4FD4A

Crystal structure of mosquito arylalkylamine n-acetyltransferase like 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
SIVLRVARLDELEQVREILHRIYYPEEGITISYVHGKSHTLDDERFSLSFVEQGTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVCGRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEKLGMECISQLALGDYRDEKGEKLFEPLDVHQVIKTCVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
molecule keywords arylalkylamine N-Acetyltransferase like 5b
total genus 74
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd4A00
4U9ZA 2OU2A 4Y49C 4UA3A 3G8WA 4RS2A 2Q4VA 3P2FA 2HV2A 3R1KA 3I9SA 3S6GA 3T90A 3VWEA 2WPWA 2PR8A 4U9YA 3S6KA 4PV6A 3FYNA 1NE9A 5FVJA 1P0HA 2ATRA 3F5BA 4XPDB 3TTHA 1S5KA 4L8AA 4KZTA 3C26A 3F8KA 1Y9WA 2GE3A 3CXSA 3T9YA 4NSQA 2H5MA 2J8RA 5F49A 1MJ9A 1PU9A 2PC1A 2K5TA 2VXKA 3DDDA 4HNWB 5DWNA 3EY5A 1Q2DA 1MK4A 4ONUA 1YREA 4CS0B 2ZW4A 1Z9UA 1KUYA 2QIRA 1QSRA 3R95A 5GCNA 5IB0A 1FY7A 2OZGA 5ISVA 2KCWA 3EXNA 2FIWA 4XNHC 2B5GB 2Y0MA 4L89A 4R3KA 4LX9A 1M44A 4YFJA 3ZJ0A 2FCKA 1VKCA 3S6HA 2HQYA 5HH1A 3D8PA 2FIAA 3SHPA 4KOTA 3JVNA 3D2PA 3G3SA 2PRBA 2J8NA 3B8GA 1BOBA 1J4JA 4KUAA 2Z0ZA 5EC4A 1IIDA 1S7KA 2BEIA 3PZJA 4J3GA 5C88A 2D4OA 4IUSA 1S7NA 4ORFA 4FD7A 4IF5A 1NSLA 4KOWA 4KLWA 4CAWA 2QMLA 1XEBA 3BJ7A 2VBQA 4QC6A 2I79A 2Q7BA 1B6BA 3FBUA 4HNYB 4AVAA 4PSXA 4QBJA 2FS5A 1YX0A 2Q0YA 4AB7A 2P6GA 1B87A 2X7BA 4OAEA 2JDCA 3W6XA 1N71A 1KZFA 2P6EA 4NF1A 2R8VA 3W6SA 2WPXA 2F5IA 5HMNA 3SXNA 1QSTA 3DR6A 2VI7A 2CNSA 2ZXVA 3GKRA 1XF8A 1YVOA 3TO7A 1Y7RA 3IWGA 2G3AA 1U6MA 2PQ8A 4JWPA 1Q2YA 1L0CA 1S3ZA 4I49A 4AG9A 1QSNA 2B3VA 1CM0A 3TO9A 4U5YA 2CNTA 3CXQA 1K4JA 4AG7A 4KOUA 3S6FA 1LRZA 3EC4A 4JLYA 2FT0A 3TOAA 4KUBA 4R3LA 1I1DA 3IGRA 4II9A 3D2MA 4PK2A 3R9FA 3K9UA 1ON0A 3BLNA 1KUXA 2R7HA 3RYOA 3JUWA 5E96A 1VHSA 4PK3A 2J8MA 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 1Z4RA 2D4PA 4JJXA 2PSWA 2R1IA 4KOYA 1S60A 2AJ6A 2B58A 4CRYB 3TT2A 2ARHA 3DNSA 1QSOA 4KVOE 4MY3A 1GHEA 1S7LA 3I3GA 2Q4YA 3TE4A 2GIVA 5J8CA 1XIXA 4XPKA 2QECA 2A4NA 4B5OA 4E0AA 4OADA 2B3UA 4MHDA 3FXTA 1YLEA 5KTDA 1RXTA 4NCZA 4H6ZA 4NEXA 1IYKA 2P6FA 4KOVA 1IB1E 1R57A 1P4NA 3QB8A 4HKFA 4KVME 4NXYA 2PR1A 3UY5A 4YRHA 4JXQA 1YK3A 4KOSA 4FD5A 2Q04A 5F47A 4E8OA 5J8FA 4CRZB 1Q2CA 1Y9KA 3EO4A 4KVXA 2FSRA 1UFHA 4QB9A 3LODA 4Y49B 1PUAA 4UWIA 2DXQA 1XMTA 3NE7A 4QUSA 4K30A 4PSWA 2G0BA 2OH1A 2REFA 1BO4A 2B4BA 2RC4A 5EBVA 2P0WA 3ZZIA 2CNMA 4MJ8A 2Q44A 1M1DA 3R9EA 4MBUA 4AVBA 3FNCA 2JDDA 3FRMA 5DWMA 2G3TA 2ZW5A 2B4DB 2FXFA 3EFAA 5F48A 4AVCA 2REEA 2EVNA 1MJAA 1XE4A 3PP9A 1WWZA 1KUVA 1QSMA 5F46A 2OB0A 2BSWA 4F6AA 2ZPAA 4MI4A 4H89A 3R9GA 2C27A 1I12A 1YVKA 4UBRA 3P2HA 3TOBA 1TIQA 4E2AA 2I00A 1RO5A 4R9MA 2Z11A 4CAXA 2VEZA 1M4GA 2AE6A 4CAVA 3CXPA 3D3SA 3TFYA 3FIXA 2OZUA 2R98A 4R57A 5KTAA 1IICA 4OLLA 4B5PB 3BJ8A 2HUZA 3H4QA 4H6UA 1YR0A 4MY0A 4ZBGA 4GS4A 2ZW6A 5KTCA 4JXRA 2VZYA 4EVYA 3OWCA 2JEVA 2FL4A 4LUAA 5H84A 4KOXA 1SQHA 4HNXB 2O28A 3SXOA 1OZPA 2GANA 2BUEA 4FD6A 2NMTA 4B5PA 1M4IA 3KKWA 5JQ4A 1M4DA 4M85A 1CJWA 4KORA 3W91A 5IX3A 3TCVA 3F0AA 4YGOA 2PDOA 3FB3A 5CNPA 4FD4A 3R96A 3WR7A 3GY9A 2EUIA 1S7FA 1MJBA 2VQYA 1NMTA 4QVTA 2B5GA 2JLMA 2IL4A 3VWDA 1YGHA 2VZZA 2Z10A 3DR8A 5I0CA 4R87A 5IV0A 2OZHA 5C82A 4XPLA 1IYLA 5H86A 3E0KA 4KLVA 4DNCA 5JPHA 3LD2A 3V8IA 4BMHA 2B4DA 4RI1A 4XPDC 3TO6A 4M3SA 3QAHA 2CY2A 4F0YA 3MGDA 4X5KA 1WK4A 2FE7A 4JD6A 3DSBA 1Z4EA 4UWJA 2BL1A 3N7ZA 2ZW7A
chains in the Genus database with same CATH superfamily
1QMUA 4U9ZA 5J1QA 4RN7A 4F9VA 4MFLA 5JM6A 2OU2A 4C68A 2PJCA 2EWBA 2PJ7A 3NFZA 4Y49C 1CP7A 2V77A 2ZEPA 4NGTA 3FEDA 2V8HA 4UA3A 3KQXA 4C2XA 1XOVA 2PIZA 3G8WA 2Q4VA 4RS2A 1BPMA 2HV2A 3P2FA 3R1KA 3I9SA 4UFXA 1HDQA 3S6GA 3T90A 2V8VA 2AFXA 5LRJA 4TWEA 3VWEA 2WPWA 2PR8A 4U9YA 4UEFA 3S6KA 4LQ6A 4PV6A 4RUHA 4R8FA 3FYNA 2AFMA 1NE9A 2GLFA 5FVJA 8CPAA 1P0HA 5K8NA 2ATRA 1Z5RA 3D4UA 3F5BA 2PJ1A 1BLLE 2AFZA 3H8GA 1S5KA 4L8AA 4XPDB 3TTHA 4MRIA 5LYLA 4KZTA 5EMIA 3C26A 1Q7LA 3F8KA 3RO0A 4R7MA 1Y9WA 2RB7A 4EMEA 2GE3A 4B6ZA 2Q43A 4OKOA 2AFSA 4YWYA 3CXSA 3KQZA 4MMOA 3D66A 1VHOA 3T9YA 2Q51A 4MHYA 4X2TA 3CDXA 4NSQA 5AG5A 2H5MA 2J8RA 3IU1A 5F49A 4A39A 1MJ9A 1PU9A 2PC1A 2K5TA 2VXKA 4JYWA 5G21A 2PRQA 4NGSA 4P44A 3DDDA 4HNWB 5DWNA 2JEWA 3EY5A 3FF3A 4UIAA 1Q2DA 1MK4A 3SI1A 4CYQA 4ONUA 1YREA 4CS0B 3FECA 2FVGA 2ZW4A 1Z9UA 3I1UA 3B3VA 2NYQA 1Z8TA 3PB7X 1KUYA 2QIRA 5LYFA 1QSRA 3R95A 5GCNA 5G22A 5IB0A 2Q7SA 1FY7A 2OZGA 2HC9A 2DEAA 5ISVA 4MXUA 3HLPA 4AXVA 2KCWA 3EXNA 1BPNA 3D68A 2FIWA 4XNHC 4MFQA 2B5GB 5LRGA 2Y0MA 4L89A 3D7FA 1TKHA 4R3KA 3TX8A 3SJEA 3N5FA 4OC4A 4UCMA 4LX9A 1M44A 2EK8A 4YFJA 3ZJ0A 2DF5A 3B3TA 2XEFA 3VH9A 2FCKA 4OP4A 4IK2A 1VKCA 3S6HA 2HQYA 3FJUA 1Z8XA 2PJ8A 5HH1A 3D8PA 2CTBA 3FEEA 2FIAA 3BI0A 5LYDA 4NGRA 4OIWA 3S9MA 3SHPA 4CGMA 1Z2LA 4KOTA 5AGEA 3JVNA 3D2PA 2QVPA 3G3SA 2GREA 1VGYA 2J8NA 2PRBA 1TXRA 3B8GA 1BOBA 1J4JA 4KUAA 2Z0ZA 3B3WA 2XEIA 5EC4A 4Q38A 1IIDA 1S7KA 2BEIA 1BAVA 1KWMA 1Z8LA 3PZJA 3L2NA 3PBEA 3B35A 4J3GA 4OC2A 4C2YA 2BO9A 2WYRA 1IOIA 1AUGA 4CYPA 3A9LA 3B3CA 2J9AA 3B2YA 5C88A 2D4OA 4IUSA 5HXDA 2C6CA 4C7IA 2ZEDA 1S7NA 4ORFA 5LRKA 5HVGA 1CPXA 1ZG9A 4FD7A 4IF5A 1AYEA 4C2ZA 1NSLA 4KOWA 5DS0A 2V8GA 4Z65A 4KLWA 4DJLA 4UEEA 2QMLA 1XEBA 3BJ7A 4CAWA 2VBQA 3IO1A 4QC6A 3PB4X 4X3RA 2I79A 1X10A 3KHZA 1A2ZA 2Q7BA 1B6BA 3FBUA 2PJ3A 4HNYB 4AVAA 2AFOA 1IOFA 1YMEA 4PSXA 2YNCA 4QBJA 2QJ8A 2FS5A 1F57A 1YX0A 2Q0YA 3JTKA 6CPAA 2IQ6A 4F0XA 4AB7A 2P6GA 4EFDA 1B87A 3S9NA 4G1PA 2JBJA 2ZOFA 2X7BA 4OAEA 1Z8WA 2JDCA 3W6XA 1N71A 4A30A 1KZFA 4P4IA 2P6EA 4BINA 4NF1A 1Y0YA 5HVHA 2R8VA 5F09A 4WWVA 3W6SA 2WPXA 2F5IA 4UF4A 2GU2A 4NJQA 2Z3OA 3NH8A 5HMNA 3SXNA 2ZEHA 1QSTA 2CIJA 3DR6A 2VI7A 3ISXA 3H8FA 2CNSA 4K3NA 2ZXVA 4MCPA 3GKRA 1XF8A 1LFWA 1YSJA 4P4BA 1YVOA 2DPSA 4W9YA 5G20A 3D67A 1Y7RA 3TO7A 3IWGA 2PJ0A 1XBUA 2G3AA 1U6MA 2WUUA 2PQ8A 3KL9A 4PXEA 1Q2YA 3CPXA 1L0CA 1DTDA 1S3ZA 4I49A 4JWPA 4AG9A 1QSNA 4TNUA 4ZGYB 2B3VA 4ZY0A 1CM0A 3TO9A 4U5YA 2CNTA 5IB9A 3CXQA 1K4JA 2POKA 2C1CA 4GM5A 2AFWA 1XMBA 3LACA 2RFHA 1IY7A 4AG7A 2XEGA 4KOUA 3WC6A 2Z3KA 5AG7A 3PFOA 4JZ0A 3S6FA 4ZYQA 1LRZA 3EC4A 4JLYA 2O4HA 4MFPA 2FT0A 4OMEA 3TOAA 4NFRA 4KUBA 1CPSA 2C6PA 4R3LA 1I1DA 3IGRA 3D7HA 4BD9A 4CYNA 4II9A 3D2MA 2PJ5A 4PK2A 3K9UA 1ON0A 2PIYA 1YLOA 3BLNA 3IC1A 3QAYA 1KUXA 4FWUA 5THWA 4DYOA 1JQGA 2R7HA 3RYOA 3JUWA 4OC3A 5E96A 1VHSA 3KI9A 4R6TA 4PK3A 2IMOA 2J8MA 4X8IA 4A2ZA 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 1Z4RA 4P4JA 2ZEGA 3HUVA 2D4PA 3PB6X 4JJXA 4UFWA 2PSWA 4UCPA 5HVFA 2R1IA 4KOYA 1S60A 1XFOA 4FAIA 2O53A 1XJOA 2AJ6A 3WABA 2B58A 2JBKA 2DPTA 3B3SA 4CRYB 3TT2A 2ARHA 3DNSA 3QNVA 3CZXA 1QSOA 4ZY1A 1ZO0A 2YGWA 3ISZA 4PXDA 4KVOE 4MY3A 1FNOA 1AMPA 4WJBA 1GHEA 1S7LA 3GB0A 3DLJA 4NGNA 4ZX9A 3B7IA 3I3GA 2PJ2A 2PJBA 3S9LA 2YNEA 4KS9A 2BCOA 1ZG8A 2Q4YA 3TE4A 2GFQA 2V8DA 2GIVA 2Z3LA 4KSAA 4B11A 2OR4A 5J8CA 1XIXA 1YW4A 2QECA 4XPKA 2A4NA 3KHXA 4M6HA 1VIXA 1JWQA 3RBUA 4B5OA 4E0AA 4OADA 2B3UA 3VATA 4MHDA 1TF9A 3FXTA 4PXBA 3CPAA 1YLEA 4NGQA 1RXTA 3VARA 4B13A 5KTDA 4NCZA 2PVWA 5A27A 4CYOA 2PJAA 4H6ZA 3IWWA 4HPSA 4NEXA 1IYKA 1LAPA 3KR5A 2P6FA 1IB1E 1F2OA 1R57A 1P4NA 4KOVA 4CGOA 3QB8A 3CT9A 4HKFA 4KVME 4NXYA 5K8PA 2PR1A 2PJ6A 2Q4ZA 4Q7AA 3UY5A 4YRHA 4IHMA 4JXQA 1YK3A 3FX6A 4KOSA 5ELYA 4FD5A 2Q04A 5F47A 2BOAA 4E8OA 1ELMP 5J8FA 4CRZB 1Q2CA 1Y9KA 3V38A 3EO4A 4KVXA 2FSRA 1UFHA 4MHNA 5G1ZA 4QB9A 3LODA 4CAFA 4Y49B 2WSAA 4MFKA 4A31A 4B10A 1PUAA 2ZEFA 4IAVA 3D7DA 1GYTA 4UWIA 2DXQA 2QYVA 1XMTA 3LWUA 3RAMA 3NE7A 2HB6A 3GUXA 3PRTA 4ONWA 4QUSA 2ZEMA 2G9DA 4K30A 4PSWA 4BBHA 1PYTB 2G0BA 4P4FA 5K8MA 2WZNA 2OH1A 2REFA 4CGPA 2ABZA 1IGBA 1CBXA 3MN8A 5JH9A 3BHXA 1TKFA 4Q36A 1BO4A 2ANPA 2B4BA 3K9TA 1LANA 2RC4A 5EBVA 2P0WA 1R3NA 4P45A 1UWYA 2CNMA 3ZZIA 1X12A 4MJ8A 2CF4A 2ZOGA 4ZY2A 1HEEA 2Q44A 1M1DA 3R9EA 1VHEA 4MBUA 3NH5A 3SI2A 4AVBA 3FNCA 5D8NA 2JDDA 3FRMA 5AG6A 5DWMA 2ZEOA 2G3TA 2ZW5A 2B4DB 2FXFA 3EFAA 3KGQA 5F48A 4AVCA 5K8OA 2REEA 2EK9A 4KSFA 2EVNA 4A37A 3NH4A 1MJAA 1XE4A 2PJ9A 3NA6A 3PP9A 4OC5A 1WWZA 3FMCA 4EWTA 1KUVA 3RZAA 1QSMA 3IEHA 2OB0A 3NE8A 2BSWA 4P6YA 4F6AA 5F46A 2ZPAA 2ODFA 4MI4A 1CX8A 4H89A 3H8EA 3BXMA 4OIDA 2GLJA 2ZEEA 3R9GA 7CPAA 2C27A 3SJXA 1ARLA 4NJRA 3RNZA 3WC5A 4UCNA 1I12A 3IWEA 1YVKA 2I3CA 4CAEA 4UBRA 3P2HA 1LOKA 3TOBA 4FBEA 1TIQA 2CTCA 2F7VA 4E2AA 4MHZA 2I00A 1RO5A 2EBJA 4LQGA 4R9MA 2Z11A 4CAXA 4YU9A 2XEJA 2PVVA 3KR4A 4ZX8A 3SI0A 2VEZA 4OC1A 4C7HA 1M4GA 4MFZA 2PCUA 2Z3MA 2AE6A 4CAVA 1LAMA 2PJ4A 3CXPA 3D3SA 1H8LA 1ARMA 3TFYA 3H5ZA 1IU8A 4P4EA 3FIXA 3IU2A 1M4LA 2OZUA 4A95A 2R98A 4PPZA 2F8HA 4R57A 1YW6A 5KTAA 1IICA 3K2KA 4OLLA 2EO8A 3WT4A 3BJ8A 4B5PB 4DUKA 1PCAA 5I4MA 2AFUA 2HUZA 3SJFA 3H4QA 1QQ9A 4O23A 3V7ZA 4B12A 4H2KA 3DGVA 3BI1A 4FUUA 4H6UA 1YR0A 1YQEA 4MY0A 4ZBGA 1DE4C 4GS4A 3PB8X 2ZW6A 5KTCA 5JGFA 4JXRA 4KSIA 4MHPA 2VZYA 4M6IA 4EVYA 4F9UA 3OWCA 2JEVA 4NGMA 2FL4A 3PB9X 4LUAA 4KOXA 2ZENA 3KASA 5H84A 5CBMA 1F2PA 1LCPA 1SQHA 3PFEA 4GXHA 2IJZA 4HNXB 5AG4A 1XRYA 3IJ3A 3GIUA 2O28A 4MCQA 1HDUA 4MCSA 3SXOA 3TC8A 1Y7EA 1OZPA 4MFJA 4PXCA 4B14A 2GANA 2BUEA 4FD6A 2NMTA 3PBBA 3JRUA 4B5PA 1M4IA 3KKWA 5LYIA 1ZG7A 2Z3NA 5JQ4A 3WC7A 1M4DA 4M85A 1CJWA 4KORA 5A28A 3W91A 5IX3A 3TCVA 4UIBA 1FT7A 4A94A 3F0AA 1RTQA 3IFEA 2ZELA 2PDOA 3FB3A 5CNPA 5CPAA 4YGOA 4FD4A 3SJGA 3R96A 3WR7A 1NSAA 3GY9A 2EUIA 1S7FA 4A38A 1MJBA 1ZLHA 1NMTA 2VQYA 4QVTA 2CXAA 4CGNA 2B5GA 2JLMA 2IL4A 1CG2A 4PQAA 3VWDA 1YGHA 2VZZA 2Z10A 3DR8A 5I0CA 2OOTA 3LMSA 4NGPA 5BWAB 4R87A 1TKJA 4A33A 3KZWA 5IV0A 2OZHA 2C6GA 3T8WA 5C82A 4XPLA 1IYLA 5H86A 1Y0RA 4CGLA 3R9FA 3E0KA 4KLVA 4DNCA 4OC0A 4ZI6A 4UEZA 5JPHA 3LD2A 3V8IA 4BMHA 1OBRA 2YNCC 2B4DA 4P4DA 4RI1A 4XPDC 5D29A 1CP6A 3D7GA 2PE3A 3PEIA 3TO6A 3IIBA 1TF8A 4M3SA 1ZLIA 3QAHA 4M6GA 3MRUA 2CY2A 4F0YA 4F8ZA 3MGDA 4X5KA 1WK4A 2NSMA 4CPAA 4MCRA 4R76A 1ELLP 2FE7A 2VL1A 3DSBA 4JD6A 4UFVA 4A32A 1Z4EA 4UWJA 4P10A 1EE3P 2BL1A 3GLJA 2YNDA 3N7ZA 3FH4A 1R43A 2ZW7A 3FVLA 2Z3PA
chains in the Genus database with same CATH topology
4U9ZA 4MFLA 2OU2A 4C68A 4Y49C 4UA3A 4C2XA 3G8WA 4RS2A 2Q4VA 3P2FA 2HV2A 3R1KA 3I9SA 4UFXA 3S6GA 3T90A 3VWEA 2WPWA 2PR8A 4U9YA 3S6KA 4PV6A 3FYNA 1NE9A 5FVJA 1P0HA 2ATRA 3F5BA 4XPDB 3TTHA 1S5KA 4L8AA 4KZTA 3C26A 3F8KA 1Y9WA 2GE3A 3CXSA 3T9YA 5AG5A 4NSQA 2H5MA 2J8RA 3IU1A 5F49A 1MJ9A 1PU9A 2PC1A 2K5TA 2VXKA 5G21A 3DDDA 4HNWB 5DWNA 3EY5A 1Q2DA 1MK4A 4CYQA 4ONUA 1YREA 4CS0B 2ZW4A 1Z9UA 1KUYA 2QIRA 1QSRA 3R95A 5GCNA 5G22A 5IB0A 1FY7A 2OZGA 5ISVA 2KCWA 3EXNA 2FIWA 4XNHC 4MFQA 2B5GB 2Y0MA 4L89A 4R3KA 4UCMA 4LX9A 1M44A 4YFJA 3ZJ0A 2FCKA 1VKCA 3S6HA 2HQYA 5HH1A 3D8PA 2FIAA 3SHPA 4CGMA 4KOTA 5AGEA 3JVNA 3D2PA 3G3SA 2PRBA 2J8NA 3B8GA 1BOBA 1J4JA 4KUAA 2Z0ZA 5EC4A 4Q38A 1IIDA 1S7KA 2BEIA 3PZJA 4J3GA 4C2YA 4CYPA 3A9LA 5C88A 2D4OA 4IUSA 4C7IA 1S7NA 4ORFA 4FD7A 4IF5A 4C2ZA 1NSLA 4KOWA 4KLWA 4CAWA 2QMLA 1XEBA 3BJ7A 2VBQA 4QC6A 2I79A 2Q7BA 1B6BA 3FBUA 4HNYB 4AVAA 4PSXA 2YNCA 4QBJA 2FS5A 1YX0A 2Q0YA 3JTKA 4F0XA 4AB7A 2P6GA 1B87A 2X7BA 4OAEA 2JDCA 3W6XA 1N71A 4A30A 1KZFA 2P6EA 4NF1A 2R8VA 3W6SA 2WPXA 2F5IA 2Z3OA 5HMNA 3SXNA 1QSTA 3DR6A 2VI7A 2CNSA 2ZXVA 3GKRA 1XF8A 1YVOA 2DPSA 5G20A 3TO7A 1Y7RA 3IWGA 2WUUA 2G3AA 1U6MA 2PQ8A 4JWPA 1Q2YA 1L0CA 1S3ZA 4I49A 4AG9A 1QSNA 4ZGYB 2B3VA 1CM0A 3TO9A 4U5YA 2CNTA 3CXQA 1K4JA 4AG7A 4KOUA 2Z3KA 5AG7A 3S6FA 1LRZA 3EC4A 4JLYA 4MFPA 2FT0A 3TOAA 4KUBA 4R3LA 1I1DA 3IGRA 4CYNA 4II9A 3D2MA 4PK2A 3R9FA 3K9UA 1ON0A 3BLNA 1KUXA 2R7HA 3RYOA 3JUWA 5E96A 1VHSA 4PK3A 2J8MA 4A2ZA 1I21A 3GYAA 1V0CA 3PGPA 4XNHB 1Z4RA 2D4PA 4JJXA 4UFWA 2PSWA 4UCPA 2R1IA 4KOYA 1S60A 2AJ6A 2B58A 2DPTA 4CRYB 3TT2A 2ARHA 3DNSA 1QSOA 1ZO0A 2YGWA 4KVOE 4MY3A 1GHEA 1S7LA 3I3GA 2YNEA 4KS9A 2Q4YA 3TE4A 2Z3LA 2GIVA 4KSAA 4B11A 5J8CA 1XIXA 4XPKA 2QECA 2A4NA 4B5OA 4E0AA 4OADA 2B3UA 4MHDA 3FXTA 1YLEA 4B13A 1RXTA 5KTDA 4NCZA 5A27A 4CYOA 4H6ZA 4NEXA 1IYKA 2P6FA 4KOVA 1IB1E 1R57A 1P4NA 4CGOA 3QB8A 4HKFA 4KVME 4NXYA 2PR1A 3UY5A 4YRHA 4JXQA 1YK3A 4KOSA 4FD5A 2Q04A 5F47A 4E8OA 5J8FA 4CRZB 1Q2CA 1Y9KA 3EO4A 4KVXA 2FSRA 1UFHA 5G1ZA 4QB9A 3LODA 4CAFA 4Y49B 2WSAA 4MFKA 4A31A 4B10A 1PUAA 4UWIA 2DXQA 1XMTA 3NE7A 4QUSA 4K30A 4PSWA 4BBHA 2G0BA 2OH1A 2REFA 4CGPA 4Q36A 1BO4A 2B4BA 2RC4A 5EBVA 2P0WA 3ZZIA 2CNMA 4MJ8A 2Q44A 1M1DA 3R9EA 4MBUA 4AVBA 3FNCA 2JDDA 3FRMA 5AG6A 5DWMA 2G3TA 2ZW5A 2B4DB 2FXFA 3EFAA 5F48A 4AVCA 2REEA 4KSFA 2EVNA 1MJAA 1XE4A 3PP9A 1WWZA 1KUVA 1QSMA 5F46A 2OB0A 2BSWA 4F6AA 2ZPAA 4MI4A 4H89A 3R9GA 2C27A 4UCNA 1I12A 3IWEA 1YVKA 4CAEA 4UBRA 3P2HA 3TOBA 1TIQA 4E2AA 2I00A 1RO5A 4R9MA 2Z11A 4CAXA 2VEZA 4C7HA 1M4GA 4MFZA 2Z3MA 2AE6A 4CAVA 3CXPA 3D3SA 3TFYA 3H5ZA 3FIXA 3IU2A 4A95A 2OZUA 2R98A 4R57A 5KTAA 1IICA 4OLLA 4B5PB 3BJ8A 2HUZA 3H4QA 4B12A 4H6UA 1YR0A 4MY0A 4ZBGA 4GS4A 2ZW6A 5KTCA 4JXRA 2VZYA 4EVYA 3OWCA 2JEVA 2FL4A 4LUAA 5H84A 4KOXA 1SQHA 4HNXB 5AG4A 2O28A 3SXOA 1OZPA 4MFJA 4B14A 2GANA 2BUEA 4FD6A 2NMTA 4B5PA 1M4IA 3KKWA 2Z3NA 5JQ4A 1M4DA 4M85A 1CJWA 4KORA 5A28A 3W91A 5IX3A 3TCVA 3F0AA 4YGOA 2PDOA 3FB3A 5CNPA 4FD4A 3R96A 3WR7A 3GY9A 2EUIA 1S7FA 1MJBA 2VQYA 1NMTA 4QVTA 2CXAA 4CGNA 2B5GA 2JLMA 2IL4A 3VWDA 1YGHA 2VZZA 2Z10A 3DR8A 5I0CA 5BWAB 4R87A 4A33A 5IV0A 2OZHA 5C82A 4XPLA 1IYLA 5H86A 4CGLA 3E0KA 4KLVA 4DNCA 5JPHA 3LD2A 3V8IA 4BMHA 2YNCC 2B4DA 4RI1A 4XPDC 3TO6A 4M3SA 3QAHA 2CY2A 4F0YA 3MGDA 4X5KA 1WK4A 2FE7A 4JD6A 3DSBA 4UFVA 4A32A 1Z4EA 4UWJA 2BL1A 2YNDA 3N7ZA 2ZW7A 2Z3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9Z A;  2OU2 A;  4Y49 C;  4UA3 A;  3G8W A;  4RS2 A;  2Q4V A;  3P2F A;  2HV2 A;  3R1K A;  3I9S A;  3S6G A;  3T90 A;  3VWE A;  2WPW A;  2PR8 A;  4U9Y A;  3S6K A;  4PV6 A;  3FYN A;  1NE9 A;  5FVJ A;  1P0H A;  2ATR A;  3F5B A;  4XPD B;  3TTH A;  1S5K A;  4L8A A;  4KZT A;  3C26 A;  3F8K A;  1Y9W A;  2GE3 A;  3CXS A;  3T9Y A;  4NSQ A;  2H5M A;  2J8R A;  5F49 A;  1MJ9 A;  1PU9 A;  2PC1 A;  2K5T A;  2VXK A;  3DDD A;  4HNW B;  5DWN A;  3EY5 A;  1Q2D A;  1MK4 A;  4ONU A;  1YRE A;  4CS0 B;  2ZW4 A;  1Z9U A;  1KUY A;  2QIR A;  1QSR A;  3R95 A;  5GCN A;  5IB0 A;  1FY7 A;  2OZG A;  5ISV A;  2KCW A;  3EXN A;  2FIW A;  4XNH C;  2B5G B;  2Y0M A;  4L89 A;  4R3K A;  4LX9 A;  1M44 A;  4YFJ A;  3ZJ0 A;  2FCK A;  1VKC A;  3S6H A;  2HQY A;  5HH1 A;  3D8P A;  2FIA A;  3SHP A;  4KOT A;  3JVN A;  3D2P A;  3G3S A;  2PRB A;  2J8N A;  3B8G A;  1BOB A;  1J4J A;  4KUA A;  2Z0Z A;  5EC4 A;  1IID A;  1S7K A;  2BEI A;  3PZJ A;  4J3G A;  5C88 A;  2D4O A;  4IUS A;  1S7N A;  4ORF A;  4FD7 A;  4IF5 A;  1NSL A;  4KOW A;  4KLW A;  4CAW A;  2QML A;  1XEB A;  3BJ7 A;  2VBQ A;  4QC6 A;  2I79 A;  2Q7B A;  1B6B A;  3FBU A;  4HNY B;  4AVA A;  4PSX A;  4QBJ A;  2FS5 A;  1YX0 A;  2Q0Y A;  4AB7 A;  2P6G A;  1B87 A;  2X7B A;  4OAE A;  2JDC A;  3W6X A;  1N71 A;  1KZF A;  2P6E A;  4NF1 A;  2R8V A;  3W6S A;  2WPX A;  2F5I A;  5HMN A;  3SXN A;  1QST A;  3DR6 A;  2VI7 A;  2CNS A;  2ZXV A;  3GKR A;  1XF8 A;  1YVO A;  3TO7 A;  1Y7R A;  3IWG A;  2G3A A;  1U6M A;  2PQ8 A;  4JWP A;  1Q2Y A;  1L0C A;  1S3Z A;  4I49 A;  4AG9 A;  1QSN A;  2B3V A;  1CM0 A;  3TO9 A;  4U5Y A;  2CNT A;  3CXQ A;  1K4J A;  4AG7 A;  4KOU A;  3S6F A;  1LRZ A;  3EC4 A;  4JLY A;  2FT0 A;  3TOA A;  4KUB A;  4R3L A;  1I1D A;  3IGR A;  4II9 A;  3D2M A;  4PK2 A;  3R9F A;  3K9U A;  1ON0 A;  3BLN A;  1KUX A;  2R7H A;  3RYO A;  3JUW A;  5E96 A;  1VHS A;  4PK3 A;  2J8M A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  1Z4R A;  2D4P A;  4JJX A;  2PSW A;  2R1I A;  4KOY A;  1S60 A;  2AJ6 A;  2B58 A;  4CRY B;  3TT2 A;  2ARH A;  3DNS A;  1QSO A;  4KVO E;  4MY3 A;  1GHE A;  1S7L A;  3I3G A;  2Q4Y A;  3TE4 A;  2GIV A;  5J8C A;  1XIX A;  4XPK A;  2QEC A;  2A4N A;  4B5O A;  4E0A A;  4OAD A;  2B3U A;  4MHD A;  3FXT A;  1YLE A;  5KTD A;  1RXT A;  4NCZ A;  4H6Z A;  4NEX A;  1IYK A;  2P6F A;  4KOV A;  1IB1 E;  1R57 A;  1P4N A;  3QB8 A;  4HKF A;  4KVM E;  4NXY A;  2PR1 A;  3UY5 A;  4YRH A;  4JXQ A;  1YK3 A;  4KOS A;  4FD5 A;  2Q04 A;  5F47 A;  4E8O A;  5J8F A;  4CRZ B;  1Q2C A;  1Y9K A;  3EO4 A;  4KVX A;  2FSR A;  1UFH A;  4QB9 A;  3LOD A;  4Y49 B;  1PUA A;  4UWI A;  2DXQ A;  1XMT A;  3NE7 A;  4QUS A;  4K30 A;  4PSW A;  2G0B A;  2OH1 A;  2REF A;  1BO4 A;  2B4B A;  2RC4 A;  5EBV A;  2P0W A;  3ZZI A;  2CNM A;  4MJ8 A;  2Q44 A;  1M1D A;  3R9E A;  4MBU A;  4AVB A;  3FNC A;  2JDD A;  3FRM A;  5DWM A;  2G3T A;  2ZW5 A;  2B4D B;  2FXF A;  3EFA A;  5F48 A;  4AVC A;  2REE A;  2EVN A;  1MJA A;  1XE4 A;  3PP9 A;  1WWZ A;  1KUV A;  1QSM A;  5F46 A;  2OB0 A;  2BSW A;  4F6A A;  2ZPA A;  4MI4 A;  4H89 A;  3R9G A;  2C27 A;  1I12 A;  1YVK A;  4UBR A;  3P2H A;  3TOB A;  1TIQ A;  4E2A A;  2I00 A;  1RO5 A;  4R9M A;  2Z11 A;  4CAX A;  2VEZ A;  1M4G A;  2AE6 A;  4CAV A;  3CXP A;  3D3S A;  3TFY A;  3FIX A;  2OZU A;  2R98 A;  4R57 A;  5KTA A;  1IIC A;  4OLL A;  4B5P B;  3BJ8 A;  2HUZ A;  3H4Q A;  4H6U A;  1YR0 A;  4MY0 A;  4ZBG A;  4GS4 A;  2ZW6 A;  5KTC A;  4JXR A;  2VZY A;  4EVY A;  3OWC A;  2JEV A;  2FL4 A;  4LUA A;  5H84 A;  4KOX A;  1SQH A;  4HNX B;  2O28 A;  3SXO A;  1OZP A;  2GAN A;  2BUE A;  4FD6 A;  2NMT A;  4B5P A;  1M4I A;  3KKW A;  5JQ4 A;  1M4D A;  4M85 A;  1CJW A;  4KOR A;  3W91 A;  5IX3 A;  3TCV A;  3F0A A;  4YGO A;  2PDO A;  3FB3 A;  5CNP A;  4FD4 A;  3R96 A;  3WR7 A;  3GY9 A;  2EUI A;  1S7F A;  1MJB A;  2VQY A;  1NMT A;  4QVT A;  2B5G A;  2JLM A;  2IL4 A;  3VWD A;  1YGH A;  2VZZ A;  2Z10 A;  3DR8 A;  5I0C A;  4R87 A;  5IV0 A;  2OZH A;  5C82 A;  4XPL A;  1IYL A;  5H86 A;  3E0K A;  4KLV A;  4DNC A;  5JPH A;  3LD2 A;  3V8I A;  4BMH A;  2B4D A;  4RI1 A;  4XPD C;  3TO6 A;  4M3S A;  3QAH A;  2CY2 A;  4F0Y A;  3MGD A;  4X5K A;  1WK4 A;  2FE7 A;  4JD6 A;  3DSB A;  1Z4E A;  4UWJ A;  2BL1 A;  3N7Z A;  2ZW7 A; 
#chains in the Genus database with same CATH topology
 1QMU A;  4U9Z A;  5J1Q A;  4RN7 A;  4F9V A;  4MFL A;  5JM6 A;  2OU2 A;  4C68 A;  2PJC A;  2EWB A;  2PJ7 A;  3NFZ A;  4Y49 C;  1CP7 A;  2V77 A;  2ZEP A;  4NGT A;  3FED A;  2V8H A;  4UA3 A;  3KQX A;  4C2X A;  1XOV A;  2PIZ A;  3G8W A;  2Q4V A;  4RS2 A;  1BPM A;  2HV2 A;  3P2F A;  3R1K A;  3I9S A;  4UFX A;  1HDQ A;  3S6G A;  3T90 A;  2V8V A;  2AFX A;  5LRJ A;  4TWE A;  3VWE A;  2WPW A;  2PR8 A;  4U9Y A;  4UEF A;  3S6K A;  4LQ6 A;  4PV6 A;  4RUH A;  4R8F A;  3FYN A;  2AFM A;  1NE9 A;  2GLF A;  5FVJ A;  8CPA A;  1P0H A;  5K8N A;  2ATR A;  1Z5R A;  3D4U A;  3F5B A;  2PJ1 A;  1BLL E;  2AFZ A;  3H8G A;  1S5K A;  4L8A A;  4XPD B;  3TTH A;  4MRI A;  5LYL A;  4KZT A;  5EMI A;  3C26 A;  1Q7L A;  3F8K A;  3RO0 A;  4R7M A;  1Y9W A;  2RB7 A;  4EME A;  2GE3 A;  4B6Z A;  2Q43 A;  4OKO A;  2AFS A;  4YWY A;  3CXS A;  3KQZ A;  4MMO A;  3D66 A;  1VHO A;  3T9Y A;  2Q51 A;  4MHY A;  4X2T A;  3CDX A;  4NSQ A;  5AG5 A;  2H5M A;  2J8R A;  3IU1 A;  5F49 A;  4A39 A;  1MJ9 A;  1PU9 A;  2PC1 A;  2K5T A;  2VXK A;  4JYW A;  5G21 A;  2PRQ A;  4NGS A;  4P44 A;  3DDD A;  4HNW B;  5DWN A;  2JEW A;  3EY5 A;  3FF3 A;  4UIA A;  1Q2D A;  1MK4 A;  3SI1 A;  4CYQ A;  4ONU A;  1YRE A;  4CS0 B;  3FEC A;  2FVG A;  2ZW4 A;  1Z9U A;  3I1U A;  3B3V A;  2NYQ A;  1Z8T A;  3PB7 X;  1KUY A;  2QIR A;  5LYF A;  1QSR A;  3R95 A;  5GCN A;  5G22 A;  5IB0 A;  2Q7S A;  1FY7 A;  2OZG A;  2HC9 A;  2DEA A;  5ISV A;  4MXU A;  3HLP A;  4AXV A;  2KCW A;  3EXN A;  1BPN A;  3D68 A;  2FIW A;  4XNH C;  4MFQ A;  2B5G B;  5LRG A;  2Y0M A;  4L89 A;  3D7F A;  1TKH A;  4R3K A;  3TX8 A;  3SJE A;  3N5F A;  4OC4 A;  4UCM A;  4LX9 A;  1M44 A;  2EK8 A;  4YFJ A;  3ZJ0 A;  2DF5 A;  3B3T A;  2XEF A;  3VH9 A;  2FCK A;  4OP4 A;  4IK2 A;  1VKC A;  3S6H A;  2HQY A;  3FJU A;  1Z8X A;  2PJ8 A;  5HH1 A;  3D8P A;  2CTB A;  3FEE A;  2FIA A;  3BI0 A;  5LYD A;  4NGR A;  4OIW A;  3S9M A;  3SHP A;  4CGM A;  1Z2L A;  4KOT A;  5AGE A;  3JVN A;  3D2P A;  2QVP A;  3G3S A;  2GRE A;  1VGY A;  2J8N A;  2PRB A;  1TXR A;  3B8G A;  1BOB A;  1J4J A;  4KUA A;  2Z0Z A;  3B3W A;  2XEI A;  5EC4 A;  4Q38 A;  1IID A;  1S7K A;  2BEI A;  1BAV A;  1KWM A;  1Z8L A;  3PZJ A;  3L2N A;  3PBE A;  3B35 A;  4J3G A;  4OC2 A;  4C2Y A;  2BO9 A;  2WYR A;  1IOI A;  1AUG A;  4CYP A;  3A9L A;  3B3C A;  2J9A A;  3B2Y A;  5C88 A;  2D4O A;  4IUS A;  5HXD A;  2C6C A;  4C7I A;  2ZED A;  1S7N A;  4ORF A;  5LRK A;  5HVG A;  1CPX A;  1ZG9 A;  4FD7 A;  4IF5 A;  1AYE A;  4C2Z A;  1NSL A;  4KOW A;  5DS0 A;  2V8G A;  4Z65 A;  4KLW A;  4DJL A;  4UEE A;  2QML A;  1XEB A;  3BJ7 A;  4CAW A;  2VBQ A;  3IO1 A;  4QC6 A;  3PB4 X;  4X3R A;  2I79 A;  1X10 A;  3KHZ A;  1A2Z A;  2Q7B A;  1B6B A;  3FBU A;  2PJ3 A;  4HNY B;  4AVA A;  2AFO A;  1IOF A;  1YME A;  4PSX A;  2YNC A;  4QBJ A;  2QJ8 A;  2FS5 A;  1F57 A;  1YX0 A;  2Q0Y A;  3JTK A;  6CPA A;  2IQ6 A;  4F0X A;  4AB7 A;  2P6G A;  4EFD A;  1B87 A;  3S9N A;  4G1P A;  2JBJ A;  2ZOF A;  2X7B A;  4OAE A;  1Z8W A;  2JDC A;  3W6X A;  1N71 A;  4A30 A;  1KZF A;  4P4I A;  2P6E A;  4BIN A;  4NF1 A;  1Y0Y A;  5HVH A;  2R8V A;  5F09 A;  4WWV A;  3W6S A;  2WPX A;  2F5I A;  4UF4 A;  2GU2 A;  4NJQ A;  2Z3O A;  3NH8 A;  5HMN A;  3SXN A;  2ZEH A;  1QST A;  2CIJ A;  3DR6 A;  2VI7 A;  3ISX A;  3H8F A;  2CNS A;  4K3N A;  2ZXV A;  4MCP A;  3GKR A;  1XF8 A;  1LFW A;  1YSJ A;  4P4B A;  1YVO A;  2DPS A;  4W9Y A;  5G20 A;  3D67 A;  1Y7R A;  3TO7 A;  3IWG A;  2PJ0 A;  1XBU A;  2G3A A;  1U6M A;  2WUU A;  2PQ8 A;  3KL9 A;  4PXE A;  1Q2Y A;  3CPX A;  1L0C A;  1DTD A;  1S3Z A;  4I49 A;  4JWP A;  4AG9 A;  1QSN A;  4TNU A;  4ZGY B;  2B3V A;  4ZY0 A;  1CM0 A;  3TO9 A;  4U5Y A;  2CNT A;  5IB9 A;  3CXQ A;  1K4J A;  2POK A;  2C1C A;  4GM5 A;  2AFW A;  1XMB A;  3LAC A;  2RFH A;  1IY7 A;  4AG7 A;  2XEG A;  4KOU A;  3WC6 A;  2Z3K A;  5AG7 A;  3PFO A;  4JZ0 A;  3S6F A;  4ZYQ A;  1LRZ A;  3EC4 A;  4JLY A;  2O4H A;  4MFP A;  2FT0 A;  4OME A;  3TOA A;  4NFR A;  4KUB A;  1CPS A;  2C6P A;  4R3L A;  1I1D A;  3IGR A;  3D7H A;  4BD9 A;  4CYN A;  4II9 A;  3D2M A;  2PJ5 A;  4PK2 A;  3K9U A;  1ON0 A;  2PIY A;  1YLO A;  3BLN A;  3IC1 A;  3QAY A;  1KUX A;  4FWU A;  5THW A;  4DYO A;  1JQG A;  2R7H A;  3RYO A;  3JUW A;  4OC3 A;  5E96 A;  1VHS A;  3KI9 A;  4R6T A;  4PK3 A;  2IMO A;  2J8M A;  4X8I A;  4A2Z A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  1Z4R A;  4P4J A;  2ZEG A;  3HUV A;  2D4P A;  3PB6 X;  4JJX A;  4UFW A;  2PSW A;  4UCP A;  5HVF A;  2R1I A;  4KOY A;  1S60 A;  1XFO A;  4FAI A;  2O53 A;  1XJO A;  2AJ6 A;  3WAB A;  2B58 A;  2JBK A;  2DPT A;  3B3S A;  4CRY B;  3TT2 A;  2ARH A;  3DNS A;  3QNV A;  3CZX A;  1QSO A;  4ZY1 A;  1ZO0 A;  2YGW A;  3ISZ A;  4PXD A;  4KVO E;  4MY3 A;  1FNO A;  1AMP A;  4WJB A;  1GHE A;  1S7L A;  3GB0 A;  3DLJ A;  4NGN A;  4ZX9 A;  3B7I A;  3I3G A;  2PJ2 A;  2PJB A;  3S9L A;  2YNE A;  4KS9 A;  2BCO A;  1ZG8 A;  2Q4Y A;  3TE4 A;  2GFQ A;  2V8D A;  2GIV A;  2Z3L A;  4KSA A;  4B11 A;  2OR4 A;  5J8C A;  1XIX A;  1YW4 A;  2QEC A;  4XPK A;  2A4N A;  3KHX A;  4M6H A;  1VIX A;  1JWQ A;  3RBU A;  4B5O A;  4E0A A;  4OAD A;  2B3U A;  3VAT A;  4MHD A;  1TF9 A;  3FXT A;  4PXB A;  3CPA A;  1YLE A;  4NGQ A;  1RXT A;  3VAR A;  4B13 A;  5KTD A;  4NCZ A;  2PVW A;  5A27 A;  4CYO A;  2PJA A;  4H6Z A;  3IWW A;  4HPS A;  4NEX A;  1IYK A;  1LAP A;  3KR5 A;  2P6F A;  1IB1 E;  1F2O A;  1R57 A;  1P4N A;  4KOV A;  4CGO A;  3QB8 A;  3CT9 A;  4HKF A;  4KVM E;  4NXY A;  5K8P A;  2PR1 A;  2PJ6 A;  2Q4Z A;  4Q7A A;  3UY5 A;  4YRH A;  4IHM A;  4JXQ A;  1YK3 A;  3FX6 A;  4KOS A;  5ELY A;  4FD5 A;  2Q04 A;  5F47 A;  2BOA A;  4E8O A;  1ELM P;  5J8F A;  4CRZ B;  1Q2C A;  1Y9K A;  3V38 A;  3EO4 A;  4KVX A;  2FSR A;  1UFH A;  4MHN A;  5G1Z A;  4QB9 A;  3LOD A;  4CAF A;  4Y49 B;  2WSA A;  4MFK A;  4A31 A;  4B10 A;  1PUA A;  2ZEF A;  4IAV A;  3D7D A;  1GYT A;  4UWI A;  2DXQ A;  2QYV A;  1XMT A;  3LWU A;  3RAM A;  3NE7 A;  2HB6 A;  3GUX A;  3PRT A;  4ONW A;  4QUS A;  2ZEM A;  2G9D A;  4K30 A;  4PSW A;  4BBH A;  1PYT B;  2G0B A;  4P4F A;  5K8M A;  2WZN A;  2OH1 A;  2REF A;  4CGP A;  2ABZ A;  1IGB A;  1CBX A;  3MN8 A;  5JH9 A;  3BHX A;  1TKF A;  4Q36 A;  1BO4 A;  2ANP A;  2B4B A;  3K9T A;  1LAN A;  2RC4 A;  5EBV A;  2P0W A;  1R3N A;  4P45 A;  1UWY A;  2CNM A;  3ZZI A;  1X12 A;  4MJ8 A;  2CF4 A;  2ZOG A;  4ZY2 A;  1HEE A;  2Q44 A;  1M1D A;  3R9E A;  1VHE A;  4MBU A;  3NH5 A;  3SI2 A;  4AVB A;  3FNC A;  5D8N A;  2JDD A;  3FRM A;  5AG6 A;  5DWM A;  2ZEO A;  2G3T A;  2ZW5 A;  2B4D B;  2FXF A;  3EFA A;  3KGQ A;  5F48 A;  4AVC A;  5K8O A;  2REE A;  2EK9 A;  4KSF A;  2EVN A;  4A37 A;  3NH4 A;  1MJA A;  1XE4 A;  2PJ9 A;  3NA6 A;  3PP9 A;  4OC5 A;  1WWZ A;  3FMC A;  4EWT A;  1KUV A;  3RZA A;  1QSM A;  3IEH A;  2OB0 A;  3NE8 A;  2BSW A;  4P6Y A;  4F6A A;  5F46 A;  2ZPA A;  2ODF A;  4MI4 A;  1CX8 A;  4H89 A;  3H8E A;  3BXM A;  4OID A;  2GLJ A;  2ZEE A;  3R9G A;  7CPA A;  2C27 A;  3SJX A;  1ARL A;  4NJR A;  3RNZ A;  3WC5 A;  4UCN A;  1I12 A;  3IWE A;  1YVK A;  2I3C A;  4CAE A;  4UBR A;  3P2H A;  1LOK A;  3TOB A;  4FBE A;  1TIQ A;  2CTC A;  2F7V A;  4E2A A;  4MHZ A;  2I00 A;  1RO5 A;  2EBJ A;  4LQG A;  4R9M A;  2Z11 A;  4CAX A;  4YU9 A;  2XEJ A;  2PVV A;  3KR4 A;  4ZX8 A;  3SI0 A;  2VEZ A;  4OC1 A;  4C7H A;  1M4G A;  4MFZ A;  2PCU A;  2Z3M A;  2AE6 A;  4CAV A;  1LAM A;  2PJ4 A;  3CXP A;  3D3S A;  1H8L A;  1ARM A;  3TFY A;  3H5Z A;  1IU8 A;  4P4E A;  3FIX A;  3IU2 A;  1M4L A;  2OZU A;  4A95 A;  2R98 A;  4PPZ A;  2F8H A;  4R57 A;  1YW6 A;  5KTA A;  1IIC A;  3K2K A;  4OLL A;  2EO8 A;  3WT4 A;  3BJ8 A;  4B5P B;  4DUK A;  1PCA A;  5I4M A;  2AFU A;  2HUZ A;  3SJF A;  3H4Q A;  1QQ9 A;  4O23 A;  3V7Z A;  4B12 A;  4H2K A;  3DGV A;  3BI1 A;  4FUU A;  4H6U A;  1YR0 A;  1YQE A;  4MY0 A;  4ZBG A;  1DE4 C;  4GS4 A;  3PB8 X;  2ZW6 A;  5KTC A;  5JGF A;  4JXR A;  4KSI A;  4MHP A;  2VZY A;  4M6I A;  4EVY A;  4F9U A;  3OWC A;  2JEV A;  4NGM A;  2FL4 A;  3PB9 X;  4LUA A;  4KOX A;  2ZEN A;  3KAS A;  5H84 A;  5CBM A;  1F2P A;  1LCP A;  1SQH A;  3PFE A;  4GXH A;  2IJZ A;  4HNX B;  5AG4 A;  1XRY A;  3IJ3 A;  3GIU A;  2O28 A;  4MCQ A;  1HDU A;  4MCS A;  3SXO A;  3TC8 A;  1Y7E A;  1OZP A;  4MFJ A;  4PXC A;  4B14 A;  2GAN A;  2BUE A;  4FD6 A;  2NMT A;  3PBB A;  3JRU A;  4B5P A;  1M4I A;  3KKW A;  5LYI A;  1ZG7 A;  2Z3N A;  5JQ4 A;  3WC7 A;  1M4D A;  4M85 A;  1CJW A;  4KOR A;  5A28 A;  3W91 A;  5IX3 A;  3TCV A;  4UIB A;  1FT7 A;  4A94 A;  3F0A A;  1RTQ A;  3IFE A;  2ZEL A;  2PDO A;  3FB3 A;  5CNP A;  5CPA A;  4YGO A;  4FD4 A;  3SJG A;  3R96 A;  3WR7 A;  1NSA A;  3GY9 A;  2EUI A;  1S7F A;  4A38 A;  1MJB A;  1ZLH A;  1NMT A;  2VQY A;  4QVT A;  2CXA A;  4CGN A;  2B5G A;  2JLM A;  2IL4 A;  1CG2 A;  4PQA A;  3VWD A;  1YGH A;  2VZZ A;  2Z10 A;  3DR8 A;  5I0C A;  2OOT A;  3LMS A;  4NGP A;  5BWA B;  4R87 A;  1TKJ A;  4A33 A;  3KZW A;  5IV0 A;  2OZH A;  2C6G A;  3T8W A;  5C82 A;  4XPL A;  1IYL A;  5H86 A;  1Y0R A;  4CGL A;  3R9F A;  3E0K A;  4KLV A;  4DNC A;  4OC0 A;  4ZI6 A;  4UEZ A;  5JPH A;  3LD2 A;  3V8I A;  4BMH A;  1OBR A;  2YNC C;  2B4D A;  4P4D A;  4RI1 A;  4XPD C;  5D29 A;  1CP6 A;  3D7G A;  2PE3 A;  3PEI A;  3TO6 A;  3IIB A;  1TF8 A;  4M3S A;  1ZLI A;  3QAH A;  4M6G A;  3MRU A;  2CY2 A;  4F0Y A;  4F8Z A;  3MGD A;  4X5K A;  1WK4 A;  2NSM A;  4CPA A;  4MCR A;  4R76 A;  1ELL P;  2FE7 A;  2VL1 A;  3DSB A;  4JD6 A;  4UFV A;  4A32 A;  1Z4E A;  4UWJ A;  4P10 A;  1EE3 P;  2BL1 A;  3GLJ A;  2YND A;  3N7Z A;  3FH4 A;  1R43 A;  2ZW7 A;  3FVL A;  2Z3P A; 
#chains in the Genus database with same CATH homology
 4U9Z A;  4MFL A;  2OU2 A;  4C68 A;  4Y49 C;  4UA3 A;  4C2X A;  3G8W A;  4RS2 A;  2Q4V A;  3P2F A;  2HV2 A;  3R1K A;  3I9S A;  4UFX A;  3S6G A;  3T90 A;  3VWE A;  2WPW A;  2PR8 A;  4U9Y A;  3S6K A;  4PV6 A;  3FYN A;  1NE9 A;  5FVJ A;  1P0H A;  2ATR A;  3F5B A;  4XPD B;  3TTH A;  1S5K A;  4L8A A;  4KZT A;  3C26 A;  3F8K A;  1Y9W A;  2GE3 A;  3CXS A;  3T9Y A;  5AG5 A;  4NSQ A;  2H5M A;  2J8R A;  3IU1 A;  5F49 A;  1MJ9 A;  1PU9 A;  2PC1 A;  2K5T A;  2VXK A;  5G21 A;  3DDD A;  4HNW B;  5DWN A;  3EY5 A;  1Q2D A;  1MK4 A;  4CYQ A;  4ONU A;  1YRE A;  4CS0 B;  2ZW4 A;  1Z9U A;  1KUY A;  2QIR A;  1QSR A;  3R95 A;  5GCN A;  5G22 A;  5IB0 A;  1FY7 A;  2OZG A;  5ISV A;  2KCW A;  3EXN A;  2FIW A;  4XNH C;  4MFQ A;  2B5G B;  2Y0M A;  4L89 A;  4R3K A;  4UCM A;  4LX9 A;  1M44 A;  4YFJ A;  3ZJ0 A;  2FCK A;  1VKC A;  3S6H A;  2HQY A;  5HH1 A;  3D8P A;  2FIA A;  3SHP A;  4CGM A;  4KOT A;  5AGE A;  3JVN A;  3D2P A;  3G3S A;  2PRB A;  2J8N A;  3B8G A;  1BOB A;  1J4J A;  4KUA A;  2Z0Z A;  5EC4 A;  4Q38 A;  1IID A;  1S7K A;  2BEI A;  3PZJ A;  4J3G A;  4C2Y A;  4CYP A;  3A9L A;  5C88 A;  2D4O A;  4IUS A;  4C7I A;  1S7N A;  4ORF A;  4FD7 A;  4IF5 A;  4C2Z A;  1NSL A;  4KOW A;  4KLW A;  4CAW A;  2QML A;  1XEB A;  3BJ7 A;  2VBQ A;  4QC6 A;  2I79 A;  2Q7B A;  1B6B A;  3FBU A;  4HNY B;  4AVA A;  4PSX A;  2YNC A;  4QBJ A;  2FS5 A;  1YX0 A;  2Q0Y A;  3JTK A;  4F0X A;  4AB7 A;  2P6G A;  1B87 A;  2X7B A;  4OAE A;  2JDC A;  3W6X A;  1N71 A;  4A30 A;  1KZF A;  2P6E A;  4NF1 A;  2R8V A;  3W6S A;  2WPX A;  2F5I A;  2Z3O A;  5HMN A;  3SXN A;  1QST A;  3DR6 A;  2VI7 A;  2CNS A;  2ZXV A;  3GKR A;  1XF8 A;  1YVO A;  2DPS A;  5G20 A;  3TO7 A;  1Y7R A;  3IWG A;  2WUU A;  2G3A A;  1U6M A;  2PQ8 A;  4JWP A;  1Q2Y A;  1L0C A;  1S3Z A;  4I49 A;  4AG9 A;  1QSN A;  4ZGY B;  2B3V A;  1CM0 A;  3TO9 A;  4U5Y A;  2CNT A;  3CXQ A;  1K4J A;  4AG7 A;  4KOU A;  2Z3K A;  5AG7 A;  3S6F A;  1LRZ A;  3EC4 A;  4JLY A;  4MFP A;  2FT0 A;  3TOA A;  4KUB A;  4R3L A;  1I1D A;  3IGR A;  4CYN A;  4II9 A;  3D2M A;  4PK2 A;  3R9F A;  3K9U A;  1ON0 A;  3BLN A;  1KUX A;  2R7H A;  3RYO A;  3JUW A;  5E96 A;  1VHS A;  4PK3 A;  2J8M A;  4A2Z A;  1I21 A;  3GYA A;  1V0C A;  3PGP A;  4XNH B;  1Z4R A;  2D4P A;  4JJX A;  4UFW A;  2PSW A;  4UCP A;  2R1I A;  4KOY A;  1S60 A;  2AJ6 A;  2B58 A;  2DPT A;  4CRY B;  3TT2 A;  2ARH A;  3DNS A;  1QSO A;  1ZO0 A;  2YGW A;  4KVO E;  4MY3 A;  1GHE A;  1S7L A;  3I3G A;  2YNE A;  4KS9 A;  2Q4Y A;  3TE4 A;  2Z3L A;  2GIV A;  4KSA A;  4B11 A;  5J8C A;  1XIX A;  4XPK A;  2QEC A;  2A4N A;  4B5O A;  4E0A A;  4OAD A;  2B3U A;  4MHD A;  3FXT A;  1YLE A;  4B13 A;  1RXT A;  5KTD A;  4NCZ A;  5A27 A;  4CYO A;  4H6Z A;  4NEX A;  1IYK A;  2P6F A;  4KOV A;  1IB1 E;  1R57 A;  1P4N A;  4CGO A;  3QB8 A;  4HKF A;  4KVM E;  4NXY A;  2PR1 A;  3UY5 A;  4YRH A;  4JXQ A;  1YK3 A;  4KOS A;  4FD5 A;  2Q04 A;  5F47 A;  4E8O A;  5J8F A;  4CRZ B;  1Q2C A;  1Y9K A;  3EO4 A;  4KVX A;  2FSR A;  1UFH A;  5G1Z A;  4QB9 A;  3LOD A;  4CAF A;  4Y49 B;  2WSA A;  4MFK A;  4A31 A;  4B10 A;  1PUA A;  4UWI A;  2DXQ A;  1XMT A;  3NE7 A;  4QUS A;  4K30 A;  4PSW A;  4BBH A;  2G0B A;  2OH1 A;  2REF A;  4CGP A;  4Q36 A;  1BO4 A;  2B4B A;  2RC4 A;  5EBV A;  2P0W A;  3ZZI A;  2CNM A;  4MJ8 A;  2Q44 A;  1M1D A;  3R9E A;  4MBU A;  4AVB A;  3FNC A;  2JDD A;  3FRM A;  5AG6 A;  5DWM A;  2G3T A;  2ZW5 A;  2B4D B;  2FXF A;  3EFA A;  5F48 A;  4AVC A;  2REE A;  4KSF A;  2EVN A;  1MJA A;  1XE4 A;  3PP9 A;  1WWZ A;  1KUV A;  1QSM A;  5F46 A;  2OB0 A;  2BSW A;  4F6A A;  2ZPA A;  4MI4 A;  4H89 A;  3R9G A;  2C27 A;  4UCN A;  1I12 A;  3IWE A;  1YVK A;  4CAE A;  4UBR A;  3P2H A;  3TOB A;  1TIQ A;  4E2A A;  2I00 A;  1RO5 A;  4R9M A;  2Z11 A;  4CAX A;  2VEZ A;  4C7H A;  1M4G A;  4MFZ A;  2Z3M A;  2AE6 A;  4CAV A;  3CXP A;  3D3S A;  3TFY A;  3H5Z A;  3FIX A;  3IU2 A;  4A95 A;  2OZU A;  2R98 A;  4R57 A;  5KTA A;  1IIC A;  4OLL A;  4B5P B;  3BJ8 A;  2HUZ A;  3H4Q A;  4B12 A;  4H6U A;  1YR0 A;  4MY0 A;  4ZBG A;  4GS4 A;  2ZW6 A;  5KTC A;  4JXR A;  2VZY A;  4EVY A;  3OWC A;  2JEV A;  2FL4 A;  4LUA A;  5H84 A;  4KOX A;  1SQH A;  4HNX B;  5AG4 A;  2O28 A;  3SXO A;  1OZP A;  4MFJ A;  4B14 A;  2GAN A;  2BUE A;  4FD6 A;  2NMT A;  4B5P A;  1M4I A;  3KKW A;  2Z3N A;  5JQ4 A;  1M4D A;  4M85 A;  1CJW A;  4KOR A;  5A28 A;  3W91 A;  5IX3 A;  3TCV A;  3F0A A;  4YGO A;  2PDO A;  3FB3 A;  5CNP A;  4FD4 A;  3R96 A;  3WR7 A;  3GY9 A;  2EUI A;  1S7F A;  1MJB A;  2VQY A;  1NMT A;  4QVT A;  2CXA A;  4CGN A;  2B5G A;  2JLM A;  2IL4 A;  3VWD A;  1YGH A;  2VZZ A;  2Z10 A;  3DR8 A;  5I0C A;  5BWA B;  4R87 A;  4A33 A;  5IV0 A;  2OZH A;  5C82 A;  4XPL A;  1IYL A;  5H86 A;  4CGL A;  3E0K A;  4KLV A;  4DNC A;  5JPH A;  3LD2 A;  3V8I A;  4BMH A;  2YNC C;  2B4D A;  4RI1 A;  4XPD C;  3TO6 A;  4M3S A;  3QAH A;  2CY2 A;  4F0Y A;  3MGD A;  4X5K A;  1WK4 A;  2FE7 A;  4JD6 A;  3DSB A;  4UFV A;  4A32 A;  1Z4E A;  4UWJ A;  2BL1 A;  2YND A;  3N7Z A;  2ZW7 A;  2Z3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...