4FD4A

Crystal structure of mosquito arylalkylamine n-acetyltransferase like 5b
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
SIVLRVARLDELEQVREILHRIYYPEEGITISYVHGKSHTLDDERFSLSFVEQGTVVVAEDSAAKKFIGVSIAGPIQPGDPDAMVEEAATTETKKWGDILKLLALLERTADVCGRYGLEKAYHVHILAVDPTYRGHSLGQRLLQFQMDLSKKLGFKAISGDFTSVFSVKLAEKLGMECISQLALGDYRDEKGEKLFEPLDVHQVIKTCVKLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arylalkylamine N-Acetyltransferase like 5b
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 74
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd4A00
3C26A 5HMNA 2KCWA 4LX9A 2JDDA 4KLWA 2Q0YA 2A4NA 4FD5A 3BJ7A 3TO7A 2ZW5A 2VXKA 4CRZB 2CNSA 1PUAA 3LODA 4BMHA 2R7HA 4IF5A 2Z10A 4KOYA 1Q2CA 2F5IA 2ARHA 1P0HA 1QSNA 1QSOA 1Q2DA 3P2HA 4MI4A 3W91A 2G3AA 3CXQA 1WK4A 2I79A 2DXQA 3H4QA 1IYKA 1NE9A 1XE4A 1S5KA 4E2AA 2CY2A 3IGRA 3I3GA 4JXQA 4UWJA 4HNYB 3GYAA 3W6SA 3SXNA 2PDOA 3JUWA 3DR8A 2BUEA 4JXRA 4AB7A 2G3TA 1S60A 3FXTA 2FCKA 2B4DB 4KVXA 4H89A 2VZYA 3R1KA 2I00A 3PGPA 4KVME 4U5YA 3T90A 1YGHA 2B4DA 2X7BA 3DNSA 4AVAA 1SQHA 2K5TA 1Z4RA 5ISVA 1S7FA 1YX0A 5KTCA 4KUBA 2G0BA 3EXNA 5F48A 4YFJA 4R3KA 1Y9WA 2C27A 4I49A 5I0CA 5DWMA 4UBRA 1K4JA 5DWNA 1S7NA 4B5OA 3R9EA 3FYNA 4MJ8A 2IL4A 4PSXA 4CS0B 2Y0MA 4UWIA 4XNHB 4KOWA 4GS4A 2VEZA 3KKWA 3G8WA 4XNHC 3TOAA 2ZPAA 2FXFA 4YRHA 5IV0A 5HH1A 3R9FA 1P4NA 2Q4YA 2QIRA 3FNCA 3TCVA 2H5MA 2PR8A 2BL1A 2QMLA 2FIAA 1Q2YA 1V0CA 4KUAA 2JEVA 1XMTA 4F6AA 4X5KA 2O28A 2B3UA 3S6GA 4QC6A 1TIQA 4ZBGA 4XPLA 1XIXA 2VQYA 4MBUA 3ZJ0A 1KUVA 4KOTA 4OADA 3R95A 1M1DA 5IB0A 3TE4A 3F0AA 4UA3A 5EC4A 2FIWA 4QB9A 2Z0ZA 4XPKA 5KTAA 1YR0A 1XEBA 1MK4A 2WPXA 3NE7A 2J8RA 4NEXA 4PK2A 2Q7BA 4KVOE 4R57A 4CAVA 3IWGA 5E96A 5H86A 4OLLA 4KLVA 3OWCA 5EBVA 1LRZA 3SHPA 2OB0A 2HQYA 4JJXA 4JD6A 2CNMA 2PRBA 3TO6A 1KZFA 3LD2A 4PK3A 2D4OA 1YK3A 4H6UA 1B87A 1Y7RA 1KUYA 3GKRA 2JDCA 1RO5A 5CNPA 3QAHA 4MY3A 3VWDA 3D8PA 2R8VA 2Q44A 4OAEA 3D3SA 1R57A 5F46A 1QSRA 3S6FA 4R3LA 3BJ8A 4HNWB 4MHDA 4IUSA 4AG9A 2OZHA 4AVCA 5C88A 1IICA 4YGOA 1M4IA 1N71A 4RI1A 1VKCA 2PSWA 4Y49B 3F5BA 4B5PA 4DNCA 1PU9A 2REEA 3P2FA 1XF8A 2OH1A 4NF1A 1M44A 4K30A 1UFHA 2P6FA 1I21A 1S7KA 2RC4A 1J4JA 1M4DA 3E0KA 2FE7A 4KOUA 3I9SA 4QVTA 4CRYB 2GE3A 4ORFA 3D2MA 3EY5A 3TTHA 2FS5A 1WWZA 2J8NA 2P6EA 1CM0A 4HKFA 5GCNA 3TT2A 2ZXVA 1I1DA 1YREA 2BSWA 1Y9KA 2EUIA 4NSQA 3S6HA 4CAWA 4PV6A 3FBUA 5KTDA 4FD7A 1FY7A 3EFAA 4II9A 2J8MA 3BLNA 4PSWA 3GY9A 3VWEA 2P0WA 2B5GB 4U9ZA 4R9MA 5J8CA 4L89A 3JVNA 3T9YA 3TO9A 5JPHA 2BEIA 3G3SA 4H6ZA 2B5GA 1IIDA 1CJWA 1QSTA 1Z4EA 1KUXA 3FB3A 2PC1A 4J3GA 4QBJA 4AVBA 4LUAA 1OZPA 2OZGA 3SXOA 1YVKA 4E0AA 3D2PA 1IB1E 2D4PA 3CXPA 2AE6A 3W6XA 2CNTA 2FSRA 5C82A 4FD6A 4KZTA 1S3ZA 2ZW7A 3FRMA 4EVYA 1YLEA 5J8FA 4XPDB 3B8GA 2FL4A 2EVNA 2P6GA 3V8IA 1IYLA 2Q04A 4KOSA 1S7LA 4XPDC 3EO4A 5JQ4A 1RXTA 2NMTA 3EC4A 2PQ8A 4KOVA 1GHEA 1Z9UA 1BOBA 1MJ9A 2REFA 3WR7A 4U9YA 4HNXB 2R1IA 2HV2A 1B6BA 2B4BA 4JLYA 3PP9A 1BO4A 4KORA 4KOXA 2OZUA 2PR1A 3UY5A 1YVOA 4B5PB 1L0CA 2FT0A 3DR6A 2JLMA 2WPWA 3K9UA 5F47A 4QUSA 2VI7A 3F8KA 1QSMA 2VBQA 4Y49C 3R9GA 1MJAA 2ZW6A 1M4GA 1ON0A 2GIVA 3FIXA 3DDDA 3R96A 4M85A 2QECA 3ZZIA 3RYOA 4R87A 2B58A 1NSLA 2ATRA 4E8OA 5FVJA 1VHSA 3CXSA 4FD4A 4NXYA 5IX3A 5F49A 2Q4VA 2GANA 4JWPA 4L8AA 3N7ZA 4MY0A 4M3SA 1MJBA 4AG7A 3DSBA 2OU2A 4ONUA 3MGDA 2ZW4A 3S6KA 4F0YA 1NMTA 2AJ6A 1U6MA 2B3VA 1I12A 2HUZA 2Z11A 2VZZA 4RS2A 4CAXA 5H84A 2R98A 3QB8A 3PZJA 3TOBA 3TFYA 4NCZA
chains in the Genus database with same CATH superfamily
4BBHA 3C26A 5AG7A 1FNOA 1R43A 5HMNA 2KCWA 2EO8A 3KHXA 4LX9A 4F0XA 2JDDA 4KLWA 2HB6A 4MFKA 2Q0YA 2A4NA 1LAPA 4FD5A 3T8WA 1AMPA 2F7VA 3BJ7A 3ISZA 2C6GA 2V8DA 1JQGA 3TO7A 4ZY0A 2ZW5A 2IQ6A 2VXKA 2PE3A 4A37A 4CRZB 3FJUA 2CNSA 3NH5A 2ZOFA 1PUAA 1VHEA 2O4HA 5G20A 3LODA 1XOVA 4NJQA 5HXDA 1BAVA 2YNCC 2WUUA 3D4UA 4MHPA 4FBEA 4BMHA 2R7HA 4IF5A 2Z3OA 4MHNA 4GM5A 4P4BA 1IGBA 1ZG7A 4R8FA 4PXBA 4A31A 3SJEA 2Z10A 4KOYA 2QYVA 1Q2CA 2F5IA 2ARHA 3BI1A 1P0HA 2PJ3A 3FX6A 3NA6A 4P10A 5G22A 4OKOA 1QSNA 1QSOA 2XEIA 1Q2DA 3P2HA 4MI4A 3W91A 5CPAA 2G3AA 2WYRA 4B12A 2Z3MA 3CXQA 5HVFA 2CTBA 2ZEFA 3B3TA 1WK4A 5LYLA 5AG6A 2I79A 2DXQA 3H4QA 2O53A 1IYKA 1NE9A 3BI0A 4OC5A 1Y0RA 3PB9X 4Q7AA 1XE4A 1S5KA 2AFSA 3IEHA 2PJCA 3QNVA 1X12A 3FVLA 1XJOA 4Z65A 4E2AA 2GREA 1BPNA 2CY2A 2HC9A 3I3GA 3IGRA 4JXQA 4JYWA 4UWJA 4PQAA 4HNYB 3GYAA 4UIBA 3W6SA 1BPMA 2DEAA 2CIJA 3SXNA 2PDOA 4X2TA 3JUWA 1ELMP 3DR8A 2BUEA 4JXRA 2EK8A 1YMEA 4AB7A 5D29A 4ZI6A 2G3TA 4MCSA 1S60A 2JBJA 2FCKA 2PJ8A 2B4DB 3FXTA 2PJBA 3KL9A 4H89A 4KVXA 4M6GA 2VZYA 3HLPA 2EWBA 3R1KA 3QAYA 1YW6A 4PPZA 2I00A 4R7MA 2F8HA 4CYQA 1ZO0A 3PGPA 4KVME 4U5YA 1R3NA 3KGQA 3T90A 1YGHA 2B4DA 1F2PA 2X7BA 3DNSA 4AVAA 1SQHA 2K5TA 1Z4RA 4ZYQA 5ISVA 1S7FA 3CPAA 4B10A 1YX0A 4B11A 5KTCA 4P6YA 2XEGA 4KUBA 4R6TA 4UEFA 2G0BA 1VIXA 3EXNA 5F48A 3B2YA 4YFJA 2J9AA 4R3KA 4ZX8A 1Y9WA 2C27A 3IWWA 4OC4A 4I49A 5I0CA 4P4JA 3KR4A 3PBEA 2YNDA 4MHZA 5DWMA 2ZELA 5DS0A 5LYDA 4AXVA 4UBRA 4ZGYB 3RO0A 1K4JA 4G1PA 2GLFA 3MN8A 4P44A 4RN7A 3CDXA 5DWNA 1S7NA 4CGLA 4RUHA 3PFOA 2PCUA 3R9EA 4B5OA 4P45A 4R76A 3FYNA 3PB7X 1F2OA 4B6ZA 4MJ8A 4EMEA 4JZ0A 2PJ1A 1F57A 2IL4A 4PSXA 2ZEHA 4CS0B 2Y0MA 4UWIA 1GYTA 4XNHB 4KOWA 4B14A 4GS4A 1QMUA 4UEEA 1PYTB 1DE4C 4MCQA 2VEZA 3FF3A 3KKWA 2V77A 2BCOA 3G8WA 4NGRA 1ARLA 3K2KA 3PFEA 4WJBA 1UWYA 4XNHC 3TOAA 1HEEA 2ZPAA 1Y0YA 1AUGA 2FXFA 3D68A 8CPAA 3BXMA 4UEZA 4YRHA 3GUXA 1ARMA 5IV0A 1IY7A 5HH1A 5JH9A 3R9FA 1P4NA 4IK2A 2Q4YA 3I1UA 2QIRA 3FNCA 2PJ0A 3SI2A 3TCVA 5LRGA 4A2ZA 2H5MA 4ZY1A 2PJ6A 2PR8A 4O23A 4OP4A 2BL1A 2QMLA 3LMSA 3B3SA 2Z3KA 5GCNA 2Z3PA 3LWUA 2FIAA 1Q2YA 1Z8WA 1V0CA 4KUAA 2V8GA 2JEVA 3H8GA 2DPSA 3CT9A 1XFOA 4IAVA 4DYOA 1XMTA 4TNUA 4F6AA 1KWMA 4X5KA 2O28A 2B3UA 1TKJA 1CP7A 3D67A 3S6GA 1RTQA 3B3WA 4QC6A 2OR4A 3RZAA 4EFDA 5HVGA 1TIQA 4ZBGA 4XPLA 1XIXA 2VQYA 2ZOGA 4NGNA 2ZEEA 4MBUA 3PBBA 3ZJ0A 3FMCA 1KUVA 2Z3NA 4KOTA 4OADA 2AFXA 1M1DA 3R95A 5IB0A 3TE4A 3F0AA 4UA3A 3D7GA 5EC4A 4OC3A 2FIWA 1Y7EA 4F8ZA 4QB9A 1H8LA 1YLOA 4ONWA 2Z0ZA 4XPKA 4MXUA 5KTAA 1YR0A 2RFHA 1XEBA 2ZEPA 1MK4A 2WPXA 3NE7A 2J8RA 2PJ7A 2PIYA 3IJ3A 4NEXA 4PK2A 2Q7BA 4KVOE 4R57A 5LYIA 4A39A 1M4LA 1XMBA 4CAVA 3IWGA 5E96A 1YW4A 2I3CA 5H86A 4TWEA 3SI0A 4OIWA 3RBUA 4OLLA 4KLVA 4MFLA 3OWCA 5EBVA 4A38A 3NFZA 1LRZA 3SHPA 4C68A 1OBRA 3FH4A 4HPSA 2OB0A 2HQYA 5A28A 3FECA 3IWEA 1CPXA 4PXCA 2CTCA 2DF5A 4P4FA 4JJXA 1ZLIA 4UCNA 1A2ZA 2EK9A 2PVWA 4KSIA 4MFQA 3RAMA 3IO1A 2CNMA 4JD6A 3WT4A 4CYOA 2AFOA 1Z8XA 2PRBA 3DGVA 3TO6A 3WABA 1KZFA 2XEFA 3LD2A 4PK3A 2D4OA 1YK3A 3L2NA 4H6UA 2AFZA 4P4EA 3IU2A 1CBXA 2VL1A 4K3NA 4A95A 1B87A 1Y7RA 3D7FA 1KUYA 3GKRA 4KSAA 3KHZA 1YQEA 1RO5A 1Z5RA 2JDCA 3QAHA 3B3CA 4MY3A 4UFVA 3KI9A 5CNPA 3VWDA 4CGOA 3D8PA 2R8VA 2Q44A 4PXDA 4OAEA 4FUUA 4FAIA 2XEJA 5IB9A 3D3SA 3TT2A 5ELYA 1R57A 2ZEMA 5F46A 1QSRA 3NE8A 4PXEA 3SJXA 2PRQA 4CAFA 3S6FA 4R3LA 1XBUA 3BJ8A 4HNWB 4IUSA 4MHDA 4AG9A 3VATA 4F9VA 2OZHA 2QVPA 3D7HA 3JTKA 4F9UA 4C2YA 4AVCA 4CGPA 5C88A 2GFQA 3CPXA 1Z2LA 1IICA 4CGNA 3BHXA 4H2KA 5J1QA 3WC7A 4YGOA 1M4IA 5K8NA 1N71A 4MFJA 1VKCA 2PSWA 4NGQA 4RI1A 4Y49B 3F5BA 4NGSA 3GB0A 2OOTA 4B5PA 1PU9A 2REEA 4DNCA 1CPSA 4A30A 5LRKA 3DLJA 1BLLE 3P2FA 1XF8A 4CGMA 2OH1A 4NF1A 1M44A 5K8OA 4OC2A 4K30A 4UFWA 1UFHA 2P6FA 4UFXA 1LANA 2C6PA 3S9NA 1I21A 2G9DA 4B13A 1S7KA 2RC4A 5BWAB 2PJ2A 3RNZA 1J4JA 1HDUA 1M4DA 4NGPA 3E0KA 2FE7A 4KOUA 3I9SA 3V7ZA 4OC1A 4QVTA 4CRYB 3TC8A 1IOFA 2GE3A 3NH4A 2AFMA 4ORFA 3D2MA 3EY5A 3TTHA 2FS5A 1WWZA 5K8PA 1AYEA 2J8NA 1ZG9A 1CM0A 2P6EA 2PJAA 3CZXA 2ZXVA 3N5FA 4HKFA 1I1DA 1YREA 2BSWA 4UCPA 1Y9KA 3WC5A 2EUIA 1X10A 2JBKA 4NSQA 2POKA 3S6HA 4BD9A 4CAWA 2ODFA 4GXHA 4PV6A 3FBUA 4MMOA 4MRIA 1Z8LA 5KTDA 4FD7A 1FY7A 3EFAA 4II9A 4UIAA 1LFWA 4NGMA 4ZX9A 2J8MA 3FEDA 2C1CA 3BLNA 4DUKA 1Z8TA 2DPTA 4CAEA 3S9LA 4NFRA 4PSWA 3GY9A 3JRUA 3VWEA 4CYNA 2P0WA 2B5GB 4KSFA 4U9ZA 4C7IA 2NSMA 4R9MA 3B35A 2PIZA 5LYFA 1XRYA 5J8CA 4L89A 3JVNA 3T9YA 4NGTA 1ZG8A 3TO9A 5JPHA 2BEIA 2ZEOA 3G3SA 2YGWA 2ZEDA 4H6ZA 5G1ZA 2B5GA 1IIDA 2Q51A 1CJWA 3LACA 3TX8A 1QSTA 1Z4EA 4P4IA 4UCMA 1KUXA 3FB3A 4DJLA 2PC1A 2PJ4A 4J3GA 4QBJA 4AVBA 5D8NA 2PJ9A 4LUAA 3VH9A 1OZPA 2OZGA 3FEEA 3SXOA 3PB6X 4KS9A 4FWUA 3KQZA 1YVKA 1JWQA 4E0AA 2QJ8A 3D2PA 1IB1E 2D4PA 3CXPA 2AE6A 3KQXA 5AG5A 4MCRA 3W6XA 1Q7LA 2WSAA 3ISXA 2CNTA 2FSRA 3B7IA 4A33A 5C82A 5JGFA 4FD6A 4KZTA 4MHYA 1VHOA 4LQ6A 2CXAA 3SJGA 1FT7A 3B3VA 1CG2A 1S3ZA 2YNCA 2BOAA 2ZW7A 4MFZA 3FRMA 4EVYA 1YLEA 5J8FA 2GU2A 4OMEA 4XPDB 3B8GA 2FL4A 2C6CA 1CP6A 3H8EA 5G21A 5LRJA 2EVNA 3SJFA 2P6GA 4Q36A 3V8IA 4EWTA 2Z3LA 1IYLA 2Q04A 2NYQA 4KOSA 5K8MA 4LQGA 4CYPA 1S7LA 4XPDC 2Q7SA 4YU9A 4X8IA 3NH8A 3EO4A 2V8HA 3WC6A 3GLJA 1YSJA 5I4MA 5JQ4A 1TKFA 3HUVA 1RXTA 2NMTA 3EC4A 2PQ8A 4KOVA 4Q38A 1QQ9A 4OIDA 1PCAA 1GHEA 1Z9UA 5EMIA 1BOBA 1MJ9A 3IC1A 2REFA 1TF8A 1DTDA 3WR7A 4C2XA 4U9YA 4HNXB 1ZLHA 2R1IA 2AFWA 2HV2A 1B6BA 5F09A 2B4BA 4JLYA 3PP9A 1BO4A 4KORA 1EE3P 2IJZA 5JM6A 2FVGA 1TXRA 1LCPA 3KZWA 4MCPA 4KOXA 1HDQA 2OZUA 2PR1A 2WZNA 2V8VA 3V38A 3IFEA 3UY5A 1YVOA 3D66A 4B5PB 1IOIA 4OC0A 1L0CA 4YWYA 2FT0A 3DR6A 2YNEA 2JLMA 2WPWA 4C2ZA 3PB8X 3K9UA 1TF9A 5F47A 4QUSA 4P4DA 4X3RA 2Q4ZA 3PEIA 2VI7A 3F8KA 1QSMA 1IU8A 2VBQA 4IHMA 4Y49C 2EBJA 3R9GA 1MJAA 2ANPA 2ZW6A 1M4GA 1ON0A 2GLJA 2GIVA 2PJ5A 3H8FA 3K9TA 3FIXA 3PRTA 4W9YA 5AG4A 2AFUA 3DDDA 1NSAA 5A27A 2RB7A 3A9LA 3R96A 4M85A 1LAMA 2QECA 3ZZIA 1CX8A 3RYOA 4R87A 2B58A 1VGYA 1LOKA 4M6IA 2ATRA 1NSLA 4E8OA 5FVJA 2PVVA 1VHSA 3CXSA 4FD4A 4NXYA 2Q43A 5IX3A 2JEWA 2IMOA 5F49A 1ELLP 4C7HA 2Q4VA 2GANA 4JWPA 4L8AA 6CPAA 3N7ZA 4A94A 2BO9A 4UF4A 4MY0A 4M3SA 5AGEA 5HVHA 1MJBA 4A32A 4AG7A 3DSBA 3MRUA 2OU2A 4ZY2A 4ONUA 3MGDA 2ZW4A 3D7DA 3S6KA 3SI1A 4F0YA 3KASA 4MFPA 3IU1A 1NMTA 2AJ6A 3PB4X 1U6MA 2B3VA 3IIBA 3S9MA 4BINA 1I12A 2HUZA 2ZEGA 2Z11A 2VZZA 4WWVA 4RS2A 2ABZA 5H84A 4CAXA 2R98A 4M6HA 3GIUA 3QB8A 2ZENA 3PZJA 5CBMA 2CF4A 3H5ZA 3TOBA 4NCZA 5THWA 3TFYA 7CPAA 4NJRA 3KR5A 3VARA 4CPAA 1TKHA
chains in the Genus database with same CATH topology
4BBHA 3C26A 5AG7A 5HMNA 2KCWA 4LX9A 4F0XA 2JDDA 4KLWA 4MFKA 2Q0YA 2A4NA 4FD5A 3BJ7A 3TO7A 2ZW5A 2VXKA 4CRZB 2CNSA 1PUAA 5G20A 3LODA 2YNCC 2WUUA 4BMHA 2R7HA 4IF5A 2Z3OA 4A31A 2Z10A 4KOYA 1Q2CA 2F5IA 2ARHA 1P0HA 5G22A 1QSNA 1QSOA 1Q2DA 3P2HA 4MI4A 3W91A 2G3AA 4B12A 2Z3MA 3CXQA 1WK4A 5AG6A 2I79A 2DXQA 3H4QA 1IYKA 1NE9A 1XE4A 1S5KA 4E2AA 2CY2A 3IGRA 3I3GA 4JXQA 4UWJA 4HNYB 3GYAA 3W6SA 3SXNA 2PDOA 3JUWA 3DR8A 2BUEA 4JXRA 4AB7A 2G3TA 1S60A 3FXTA 2FCKA 2B4DB 4KVXA 4H89A 2VZYA 3R1KA 2I00A 4CYQA 1ZO0A 3PGPA 4KVME 4U5YA 3T90A 1YGHA 2B4DA 2X7BA 3DNSA 4AVAA 1SQHA 2K5TA 1Z4RA 5ISVA 1S7FA 4B10A 1YX0A 4B11A 5KTCA 4KUBA 2G0BA 3EXNA 5F48A 4YFJA 4R3KA 1Y9WA 2C27A 4I49A 5I0CA 2YNDA 5DWMA 4UBRA 4ZGYB 1K4JA 5DWNA 4CGLA 1S7NA 4B5OA 3R9EA 3FYNA 4MJ8A 2IL4A 4PSXA 4CS0B 2Y0MA 4UWIA 4XNHB 4KOWA 4B14A 4GS4A 2VEZA 3KKWA 3G8WA 4XNHC 3TOAA 2ZPAA 2FXFA 4YRHA 5IV0A 5HH1A 3R9FA 1P4NA 2Q4YA 2QIRA 3FNCA 3TCVA 4A2ZA 2H5MA 2PR8A 2BL1A 2QMLA 2Z3KA 2Z3PA 2FIAA 1Q2YA 1V0CA 4KUAA 2JEVA 2DPSA 1XMTA 4F6AA 4X5KA 2O28A 2B3UA 3S6GA 4QC6A 1TIQA 4ZBGA 4XPLA 1XIXA 2VQYA 4MBUA 3ZJ0A 1KUVA 2Z3NA 4KOTA 4OADA 3R95A 1M1DA 5IB0A 3TE4A 3F0AA 4UA3A 5EC4A 2FIWA 4QB9A 2Z0ZA 4XPKA 5KTAA 1YR0A 1XEBA 1MK4A 2WPXA 3NE7A 2J8RA 4NEXA 4PK2A 2Q7BA 4KVOE 4R57A 4CAVA 3IWGA 5E96A 5H86A 4OLLA 4KLVA 4MFLA 3OWCA 5EBVA 1LRZA 3SHPA 4C68A 2OB0A 2HQYA 5A28A 3IWEA 4JJXA 4UCNA 4MFQA 4JD6A 2CNMA 4CYOA 2PRBA 3TO6A 1KZFA 3LD2A 4PK3A 2D4OA 1YK3A 4H6UA 3IU2A 4A95A 1B87A 1Y7RA 1KUYA 3GKRA 4KSAA 2JDCA 1RO5A 5CNPA 3QAHA 4MY3A 4UFVA 4CGOA 3VWDA 3D8PA 2R8VA 2Q44A 4OAEA 3D3SA 1R57A 5F46A 1QSRA 4CAFA 3S6FA 4R3LA 3BJ8A 4HNWB 4MHDA 4IUSA 4AG9A 2OZHA 3JTKA 4C2YA 4AVCA 4CGPA 5C88A 1IICA 4CGNA 4YGOA 1M4IA 1N71A 4MFJA 1VKCA 2PSWA 4RI1A 4Y49B 3F5BA 4B5PA 4DNCA 1PU9A 2REEA 4A30A 3P2FA 4CGMA 1XF8A 2OH1A 4NF1A 1M44A 4K30A 4UFWA 1UFHA 2P6FA 4UFXA 1I21A 4B13A 1S7KA 2RC4A 5BWAB 1J4JA 1M4DA 3E0KA 2FE7A 4KOUA 3I9SA 4QVTA 4CRYB 2GE3A 4ORFA 3D2MA 3EY5A 3TTHA 2FS5A 1WWZA 2J8NA 2P6EA 1CM0A 4HKFA 5GCNA 4UCPA 2ZXVA 3TT2A 1I1DA 1YREA 2BSWA 1Y9KA 2EUIA 4NSQA 3S6HA 4CAWA 4PV6A 3FBUA 5KTDA 4FD7A 1FY7A 3EFAA 4II9A 2J8MA 3BLNA 2DPTA 4CAEA 4PSWA 3GY9A 3VWEA 4CYNA 2P0WA 2B5GB 4KSFA 4U9ZA 4C7IA 4R9MA 5J8CA 4L89A 3JVNA 3T9YA 3TO9A 5JPHA 2BEIA 3G3SA 4H6ZA 2YGWA 5G1ZA 2B5GA 1IIDA 1CJWA 1QSTA 1Z4EA 4UCMA 1KUXA 3FB3A 2PC1A 4J3GA 4QBJA 4AVBA 4LUAA 1OZPA 2OZGA 3SXOA 4KS9A 1YVKA 4E0AA 3D2PA 1IB1E 2D4PA 3CXPA 2AE6A 5AG5A 3W6XA 2WSAA 2CNTA 2FSRA 4A33A 5C82A 4FD6A 4KZTA 2CXAA 1S3ZA 2YNCA 2ZW7A 4MFZA 3FRMA 4EVYA 1YLEA 5J8FA 4XPDB 3B8GA 2FL4A 5G21A 2EVNA 2P6GA 4Q36A 3V8IA 2Z3LA 1IYLA 2Q04A 4KOSA 4CYPA 1S7LA 4XPDC 3EO4A 5JQ4A 1RXTA 2NMTA 3EC4A 2PQ8A 4KOVA 4Q38A 1GHEA 1Z9UA 1BOBA 1MJ9A 2REFA 3WR7A 4C2XA 4U9YA 4HNXB 2R1IA 2HV2A 1B6BA 2B4BA 4JLYA 3PP9A 1BO4A 4KORA 4KOXA 2OZUA 2PR1A 3UY5A 1YVOA 4B5PB 1L0CA 2FT0A 3DR6A 2YNEA 2JLMA 2WPWA 4C2ZA 3K9UA 5F47A 4QUSA 2VI7A 3F8KA 1QSMA 2VBQA 4Y49C 3R9GA 1MJAA 2ZW6A 1M4GA 1ON0A 2GIVA 3FIXA 5AG4A 3DDDA 5A27A 3A9LA 3R96A 4M85A 2QECA 3ZZIA 3RYOA 4R87A 2B58A 1NSLA 2ATRA 4E8OA 5FVJA 1VHSA 3CXSA 4FD4A 4NXYA 5IX3A 5F49A 4C7HA 2Q4VA 2GANA 4JWPA 4L8AA 3N7ZA 5AGEA 4MY0A 4M3SA 1MJBA 4A32A 4AG7A 3DSBA 2OU2A 4ONUA 3MGDA 2ZW4A 3S6KA 4F0YA 4MFPA 3IU1A 1NMTA 2AJ6A 1U6MA 2B3VA 1I12A 2HUZA 2Z11A 2VZZA 4RS2A 4CAXA 5H84A 2R98A 3QB8A 3PZJA 3H5ZA 3TOBA 4NCZA 3TFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C26 A;  5HMN A;  2KCW A;  4LX9 A;  2JDD A;  4KLW A;  2Q0Y A;  2A4N A;  4FD5 A;  3BJ7 A;  3TO7 A;  2ZW5 A;  2VXK A;  4CRZ B;  2CNS A;  1PUA A;  3LOD A;  4BMH A;  2R7H A;  4IF5 A;  2Z10 A;  4KOY A;  1Q2C A;  2F5I A;  2ARH A;  1P0H A;  1QSN A;  1QSO A;  1Q2D A;  3P2H A;  4MI4 A;  3W91 A;  2G3A A;  3CXQ A;  1WK4 A;  2I79 A;  2DXQ A;  3H4Q A;  1IYK A;  1NE9 A;  1XE4 A;  1S5K A;  4E2A A;  2CY2 A;  3IGR A;  3I3G A;  4JXQ A;  4UWJ A;  4HNY B;  3GYA A;  3W6S A;  3SXN A;  2PDO A;  3JUW A;  3DR8 A;  2BUE A;  4JXR A;  4AB7 A;  2G3T A;  1S60 A;  3FXT A;  2FCK A;  2B4D B;  4KVX A;  4H89 A;  2VZY A;  3R1K A;  2I00 A;  3PGP A;  4KVM E;  4U5Y A;  3T90 A;  1YGH A;  2B4D A;  2X7B A;  3DNS A;  4AVA A;  1SQH A;  2K5T A;  1Z4R A;  5ISV A;  1S7F A;  1YX0 A;  5KTC A;  4KUB A;  2G0B A;  3EXN A;  5F48 A;  4YFJ A;  4R3K A;  1Y9W A;  2C27 A;  4I49 A;  5I0C A;  5DWM A;  4UBR A;  1K4J A;  5DWN A;  1S7N A;  4B5O A;  3R9E A;  3FYN A;  4MJ8 A;  2IL4 A;  4PSX A;  4CS0 B;  2Y0M A;  4UWI A;  4XNH B;  4KOW A;  4GS4 A;  2VEZ A;  3KKW A;  3G8W A;  4XNH C;  3TOA A;  2ZPA A;  2FXF A;  4YRH A;  5IV0 A;  5HH1 A;  3R9F A;  1P4N A;  2Q4Y A;  2QIR A;  3FNC A;  3TCV A;  2H5M A;  2PR8 A;  2BL1 A;  2QML A;  2FIA A;  1Q2Y A;  1V0C A;  4KUA A;  2JEV A;  1XMT A;  4F6A A;  4X5K A;  2O28 A;  2B3U A;  3S6G A;  4QC6 A;  1TIQ A;  4ZBG A;  4XPL A;  1XIX A;  2VQY A;  4MBU A;  3ZJ0 A;  1KUV A;  4KOT A;  4OAD A;  3R95 A;  1M1D A;  5IB0 A;  3TE4 A;  3F0A A;  4UA3 A;  5EC4 A;  2FIW A;  4QB9 A;  2Z0Z A;  4XPK A;  5KTA A;  1YR0 A;  1XEB A;  1MK4 A;  2WPX A;  3NE7 A;  2J8R A;  4NEX A;  4PK2 A;  2Q7B A;  4KVO E;  4R57 A;  4CAV A;  3IWG A;  5E96 A;  5H86 A;  4OLL A;  4KLV A;  3OWC A;  5EBV A;  1LRZ A;  3SHP A;  2OB0 A;  2HQY A;  4JJX A;  4JD6 A;  2CNM A;  2PRB A;  3TO6 A;  1KZF A;  3LD2 A;  4PK3 A;  2D4O A;  1YK3 A;  4H6U A;  1B87 A;  1Y7R A;  1KUY A;  3GKR A;  2JDC A;  1RO5 A;  5CNP A;  3QAH A;  4MY3 A;  3VWD A;  3D8P A;  2R8V A;  2Q44 A;  4OAE A;  3D3S A;  1R57 A;  5F46 A;  1QSR A;  3S6F A;  4R3L A;  3BJ8 A;  4HNW B;  4MHD A;  4IUS A;  4AG9 A;  2OZH A;  4AVC A;  5C88 A;  1IIC A;  4YGO A;  1M4I A;  1N71 A;  4RI1 A;  1VKC A;  2PSW A;  4Y49 B;  3F5B A;  4B5P A;  4DNC A;  1PU9 A;  2REE A;  3P2F A;  1XF8 A;  2OH1 A;  4NF1 A;  1M44 A;  4K30 A;  1UFH A;  2P6F A;  1I21 A;  1S7K A;  2RC4 A;  1J4J A;  1M4D A;  3E0K A;  2FE7 A;  4KOU A;  3I9S A;  4QVT A;  4CRY B;  2GE3 A;  4ORF A;  3D2M A;  3EY5 A;  3TTH A;  2FS5 A;  1WWZ A;  2J8N A;  2P6E A;  1CM0 A;  4HKF A;  5GCN A;  3TT2 A;  2ZXV A;  1I1D A;  1YRE A;  2BSW A;  1Y9K A;  2EUI A;  4NSQ A;  3S6H A;  4CAW A;  4PV6 A;  3FBU A;  5KTD A;  4FD7 A;  1FY7 A;  3EFA A;  4II9 A;  2J8M A;  3BLN A;  4PSW A;  3GY9 A;  3VWE A;  2P0W A;  2B5G B;  4U9Z A;  4R9M A;  5J8C A;  4L89 A;  3JVN A;  3T9Y A;  3TO9 A;  5JPH A;  2BEI A;  3G3S A;  4H6Z A;  2B5G A;  1IID A;  1CJW A;  1QST A;  1Z4E A;  1KUX A;  3FB3 A;  2PC1 A;  4J3G A;  4QBJ A;  4AVB A;  4LUA A;  1OZP A;  2OZG A;  3SXO A;  1YVK A;  4E0A A;  3D2P A;  1IB1 E;  2D4P A;  3CXP A;  2AE6 A;  3W6X A;  2CNT A;  2FSR A;  5C82 A;  4FD6 A;  4KZT A;  1S3Z A;  2ZW7 A;  3FRM A;  4EVY A;  1YLE A;  5J8F A;  4XPD B;  3B8G A;  2FL4 A;  2EVN A;  2P6G A;  3V8I A;  1IYL A;  2Q04 A;  4KOS A;  1S7L A;  4XPD C;  3EO4 A;  5JQ4 A;  1RXT A;  2NMT A;  3EC4 A;  2PQ8 A;  4KOV A;  1GHE A;  1Z9U A;  1BOB A;  1MJ9 A;  2REF A;  3WR7 A;  4U9Y A;  4HNX B;  2R1I A;  2HV2 A;  1B6B A;  2B4B A;  4JLY A;  3PP9 A;  1BO4 A;  4KOR A;  4KOX A;  2OZU A;  2PR1 A;  3UY5 A;  1YVO A;  4B5P B;  1L0C A;  2FT0 A;  3DR6 A;  2JLM A;  2WPW A;  3K9U A;  5F47 A;  4QUS A;  2VI7 A;  3F8K A;  1QSM A;  2VBQ A;  4Y49 C;  3R9G A;  1MJA A;  2ZW6 A;  1M4G A;  1ON0 A;  2GIV A;  3FIX A;  3DDD A;  3R96 A;  4M85 A;  2QEC A;  3ZZI A;  3RYO A;  4R87 A;  2B58 A;  1NSL A;  2ATR A;  4E8O A;  5FVJ A;  1VHS A;  3CXS A;  4FD4 A;  4NXY A;  5IX3 A;  5F49 A;  2Q4V A;  2GAN A;  4JWP A;  4L8A A;  3N7Z A;  4MY0 A;  4M3S A;  1MJB A;  4AG7 A;  3DSB A;  2OU2 A;  4ONU A;  3MGD A;  2ZW4 A;  3S6K A;  4F0Y A;  1NMT A;  2AJ6 A;  1U6M A;  2B3V A;  1I12 A;  2HUZ A;  2Z11 A;  2VZZ A;  4RS2 A;  4CAX A;  5H84 A;  2R98 A;  3QB8 A;  3PZJ A;  3TOB A;  3TFY A;  4NCZ A; 
#chains in the Genus database with same CATH topology
 4BBH A;  3C26 A;  5AG7 A;  1FNO A;  1R43 A;  5HMN A;  2KCW A;  2EO8 A;  3KHX A;  4LX9 A;  4F0X A;  2JDD A;  4KLW A;  2HB6 A;  4MFK A;  2Q0Y A;  2A4N A;  1LAP A;  4FD5 A;  3T8W A;  1AMP A;  2F7V A;  3BJ7 A;  3ISZ A;  2C6G A;  2V8D A;  1JQG A;  3TO7 A;  4ZY0 A;  2ZW5 A;  2IQ6 A;  2VXK A;  2PE3 A;  4A37 A;  4CRZ B;  3FJU A;  2CNS A;  3NH5 A;  2ZOF A;  1PUA A;  1VHE A;  2O4H A;  5G20 A;  3LOD A;  1XOV A;  4NJQ A;  5HXD A;  1BAV A;  2YNC C;  2WUU A;  3D4U A;  4MHP A;  4FBE A;  4BMH A;  2R7H A;  4IF5 A;  2Z3O A;  4MHN A;  4GM5 A;  4P4B A;  1IGB A;  1ZG7 A;  4R8F A;  4PXB A;  4A31 A;  3SJE A;  2Z10 A;  4KOY A;  2QYV A;  1Q2C A;  2F5I A;  2ARH A;  3BI1 A;  1P0H A;  2PJ3 A;  3FX6 A;  3NA6 A;  4P10 A;  5G22 A;  4OKO A;  1QSN A;  1QSO A;  2XEI A;  1Q2D A;  3P2H A;  4MI4 A;  3W91 A;  5CPA A;  2G3A A;  2WYR A;  4B12 A;  2Z3M A;  3CXQ A;  5HVF A;  2CTB A;  2ZEF A;  3B3T A;  1WK4 A;  5LYL A;  5AG6 A;  2I79 A;  2DXQ A;  3H4Q A;  2O53 A;  1IYK A;  1NE9 A;  3BI0 A;  4OC5 A;  1Y0R A;  3PB9 X;  4Q7A A;  1XE4 A;  1S5K A;  2AFS A;  3IEH A;  2PJC A;  3QNV A;  1X12 A;  3FVL A;  1XJO A;  4Z65 A;  4E2A A;  2GRE A;  1BPN A;  2CY2 A;  2HC9 A;  3I3G A;  3IGR A;  4JXQ A;  4JYW A;  4UWJ A;  4PQA A;  4HNY B;  3GYA A;  4UIB A;  3W6S A;  1BPM A;  2DEA A;  2CIJ A;  3SXN A;  2PDO A;  4X2T A;  3JUW A;  1ELM P;  3DR8 A;  2BUE A;  4JXR A;  2EK8 A;  1YME A;  4AB7 A;  5D29 A;  4ZI6 A;  2G3T A;  4MCS A;  1S60 A;  2JBJ A;  2FCK A;  2PJ8 A;  2B4D B;  3FXT A;  2PJB A;  3KL9 A;  4H89 A;  4KVX A;  4M6G A;  2VZY A;  3HLP A;  2EWB A;  3R1K A;  3QAY A;  1YW6 A;  4PPZ A;  2I00 A;  4R7M A;  2F8H A;  4CYQ A;  1ZO0 A;  3PGP A;  4KVM E;  4U5Y A;  1R3N A;  3KGQ A;  3T90 A;  1YGH A;  2B4D A;  1F2P A;  2X7B A;  3DNS A;  4AVA A;  1SQH A;  2K5T A;  1Z4R A;  4ZYQ A;  5ISV A;  1S7F A;  3CPA A;  4B10 A;  1YX0 A;  4B11 A;  5KTC A;  4P6Y A;  2XEG A;  4KUB A;  4R6T A;  4UEF A;  2G0B A;  1VIX A;  3EXN A;  5F48 A;  3B2Y A;  4YFJ A;  2J9A A;  4R3K A;  4ZX8 A;  1Y9W A;  2C27 A;  3IWW A;  4OC4 A;  4I49 A;  5I0C A;  4P4J A;  3KR4 A;  3PBE A;  2YND A;  4MHZ A;  5DWM A;  2ZEL A;  5DS0 A;  5LYD A;  4AXV A;  4UBR A;  4ZGY B;  3RO0 A;  1K4J A;  4G1P A;  2GLF A;  3MN8 A;  4P44 A;  4RN7 A;  3CDX A;  5DWN A;  1S7N A;  4CGL A;  4RUH A;  3PFO A;  2PCU A;  3R9E A;  4B5O A;  4P45 A;  4R76 A;  3FYN A;  3PB7 X;  1F2O A;  4B6Z A;  4MJ8 A;  4EME A;  4JZ0 A;  2PJ1 A;  1F57 A;  2IL4 A;  4PSX A;  2ZEH A;  4CS0 B;  2Y0M A;  4UWI A;  1GYT A;  4XNH B;  4KOW A;  4B14 A;  4GS4 A;  1QMU A;  4UEE A;  1PYT B;  1DE4 C;  4MCQ A;  2VEZ A;  3FF3 A;  3KKW A;  2V77 A;  2BCO A;  3G8W A;  4NGR A;  1ARL A;  3K2K A;  3PFE A;  4WJB A;  1UWY A;  4XNH C;  3TOA A;  1HEE A;  2ZPA A;  1Y0Y A;  1AUG A;  2FXF A;  3D68 A;  8CPA A;  3BXM A;  4UEZ A;  4YRH A;  3GUX A;  1ARM A;  5IV0 A;  1IY7 A;  5HH1 A;  5JH9 A;  3R9F A;  1P4N A;  4IK2 A;  2Q4Y A;  3I1U A;  2QIR A;  3FNC A;  2PJ0 A;  3SI2 A;  3TCV A;  5LRG A;  4A2Z A;  2H5M A;  4ZY1 A;  2PJ6 A;  2PR8 A;  4O23 A;  4OP4 A;  2BL1 A;  2QML A;  3LMS A;  3B3S A;  2Z3K A;  5GCN A;  2Z3P A;  3LWU A;  2FIA A;  1Q2Y A;  1Z8W A;  1V0C A;  4KUA A;  2V8G A;  2JEV A;  3H8G A;  2DPS A;  3CT9 A;  1XFO A;  4IAV A;  4DYO A;  1XMT A;  4TNU A;  4F6A A;  1KWM A;  4X5K A;  2O28 A;  2B3U A;  1TKJ A;  1CP7 A;  3D67 A;  3S6G A;  1RTQ A;  3B3W A;  4QC6 A;  2OR4 A;  3RZA A;  4EFD A;  5HVG A;  1TIQ A;  4ZBG A;  4XPL A;  1XIX A;  2VQY A;  2ZOG A;  4NGN A;  2ZEE A;  4MBU A;  3PBB A;  3ZJ0 A;  3FMC A;  1KUV A;  2Z3N A;  4KOT A;  4OAD A;  2AFX A;  1M1D A;  3R95 A;  5IB0 A;  3TE4 A;  3F0A A;  4UA3 A;  3D7G A;  5EC4 A;  4OC3 A;  2FIW A;  1Y7E A;  4F8Z A;  4QB9 A;  1H8L A;  1YLO A;  4ONW A;  2Z0Z A;  4XPK A;  4MXU A;  5KTA A;  1YR0 A;  2RFH A;  1XEB A;  2ZEP A;  1MK4 A;  2WPX A;  3NE7 A;  2J8R A;  2PJ7 A;  2PIY A;  3IJ3 A;  4NEX A;  4PK2 A;  2Q7B A;  4KVO E;  4R57 A;  5LYI A;  4A39 A;  1M4L A;  1XMB A;  4CAV A;  3IWG A;  5E96 A;  1YW4 A;  2I3C A;  5H86 A;  4TWE A;  3SI0 A;  4OIW A;  3RBU A;  4OLL A;  4KLV A;  4MFL A;  3OWC A;  5EBV A;  4A38 A;  3NFZ A;  1LRZ A;  3SHP A;  4C68 A;  1OBR A;  3FH4 A;  4HPS A;  2OB0 A;  2HQY A;  5A28 A;  3FEC A;  3IWE A;  1CPX A;  4PXC A;  2CTC A;  2DF5 A;  4P4F A;  4JJX A;  1ZLI A;  4UCN A;  1A2Z A;  2EK9 A;  2PVW A;  4KSI A;  4MFQ A;  3RAM A;  3IO1 A;  2CNM A;  4JD6 A;  3WT4 A;  4CYO A;  2AFO A;  1Z8X A;  2PRB A;  3DGV A;  3TO6 A;  3WAB A;  1KZF A;  2XEF A;  3LD2 A;  4PK3 A;  2D4O A;  1YK3 A;  3L2N A;  4H6U A;  2AFZ A;  4P4E A;  3IU2 A;  1CBX A;  2VL1 A;  4K3N A;  4A95 A;  1B87 A;  1Y7R A;  3D7F A;  1KUY A;  3GKR A;  4KSA A;  3KHZ A;  1YQE A;  1RO5 A;  1Z5R A;  2JDC A;  3QAH A;  3B3C A;  4MY3 A;  4UFV A;  3KI9 A;  5CNP A;  3VWD A;  4CGO A;  3D8P A;  2R8V A;  2Q44 A;  4PXD A;  4OAE A;  4FUU A;  4FAI A;  2XEJ A;  5IB9 A;  3D3S A;  3TT2 A;  5ELY A;  1R57 A;  2ZEM A;  5F46 A;  1QSR A;  3NE8 A;  4PXE A;  3SJX A;  2PRQ A;  4CAF A;  3S6F A;  4R3L A;  1XBU A;  3BJ8 A;  4HNW B;  4IUS A;  4MHD A;  4AG9 A;  3VAT A;  4F9V A;  2OZH A;  2QVP A;  3D7H A;  3JTK A;  4F9U A;  4C2Y A;  4AVC A;  4CGP A;  5C88 A;  2GFQ A;  3CPX A;  1Z2L A;  1IIC A;  4CGN A;  3BHX A;  4H2K A;  5J1Q A;  3WC7 A;  4YGO A;  1M4I A;  5K8N A;  1N71 A;  4MFJ A;  1VKC A;  2PSW A;  4NGQ A;  4RI1 A;  4Y49 B;  3F5B A;  4NGS A;  3GB0 A;  2OOT A;  4B5P A;  1PU9 A;  2REE A;  4DNC A;  1CPS A;  4A30 A;  5LRK A;  3DLJ A;  1BLL E;  3P2F A;  1XF8 A;  4CGM A;  2OH1 A;  4NF1 A;  1M44 A;  5K8O A;  4OC2 A;  4K30 A;  4UFW A;  1UFH A;  2P6F A;  4UFX A;  1LAN A;  2C6P A;  3S9N A;  1I21 A;  2G9D A;  4B13 A;  1S7K A;  2RC4 A;  5BWA B;  2PJ2 A;  3RNZ A;  1J4J A;  1HDU A;  1M4D A;  4NGP A;  3E0K A;  2FE7 A;  4KOU A;  3I9S A;  3V7Z A;  4OC1 A;  4QVT A;  4CRY B;  3TC8 A;  1IOF A;  2GE3 A;  3NH4 A;  2AFM A;  4ORF A;  3D2M A;  3EY5 A;  3TTH A;  2FS5 A;  1WWZ A;  5K8P A;  1AYE A;  2J8N A;  1ZG9 A;  1CM0 A;  2P6E A;  2PJA A;  3CZX A;  2ZXV A;  3N5F A;  4HKF A;  1I1D A;  1YRE A;  2BSW A;  4UCP A;  1Y9K A;  3WC5 A;  2EUI A;  1X10 A;  2JBK A;  4NSQ A;  2POK A;  3S6H A;  4BD9 A;  4CAW A;  2ODF A;  4GXH A;  4PV6 A;  3FBU A;  4MMO A;  4MRI A;  1Z8L A;  5KTD A;  4FD7 A;  1FY7 A;  3EFA A;  4II9 A;  4UIA A;  1LFW A;  4NGM A;  4ZX9 A;  2J8M A;  3FED A;  2C1C A;  3BLN A;  4DUK A;  1Z8T A;  2DPT A;  4CAE A;  3S9L A;  4NFR A;  4PSW A;  3GY9 A;  3JRU A;  3VWE A;  4CYN A;  2P0W A;  2B5G B;  4KSF A;  4U9Z A;  4C7I A;  2NSM A;  4R9M A;  3B35 A;  2PIZ A;  5LYF A;  1XRY A;  5J8C A;  4L89 A;  3JVN A;  3T9Y A;  4NGT A;  1ZG8 A;  3TO9 A;  5JPH A;  2BEI A;  2ZEO A;  3G3S A;  2YGW A;  2ZED A;  4H6Z A;  5G1Z A;  2B5G A;  1IID A;  2Q51 A;  1CJW A;  3LAC A;  3TX8 A;  1QST A;  1Z4E A;  4P4I A;  4UCM A;  1KUX A;  3FB3 A;  4DJL A;  2PC1 A;  2PJ4 A;  4J3G A;  4QBJ A;  4AVB A;  5D8N A;  2PJ9 A;  4LUA A;  3VH9 A;  1OZP A;  2OZG A;  3FEE A;  3SXO A;  3PB6 X;  4KS9 A;  4FWU A;  3KQZ A;  1YVK A;  1JWQ A;  4E0A A;  2QJ8 A;  3D2P A;  1IB1 E;  2D4P A;  3CXP A;  2AE6 A;  3KQX A;  5AG5 A;  4MCR A;  3W6X A;  1Q7L A;  2WSA A;  3ISX A;  2CNT A;  2FSR A;  3B7I A;  4A33 A;  5C82 A;  5JGF A;  4FD6 A;  4KZT A;  4MHY A;  1VHO A;  4LQ6 A;  2CXA A;  3SJG A;  1FT7 A;  3B3V A;  1CG2 A;  1S3Z A;  2YNC A;  2BOA A;  2ZW7 A;  4MFZ A;  3FRM A;  4EVY A;  1YLE A;  5J8F A;  2GU2 A;  4OME A;  4XPD B;  3B8G A;  2FL4 A;  2C6C A;  1CP6 A;  3H8E A;  5G21 A;  5LRJ A;  2EVN A;  3SJF A;  2P6G A;  4Q36 A;  3V8I A;  4EWT A;  2Z3L A;  1IYL A;  2Q04 A;  2NYQ A;  4KOS A;  5K8M A;  4LQG A;  4CYP A;  1S7L A;  4XPD C;  2Q7S A;  4YU9 A;  4X8I A;  3NH8 A;  3EO4 A;  2V8H A;  3WC6 A;  3GLJ A;  1YSJ A;  5I4M A;  5JQ4 A;  1TKF A;  3HUV A;  1RXT A;  2NMT A;  3EC4 A;  2PQ8 A;  4KOV A;  4Q38 A;  1QQ9 A;  4OID A;  1PCA A;  1GHE A;  1Z9U A;  5EMI A;  1BOB A;  1MJ9 A;  3IC1 A;  2REF A;  1TF8 A;  1DTD A;  3WR7 A;  4C2X A;  4U9Y A;  4HNX B;  1ZLH A;  2R1I A;  2AFW A;  2HV2 A;  1B6B A;  5F09 A;  2B4B A;  4JLY A;  3PP9 A;  1BO4 A;  4KOR A;  1EE3 P;  2IJZ A;  5JM6 A;  2FVG A;  1TXR A;  1LCP A;  3KZW A;  4MCP A;  4KOX A;  1HDQ A;  2OZU A;  2PR1 A;  2WZN A;  2V8V A;  3V38 A;  3IFE A;  3UY5 A;  1YVO A;  3D66 A;  4B5P B;  1IOI A;  4OC0 A;  1L0C A;  4YWY A;  2FT0 A;  3DR6 A;  2YNE A;  2JLM A;  2WPW A;  4C2Z A;  3PB8 X;  3K9U A;  1TF9 A;  5F47 A;  4QUS A;  4P4D A;  4X3R A;  2Q4Z A;  3PEI A;  2VI7 A;  3F8K A;  1QSM A;  1IU8 A;  2VBQ A;  4IHM A;  4Y49 C;  2EBJ A;  3R9G A;  1MJA A;  2ANP A;  2ZW6 A;  1M4G A;  1ON0 A;  2GLJ A;  2GIV A;  2PJ5 A;  3H8F A;  3K9T A;  3FIX A;  3PRT A;  4W9Y A;  5AG4 A;  2AFU A;  3DDD A;  1NSA A;  5A27 A;  2RB7 A;  3A9L A;  3R96 A;  4M85 A;  1LAM A;  2QEC A;  3ZZI A;  1CX8 A;  3RYO A;  4R87 A;  2B58 A;  1VGY A;  1LOK A;  4M6I A;  2ATR A;  1NSL A;  4E8O A;  5FVJ A;  2PVV A;  1VHS A;  3CXS A;  4FD4 A;  4NXY A;  2Q43 A;  5IX3 A;  2JEW A;  2IMO A;  5F49 A;  1ELL P;  4C7H A;  2Q4V A;  2GAN A;  4JWP A;  4L8A A;  6CPA A;  3N7Z A;  4A94 A;  2BO9 A;  4UF4 A;  4MY0 A;  4M3S A;  5AGE A;  5HVH A;  1MJB A;  4A32 A;  4AG7 A;  3DSB A;  3MRU A;  2OU2 A;  4ZY2 A;  4ONU A;  3MGD A;  2ZW4 A;  3D7D A;  3S6K A;  3SI1 A;  4F0Y A;  3KAS A;  4MFP A;  3IU1 A;  1NMT A;  2AJ6 A;  3PB4 X;  1U6M A;  2B3V A;  3IIB A;  3S9M A;  4BIN A;  1I12 A;  2HUZ A;  2ZEG A;  2Z11 A;  2VZZ A;  4WWV A;  4RS2 A;  2ABZ A;  5H84 A;  4CAX A;  2R98 A;  4M6H A;  3GIU A;  3QB8 A;  2ZEN A;  3PZJ A;  5CBM A;  2CF4 A;  3H5Z A;  3TOB A;  4NCZ A;  5THW A;  3TFY A;  7CPA A;  4NJR A;  3KR5 A;  3VAR A;  4CPA A;  1TKH A; 
#chains in the Genus database with same CATH homology
 4BBH A;  3C26 A;  5AG7 A;  5HMN A;  2KCW A;  4LX9 A;  4F0X A;  2JDD A;  4KLW A;  4MFK A;  2Q0Y A;  2A4N A;  4FD5 A;  3BJ7 A;  3TO7 A;  2ZW5 A;  2VXK A;  4CRZ B;  2CNS A;  1PUA A;  5G20 A;  3LOD A;  2YNC C;  2WUU A;  4BMH A;  2R7H A;  4IF5 A;  2Z3O A;  4A31 A;  2Z10 A;  4KOY A;  1Q2C A;  2F5I A;  2ARH A;  1P0H A;  5G22 A;  1QSN A;  1QSO A;  1Q2D A;  3P2H A;  4MI4 A;  3W91 A;  2G3A A;  4B12 A;  2Z3M A;  3CXQ A;  1WK4 A;  5AG6 A;  2I79 A;  2DXQ A;  3H4Q A;  1IYK A;  1NE9 A;  1XE4 A;  1S5K A;  4E2A A;  2CY2 A;  3IGR A;  3I3G A;  4JXQ A;  4UWJ A;  4HNY B;  3GYA A;  3W6S A;  3SXN A;  2PDO A;  3JUW A;  3DR8 A;  2BUE A;  4JXR A;  4AB7 A;  2G3T A;  1S60 A;  3FXT A;  2FCK A;  2B4D B;  4KVX A;  4H89 A;  2VZY A;  3R1K A;  2I00 A;  4CYQ A;  1ZO0 A;  3PGP A;  4KVM E;  4U5Y A;  3T90 A;  1YGH A;  2B4D A;  2X7B A;  3DNS A;  4AVA A;  1SQH A;  2K5T A;  1Z4R A;  5ISV A;  1S7F A;  4B10 A;  1YX0 A;  4B11 A;  5KTC A;  4KUB A;  2G0B A;  3EXN A;  5F48 A;  4YFJ A;  4R3K A;  1Y9W A;  2C27 A;  4I49 A;  5I0C A;  2YND A;  5DWM A;  4UBR A;  4ZGY B;  1K4J A;  5DWN A;  4CGL A;  1S7N A;  4B5O A;  3R9E A;  3FYN A;  4MJ8 A;  2IL4 A;  4PSX A;  4CS0 B;  2Y0M A;  4UWI A;  4XNH B;  4KOW A;  4B14 A;  4GS4 A;  2VEZ A;  3KKW A;  3G8W A;  4XNH C;  3TOA A;  2ZPA A;  2FXF A;  4YRH A;  5IV0 A;  5HH1 A;  3R9F A;  1P4N A;  2Q4Y A;  2QIR A;  3FNC A;  3TCV A;  4A2Z A;  2H5M A;  2PR8 A;  2BL1 A;  2QML A;  2Z3K A;  2Z3P A;  2FIA A;  1Q2Y A;  1V0C A;  4KUA A;  2JEV A;  2DPS A;  1XMT A;  4F6A A;  4X5K A;  2O28 A;  2B3U A;  3S6G A;  4QC6 A;  1TIQ A;  4ZBG A;  4XPL A;  1XIX A;  2VQY A;  4MBU A;  3ZJ0 A;  1KUV A;  2Z3N A;  4KOT A;  4OAD A;  3R95 A;  1M1D A;  5IB0 A;  3TE4 A;  3F0A A;  4UA3 A;  5EC4 A;  2FIW A;  4QB9 A;  2Z0Z A;  4XPK A;  5KTA A;  1YR0 A;  1XEB A;  1MK4 A;  2WPX A;  3NE7 A;  2J8R A;  4NEX A;  4PK2 A;  2Q7B A;  4KVO E;  4R57 A;  4CAV A;  3IWG A;  5E96 A;  5H86 A;  4OLL A;  4KLV A;  4MFL A;  3OWC A;  5EBV A;  1LRZ A;  3SHP A;  4C68 A;  2OB0 A;  2HQY A;  5A28 A;  3IWE A;  4JJX A;  4UCN A;  4MFQ A;  4JD6 A;  2CNM A;  4CYO A;  2PRB A;  3TO6 A;  1KZF A;  3LD2 A;  4PK3 A;  2D4O A;  1YK3 A;  4H6U A;  3IU2 A;  4A95 A;  1B87 A;  1Y7R A;  1KUY A;  3GKR A;  4KSA A;  2JDC A;  1RO5 A;  5CNP A;  3QAH A;  4MY3 A;  4UFV A;  4CGO A;  3VWD A;  3D8P A;  2R8V A;  2Q44 A;  4OAE A;  3D3S A;  1R57 A;  5F46 A;  1QSR A;  4CAF A;  3S6F A;  4R3L A;  3BJ8 A;  4HNW B;  4MHD A;  4IUS A;  4AG9 A;  2OZH A;  3JTK A;  4C2Y A;  4AVC A;  4CGP A;  5C88 A;  1IIC A;  4CGN A;  4YGO A;  1M4I A;  1N71 A;  4MFJ A;  1VKC A;  2PSW A;  4RI1 A;  4Y49 B;  3F5B A;  4B5P A;  4DNC A;  1PU9 A;  2REE A;  4A30 A;  3P2F A;  4CGM A;  1XF8 A;  2OH1 A;  4NF1 A;  1M44 A;  4K30 A;  4UFW A;  1UFH A;  2P6F A;  4UFX A;  1I21 A;  4B13 A;  1S7K A;  2RC4 A;  5BWA B;  1J4J A;  1M4D A;  3E0K A;  2FE7 A;  4KOU A;  3I9S A;  4QVT A;  4CRY B;  2GE3 A;  4ORF A;  3D2M A;  3EY5 A;  3TTH A;  2FS5 A;  1WWZ A;  2J8N A;  2P6E A;  1CM0 A;  4HKF A;  5GCN A;  4UCP A;  2ZXV A;  3TT2 A;  1I1D A;  1YRE A;  2BSW A;  1Y9K A;  2EUI A;  4NSQ A;  3S6H A;  4CAW A;  4PV6 A;  3FBU A;  5KTD A;  4FD7 A;  1FY7 A;  3EFA A;  4II9 A;  2J8M A;  3BLN A;  2DPT A;  4CAE A;  4PSW A;  3GY9 A;  3VWE A;  4CYN A;  2P0W A;  2B5G B;  4KSF A;  4U9Z A;  4C7I A;  4R9M A;  5J8C A;  4L89 A;  3JVN A;  3T9Y A;  3TO9 A;  5JPH A;  2BEI A;  3G3S A;  4H6Z A;  2YGW A;  5G1Z A;  2B5G A;  1IID A;  1CJW A;  1QST A;  1Z4E A;  4UCM A;  1KUX A;  3FB3 A;  2PC1 A;  4J3G A;  4QBJ A;  4AVB A;  4LUA A;  1OZP A;  2OZG A;  3SXO A;  4KS9 A;  1YVK A;  4E0A A;  3D2P A;  1IB1 E;  2D4P A;  3CXP A;  2AE6 A;  5AG5 A;  3W6X A;  2WSA A;  2CNT A;  2FSR A;  4A33 A;  5C82 A;  4FD6 A;  4KZT A;  2CXA A;  1S3Z A;  2YNC A;  2ZW7 A;  4MFZ A;  3FRM A;  4EVY A;  1YLE A;  5J8F A;  4XPD B;  3B8G A;  2FL4 A;  5G21 A;  2EVN A;  2P6G A;  4Q36 A;  3V8I A;  2Z3L A;  1IYL A;  2Q04 A;  4KOS A;  4CYP A;  1S7L A;  4XPD C;  3EO4 A;  5JQ4 A;  1RXT A;  2NMT A;  3EC4 A;  2PQ8 A;  4KOV A;  4Q38 A;  1GHE A;  1Z9U A;  1BOB A;  1MJ9 A;  2REF A;  3WR7 A;  4C2X A;  4U9Y A;  4HNX B;  2R1I A;  2HV2 A;  1B6B A;  2B4B A;  4JLY A;  3PP9 A;  1BO4 A;  4KOR A;  4KOX A;  2OZU A;  2PR1 A;  3UY5 A;  1YVO A;  4B5P B;  1L0C A;  2FT0 A;  3DR6 A;  2YNE A;  2JLM A;  2WPW A;  4C2Z A;  3K9U A;  5F47 A;  4QUS A;  2VI7 A;  3F8K A;  1QSM A;  2VBQ A;  4Y49 C;  3R9G A;  1MJA A;  2ZW6 A;  1M4G A;  1ON0 A;  2GIV A;  3FIX A;  5AG4 A;  3DDD A;  5A27 A;  3A9L A;  3R96 A;  4M85 A;  2QEC A;  3ZZI A;  3RYO A;  4R87 A;  2B58 A;  1NSL A;  2ATR A;  4E8O A;  5FVJ A;  1VHS A;  3CXS A;  4FD4 A;  4NXY A;  5IX3 A;  5F49 A;  4C7H A;  2Q4V A;  2GAN A;  4JWP A;  4L8A A;  3N7Z A;  5AGE A;  4MY0 A;  4M3S A;  1MJB A;  4A32 A;  4AG7 A;  3DSB A;  2OU2 A;  4ONU A;  3MGD A;  2ZW4 A;  3S6K A;  4F0Y A;  4MFP A;  3IU1 A;  1NMT A;  2AJ6 A;  1U6M A;  2B3V A;  1I12 A;  2HUZ A;  2Z11 A;  2VZZ A;  4RS2 A;  4CAX A;  5H84 A;  2R98 A;  3QB8 A;  3PZJ A;  3H5Z A;  3TOB A;  4NCZ A;  3TFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...