4MJ8A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with polyamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title Crystal structure of spermidine N-acetyltransferase from Vibrio cholerae in complex with polyamine
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 56
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mj8A00
3TO6A 1U6MA 1Z4EA 4RI1A 5FVJA 2VZYA 3PP9A 2G0BA 1V0CA 5EC4A 3FB3A 4QB9A 3N7ZA 3K9UA 2VEZA 2B4DA 2R98A 3W6SA 3DR8A 3R95A 5JPHA 2A4NA 5F48A 4H6UA 4QC6A 4JXRA 4PSWA 2R1IA 3D2PA 4CS0B 3TT2A 4UWIA 2RC4A 3DDDA 4R9MA 4U9YA 3G3SA 2Y0MA 4CAWA 2ZW7A 2Z0ZA 3UY5A 2NMTA 3MGDA 2FIWA 3GYAA 3VWEA 2Q44A 3GY9A 4QUSA 4PV6A 3R9FA 2D4PA 2VBQA 4QBJA 2DXQA 2G3TA 2BL1A 1Q2YA 1FY7A 4AG7A 4NXYA 2J8MA 2ZPAA 2OZGA 1MK4A 2EVNA 3DR6A 3T9YA 3JVNA 3S6KA 2AE6A 2FIAA 3OWCA 1MJBA 2GIVA 4KOYA 4ONUA 4MJ8A 1YX0A 5KTCA 2CNTA 1Y7RA 3SXNA 3LD2A 2OB0A 3TOAA 1CJWA 2OZHA 2O28A 4FD7A 1KUVA 2P6EA 3EFAA 3S6HA 1NMTA 1NSLA 4KLWA 2HQYA 1S3ZA 3QB8A 2Q04A 2OZUA 1YREA 4FD4A 3QAHA 4R87A 1QSTA 3JUWA 5H84A 1YVOA 4OADA 1MJ9A 4GS4A 1S5KA 3VWDA 4ZBGA 2ARHA 2B5GA 2WPWA 1S7LA 3F8KA 4MHDA 1Z4RA 2KCWA 1RXTA 1Y9WA 2EUIA 2K5TA 4NEXA 3SHPA 1OZPA 2B58A 4KOXA 2GE3A 2R8VA 5E96A 1P0HA 5F46A 4KUAA 3TO9A 1XE4A 2J8NA 2FS5A 4CRZB 4OAEA 4KOTA 2IL4A 2QECA 2FL4A 1N71A 2B4DB 2Z10A 4E8OA 4YRHA 3W6XA 3TE4A 1B6BA 3I3GA 2I79A 1K4JA 1PUAA 3FYNA 3BLNA 3R1KA 2PR8A 5HMNA 3B8GA 5KTDA 2F5IA 5HH1A 1RO5A 2VZZA 4XPDC 1S7NA 2B3UA 1R57A 2R7HA 4HNXB 4U9ZA 1Q2CA 2QMLA 4YGOA 1I1DA 1QSMA 4KORA 1KUXA 4MY0A 4JJXA 3P2FA 1CM0A 2HV2A 3EY5A 2GANA 2JDDA 4MBUA 5C88A 4XPLA 3C26A 4HNWB 1IICA 2Q4VA 2VQYA 1NE9A 4B5PB 3I9SA 1MJAA 1Q2DA 4Y49C 2J8RA 4KVOE 3SXOA 4CRYB 2Q4YA 3CXSA 3R96A 4J3GA 4NCZA 4UWJA 4YFJA 5IV0A 2PQ8A 1M4DA 4R57A 1I12A 3TOBA 4KOSA 3DNSA 4AVBA 3CXPA 4F0YA 4IUSA 4BMHA 3WR7A 5J8CA 1QSRA 2PC1A 2P6GA 5H86A 3RYOA 2B5GB 2QIRA 3FRMA 2BEIA 3LODA 4F6AA 1M4GA 1BOBA 4KOUA 4MI4A 4XPKA 1TIQA 4CAXA 4AVCA 1IYLA 2B4BA 3TTHA 2P0WA 3GKRA 4PK3A 1YK3A 2FE7A 1VKCA 5J8FA 2BSWA 4OLLA 4XPDB 4U5YA 3H4QA 4JLYA 1LRZA 5C82A 4KOWA 1IB1E 5DWMA 3PZJA 3T90A 1XIXA 2JEVA 4FD6A 5F47A 5IX3A 4LUAA 4AG9A 1J4JA 2JLMA 1UFHA 1P4NA 2ATRA 2WPXA 3E0KA 3D8PA 4XNHB 3ZZIA 2PDOA 2PRBA 5IB0A 2REFA 1KUYA 1IIDA 4L89A 2FCKA 2OU2A 5EBVA 1Z9UA 4FD5A 1M44A 3R9GA 4NF1A 5DWNA 1S7FA 3FIXA 4RS2A 4JD6A 2CNSA 4Y49B 3D2MA 3KKWA 1VHSA 1S7KA 4X5KA 4NSQA 4II9A 1GHEA 2ZW5A 5I0CA 5ISVA 1ON0A 3EXNA 3NE7A 3S6FA 5GCNA 1M4IA 3FXTA 2FSRA 1S60A 3S6GA 4LX9A 4XNHC 2D4OA 3ZJ0A 1I21A 2Q7BA 4DNCA 3TCVA 4K30A 1XF8A 2ZXVA 4JXQA 1L0CA 3R9EA 2Z11A 4KVME 4E0AA 4JWPA 4M3SA 3P2HA 4L8AA 2REEA 4R3LA 4UBRA 2P6FA 1YLEA 3V8IA 4KLVA 5CNPA 1Y9KA 2FT0A 5JQ4A 3TFYA 4PK2A 2JDCA 1YVKA 4KOVA 1WK4A 3EC4A 3IWGA 2PR1A 2B3VA 2FXFA 2BUEA 2AJ6A 1SQHA 4AB7A 2I00A 4UA3A 3D3SA 2ZW4A 1QSOA 4H6ZA 4B5PA 3G8WA 4IF5A 2ZW6A 1IYKA 3BJ8A 1PU9A 2H5MA 3FBUA 4HKFA 4PSXA 2CNMA 4QVTA 2Q0YA 3FNCA 4CAVA 4ORFA 3W91A 4HNYB 1XMTA 1B87A 2CY2A 2VI7A 3TO7A 4E2AA 4M85A 4R3KA 4B5OA 5KTAA 2OH1A 4EVYA 5F49A 1BO4A 3IGRA 4H89A 2PSWA 2X7BA 1WWZA 1XEBA 3PGPA 2VXKA 1YGHA 2G3AA 3F0AA 4KUBA 1YR0A 3BJ7A 4AVAA 4KZTA 1M1DA 4I49A 1QSNA 2HUZA 3DSBA 3F5BA 4MY3A 1KZFA 3EO4A 4KVXA 2C27A 3CXQA
chains in the Genus database with same CATH superfamily
3JTKA 3TO6A 1U6MA 4F9UA 1Z4EA 4A30A 4RI1A 4CGLA 5FVJA 1ZLIA 2VZYA 3PP9A 2G0BA 1QMUA 1V0CA 2PE3A 5EC4A 3FB3A 4QB9A 3N7ZA 4NJQA 3K9UA 1Y0RA 3PBBA 2VEZA 4CGPA 1F2PA 5LRKA 2V77A 2B4DA 2R98A 3W6SA 3DR8A 3R95A 3D7FA 4P45A 2JBKA 2A4NA 5F48A 5F09A 4A33A 3B35A 4H6UA 4QC6A 3NH8A 4JXRA 4LQ6A 3H8EA 4PSWA 2R1IA 4G1PA 3D2PA 4CS0B 3TT2A 4B11A 4LQGA 4UWIA 5K8MA 2RC4A 3DDDA 2PJ0A 4R9MA 4U9YA 4TNUA 3G3SA 3H5ZA 3VH9A 5AG4A 2Y0MA 4CAWA 2ZW7A 4OC3A 1XOVA 3S9LA 2AFSA 1XFOA 2Z0ZA 1DTDA 3UY5A 4B10A 4CPAA 2DF5A 2NMTA 5AG5A 2ZEFA 3MGDA 2FIWA 3GYAA 3VWEA 2XEFA 4UCNA 3HUVA 1Z8WA 1CP6A 2Q44A 1AMPA 3GY9A 4QUSA 4PV6A 3R9FA 2D4PA 2VBQA 2FVGA 2DXQA 2G3TA 1BPMA 3FX6A 1X12A 2BL1A 5G20A 4MHZA 1XJOA 1ZG7A 3KQXA 2NYQA 1Q2YA 1TKJA 1FY7A 4AG7A 1M4LA 5LYDA 4MHPA 4NXYA 2J8MA 2ZPAA 3V7ZA 4DJLA 2OZGA 2PJBA 1MK4A 4YU9A 3PB9X 2EVNA 3KGQA 5ELYA 3DR6A 4P4DA 4OC4A 3T9YA 3D66A 3JVNA 1VIXA 2ZEOA 2ZEDA 2AE6A 3FF3A 3JRUA 3RZAA 3S6KA 4Q38A 3ISZA 1IY7A 3WABA 4QBJA 5HXDA 1GYTA 2FIAA 3KI9A 5IB9A 4RN7A 1CBXA 3OWCA 3IWEA 4HPSA 4KSIA 4NGQA 4ONWA 1MJBA 2GIVA 2C6PA 4KOYA 4ONUA 1IU8A 5G1ZA 1LAPA 2PIZA 2C6GA 4MJ8A 4PPZA 1YX0A 1CPSA 5KTCA 2CNTA 3FECA 1Y7RA 3KR4A 3SXNA 3LD2A 2OB0A 1DE4C 4NJRA 2Q7SA 3TOAA 2CF4A 4R8FA 1CJWA 2OZHA 3DLJA 2EO8A 2Z3OA 4OIDA 2O28A 4FD7A 3VARA 1KUVA 1CG2A 2P6EA 2ZEEA 3EFAA 3S6HA 4FWUA 1NMTA 1NSLA 4KLWA 5HVFA 2HQYA 1S3ZA 3NA6A 2Q04A 3QB8A 4P4BA 3RAMA 1TKFA 3TC8A 4C2XA 2PJ9A 2EWBA 2OZUA 3NE8A 1YREA 4FD4A 4MFLA 1CP7A 4OC5A 3QAHA 5J1QA 4R87A 4B14A 1QSTA 3JUWA 3ISXA 5H84A 1YVOA 1TKHA 1MJ9A 4GS4A 2WZNA 4OADA 3PB7X 1S5KA 3VWDA 4ZBGA 2ARHA 2B5GA 5K8NA 2ZEGA 4ZY2A 4B13A 2PJ1A 2WPWA 1S7LA 3MRUA 5D29A 1IGBA 1VGYA 4UCMA 1ELMP 4A94A 3F8KA 3D68A 4F9VA 3RBUA 4B12A 4MHDA 1Z4RA 2KCWA 4C68A 4BINA 2GLFA 1RXTA 1Y9WA 2EUIA 2AFUA 3B7IA 2PJ3A 3NH5A 4MXUA 2PJ5A 1HDQA 2K5TA 2Z3KA 3S9NA 2AFWA 4NEXA 4P44A 3SHPA 1OZPA 2B58A 4IHMA 3D7HA 2CIJA 3FEEA 1RTQA 1PYTB 4KOXA 4B6ZA 2GE3A 4DUKA 2R8VA 5E96A 4EWTA 1P0HA 5F46A 3PB6X 5LYFA 4Z65A 4KUAA 3TO9A 4RUHA 1XE4A 2J8NA 2FS5A 1LCPA 2QYVA 4CRZB 4OAEA 2Z3NA 2YGWA 4KOTA 1AYEA 2IL4A 2QECA 2FL4A 1FNOA 2NSMA 1TF8A 2ZEHA 1N71A 2B4DB 2Z10A 4ZYQA 4FUUA 4MRIA 4E8OA 4YRHA 3SJFA 3W6XA 3TE4A 3GB0A 3H8GA 1B6BA 3FMCA 4Q7AA 3I3GA 2I79A 1K4JA 4MFZA 1PUAA 3FYNA 1ZLHA 3K2KA 5JM6A 3BLNA 3R1KA 2PR8A 5HMNA 2YNCA 3B8GA 4IK2A 5KTDA 2F5IA 3D67A 5HH1A 4AXVA 1TXRA 1RO5A 2PJ2A 2VZZA 4XPDC 1S7NA 2B3UA 1R57A 3B3WA 4NGNA 1TF9A 5I4MA 4C7IA 2R7HA 2PJ4A 4W9YA 3IIBA 3IU2A 4HNXB 1LOKA 2PVVA 4U9ZA 4WJBA 3WT4A 1Q2CA 3WC7A 4UFWA 2QMLA 4YGOA 2F7VA 4PQAA 1I1DA 4OP4A 1QQ9A 4P4FA 3SJGA 2BCOA 1QSMA 1YMEA 4MCSA 4KORA 1KUXA 3KQZA 2EK8A 4JJXA 4MY0A 1OBRA 4UEFA 4A95A 1BPNA 4BBHA 1LAMA 3P2FA 3KL9A 1CM0A 4ZX9A 2HV2A 1HDUA 5EMIA 2C6CA 5G21A 3EY5A 2GANA 2JDDA 4MBUA 4UEZA 3GUXA 4PXEA 2AFXA 4ZGYB 5JPHA 5C88A 4XPLA 1Z8LA 4OC2A 3C26A 1ZG8A 2GFQA 4HNWB 1IICA 2Q4VA 2VQYA 1YW6A 1YQEA 2Z3LA 3D4UA 4O23A 1NE9A 4C7HA 4B5PB 3I9SA 1MJAA 2DPSA 1Q2DA 3TX8A 5LYLA 4UIBA 2J8RA 4Y49C 1JQGA 4KVOE 2AFOA 2OR4A 2Q51A 3SI2A 3SXOA 2Q4YA 3CXSA 4KSAA 4CRYB 2AFZA 4M6HA 5CBMA 4MFJA 3FJUA 3R96A 4MCRA 4UFXA 2WSAA 4J3GA 2EK9A 4NCZA 4UWJA 1ELLP 3QAYA 4WWVA 3PEIA 4CGMA 4YFJA 1Z2LA 3B2YA 5IV0A 1KWMA 2PQ8A 1ZG9A 1M4DA 4R57A 1I12A 4ZI6A 3TOBA 2POKA 4KOSA 3DNSA 4AVBA 4NGSA 2O53A 3CXPA 3NH4A 4F0YA 4IUSA 4BMHA 3GIUA 5AGEA 3WR7A 2PCUA 2PVWA 4M6IA 3IJ3A 2PJ6A 3SJXA 2OOTA 4P6YA 4UIAA 4CYNA 5J8CA 1QSRA 2PJ8A 4M6GA 1EE3P 2WYRA 2BO9A 2P6GA 2PC1A 5CPAA 5A28A 5H86A 2ZOFA 4A31A 3RYOA 2XEIA 2B5GB 2QIRA 3FRMA 4NGTA 2BEIA 4P4EA 3LODA 2I3CA 1YW4A 4X8IA 2CTCA 3BI0A 1YSJA 1ARLA 2ZEPA 4F6AA 3RO0A 1M4GA 1BOBA 4KOUA 4MI4A 2RFHA 4GM5A 4Q36A 4XPKA 3PB8X 1TIQA 4CAXA 2J9AA 4AVCA 4FAIA 2IMOA 1IYLA 3VATA 2B4BA 4OKOA 3TTHA 1ZO0A 2P0WA 3GKRA 4PK3A 3IEHA 4H2KA 4X2TA 1YK3A 2FE7A 1VKCA 5J8FA 1FT7A 2DEAA 2BSWA 4GXHA 3PBEA 4OLLA 3SJEA 2AFMA 4CGNA 3IFEA 4XPDB 4U5YA 3H4QA 4MFPA 4JLYA 1LRZA 3PFOA 3B3CA 5C82A 5G22A 3BHXA 4KOWA 1IB1E 2XEJA 5DWMA 3PZJA 1JWQA 2HB6A 3PRTA 3T90A 5JH9A 1XIXA 1R3NA 2JEVA 4FD6A 4OC0A 4UFVA 5F47A 2G9DA 4MFKA 5IX3A 5D8NA 1UWYA 4LUAA 4AG9A 3CDXA 1J4JA 1Y0YA 2JLMA 1UFHA 1P4NA 2ATRA 2WPXA 2VL1A 1NSAA 2GREA 3E0KA 2ZEMA 4JYWA 3BI1A 3D8PA 1A2ZA 3KZWA 2BOAA 4XNHB 2PDOA 4KS9A 3ZZIA 2PRBA 5IB0A 3PFEA 4MHYA 2REFA 1KUYA 1Y7EA 1IIDA 2Q43A 4L89A 4MCPA 2FCKA 2OU2A 5EBVA 4C2ZA 1VHEA 1IOIA 1Z9UA 3WC5A 5HVHA 4FD5A 2JEWA 1M44A 2QJ8A 3KHZA 4NFRA 3R9GA 2Q4ZA 5JGFA 4NF1A 1YLOA 4OC1A 4P4JA 5DWNA 4KSFA 4P4IA 1S7FA 3IO1A 3FIXA 4RS2A 4JD6A 2CNSA 2PJCA 3CT9A 3D2MA 4Y49B 3KKWA 8CPAA 1VHSA 3LACA 1S7KA 4X5KA 4NSQA 4II9A 2ABZA 1CX8A 1GHEA 2Z3MA 2ZW5A 3GLJA 4R6TA 3MN8A 3B3TA 2PJAA 3FH4A 5A27A 4FBEA 5I0CA 5ISVA 1ON0A 3EXNA 5AG6A 3NE7A 3S6FA 1AUGA 6CPAA 5GCNA 4ZX8A 4CAEA 4MMOA 4R76A 4EMEA 3D7GA 2YNDA 1M4IA 3FXTA 2FSRA 1S60A 3S6GA 4CGOA 4LX9A 4XNHC 2D4OA 3NFZA 2PIYA 4UF4A 2YNCC 4A2ZA 1XRYA 3ZJ0A 1I21A 3FEDA 2RB7A 3KHXA 4BD9A 2ANPA 2Q7BA 4DNCA 5AG7A 3TCVA 4K30A 4F0XA 1XF8A 4TWEA 5HVGA 2ZXVA 4JXQA 2V8GA 1L0CA 2GU2A 3R9EA 2Z11A 3QNVA 3KR5A 4A37A 4KVME 2XEGA 2ODFA 4X3RA 4E0AA 3CPXA 2V8DA 4JWPA 1F2OA 4M3SA 4PXBA 5DS0A 3P2HA 4L8AA 2REEA 3L2NA 4NGPA 4R3LA 4UBRA 2P6FA 4P10A 1YLEA 5LRGA 3V8IA 1XMBA 1HEEA 4KLVA 4IAVA 3KASA 3N5FA 5CNPA 1Y9KA 4CAFA 1IOFA 2FT0A 2PRQA 4JZ0A 4YWYA 5JQ4A 3A9LA 3TFYA 1LANA 4PK2A 4ZY1A 2JDCA 1YVKA 4KOVA 1WK4A 3EC4A 3IWGA 5BWAB 2PR1A 2B3VA 2FXFA 2CXAA 4F8ZA 2BUEA 3SI0A 2AJ6A 2Z3PA 1SQHA 3IC1A 2I00A 4AB7A 4UA3A 2PJ7A 4A39A 3D3SA 2ZW4A 1QSOA 1CPXA 4H6ZA 4B5PA 2F8HA 3CPAA 3G8WA 4IF5A 2ZW6A 1XBUA 2HC9A 5THWA 3IU1A 4CYPA 2IQ6A 1IYKA 1LFWA 3BJ8A 1BLLE 1PU9A 2WUUA 4R7MA 4EFDA 1Z5RA 3S9MA 1BAVA 4UCPA 2H5MA 3FBUA 4HKFA 4PSXA 2V8HA 2CNMA 4QVTA 2JBJA 2ZENA 2GLJA 4CYOA 7CPAA 2Q0YA 1X10A 3FNCA 3K9TA 4CAVA 5LYIA 4PXCA 4ORFA 3W91A 3CZXA 4HNYB 1ARMA 4C2YA 3RNZA 1XMTA 1B87A 2CY2A 2VI7A 4MHNA 1Z8TA 3TO7A 3B3SA 4PXDA 2ZELA 4E2AA 3V38A 4OIWA 4M85A 4R3KA 4B5OA 2EBJA 2OH1A 4EVYA 5KTAA 1Z8XA 3LWUA 5K8PA 4OMEA 3BXMA 2QVPA 2YNEA 5F49A 1BO4A 3H8FA 3IGRA 4H89A 4MFQA 1Q7LA 2PSWA 5LRJA 3WC6A 2X7BA 4MCQA 2IJZA 4A32A 1WWZA 1XEBA 2O4HA 3PGPA 2ZOGA 2V8VA 2VXKA 1YGHA 2G3AA 4UEEA 2CTBA 3IWWA 3SI1A 3F0AA 4K3NA 1VHOA 1F57A 3PB4X 4KUBA 3T8WA 5K8OA 4A38A 1YR0A 1H8LA 4NGMA 3BJ7A 4AVAA 4CYQA 4KZTA 1R43A 1M1DA 3B3VA 3DGVA 4NGRA 3HLPA 4I49A 1QSNA 3FVLA 2HUZA 3DSBA 3F5BA 2C1CA 4MY3A 2DPTA 3D7DA 3I1UA 4ZY0A 1KZFA 3EO4A 4KVXA 1PCAA 2C27A 4DYOA 3CXQA 3LMSA
chains in the Genus database with same CATH topology
3JTKA 3TO6A 1U6MA 1Z4EA 4A30A 4RI1A 5FVJA 2VZYA 3PP9A 2G0BA 1V0CA 5EC4A 3FB3A 4QB9A 3N7ZA 3K9UA 4CGPA 2VEZA 2B4DA 2R98A 3W6SA 3DR8A 3R95A 5JPHA 2A4NA 5F48A 4A33A 4H6UA 4QC6A 4JXRA 4PSWA 2R1IA 3D2PA 4CS0B 3TT2A 4B11A 4UWIA 2RC4A 3DDDA 4R9MA 4U9YA 3G3SA 3H5ZA 5AG4A 2Y0MA 4CAWA 2ZW7A 2Z0ZA 3UY5A 4B10A 5AG5A 2NMTA 3MGDA 2FIWA 3GYAA 3VWEA 4UCNA 2Q44A 3GY9A 4QUSA 4PV6A 3R9FA 2D4PA 2VBQA 5G20A 2DXQA 2G3TA 4QBJA 2BL1A 1Q2YA 1FY7A 4AG7A 4NXYA 2J8MA 2ZPAA 2OZGA 1MK4A 2EVNA 3DR6A 3T9YA 3JVNA 3S6KA 2AE6A 4Q38A 2FIAA 3OWCA 3IWEA 1MJBA 2GIVA 4KOYA 4ONUA 5G1ZA 4MJ8A 1YX0A 5KTCA 2CNTA 1Y7RA 3SXNA 3LD2A 2OB0A 3TOAA 1CJWA 2OZHA 2Z3OA 2O28A 4FD7A 1KUVA 2P6EA 3EFAA 3S6HA 1NMTA 1NSLA 4KLWA 2HQYA 1S3ZA 3QB8A 2Q04A 4C2XA 2OZUA 1YREA 4FD4A 4MFLA 3QAHA 4R87A 4B14A 1QSTA 3JUWA 5H84A 1YVOA 4OADA 1MJ9A 4GS4A 1S5KA 3VWDA 4ZBGA 2ARHA 2B5GA 4B13A 2WPWA 1S7LA 4UCMA 3F8KA 4B12A 4MHDA 1Z4RA 2KCWA 4C68A 1RXTA 1Y9WA 2EUIA 2K5TA 2Z3KA 4NEXA 3SHPA 1OZPA 2B58A 4KOXA 2GE3A 2R8VA 5E96A 1P0HA 5F46A 4KUAA 3TO9A 1XE4A 2J8NA 2FS5A 4CRZB 4OAEA 2Z3NA 2YGWA 4KOTA 2IL4A 2QECA 2FL4A 1N71A 2B4DB 2Z10A 4E8OA 4YRHA 3W6XA 3TE4A 1B6BA 3I3GA 2I79A 1K4JA 4MFZA 1PUAA 3FYNA 3BLNA 3R1KA 2PR8A 5HMNA 2YNCA 3B8GA 5KTDA 2F5IA 5HH1A 1RO5A 2VZZA 4XPDC 1S7NA 2B3UA 1R57A 4C7IA 2R7HA 3IU2A 4HNXB 4U9ZA 1Q2CA 4UFWA 2QMLA 4YGOA 1I1DA 1QSMA 4KORA 1KUXA 4MY0A 4JJXA 4A95A 4BBHA 3P2FA 1CM0A 2HV2A 5G21A 3EY5A 2GANA 2JDDA 4MBUA 4ZGYB 5C88A 4XPLA 3C26A 4HNWB 1IICA 2Q4VA 2VQYA 2Z3LA 1NE9A 4C7HA 4B5PB 3I9SA 1MJAA 2DPSA 1Q2DA 4Y49C 2J8RA 4KVOE 4CGLA 3SXOA 4CRYB 2Q4YA 3CXSA 4KSAA 4MFJA 3R96A 4UFXA 2WSAA 4J3GA 4NCZA 4UWJA 4CGMA 4YFJA 5IV0A 2PQ8A 1M4DA 4R57A 1I12A 3TOBA 4KOSA 3DNSA 4AVBA 3CXPA 4F0YA 4IUSA 4BMHA 5AGEA 3WR7A 4CYNA 5J8CA 1QSRA 2PC1A 2P6GA 5A28A 5H86A 4A31A 3RYOA 2B5GB 2QIRA 3FRMA 2BEIA 3LODA 4F6AA 1M4GA 1BOBA 4KOUA 4MI4A 4Q36A 4XPKA 1TIQA 4CAXA 4AVCA 1IYLA 2B4BA 3TTHA 1ZO0A 2P0WA 3GKRA 4PK3A 1YK3A 2FE7A 1VKCA 5J8FA 2BSWA 4OLLA 4CGNA 4XPDB 4U5YA 3H4QA 4MFPA 4JLYA 1LRZA 5C82A 5G22A 4KOWA 1IB1E 5DWMA 3PZJA 3T90A 1XIXA 2JEVA 4FD6A 4UFVA 5F47A 5IX3A 4MFKA 4LUAA 4AG9A 1J4JA 2JLMA 1UFHA 1P4NA 2ATRA 2WPXA 3E0KA 3D8PA 4XNHB 3ZZIA 2PDOA 4KS9A 2PRBA 5IB0A 2REFA 1KUYA 1IIDA 4L89A 2FCKA 2OU2A 5EBVA 4C2ZA 1Z9UA 4FD5A 1M44A 3R9GA 4NF1A 5DWNA 4KSFA 1S7FA 3FIXA 4RS2A 4JD6A 2CNSA 4Y49B 3D2MA 3KKWA 1VHSA 1S7KA 4X5KA 4NSQA 4II9A 1GHEA 2Z3MA 2ZW5A 5A27A 5I0CA 5ISVA 1ON0A 3EXNA 5AG6A 3NE7A 3S6FA 5GCNA 4CAEA 2YNDA 1M4IA 3FXTA 2FSRA 1S60A 3S6GA 4CGOA 4LX9A 4XNHC 2D4OA 2YNCC 4A2ZA 3ZJ0A 1I21A 2Q7BA 4DNCA 5AG7A 3TCVA 4K30A 4F0XA 1XF8A 2ZXVA 4JXQA 1L0CA 3R9EA 2Z11A 4KVME 4E0AA 4JWPA 4M3SA 3P2HA 4L8AA 2REEA 4R3LA 4UBRA 2P6FA 1YLEA 3V8IA 4KLVA 5CNPA 1Y9KA 4CAFA 2FT0A 5JQ4A 3A9LA 3TFYA 4PK2A 2JDCA 1YVKA 4KOVA 1WK4A 3EC4A 3IWGA 5BWAB 2PR1A 2B3VA 2FXFA 2CXAA 2BUEA 2AJ6A 2Z3PA 1SQHA 4AB7A 2I00A 4UA3A 3D3SA 2ZW4A 1QSOA 4H6ZA 4B5PA 3G8WA 4IF5A 2ZW6A 3IU1A 4CYPA 1IYKA 3BJ8A 1PU9A 2WUUA 4UCPA 2H5MA 3FBUA 4HKFA 4PSXA 2CNMA 4QVTA 4CYOA 2Q0YA 3FNCA 4CAVA 4ORFA 3W91A 4HNYB 4C2YA 1XMTA 1B87A 2CY2A 2VI7A 3TO7A 4E2AA 4M85A 4R3KA 4B5OA 5KTAA 2OH1A 4EVYA 2YNEA 5F49A 1BO4A 3IGRA 4MFQA 4H89A 2PSWA 2X7BA 4A32A 1WWZA 1XEBA 3PGPA 2VXKA 1YGHA 2G3AA 3F0AA 4KUBA 1YR0A 3BJ7A 4AVAA 4CYQA 4KZTA 1M1DA 4I49A 1QSNA 2HUZA 3DSBA 3F5BA 4MY3A 2DPTA 1KZFA 3EO4A 4KVXA 2C27A 3CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO6 A;  1U6M A;  1Z4E A;  4RI1 A;  5FVJ A;  2VZY A;  3PP9 A;  2G0B A;  1V0C A;  5EC4 A;  3FB3 A;  4QB9 A;  3N7Z A;  3K9U A;  2VEZ A;  2B4D A;  2R98 A;  3W6S A;  3DR8 A;  3R95 A;  5JPH A;  2A4N A;  5F48 A;  4H6U A;  4QC6 A;  4JXR A;  4PSW A;  2R1I A;  3D2P A;  4CS0 B;  3TT2 A;  4UWI A;  2RC4 A;  3DDD A;  4R9M A;  4U9Y A;  3G3S A;  2Y0M A;  4CAW A;  2ZW7 A;  2Z0Z A;  3UY5 A;  2NMT A;  3MGD A;  2FIW A;  3GYA A;  3VWE A;  2Q44 A;  3GY9 A;  4QUS A;  4PV6 A;  3R9F A;  2D4P A;  2VBQ A;  4QBJ A;  2DXQ A;  2G3T A;  2BL1 A;  1Q2Y A;  1FY7 A;  4AG7 A;  4NXY A;  2J8M A;  2ZPA A;  2OZG A;  1MK4 A;  2EVN A;  3DR6 A;  3T9Y A;  3JVN A;  3S6K A;  2AE6 A;  2FIA A;  3OWC A;  1MJB A;  2GIV A;  4KOY A;  4ONU A;  4MJ8 A;  1YX0 A;  5KTC A;  2CNT A;  1Y7R A;  3SXN A;  3LD2 A;  2OB0 A;  3TOA A;  1CJW A;  2OZH A;  2O28 A;  4FD7 A;  1KUV A;  2P6E A;  3EFA A;  3S6H A;  1NMT A;  1NSL A;  4KLW A;  2HQY A;  1S3Z A;  3QB8 A;  2Q04 A;  2OZU A;  1YRE A;  4FD4 A;  3QAH A;  4R87 A;  1QST A;  3JUW A;  5H84 A;  1YVO A;  4OAD A;  1MJ9 A;  4GS4 A;  1S5K A;  3VWD A;  4ZBG A;  2ARH A;  2B5G A;  2WPW A;  1S7L A;  3F8K A;  4MHD A;  1Z4R A;  2KCW A;  1RXT A;  1Y9W A;  2EUI A;  2K5T A;  4NEX A;  3SHP A;  1OZP A;  2B58 A;  4KOX A;  2GE3 A;  2R8V A;  5E96 A;  1P0H A;  5F46 A;  4KUA A;  3TO9 A;  1XE4 A;  2J8N A;  2FS5 A;  4CRZ B;  4OAE A;  4KOT A;  2IL4 A;  2QEC A;  2FL4 A;  1N71 A;  2B4D B;  2Z10 A;  4E8O A;  4YRH A;  3W6X A;  3TE4 A;  1B6B A;  3I3G A;  2I79 A;  1K4J A;  1PUA A;  3FYN A;  3BLN A;  3R1K A;  2PR8 A;  5HMN A;  3B8G A;  5KTD A;  2F5I A;  5HH1 A;  1RO5 A;  2VZZ A;  4XPD C;  1S7N A;  2B3U A;  1R57 A;  2R7H A;  4HNX B;  4U9Z A;  1Q2C A;  2QML A;  4YGO A;  1I1D A;  1QSM A;  4KOR A;  1KUX A;  4MY0 A;  4JJX A;  3P2F A;  1CM0 A;  2HV2 A;  3EY5 A;  2GAN A;  2JDD A;  4MBU A;  5C88 A;  4XPL A;  3C26 A;  4HNW B;  1IIC A;  2Q4V A;  2VQY A;  1NE9 A;  4B5P B;  3I9S A;  1MJA A;  1Q2D A;  4Y49 C;  2J8R A;  4KVO E;  3SXO A;  4CRY B;  2Q4Y A;  3CXS A;  3R96 A;  4J3G A;  4NCZ A;  4UWJ A;  4YFJ A;  5IV0 A;  2PQ8 A;  1M4D A;  4R57 A;  1I12 A;  3TOB A;  4KOS A;  3DNS A;  4AVB A;  3CXP A;  4F0Y A;  4IUS A;  4BMH A;  3WR7 A;  5J8C A;  1QSR A;  2PC1 A;  2P6G A;  5H86 A;  3RYO A;  2B5G B;  2QIR A;  3FRM A;  2BEI A;  3LOD A;  4F6A A;  1M4G A;  1BOB A;  4KOU A;  4MI4 A;  4XPK A;  1TIQ A;  4CAX A;  4AVC A;  1IYL A;  2B4B A;  3TTH A;  2P0W A;  3GKR A;  4PK3 A;  1YK3 A;  2FE7 A;  1VKC A;  5J8F A;  2BSW A;  4OLL A;  4XPD B;  4U5Y A;  3H4Q A;  4JLY A;  1LRZ A;  5C82 A;  4KOW A;  1IB1 E;  5DWM A;  3PZJ A;  3T90 A;  1XIX A;  2JEV A;  4FD6 A;  5F47 A;  5IX3 A;  4LUA A;  4AG9 A;  1J4J A;  2JLM A;  1UFH A;  1P4N A;  2ATR A;  2WPX A;  3E0K A;  3D8P A;  4XNH B;  3ZZI A;  2PDO A;  2PRB A;  5IB0 A;  2REF A;  1KUY A;  1IID A;  4L89 A;  2FCK A;  2OU2 A;  5EBV A;  1Z9U A;  4FD5 A;  1M44 A;  3R9G A;  4NF1 A;  5DWN A;  1S7F A;  3FIX A;  4RS2 A;  4JD6 A;  2CNS A;  4Y49 B;  3D2M A;  3KKW A;  1VHS A;  1S7K A;  4X5K A;  4NSQ A;  4II9 A;  1GHE A;  2ZW5 A;  5I0C A;  5ISV A;  1ON0 A;  3EXN A;  3NE7 A;  3S6F A;  5GCN A;  1M4I A;  3FXT A;  2FSR A;  1S60 A;  3S6G A;  4LX9 A;  4XNH C;  2D4O A;  3ZJ0 A;  1I21 A;  2Q7B A;  4DNC A;  3TCV A;  4K30 A;  1XF8 A;  2ZXV A;  4JXQ A;  1L0C A;  3R9E A;  2Z11 A;  4KVM E;  4E0A A;  4JWP A;  4M3S A;  3P2H A;  4L8A A;  2REE A;  4R3L A;  4UBR A;  2P6F A;  1YLE A;  3V8I A;  4KLV A;  5CNP A;  1Y9K A;  2FT0 A;  5JQ4 A;  3TFY A;  4PK2 A;  2JDC A;  1YVK A;  4KOV A;  1WK4 A;  3EC4 A;  3IWG A;  2PR1 A;  2B3V A;  2FXF A;  2BUE A;  2AJ6 A;  1SQH A;  4AB7 A;  2I00 A;  4UA3 A;  3D3S A;  2ZW4 A;  1QSO A;  4H6Z A;  4B5P A;  3G8W A;  4IF5 A;  2ZW6 A;  1IYK A;  3BJ8 A;  1PU9 A;  2H5M A;  3FBU A;  4HKF A;  4PSX A;  2CNM A;  4QVT A;  2Q0Y A;  3FNC A;  4CAV A;  4ORF A;  3W91 A;  4HNY B;  1XMT A;  1B87 A;  2CY2 A;  2VI7 A;  3TO7 A;  4E2A A;  4M85 A;  4R3K A;  4B5O A;  5KTA A;  2OH1 A;  4EVY A;  5F49 A;  1BO4 A;  3IGR A;  4H89 A;  2PSW A;  2X7B A;  1WWZ A;  1XEB A;  3PGP A;  2VXK A;  1YGH A;  2G3A A;  3F0A A;  4KUB A;  1YR0 A;  3BJ7 A;  4AVA A;  4KZT A;  1M1D A;  4I49 A;  1QSN A;  2HUZ A;  3DSB A;  3F5B A;  4MY3 A;  1KZF A;  3EO4 A;  4KVX A;  2C27 A;  3CXQ A; 
#chains in the Genus database with same CATH topology
 3JTK A;  3TO6 A;  1U6M A;  4F9U A;  1Z4E A;  4A30 A;  4RI1 A;  4CGL A;  5FVJ A;  1ZLI A;  2VZY A;  3PP9 A;  2G0B A;  1QMU A;  1V0C A;  2PE3 A;  5EC4 A;  3FB3 A;  4QB9 A;  3N7Z A;  4NJQ A;  3K9U A;  1Y0R A;  3PBB A;  2VEZ A;  4CGP A;  1F2P A;  5LRK A;  2V77 A;  2B4D A;  2R98 A;  3W6S A;  3DR8 A;  3R95 A;  3D7F A;  4P45 A;  2JBK A;  2A4N A;  5F48 A;  5F09 A;  4A33 A;  3B35 A;  4H6U A;  4QC6 A;  3NH8 A;  4JXR A;  4LQ6 A;  3H8E A;  4PSW A;  2R1I A;  4G1P A;  3D2P A;  4CS0 B;  3TT2 A;  4B11 A;  4LQG A;  4UWI A;  5K8M A;  2RC4 A;  3DDD A;  2PJ0 A;  4R9M A;  4U9Y A;  4TNU A;  3G3S A;  3H5Z A;  3VH9 A;  5AG4 A;  2Y0M A;  4CAW A;  2ZW7 A;  4OC3 A;  1XOV A;  3S9L A;  2AFS A;  1XFO A;  2Z0Z A;  1DTD A;  3UY5 A;  4B10 A;  4CPA A;  2DF5 A;  2NMT A;  5AG5 A;  2ZEF A;  3MGD A;  2FIW A;  3GYA A;  3VWE A;  2XEF A;  4UCN A;  3HUV A;  1Z8W A;  1CP6 A;  2Q44 A;  1AMP A;  3GY9 A;  4QUS A;  4PV6 A;  3R9F A;  2D4P A;  2VBQ A;  2FVG A;  2DXQ A;  2G3T A;  1BPM A;  3FX6 A;  1X12 A;  2BL1 A;  5G20 A;  4MHZ A;  1XJO A;  1ZG7 A;  3KQX A;  2NYQ A;  1Q2Y A;  1TKJ A;  1FY7 A;  4AG7 A;  1M4L A;  5LYD A;  4MHP A;  4NXY A;  2J8M A;  2ZPA A;  3V7Z A;  4DJL A;  2OZG A;  2PJB A;  1MK4 A;  4YU9 A;  3PB9 X;  2EVN A;  3KGQ A;  5ELY A;  3DR6 A;  4P4D A;  4OC4 A;  3T9Y A;  3D66 A;  3JVN A;  1VIX A;  2ZEO A;  2ZED A;  2AE6 A;  3FF3 A;  3JRU A;  3RZA A;  3S6K A;  4Q38 A;  3ISZ A;  1IY7 A;  3WAB A;  4QBJ A;  5HXD A;  1GYT A;  2FIA A;  3KI9 A;  5IB9 A;  4RN7 A;  1CBX A;  3OWC A;  3IWE A;  4HPS A;  4KSI A;  4NGQ A;  4ONW A;  1MJB A;  2GIV A;  2C6P A;  4KOY A;  4ONU A;  1IU8 A;  5G1Z A;  1LAP A;  2PIZ A;  2C6G A;  4MJ8 A;  4PPZ A;  1YX0 A;  1CPS A;  5KTC A;  2CNT A;  3FEC A;  1Y7R A;  3KR4 A;  3SXN A;  3LD2 A;  2OB0 A;  1DE4 C;  4NJR A;  2Q7S A;  3TOA A;  2CF4 A;  4R8F A;  1CJW A;  2OZH A;  3DLJ A;  2EO8 A;  2Z3O A;  4OID A;  2O28 A;  4FD7 A;  3VAR A;  1KUV A;  1CG2 A;  2P6E A;  2ZEE A;  3EFA A;  3S6H A;  4FWU A;  1NMT A;  1NSL A;  4KLW A;  5HVF A;  2HQY A;  1S3Z A;  3NA6 A;  2Q04 A;  3QB8 A;  4P4B A;  3RAM A;  1TKF A;  3TC8 A;  4C2X A;  2PJ9 A;  2EWB A;  2OZU A;  3NE8 A;  1YRE A;  4FD4 A;  4MFL A;  1CP7 A;  4OC5 A;  3QAH A;  5J1Q A;  4R87 A;  4B14 A;  1QST A;  3JUW A;  3ISX A;  5H84 A;  1YVO A;  1TKH A;  1MJ9 A;  4GS4 A;  2WZN A;  4OAD A;  3PB7 X;  1S5K A;  3VWD A;  4ZBG A;  2ARH A;  2B5G A;  5K8N A;  2ZEG A;  4ZY2 A;  4B13 A;  2PJ1 A;  2WPW A;  1S7L A;  3MRU A;  5D29 A;  1IGB A;  1VGY A;  4UCM A;  1ELM P;  4A94 A;  3F8K A;  3D68 A;  4F9V A;  3RBU A;  4B12 A;  4MHD A;  1Z4R A;  2KCW A;  4C68 A;  4BIN A;  2GLF A;  1RXT A;  1Y9W A;  2EUI A;  2AFU A;  3B7I A;  2PJ3 A;  3NH5 A;  4MXU A;  2PJ5 A;  1HDQ A;  2K5T A;  2Z3K A;  3S9N A;  2AFW A;  4NEX A;  4P44 A;  3SHP A;  1OZP A;  2B58 A;  4IHM A;  3D7H A;  2CIJ A;  3FEE A;  1RTQ A;  1PYT B;  4KOX A;  4B6Z A;  2GE3 A;  4DUK A;  2R8V A;  5E96 A;  4EWT A;  1P0H A;  5F46 A;  3PB6 X;  5LYF A;  4Z65 A;  4KUA A;  3TO9 A;  4RUH A;  1XE4 A;  2J8N A;  2FS5 A;  1LCP A;  2QYV A;  4CRZ B;  4OAE A;  2Z3N A;  2YGW A;  4KOT A;  1AYE A;  2IL4 A;  2QEC A;  2FL4 A;  1FNO A;  2NSM A;  1TF8 A;  2ZEH A;  1N71 A;  2B4D B;  2Z10 A;  4ZYQ A;  4FUU A;  4MRI A;  4E8O A;  4YRH A;  3SJF A;  3W6X A;  3TE4 A;  3GB0 A;  3H8G A;  1B6B A;  3FMC A;  4Q7A A;  3I3G A;  2I79 A;  1K4J A;  4MFZ A;  1PUA A;  3FYN A;  1ZLH A;  3K2K A;  5JM6 A;  3BLN A;  3R1K A;  2PR8 A;  5HMN A;  2YNC A;  3B8G A;  4IK2 A;  5KTD A;  2F5I A;  3D67 A;  5HH1 A;  4AXV A;  1TXR A;  1RO5 A;  2PJ2 A;  2VZZ A;  4XPD C;  1S7N A;  2B3U A;  1R57 A;  3B3W A;  4NGN A;  1TF9 A;  5I4M A;  4C7I A;  2R7H A;  2PJ4 A;  4W9Y A;  3IIB A;  3IU2 A;  4HNX B;  1LOK A;  2PVV A;  4U9Z A;  4WJB A;  3WT4 A;  1Q2C A;  3WC7 A;  4UFW A;  2QML A;  4YGO A;  2F7V A;  4PQA A;  1I1D A;  4OP4 A;  1QQ9 A;  4P4F A;  3SJG A;  2BCO A;  1QSM A;  1YME A;  4MCS A;  4KOR A;  1KUX A;  3KQZ A;  2EK8 A;  4JJX A;  4MY0 A;  1OBR A;  4UEF A;  4A95 A;  1BPN A;  4BBH A;  1LAM A;  3P2F A;  3KL9 A;  1CM0 A;  4ZX9 A;  2HV2 A;  1HDU A;  5EMI A;  2C6C A;  5G21 A;  3EY5 A;  2GAN A;  2JDD A;  4MBU A;  4UEZ A;  3GUX A;  4PXE A;  2AFX A;  4ZGY B;  5JPH A;  5C88 A;  4XPL A;  1Z8L A;  4OC2 A;  3C26 A;  1ZG8 A;  2GFQ A;  4HNW B;  1IIC A;  2Q4V A;  2VQY A;  1YW6 A;  1YQE A;  2Z3L A;  3D4U A;  4O23 A;  1NE9 A;  4C7H A;  4B5P B;  3I9S A;  1MJA A;  2DPS A;  1Q2D A;  3TX8 A;  5LYL A;  4UIB A;  2J8R A;  4Y49 C;  1JQG A;  4KVO E;  2AFO A;  2OR4 A;  2Q51 A;  3SI2 A;  3SXO A;  2Q4Y A;  3CXS A;  4KSA A;  4CRY B;  2AFZ A;  4M6H A;  5CBM A;  4MFJ A;  3FJU A;  3R96 A;  4MCR A;  4UFX A;  2WSA A;  4J3G A;  2EK9 A;  4NCZ A;  4UWJ A;  1ELL P;  3QAY A;  4WWV A;  3PEI A;  4CGM A;  4YFJ A;  1Z2L A;  3B2Y A;  5IV0 A;  1KWM A;  2PQ8 A;  1ZG9 A;  1M4D A;  4R57 A;  1I12 A;  4ZI6 A;  3TOB A;  2POK A;  4KOS A;  3DNS A;  4AVB A;  4NGS A;  2O53 A;  3CXP A;  3NH4 A;  4F0Y A;  4IUS A;  4BMH A;  3GIU A;  5AGE A;  3WR7 A;  2PCU A;  2PVW A;  4M6I A;  3IJ3 A;  2PJ6 A;  3SJX A;  2OOT A;  4P6Y A;  4UIA A;  4CYN A;  5J8C A;  1QSR A;  2PJ8 A;  4M6G A;  1EE3 P;  2WYR A;  2BO9 A;  2P6G A;  2PC1 A;  5CPA A;  5A28 A;  5H86 A;  2ZOF A;  4A31 A;  3RYO A;  2XEI A;  2B5G B;  2QIR A;  3FRM A;  4NGT A;  2BEI A;  4P4E A;  3LOD A;  2I3C A;  1YW4 A;  4X8I A;  2CTC A;  3BI0 A;  1YSJ A;  1ARL A;  2ZEP A;  4F6A A;  3RO0 A;  1M4G A;  1BOB A;  4KOU A;  4MI4 A;  2RFH A;  4GM5 A;  4Q36 A;  4XPK A;  3PB8 X;  1TIQ A;  4CAX A;  2J9A A;  4AVC A;  4FAI A;  2IMO A;  1IYL A;  3VAT A;  2B4B A;  4OKO A;  3TTH A;  1ZO0 A;  2P0W A;  3GKR A;  4PK3 A;  3IEH A;  4H2K A;  4X2T A;  1YK3 A;  2FE7 A;  1VKC A;  5J8F A;  1FT7 A;  2DEA A;  2BSW A;  4GXH A;  3PBE A;  4OLL A;  3SJE A;  2AFM A;  4CGN A;  3IFE A;  4XPD B;  4U5Y A;  3H4Q A;  4MFP A;  4JLY A;  1LRZ A;  3PFO A;  3B3C A;  5C82 A;  5G22 A;  3BHX A;  4KOW A;  1IB1 E;  2XEJ A;  5DWM A;  3PZJ A;  1JWQ A;  2HB6 A;  3PRT A;  3T90 A;  5JH9 A;  1XIX A;  1R3N A;  2JEV A;  4FD6 A;  4OC0 A;  4UFV A;  5F47 A;  2G9D A;  4MFK A;  5IX3 A;  5D8N A;  1UWY A;  4LUA A;  4AG9 A;  3CDX A;  1J4J A;  1Y0Y A;  2JLM A;  1UFH A;  1P4N A;  2ATR A;  2WPX A;  2VL1 A;  1NSA A;  2GRE A;  3E0K A;  2ZEM A;  4JYW A;  3BI1 A;  3D8P A;  1A2Z A;  3KZW A;  2BOA A;  4XNH B;  2PDO A;  4KS9 A;  3ZZI A;  2PRB A;  5IB0 A;  3PFE A;  4MHY A;  2REF A;  1KUY A;  1Y7E A;  1IID A;  2Q43 A;  4L89 A;  4MCP A;  2FCK A;  2OU2 A;  5EBV A;  4C2Z A;  1VHE A;  1IOI A;  1Z9U A;  3WC5 A;  5HVH A;  4FD5 A;  2JEW A;  1M44 A;  2QJ8 A;  3KHZ A;  4NFR A;  3R9G A;  2Q4Z A;  5JGF A;  4NF1 A;  1YLO A;  4OC1 A;  4P4J A;  5DWN A;  4KSF A;  4P4I A;  1S7F A;  3IO1 A;  3FIX A;  4RS2 A;  4JD6 A;  2CNS A;  2PJC A;  3CT9 A;  3D2M A;  4Y49 B;  3KKW A;  8CPA A;  1VHS A;  3LAC A;  1S7K A;  4X5K A;  4NSQ A;  4II9 A;  2ABZ A;  1CX8 A;  1GHE A;  2Z3M A;  2ZW5 A;  3GLJ A;  4R6T A;  3MN8 A;  3B3T A;  2PJA A;  3FH4 A;  5A27 A;  4FBE A;  5I0C A;  5ISV A;  1ON0 A;  3EXN A;  5AG6 A;  3NE7 A;  3S6F A;  1AUG A;  6CPA A;  5GCN A;  4ZX8 A;  4CAE A;  4MMO A;  4R76 A;  4EME A;  3D7G A;  2YND A;  1M4I A;  3FXT A;  2FSR A;  1S60 A;  3S6G A;  4CGO A;  4LX9 A;  4XNH C;  2D4O A;  3NFZ A;  2PIY A;  4UF4 A;  2YNC C;  4A2Z A;  1XRY A;  3ZJ0 A;  1I21 A;  3FED A;  2RB7 A;  3KHX A;  4BD9 A;  2ANP A;  2Q7B A;  4DNC A;  5AG7 A;  3TCV A;  4K30 A;  4F0X A;  1XF8 A;  4TWE A;  5HVG A;  2ZXV A;  4JXQ A;  2V8G A;  1L0C A;  2GU2 A;  3R9E A;  2Z11 A;  3QNV A;  3KR5 A;  4A37 A;  4KVM E;  2XEG A;  2ODF A;  4X3R A;  4E0A A;  3CPX A;  2V8D A;  4JWP A;  1F2O A;  4M3S A;  4PXB A;  5DS0 A;  3P2H A;  4L8A A;  2REE A;  3L2N A;  4NGP A;  4R3L A;  4UBR A;  2P6F A;  4P10 A;  1YLE A;  5LRG A;  3V8I A;  1XMB A;  1HEE A;  4KLV A;  4IAV A;  3KAS A;  3N5F A;  5CNP A;  1Y9K A;  4CAF A;  1IOF A;  2FT0 A;  2PRQ A;  4JZ0 A;  4YWY A;  5JQ4 A;  3A9L A;  3TFY A;  1LAN A;  4PK2 A;  4ZY1 A;  2JDC A;  1YVK A;  4KOV A;  1WK4 A;  3EC4 A;  3IWG A;  5BWA B;  2PR1 A;  2B3V A;  2FXF A;  2CXA A;  4F8Z A;  2BUE A;  3SI0 A;  2AJ6 A;  2Z3P A;  1SQH A;  3IC1 A;  2I00 A;  4AB7 A;  4UA3 A;  2PJ7 A;  4A39 A;  3D3S A;  2ZW4 A;  1QSO A;  1CPX A;  4H6Z A;  4B5P A;  2F8H A;  3CPA A;  3G8W A;  4IF5 A;  2ZW6 A;  1XBU A;  2HC9 A;  5THW A;  3IU1 A;  4CYP A;  2IQ6 A;  1IYK A;  1LFW A;  3BJ8 A;  1BLL E;  1PU9 A;  2WUU A;  4R7M A;  4EFD A;  1Z5R A;  3S9M A;  1BAV A;  4UCP A;  2H5M A;  3FBU A;  4HKF A;  4PSX A;  2V8H A;  2CNM A;  4QVT A;  2JBJ A;  2ZEN A;  2GLJ A;  4CYO A;  7CPA A;  2Q0Y A;  1X10 A;  3FNC A;  3K9T A;  4CAV A;  5LYI A;  4PXC A;  4ORF A;  3W91 A;  3CZX A;  4HNY B;  1ARM A;  4C2Y A;  3RNZ A;  1XMT A;  1B87 A;  2CY2 A;  2VI7 A;  4MHN A;  1Z8T A;  3TO7 A;  3B3S A;  4PXD A;  2ZEL A;  4E2A A;  3V38 A;  4OIW A;  4M85 A;  4R3K A;  4B5O A;  2EBJ A;  2OH1 A;  4EVY A;  5KTA A;  1Z8X A;  3LWU A;  5K8P A;  4OME A;  3BXM A;  2QVP A;  2YNE A;  5F49 A;  1BO4 A;  3H8F A;  3IGR A;  4H89 A;  4MFQ A;  1Q7L A;  2PSW A;  5LRJ A;  3WC6 A;  2X7B A;  4MCQ A;  2IJZ A;  4A32 A;  1WWZ A;  1XEB A;  2O4H A;  3PGP A;  2ZOG A;  2V8V A;  2VXK A;  1YGH A;  2G3A A;  4UEE A;  2CTB A;  3IWW A;  3SI1 A;  3F0A A;  4K3N A;  1VHO A;  1F57 A;  3PB4 X;  4KUB A;  3T8W A;  5K8O A;  4A38 A;  1YR0 A;  1H8L A;  4NGM A;  3BJ7 A;  4AVA A;  4CYQ A;  4KZT A;  1R43 A;  1M1D A;  3B3V A;  3DGV A;  4NGR A;  3HLP A;  4I49 A;  1QSN A;  3FVL A;  2HUZ A;  3DSB A;  3F5B A;  2C1C A;  4MY3 A;  2DPT A;  3D7D A;  3I1U A;  4ZY0 A;  1KZF A;  3EO4 A;  4KVX A;  1PCA A;  2C27 A;  4DYO A;  3CXQ A;  3LMS A; 
#chains in the Genus database with same CATH homology
 3JTK A;  3TO6 A;  1U6M A;  1Z4E A;  4A30 A;  4RI1 A;  5FVJ A;  2VZY A;  3PP9 A;  2G0B A;  1V0C A;  5EC4 A;  3FB3 A;  4QB9 A;  3N7Z A;  3K9U A;  4CGP A;  2VEZ A;  2B4D A;  2R98 A;  3W6S A;  3DR8 A;  3R95 A;  5JPH A;  2A4N A;  5F48 A;  4A33 A;  4H6U A;  4QC6 A;  4JXR A;  4PSW A;  2R1I A;  3D2P A;  4CS0 B;  3TT2 A;  4B11 A;  4UWI A;  2RC4 A;  3DDD A;  4R9M A;  4U9Y A;  3G3S A;  3H5Z A;  5AG4 A;  2Y0M A;  4CAW A;  2ZW7 A;  2Z0Z A;  3UY5 A;  4B10 A;  5AG5 A;  2NMT A;  3MGD A;  2FIW A;  3GYA A;  3VWE A;  4UCN A;  2Q44 A;  3GY9 A;  4QUS A;  4PV6 A;  3R9F A;  2D4P A;  2VBQ A;  5G20 A;  2DXQ A;  2G3T A;  4QBJ A;  2BL1 A;  1Q2Y A;  1FY7 A;  4AG7 A;  4NXY A;  2J8M A;  2ZPA A;  2OZG A;  1MK4 A;  2EVN A;  3DR6 A;  3T9Y A;  3JVN A;  3S6K A;  2AE6 A;  4Q38 A;  2FIA A;  3OWC A;  3IWE A;  1MJB A;  2GIV A;  4KOY A;  4ONU A;  5G1Z A;  4MJ8 A;  1YX0 A;  5KTC A;  2CNT A;  1Y7R A;  3SXN A;  3LD2 A;  2OB0 A;  3TOA A;  1CJW A;  2OZH A;  2Z3O A;  2O28 A;  4FD7 A;  1KUV A;  2P6E A;  3EFA A;  3S6H A;  1NMT A;  1NSL A;  4KLW A;  2HQY A;  1S3Z A;  3QB8 A;  2Q04 A;  4C2X A;  2OZU A;  1YRE A;  4FD4 A;  4MFL A;  3QAH A;  4R87 A;  4B14 A;  1QST A;  3JUW A;  5H84 A;  1YVO A;  4OAD A;  1MJ9 A;  4GS4 A;  1S5K A;  3VWD A;  4ZBG A;  2ARH A;  2B5G A;  4B13 A;  2WPW A;  1S7L A;  4UCM A;  3F8K A;  4B12 A;  4MHD A;  1Z4R A;  2KCW A;  4C68 A;  1RXT A;  1Y9W A;  2EUI A;  2K5T A;  2Z3K A;  4NEX A;  3SHP A;  1OZP A;  2B58 A;  4KOX A;  2GE3 A;  2R8V A;  5E96 A;  1P0H A;  5F46 A;  4KUA A;  3TO9 A;  1XE4 A;  2J8N A;  2FS5 A;  4CRZ B;  4OAE A;  2Z3N A;  2YGW A;  4KOT A;  2IL4 A;  2QEC A;  2FL4 A;  1N71 A;  2B4D B;  2Z10 A;  4E8O A;  4YRH A;  3W6X A;  3TE4 A;  1B6B A;  3I3G A;  2I79 A;  1K4J A;  4MFZ A;  1PUA A;  3FYN A;  3BLN A;  3R1K A;  2PR8 A;  5HMN A;  2YNC A;  3B8G A;  5KTD A;  2F5I A;  5HH1 A;  1RO5 A;  2VZZ A;  4XPD C;  1S7N A;  2B3U A;  1R57 A;  4C7I A;  2R7H A;  3IU2 A;  4HNX B;  4U9Z A;  1Q2C A;  4UFW A;  2QML A;  4YGO A;  1I1D A;  1QSM A;  4KOR A;  1KUX A;  4MY0 A;  4JJX A;  4A95 A;  4BBH A;  3P2F A;  1CM0 A;  2HV2 A;  5G21 A;  3EY5 A;  2GAN A;  2JDD A;  4MBU A;  4ZGY B;  5C88 A;  4XPL A;  3C26 A;  4HNW B;  1IIC A;  2Q4V A;  2VQY A;  2Z3L A;  1NE9 A;  4C7H A;  4B5P B;  3I9S A;  1MJA A;  2DPS A;  1Q2D A;  4Y49 C;  2J8R A;  4KVO E;  4CGL A;  3SXO A;  4CRY B;  2Q4Y A;  3CXS A;  4KSA A;  4MFJ A;  3R96 A;  4UFX A;  2WSA A;  4J3G A;  4NCZ A;  4UWJ A;  4CGM A;  4YFJ A;  5IV0 A;  2PQ8 A;  1M4D A;  4R57 A;  1I12 A;  3TOB A;  4KOS A;  3DNS A;  4AVB A;  3CXP A;  4F0Y A;  4IUS A;  4BMH A;  5AGE A;  3WR7 A;  4CYN A;  5J8C A;  1QSR A;  2PC1 A;  2P6G A;  5A28 A;  5H86 A;  4A31 A;  3RYO A;  2B5G B;  2QIR A;  3FRM A;  2BEI A;  3LOD A;  4F6A A;  1M4G A;  1BOB A;  4KOU A;  4MI4 A;  4Q36 A;  4XPK A;  1TIQ A;  4CAX A;  4AVC A;  1IYL A;  2B4B A;  3TTH A;  1ZO0 A;  2P0W A;  3GKR A;  4PK3 A;  1YK3 A;  2FE7 A;  1VKC A;  5J8F A;  2BSW A;  4OLL A;  4CGN A;  4XPD B;  4U5Y A;  3H4Q A;  4MFP A;  4JLY A;  1LRZ A;  5C82 A;  5G22 A;  4KOW A;  1IB1 E;  5DWM A;  3PZJ A;  3T90 A;  1XIX A;  2JEV A;  4FD6 A;  4UFV A;  5F47 A;  5IX3 A;  4MFK A;  4LUA A;  4AG9 A;  1J4J A;  2JLM A;  1UFH A;  1P4N A;  2ATR A;  2WPX A;  3E0K A;  3D8P A;  4XNH B;  3ZZI A;  2PDO A;  4KS9 A;  2PRB A;  5IB0 A;  2REF A;  1KUY A;  1IID A;  4L89 A;  2FCK A;  2OU2 A;  5EBV A;  4C2Z A;  1Z9U A;  4FD5 A;  1M44 A;  3R9G A;  4NF1 A;  5DWN A;  4KSF A;  1S7F A;  3FIX A;  4RS2 A;  4JD6 A;  2CNS A;  4Y49 B;  3D2M A;  3KKW A;  1VHS A;  1S7K A;  4X5K A;  4NSQ A;  4II9 A;  1GHE A;  2Z3M A;  2ZW5 A;  5A27 A;  5I0C A;  5ISV A;  1ON0 A;  3EXN A;  5AG6 A;  3NE7 A;  3S6F A;  5GCN A;  4CAE A;  2YND A;  1M4I A;  3FXT A;  2FSR A;  1S60 A;  3S6G A;  4CGO A;  4LX9 A;  4XNH C;  2D4O A;  2YNC C;  4A2Z A;  3ZJ0 A;  1I21 A;  2Q7B A;  4DNC A;  5AG7 A;  3TCV A;  4K30 A;  4F0X A;  1XF8 A;  2ZXV A;  4JXQ A;  1L0C A;  3R9E A;  2Z11 A;  4KVM E;  4E0A A;  4JWP A;  4M3S A;  3P2H A;  4L8A A;  2REE A;  4R3L A;  4UBR A;  2P6F A;  1YLE A;  3V8I A;  4KLV A;  5CNP A;  1Y9K A;  4CAF A;  2FT0 A;  5JQ4 A;  3A9L A;  3TFY A;  4PK2 A;  2JDC A;  1YVK A;  4KOV A;  1WK4 A;  3EC4 A;  3IWG A;  5BWA B;  2PR1 A;  2B3V A;  2FXF A;  2CXA A;  2BUE A;  2AJ6 A;  2Z3P A;  1SQH A;  4AB7 A;  2I00 A;  4UA3 A;  3D3S A;  2ZW4 A;  1QSO A;  4H6Z A;  4B5P A;  3G8W A;  4IF5 A;  2ZW6 A;  3IU1 A;  4CYP A;  1IYK A;  3BJ8 A;  1PU9 A;  2WUU A;  4UCP A;  2H5M A;  3FBU A;  4HKF A;  4PSX A;  2CNM A;  4QVT A;  4CYO A;  2Q0Y A;  3FNC A;  4CAV A;  4ORF A;  3W91 A;  4HNY B;  4C2Y A;  1XMT A;  1B87 A;  2CY2 A;  2VI7 A;  3TO7 A;  4E2A A;  4M85 A;  4R3K A;  4B5O A;  5KTA A;  2OH1 A;  4EVY A;  2YNE A;  5F49 A;  1BO4 A;  3IGR A;  4MFQ A;  4H89 A;  2PSW A;  2X7B A;  4A32 A;  1WWZ A;  1XEB A;  3PGP A;  2VXK A;  1YGH A;  2G3A A;  3F0A A;  4KUB A;  1YR0 A;  3BJ7 A;  4AVA A;  4CYQ A;  4KZT A;  1M1D A;  4I49 A;  1QSN A;  2HUZ A;  3DSB A;  3F5B A;  4MY3 A;  2DPT A;  1KZF A;  3EO4 A;  4KVX A;  2C27 A;  3CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...