5H84A

Human gcn5 bound to propionyl-coa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT2A
publication title Structural basis for acyl-group discrimination by human Gcn5L2.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 164
sequence length 164
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5h84A00
4B5OA 4M3SA 4KZTA 4CAVA 4B5PB 4XPDB 3GY9A 3BLNA 4L8AA 2OZHA 3D8PA 1ON0A 4KOXA 4PSXA 3PP9A 1GHEA 4I49A 3BJ8A 2OU2A 3GYAA 3F5BA 4HNYB 4JJXA 5IB0A 3MGDA 2HUZA 3R9FA 2KCWA 4U9YA 3DR6A 2GANA 2R98A 5J8CA 2PC1A 5JPHA 3R9EA 3D3SA 3T90A 4XPLA 3JUWA 4LX9A 2HV2A 1QSMA 4MBUA 4QUSA 3SHPA 4KOTA 4IUSA 3TO7A 3QB8A 2Q4VA 3CXQA 3W91A 5F47A 1VHSA 4UWIA 2QECA 1M44A 3IWGA 4IF5A 2IL4A 1S7FA 1YR0A 4KVME 2REEA 5HH1A 2GE3A 2Z0ZA 2AJ6A 3ZZIA 1IIDA 4CAWA 4II9A 4KUBA 1M4DA 1Z4EA 5IV0A 3VWEA 1M4GA 2F5IA 2ZPAA 2I00A 4MJ8A 4ORFA 4XNHC 4UA3A 4L89A 4F6AA 3DR8A 1IB1E 3P2FA 1BOBA 5C82A 5HMNA 1L0CA 4NEXA 1BO4A 3QAHA 4KOYA 3I9SA 2B5GB 3CXPA 3KKWA 2PDOA 2ZW5A 4X5KA 2VEZA 4HNWB 1S7KA 1LRZA 2J8NA 2Q04A 3BJ7A 4XNHB 3WR7A 2DXQA 1WWZA 4FD7A 1KZFA 4Y49B 2BL1A 3TE4A 2PR1A 4PSWA 3RYOA 2ARHA 3DNSA 4R3KA 3JVNA 2B4DA 5FVJA 1YREA 2P6EA 1U6MA 3NE7A 2R1IA 2Q4YA 2B58A 2WPWA 4QBJA 1RO5A 1Y9WA 2K5TA 2FSRA 4KOVA 1XF8A 3TOAA 4K30A 2EVNA 2VQYA 4MI4A 4EVYA 4CAXA 1UFHA 2C27A 2FL4A 2B4DB 3G3SA 4PV6A 2RC4A 5KTCA 1M1DA 4U9ZA 2O28A 5EC4A 4PK3A 3PGPA 1KUVA 2QMLA 1Q2YA 2Q0YA 1QSTA 2PRBA 4AG9A 5F49A 2R7HA 2P6FA 4OLLA 2PQ8A 4AVAA 3S6GA 1S3ZA 4AVBA 3DDDA 2D4OA 3FBUA 2Q44A 4MY3A 3S6KA 4OADA 2H5MA 2BSWA 2ZW7A 2JEVA 2NMTA 3R96A 3R95A 4R9MA 3TTHA 4KOSA 4KUAA 2J8RA 3EFAA 1IYKA 1YVOA 1SQHA 4QC6A 4FD4A 3F8KA 5C88A 4NXYA 2OH1A 1WK4A 2HQYA 4U5YA 3T9YA 4RI1A 2A4NA 4J3GA 1S7LA 2I79A 3FRMA 4AVCA 1XE4A 1YLEA 1K4JA 2JDCA 2FS5A 4YGOA 3EY5A 1QSRA 1CJWA 2VZZA 2EUIA 4KOUA 1Y7RA 3FXTA 1QSOA 2CNSA 2FIAA 3G8WA 1I21A 1PUAA 2B3UA 2FE7A 4YFJA 1J4JA 1IYLA 4HNXB 4JXQA 5I0CA 2CNTA 2PR8A 3S6FA 1XEBA 2VXKA 1KUYA 4KLWA 4LUAA 3TFYA 4KOWA 2OZGA 3I3GA 4KLVA 2B4BA 2OB0A 2G0BA 2WPXA 3LODA 4QB9A 4NSQA 4E2AA 2FIWA 1MK4A 2G3TA 4JXRA 2FXFA 4MY0A 3VWDA 4GS4A 4B5PA 4BMHA 3N7ZA 1MJAA 5H84A 2OZUA 4CS0B 3ZJ0A 3FIXA 5KTDA 3OWCA 3C26A 3UY5A 4JWPA 5F46A 4PK2A 2FT0A 3D2PA 1Y9KA 5EBVA 5IX3A 3R9GA 1B87A 3F0AA 5KTAA 2B3VA 4AG7A 1P4NA 2BUEA 4UWJA 1XMTA 2G3AA 3FYNA 3EO4A 4R87A 1I12A 1N71A 2BEIA 3FB3A 5F48A 4FD6A 2AE6A 2ZXVA 2REFA 1S60A 1PU9A 4H6UA 4NF1A 3B8GA 4KORA 4FD5A 4AB7A 1KUXA 3V8IA 4ZBGA 5CNPA 4JD6A 3P2HA 3TO9A 4KVXA 1YGHA 2R8VA 2ZW6A 4UBRA 1YX0A 4R3LA 4NCZA 1P0HA 3H4QA 3GKRA 1CM0A 1RXTA 1MJ9A 5JQ4A 1OZPA 2Z11A 3R1KA 1QSNA 2CY2A 2Y0MA 4H89A 4M85A 4ONUA 2P6GA 2VZYA 3TO6A 1TIQA 3W6SA 4CRZB 2GIVA 5H86A 1Z4RA 3D2MA 4RS2A 1VKCA 3TT2A 4KVOE 2JDDA 3EC4A 3S6HA 1Q2DA 2B5GA 1XIXA 4CRYB 3SXNA 3TCVA 4H6ZA 2Z10A 4XPKA 3W6XA 1S5KA 1MJBA 3TOBA 5ISVA 4QVTA 2P0WA 2ZW4A 2PSWA 4YRHA 2CNMA 4Y49C 3PZJA 3EXNA 1YVKA 1I1DA 2VI7A 2FCKA 3LD2A 2Q7BA 1S7NA 4JLYA 2JLMA 2D4PA 4OAEA 2QIRA 3K9UA 3CXSA 3SXOA 1R57A 5DWMA 1Z9UA 4R57A 4DNCA 1Q2CA 2ATRA 3DSBA 4XPDC 1M4IA 1NSLA 4E8OA 3E0KA 5GCNA 4HKFA 4MHDA 4E0AA 5E96A 1FY7A 2VBQA 1V0CA 1NE9A 1IICA 1YK3A 2J8MA 2X7BA 5DWNA 1NMTA 3FNCA 3IGRA 5J8FA 1B6BA 4F0YA
chains in the Genus database with same CATH superfamily
4NJQA 1XBUA 4MFJA 4B5OA 3H8GA 4M3SA 4KZTA 2ABZA 4CAVA 4B5PB 4XPDB 3QNVA 3GUXA 4Z65A 3GY9A 3IWEA 1YQEA 1Q7LA 2F8HA 2G9DA 1TKFA 2JBJA 3BLNA 1ZLIA 4L8AA 2I3CA 4UF4A 2OZHA 3D8PA 4PXDA 4MMOA 1ON0A 2O53A 3B2YA 4KOXA 4PSXA 4WWVA 3PP9A 1GHEA 4I49A 1QMUA 3BJ8A 3GIUA 2OU2A 3GYAA 1F2PA 1BAVA 3F5BA 4HNYB 4JJXA 4R7MA 5IB0A 4Q7AA 3MGDA 1KWMA 2EWBA 4CGOA 2HUZA 4F9VA 4EMEA 1PYTB 4OC4A 3R9FA 4IHMA 1VHEA 3HLPA 2KCWA 4FAIA 4A38A 3B3CA 4FBEA 4U9YA 3D7GA 2VL1A 3DR6A 3MN8A 4A94A 2GANA 1Z8TA 5AG6A 2AFSA 2R98A 5J8CA 2PC1A 2DPTA 5JPHA 2ZOGA 3D3SA 4MCQA 4XPLA 3R9EA 1H8LA 3JUWA 4LX9A 3T90A 4NFRA 4A30A 5J1QA 2J9AA 4YU9A 1A2ZA 4CYOA 5C88A 2HV2A 1QSMA 4MBUA 2ZOFA 4QUSA 4EFDA 3SHPA 3PFEA 4KOTA 3SI2A 4B11A 5JH9A 4IUSA 3TO7A 3QB8A 2Q4VA 3CXQA 2PIZA 3W91A 4NGMA 5F47A 1VHSA 4UWIA 6CPAA 2ZEDA 2QECA 1CP6A 4F0XA 2POKA 1M44A 3V7ZA 3IWGA 2Q7SA 4IF5A 4ZI6A 2IL4A 2PVVA 1S7FA 2PJ8A 3D66A 3FMCA 1YR0A 4KVME 3PEIA 2REEA 3S9MA 3GB0A 4R76A 5HH1A 2GE3A 5IB9A 2Z0ZA 3ISZA 1CG2A 2AJ6A 3ZZIA 1IIDA 4NGQA 1HDQA 3CT9A 4CAWA 3B3SA 1BPNA 4KUBA 4II9A 5JGFA 1M4DA 1Z4EA 3IU2A 3VWEA 1M4GA 5IV0A 4YWYA 2F5IA 2ZPAA 1YSJA 4CYQA 2I00A 4UEZA 4MJ8A 5G1ZA 4ORFA 3PFOA 2YGWA 2ZELA 4UEEA 4XNHC 1BPMA 3I1UA 4X8IA 4UA3A 4L89A 3HUVA 3DR8A 3H5ZA 4F6AA 1IB1E 4CPAA 1F2OA 1TKJA 3P2FA 1BOBA 2PE3A 5C82A 3CZXA 5HMNA 2NSMA 1L0CA 4NEXA 1BO4A 5THWA 2XEFA 5K8OA 4B10A 3PB7X 3QAHA 4KOYA 4RN7A 3I9SA 5LYLA 1Z5RA 2B5GB 3BI0A 3CXPA 3KKWA 4P4FA 1FT7A 2C6CA 1LAMA 2PDOA 2QYVA 2ZW5A 2F7VA 4X5KA 4EWTA 4A37A 2VEZA 2V8DA 3NH8A 1XRYA 4HNWB 1JQGA 1S7KA 1LRZA 2J8NA 2Q04A 2IJZA 2V8GA 2PJAA 3BJ7A 2QVPA 4NGRA 4XNHB 3D7HA 2DXQA 3WR7A 4OIWA 1WWZA 2ZENA 4B6ZA 4P4IA 4C7HA 5LRJA 2PJCA 2JBKA 4FD7A 1KZFA 5G21A 4PXBA 1IOIA 1LCPA 4Y49B 2BL1A 3B3WA 4CYNA 3TE4A 4CYPA 3B3TA 2PR1A 1LOKA 2GLJA 4PXCA 4PSWA 3RYOA 2O4HA 4ZGYB 2RFHA 2ARHA 3D7DA 2Z3PA 3DNSA 1CBXA 4MXUA 4R3KA 3JVNA 3VARA 2B4DA 5FVJA 1YREA 1VGYA 4NGSA 2P6EA 1U6MA 8CPAA 3NE7A 3RAMA 2R1IA 1JWQA 2Q4YA 3NFZA 2NYQA 2B58A 2WPWA 3CPXA 2PCUA 1XOVA 4QBJA 3FEDA 1RO5A 2PRQA 1Y9WA 2K5TA 2AFZA 2FSRA 4KOVA 4OKOA 1XF8A 3FEEA 4LQGA 3TOAA 3DGVA 1R43A 1CPXA 4K30A 2EVNA 2VQYA 4MI4A 4EVYA 4CAXA 4P10A 1UFHA 2C27A 5AG5A 3LACA 4R8FA 4MHZA 2FL4A 2B4DB 2OR4A 4NGTA 1ARMA 3D4UA 3G3SA 4PV6A 2RC4A 5KTCA 5EMIA 1M1DA 5JM6A 1DE4C 4U9ZA 2O28A 4P4EA 2GLFA 4M6GA 5HVFA 5EC4A 4PK3A 3PGPA 5LYDA 1ELMP 1IOFA 1KUVA 2DEAA 2QMLA 3WT4A 2C6PA 4F8ZA 4BBHA 1Q2YA 2FVGA 1CPSA 2V77A 4P44A 1VIXA 4AXVA 2Q0YA 4CGPA 5I4MA 4NGNA 1QSTA 2PRBA 3N5FA 1DTDA 2YNCC 3KQXA 5F49A 4A33A 4AG9A 2R7HA 2P6FA 3H8EA 2WSAA 2HB6A 3SJGA 4OLLA 2PQ8A 3S9NA 5LRKA 4P45A 4AVAA 4LQ6A 2EK8A 5LYFA 3S6GA 1S3ZA 3DLJA 3VATA 3FVLA 2YNCA 1IY7A 4AVBA 4MFLA 2V8VA 4UEFA 3SI1A 2PJ1A 7CPAA 5HXDA 3DDDA 4MFKA 4B12A 2D4OA 2CIJA 3FBUA 3JRUA 2Q44A 2PIYA 4MY3A 2YNDA 4UIAA 3S6KA 4P4BA 4OADA 2H5MA 2BSWA 4B13A 2Q4ZA 1YW6A 4CGLA 2ZW7A 2JEVA 4IK2A 2NMTA 4OC2A 3PB6X 4FWUA 3R96A 2ZEPA 3R95A 4H2KA 4R9MA 5A28A 2GU2A 4ZYQA 3TTHA 4KOSA 4IAVA 2PJBA 3D68A 4KUAA 2J8RA 4OIDA 3EFAA 1IYKA 1YVOA 1SQHA 3K2KA 4QC6A 1XMBA 4FD4A 2V8HA 4X3RA 4Q36A 3F8KA 4KS9A 4G1PA 4M6IA 2OH1A 1M4LA 4NXYA 1WK4A 2HQYA 4U5YA 3T9YA 4P4DA 2DPSA 4RI1A 4PQAA 1GYTA 2A4NA 1TXRA 1S7LA 2I79A 4J3GA 1ZG7A 3FRMA 3SI0A 5G20A 1XE4A 4AVCA 1YLEA 1K4JA 2GREA 3IO1A 4MCPA 3TX8A 3PRTA 5BWAB 1PCAA 2AFUA 2JDCA 3KASA 5K8PA 4DUKA 2FS5A 2IQ6A 4KSFA 1ZLHA 4YGOA 4ZX8A 1X12A 3PB9X 2WZNA 3EY5A 2ZEEA 1QSRA 1CJWA 2PJ3A 2VZZA 4FUUA 2GFQA 1BLLE 2EUIA 4KOUA 1Y7RA 5LRGA 2BCOA 3IWWA 1YW4A 3FXTA 4CAEA 1QSOA 3BHXA 2CNSA 2AFMA 2XEGA 4BD9A 5K8NA 3H8FA 2FIAA 3G8WA 3KGQA 1I21A 1PUAA 2ZEOA 1ZG9A 2B3UA 4MCRA 2Q43A 2FE7A 2ODFA 3D7FA 3KL9A 3QAYA 3SJFA 4YFJA 1J4JA 3V38A 1Z8WA 1IYLA 4HNXB 4JXQA 4RUHA 5I0CA 2CNTA 2DF5A 1AUGA 2WYRA 2PR8A 2ZEMA 3S6FA 1XEBA 2VXKA 3B3VA 4UFWA 5CPAA 1KUYA 4KLWA 4LUAA 5D29A 5A27A 3TFYA 1UWYA 4KOWA 1Y7EA 2OZGA 1YMEA 3I3GA 4KLVA 2B4BA 2OB0A 2G0BA 2WPXA 3LODA 4QB9A 4NSQA 4ZX9A 4E2AA 2FIWA 1MK4A 2G3TA 3CPAA 4C2YA 4JXRA 2IMOA 2FXFA 3IU1A 2AFXA 1HDUA 4MFZA 4CGNA 4MY0A 3VWDA 4GS4A 3BI1A 4B5PA 2CTCA 4BMHA 4OC1A 3N7ZA 4OP4A 1MJAA 3NH4A 1FNOA 4P4JA 5H84A 3FH4A 2ANPA 2OZUA 1OBRA 4OMEA 4CS0B 3ZJ0A 1ZG8A 2PJ6A 3FIXA 5KTDA 5LYIA 3OWCA 3C26A 3UY5A 3CDXA 4JWPA 4PK2A 2FT0A 5F46A 2ZEGA 3RO0A 5CBMA 3D2PA 1Y9KA 1XJOA 1YLOA 5EBVA 3R9GA 5IX3A 1B87A 3F0AA 3SJEA 3KQZA 5KTAA 3IJ3A 2B3VA 2WUUA 5AG7A 5AGEA 1IU8A 5D8NA 4AG7A 1P4NA 2BUEA 3D67A 4UWJA 3A9LA 1LANA 1XMTA 2G3AA 3FYNA 2CTBA 1AMPA 4MHYA 3RZAA 3KR4A 1B6BA 3RNZA 1IGBA 2ZEFA 3KR5A 4A95A 2RB7A 2EK9A 3EO4A 4R87A 2JEWA 4KSAA 1I12A 5G22A 2XEJA 2CXAA 3L2NA 4DYOA 1N71A 4JYWA 2BEIA 3FB3A 4JZ0A 5F48A 4C7IA 3IIBA 4FD6A 4R6TA 2AE6A 1XFOA 2ZXVA 2REFA 1ELLP 4B14A 4OC0A 3S9LA 1Z8XA 4UCPA 1S60A 1PU9A 4H6UA 4NF1A 5DS0A 4GM5A 3KZWA 4MRIA 3TC8A 1VHOA 4P6YA 3B8GA 3NE8A 1X10A 4KORA 4ONWA 4FD5A 4AB7A 1KUXA 1LFWA 3V8IA 1ZO0A 2BO9A 2C6GA 4ZBGA 5CNPA 4JD6A 3P2HA 3TO9A 4KVXA 2Z3LA 3WC7A 1YGHA 2R8VA 2PJ0A 2PJ9A 1YX0A 2ZW6A 4UBRA 4C2XA 4W9YA 4R3LA 3FECA 4NJRA 2Q51A 3NH5A 4C68A 3KHXA 4NCZA 5AG4A 1P0HA 5F09A 4UCNA 3H4QA 4TWEA 3BXMA 2OOTA 1Z2LA 2PJ5A 1R3NA 2AFWA 3B35A 3PBBA 4ZY2A 2PJ2A 4KSIA 2HC9A 3GKRA 1CM0A 1Z8LA 2Z3KA 4X2TA 4F9UA 1RXTA 1TF8A 1MJ9A 5JQ4A 4DJLA 3FX6A 1OZPA 2QJ8A 2Z11A 3R1KA 1QSNA 4OC3A 4HPSA 3T8WA 2ZEHA 2CY2A 2Y0MA 4H89A 4M85A 4ONUA 4A31A 4K3NA 3K9TA 2P6GA 2VZYA 3TO6A 1F57A 4ZY1A 3ISXA 1TIQA 3W6SA 2PVWA 4TNUA 4CRZB 2GIVA 5H86A 1Z4RA 4MFPA 3D2MA 4RS2A 1VKCA 1Y0RA 5HVHA 3TT2A 2CF4A 4KVOE 2JDDA 3EC4A 4NGPA 3S6HA 1Y0YA 1Q2DA 2B5GA 1XIXA 4CRYB 3PB4X 4ZY0A 3SXNA 2Z3MA 2XEIA 3TCVA 3MRUA 4H6ZA 2Z10A 4XPKA 3GLJA 3LMSA 3KHZA 4M6HA 4A39A 4BINA 1EE3P 3W6XA 1S5KA 1MJBA 3TOBA 1HEEA 4MFQA 5ELYA 3RBUA 3SJXA 5ISVA 2EBJA 4MHPA 4CGMA 4QVTA 2P0WA 3NA6A 3FJUA 5K8MA 2ZW4A 1TF9A 2PSWA 1CX8A 4YRHA 3WC6A 2CNMA 4Y49C 3PB8X 3PZJA 3EXNA 1YVKA 4PPZA 2Z3OA 1I1DA 1QQ9A 2C1CA 4UCMA 5HVGA 3IC1A 2VI7A 2FCKA 3LD2A 2Q7BA 2EO8A 4GXHA 1S7NA 3PBEA 4JLYA 2PJ7A 2JLMA 1LAPA 2D4PA 2Z3NA 4OAEA 4PXEA 2QIRA 1TKHA 3CXSA 3IFEA 3K9UA 1R57A 4UFVA 3SXOA 3WABA 5DWMA 4C2ZA 1Z9UA 4R57A 4DNCA 2BOAA 1Q2CA 2ATRA 2PJ4A 3DSBA 1M4IA 4XPDC 3VH9A 1NSLA 1NSAA 4E8OA 3WC5A 3B7IA 3E0KA 1ARLA 5GCNA 4OC5A 4HKFA 4UIBA 4MHDA 2AFOA 4MHNA 4E0AA 3IEHA 1FY7A 5E96A 4A32A 4UFXA 2VBQA 4CAFA 1V0CA 1NE9A 1IICA 1YK3A 2YNEA 4MCSA 3FF3A 2J8MA 2X7BA 4A2ZA 3LWUA 3KI9A 5DWNA 1NMTA 1CP7A 3FNCA 1RTQA 3IGRA 4WJBA 4O23A 5J8FA 1AYEA 3JTKA 4Q38A 4F0YA
chains in the Genus database with same CATH topology
4MFJA 4B5OA 4M3SA 4KZTA 4CAVA 4B5PB 4XPDB 3GY9A 3IWEA 3BLNA 4L8AA 2OZHA 3D8PA 1ON0A 4KOXA 4PSXA 3PP9A 1GHEA 4I49A 3BJ8A 2OU2A 3GYAA 3F5BA 4HNYB 4JJXA 5IB0A 3MGDA 4CGOA 2HUZA 3R9FA 2KCWA 4U9YA 3DR6A 2GANA 5AG6A 2R98A 5J8CA 2PC1A 2DPTA 5JPHA 3R9EA 3D3SA 3T90A 4XPLA 3JUWA 4LX9A 4A30A 4CYOA 2HV2A 1QSMA 4MBUA 4QUSA 3SHPA 4KOTA 4B11A 4IUSA 3TO7A 3QB8A 2Q4VA 3CXQA 3W91A 5F47A 1VHSA 4UWIA 2QECA 4F0XA 1M44A 3IWGA 4IF5A 2IL4A 1S7FA 1YR0A 4KVME 2REEA 5HH1A 2GE3A 2Z0ZA 2AJ6A 3ZZIA 1IIDA 4CAWA 4II9A 4KUBA 1M4DA 1Z4EA 3IU2A 3VWEA 1M4GA 5IV0A 2F5IA 2ZPAA 4CYQA 2I00A 5G1ZA 4MJ8A 4ORFA 2YGWA 4XNHC 4UA3A 4L89A 4F6AA 3DR8A 3H5ZA 1IB1E 3P2FA 1BOBA 5C82A 5HMNA 1L0CA 4NEXA 1BO4A 4B10A 3QAHA 4KOYA 3I9SA 2B5GB 3CXPA 3KKWA 2PDOA 2ZW5A 4X5KA 2VEZA 4HNWB 1S7KA 1LRZA 2J8NA 2Q04A 3BJ7A 4XNHB 3WR7A 2DXQA 1WWZA 4C7HA 4FD7A 1KZFA 5G21A 4Y49B 2BL1A 4CYNA 3TE4A 4CYPA 2PR1A 4PSWA 3RYOA 4ZGYB 2ARHA 2Z3PA 3DNSA 4R3KA 3JVNA 2B4DA 5FVJA 1YREA 2P6EA 1U6MA 3NE7A 2R1IA 2Q4YA 2B58A 2WPWA 4QBJA 1RO5A 1Y9WA 2K5TA 2FSRA 4KOVA 1XF8A 3TOAA 4K30A 2EVNA 2VQYA 4MI4A 4EVYA 4CAXA 1UFHA 2C27A 5AG5A 2FL4A 2B4DB 3G3SA 4PV6A 2RC4A 5KTCA 1M1DA 4U9ZA 2O28A 5EC4A 4PK3A 3PGPA 1KUVA 2QMLA 4BBHA 1Q2YA 4CGPA 2Q0YA 1QSTA 2PRBA 2YNCC 4AG9A 5F49A 4A33A 2R7HA 2P6FA 2WSAA 4OLLA 2PQ8A 4AVAA 3S6GA 1S3ZA 2YNCA 4AVBA 4MFLA 3DDDA 4MFKA 4B12A 2D4OA 3FBUA 2Q44A 4B13A 4MY3A 2YNDA 3S6KA 4OADA 2H5MA 2BSWA 4CGLA 2ZW7A 2JEVA 2NMTA 3R96A 3R95A 4R9MA 5A28A 3TTHA 4KOSA 4KUAA 2J8RA 3EFAA 1IYKA 1YVOA 1SQHA 4QC6A 4FD4A 4Q36A 3F8KA 4KS9A 4NXYA 5C88A 2OH1A 1WK4A 2HQYA 4U5YA 3T9YA 2DPSA 4RI1A 2A4NA 4J3GA 1S7LA 2I79A 3FRMA 4AVCA 5G20A 1XE4A 1YLEA 1K4JA 5BWAB 2JDCA 2FS5A 4KSFA 4YGOA 3EY5A 1QSRA 1CJWA 2VZZA 2EUIA 4KOUA 1Y7RA 3FXTA 4CAEA 1QSOA 2CNSA 2FIAA 3G8WA 1I21A 1PUAA 2B3UA 2FE7A 4YFJA 1J4JA 1IYLA 4HNXB 4JXQA 5I0CA 2CNTA 2PR8A 3S6FA 1XEBA 2VXKA 4UFWA 1KUYA 4KLWA 4LUAA 3TFYA 5A27A 4KOWA 2OZGA 3I3GA 4KLVA 2B4BA 2OB0A 2G0BA 2WPXA 3LODA 4QB9A 4NSQA 4E2AA 2FIWA 1MK4A 2G3TA 4C2YA 4JXRA 2FXFA 3IU1A 4MFZA 4CGNA 4MY0A 3VWDA 4GS4A 4B5PA 4BMHA 3N7ZA 1MJAA 5H84A 2OZUA 4CS0B 3ZJ0A 3FIXA 5KTDA 3OWCA 3C26A 3UY5A 4JWPA 5F46A 4PK2A 2FT0A 3D2PA 1Y9KA 5EBVA 5IX3A 3R9GA 1B87A 3F0AA 5KTAA 2B3VA 2WUUA 5AG7A 5AGEA 4AG7A 1P4NA 2BUEA 4UWJA 3A9LA 1XMTA 2G3AA 3FYNA 4A95A 3EO4A 4R87A 4KSAA 1I12A 5G22A 2CXAA 1N71A 2BEIA 3FB3A 5F48A 4C7IA 4FD6A 2AE6A 2ZXVA 2REFA 4B14A 4UCPA 1S60A 1PU9A 4H6UA 4NF1A 3B8GA 4KORA 4FD5A 4AB7A 1KUXA 3V8IA 1ZO0A 4ZBGA 5CNPA 4JD6A 3P2HA 3TO9A 4KVXA 2Z3LA 1YGHA 2R8VA 2ZW6A 4UBRA 1YX0A 4C2XA 4R3LA 4C68A 4NCZA 5AG4A 1P0HA 4UCNA 3H4QA 3GKRA 1CM0A 2Z3KA 1RXTA 1MJ9A 5JQ4A 1OZPA 2Z11A 3R1KA 1QSNA 2CY2A 2Y0MA 4H89A 4M85A 4ONUA 4A31A 2P6GA 2VZYA 3TO6A 1TIQA 3W6SA 4CRZB 2GIVA 5H86A 1Z4RA 4MFPA 3D2MA 4RS2A 1VKCA 3TT2A 4KVOE 2JDDA 3EC4A 3S6HA 1Q2DA 2B5GA 1XIXA 4CRYB 3SXNA 2Z3MA 3TCVA 4H6ZA 2Z10A 4XPKA 3W6XA 1S5KA 1MJBA 3TOBA 4MFQA 5ISVA 4CGMA 4QVTA 2P0WA 2ZW4A 2PSWA 4YRHA 2CNMA 4Y49C 3PZJA 3EXNA 1YVKA 2Z3OA 1I1DA 4UCMA 2VI7A 2FCKA 3LD2A 2Q7BA 1S7NA 4JLYA 2JLMA 2D4PA 2Z3NA 4OAEA 2QIRA 3K9UA 3CXSA 4UFVA 3SXOA 1R57A 5DWMA 4C2ZA 1Z9UA 4R57A 4DNCA 1Q2CA 2ATRA 3DSBA 4XPDC 1M4IA 1NSLA 4E8OA 3E0KA 5GCNA 4HKFA 4MHDA 4E0AA 5E96A 1FY7A 4A32A 4UFXA 2VBQA 4CAFA 1V0CA 1NE9A 1IICA 1YK3A 2YNEA 2J8MA 2X7BA 4A2ZA 5DWNA 1NMTA 3FNCA 3IGRA 5J8FA 1B6BA 3JTKA 4Q38A 4F0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5O A;  4M3S A;  4KZT A;  4CAV A;  4B5P B;  4XPD B;  3GY9 A;  3BLN A;  4L8A A;  2OZH A;  3D8P A;  1ON0 A;  4KOX A;  4PSX A;  3PP9 A;  1GHE A;  4I49 A;  3BJ8 A;  2OU2 A;  3GYA A;  3F5B A;  4HNY B;  4JJX A;  5IB0 A;  3MGD A;  2HUZ A;  3R9F A;  2KCW A;  4U9Y A;  3DR6 A;  2GAN A;  2R98 A;  5J8C A;  2PC1 A;  5JPH A;  3R9E A;  3D3S A;  3T90 A;  4XPL A;  3JUW A;  4LX9 A;  2HV2 A;  1QSM A;  4MBU A;  4QUS A;  3SHP A;  4KOT A;  4IUS A;  3TO7 A;  3QB8 A;  2Q4V A;  3CXQ A;  3W91 A;  5F47 A;  1VHS A;  4UWI A;  2QEC A;  1M44 A;  3IWG A;  4IF5 A;  2IL4 A;  1S7F A;  1YR0 A;  4KVM E;  2REE A;  5HH1 A;  2GE3 A;  2Z0Z A;  2AJ6 A;  3ZZI A;  1IID A;  4CAW A;  4II9 A;  4KUB A;  1M4D A;  1Z4E A;  5IV0 A;  3VWE A;  1M4G A;  2F5I A;  2ZPA A;  2I00 A;  4MJ8 A;  4ORF A;  4XNH C;  4UA3 A;  4L89 A;  4F6A A;  3DR8 A;  1IB1 E;  3P2F A;  1BOB A;  5C82 A;  5HMN A;  1L0C A;  4NEX A;  1BO4 A;  3QAH A;  4KOY A;  3I9S A;  2B5G B;  3CXP A;  3KKW A;  2PDO A;  2ZW5 A;  4X5K A;  2VEZ A;  4HNW B;  1S7K A;  1LRZ A;  2J8N A;  2Q04 A;  3BJ7 A;  4XNH B;  3WR7 A;  2DXQ A;  1WWZ A;  4FD7 A;  1KZF A;  4Y49 B;  2BL1 A;  3TE4 A;  2PR1 A;  4PSW A;  3RYO A;  2ARH A;  3DNS A;  4R3K A;  3JVN A;  2B4D A;  5FVJ A;  1YRE A;  2P6E A;  1U6M A;  3NE7 A;  2R1I A;  2Q4Y A;  2B58 A;  2WPW A;  4QBJ A;  1RO5 A;  1Y9W A;  2K5T A;  2FSR A;  4KOV A;  1XF8 A;  3TOA A;  4K30 A;  2EVN A;  2VQY A;  4MI4 A;  4EVY A;  4CAX A;  1UFH A;  2C27 A;  2FL4 A;  2B4D B;  3G3S A;  4PV6 A;  2RC4 A;  5KTC A;  1M1D A;  4U9Z A;  2O28 A;  5EC4 A;  4PK3 A;  3PGP A;  1KUV A;  2QML A;  1Q2Y A;  2Q0Y A;  1QST A;  2PRB A;  4AG9 A;  5F49 A;  2R7H A;  2P6F A;  4OLL A;  2PQ8 A;  4AVA A;  3S6G A;  1S3Z A;  4AVB A;  3DDD A;  2D4O A;  3FBU A;  2Q44 A;  4MY3 A;  3S6K A;  4OAD A;  2H5M A;  2BSW A;  2ZW7 A;  2JEV A;  2NMT A;  3R96 A;  3R95 A;  4R9M A;  3TTH A;  4KOS A;  4KUA A;  2J8R A;  3EFA A;  1IYK A;  1YVO A;  1SQH A;  4QC6 A;  4FD4 A;  3F8K A;  5C88 A;  4NXY A;  2OH1 A;  1WK4 A;  2HQY A;  4U5Y A;  3T9Y A;  4RI1 A;  2A4N A;  4J3G A;  1S7L A;  2I79 A;  3FRM A;  4AVC A;  1XE4 A;  1YLE A;  1K4J A;  2JDC A;  2FS5 A;  4YGO A;  3EY5 A;  1QSR A;  1CJW A;  2VZZ A;  2EUI A;  4KOU A;  1Y7R A;  3FXT A;  1QSO A;  2CNS A;  2FIA A;  3G8W A;  1I21 A;  1PUA A;  2B3U A;  2FE7 A;  4YFJ A;  1J4J A;  1IYL A;  4HNX B;  4JXQ A;  5I0C A;  2CNT A;  2PR8 A;  3S6F A;  1XEB A;  2VXK A;  1KUY A;  4KLW A;  4LUA A;  3TFY A;  4KOW A;  2OZG A;  3I3G A;  4KLV A;  2B4B A;  2OB0 A;  2G0B A;  2WPX A;  3LOD A;  4QB9 A;  4NSQ A;  4E2A A;  2FIW A;  1MK4 A;  2G3T A;  4JXR A;  2FXF A;  4MY0 A;  3VWD A;  4GS4 A;  4B5P A;  4BMH A;  3N7Z A;  1MJA A;  5H84 A;  2OZU A;  4CS0 B;  3ZJ0 A;  3FIX A;  5KTD A;  3OWC A;  3C26 A;  3UY5 A;  4JWP A;  5F46 A;  4PK2 A;  2FT0 A;  3D2P A;  1Y9K A;  5EBV A;  5IX3 A;  3R9G A;  1B87 A;  3F0A A;  5KTA A;  2B3V A;  4AG7 A;  1P4N A;  2BUE A;  4UWJ A;  1XMT A;  2G3A A;  3FYN A;  3EO4 A;  4R87 A;  1I12 A;  1N71 A;  2BEI A;  3FB3 A;  5F48 A;  4FD6 A;  2AE6 A;  2ZXV A;  2REF A;  1S60 A;  1PU9 A;  4H6U A;  4NF1 A;  3B8G A;  4KOR A;  4FD5 A;  4AB7 A;  1KUX A;  3V8I A;  4ZBG A;  5CNP A;  4JD6 A;  3P2H A;  3TO9 A;  4KVX A;  1YGH A;  2R8V A;  2ZW6 A;  4UBR A;  1YX0 A;  4R3L A;  4NCZ A;  1P0H A;  3H4Q A;  3GKR A;  1CM0 A;  1RXT A;  1MJ9 A;  5JQ4 A;  1OZP A;  2Z11 A;  3R1K A;  1QSN A;  2CY2 A;  2Y0M A;  4H89 A;  4M85 A;  4ONU A;  2P6G A;  2VZY A;  3TO6 A;  1TIQ A;  3W6S A;  4CRZ B;  2GIV A;  5H86 A;  1Z4R A;  3D2M A;  4RS2 A;  1VKC A;  3TT2 A;  4KVO E;  2JDD A;  3EC4 A;  3S6H A;  1Q2D A;  2B5G A;  1XIX A;  4CRY B;  3SXN A;  3TCV A;  4H6Z A;  2Z10 A;  4XPK A;  3W6X A;  1S5K A;  1MJB A;  3TOB A;  5ISV A;  4QVT A;  2P0W A;  2ZW4 A;  2PSW A;  4YRH A;  2CNM A;  4Y49 C;  3PZJ A;  3EXN A;  1YVK A;  1I1D A;  2VI7 A;  2FCK A;  3LD2 A;  2Q7B A;  1S7N A;  4JLY A;  2JLM A;  2D4P A;  4OAE A;  2QIR A;  3K9U A;  3CXS A;  3SXO A;  1R57 A;  5DWM A;  1Z9U A;  4R57 A;  4DNC A;  1Q2C A;  2ATR A;  3DSB A;  4XPD C;  1M4I A;  1NSL A;  4E8O A;  3E0K A;  5GCN A;  4HKF A;  4MHD A;  4E0A A;  5E96 A;  1FY7 A;  2VBQ A;  1V0C A;  1NE9 A;  1IIC A;  1YK3 A;  2J8M A;  2X7B A;  5DWN A;  1NMT A;  3FNC A;  3IGR A;  5J8F A;  1B6B A;  4F0Y A; 
#chains in the Genus database with same CATH topology
 4NJQ A;  1XBU A;  4MFJ A;  4B5O A;  3H8G A;  4M3S A;  4KZT A;  2ABZ A;  4CAV A;  4B5P B;  4XPD B;  3QNV A;  3GUX A;  4Z65 A;  3GY9 A;  3IWE A;  1YQE A;  1Q7L A;  2F8H A;  2G9D A;  1TKF A;  2JBJ A;  3BLN A;  1ZLI A;  4L8A A;  2I3C A;  4UF4 A;  2OZH A;  3D8P A;  4PXD A;  4MMO A;  1ON0 A;  2O53 A;  3B2Y A;  4KOX A;  4PSX A;  4WWV A;  3PP9 A;  1GHE A;  4I49 A;  1QMU A;  3BJ8 A;  3GIU A;  2OU2 A;  3GYA A;  1F2P A;  1BAV A;  3F5B A;  4HNY B;  4JJX A;  4R7M A;  5IB0 A;  4Q7A A;  3MGD A;  1KWM A;  2EWB A;  4CGO A;  2HUZ A;  4F9V A;  4EME A;  1PYT B;  4OC4 A;  3R9F A;  4IHM A;  1VHE A;  3HLP A;  2KCW A;  4FAI A;  4A38 A;  3B3C A;  4FBE A;  4U9Y A;  3D7G A;  2VL1 A;  3DR6 A;  3MN8 A;  4A94 A;  2GAN A;  1Z8T A;  5AG6 A;  2AFS A;  2R98 A;  5J8C A;  2PC1 A;  2DPT A;  5JPH A;  2ZOG A;  3D3S A;  4MCQ A;  4XPL A;  3R9E A;  1H8L A;  3JUW A;  4LX9 A;  3T90 A;  4NFR A;  4A30 A;  5J1Q A;  2J9A A;  4YU9 A;  1A2Z A;  4CYO A;  5C88 A;  2HV2 A;  1QSM A;  4MBU A;  2ZOF A;  4QUS A;  4EFD A;  3SHP A;  3PFE A;  4KOT A;  3SI2 A;  4B11 A;  5JH9 A;  4IUS A;  3TO7 A;  3QB8 A;  2Q4V A;  3CXQ A;  2PIZ A;  3W91 A;  4NGM A;  5F47 A;  1VHS A;  4UWI A;  6CPA A;  2ZED A;  2QEC A;  1CP6 A;  4F0X A;  2POK A;  1M44 A;  3V7Z A;  3IWG A;  2Q7S A;  4IF5 A;  4ZI6 A;  2IL4 A;  2PVV A;  1S7F A;  2PJ8 A;  3D66 A;  3FMC A;  1YR0 A;  4KVM E;  3PEI A;  2REE A;  3S9M A;  3GB0 A;  4R76 A;  5HH1 A;  2GE3 A;  5IB9 A;  2Z0Z A;  3ISZ A;  1CG2 A;  2AJ6 A;  3ZZI A;  1IID A;  4NGQ A;  1HDQ A;  3CT9 A;  4CAW A;  3B3S A;  1BPN A;  4KUB A;  4II9 A;  5JGF A;  1M4D A;  1Z4E A;  3IU2 A;  3VWE A;  1M4G A;  5IV0 A;  4YWY A;  2F5I A;  2ZPA A;  1YSJ A;  4CYQ A;  2I00 A;  4UEZ A;  4MJ8 A;  5G1Z A;  4ORF A;  3PFO A;  2YGW A;  2ZEL A;  4UEE A;  4XNH C;  1BPM A;  3I1U A;  4X8I A;  4UA3 A;  4L89 A;  3HUV A;  3DR8 A;  3H5Z A;  4F6A A;  1IB1 E;  4CPA A;  1F2O A;  1TKJ A;  3P2F A;  1BOB A;  2PE3 A;  5C82 A;  3CZX A;  5HMN A;  2NSM A;  1L0C A;  4NEX A;  1BO4 A;  5THW A;  2XEF A;  5K8O A;  4B10 A;  3PB7 X;  3QAH A;  4KOY A;  4RN7 A;  3I9S A;  5LYL A;  1Z5R A;  2B5G B;  3BI0 A;  3CXP A;  3KKW A;  4P4F A;  1FT7 A;  2C6C A;  1LAM A;  2PDO A;  2QYV A;  2ZW5 A;  2F7V A;  4X5K A;  4EWT A;  4A37 A;  2VEZ A;  2V8D A;  3NH8 A;  1XRY A;  4HNW B;  1JQG A;  1S7K A;  1LRZ A;  2J8N A;  2Q04 A;  2IJZ A;  2V8G A;  2PJA A;  3BJ7 A;  2QVP A;  4NGR A;  4XNH B;  3D7H A;  2DXQ A;  3WR7 A;  4OIW A;  1WWZ A;  2ZEN A;  4B6Z A;  4P4I A;  4C7H A;  5LRJ A;  2PJC A;  2JBK A;  4FD7 A;  1KZF A;  5G21 A;  4PXB A;  1IOI A;  1LCP A;  4Y49 B;  2BL1 A;  3B3W A;  4CYN A;  3TE4 A;  4CYP A;  3B3T A;  2PR1 A;  1LOK A;  2GLJ A;  4PXC A;  4PSW A;  3RYO A;  2O4H A;  4ZGY B;  2RFH A;  2ARH A;  3D7D A;  2Z3P A;  3DNS A;  1CBX A;  4MXU A;  4R3K A;  3JVN A;  3VAR A;  2B4D A;  5FVJ A;  1YRE A;  1VGY A;  4NGS A;  2P6E A;  1U6M A;  8CPA A;  3NE7 A;  3RAM A;  2R1I A;  1JWQ A;  2Q4Y A;  3NFZ A;  2NYQ A;  2B58 A;  2WPW A;  3CPX A;  2PCU A;  1XOV A;  4QBJ A;  3FED A;  1RO5 A;  2PRQ A;  1Y9W A;  2K5T A;  2AFZ A;  2FSR A;  4KOV A;  4OKO A;  1XF8 A;  3FEE A;  4LQG A;  3TOA A;  3DGV A;  1R43 A;  1CPX A;  4K30 A;  2EVN A;  2VQY A;  4MI4 A;  4EVY A;  4CAX A;  4P10 A;  1UFH A;  2C27 A;  5AG5 A;  3LAC A;  4R8F A;  4MHZ A;  2FL4 A;  2B4D B;  2OR4 A;  4NGT A;  1ARM A;  3D4U A;  3G3S A;  4PV6 A;  2RC4 A;  5KTC A;  5EMI A;  1M1D A;  5JM6 A;  1DE4 C;  4U9Z A;  2O28 A;  4P4E A;  2GLF A;  4M6G A;  5HVF A;  5EC4 A;  4PK3 A;  3PGP A;  5LYD A;  1ELM P;  1IOF A;  1KUV A;  2DEA A;  2QML A;  3WT4 A;  2C6P A;  4F8Z A;  4BBH A;  1Q2Y A;  2FVG A;  1CPS A;  2V77 A;  4P44 A;  1VIX A;  4AXV A;  2Q0Y A;  4CGP A;  5I4M A;  4NGN A;  1QST A;  2PRB A;  3N5F A;  1DTD A;  2YNC C;  3KQX A;  5F49 A;  4A33 A;  4AG9 A;  2R7H A;  2P6F A;  3H8E A;  2WSA A;  2HB6 A;  3SJG A;  4OLL A;  2PQ8 A;  3S9N A;  5LRK A;  4P45 A;  4AVA A;  4LQ6 A;  2EK8 A;  5LYF A;  3S6G A;  1S3Z A;  3DLJ A;  3VAT A;  3FVL A;  2YNC A;  1IY7 A;  4AVB A;  4MFL A;  2V8V A;  4UEF A;  3SI1 A;  2PJ1 A;  7CPA A;  5HXD A;  3DDD A;  4MFK A;  4B12 A;  2D4O A;  2CIJ A;  3FBU A;  3JRU A;  2Q44 A;  2PIY A;  4MY3 A;  2YND A;  4UIA A;  3S6K A;  4P4B A;  4OAD A;  2H5M A;  2BSW A;  4B13 A;  2Q4Z A;  1YW6 A;  4CGL A;  2ZW7 A;  2JEV A;  4IK2 A;  2NMT A;  4OC2 A;  3PB6 X;  4FWU A;  3R96 A;  2ZEP A;  3R95 A;  4H2K A;  4R9M A;  5A28 A;  2GU2 A;  4ZYQ A;  3TTH A;  4KOS A;  4IAV A;  2PJB A;  3D68 A;  4KUA A;  2J8R A;  4OID A;  3EFA A;  1IYK A;  1YVO A;  1SQH A;  3K2K A;  4QC6 A;  1XMB A;  4FD4 A;  2V8H A;  4X3R A;  4Q36 A;  3F8K A;  4KS9 A;  4G1P A;  4M6I A;  2OH1 A;  1M4L A;  4NXY A;  1WK4 A;  2HQY A;  4U5Y A;  3T9Y A;  4P4D A;  2DPS A;  4RI1 A;  4PQA A;  1GYT A;  2A4N A;  1TXR A;  1S7L A;  2I79 A;  4J3G A;  1ZG7 A;  3FRM A;  3SI0 A;  5G20 A;  1XE4 A;  4AVC A;  1YLE A;  1K4J A;  2GRE A;  3IO1 A;  4MCP A;  3TX8 A;  3PRT A;  5BWA B;  1PCA A;  2AFU A;  2JDC A;  3KAS A;  5K8P A;  4DUK A;  2FS5 A;  2IQ6 A;  4KSF A;  1ZLH A;  4YGO A;  4ZX8 A;  1X12 A;  3PB9 X;  2WZN A;  3EY5 A;  2ZEE A;  1QSR A;  1CJW A;  2PJ3 A;  2VZZ A;  4FUU A;  2GFQ A;  1BLL E;  2EUI A;  4KOU A;  1Y7R A;  5LRG A;  2BCO A;  3IWW A;  1YW4 A;  3FXT A;  4CAE A;  1QSO A;  3BHX A;  2CNS A;  2AFM A;  2XEG A;  4BD9 A;  5K8N A;  3H8F A;  2FIA A;  3G8W A;  3KGQ A;  1I21 A;  1PUA A;  2ZEO A;  1ZG9 A;  2B3U A;  4MCR A;  2Q43 A;  2FE7 A;  2ODF A;  3D7F A;  3KL9 A;  3QAY A;  3SJF A;  4YFJ A;  1J4J A;  3V38 A;  1Z8W A;  1IYL A;  4HNX B;  4JXQ A;  4RUH A;  5I0C A;  2CNT A;  2DF5 A;  1AUG A;  2WYR A;  2PR8 A;  2ZEM A;  3S6F A;  1XEB A;  2VXK A;  3B3V A;  4UFW A;  5CPA A;  1KUY A;  4KLW A;  4LUA A;  5D29 A;  5A27 A;  3TFY A;  1UWY A;  4KOW A;  1Y7E A;  2OZG A;  1YME A;  3I3G A;  4KLV A;  2B4B A;  2OB0 A;  2G0B A;  2WPX A;  3LOD A;  4QB9 A;  4NSQ A;  4ZX9 A;  4E2A A;  2FIW A;  1MK4 A;  2G3T A;  3CPA A;  4C2Y A;  4JXR A;  2IMO A;  2FXF A;  3IU1 A;  2AFX A;  1HDU A;  4MFZ A;  4CGN A;  4MY0 A;  3VWD A;  4GS4 A;  3BI1 A;  4B5P A;  2CTC A;  4BMH A;  4OC1 A;  3N7Z A;  4OP4 A;  1MJA A;  3NH4 A;  1FNO A;  4P4J A;  5H84 A;  3FH4 A;  2ANP A;  2OZU A;  1OBR A;  4OME A;  4CS0 B;  3ZJ0 A;  1ZG8 A;  2PJ6 A;  3FIX A;  5KTD A;  5LYI A;  3OWC A;  3C26 A;  3UY5 A;  3CDX A;  4JWP A;  4PK2 A;  2FT0 A;  5F46 A;  2ZEG A;  3RO0 A;  5CBM A;  3D2P A;  1Y9K A;  1XJO A;  1YLO A;  5EBV A;  3R9G A;  5IX3 A;  1B87 A;  3F0A A;  3SJE A;  3KQZ A;  5KTA A;  3IJ3 A;  2B3V A;  2WUU A;  5AG7 A;  5AGE A;  1IU8 A;  5D8N A;  4AG7 A;  1P4N A;  2BUE A;  3D67 A;  4UWJ A;  3A9L A;  1LAN A;  1XMT A;  2G3A A;  3FYN A;  2CTB A;  1AMP A;  4MHY A;  3RZA A;  3KR4 A;  1B6B A;  3RNZ A;  1IGB A;  2ZEF A;  3KR5 A;  4A95 A;  2RB7 A;  2EK9 A;  3EO4 A;  4R87 A;  2JEW A;  4KSA A;  1I12 A;  5G22 A;  2XEJ A;  2CXA A;  3L2N A;  4DYO A;  1N71 A;  4JYW A;  2BEI A;  3FB3 A;  4JZ0 A;  5F48 A;  4C7I A;  3IIB A;  4FD6 A;  4R6T A;  2AE6 A;  1XFO A;  2ZXV A;  2REF A;  1ELL P;  4B14 A;  4OC0 A;  3S9L A;  1Z8X A;  4UCP A;  1S60 A;  1PU9 A;  4H6U A;  4NF1 A;  5DS0 A;  4GM5 A;  3KZW A;  4MRI A;  3TC8 A;  1VHO A;  4P6Y A;  3B8G A;  3NE8 A;  1X10 A;  4KOR A;  4ONW A;  4FD5 A;  4AB7 A;  1KUX A;  1LFW A;  3V8I A;  1ZO0 A;  2BO9 A;  2C6G A;  4ZBG A;  5CNP A;  4JD6 A;  3P2H A;  3TO9 A;  4KVX A;  2Z3L A;  3WC7 A;  1YGH A;  2R8V A;  2PJ0 A;  2PJ9 A;  1YX0 A;  2ZW6 A;  4UBR A;  4C2X A;  4W9Y A;  4R3L A;  3FEC A;  4NJR A;  2Q51 A;  3NH5 A;  4C68 A;  3KHX A;  4NCZ A;  5AG4 A;  1P0H A;  5F09 A;  4UCN A;  3H4Q A;  4TWE A;  3BXM A;  2OOT A;  1Z2L A;  2PJ5 A;  1R3N A;  2AFW A;  3B35 A;  3PBB A;  4ZY2 A;  2PJ2 A;  4KSI A;  2HC9 A;  3GKR A;  1CM0 A;  1Z8L A;  2Z3K A;  4X2T A;  4F9U A;  1RXT A;  1TF8 A;  1MJ9 A;  5JQ4 A;  4DJL A;  3FX6 A;  1OZP A;  2QJ8 A;  2Z11 A;  3R1K A;  1QSN A;  4OC3 A;  4HPS A;  3T8W A;  2ZEH A;  2CY2 A;  2Y0M A;  4H89 A;  4M85 A;  4ONU A;  4A31 A;  4K3N A;  3K9T A;  2P6G A;  2VZY A;  3TO6 A;  1F57 A;  4ZY1 A;  3ISX A;  1TIQ A;  3W6S A;  2PVW A;  4TNU A;  4CRZ B;  2GIV A;  5H86 A;  1Z4R A;  4MFP A;  3D2M A;  4RS2 A;  1VKC A;  1Y0R A;  5HVH A;  3TT2 A;  2CF4 A;  4KVO E;  2JDD A;  3EC4 A;  4NGP A;  3S6H A;  1Y0Y A;  1Q2D A;  2B5G A;  1XIX A;  4CRY B;  3PB4 X;  4ZY0 A;  3SXN A;  2Z3M A;  2XEI A;  3TCV A;  3MRU A;  4H6Z A;  2Z10 A;  4XPK A;  3GLJ A;  3LMS A;  3KHZ A;  4M6H A;  4A39 A;  4BIN A;  1EE3 P;  3W6X A;  1S5K A;  1MJB A;  3TOB A;  1HEE A;  4MFQ A;  5ELY A;  3RBU A;  3SJX A;  5ISV A;  2EBJ A;  4MHP A;  4CGM A;  4QVT A;  2P0W A;  3NA6 A;  3FJU A;  5K8M A;  2ZW4 A;  1TF9 A;  2PSW A;  1CX8 A;  4YRH A;  3WC6 A;  2CNM A;  4Y49 C;  3PB8 X;  3PZJ A;  3EXN A;  1YVK A;  4PPZ A;  2Z3O A;  1I1D A;  1QQ9 A;  2C1C A;  4UCM A;  5HVG A;  3IC1 A;  2VI7 A;  2FCK A;  3LD2 A;  2Q7B A;  2EO8 A;  4GXH A;  1S7N A;  3PBE A;  4JLY A;  2PJ7 A;  2JLM A;  1LAP A;  2D4P A;  2Z3N A;  4OAE A;  4PXE A;  2QIR A;  1TKH A;  3CXS A;  3IFE A;  3K9U A;  1R57 A;  4UFV A;  3SXO A;  3WAB A;  5DWM A;  4C2Z A;  1Z9U A;  4R57 A;  4DNC A;  2BOA A;  1Q2C A;  2ATR A;  2PJ4 A;  3DSB A;  1M4I A;  4XPD C;  3VH9 A;  1NSL A;  1NSA A;  4E8O A;  3WC5 A;  3B7I A;  3E0K A;  1ARL A;  5GCN A;  4OC5 A;  4HKF A;  4UIB A;  4MHD A;  2AFO A;  4MHN A;  4E0A A;  3IEH A;  1FY7 A;  5E96 A;  4A32 A;  4UFX A;  2VBQ A;  4CAF A;  1V0C A;  1NE9 A;  1IIC A;  1YK3 A;  2YNE A;  4MCS A;  3FF3 A;  2J8M A;  2X7B A;  4A2Z A;  3LWU A;  3KI9 A;  5DWN A;  1NMT A;  1CP7 A;  3FNC A;  1RTQ A;  3IGR A;  4WJB A;  4O23 A;  5J8F A;  1AYE A;  3JTK A;  4Q38 A;  4F0Y A; 
#chains in the Genus database with same CATH homology
 4MFJ A;  4B5O A;  4M3S A;  4KZT A;  4CAV A;  4B5P B;  4XPD B;  3GY9 A;  3IWE A;  3BLN A;  4L8A A;  2OZH A;  3D8P A;  1ON0 A;  4KOX A;  4PSX A;  3PP9 A;  1GHE A;  4I49 A;  3BJ8 A;  2OU2 A;  3GYA A;  3F5B A;  4HNY B;  4JJX A;  5IB0 A;  3MGD A;  4CGO A;  2HUZ A;  3R9F A;  2KCW A;  4U9Y A;  3DR6 A;  2GAN A;  5AG6 A;  2R98 A;  5J8C A;  2PC1 A;  2DPT A;  5JPH A;  3R9E A;  3D3S A;  3T90 A;  4XPL A;  3JUW A;  4LX9 A;  4A30 A;  4CYO A;  2HV2 A;  1QSM A;  4MBU A;  4QUS A;  3SHP A;  4KOT A;  4B11 A;  4IUS A;  3TO7 A;  3QB8 A;  2Q4V A;  3CXQ A;  3W91 A;  5F47 A;  1VHS A;  4UWI A;  2QEC A;  4F0X A;  1M44 A;  3IWG A;  4IF5 A;  2IL4 A;  1S7F A;  1YR0 A;  4KVM E;  2REE A;  5HH1 A;  2GE3 A;  2Z0Z A;  2AJ6 A;  3ZZI A;  1IID A;  4CAW A;  4II9 A;  4KUB A;  1M4D A;  1Z4E A;  3IU2 A;  3VWE A;  1M4G A;  5IV0 A;  2F5I A;  2ZPA A;  4CYQ A;  2I00 A;  5G1Z A;  4MJ8 A;  4ORF A;  2YGW A;  4XNH C;  4UA3 A;  4L89 A;  4F6A A;  3DR8 A;  3H5Z A;  1IB1 E;  3P2F A;  1BOB A;  5C82 A;  5HMN A;  1L0C A;  4NEX A;  1BO4 A;  4B10 A;  3QAH A;  4KOY A;  3I9S A;  2B5G B;  3CXP A;  3KKW A;  2PDO A;  2ZW5 A;  4X5K A;  2VEZ A;  4HNW B;  1S7K A;  1LRZ A;  2J8N A;  2Q04 A;  3BJ7 A;  4XNH B;  3WR7 A;  2DXQ A;  1WWZ A;  4C7H A;  4FD7 A;  1KZF A;  5G21 A;  4Y49 B;  2BL1 A;  4CYN A;  3TE4 A;  4CYP A;  2PR1 A;  4PSW A;  3RYO A;  4ZGY B;  2ARH A;  2Z3P A;  3DNS A;  4R3K A;  3JVN A;  2B4D A;  5FVJ A;  1YRE A;  2P6E A;  1U6M A;  3NE7 A;  2R1I A;  2Q4Y A;  2B58 A;  2WPW A;  4QBJ A;  1RO5 A;  1Y9W A;  2K5T A;  2FSR A;  4KOV A;  1XF8 A;  3TOA A;  4K30 A;  2EVN A;  2VQY A;  4MI4 A;  4EVY A;  4CAX A;  1UFH A;  2C27 A;  5AG5 A;  2FL4 A;  2B4D B;  3G3S A;  4PV6 A;  2RC4 A;  5KTC A;  1M1D A;  4U9Z A;  2O28 A;  5EC4 A;  4PK3 A;  3PGP A;  1KUV A;  2QML A;  4BBH A;  1Q2Y A;  4CGP A;  2Q0Y A;  1QST A;  2PRB A;  2YNC C;  4AG9 A;  5F49 A;  4A33 A;  2R7H A;  2P6F A;  2WSA A;  4OLL A;  2PQ8 A;  4AVA A;  3S6G A;  1S3Z A;  2YNC A;  4AVB A;  4MFL A;  3DDD A;  4MFK A;  4B12 A;  2D4O A;  3FBU A;  2Q44 A;  4B13 A;  4MY3 A;  2YND A;  3S6K A;  4OAD A;  2H5M A;  2BSW A;  4CGL A;  2ZW7 A;  2JEV A;  2NMT A;  3R96 A;  3R95 A;  4R9M A;  5A28 A;  3TTH A;  4KOS A;  4KUA A;  2J8R A;  3EFA A;  1IYK A;  1YVO A;  1SQH A;  4QC6 A;  4FD4 A;  4Q36 A;  3F8K A;  4KS9 A;  4NXY A;  5C88 A;  2OH1 A;  1WK4 A;  2HQY A;  4U5Y A;  3T9Y A;  2DPS A;  4RI1 A;  2A4N A;  4J3G A;  1S7L A;  2I79 A;  3FRM A;  4AVC A;  5G20 A;  1XE4 A;  1YLE A;  1K4J A;  5BWA B;  2JDC A;  2FS5 A;  4KSF A;  4YGO A;  3EY5 A;  1QSR A;  1CJW A;  2VZZ A;  2EUI A;  4KOU A;  1Y7R A;  3FXT A;  4CAE A;  1QSO A;  2CNS A;  2FIA A;  3G8W A;  1I21 A;  1PUA A;  2B3U A;  2FE7 A;  4YFJ A;  1J4J A;  1IYL A;  4HNX B;  4JXQ A;  5I0C A;  2CNT A;  2PR8 A;  3S6F A;  1XEB A;  2VXK A;  4UFW A;  1KUY A;  4KLW A;  4LUA A;  3TFY A;  5A27 A;  4KOW A;  2OZG A;  3I3G A;  4KLV A;  2B4B A;  2OB0 A;  2G0B A;  2WPX A;  3LOD A;  4QB9 A;  4NSQ A;  4E2A A;  2FIW A;  1MK4 A;  2G3T A;  4C2Y A;  4JXR A;  2FXF A;  3IU1 A;  4MFZ A;  4CGN A;  4MY0 A;  3VWD A;  4GS4 A;  4B5P A;  4BMH A;  3N7Z A;  1MJA A;  5H84 A;  2OZU A;  4CS0 B;  3ZJ0 A;  3FIX A;  5KTD A;  3OWC A;  3C26 A;  3UY5 A;  4JWP A;  5F46 A;  4PK2 A;  2FT0 A;  3D2P A;  1Y9K A;  5EBV A;  5IX3 A;  3R9G A;  1B87 A;  3F0A A;  5KTA A;  2B3V A;  2WUU A;  5AG7 A;  5AGE A;  4AG7 A;  1P4N A;  2BUE A;  4UWJ A;  3A9L A;  1XMT A;  2G3A A;  3FYN A;  4A95 A;  3EO4 A;  4R87 A;  4KSA A;  1I12 A;  5G22 A;  2CXA A;  1N71 A;  2BEI A;  3FB3 A;  5F48 A;  4C7I A;  4FD6 A;  2AE6 A;  2ZXV A;  2REF A;  4B14 A;  4UCP A;  1S60 A;  1PU9 A;  4H6U A;  4NF1 A;  3B8G A;  4KOR A;  4FD5 A;  4AB7 A;  1KUX A;  3V8I A;  1ZO0 A;  4ZBG A;  5CNP A;  4JD6 A;  3P2H A;  3TO9 A;  4KVX A;  2Z3L A;  1YGH A;  2R8V A;  2ZW6 A;  4UBR A;  1YX0 A;  4C2X A;  4R3L A;  4C68 A;  4NCZ A;  5AG4 A;  1P0H A;  4UCN A;  3H4Q A;  3GKR A;  1CM0 A;  2Z3K A;  1RXT A;  1MJ9 A;  5JQ4 A;  1OZP A;  2Z11 A;  3R1K A;  1QSN A;  2CY2 A;  2Y0M A;  4H89 A;  4M85 A;  4ONU A;  4A31 A;  2P6G A;  2VZY A;  3TO6 A;  1TIQ A;  3W6S A;  4CRZ B;  2GIV A;  5H86 A;  1Z4R A;  4MFP A;  3D2M A;  4RS2 A;  1VKC A;  3TT2 A;  4KVO E;  2JDD A;  3EC4 A;  3S6H A;  1Q2D A;  2B5G A;  1XIX A;  4CRY B;  3SXN A;  2Z3M A;  3TCV A;  4H6Z A;  2Z10 A;  4XPK A;  3W6X A;  1S5K A;  1MJB A;  3TOB A;  4MFQ A;  5ISV A;  4CGM A;  4QVT A;  2P0W A;  2ZW4 A;  2PSW A;  4YRH A;  2CNM A;  4Y49 C;  3PZJ A;  3EXN A;  1YVK A;  2Z3O A;  1I1D A;  4UCM A;  2VI7 A;  2FCK A;  3LD2 A;  2Q7B A;  1S7N A;  4JLY A;  2JLM A;  2D4P A;  2Z3N A;  4OAE A;  2QIR A;  3K9U A;  3CXS A;  4UFV A;  3SXO A;  1R57 A;  5DWM A;  4C2Z A;  1Z9U A;  4R57 A;  4DNC A;  1Q2C A;  2ATR A;  3DSB A;  4XPD C;  1M4I A;  1NSL A;  4E8O A;  3E0K A;  5GCN A;  4HKF A;  4MHD A;  4E0A A;  5E96 A;  1FY7 A;  4A32 A;  4UFX A;  2VBQ A;  4CAF A;  1V0C A;  1NE9 A;  1IIC A;  1YK3 A;  2YNE A;  2J8M A;  2X7B A;  4A2Z A;  5DWN A;  1NMT A;  3FNC A;  3IGR A;  5J8F A;  1B6B A;  3JTK A;  4Q38 A;  4F0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...