ZA 4JXRA 4C2YA 2PC1A 1QSRA 3PP9A 2B3UA 4UWIA 4X5KA 2Q4VA 1Z4RA 3SHPA 1R57A 1YVKA 1QSMA 3D2MA 2Q44A 5A28A 2VZZA 4PSWA 2D4PA 4UCMA 1FY7A 2FCKA 1PU9A 2NMTA 4CGNA 4AG7A 2Z3NA 3TOAA 4CAVA 4HNXB 3I3GA 4H89A 1CJWA 3R95A 4MFPA 4II9A 4R57A 2Q7BA 5A27A 2J8NA 2Z3KA 3TOBA 2EVNA 4B10A 4F0XA 4KSAA 1S7KA 1XE4A 4HNYB 3IGRA 2R7HA 4KOUA 1YREA 3IU2A 1CM0A 2FIWA 1NMTA 3PGPA 5F49A 3GYAA 2I00A 4XPDB 5JPHA 1YX0A 3A9LA 2WUUA 4RI1A 4BBHA 4B5OA 4M3SA 3LD2A 2HUZA 4B12A 1MJ9A 4MFKA 4PK3A 4I49A 4E8OA 1ZO0A 2REEA 4A30A 4C7HA 2F5IA 3R96A 2H5MA 2FIAA 4B5PB 1N71A 2PDOA 4QB9A 3D2PA 2B4DA 4OLLA 2R98A 2CNMA 3TCVA 3WR7A 5IB0A 4AG9A 2FSRA 4XPDC 4E0AA 4ZGYB 5ISVA 2OU2A 4A32A 5AG4A 2G3AA 4CGPA 4U5YA 2Z3MA 4F0YA 3IU1A 5EC4A 1PUAA 2PRBA 4NSQA 5KTAA 1XEBA 1KZFA 5AG5A 3DNSA 4CS0B 5CNPA 2X7BA 2EUIA 4DNCA 2PQ8A 3N7ZA 2CY2A 1J4JA 3P2HA 2CNSA 3B8GA 2ZW4A 2YNEA 1VHSA 3D3SA 3FNCA 3EO4A 4XPLA 4C68A 1IB1E 1RXTA 2WPXA 4CYPA 3IWGA 2JEVA 3W91A 4R9MA 1YR0A 1UFHA 4B14A 2VQYA 4MFZA 4Q36A 5H84A 3TTHA 2B5GB 4RS2A 4LUAA 5FVJA 4KLWA 3ZZIA 4Y49C 4KUAA 2FS5A 3LODA 2ZPAA 2DPSA 1OZPA 2Z3OA 4XPKA 4QBJA 1M44A 5BWAB 3BJ8A 3IWEA 2P0WA 2RC4A 4H6ZA 4PV6A 1Z9UA 2CNTA 4L8AA 5GCNA 2Z11A 1LRZA 2J8MA 1MK4A 2VZYA 4KUBA 4L89A 4FD7A 4CYNA 1S3ZA 2VBQA 1I21A 3TO6A 1YK3A 2ZXVA 4MHDA 4CAWA 1YVOA 4UA3A 1M1DA 2G3TA 4CRYB 1WK4A 2YNCC 1Q2DA 4NEXA 1M4DA 3V8IA 4Q38A 2AJ6A 2BEIA 4UBRA 4PK2A 5EBVA 4CGLA 4OADA 3CXQA 3TT2A 5F48A 4FD6A 5DWMA 1Z4EA 3UY5A 1Y9KA 1U6MA 1Y9WA 4F6AA 5IV0A 4R3KA 2OZUA 1KUYA 2Q04A 4MBUA 5C82A 1I12A 4MI4A 3S6KA 2B4BA 3QAHA 4KOXA 4UWJA 3VWDA 3PZJA 1RO5A 3EC4A 3R1KA 2A4NA 3FIXA 1Q2YA 3DSBA 2C27A 3EY5A 4MFJA 2IL4A 2ARHA 2GANA 1MJAA 3SXNA 4PSXA 5KTCA 1K4JA 1I1DA 2REFA 3R9EA 1IYLA 2Q0YA 4UCPA 4QC6A 2FL4A 3S6GA 1KUVA 1WWZA 5I0CA 4NF1A 3W6SA 3CXPA 4CGOA 3H4QA 4UFWA 4QVTA 3C26A 4K30A 2CXAA 4JD6A 1NSLA 3F5BA 2B4DB 1BOBA 1BO4A 2JDDA 2VXKA 2P6FA 3BJ7A 2D4OA 1S5KA 1IIDA 1QSTA 2B3VA 5IX3A 1QSOA 2Z10A 3TO9A 4J3GA 5H86A 5KTDA 4CYOA 4KLVA 4A31A 4M85A 2BSWA 4JXQA 1XF8A 4UCNA 4HNWB 4U9YA 5HH1A 5J8FA 2QECA 1NE9A 2G0BA 4UFVA 2GIVA 3EFAA 4ORFA 2DXQA 4MY3A 1KUXA 2PSWA 3QB8A 4IUSA 2GE3A 4JJXA 3R9GA 4C7IA 2OB0A 2HV2A 3JVNA 5HMNA 2PR8A 1L0CA 1B87A 2JLMA 2OZHA 5J8CA 4JWPA 1IYKA 2B58A 4B13A 4BMHA 4ONUA 2Z0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJB A;  4CAX A;  2I79 A;  1S60 A;  4CRZ B;  1Y7R A;  3NE7 A;  4FD5 A;  4HKF A;  2P6E A;  3P2F A;  4MY0 A;  1YGH A;  3G8W A;  1XMT A;  3KKW A;  3TE4 A;  4KZT A;  1S7L A;  4GS4 A;  1IIC A;  4YFJ A;  3G3S A;  2KCW A;  3FYN A;  2ZW5 A;  2BUE A;  3BLN A;  4XNH B;  3DR6 A;  1ON0 A;  1S7F A;  3SXO A;  4B5P A;  4YRH A;  2WPW A;  2QIR A;  2Y0M A;  3EXN A;  4AVC A;  3TO7 A;  3S6F A;  2QML A;  4KOT A;  3CXS A;  2ATR A;  5E96 A;  4LX9 A;  3R9F A;  3ZJ0 A;  5JQ4 A;  3GY9 A;  2BL1 A;  1Q2C A;  4YGO A;  4H6U A;  2ZW6 A;  4OAE A;  2OZG A;  3DDD A;  5DWN A;  3OWC A;  1VKC A;  4NXY A;  4E2A A;  4KOS A;  2FE7 A;  3FB3 A;  4R87 A;  5C88 A;  3I9S A;  4KVM E;  4XNH C;  4AVA A;  3E0K A;  4KOY A;  4U9Z A;  2P6G A;  5F47 A;  1P0H A;  1YLE A;  3F8K A;  2J8R A;  3FRM A;  2R8V A;  3D8P A;  4KVO E;  2PR1 A;  1V0C A;  4AVB A;  4QUS A;  4KOR A;  2R1I A;  2VI7 A;  3T9Y A;  2ZW7 A;  3RYO A;  4FD4 A;  4IF5 A;  1M4G A;  3VWE A;  2O28 A;  4JLY A;  1GHE A;  2HQY A;  2Q4Y A;  3MGD A;  5F46 A;  1B6B A;  1XIX A;  3T90 A;  2B5G A;  2K5T A;  4AB7 A;  1P4N A;  3FXT A;  4Y49 B;  4R3L A;  1M4I A;  3W6X A;  1TIQ A;  3F0A A;  4MJ8 A;  1QSN A;  4NCZ A;  1SQH A;  3JUW A;  4EVY A;  3FBU A;  2FT0 A;  4KVX A;  3GKR A;  4KOV A;  2FXF A;  3TFY A;  3S6H A;  2JDC A;  2VEZ A;  2AE6 A;  2OH1 A;  4KOW A;  3DR8 A;  3K9U A;  1S7N A;  4ZBG A;  4JXR A;  2PC1 A;  1QSR A;  3PP9 A;  2B3U A;  4UWI A;  4X5K A;  2Q4V A;  1Z4R A;  3SHP A;  1R57 A;  1YVK A;  1QSM A;  3D2M A;  2Q44 A;  2VZZ A;  4PSW A;  2D4P A;  1FY7 A;  2FCK A;  1PU9 A;  2NMT A;  4AG7 A;  4CAV A;  3TOA A;  4HNX B;  3I3G A;  4H89 A;  1CJW A;  3R95 A;  4II9 A;  4R57 A;  2Q7B A;  2J8N A;  3TOB A;  2EVN A;  1S7K A;  1XE4 A;  4HNY B;  3IGR A;  2R7H A;  4KOU A;  1YRE A;  1CM0 A;  2FIW A;  1NMT A;  3PGP A;  5F49 A;  3GYA A;  2I00 A;  4XPD B;  5JPH A;  1YX0 A;  4RI1 A;  4B5O A;  4M3S A;  3LD2 A;  2HUZ A;  1MJ9 A;  4PK3 A;  4I49 A;  4E8O A;  2REE A;  2F5I A;  3R96 A;  2H5M A;  2FIA A;  4B5P B;  1N71 A;  2PDO A;  4QB9 A;  3D2P A;  2B4D A;  4OLL A;  2R98 A;  2CNM A;  3TCV A;  3WR7 A;  5IB0 A;  4AG9 A;  2FSR A;  4XPD C;  4E0A A;  5ISV A;  2OU2 A;  2G3A A;  4U5Y A;  4F0Y A;  5EC4 A;  1PUA A;  2PRB A;  4NSQ A;  5KTA A;  1XEB A;  1KZF A;  3DNS A;  4CS0 B;  5CNP A;  2X7B A;  2EUI A;  4DNC A;  2PQ8 A;  3N7Z A;  2CY2 A;  1J4J A;  3P2H A;  2CNS A;  3B8G A;  2ZW4 A;  1VHS A;  3D3S A;  3FNC A;  3EO4 A;  4XPL A;  1IB1 E;  1RXT A;  2WPX A;  3IWG A;  2JEV A;  3W91 A;  4R9M A;  1YR0 A;  1UFH A;  2VQY A;  5H84 A;  3TTH A;  2B5G B;  4RS2 A;  4LUA A;  5FVJ A;  4KLW A;  3ZZI A;  4Y49 C;  4KUA A;  2FS5 A;  3LOD A;  2ZPA A;  1OZP A;  4XPK A;  4QBJ A;  1M44 A;  3BJ8 A;  2P0W A;  2RC4 A;  4H6Z A;  4PV6 A;  1Z9U A;  2CNT A;  4L8A A;  5GCN A;  2Z11 A;  1LRZ A;  2J8M A;  1MK4 A;  2VZY A;  4KUB A;  4L89 A;  4FD7 A;  1S3Z A;  2VBQ A;  1I21 A;  3TO6 A;  1YK3 A;  2ZXV A;  4MHD A;  4CAW A;  1YVO A;  4UA3 A;  1M1D A;  2G3T A;  4CRY B;  1WK4 A;  1Q2D A;  4NEX A;  1M4D A;  3V8I A;  2AJ6 A;  2BEI A;  4UBR A;  4PK2 A;  5EBV A;  4OAD A;  3CXQ A;  3TT2 A;  5F48 A;  4FD6 A;  5DWM A;  1Z4E A;  3UY5 A;  1Y9K A;  1U6M A;  1Y9W A;  4F6A A;  5IV0 A;  4R3K A;  2OZU A;  1KUY A;  2Q04 A;  4MBU A;  5C82 A;  1I12 A;  4MI4 A;  3S6K A;  2B4B A;  3QAH A;  4KOX A;  4UWJ A;  3VWD A;  3PZJ A;  1RO5 A;  3EC4 A;  3R1K A;  2A4N A;  3FIX A;  1Q2Y A;  3DSB A;  2C27 A;  3EY5 A;  2IL4 A;  2ARH A;  2GAN A;  1MJA A;  3SXN A;  4PSX A;  5KTC A;  1K4J A;  1I1D A;  2REF A;  3R9E A;  1IYL A;  2Q0Y A;  4QC6 A;  2FL4 A;  3S6G A;  1KUV A;  1WWZ A;  5I0C A;  4NF1 A;  3W6S A;  3CXP A;  3H4Q A;  4QVT A;  3C26 A;  4K30 A;  4JD6 A;  1NSL A;  3F5B A;  2B4D B;  1BOB A;  1BO4 A;  2JDD A;  2VXK A;  2P6F A;  3BJ7 A;  2D4O A;  1S5K A;  1IID A;  1QST A;  2B3V A;  5IX3 A;  1QSO A;  2Z10 A;  3TO9 A;  4J3G A;  5H86 A;  5KTD A;  4KLV A;  4M85 A;  2BSW A;  4JXQ A;  1XF8 A;  4HNW B;  4U9Y A;  5HH1 A;  5J8F A;  2QEC A;  1NE9 A;  2G0B A;  2GIV A;  3EFA A;  4ORF A;  2DXQ A;  4MY3 A;  1KUX A;  2PSW A;  3QB8 A;  4IUS A;  2GE3 A;  4JJX A;  3R9G A;  5HMN A;  2OB0 A;  2HV2 A;  3JVN A;  2PR8 A;  1L0C A;  1B87 A;  2JLM A;  2OZH A;  5J8C A;  4JWP A;  1IYK A;  2B58 A;  4BMH A;  4ONU A;  2Z0Z A; 
#chains in the Genus database with same CATH topology
 1MJB A;  4MFL A;  5THW A;  4CAX A;  2I79 A;  4P4I A;  4UEE A;  4P4D A;  1S60 A;  2PJ4 A;  2I3C A;  4CRZ B;  3SJG A;  1Y7R A;  2PJ2 A;  3NE7 A;  4JYW A;  3D4U A;  4FD5 A;  4CAF A;  4HKF A;  2P6E A;  3D7G A;  3P2F A;  3IO1 A;  4MY0 A;  1YGH A;  2IJZ A;  4UFX A;  5LRJ A;  3G8W A;  1IU8 A;  5LRG A;  1XMT A;  3KKW A;  3NH4 A;  5G21 A;  4Q7A A;  3HLP A;  3TE4 A;  4ZY2 A;  4CGM A;  4KZT A;  4DUK A;  1S7L A;  3JTK A;  2Z3P A;  4GS4 A;  2PJ1 A;  1IIC A;  1PCA A;  4YFJ A;  4P44 A;  3G3S A;  3LAC A;  2KCW A;  5D29 A;  3D7D A;  3FJU A;  2DPT A;  3FYN A;  3NH5 A;  3K2K A;  2ZW5 A;  2BUE A;  3BLN A;  4XNH B;  4FBE A;  2ZEG A;  1ON0 A;  1S7F A;  3DR6 A;  3SXO A;  4B5P A;  2JEW A;  2ZEE A;  4YRH A;  2WPW A;  5G22 A;  1CPS A;  4P4E A;  2QIR A;  2Y0M A;  4F9U A;  3EXN A;  4KS9 A;  2Q7S A;  3KR5 A;  3ISX A;  4AVC A;  3TO7 A;  3S6F A;  3CT9 A;  2QML A;  4KOT A;  1ZLI A;  4CAE A;  3CXS A;  3NE8 A;  4A33 A;  2ATR A;  5AGE A;  5G20 A;  2ZED A;  2GLJ A;  5E96 A;  4LX9 A;  1HDU A;  3IFE A;  2EBJ A;  3R9F A;  3ZJ0 A;  3H5Z A;  5JQ4 A;  3GY9 A;  4C2X A;  2BL1 A;  2V8G A;  4X2T A;  1Q2C A;  4YGO A;  3SJF A;  4H6U A;  2ZW6 A;  4B11 A;  1UWY A;  2XEG A;  4OAE A;  2OZG A;  3DDD A;  5DWN A;  3OWC A;  2WSA A;  1VKC A;  2PJ8 A;  4NXY A;  4ONW A;  4KOS A;  5LYD A;  2FE7 A;  4E2A A;  4EWT A;  4MFQ A;  3FB3 A;  4R87 A;  2EK9 A;  2YGW A;  5C88 A;  3I9S A;  3SJE A;  4KVM E;  4XNH C;  1HDQ A;  1ELM P;  2IQ6 A;  4AVA A;  3ISZ A;  3E0K A;  4KOY A;  1XRY A;  4NGS A;  4U9Z A;  2P6G A;  5F47 A;  1M4L A;  4AXV A;  4X8I A;  3KHX A;  4OC0 A;  5JH9 A;  2ZEP A;  1P0H A;  5K8N A;  3FEC A;  5JGF A;  1YLE A;  3F8K A;  1TF9 A;  2JBK A;  1IOI A;  1TXR A;  4A95 A;  2J8R A;  1Y0Y A;  3FRM A;  1TKJ A;  2R8V A;  3D8P A;  1Z8L A;  3D66 A;  4KVO E;  2PR1 A;  4MCS A;  4B6Z A;  1V0C A;  4AVB A;  4A38 A;  4QUS A;  2YND A;  5AG7 A;  4KOR A;  2R1I A;  2VI7 A;  2ODF A;  2G9D A;  3T9Y A;  2ZW7 A;  3RYO A;  4FD4 A;  4IF5 A;  2GU2 A;  2Z3L A;  3GB0 A;  3SI2 A;  1M4G A;  3VWE A;  1FNO A;  1YW6 A;  2O28 A;  3CPX A;  4JLY A;  1IY7 A;  1GHE A;  4OC3 A;  1RTQ A;  2HQY A;  2Q4Y A;  3MGD A;  3D67 A;  2V77 A;  1B6B A;  2OOT A;  5F46 A;  4KSF A;  1XIX A;  3T90 A;  2B5G A;  2K5T A;  3LWU A;  2NYQ A;  4NFR A;  2PVW A;  5AG6 A;  1P4N A;  3FXT A;  4AB7 A;  4MXU A;  4Y49 B;  4R3L A;  4F8Z A;  2YNC A;  2PCU A;  4CYQ A;  1M4I A;  3PRT A;  3W6X A;  1TIQ A;  2GFQ A;  3F0A A;  2JBJ A;  4MJ8 A;  1FT7 A;  1QSN A;  1CBX A;  4NCZ A;  1KWM A;  1XJO A;  4PPZ A;  1SQH A;  4NGT A;  3JUW A;  1TKH A;  4MCR A;  4C2Z A;  4EVY A;  3FBU A;  2FT0 A;  2EO8 A;  3GKR A;  4KVX A;  4FAI A;  2C6G A;  4KOV A;  2FXF A;  3TFY A;  2ZEL A;  3BHX A;  3S6H A;  4WWV A;  2JDC A;  2VEZ A;  3PFE A;  4K3N A;  1VHO A;  2AE6 A;  2OH1 A;  2ZEN A;  3D68 A;  4KOW A;  5HVH A;  1Z8T A;  3KHZ A;  4KSI A;  3DR8 A;  2PJ0 A;  2DF5 A;  4NGN A;  3K9U A;  1YSJ A;  3WC6 A;  1S7N A;  5G1Z A;  4ZBG A;  4A2Z A;  3CDX A;  4JXR A;  4C2Y A;  2O4H A;  1QSR A;  2PC1 A;  3PP9 A;  5DS0 A;  2B3U A;  4UWI A;  4X5K A;  2Q4V A;  1Z4R A;  3SHP A;  3B3V A;  1GYT A;  1R57 A;  1YVK A;  4GM5 A;  1QSM A;  2PJ7 A;  3D2M A;  2Q44 A;  5A28 A;  2VZZ A;  4M6G A;  4PSW A;  3QAY A;  2D4P A;  4UCM A;  1FY7 A;  1XMB A;  2FCK A;  1PU9 A;  2NMT A;  4FUU A;  4CGN A;  4AG7 A;  2Z3N A;  3TOA A;  2PJ9 A;  3KI9 A;  4CAV A;  4ZI6 A;  2ZEM A;  4HNX B;  3I3G A;  4H89 A;  2XEF A;  1CJW A;  4UIB A;  2CIJ A;  6CPA A;  3H8E A;  3BI0 A;  3R95 A;  2Q4Z A;  1BPN A;  1LAN A;  2RB7 A;  4MFP A;  2AFZ A;  4II9 A;  3B3C A;  5LYI A;  4R57 A;  4NGM A;  1QMU A;  2Q7B A;  3GUX A;  2J8N A;  2Z3K A;  3TOB A;  2EVN A;  5A27 A;  3DLJ A;  4B10 A;  2ANP A;  4F0X A;  3B35 A;  4KSA A;  1S7K A;  3FF3 A;  3IC1 A;  1XE4 A;  1X12 A;  1XFO A;  4HNY B;  5JM6 A;  3KZW A;  2PJ5 A;  5K8O A;  3IGR A;  3WAB A;  2R7H A;  4OC4 A;  4KOU A;  1X10 A;  1ELL P;  1YRE A;  1CM0 A;  3IU2 A;  2QVP A;  4IHM A;  2FIW A;  1NMT A;  2BOA A;  4OME A;  3PGP A;  1BAV A;  2PJ3 A;  5F49 A;  3SI0 A;  3GYA A;  2I00 A;  4XPD B;  5JPH A;  1YX0 A;  4ZX9 A;  4A39 A;  3A9L A;  2WUU A;  4RI1 A;  3RBU A;  4BBH A;  4DJL A;  4MCP A;  4B5O A;  4OC2 A;  5F09 A;  4M3S A;  3LD2 A;  1TKF A;  1DE4 C;  2HUZ A;  4B12 A;  1MJ9 A;  4MFK A;  1LAP A;  1LAM A;  4PK3 A;  3NH8 A;  4R76 A;  2ZOG A;  4DYO A;  4I49 A;  4E8O A;  1ZO0 A;  2REE A;  4A30 A;  4C7H A;  2F5I A;  3R96 A;  4ZY0 A;  2H5M A;  1F57 A;  2FIA A;  5IB9 A;  4B5P B;  2PJC A;  1BPM A;  1AMP A;  1N71 A;  4FWU A;  2PDO A;  4OID A;  2ABZ A;  4ZX8 A;  4QB9 A;  3RZA A;  3D2P A;  2B4D A;  2PE3 A;  1PYT B;  3WT4 A;  4OLL A;  2R98 A;  2CNM A;  2GLF A;  3B3S A;  1QQ9 A;  3TCV A;  3WR7 A;  4M6H A;  4BIN A;  5IB0 A;  3PFO A;  4AG9 A;  3T8W A;  1LCP A;  2FSR A;  4XPD C;  4OC1 A;  4E0A A;  4ZGY B;  4LQG A;  1CP7 A;  5ISV A;  2OU2 A;  4A32 A;  1CX8 A;  5AG4 A;  2G3A A;  3VAT A;  4CGP A;  1BLL E;  2PIY A;  4U5Y A;  4G1P A;  2Z3M A;  1NSA A;  4F0Y A;  2AFO A;  1YME A;  3IU1 A;  5EC4 A;  1PUA A;  2PRB A;  4NSQ A;  2DEA A;  4R7M A;  5KTA A;  1A2Z A;  5LRK A;  1XEB A;  1KZF A;  3LMS A;  5AG5 A;  3DNS A;  4MHZ A;  4MRI A;  3PBB A;  3KQX A;  1IOF A;  1LFW A;  3KAS A;  4MMO A;  5CNP A;  2X7B A;  4CS0 B;  4EME A;  2EUI A;  4DNC A;  4Z65 A;  2PIZ A;  2PQ8 A;  3N7Z A;  2CY2 A;  1YLO A;  4ZY1 A;  1J4J A;  3P2H A;  2CNS A;  3B8G A;  2ZW4 A;  2YNE A;  1VHS A;  3D3S A;  2AFM A;  3FNC A;  1HEE A;  3CPA A;  3EO4 A;  4XPL A;  1H8L A;  4C68 A;  2VL1 A;  4CPA A;  1IB1 E;  4MHP A;  1RXT A;  3D7H A;  3I1U A;  2WPX A;  1EE3 P;  1ARM A;  4CYP A;  3IWG A;  2JEV A;  3MN8 A;  4IK2 A;  3W91 A;  4R9M A;  3PBE A;  1YR0 A;  1UFH A;  4NJQ A;  1ZLH A;  4B14 A;  4UIA A;  1Z2L A;  3S9M A;  2VQY A;  4MFZ A;  2AFS A;  4Q36 A;  3KR4 A;  3D7F A;  5H84 A;  3BI1 A;  2PJB A;  4P6Y A;  2B5G B;  3TTH A;  5D8N A;  4RS2 A;  1JWQ A;  4LUA A;  3S9L A;  5CBM A;  4H2K A;  5FVJ A;  4KLW A;  2J9A A;  3HUV A;  5EMI A;  4A37 A;  3ZZI A;  4MHY A;  5K8P A;  2Q43 A;  4Y49 C;  4KUA A;  2FS5 A;  3LOD A;  4OP4 A;  2ZPA A;  3CZX A;  5HVF A;  3FX6 A;  2DPS A;  1OZP A;  2Z3O A;  3PB8 X;  4TNU A;  3K9T A;  4XPK A;  4QBJ A;  3FMC A;  2XEJ A;  4NGQ A;  3B3W A;  3TC8 A;  1M44 A;  5K8M A;  4RN7 A;  3BJ8 A;  3IWE A;  2EK8 A;  2P0W A;  5BWA B;  2RC4 A;  1AYE A;  4H6Z A;  4WJB A;  5LYF A;  4PV6 A;  2BCO A;  1Z9U A;  2CNT A;  4L8A A;  4PXD A;  2RFH A;  1F2P A;  5GCN A;  2Z11 A;  4P45 A;  5I4M A;  2CTC A;  4UEF A;  1LRZ A;  1TF8 A;  2J8M A;  3FEE A;  4PXE A;  1MK4 A;  2VZY A;  4OKO A;  1OBR A;  2CTB A;  2QJ8 A;  4KUB A;  4L89 A;  4FD7 A;  4CYN A;  1S3Z A;  2VBQ A;  1I21 A;  3TO6 A;  4OIW A;  3L2N A;  1CG2 A;  1YK3 A;  2ZXV A;  4MHD A;  4CAW A;  2FVG A;  1YVO A;  4UA3 A;  1M1D A;  2G3T A;  4A94 A;  4CRY B;  1WK4 A;  2IMO A;  2HB6 A;  2WZN A;  1LOK A;  2YNC C;  2ZEO A;  1Q2D A;  2PVV A;  1F2O A;  1M4D A;  4NEX A;  4Q38 A;  3TX8 A;  3V8I A;  1VGY A;  2AJ6 A;  2Q51 A;  2BEI A;  3H8F A;  4UBR A;  1Z8X A;  4YU9 A;  4HPS A;  1R3N A;  4PK2 A;  3FVL A;  3MRU A;  5EBV A;  4CGL A;  4OAD A;  3CXQ A;  4P4B A;  4JZ0 A;  3JRU A;  5F48 A;  2BO9 A;  4FD6 A;  1XOV A;  5ELY A;  3TT2 A;  5DWM A;  1Y0R A;  1Z5R A;  3KL9 A;  2POK A;  1Z4E A;  3UY5 A;  1Y9K A;  3RNZ A;  1ZG7 A;  1U6M A;  1Y9W A;  4P4F A;  4F6A A;  5IV0 A;  3BXM A;  3PB4 X;  1AUG A;  3NA6 A;  4R3K A;  3B2Y A;  1YW4 A;  4M6I A;  1VIX A;  3FED A;  3VAR A;  2OZU A;  1KUY A;  2Q04 A;  4IAV A;  2AFU A;  4MBU A;  4UF4 A;  3V38 A;  5C82 A;  1I12 A;  2WYR A;  3B3T A;  4MI4 A;  5LYL A;  3S6K A;  2B4B A;  4MHN A;  3QAH A;  4KOX A;  4UWJ A;  1DTD A;  3IJ3 A;  2PJ6 A;  2V8H A;  1Q7L A;  3VWD A;  1ZG9 A;  3PZJ A;  1RO5 A;  3EC4 A;  2AFW A;  3R1K A;  2A4N A;  3RAM A;  3FIX A;  1JQG A;  2HC9 A;  1Q2Y A;  3DSB A;  2C27 A;  3EY5 A;  4PXB A;  4MFJ A;  2IL4 A;  5J1Q A;  2ARH A;  2F8H A;  3PB7 X;  4LQ6 A;  1Y7E A;  2GAN A;  2C6P A;  1MJA A;  3SXN A;  3PB9 X;  1R43 A;  3GIU A;  3VH9 A;  1IGB A;  2OR4 A;  4PSX A;  2EWB A;  5KTC A;  5HXD A;  1K4J A;  1I1D A;  2REF A;  1YQE A;  3R9E A;  3GLJ A;  1IYL A;  2Q0Y A;  4UCP A;  4QC6 A;  7CPA A;  2FL4 A;  1ARL A;  3S6G A;  1KUV A;  4TWE A;  3IWW A;  1WWZ A;  3KQZ A;  4GXH A;  5I0C A;  4NF1 A;  4R6T A;  4R8F A;  3W6S A;  3CXP A;  4CGO A;  4P10 A;  4OC5 A;  3H4Q A;  4UFW A;  4QVT A;  3C26 A;  4K30 A;  4W9Y A;  3PEI A;  2CXA A;  2GRE A;  4JD6 A;  1NSL A;  3F5B A;  3PB6 X;  2B4D B;  2PJA A;  3WC5 A;  1VHE A;  3S9N A;  1BOB A;  4P4J A;  4MCQ A;  1BO4 A;  2JDD A;  2ZEH A;  3WC7 A;  2XEI A;  2VXK A;  2C1C A;  2P6F A;  2CF4 A;  3BJ7 A;  2D4O A;  1S5K A;  3IEH A;  3SI1 A;  1IID A;  3SJX A;  2NSM A;  1QST A;  5CPA A;  4X3R A;  4RUH A;  2B3V A;  5IX3 A;  1QSO A;  2ZEF A;  2Z10 A;  3TO9 A;  3N5F A;  8CPA A;  4PQA A;  1Z8W A;  2O53 A;  4J3G A;  4NJR A;  4YWY A;  5H86 A;  5KTD A;  4CYO A;  4KLV A;  2V8D A;  3DGV A;  2PRQ A;  4M85 A;  4NGP A;  2AFX A;  4NGR A;  2BSW A;  4JXQ A;  4A31 A;  4F9V A;  3QNV A;  4UEZ A;  4ZYQ A;  3FH4 A;  1XF8 A;  4UCN A;  4HNW B;  3RO0 A;  4U9Y A;  5HH1 A;  5J8F A;  2QEC A;  1NE9 A;  2G0B A;  4UFV A;  2V8V A;  2ZOF A;  2GIV A;  3EFA A;  2C6C A;  1ZG8 A;  5HVG A;  4ORF A;  2DXQ A;  4MY3 A;  2Z0Z A;  1KUX A;  1CP6 A;  3H8G A;  3NFZ A;  2PSW A;  3B7I A;  4PXC A;  3QB8 A;  4IUS A;  4EFD A;  2F7V A;  3KGQ A;  2GE3 A;  4JJX A;  3R9G A;  4C7I A;  2OB0 A;  2HV2 A;  3JVN A;  3IIB A;  2PR8 A;  3V7Z A;  5HMN A;  1L0C A;  1B87 A;  1XBU A;  2JLM A;  2OZH A;  4O23 A;  5J8C A;  4JWP A;  4BD9 A;  1IYK A;  2B58 A;  4B13 A;  4BMH A;  4ONU A;  1CPX A;  2QYV A; 
#chains in the Genus database with same CATH homology
 1MJB A;  4MFL A;  4CAX A;  2I79 A;  1S60 A;  4CRZ B;  1Y7R A;  3NE7 A;  4FD5 A;  4CAF A;  4HKF A;  2P6E A;  3P2F A;  4MY0 A;  1YGH A;  4UFX A;  3G8W A;  1XMT A;  3KKW A;  5G21 A;  3TE4 A;  4CGM A;  4KZT A;  1S7L A;  3JTK A;  2Z3P A;  4GS4 A;  1IIC A;  4YFJ A;  3G3S A;  2KCW A;  2DPT A;  3FYN A;  2ZW5 A;  2BUE A;  3BLN A;  4XNH B;  3DR6 A;  1ON0 A;  1S7F A;  3SXO A;  4B5P A;  5G22 A;  4YRH A;  2WPW A;  2QIR A;  2Y0M A;  3EXN A;  4KS9 A;  4AVC A;  3TO7 A;  3S6F A;  2QML A;  4KOT A;  4CAE A;  3CXS A;  4A33 A;  2ATR A;  5AGE A;  5G20 A;  5E96 A;  4LX9 A;  3R9F A;  3ZJ0 A;  3H5Z A;  5JQ4 A;  3GY9 A;  4C2X A;  2BL1 A;  1Q2C A;  4YGO A;  4H6U A;  2ZW6 A;  4B11 A;  4OAE A;  2OZG A;  3DDD A;  5DWN A;  3OWC A;  2WSA A;  1VKC A;  4NXY A;  4E2A A;  4KOS A;  2FE7 A;  4MFQ A;  3FB3 A;  4R87 A;  2YGW A;  5C88 A;  3I9S A;  4KVM E;  4XNH C;  4AVA A;  3E0K A;  4KOY A;  4U9Z A;  2P6G A;  5F47 A;  1P0H A;  1YLE A;  3F8K A;  4A95 A;  2J8R A;  3FRM A;  2R8V A;  3D8P A;  4KVO E;  2PR1 A;  1V0C A;  4AVB A;  4QUS A;  2YND A;  5AG7 A;  4KOR A;  2R1I A;  2VI7 A;  3T9Y A;  2ZW7 A;  3RYO A;  4FD4 A;  4IF5 A;  2Z3L A;  1M4G A;  3VWE A;  2O28 A;  4JLY A;  1GHE A;  2HQY A;  2Q4Y A;  3MGD A;  5F46 A;  1B6B A;  4KSF A;  1XIX A;  3T90 A;  2B5G A;  2K5T A;  5AG6 A;  1P4N A;  3FXT A;  4AB7 A;  4Y49 B;  4R3L A;  2YNC A;  4CYQ A;  1M4I A;  3W6X A;  1TIQ A;  3F0A A;  4MJ8 A;  1QSN A;  4NCZ A;  1SQH A;  3JUW A;  4EVY A;  4C2Z A;  3FBU A;  2FT0 A;  4KVX A;  3GKR A;  4KOV A;  2FXF A;  3TFY A;  3S6H A;  2JDC A;  2VEZ A;  2AE6 A;  2OH1 A;  4KOW A;  3DR8 A;  3K9U A;  1S7N A;  5G1Z A;  4ZBG A;  4A2Z A;  4JXR A;  4C2Y A;  2PC1 A;  1QSR A;  3PP9 A;  2B3U A;  4UWI A;  4X5K A;  2Q4V A;  1Z4R A;  3SHP A;  1R57 A;  1YVK A;  1QSM A;  3D2M A;  2Q44 A;  5A28 A;  2VZZ A;  4PSW A;  2D4P A;  4UCM A;  1FY7 A;  2FCK A;  1PU9 A;  2NMT A;  4CGN A;  4AG7 A;  2Z3N A;  3TOA A;  4CAV A;  4HNX B;  3I3G A;  4H89 A;  1CJW A;  3R95 A;  4MFP A;  4II9 A;  4R57 A;  2Q7B A;  5A27 A;  2J8N A;  2Z3K A;  3TOB A;  2EVN A;  4B10 A;  4F0X A;  4KSA A;  1S7K A;  1XE4 A;  4HNY B;  3IGR A;  2R7H A;  4KOU A;  1YRE A;  3IU2 A;  1CM0 A;  2FIW A;  1NMT A;  3PGP A;  5F49 A;  3GYA A;  2I00 A;  4XPD B;  5JPH A;  1YX0 A;  3A9L A;  2WUU A;  4RI1 A;  4BBH A;  4B5O A;  4M3S A;  3LD2 A;  2HUZ A;  4B12 A;  1MJ9 A;  4MFK A;  4PK3 A;  4I49 A;  4E8O A;  1ZO0 A;  2REE A;  4A30 A;  4C7H A;  2F5I A;  3R96 A;  2H5M A;  2FIA A;  4B5P B;  1N71 A;  2PDO A;  4QB9 A;  3D2P A;  2B4D A;  4OLL A;  2R98 A;  2CNM A;  3TCV A;  3WR7 A;  5IB0 A;  4AG9 A;  2FSR A;  4XPD C;  4E0A A;  4ZGY B;  5ISV A;  2OU2 A;  4A32 A;  5AG4 A;  2G3A A;  4CGP A;  4U5Y A;  2Z3M A;  4F0Y A;  3IU1 A;  5EC4 A;  1PUA A;  2PRB A;  4NSQ A;  5KTA A;  1XEB A;  1KZF A;  5AG5 A;  3DNS A;  4CS0 B;  5CNP A;  2X7B A;  2EUI A;  4DNC A;  2PQ8 A;  3N7Z A;  2CY2 A;  1J4J A;  3P2H A;  2CNS A;  3B8G A;  2ZW4 A;  2YNE A;  1VHS A;  3D3S A;  3FNC A;  3EO4 A;  4XPL A;  4C68 A;  1IB1 E;  1RXT A;  2WPX A;  4CYP A;  3IWG A;  2JEV A;  3W91 A;  4R9M A;  1YR0 A;  1UFH A;  4B14 A;  2VQY A;  4MFZ A;  4Q36 A;  5H84 A;  3TTH A;  2B5G B;  4RS2 A;  4LUA A;  5FVJ A;  4KLW A;  3ZZI A;  4Y49 C;  4KUA A;  2FS5 A;  3LOD A;  2ZPA A;  2DPS A;  1OZP A;  2Z3O A;  4XPK A;  4QBJ A;  1M44 A;  5BWA B;  3BJ8 A;  3IWE A;  2P0W A;  2RC4 A;  4H6Z A;  4PV6 A;  1Z9U A;  2CNT A;  4L8A A;  5GCN A;  2Z11 A;  1LRZ A;  2J8M A;  1MK4 A;  2VZY A;  4KUB A;  4L89 A;  4FD7 A;  4CYN A;  1S3Z A;  2VBQ A;  1I21 A;  3TO6 A;  1YK3 A;  2ZXV A;  4MHD A;  4CAW A;  1YVO A;  4UA3 A;  1M1D A;  2G3T A;  4CRY B;  1WK4 A;  2YNC C;  1Q2D A;  4NEX A;  1M4D A;  3V8I A;  4Q38 A;  2AJ6 A;  2BEI A;  4UBR A;  4PK2 A;  5EBV A;  4CGL A;  4OAD A;  3CXQ A;  3TT2 A;  5F48 A;  4FD6 A;  5DWM A;  1Z4E A;  3UY5 A;  1Y9K A;  1U6M A;  1Y9W A;  4F6A A;  5IV0 A;  4R3K A;  2OZU A;  1KUY A;  2Q04 A;  4MBU A;  5C82 A;  1I12 A;  4MI4 A;  3S6K A;  2B4B A;  3QAH A;  4KOX A;  4UWJ A;  3VWD A;  3PZJ A;  1RO5 A;  3EC4 A;  3R1K A;  2A4N A;  3FIX A;  1Q2Y A;  3DSB A;  2C27 A;  3EY5 A;  4MFJ A;  2IL4 A;  2ARH A;  2GAN A;  1MJA A;  3SXN A;  4PSX A;  5KTC A;  1K4J A;  1I1D A;  2REF A;  3R9E A;  1IYL A;  2Q0Y A;  4UCP A;  4QC6 A;  2FL4 A;  3S6G A;  1KUV A;  1WWZ A;  5I0C A;  4NF1 A;  3W6S A;  3CXP A;  4CGO A;  3H4Q A;  4UFW A;  4QVT A;  3C26 A;  4K30 A;  2CXA A;  4JD6 A;  1NSL A;  3F5B A;  2B4D B;  1BOB A;  1BO4 A;  2JDD A;  2VXK A;  2P6F A;  3BJ7 A;  2D4O A;  1S5K A;  1IID A;  1QST A;  2B3V A;  5IX3 A;  1QSO A;  2Z10 A;  3TO9 A;  4J3G A;  5H86 A;  5KTD A;  4CYO A;  4KLV A;  4A31 A;  4M85 A;  2BSW A;  4JXQ A;  1XF8 A;  4UCN A;  4HNW B;  4U9Y A;  5HH1 A;  5J8F A;  2QEC A;  1NE9 A;  2G0B A;  4UFV A;  2GIV A;  3EFA A;  4ORF A;  2DXQ A;  4MY3 A;  1KUX A;  2PSW A;  3QB8 A;  4IUS A;  2GE3 A;  4JJX A;  3R9G A;  4C7I A;  2OB0 A;  2HV2 A;  3JVN A;  5HMN A;  2PR8 A;  1L0C A;  1B87 A;  2JLM A;  2OZH A;  5J8C A;  4JWP A;  1IYK A;  2B58 A;  4B13 A;  4BMH A;  4ONU A;  2Z0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...