5H84A

Human gcn5 bound to propionyl-coa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase KAT2A
publication title Structural basis for acyl-group discrimination by human Gcn5L2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 164
sequence length 164
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5h84A00
3TO6A 1PU9A 3GYAA 3LODA 1IIDA 2BUEA 4UWJA 3FRMA 4PK2A 2X7BA 3FNCA 4KZTA 2FT0A 3SHPA 3S6FA 1CM0A 1YREA 2G0BA 1S5KA 5H84A 4ONUA 2C27A 2AJ6A 1VKCA 3RYOA 1K4JA 4KOUA 4XNHB 5KTCA 1LRZA 1I12A 1NMTA 2WPWA 3TCVA 5E96A 1YGHA 4U5YA 1WK4A 1GHEA 4Y49B 4HNWB 5I0CA 5J8CA 1Y9WA 4YFJA 3PGPA 2HUZA 3F8KA 4F0YA 2I00A 2GE3A 1S7KA 4FD7A 1Y9KA 4KOWA 1M4GA 1PUAA 3B8GA 2PC1A 3T90A 1RXTA 1NE9A 3EO4A 2Z10A 3CXPA 3N7ZA 5KTDA 3CXSA 1V0CA 3TOAA 1I21A 4KOYA 3JVNA 4KVXA 3NE7A 1IB1E 4KLVA 4HNXB 2B58A 1RO5A 1Q2CA 3CXQA 4KORA 2FE7A 3ZJ0A 1KUVA 2VBQA 1KUYA 3MGDA 3GKRA 4JD6A 3TO7A 4K30A 5IX3A 2FIWA 2PQ8A 2BL1A 4ZBGA 2GANA 3VWDA 3FB3A 4E8OA 2HV2A 4L89A 3QAHA 4ORFA 2CY2A 1VHSA 4XPKA 1Q2YA 2FIAA 3V8IA 2Z0ZA 4KUBA 1XF8A 2I79A 3W91A 4M3SA 2B4DB 3DDDA 5DWNA 2JDCA 2Q0YA 4AG9A 2P0WA 1OZPA 1YVKA 4KLWA 2VZZA 2NMTA 3BJ8A 3TOBA 1M1DA 3TO9A 4PSXA 4CAVA 4UA3A 2HQYA 1XE4A 2ZW4A 4QBJA 1J4JA 1BO4A 3W6XA 4MY0A 1NSLA 4HKFA 4CAXA 2FCKA 4PK3A 2Q04A 4XPLA 3EC4A 3D3SA 2A4NA 2PR1A 4JXRA 1YVOA 2P6GA 3H4QA 3R95A 4KOSA 2KCWA 2ZW5A 1YX0A 3DSBA 5ISVA 3DR6A 4XNHC 1UFHA 1U6MA 2Y0MA 1YR0A 4AVCA 2ZW6A 4LX9A 4M85A 4CRZB 2B3VA 3UY5A 2P6FA 1P4NA 4R3LA 4Y49C 2ZXVA 2OZUA 1IICA 1XEBA 1YLEA 3LD2A 3P2FA 2WPXA 1Z4RA 1MJBA 4RI1A 3F5BA 4B5PA 1FY7A 1QSRA 4AG7A 4AVBA 2CNTA 5HMNA 2B3UA 4JJXA 4KOVA 4CRYB 2RC4A 3R9FA 4RS2A 3R9GA 1B87A 2D4PA 3DNSA 2R98A 1Z9UA 3S6GA 3ZZIA 1QSTA 4BMHA 2EUIA 4MHDA 4F6AA 2PR8A 2IL4A 3BLNA 2REFA 4GS4A 2QMLA 4MBUA 5GCNA 1N71A 1XIXA 1CJWA 4KOXA 2BEIA 2VI7A 1M4IA 1KZFA 2B5GA 2G3AA 3PZJA 4YGOA 1Q2DA 3EFAA 1S7NA 4NCZA 4IUSA 5DWMA 4QC6A 4QUSA 1P0HA 4U9YA 2F5IA 2QECA 1QSNA 1TIQA 2FS5A 4UBRA 4JLYA 5F46A 4J3GA 2OZHA 2O28A 5EBVA 2K5TA 4OADA 2VQYA 4FD5A 3JUWA 2OH1A 3VWEA 2VEZA 2Z11A 1S60A 4JWPA 4NF1A 4PV6A 4X5KA 5C82A 2PRBA 4NEXA 4NXYA 4UWIA 1S7FA 2REEA 3W6SA 2OZGA 1ON0A 2ZPAA 3SXNA 3PP9A 5H86A 2J8NA 3FIXA 2OB0A 4KVOE 3KKWA 1MJAA 1M4DA 4R87A 1IYLA 4XPDC 3R1KA 4XPDB 1WWZA 3EXNA 3S6HA 4KOTA 2FL4A 3EY5A 2Q7BA 2H5MA 3K9UA 3QB8A 4OLLA 3DR8A 2B4BA 3TTHA 1R57A 4CAWA 2CNMA 3D2MA 3E0KA 3FXTA 2BSWA 3R96A 2R8VA 1QSOA 4E2AA 3S6KA 4H6UA 2JDDA 4YRHA 1M44A 2VXKA 2D4OA 1XMTA 4NSQA 1S3ZA 4E0AA 4KUAA 4QB9A 3FYNA 4PSWA 3F0AA 2JEVA 1SQHA 4R57A 3D2PA 2AE6A 2R1IA 3D8PA 4MJ8A 5IV0A 4R9MA 5C88A 3OWCA 4H6ZA 3TE4A 3I9SA 5CNPA 2J8RA 4CS0B 2ZW7A 4HNYB 3BJ7A 4B5OA 1L0CA 4R3KA 4EVYA 1BOBA 2JLMA 4MI4A 2Q4VA 2B4DA 2DXQA 3GY9A 2PSWA 3FBUA 4II9A 4LUAA 5F48A 3C26A 2ATRA 4QVTA 1QSMA 1YK3A 5F47A 2G3TA 5EC4A 5JQ4A 4IF5A 5KTAA 3IWGA 2OU2A 2EVNA 4B5PB 1MK4A 3R9EA 4L8AA 5FVJA 1IYKA 1S7LA 5F49A 2J8MA 2Q4YA 1B6BA 3WR7A 5J8FA 2CNSA 1KUXA 5HH1A 4MY3A 4FD6A 4DNCA 4H89A 4FD4A 1Z4EA 4U9ZA 2FXFA 2VZYA 4I49A 1Y7RA 3TFYA 2QIRA 2ARHA 3G8WA 4KVME 3SXOA 2GIVA 3TT2A 2B5GB 4AVAA 2Q44A 2R7HA 1MJ9A 2PDOA 3IGRA 1I1DA 3G3SA 4OAEA 4JXQA 3P2HA 4AB7A 3T9YA 3I3GA 2FSRA 2P6EA 5IB0A 5JPHA
chains in the Genus database with same CATH superfamily
4UEFA 1PU9A 2QVPA 3GYAA 3PB4X 3TO6A 4C7HA 4ONWA 4OC5A 2Z3LA 5DS0A 2XEIA 3LODA 1IIDA 2BUEA 4UWJA 3GIUA 3FRMA 3JTKA 5G1ZA 4CGMA 4MFZA 2X7BA 4PK2A 4FAIA 2I3CA 5HVGA 2Z3KA 4A30A 3FNCA 4KZTA 1BPNA 2FT0A 3CDXA 2VL1A 4CGOA 4M6GA 3SHPA 1CG2A 3S6FA 1CM0A 1YREA 5G20A 2XEJA 2JBKA 2G0BA 1Q7LA 1S5KA 5H84A 3V7ZA 4ONUA 2C27A 2AJ6A 4MCSA 1VKCA 3CZXA 3D66A 3QAYA 3RYOA 1K4JA 4KOUA 4XNHB 4CYNA 5KTCA 1LRZA 1I12A 1NMTA 2Z3NA 2GFQA 2WPWA 3TCVA 1RTQA 2QYVA 4M6IA 5E96A 1YGHA 3D7HA 4U5YA 1WK4A 2PJ0A 4A2ZA 1GHEA 4Y49B 4HNWB 5I0CA 2V8GA 5J8CA 1Y9WA 1H8LA 5HVHA 3S9LA 5HVFA 2EBJA 3KL9A 3PFEA 4YFJA 3PEIA 3PGPA 2HUZA 2ZELA 3F8KA 4F0YA 2I00A 2GE3A 1S7KA 1BAVA 2DF5A 4FD7A 3JRUA 4ZY0A 3TX8A 1Y9KA 2F8HA 4KOWA 3KQXA 3FECA 1PCAA 3SJFA 4WJBA 3FEEA 3RZAA 1LANA 4UCNA 4Z65A 1M4GA 4TWEA 1HDQA 3K9TA 2HB6A 4MHYA 2PJ5A 1PUAA 3B8GA 2PC1A 3D7DA 4F9VA 1TKHA 3PB6X 1VHEA 2AFXA 3T90A 1RXTA 1NE9A 1ARMA 3EO4A 4EFDA 2Z10A 4FBEA 1ZLIA 1AMPA 1AYEA 3B3TA 4ZI6A 3CXPA 4OC4A 3N7ZA 5KTDA 3CXSA 3IO1A 1NSAA 1V0CA 4UCPA 1I21A 4KOYA 1CX8A 3JVNA 5AG6A 3TOAA 4B10A 4KVXA 4C2ZA 3NE7A 1IB1E 2PJ4A 4KLVA 4HNXB 2B58A 1RO5A 4CGPA 1Q2CA 3HLPA 3CXQA 4B12A 1F2PA 4KORA 5K8OA 2ANPA 4MXUA 7CPAA 3HUVA 2IJZA 2FE7A 1Z8LA 4Q7AA 3IC1A 3ZJ0A 1KUVA 4RUHA 3NH8A 2PVWA 2VBQA 4MMOA 3D4UA 4MCRA 1KUYA 3MGDA 2GLJA 3GKRA 2PVVA 4JD6A 3TO7A 2PRQA 3DLJA 4DUKA 4P4BA 2O53A 3KR4A 4K30A 5IB9A 4A38A 5IX3A 1QQ9A 2FIWA 2PQ8A 5J1QA 3CT9A 2BL1A 4NGQA 5THWA 4ZBGA 2GANA 3VWDA 3FB3A 2V8DA 5K8NA 1ZLHA 4E8OA 8CPAA 3GB0A 2HV2A 3WC6A 2ZEPA 4L89A 3SJGA 3NH4A 3NE8A 3QAHA 3LWUA 2C1CA 4ORFA 5AG7A 2CY2A 5EMIA 1VHSA 2ABZA 4KSIA 4XPKA 1Q2YA 3PRTA 3FH4A 2FIAA 4UFXA 2Z0ZA 3V8IA 4MCPA 3MN8A 4PXEA 4KUBA 3IU2A 1XF8A 2I79A 3W91A 4M3SA 2B4DB 4ZX9A 5AG4A 3DDDA 2C6CA 5DWNA 2JDCA 2Q0YA 4AG9A 2EO8A 2P0WA 1OZPA 2IQ6A 1YVKA 1ELMP 3QNVA 3S9MA 4KLWA 2VZZA 5LYDA 2PJ6A 3SI2A 2NMTA 3BJ8A 2ZOFA 3TOBA 1M1DA 1TF9A 2PE3A 3TO9A 1ZG9A 4PSXA 4CAVA 4A95A 3IWEA 4UA3A 2HQYA 1JWQA 1XE4A 2ZW4A 3LACA 2DPTA 3VATA 3WABA 4QBJA 3IU1A 4CGNA 1J4JA 1CPSA 1BO4A 4MHPA 3W6XA 1TKJA 4MY0A 4TNUA 1XBUA 4HKFA 1NSLA 3SJEA 4CAXA 2FCKA 4P44A 5LRJA 4PK3A 1CBXA 4NJRA 1KWMA 3TC8A 2NSMA 1BPMA 2OOTA 2HC9A 2Q04A 3B3VA 3BI1A 2V8HA 3EC4A 4XPLA 3D3SA 2A4NA 2PR1A 1XFOA 3FX6A 4JXRA 1YVOA 4CYQA 4NJQA 2P6GA 3SI1A 3GUXA 3H4QA 3R95A 4KOSA 2KCWA 4MHZA 2ZW5A 3WC5A 1YX0A 3DSBA 4UFWA 4IK2A 4OIWA 5ISVA 3DR6A 4UEEA 1CPXA 4XNHC 1UFHA 1Y0RA 2DPSA 4X2TA 1U6MA 2Z3PA 2Y0MA 1YR0A 2BOAA 2PJAA 4AVCA 1R43A 2ZW6A 4LX9A 4M85A 2B3VA 4CRZB 3UY5A 4P4JA 1LCPA 5HXDA 2IMOA 2P6FA 1P4NA 2PJ7A 4R3LA 4Y49C 4UFVA 2ZXVA 1Z8TA 2Q43A 1TXRA 1IOIA 4B11A 2OZUA 4MFQA 4BBHA 1Z8XA 4CYOA 1IICA 5CBMA 1X12A 1XEBA 1YLEA 2RB7A 4GXHA 3RAMA 3H8GA 2JBJA 4P4EA 3LD2A 3P2FA 2WPXA 2BO9A 1Z4RA 1MJBA 2YNEA 4G1PA 4RI1A 5BWAB 3F5BA 4B5PA 4LQGA 1FY7A 2CF4A 2YNCA 2GREA 1QSRA 3B3WA 2DEAA 2PIZA 4AG7A 2AFMA 2CNTA 3FMCA 4AVBA 4EMEA 2FVGA 5HMNA 2B3UA 3D67A 4CGLA 3BHXA 4JJXA 4KOVA 5A28A 4OMEA 4CRYB 4X8IA 2RC4A 1ZG7A 3KI9A 3R9FA 3KGQA 3IEHA 4RS2A 1Z2LA 3R9GA 4P6YA 1B87A 1QMUA 2D4PA 3DNSA 4MFJA 2R98A 1ELLP 2BCOA 3D68A 1Z9UA 4OC1A 3VARA 3S6GA 3ZZIA 1M4LA 2WYRA 1IU8A 1QSTA 2GU2A 1YMEA 4A33A 4BMHA 4C7IA 2EUIA 4EWTA 4MHDA 1VGYA 4F6AA 2PR8A 4ZX8A 2IL4A 3BLNA 2REFA 4GS4A 2QMLA 4MBUA 1LFWA 5GCNA 4BD9A 3LMSA 1IY7A 3NH5A 4GM5A 1DTDA 5LRGA 2ZEOA 4PXBA 1N71A 1LOKA 1XIXA 3IFEA 2ZEMA 4O23A 1CJWA 4NGSA 4KOXA 5JH9A 2BEIA 2VI7A 1M4IA 1Y0YA 2F7VA 4X3RA 1KZFA 2B5GA 4ZY1A 4KSFA 4C2XA 2G3AA 5LYLA 3PZJA 1XOVA 1Q2DA 2AFZA 3EFAA 1S7NA 2RFHA 4NCZA 3NA6A 4OP4A 4YGOA 4IUSA 5DWMA 2AFUA 4P45A 2CXAA 3GLJA 1HDUA 2ZEHA 4QC6A 4QUSA 1P0HA 2V8VA 4R76A 4C2YA 2EWBA 4U9YA 2PJ3A 5K8MA 2F5IA 1DE4C 2QECA 1QSNA 4OKOA 1TIQA 2FS5A 3ISZA 4UBRA 4JLYA 5F46A 4J3GA 4NFRA 2C6PA 1PYTB 3ISXA 3PBBA 4OC3A 2OZHA 2O28A 2PJCA 4RN7A 4UEZA 5EBVA 2K5TA 4LQ6A 1FNOA 3KASA 4OADA 2VQYA 4MFKA 4FD5A 4F9UA 4MRIA 1LAPA 3JUWA 3B7IA 2OH1A 1F2OA 3VWEA 4B14A 2VEZA 2Z11A 1S60A 4JWPA 4NF1A 4PV6A 1UWYA 4NGPA 3WT4A 4BINA 4X5KA 5C82A 4JYWA 2PRBA 2PJ8A 4NEXA 4NXYA 4OC2A 4UWIA 1S7FA 2REEA 3W6SA 4ZYQA 2OZGA 3BXMA 1ON0A 3RO0A 4DYOA 4W9YA 2NYQA 4FWUA 5G21A 2PJBA 2ZPAA 4DJLA 4CYPA 4M6HA 2Z3OA 4A32A 3SXNA 4YWYA 5CPAA 1XMBA 3PP9A 5H86A 5LYIA 5I4MA 2J8NA 3FIXA 2OB0A 4KVOE 3KKWA 1AUGA 1MJAA 1M4DA 2C6GA 5K8PA 4P4DA 4R87A 2CIJA 1JQGA 4F8ZA 4PXDA 1IYLA 2PIYA 4XPDC 5JM6A 3R1KA 4FUUA 4XPDB 3FEDA 2WSAA 1WWZA 3EXNA 3S6HA 3CPXA 4CAEA 4KOTA 2FL4A 2Z3MA 3EY5A 3K2KA 2Q7BA 1VIXA 2H5MA 3K9UA 3QB8A 1EE3P 4OLLA 3WC7A 3DR8A 2B4BA 2ZOGA 3BI0A 1YSJA 1R57A 3D7FA 3TTHA 2CTCA 1YW6A 2PCUA 4P4IA 1FT7A 1F57A 4CAWA 2ZENA 2CNMA 1LAMA 3D2MA 1Z5RA 5LRKA 3E0KA 4ZGYB 3FXTA 2BSWA 1HEEA 2EK8A 2R8VA 1ZO0A 1QSOA 3R96A 4KSAA 4E2AA 1Y7EA 3S6KA 5F09A 4Q38A 4H6UA 2JDDA 4C68A 4YRHA 1M44A 2VXKA 3RBUA 2D4OA 4MFLA 3SI0A 4R8FA 1XMTA 2XEGA 4NSQA 1S3ZA 4E0AA 3PB7X 4KUAA 2PJ2A 3PFOA 4QB9A 1TKFA 3FYNA 3FVLA 3PB9X 4PSWA 3F0AA 2JEVA 1SQHA 4R57A 3D2PA 2CTBA 3T8WA 2AE6A 4B6ZA 2G9DA 1OBRA 2Q4ZA 4UIBA 3IIBA 4IHMA 2R1IA 4NGTA 3D8PA 4MJ8A 5IV0A 4R9MA 2PJ9A 5C88A 4CPAA 5JGFA 3OWCA 4H6ZA 1CP7A 3TE4A 5AG5A 2ODFA 3I9SA 5LYFA 1Z8WA 5CNPA 3RNZA 2V77A 3D7GA 4K3NA 2J8RA 4CS0B 3I1UA 5AGEA 2ZW7A 4HNYB 3B35A 3BJ7A 4B5OA 1L0CA 1VHOA 4JZ0A 2XEFA 4R3KA 4EVYA 1BOBA 2JLMA 4MI4A 2Q4VA 2B4DA 2DXQA 2O4HA 3GY9A 2PSWA 2JEWA 3FBUA 4II9A 1TF8A 2Q7SA 5D29A 4LUAA 5F48A 3C26A 3VH9A 1BLLE 5D8NA 3B2YA 2ATRA 3H5ZA 4QVTA 3SJXA 3KZWA 3NFZA 4OC0A 1QSMA 1YK3A 4F0XA 4Q36A 5F47A 2G3TA 3IJ3A 5EC4A 3H8FA 3V38A 3IWWA 5JQ4A 4IF5A 1GYTA 1X10A 4KS9A 5KTAA 3H8EA 2YGWA 3KQZA 3L2NA 3IWGA 2YNDA 1R3NA 2OU2A 3KR5A 2EVNA 1ARLA 4B5PB 1XJOA 2YNCC 4ZY2A 1MK4A 5G22A 3FF3A 4PXCA 4R7MA 3R9EA 4L8AA 5FVJA 4P10A 6CPAA 1IYKA 1S7LA 5F49A 3B3SA 4HPSA 2J8MA 3PBEA 4WWVA 2POKA 2Q4YA 4P4FA 5ELYA 1B6BA 4PPZA 3WR7A 5A27A 4MFPA 5J8FA 2CNSA 1KUXA 2J9AA 5HH1A 4MY3A 2WUUA 2ZEFA 4A94A 1ZG8A 4FD6A 4NGNA 3N5FA 4OIDA 4AXVA 4B13A 4DNCA 2P6EA 4H89A 4FD4A 4NGRA 4A37A 1Z4EA 2WZNA 1YW4A 4H2KA 3DGVA 4U9ZA 3FJUA 2FXFA 2AFSA 4A39A 4A31A 4UCMA 2VZYA 3B3CA 4I49A 2QJ8A 1Y7RA 3TFYA 2QIRA 2ARHA 3G8WA 4KVME 1YLOA 3SXOA 4UF4A 4UIAA 2GIVA 2GLFA 1IGBA 3TT2A 2ZEDA 1A2ZA 1XRYA 4MHNA 1YQEA 2B5GB 2Q51A 3MRUA 4IAVA 3S9NA 4MCQA 1IOFA 2Q44A 4AVAA 2R7HA 4R6TA 1CP6A 3CPAA 1MJ9A 2PDOA 3IGRA 3KHZA 4YU9A 1I1DA 4CAFA 3G3SA 2PJ1A 3A9LA 4NGMA 4OAEA 4PQAA 3PB8X 3KHXA 4JXQA 2ZEGA 2AFWA 2ZEEA 2OR4A 3P2HA 4AB7A 3T9YA 2AFOA 3I3GA 2FSRA 2EK9A 5IB0A 5JPHA
chains in the Genus database with same CATH topology
3TO6A 1PU9A 3GYAA 4C7HA 2Z3LA 3LODA 1IIDA 2BUEA 4UWJA 3JTKA 3FRMA 4CGMA 5G1ZA 4MFZA 2X7BA 4PK2A 2Z3KA 4A30A 3FNCA 4KZTA 2FT0A 4CGOA 3SHPA 3S6FA 1CM0A 1YREA 5G20A 2G0BA 1S5KA 5H84A 4ONUA 2C27A 2AJ6A 1VKCA 3RYOA 1K4JA 4KOUA 4XNHB 5KTCA 1LRZA 1I12A 1NMTA 2Z3NA 2WPWA 3TCVA 5E96A 1YGHA 4U5YA 1WK4A 4A2ZA 1GHEA 4Y49B 4HNWB 5I0CA 5J8CA 1Y9WA 4YFJA 3PGPA 2HUZA 3F8KA 4F0YA 2I00A 2GE3A 1S7KA 4FD7A 1Y9KA 4KOWA 4UCNA 1M4GA 1PUAA 3B8GA 2PC1A 3T90A 1RXTA 1NE9A 3EO4A 2Z10A 3CXPA 3N7ZA 5KTDA 3CXSA 4UCPA 1V0CA 5AG6A 1I21A 4KOYA 3JVNA 3TOAA 4B10A 4KVXA 4C2ZA 3NE7A 1IB1E 4KLVA 4HNXB 2B58A 1RO5A 4CGPA 1Q2CA 3CXQA 4B12A 4KORA 2FE7A 3ZJ0A 1KUVA 2VBQA 1KUYA 3MGDA 3GKRA 4JD6A 3TO7A 4K30A 5IX3A 2FIWA 2PQ8A 2BL1A 4ZBGA 2GANA 3VWDA 3FB3A 4E8OA 2HV2A 4L89A 3QAHA 5AG7A 4ORFA 2CY2A 1VHSA 4XPKA 1Q2YA 4UFXA 2FIAA 3V8IA 2Z0ZA 4KUBA 3IU2A 1XF8A 2I79A 3W91A 4M3SA 2B4DB 5AG4A 3DDDA 5DWNA 2JDCA 2Q0YA 4AG9A 2P0WA 1OZPA 1YVKA 4KLWA 2VZZA 4B11A 4CYNA 2NMTA 3BJ8A 3TOBA 1M1DA 3TO9A 4PSXA 4CAVA 4A95A 3IWEA 4UA3A 2HQYA 1XE4A 2ZW4A 2DPTA 4QBJA 3IU1A 4CGNA 1J4JA 1BO4A 3W6XA 4MY0A 1NSLA 4HKFA 4CAXA 2FCKA 4PK3A 2Q04A 4XPLA 3EC4A 3D3SA 2A4NA 2PR1A 4JXRA 1YVOA 4CYQA 2P6GA 3H4QA 3R95A 4KOSA 2KCWA 2ZW5A 1YX0A 3DSBA 4UFWA 5ISVA 3DR6A 4XNHC 1UFHA 2DPSA 1U6MA 2Z3PA 2Y0MA 1YR0A 4AVCA 2ZW6A 4LX9A 4M85A 4CRZB 2B3VA 3UY5A 2P6FA 1P4NA 4R3LA 4Y49C 4UFVA 2ZXVA 2OZUA 4MFQA 4BBHA 4CYOA 1IICA 1XEBA 1YLEA 3LD2A 3P2FA 2WPXA 1Z4RA 1MJBA 2YNEA 4RI1A 5BWAB 3F5BA 4B5PA 1FY7A 2YNCA 1QSRA 4AG7A 4AVBA 2CNTA 5HMNA 2B3UA 4CGLA 4JJXA 4KOVA 5A28A 4CRYB 2RC4A 3R9FA 4RS2A 3R9GA 1B87A 2D4PA 3DNSA 4MFJA 2R98A 1Z9UA 3S6GA 3ZZIA 1QSTA 4A33A 4BMHA 4C7IA 2EUIA 4MHDA 4F6AA 2PR8A 2IL4A 3BLNA 2REFA 4GS4A 2QMLA 4MBUA 5GCNA 1N71A 1XIXA 1CJWA 4KOXA 2BEIA 2VI7A 1M4IA 1KZFA 2B5GA 4KSFA 4C2XA 2G3AA 3PZJA 4YGOA 1Q2DA 3EFAA 1S7NA 4NCZA 4IUSA 5DWMA 2CXAA 4QC6A 4QUSA 1P0HA 4C2YA 4U9YA 2F5IA 2QECA 1QSNA 1TIQA 2FS5A 4UBRA 4JLYA 5F46A 4J3GA 2OZHA 2O28A 5EBVA 2K5TA 4OADA 2VQYA 4MFKA 4FD5A 3JUWA 2OH1A 3VWEA 4B14A 2VEZA 2Z11A 1S60A 4JWPA 4NF1A 4PV6A 4X5KA 5C82A 2PRBA 4NEXA 4NXYA 4UWIA 1S7FA 2REEA 3W6SA 2OZGA 1ON0A 5G21A 2ZPAA 4CYPA 2Z3OA 4A32A 3SXNA 3PP9A 5H86A 2J8NA 3FIXA 2OB0A 4KVOE 3KKWA 1MJAA 1M4DA 4R87A 1IYLA 4XPDC 3R1KA 4XPDB 2WSAA 1WWZA 3EXNA 3S6HA 4CAEA 4KOTA 2FL4A 2Z3MA 3EY5A 2Q7BA 2H5MA 3K9UA 3QB8A 4OLLA 3DR8A 2B4BA 3TTHA 1R57A 4CAWA 2CNMA 3D2MA 3E0KA 4ZGYB 3FXTA 2BSWA 3R96A 2R8VA 1ZO0A 1QSOA 4KSAA 4E2AA 3S6KA 4Q38A 4H6UA 2JDDA 4C68A 4YRHA 1M44A 2VXKA 2D4OA 4MFLA 1XMTA 4NSQA 1S3ZA 4E0AA 4KUAA 4QB9A 3FYNA 4PSWA 3F0AA 2JEVA 1SQHA 4R57A 3D2PA 2AE6A 2R1IA 3D8PA 4MJ8A 5IV0A 4R9MA 5C88A 3OWCA 4H6ZA 3TE4A 5AG5A 3I9SA 5CNPA 2J8RA 4CS0B 5AGEA 2ZW7A 4HNYB 3BJ7A 4B5OA 1L0CA 4R3KA 4EVYA 1BOBA 2JLMA 4MI4A 2Q4VA 2B4DA 2DXQA 3GY9A 2PSWA 3FBUA 4II9A 4LUAA 5F48A 3C26A 2ATRA 3H5ZA 4QVTA 1QSMA 1YK3A 4F0XA 4Q36A 5F47A 2G3TA 5EC4A 5JQ4A 4IF5A 4KS9A 5KTAA 2YGWA 3IWGA 2YNDA 2OU2A 2EVNA 4B5PB 2YNCC 1MK4A 5G22A 3R9EA 4L8AA 5FVJA 1IYKA 1S7LA 5F49A 2J8MA 2Q4YA 1B6BA 3WR7A 5A27A 4MFPA 5J8FA 2CNSA 1KUXA 5HH1A 4MY3A 2WUUA 4FD6A 4B13A 4DNCA 4H89A 4FD4A 1Z4EA 4U9ZA 2FXFA 4A31A 4UCMA 2VZYA 4I49A 1Y7RA 3TFYA 2QIRA 2ARHA 3G8WA 4KVME 3SXOA 2GIVA 3TT2A 2B5GB 4AVAA 2Q44A 2R7HA 1MJ9A 2PDOA 3IGRA 1I1DA 4CAFA 3G3SA 3A9LA 4OAEA 4JXQA 3P2HA 4AB7A 3T9YA 3I3GA 2FSRA 2P6EA 5IB0A 5JPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  1PU9 A;  3GYA A;  3LOD A;  1IID A;  2BUE A;  4UWJ A;  3FRM A;  4PK2 A;  2X7B A;  3FNC A;  4KZT A;  2FT0 A;  3SHP A;  3S6F A;  1CM0 A;  1YRE A;  2G0B A;  1S5K A;  5H84 A;  4ONU A;  2C27 A;  2AJ6 A;  1VKC A;  3RYO A;  1K4J A;  4KOU A;  4XNH B;  5KTC A;  1LRZ A;  1I12 A;  1NMT A;  2WPW A;  3TCV A;  5E96 A;  1YGH A;  4U5Y A;  1WK4 A;  1GHE A;  4Y49 B;  4HNW B;  5I0C A;  5J8C A;  1Y9W A;  4YFJ A;  3PGP A;  2HUZ A;  3F8K A;  4F0Y A;  2I00 A;  2GE3 A;  1S7K A;  4FD7 A;  1Y9K A;  4KOW A;  1M4G A;  1PUA A;  3B8G A;  2PC1 A;  3T90 A;  1RXT A;  1NE9 A;  3EO4 A;  2Z10 A;  3CXP A;  3N7Z A;  5KTD A;  3CXS A;  1V0C A;  3TOA A;  1I21 A;  4KOY A;  3JVN A;  4KVX A;  3NE7 A;  1IB1 E;  4KLV A;  4HNX B;  2B58 A;  1RO5 A;  1Q2C A;  3CXQ A;  4KOR A;  2FE7 A;  3ZJ0 A;  1KUV A;  2VBQ A;  1KUY A;  3MGD A;  3GKR A;  4JD6 A;  3TO7 A;  4K30 A;  5IX3 A;  2FIW A;  2PQ8 A;  2BL1 A;  4ZBG A;  2GAN A;  3VWD A;  3FB3 A;  4E8O A;  2HV2 A;  4L89 A;  3QAH A;  4ORF A;  2CY2 A;  1VHS A;  4XPK A;  1Q2Y A;  2FIA A;  3V8I A;  2Z0Z A;  4KUB A;  1XF8 A;  2I79 A;  3W91 A;  4M3S A;  2B4D B;  3DDD A;  5DWN A;  2JDC A;  2Q0Y A;  4AG9 A;  2P0W A;  1OZP A;  1YVK A;  4KLW A;  2VZZ A;  2NMT A;  3BJ8 A;  3TOB A;  1M1D A;  3TO9 A;  4PSX A;  4CAV A;  4UA3 A;  2HQY A;  1XE4 A;  2ZW4 A;  4QBJ A;  1J4J A;  1BO4 A;  3W6X A;  4MY0 A;  1NSL A;  4HKF A;  4CAX A;  2FCK A;  4PK3 A;  2Q04 A;  4XPL A;  3EC4 A;  3D3S A;  2A4N A;  2PR1 A;  4JXR A;  1YVO A;  2P6G A;  3H4Q A;  3R95 A;  4KOS A;  2KCW A;  2ZW5 A;  1YX0 A;  3DSB A;  5ISV A;  3DR6 A;  4XNH C;  1UFH A;  1U6M A;  2Y0M A;  1YR0 A;  4AVC A;  2ZW6 A;  4LX9 A;  4M85 A;  4CRZ B;  2B3V A;  3UY5 A;  2P6F A;  1P4N A;  4R3L A;  4Y49 C;  2ZXV A;  2OZU A;  1IIC A;  1XEB A;  1YLE A;  3LD2 A;  3P2F A;  2WPX A;  1Z4R A;  1MJB A;  4RI1 A;  3F5B A;  4B5P A;  1FY7 A;  1QSR A;  4AG7 A;  4AVB A;  2CNT A;  5HMN A;  2B3U A;  4JJX A;  4KOV A;  4CRY B;  2RC4 A;  3R9F A;  4RS2 A;  3R9G A;  1B87 A;  2D4P A;  3DNS A;  2R98 A;  1Z9U A;  3S6G A;  3ZZI A;  1QST A;  4BMH A;  2EUI A;  4MHD A;  4F6A A;  2PR8 A;  2IL4 A;  3BLN A;  2REF A;  4GS4 A;  2QML A;  4MBU A;  5GCN A;  1N71 A;  1XIX A;  1CJW A;  4KOX A;  2BEI A;  2VI7 A;  1M4I A;  1KZF A;  2B5G A;  2G3A A;  3PZJ A;  4YGO A;  1Q2D A;  3EFA A;  1S7N A;  4NCZ A;  4IUS A;  5DWM A;  4QC6 A;  4QUS A;  1P0H A;  4U9Y A;  2F5I A;  2QEC A;  1QSN A;  1TIQ A;  2FS5 A;  4UBR A;  4JLY A;  5F46 A;  4J3G A;  2OZH A;  2O28 A;  5EBV A;  2K5T A;  4OAD A;  2VQY A;  4FD5 A;  3JUW A;  2OH1 A;  3VWE A;  2VEZ A;  2Z11 A;  1S60 A;  4JWP A;  4NF1 A;  4PV6 A;  4X5K A;  5C82 A;  2PRB A;  4NEX A;  4NXY A;  4UWI A;  1S7F A;  2REE A;  3W6S A;  2OZG A;  1ON0 A;  2ZPA A;  3SXN A;  3PP9 A;  5H86 A;  2J8N A;  3FIX A;  2OB0 A;  4KVO E;  3KKW A;  1MJA A;  1M4D A;  4R87 A;  1IYL A;  4XPD C;  3R1K A;  4XPD B;  1WWZ A;  3EXN A;  3S6H A;  4KOT A;  2FL4 A;  3EY5 A;  2Q7B A;  2H5M A;  3K9U A;  3QB8 A;  4OLL A;  3DR8 A;  2B4B A;  3TTH A;  1R57 A;  4CAW A;  2CNM A;  3D2M A;  3E0K A;  3FXT A;  2BSW A;  3R96 A;  2R8V A;  1QSO A;  4E2A A;  3S6K A;  4H6U A;  2JDD A;  4YRH A;  1M44 A;  2VXK A;  2D4O A;  1XMT A;  4NSQ A;  1S3Z A;  4E0A A;  4KUA A;  4QB9 A;  3FYN A;  4PSW A;  3F0A A;  2JEV A;  1SQH A;  4R57 A;  3D2P A;  2AE6 A;  2R1I A;  3D8P A;  4MJ8 A;  5IV0 A;  4R9M A;  5C88 A;  3OWC A;  4H6Z A;  3TE4 A;  3I9S A;  5CNP A;  2J8R A;  4CS0 B;  2ZW7 A;  4HNY B;  3BJ7 A;  4B5O A;  1L0C A;  4R3K A;  4EVY A;  1BOB A;  2JLM A;  4MI4 A;  2Q4V A;  2B4D A;  2DXQ A;  3GY9 A;  2PSW A;  3FBU A;  4II9 A;  4LUA A;  5F48 A;  3C26 A;  2ATR A;  4QVT A;  1QSM A;  1YK3 A;  5F47 A;  2G3T A;  5EC4 A;  5JQ4 A;  4IF5 A;  5KTA A;  3IWG A;  2OU2 A;  2EVN A;  4B5P B;  1MK4 A;  3R9E A;  4L8A A;  5FVJ A;  1IYK A;  1S7L A;  5F49 A;  2J8M A;  2Q4Y A;  1B6B A;  3WR7 A;  5J8F A;  2CNS A;  1KUX A;  5HH1 A;  4MY3 A;  4FD6 A;  4DNC A;  4H89 A;  4FD4 A;  1Z4E A;  4U9Z A;  2FXF A;  2VZY A;  4I49 A;  1Y7R A;  3TFY A;  2QIR A;  2ARH A;  3G8W A;  4KVM E;  3SXO A;  2GIV A;  3TT2 A;  2B5G B;  4AVA A;  2Q44 A;  2R7H A;  1MJ9 A;  2PDO A;  3IGR A;  1I1D A;  3G3S A;  4OAE A;  4JXQ A;  3P2H A;  4AB7 A;  3T9Y A;  3I3G A;  2FSR A;  2P6E A;  5IB0 A;  5JPH A; 
#chains in the Genus database with same CATH topology
 4UEF A;  1PU9 A;  2QVP A;  3GYA A;  3PB4 X;  3TO6 A;  4C7H A;  4ONW A;  4OC5 A;  2Z3L A;  5DS0 A;  2XEI A;  3LOD A;  1IID A;  2BUE A;  4UWJ A;  3GIU A;  3FRM A;  3JTK A;  5G1Z A;  4CGM A;  4MFZ A;  2X7B A;  4PK2 A;  4FAI A;  2I3C A;  5HVG A;  2Z3K A;  4A30 A;  3FNC A;  4KZT A;  1BPN A;  2FT0 A;  3CDX A;  2VL1 A;  4CGO A;  4M6G A;  3SHP A;  1CG2 A;  3S6F A;  1CM0 A;  1YRE A;  5G20 A;  2XEJ A;  2JBK A;  2G0B A;  1Q7L A;  1S5K A;  5H84 A;  3V7Z A;  4ONU A;  2C27 A;  2AJ6 A;  4MCS A;  1VKC A;  3CZX A;  3D66 A;  3QAY A;  3RYO A;  1K4J A;  4KOU A;  4XNH B;  4CYN A;  5KTC A;  1LRZ A;  1I12 A;  1NMT A;  2Z3N A;  2GFQ A;  2WPW A;  3TCV A;  1RTQ A;  2QYV A;  4M6I A;  5E96 A;  1YGH A;  3D7H A;  4U5Y A;  1WK4 A;  2PJ0 A;  4A2Z A;  1GHE A;  4Y49 B;  4HNW B;  5I0C A;  2V8G A;  5J8C A;  1Y9W A;  1H8L A;  5HVH A;  3S9L A;  5HVF A;  2EBJ A;  3KL9 A;  3PFE A;  4YFJ A;  3PEI A;  3PGP A;  2HUZ A;  2ZEL A;  3F8K A;  4F0Y A;  2I00 A;  2GE3 A;  1S7K A;  1BAV A;  2DF5 A;  4FD7 A;  3JRU A;  4ZY0 A;  3TX8 A;  1Y9K A;  2F8H A;  4KOW A;  3KQX A;  3FEC A;  1PCA A;  3SJF A;  4WJB A;  3FEE A;  3RZA A;  1LAN A;  4UCN A;  4Z65 A;  1M4G A;  4TWE A;  1HDQ A;  3K9T A;  2HB6 A;  4MHY A;  2PJ5 A;  1PUA A;  3B8G A;  2PC1 A;  3D7D A;  4F9V A;  1TKH A;  3PB6 X;  1VHE A;  2AFX A;  3T90 A;  1RXT A;  1NE9 A;  1ARM A;  3EO4 A;  4EFD A;  2Z10 A;  4FBE A;  1ZLI A;  1AMP A;  1AYE A;  3B3T A;  4ZI6 A;  3CXP A;  4OC4 A;  3N7Z A;  5KTD A;  3CXS A;  3IO1 A;  1NSA A;  1V0C A;  4UCP A;  1I21 A;  4KOY A;  1CX8 A;  3JVN A;  5AG6 A;  3TOA A;  4B10 A;  4KVX A;  4C2Z A;  3NE7 A;  1IB1 E;  2PJ4 A;  4KLV A;  4HNX B;  2B58 A;  1RO5 A;  4CGP A;  1Q2C A;  3HLP A;  3CXQ A;  4B12 A;  1F2P A;  4KOR A;  5K8O A;  2ANP A;  4MXU A;  7CPA A;  3HUV A;  2IJZ A;  2FE7 A;  1Z8L A;  4Q7A A;  3IC1 A;  3ZJ0 A;  1KUV A;  4RUH A;  3NH8 A;  2PVW A;  2VBQ A;  4MMO A;  3D4U A;  4MCR A;  1KUY A;  3MGD A;  2GLJ A;  3GKR A;  2PVV A;  4JD6 A;  3TO7 A;  2PRQ A;  3DLJ A;  4DUK A;  4P4B A;  2O53 A;  3KR4 A;  4K30 A;  5IB9 A;  4A38 A;  5IX3 A;  1QQ9 A;  2FIW A;  2PQ8 A;  5J1Q A;  3CT9 A;  2BL1 A;  4NGQ A;  5THW A;  4ZBG A;  2GAN A;  3VWD A;  3FB3 A;  2V8D A;  5K8N A;  1ZLH A;  4E8O A;  8CPA A;  3GB0 A;  2HV2 A;  3WC6 A;  2ZEP A;  4L89 A;  3SJG A;  3NH4 A;  3NE8 A;  3QAH A;  3LWU A;  2C1C A;  4ORF A;  5AG7 A;  2CY2 A;  5EMI A;  1VHS A;  2ABZ A;  4KSI A;  4XPK A;  1Q2Y A;  3PRT A;  3FH4 A;  2FIA A;  4UFX A;  2Z0Z A;  3V8I A;  4MCP A;  3MN8 A;  4PXE A;  4KUB A;  3IU2 A;  1XF8 A;  2I79 A;  3W91 A;  4M3S A;  2B4D B;  4ZX9 A;  5AG4 A;  3DDD A;  2C6C A;  5DWN A;  2JDC A;  2Q0Y A;  4AG9 A;  2EO8 A;  2P0W A;  1OZP A;  2IQ6 A;  1YVK A;  1ELM P;  3QNV A;  3S9M A;  4KLW A;  2VZZ A;  5LYD A;  2PJ6 A;  3SI2 A;  2NMT A;  3BJ8 A;  2ZOF A;  3TOB A;  1M1D A;  1TF9 A;  2PE3 A;  3TO9 A;  1ZG9 A;  4PSX A;  4CAV A;  4A95 A;  3IWE A;  4UA3 A;  2HQY A;  1JWQ A;  1XE4 A;  2ZW4 A;  3LAC A;  2DPT A;  3VAT A;  3WAB A;  4QBJ A;  3IU1 A;  4CGN A;  1J4J A;  1CPS A;  1BO4 A;  4MHP A;  3W6X A;  1TKJ A;  4MY0 A;  4TNU A;  1XBU A;  4HKF A;  1NSL A;  3SJE A;  4CAX A;  2FCK A;  4P44 A;  5LRJ A;  4PK3 A;  1CBX A;  4NJR A;  1KWM A;  3TC8 A;  2NSM A;  1BPM A;  2OOT A;  2HC9 A;  2Q04 A;  3B3V A;  3BI1 A;  2V8H A;  3EC4 A;  4XPL A;  3D3S A;  2A4N A;  2PR1 A;  1XFO A;  3FX6 A;  4JXR A;  1YVO A;  4CYQ A;  4NJQ A;  2P6G A;  3SI1 A;  3GUX A;  3H4Q A;  3R95 A;  4KOS A;  2KCW A;  4MHZ A;  2ZW5 A;  3WC5 A;  1YX0 A;  3DSB A;  4UFW A;  4IK2 A;  4OIW A;  5ISV A;  3DR6 A;  4UEE A;  1CPX A;  4XNH C;  1UFH A;  1Y0R A;  2DPS A;  4X2T A;  1U6M A;  2Z3P A;  2Y0M A;  1YR0 A;  2BOA A;  2PJA A;  4AVC A;  1R43 A;  2ZW6 A;  4LX9 A;  4M85 A;  2B3V A;  4CRZ B;  3UY5 A;  4P4J A;  1LCP A;  5HXD A;  2IMO A;  2P6F A;  1P4N A;  2PJ7 A;  4R3L A;  4Y49 C;  4UFV A;  2ZXV A;  1Z8T A;  2Q43 A;  1TXR A;  1IOI A;  4B11 A;  2OZU A;  4MFQ A;  4BBH A;  1Z8X A;  4CYO A;  1IIC A;  5CBM A;  1X12 A;  1XEB A;  1YLE A;  2RB7 A;  4GXH A;  3RAM A;  3H8G A;  2JBJ A;  4P4E A;  3LD2 A;  3P2F A;  2WPX A;  2BO9 A;  1Z4R A;  1MJB A;  2YNE A;  4G1P A;  4RI1 A;  5BWA B;  3F5B A;  4B5P A;  4LQG A;  1FY7 A;  2CF4 A;  2YNC A;  2GRE A;  1QSR A;  3B3W A;  2DEA A;  2PIZ A;  4AG7 A;  2AFM A;  2CNT A;  3FMC A;  4AVB A;  4EME A;  2FVG A;  5HMN A;  2B3U A;  3D67 A;  4CGL A;  3BHX A;  4JJX A;  4KOV A;  5A28 A;  4OME A;  4CRY B;  4X8I A;  2RC4 A;  1ZG7 A;  3KI9 A;  3R9F A;  3KGQ A;  3IEH A;  4RS2 A;  1Z2L A;  3R9G A;  4P6Y A;  1B87 A;  1QMU A;  2D4P A;  3DNS A;  4MFJ A;  2R98 A;  1ELL P;  2BCO A;  3D68 A;  1Z9U A;  4OC1 A;  3VAR A;  3S6G A;  3ZZI A;  1M4L A;  2WYR A;  1IU8 A;  1QST A;  2GU2 A;  1YME A;  4A33 A;  4BMH A;  4C7I A;  2EUI A;  4EWT A;  4MHD A;  1VGY A;  4F6A A;  2PR8 A;  4ZX8 A;  2IL4 A;  3BLN A;  2REF A;  4GS4 A;  2QML A;  4MBU A;  1LFW A;  5GCN A;  4BD9 A;  3LMS A;  1IY7 A;  3NH5 A;  4GM5 A;  1DTD A;  5LRG A;  2ZEO A;  4PXB A;  1N71 A;  1LOK A;  1XIX A;  3IFE A;  2ZEM A;  4O23 A;  1CJW A;  4NGS A;  4KOX A;  5JH9 A;  2BEI A;  2VI7 A;  1M4I A;  1Y0Y A;  2F7V A;  4X3R A;  1KZF A;  2B5G A;  4ZY1 A;  4KSF A;  4C2X A;  2G3A A;  5LYL A;  3PZJ A;  1XOV A;  1Q2D A;  2AFZ A;  3EFA A;  1S7N A;  2RFH A;  4NCZ A;  3NA6 A;  4OP4 A;  4YGO A;  4IUS A;  5DWM A;  2AFU A;  4P45 A;  2CXA A;  3GLJ A;  1HDU A;  2ZEH A;  4QC6 A;  4QUS A;  1P0H A;  2V8V A;  4R76 A;  4C2Y A;  2EWB A;  4U9Y A;  2PJ3 A;  5K8M A;  2F5I A;  1DE4 C;  2QEC A;  1QSN A;  4OKO A;  1TIQ A;  2FS5 A;  3ISZ A;  4UBR A;  4JLY A;  5F46 A;  4J3G A;  4NFR A;  2C6P A;  1PYT B;  3ISX A;  3PBB A;  4OC3 A;  2OZH A;  2O28 A;  2PJC A;  4RN7 A;  4UEZ A;  5EBV A;  2K5T A;  4LQ6 A;  1FNO A;  3KAS A;  4OAD A;  2VQY A;  4MFK A;  4FD5 A;  4F9U A;  4MRI A;  1LAP A;  3JUW A;  3B7I A;  2OH1 A;  1F2O A;  3VWE A;  4B14 A;  2VEZ A;  2Z11 A;  1S60 A;  4JWP A;  4NF1 A;  4PV6 A;  1UWY A;  4NGP A;  3WT4 A;  4BIN A;  4X5K A;  5C82 A;  4JYW A;  2PRB A;  2PJ8 A;  4NEX A;  4NXY A;  4OC2 A;  4UWI A;  1S7F A;  2REE A;  3W6S A;  4ZYQ A;  2OZG A;  3BXM A;  1ON0 A;  3RO0 A;  4DYO A;  4W9Y A;  2NYQ A;  4FWU A;  5G21 A;  2PJB A;  2ZPA A;  4DJL A;  4CYP A;  4M6H A;  2Z3O A;  4A32 A;  3SXN A;  4YWY A;  5CPA A;  1XMB A;  3PP9 A;  5H86 A;  5LYI A;  5I4M A;  2J8N A;  3FIX A;  2OB0 A;  4KVO E;  3KKW A;  1AUG A;  1MJA A;  1M4D A;  2C6G A;  5K8P A;  4P4D A;  4R87 A;  2CIJ A;  1JQG A;  4F8Z A;  4PXD A;  1IYL A;  2PIY A;  4XPD C;  5JM6 A;  3R1K A;  4FUU A;  4XPD B;  3FED A;  2WSA A;  1WWZ A;  3EXN A;  3S6H A;  3CPX A;  4CAE A;  4KOT A;  2FL4 A;  2Z3M A;  3EY5 A;  3K2K A;  2Q7B A;  1VIX A;  2H5M A;  3K9U A;  3QB8 A;  1EE3 P;  4OLL A;  3WC7 A;  3DR8 A;  2B4B A;  2ZOG A;  3BI0 A;  1YSJ A;  1R57 A;  3D7F A;  3TTH A;  2CTC A;  1YW6 A;  2PCU A;  4P4I A;  1FT7 A;  1F57 A;  4CAW A;  2ZEN A;  2CNM A;  1LAM A;  3D2M A;  1Z5R A;  5LRK A;  3E0K A;  4ZGY B;  3FXT A;  2BSW A;  1HEE A;  2EK8 A;  2R8V A;  1ZO0 A;  1QSO A;  3R96 A;  4KSA A;  4E2A A;  1Y7E A;  3S6K A;  5F09 A;  4Q38 A;  4H6U A;  2JDD A;  4C68 A;  4YRH A;  1M44 A;  2VXK A;  3RBU A;  2D4O A;  4MFL A;  3SI0 A;  4R8F A;  1XMT A;  2XEG A;  4NSQ A;  1S3Z A;  4E0A A;  3PB7 X;  4KUA A;  2PJ2 A;  3PFO A;  4QB9 A;  1TKF A;  3FYN A;  3FVL A;  3PB9 X;  4PSW A;  3F0A A;  2JEV A;  1SQH A;  4R57 A;  3D2P A;  2CTB A;  3T8W A;  2AE6 A;  4B6Z A;  2G9D A;  1OBR A;  2Q4Z A;  4UIB A;  3IIB A;  4IHM A;  2R1I A;  4NGT A;  3D8P A;  4MJ8 A;  5IV0 A;  4R9M A;  2PJ9 A;  5C88 A;  4CPA A;  5JGF A;  3OWC A;  4H6Z A;  1CP7 A;  3TE4 A;  5AG5 A;  2ODF A;  3I9S A;  5LYF A;  1Z8W A;  5CNP A;  3RNZ A;  2V77 A;  3D7G A;  4K3N A;  2J8R A;  4CS0 B;  3I1U A;  5AGE A;  2ZW7 A;  4HNY B;  3B35 A;  3BJ7 A;  4B5O A;  1L0C A;  1VHO A;  4JZ0 A;  2XEF A;  4R3K A;  4EVY A;  1BOB A;  2JLM A;  4MI4 A;  2Q4V A;  2B4D A;  2DXQ A;  2O4H A;  3GY9 A;  2PSW A;  2JEW A;  3FBU A;  4II9 A;  1TF8 A;  2Q7S A;  5D29 A;  4LUA A;  5F48 A;  3C26 A;  3VH9 A;  1BLL E;  5D8N A;  3B2Y A;  2ATR A;  3H5Z A;  4QVT A;  3SJX A;  3KZW A;  3NFZ A;  4OC0 A;  1QSM A;  1YK3 A;  4F0X A;  4Q36 A;  5F47 A;  2G3T A;  3IJ3 A;  5EC4 A;  3H8F A;  3V38 A;  3IWW A;  5JQ4 A;  4IF5 A;  1GYT A;  1X10 A;  4KS9 A;  5KTA A;  3H8E A;  2YGW A;  3KQZ A;  3L2N A;  3IWG A;  2YND A;  1R3N A;  2OU2 A;  3KR5 A;  2EVN A;  1ARL A;  4B5P B;  1XJO A;  2YNC C;  4ZY2 A;  1MK4 A;  5G22 A;  3FF3 A;  4PXC A;  4R7M A;  3R9E A;  4L8A A;  5FVJ A;  4P10 A;  6CPA A;  1IYK A;  1S7L A;  5F49 A;  3B3S A;  4HPS A;  2J8M A;  3PBE A;  4WWV A;  2POK A;  2Q4Y A;  4P4F A;  5ELY A;  1B6B A;  4PPZ A;  3WR7 A;  5A27 A;  4MFP A;  5J8F A;  2CNS A;  1KUX A;  2J9A A;  5HH1 A;  4MY3 A;  2WUU A;  2ZEF A;  4A94 A;  1ZG8 A;  4FD6 A;  4NGN A;  3N5F A;  4OID A;  4AXV A;  4B13 A;  4DNC A;  2P6E A;  4H89 A;  4FD4 A;  4NGR A;  4A37 A;  1Z4E A;  2WZN A;  1YW4 A;  4H2K A;  3DGV A;  4U9Z A;  3FJU A;  2FXF A;  2AFS A;  4A39 A;  4A31 A;  4UCM A;  2VZY A;  3B3C A;  4I49 A;  2QJ8 A;  1Y7R A;  3TFY A;  2QIR A;  2ARH A;  3G8W A;  4KVM E;  1YLO A;  3SXO A;  4UF4 A;  4UIA A;  2GIV A;  2GLF A;  1IGB A;  3TT2 A;  2ZED A;  1A2Z A;  1XRY A;  4MHN A;  1YQE A;  2B5G B;  2Q51 A;  3MRU A;  4IAV A;  3S9N A;  4MCQ A;  1IOF A;  2Q44 A;  4AVA A;  2R7H A;  4R6T A;  1CP6 A;  3CPA A;  1MJ9 A;  2PDO A;  3IGR A;  3KHZ A;  4YU9 A;  1I1D A;  4CAF A;  3G3S A;  2PJ1 A;  3A9L A;  4NGM A;  4OAE A;  4PQA A;  3PB8 X;  3KHX A;  4JXQ A;  2ZEG A;  2AFW A;  2ZEE A;  2OR4 A;  3P2H A;  4AB7 A;  3T9Y A;  2AFO A;  3I3G A;  2FSR A;  2EK9 A;  5IB0 A;  5JPH A; 
#chains in the Genus database with same CATH homology
 3TO6 A;  1PU9 A;  3GYA A;  4C7H A;  2Z3L A;  3LOD A;  1IID A;  2BUE A;  4UWJ A;  3JTK A;  3FRM A;  4CGM A;  5G1Z A;  4MFZ A;  2X7B A;  4PK2 A;  2Z3K A;  4A30 A;  3FNC A;  4KZT A;  2FT0 A;  4CGO A;  3SHP A;  3S6F A;  1CM0 A;  1YRE A;  5G20 A;  2G0B A;  1S5K A;  5H84 A;  4ONU A;  2C27 A;  2AJ6 A;  1VKC A;  3RYO A;  1K4J A;  4KOU A;  4XNH B;  5KTC A;  1LRZ A;  1I12 A;  1NMT A;  2Z3N A;  2WPW A;  3TCV A;  5E96 A;  1YGH A;  4U5Y A;  1WK4 A;  4A2Z A;  1GHE A;  4Y49 B;  4HNW B;  5I0C A;  5J8C A;  1Y9W A;  4YFJ A;  3PGP A;  2HUZ A;  3F8K A;  4F0Y A;  2I00 A;  2GE3 A;  1S7K A;  4FD7 A;  1Y9K A;  4KOW A;  4UCN A;  1M4G A;  1PUA A;  3B8G A;  2PC1 A;  3T90 A;  1RXT A;  1NE9 A;  3EO4 A;  2Z10 A;  3CXP A;  3N7Z A;  5KTD A;  3CXS A;  4UCP A;  1V0C A;  5AG6 A;  1I21 A;  4KOY A;  3JVN A;  3TOA A;  4B10 A;  4KVX A;  4C2Z A;  3NE7 A;  1IB1 E;  4KLV A;  4HNX B;  2B58 A;  1RO5 A;  4CGP A;  1Q2C A;  3CXQ A;  4B12 A;  4KOR A;  2FE7 A;  3ZJ0 A;  1KUV A;  2VBQ A;  1KUY A;  3MGD A;  3GKR A;  4JD6 A;  3TO7 A;  4K30 A;  5IX3 A;  2FIW A;  2PQ8 A;  2BL1 A;  4ZBG A;  2GAN A;  3VWD A;  3FB3 A;  4E8O A;  2HV2 A;  4L89 A;  3QAH A;  5AG7 A;  4ORF A;  2CY2 A;  1VHS A;  4XPK A;  1Q2Y A;  4UFX A;  2FIA A;  3V8I A;  2Z0Z A;  4KUB A;  3IU2 A;  1XF8 A;  2I79 A;  3W91 A;  4M3S A;  2B4D B;  5AG4 A;  3DDD A;  5DWN A;  2JDC A;  2Q0Y A;  4AG9 A;  2P0W A;  1OZP A;  1YVK A;  4KLW A;  2VZZ A;  4B11 A;  4CYN A;  2NMT A;  3BJ8 A;  3TOB A;  1M1D A;  3TO9 A;  4PSX A;  4CAV A;  4A95 A;  3IWE A;  4UA3 A;  2HQY A;  1XE4 A;  2ZW4 A;  2DPT A;  4QBJ A;  3IU1 A;  4CGN A;  1J4J A;  1BO4 A;  3W6X A;  4MY0 A;  1NSL A;  4HKF A;  4CAX A;  2FCK A;  4PK3 A;  2Q04 A;  4XPL A;  3EC4 A;  3D3S A;  2A4N A;  2PR1 A;  4JXR A;  1YVO A;  4CYQ A;  2P6G A;  3H4Q A;  3R95 A;  4KOS A;  2KCW A;  2ZW5 A;  1YX0 A;  3DSB A;  4UFW A;  5ISV A;  3DR6 A;  4XNH C;  1UFH A;  2DPS A;  1U6M A;  2Z3P A;  2Y0M A;  1YR0 A;  4AVC A;  2ZW6 A;  4LX9 A;  4M85 A;  4CRZ B;  2B3V A;  3UY5 A;  2P6F A;  1P4N A;  4R3L A;  4Y49 C;  4UFV A;  2ZXV A;  2OZU A;  4MFQ A;  4BBH A;  4CYO A;  1IIC A;  1XEB A;  1YLE A;  3LD2 A;  3P2F A;  2WPX A;  1Z4R A;  1MJB A;  2YNE A;  4RI1 A;  5BWA B;  3F5B A;  4B5P A;  1FY7 A;  2YNC A;  1QSR A;  4AG7 A;  4AVB A;  2CNT A;  5HMN A;  2B3U A;  4CGL A;  4JJX A;  4KOV A;  5A28 A;  4CRY B;  2RC4 A;  3R9F A;  4RS2 A;  3R9G A;  1B87 A;  2D4P A;  3DNS A;  4MFJ A;  2R98 A;  1Z9U A;  3S6G A;  3ZZI A;  1QST A;  4A33 A;  4BMH A;  4C7I A;  2EUI A;  4MHD A;  4F6A A;  2PR8 A;  2IL4 A;  3BLN A;  2REF A;  4GS4 A;  2QML A;  4MBU A;  5GCN A;  1N71 A;  1XIX A;  1CJW A;  4KOX A;  2BEI A;  2VI7 A;  1M4I A;  1KZF A;  2B5G A;  4KSF A;  4C2X A;  2G3A A;  3PZJ A;  4YGO A;  1Q2D A;  3EFA A;  1S7N A;  4NCZ A;  4IUS A;  5DWM A;  2CXA A;  4QC6 A;  4QUS A;  1P0H A;  4C2Y A;  4U9Y A;  2F5I A;  2QEC A;  1QSN A;  1TIQ A;  2FS5 A;  4UBR A;  4JLY A;  5F46 A;  4J3G A;  2OZH A;  2O28 A;  5EBV A;  2K5T A;  4OAD A;  2VQY A;  4MFK A;  4FD5 A;  3JUW A;  2OH1 A;  3VWE A;  4B14 A;  2VEZ A;  2Z11 A;  1S60 A;  4JWP A;  4NF1 A;  4PV6 A;  4X5K A;  5C82 A;  2PRB A;  4NEX A;  4NXY A;  4UWI A;  1S7F A;  2REE A;  3W6S A;  2OZG A;  1ON0 A;  5G21 A;  2ZPA A;  4CYP A;  2Z3O A;  4A32 A;  3SXN A;  3PP9 A;  5H86 A;  2J8N A;  3FIX A;  2OB0 A;  4KVO E;  3KKW A;  1MJA A;  1M4D A;  4R87 A;  1IYL A;  4XPD C;  3R1K A;  4XPD B;  2WSA A;  1WWZ A;  3EXN A;  3S6H A;  4CAE A;  4KOT A;  2FL4 A;  2Z3M A;  3EY5 A;  2Q7B A;  2H5M A;  3K9U A;  3QB8 A;  4OLL A;  3DR8 A;  2B4B A;  3TTH A;  1R57 A;  4CAW A;  2CNM A;  3D2M A;  3E0K A;  4ZGY B;  3FXT A;  2BSW A;  3R96 A;  2R8V A;  1ZO0 A;  1QSO A;  4KSA A;  4E2A A;  3S6K A;  4Q38 A;  4H6U A;  2JDD A;  4C68 A;  4YRH A;  1M44 A;  2VXK A;  2D4O A;  4MFL A;  1XMT A;  4NSQ A;  1S3Z A;  4E0A A;  4KUA A;  4QB9 A;  3FYN A;  4PSW A;  3F0A A;  2JEV A;  1SQH A;  4R57 A;  3D2P A;  2AE6 A;  2R1I A;  3D8P A;  4MJ8 A;  5IV0 A;  4R9M A;  5C88 A;  3OWC A;  4H6Z A;  3TE4 A;  5AG5 A;  3I9S A;  5CNP A;  2J8R A;  4CS0 B;  5AGE A;  2ZW7 A;  4HNY B;  3BJ7 A;  4B5O A;  1L0C A;  4R3K A;  4EVY A;  1BOB A;  2JLM A;  4MI4 A;  2Q4V A;  2B4D A;  2DXQ A;  3GY9 A;  2PSW A;  3FBU A;  4II9 A;  4LUA A;  5F48 A;  3C26 A;  2ATR A;  3H5Z A;  4QVT A;  1QSM A;  1YK3 A;  4F0X A;  4Q36 A;  5F47 A;  2G3T A;  5EC4 A;  5JQ4 A;  4IF5 A;  4KS9 A;  5KTA A;  2YGW A;  3IWG A;  2YND A;  2OU2 A;  2EVN A;  4B5P B;  2YNC C;  1MK4 A;  5G22 A;  3R9E A;  4L8A A;  5FVJ A;  1IYK A;  1S7L A;  5F49 A;  2J8M A;  2Q4Y A;  1B6B A;  3WR7 A;  5A27 A;  4MFP A;  5J8F A;  2CNS A;  1KUX A;  5HH1 A;  4MY3 A;  2WUU A;  4FD6 A;  4B13 A;  4DNC A;  4H89 A;  4FD4 A;  1Z4E A;  4U9Z A;  2FXF A;  4A31 A;  4UCM A;  2VZY A;  4I49 A;  1Y7R A;  3TFY A;  2QIR A;  2ARH A;  3G8W A;  4KVM E;  3SXO A;  2GIV A;  3TT2 A;  2B5G B;  4AVA A;  2Q44 A;  2R7H A;  1MJ9 A;  2PDO A;  3IGR A;  1I1D A;  4CAF A;  3G3S A;  3A9L A;  4OAE A;  4JXQ A;  3P2H A;  4AB7 A;  3T9Y A;  3I3G A;  2FSR A;  2P6E A;  5IB0 A;  5JPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...