4MJ8A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with polyamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title Crystal structure of spermidine N-acetyltransferase from Vibrio cholerae in complex with polyamine
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 56
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mj8A00
4NCZA 3GKRA 2REFA 3VWDA 2VQYA 4JLYA 1TIQA 1Y9WA 1Z9UA 3BJ8A 2D4PA 1B6BA 2B4BA 3JVNA 4HNXB 1QSMA 4XPDC 2R1IA 3ZZIA 4HNWB 3P2HA 1PUAA 2F5IA 4ONUA 4H6UA 2B3UA 1I12A 2BEIA 2Z11A 2OZHA 4E8OA 3TOAA 5KTCA 1IIDA 2GIVA 4KOYA 2Q4VA 3EO4A 5FVJA 1PU9A 1KZFA 4YGOA 1MJAA 3C26A 2GANA 2B5GA 4H89A 4B5PA 1S3ZA 4KZTA 1VHSA 1CM0A 4JJXA 3D3SA 1ON0A 2EVNA 1S60A 3LODA 1BOBA 1IB1E 1QSRA 4KOXA 2Q4YA 2CY2A 3S6GA 4QBJA 2Q7BA 2OU2A 2OH1A 2FCKA 2AE6A 4CAWA 1Y9KA 2HUZA 4FD4A 2CNMA 1YREA 1UFHA 4KOSA 3SXNA 5C88A 2J8NA 4J3GA 2J8RA 2PRBA 2PSWA 4OAEA 2PC1A 4QC6A 4R9MA 4II9A 3TE4A 3R9EA 4PK3A 2G3AA 1GHEA 1QSNA 2ARHA 2BSWA 2FIAA 5H84A 4XNHB 3R95A 5J8FA 1QSTA 3S6HA 3FNCA 2B5GB 3GYAA 1MJBA 4B5PB 1U6MA 1RXTA 1YK3A 2KCWA 4PSWA 3CXSA 1I1DA 2DXQA 4NF1A 4ZBGA 2PQ8A 4LX9A 2Z0ZA 3WR7A 3IWGA 3BJ7A 2J8MA 3R9GA 3T9YA 1KUYA 5E96A 5IV0A 1NE9A 3CXQA 2FXFA 3TCVA 2B58A 2FIWA 2FL4A 1S7KA 3D2PA 1XMTA 3DNSA 2PR8A 2CNSA 3G8WA 4B5OA 2A4NA 2R8VA 1S7NA 4JXRA 4QUSA 4NSQA 4M85A 2NMTA 4PSXA 3W6SA 4HKFA 3TT2A 3EXNA 4LUAA 2JDDA 1Q2DA 1XEBA 2OZGA 4KOTA 3LD2A 1MK4A 2JEVA 5JQ4A 2VZYA 2ZPAA 4AVCA 3TOBA 4NXYA 4XPKA 4X5KA 4R3KA 4KORA 2FT0A 1IICA 5KTAA 2VXKA 5IX3A 1L0CA 5IB0A 3I3GA 2Q04A 1KUXA 4E2AA 1RO5A 1R57A 3BLNA 1M4IA 1M1DA 3DR8A 3EY5A 4MHDA 1LRZA 4IUSA 5C82A 4CRZB 5F46A 5HH1A 1KUVA 2QIRA 3D2MA 4DNCA 1J4JA 4BMHA 2QMLA 4UWJA 1I21A 4R57A 4YFJA 1XF8A 3W91A 4RS2A 2Q44A 2GE3A 4Y49B 4KOUA 4MI4A 2FE7A 1N71A 4AG9A 5ISVA 2ATRA 3OWCA 3CXPA 5HMNA 2FSRA 5JPHA 1YLEA 4CRYB 3QAHA 4ORFA 3TFYA 1Z4RA 1YGHA 4F0YA 3VWEA 2ZW7A 4GS4A 4YRHA 1M44A 1Z4EA 3DSBA 2HQYA 5I0CA 4MY0A 5KTDA 3PP9A 2EUIA 4E0AA 4AVBA 2R98A 1SQHA 4K30A 1M4GA 3RYOA 2BL1A 4XNHC 3S6FA 3T90A 2G0BA 4FD6A 4MJ8A 2P6FA 2G3TA 2O28A 2R7HA 4KVOE 2ZW5A 1V0CA 1M4DA 1WWZA 1P0HA 3IGRA 3SHPA 4FD5A 4UWIA 4OLLA 1FY7A 4U9YA 5EBVA 4L89A 2WPXA 4MY3A 2I79A 4XPDB 3DDDA 3FRMA 3W6XA 4NEXA 4KVXA 3G3SA 4KOVA 1S5KA 4RI1A 3QB8A 3K9UA 3V8IA 4UA3A 4UBRA 4U5YA 3PGPA 1IYKA 4KUBA 3FIXA 2OB0A 4PK2A 5J8CA 3F8KA 2Y0MA 1Q2YA 2JDCA 4IF5A 1YX0A 3GY9A 2D4OA 3DR6A 1NSLA 1BO4A 5GCNA 4FD7A 3FXTA 1YVKA 2B3VA 4MBUA 3I9SA 4HNYB 1S7FA 2B4DA 1YR0A 2PR1A 3TO7A 1XE4A 2PDOA 3R96A 2AJ6A 2Q0YA 3TO9A 2K5TA 3TO6A 2JLMA 4KOWA 2ZW6A 2P0WA 2ZXVA 2H5MA 4JWPA 4H6ZA 4PV6A 1VKCA 1Q2CA 4XPLA 3P2FA 4JD6A 5F47A 2BUEA 3FB3A 3E0KA 4I49A 2P6EA 2I00A 5F48A 2Z10A 4KLWA 4KLVA 4AB7A 3N7ZA 2C27A 4R3LA 2IL4A 1WK4A 4R87A 2P6GA 3R1KA 1Y7RA 1OZPA 3SXOA 1P4NA 4AG7A 4EVYA 3ZJ0A 2FS5A 4QB9A 3NE7A 2HV2A 1MJ9A 5EC4A 3S6KA 3B8GA 3KKWA 1QSOA 1K4JA 4KUAA 2X7BA 3FBUA 3EFAA 4U9ZA 5DWNA 3PZJA 1YVOA 4OADA 1CJWA 4CAVA 4Y49C 1B87A 1S7LA 3TTHA 4JXQA 3MGDA 4L8AA 2QECA 2B4DB 3F0AA 2RC4A 4CAXA 5H86A 2VZZA 5DWMA 2WPWA 2REEA 4F6AA 5F49A 2CNTA 2ZW4A 3F5BA 1NMTA 4M3SA 3FYNA 3R9FA 1IYLA 3H4QA 4QVTA 3UY5A 1XIXA 5CNPA 2OZUA 4CS0B 2VI7A 2VEZA 4KVME 2VBQA 4AVAA 3EC4A 3D8PA 3JUWA
chains in the Genus database with same CATH superfamily
2Q7SA 1CPSA 3GKRA 2REFA 4KSIA 4NCZA 2VQYA 4MCRA 1XFOA 4P44A 1YSJA 3V7ZA 2AFMA 3VWDA 4ZX8A 4JLYA 1UWYA 1TIQA 1Y9WA 1Z9UA 2ODFA 3BJ8A 3SJEA 4M6HA 1H8LA 2D4PA 1B6BA 3KZWA 3WC7A 2CIJA 5CPAA 1ELMP 1VHOA 2PJ2A 1CP7A 1CG2A 1YQEA 2B4BA 2V8DA 4C2YA 2VL1A 1DTDA 3CDXA 3JVNA 4ZI6A 3RAMA 2Z3MA 5I4MA 4HNXB 1OBRA 3D7GA 1QSMA 2PE3A 4XPDC 5LYDA 2R1IA 3ZZIA 4HNWB 3KI9A 3NA6A 3P2HA 2RB7A 1M4LA 1PUAA 5LRGA 2F7VA 4C2ZA 2F5IA 4ONUA 4H6UA 3SJXA 2B3UA 3FVLA 1I12A 2BEIA 2Z11A 2V77A 3PBEA 2OZHA 1QMUA 4E8OA 3TOAA 4X2TA 3GUXA 4G1PA 3VH9A 1IIDA 1LAMA 5HVHA 5KTCA 4NJRA 4OC1A 2GIVA 2WUUA 4KOYA 4OC5A 2Q4VA 3EO4A 5FVJA 3KR4A 1ZO0A 1PU9A 1KZFA 2C6GA 4YGOA 1MJAA 3C26A 1TKFA 2GANA 4UEFA 2B5GA 4H89A 4B5PA 1S3ZA 1Y7EA 4A37A 4KZTA 1VHSA 1CM0A 4FWUA 4JJXA 3BHXA 3D3SA 3QNVA 2Q51A 4MFPA 1ON0A 1TKHA 2EVNA 4YWYA 1XMBA 4DUKA 3H8GA 4F9UA 2YNCA 1S60A 3LODA 4CGOA 2PJ5A 1BOBA 1IB1E 1QSRA 3IWEA 4KOXA 4UEEA 2Q4YA 3WABA 2CY2A 3S6GA 4QBJA 2Q7BA 2OU2A 2GU2A 1Z8XA 2OH1A 4NJQA 2FCKA 2AE6A 4EMEA 4MCSA 4CAWA 4UFXA 1Y9KA 2ANPA 2HUZA 4FD4A 2CNMA 1YREA 2IQ6A 1UFHA 4IAVA 3BI0A 4UIAA 4KOSA 4MFZA 2O4HA 2ABZA 3H8EA 3SXNA 4Z65A 4F0YA 5C88A 7CPAA 2J8NA 4J3GA 2J8RA 2PRBA 3NFZA 2PSWA 2PJCA 4FUUA 4BBHA 4OAEA 3PB8X 2PC1A 2ZENA 5LYLA 4QC6A 4HPSA 4R9MA 3D4UA 1HEEA 5G20A 4II9A 1LOKA 2ZOFA 3SI0A 3TE4A 3R9EA 4A33A 4PK3A 2F8HA 2G3AA 1GHEA 5K8NA 4KSAA 2PJ9A 1QSNA 2ARHA 2BSWA 3PFOA 2FIAA 5A28A 5H84A 4BD9A 4XNHB 4CGMA 3R95A 5J8FA 4PXCA 1ZG9A 4FBEA 2GLJA 2O53A 2EO8A 1QSTA 3SJGA 4YU9A 3S6HA 1F57A 1TF9A 3FNCA 3H5ZA 4IK2A 4P4DA 2XEFA 4A30A 3NH4A 2B5GB 3GYAA 1MJBA 2C6PA 4B5PB 2Z3NA 1U6MA 4UCMA 1RXTA 5D8NA 1VGYA 1YK3A 2CF4A 2KCWA 4MXUA 4PSWA 3CXSA 1I1DA 2DXQA 2XEJA 3JUWA 4NF1A 4CYPA 2NYQA 4ZBGA 4PXBA 5K8PA 2AFZA 2PQ8A 3ISZA 4LX9A 5LRJA 3NH8A 1CPXA 2Z0ZA 3WR7A 5K8OA 3IWGA 4PXEA 3BJ7A 2J8MA 3R9GA 5BWAB 4OC3A 3T9YA 3SI1A 1KUYA 5E96A 3DLJA 4ZY1A 1Z2LA 5THWA 1BLLE 3IU2A 5IV0A 2CTCA 1NE9A 4NGMA 2G9DA 2FXFA 3CXQA 3TCVA 3V38A 4CPAA 3S9NA 4LQGA 2B58A 4R6TA 5ELYA 2FIWA 3A9LA 1GYTA 2FL4A 1S7KA 3D2PA 4CAFA 1XMTA 3DNSA 3KQZA 4R7MA 2PR8A 2CNSA 3G8WA 4B5OA 2A4NA 3B3WA 3PRTA 2R8VA 1S7NA 1QQ9A 4K3NA 2DEAA 3IWWA 4JXRA 3JRUA 4QUSA 4GM5A 1CP6A 4NSQA 4M85A 2NMTA 4PSXA 3W6SA 1BAVA 1NSAA 4A95A 4CGNA 1F2OA 4HKFA 3TT2A 4CGPA 5CBMA 3EXNA 1JWQA 4LUAA 5AGEA 2JDDA 1KWMA 1YLOA 2C1CA 3QAYA 3N5FA 3MN8A 1Q2DA 3FECA 3IJ3A 3PB7X 1XEBA 2OZGA 2WZNA 4KOTA 3LD2A 4MRIA 1MK4A 2JEVA 4WWVA 2VZYA 4ZX9A 3KQXA 2Z3LA 4OIDA 3FF3A 2ZPAA 4C68A 5HVFA 4LQ6A 1XRYA 4AVCA 2PVWA 2PJ4A 1R43A 1CBXA 2JEWA 4X8IA 3TOBA 4NXYA 4XPKA 4KSFA 1Z5RA 3PFEA 4X5KA 3KL9A 3K2KA 4R3KA 5A27A 1XBUA 4KORA 2FT0A 3SI2A 1X10A 2GREA 4OP4A 1IICA 1TXRA 3L2NA 3RO0A 2VXKA 5IX3A 5KTAA 2QJ8A 3NH5A 3S9LA 1L0CA 3LACA 5IB0A 2OR4A 2RFHA 3I3GA 2QVPA 3HLPA 2Q04A 1KUXA 4E2AA 5J1QA 4P6YA 1EE3P 3KASA 4O23A 4P4EA 1RO5A 3TX8A 3VATA 4B10A 1R57A 2OOTA 2JBKA 2GFQA 4A94A 5HXDA 3BLNA 1M4IA 4A39A 1M1DA 1Q7LA 3DR8A 3EY5A 4MHDA 4NFRA 5AG6A 5EMIA 1LRZA 2PJ0A 4IUSA 2Q43A 2Z3KA 2ZEEA 5C82A 1HDUA 4CRZB 5F46A 5HH1A 1KUVA 2AFXA 4MFJA 4B14A 2QIRA 8CPAA 3D2MA 4DNCA 1J4JA 2ZEFA 4BMHA 2QMLA 1Y0YA 1X12A 1I21A 4R57A 4UWJA 4YFJA 1XF8A 4H2KA 5D29A 5G21A 3CZXA 3W91A 4F9VA 2WYRA 4RS2A 3K9TA 1XOVA 3RNZA 2Q44A 4A31A 2GE3A 4TNUA 5DS0A 4Y49B 2V8GA 4IHMA 4KOUA 1AMPA 4MI4A 2FE7A 1N71A 2PJ7A 3IIBA 1F2PA 4AG9A 5ISVA 2ATRA 2QYVA 3OWCA 4R8FA 4OC4A 2CTBA 4X3RA 3CT9A 4ONWA 3WC6A 3SJFA 3B3CA 3CXPA 5HMNA 2FSRA 4CAEA 5LYIA 5JPHA 1CX8A 1YLEA 2BOAA 4Q36A 3QAHA 4ORFA 4B6ZA 4CRYB 1Z4RA 3TFYA 2YNDA 1YGHA 2V8VA 3VWEA 1Y0RA 2ZW7A 3FJUA 2XEIA 4GS4A 4YRHA 2J9AA 1M44A 1Z4EA 3DSBA 2HQYA 2BCOA 4MHPA 3CPXA 4MY0A 5I0CA 1BPNA 2JBJA 2PJ3A 2AFWA 2PVVA 3PP9A 4B11A 5KTDA 2EUIA 3PB9X 4GXHA 4E0AA 4AVBA 2R98A 1SQHA 3ISXA 2IJZA 4K30A 1ELLP 4P4BA 4PQAA 1M4GA 2ZEOA 4ZY0A 4AXVA 2Z3PA 2DPTA 3GIUA 3FMCA 4DYOA 3RYOA 2GLFA 1DE4C 2BL1A 4XNHC 2C6CA 2G0BA 3S6FA 3T90A 4FD6A 4MJ8A 2P6FA 5JQ4A 4EWTA 1ARMA 1Z8TA 2G3TA 2O28A 3D7HA 2R7HA 4KVOE 2ZW5A 1V0CA 4DJLA 1M4DA 4Q38A 4C2XA 1WWZA 3D67A 2AFSA 1LFWA 1P0HA 3IGRA 4MFKA 4NGNA 3SHPA 4C7HA 1ZLIA 1BPMA 3KHXA 1AYEA 4FD5A 4UWIA 4OLLA 4F0XA 1FY7A 2Q4ZA 3PBBA 4U9YA 2YNCC 5EBVA 3IO1A 1YMEA 4B12A 3HUVA 3FEDA 4ZYQA 5AG7A 5JH9A 4OKOA 3FH4A 4L89A 2AFOA 2WPXA 2DF5A 3IEHA 4MY3A 4TWEA 3T8WA 2I79A 4XPDB 3DDDA 3FRMA 4MCQA 3W6XA 1FNOA 3KHZA 4MHYA 2YGWA 4NEXA 4KVXA 3IU1A 4MFLA 3G3SA 4KOVA 4M6IA 1S5KA 3I1UA 4RI1A 3LWUA 2PIYA 4UF4A 3QB8A 2DPSA 3K9UA 1IU8A 3V8IA 3CPAA 3PB6X 4UA3A 4UBRA 3TC8A 6CPAA 4U5YA 3H8FA 4KS9A 2CXAA 2EBJA 1PCAA 3PGPA 1IYKA 2YNEA 3FX6A 4KUBA 4A38A 3FIXA 2OB0A 4PK2A 4ZGYB 5J8CA 4CYQA 4ZY2A 3F8KA 2Y0MA 1Q2YA 4UEZA 1Z8LA 2JDCA 4C7IA 4IF5A 1IGBA 1YX0A 3BXMA 3RZAA 3EC4A 4P4FA 3GY9A 2D4OA 3JTKA 3DR6A 1JQGA 3B35A 4RN7A 1NSLA 1BO4A 3KR5A 3PB4X 3B2YA 4P4IA 5GCNA 5JGFA 1LANA 4FD7A 3WC5A 3GB0A 1ZG8A 2ZEHA 3FXTA 4OC2A 2XEGA 1YVKA 2EK8A 3KGQA 2B3VA 4MBUA 4NGTA 3I9SA 4HNYB 1S7FA 2POKA 2PCUA 2B4DA 4MFQA 1YR0A 5HVGA 2PR1A 1IOFA 1XE4A 2PDOA 3R96A 2AJ6A 3TO7A 2Q0YA 4NGQA 2IMOA 3TO9A 1ARLA 1IOIA 3D68A 4Q7AA 2ZEDA 2K5TA 3TO6A 1VIXA 4M6GA 2HB6A 2JLMA 4A2ZA 4KOWA 2ZW6A 2P0WA 1TF8A 2ZXVA 2H5MA 3IC1A 4JWPA 4H6ZA 4PV6A 1VKCA 4PXDA 5LYFA 1LCPA 4UFVA 1Q2CA 1IY7A 3P2FA 2PRQA 4JD6A 4XPLA 5F47A 4EFDA 1TKJA 2BUEA 3FB3A 3E0KA 2PJ1A 4I49A 1AUGA 2P6EA 2I00A 5F48A 2Z10A 4KLWA 4B13A 4KLVA 4OC0A 1XJOA 5LRKA 1Z8WA 4UCPA 2PJBA 4AB7A 4PPZA 3N7ZA 2C27A 4P45A 4R3LA 4JZ0A 1WK4A 1ZG7A 4R87A 3B3SA 2P6GA 2HC9A 5AG5A 3R1KA 1Y7RA 1OZPA 3SXOA 1P4NA 4AG7A 3FEEA 1R3NA 2AFUA 4NGRA 3ZJ0A 4EVYA 4R76A 4OMEA 2FS5A 4UIBA 2PJ8A 4QB9A 3NE7A 2HV2A 1MJ9A 4NGPA 1HDQA 3B8GA 3KKWA 5EC4A 3S6KA 1QSOA 1K4JA 1FT7A 1PYTB 4CYOA 4KUAA 2X7BA 3FBUA 3EFAA 4U9ZA 4UFWA 5DWNA 3PZJA 1YVOA 3PEIA 4OADA 3LMSA 3MRUA 1CJWA 5IB9A 4CAVA 2I3CA 4W9YA 4Y49C 5G1ZA 3NE8A 4OIWA 1B87A 1A2ZA 1S7LA 3TTHA 2EK9A 4BINA 5JM6A 4JYWA 3D66A 2NSMA 2BO9A 4JXQA 3MGDA 4A32A 4RUHA 4L8AA 2QECA 2B4DB 4MHZA 3DGVA 3F0AA 4F8ZA 2RC4A 2ZEPA 4CAXA 5K8MA 5H86A 2VZZA 3S9MA 5DWMA 3VARA 2WPWA 2REEA 2Z3OA 3B7IA 4P4JA 2PJ6A 4UCNA 1RTQA 2WSAA 4F6AA 2ZEMA 2ZOGA 4NGSA 4MCPA 2CNTA 2PJAA 2ZW4A 1VHEA 5F49A 5AG4A 3RBUA 3F5BA 1NMTA 1YW6A 1ZLHA 4M3SA 2V8HA 3FYNA 2ZEGA 4MMOA 2PIZA 3B3VA 3R9FA 1IYLA 3WT4A 3BI1A 4P10A 5F09A 3H4QA 4MHNA 2ZELA 1LAPA 4QVTA 4WJBA 5G22A 3UY5A 1XIXA 5CNPA 3B3TA 4CYNA 2OZUA 3D7FA 4CS0B 3IFEA 2VEZA 4KVME 3GLJA 1YW4A 3D7DA 2FVGA 2VBQA 4AVAA 2VI7A 2EWBA 3D8PA 2IL4A 4FAIA 4CGLA
chains in the Genus database with same CATH topology
4NCZA 3GKRA 2REFA 4UFVA 3VWDA 2VQYA 4JLYA 1TIQA 1Y9WA 1Z9UA 3BJ8A 2D4PA 1B6BA 2B4BA 4C2YA 3JVNA 2Z3MA 4HNXB 1QSMA 4XPDC 2R1IA 3ZZIA 4HNWB 3P2HA 1PUAA 4C2ZA 2F5IA 4ONUA 4H6UA 2B3UA 1I12A 2BEIA 2Z11A 2OZHA 4E8OA 3TOAA 5KTCA 1IIDA 2GIVA 2WUUA 4KOYA 2Q4VA 3EO4A 5FVJA 1ZO0A 1PU9A 1KZFA 4YGOA 1MJAA 3C26A 2GANA 2B5GA 4H89A 4B5PA 1S3ZA 4KZTA 1VHSA 1CM0A 4JJXA 3D3SA 4MFPA 1ON0A 2EVNA 2YNCA 1S60A 3LODA 4CGOA 1BOBA 1IB1E 1QSRA 3IWEA 4KOXA 2Q4YA 2CY2A 3S6GA 4QBJA 2Q7BA 2OU2A 2OH1A 2FCKA 2AE6A 4CAWA 4UFXA 1Y9KA 2HUZA 4FD4A 2CNMA 1YREA 1UFHA 4KOSA 4MFZA 3SXNA 5C88A 2J8NA 4J3GA 2J8RA 2PRBA 2PSWA 4BBHA 4OAEA 2PC1A 4QC6A 4R9MA 5G20A 4II9A 3TE4A 3R9EA 4A33A 4PK3A 2G3AA 1GHEA 4KSAA 1QSNA 2ARHA 2BSWA 2FIAA 5A28A 5H84A 4XNHB 4CGMA 3R95A 5J8FA 1QSTA 3S6HA 3FNCA 3H5ZA 4A30A 2B5GB 3GYAA 1MJBA 4B5PB 2Z3NA 1U6MA 4UCMA 1RXTA 1YK3A 2KCWA 4PSWA 3CXSA 1I1DA 2DXQA 4NF1A 4CYPA 4ZBGA 2PQ8A 4LX9A 2Z0ZA 3WR7A 3IWGA 3BJ7A 2J8MA 3R9GA 5BWAB 3T9YA 1KUYA 5E96A 3IU2A 5IV0A 1NE9A 3CXQA 2FXFA 3TCVA 2B58A 3A9LA 2FIWA 4CAFA 2FL4A 1S7KA 3D2PA 1XMTA 3DNSA 2PR8A 2CNSA 3G8WA 4B5OA 2A4NA 2R8VA 1S7NA 4JXRA 4QUSA 4NSQA 4M85A 2NMTA 4PSXA 3W6SA 4A95A 4CGNA 4HKFA 3TT2A 4CGPA 3EXNA 4LUAA 5AGEA 2JDDA 1Q2DA 1XEBA 2OZGA 4KOTA 3LD2A 1MK4A 2JEVA 5JQ4A 2VZYA 4C68A 2Z3LA 2ZPAA 4AVCA 3TOBA 4NXYA 4XPKA 4KSFA 4X5KA 4R3KA 5A27A 4KORA 2FT0A 1IICA 5KTAA 2VXKA 5IX3A 1L0CA 5IB0A 3I3GA 2Q04A 1KUXA 4E2AA 1RO5A 4B10A 1R57A 3BLNA 1M4IA 1M1DA 3DR8A 3EY5A 4MHDA 5AG6A 1LRZA 4IUSA 2Z3KA 5C82A 4CRZB 5F46A 5HH1A 1KUVA 4MFJA 4B14A 2QIRA 3D2MA 4DNCA 1J4JA 4BMHA 2QMLA 4UWJA 1I21A 4R57A 4YFJA 1XF8A 3W91A 5G21A 4RS2A 2Q44A 4A31A 2GE3A 4Y49B 4KOUA 4MI4A 2FE7A 1N71A 4AG9A 5ISVA 2ATRA 3OWCA 3CXPA 5HMNA 2FSRA 4CAEA 5JPHA 1YLEA 4Q36A 4CRYB 3QAHA 4ORFA 3TFYA 1Z4RA 2YNDA 1YGHA 4F0YA 3VWEA 2ZW7A 4GS4A 4YRHA 1M44A 1Z4EA 3DSBA 2HQYA 5I0CA 4MY0A 4B11A 3PP9A 5KTDA 2EUIA 4E0AA 4AVBA 2R98A 1SQHA 4K30A 1M4GA 2Z3PA 2DPTA 3RYOA 2BL1A 4XNHC 3S6FA 3T90A 2G0BA 4FD6A 4MJ8A 2P6FA 2G3TA 2O28A 2R7HA 4KVOE 2ZW5A 1V0CA 1M4DA 4Q38A 4C2XA 1WWZA 1P0HA 3IGRA 4MFKA 3SHPA 4C7HA 4FD5A 4UWIA 4F0XA 4OLLA 1FY7A 4U9YA 2YNCC 5EBVA 4B12A 5AG7A 4L89A 2WPXA 4MY3A 2I79A 4XPDB 3DDDA 3FRMA 3W6XA 2YGWA 4NEXA 4KVXA 3IU1A 4MFLA 3G3SA 4KOVA 1S5KA 4RI1A 3QB8A 2DPSA 3K9UA 3V8IA 4UA3A 4UBRA 4U5YA 4KS9A 2CXAA 3PGPA 1IYKA 2YNEA 4KUBA 3FIXA 2OB0A 4PK2A 4ZGYB 5J8CA 4CYQA 3F8KA 2Y0MA 1Q2YA 2JDCA 4C7IA 4IF5A 1YX0A 3GY9A 2D4OA 3JTKA 3DR6A 1NSLA 1BO4A 5GCNA 4FD7A 3FXTA 1YVKA 2B3VA 4MBUA 3I9SA 4HNYB 1S7FA 4MFQA 2B4DA 1YR0A 2PR1A 3TO7A 1XE4A 2PDOA 3R96A 2AJ6A 2Q0YA 3TO9A 2K5TA 3TO6A 2JLMA 4A2ZA 4KOWA 2ZW6A 2P0WA 2ZXVA 2H5MA 4JWPA 4H6ZA 4PV6A 1VKCA 1Q2CA 4XPLA 3P2FA 4JD6A 5F47A 2BUEA 3FB3A 3E0KA 4I49A 2P6EA 2I00A 5F48A 2Z10A 4KLWA 4B13A 4KLVA 4UCPA 4AB7A 3N7ZA 2C27A 4R3LA 2IL4A 1WK4A 4R87A 2P6GA 5AG5A 3R1KA 1Y7RA 1OZPA 3SXOA 1P4NA 4AG7A 4EVYA 3ZJ0A 2FS5A 4QB9A 3NE7A 2HV2A 1MJ9A 5EC4A 3S6KA 3B8GA 3KKWA 1QSOA 1K4JA 4CYOA 4KUAA 2X7BA 3FBUA 3EFAA 4U9ZA 4UFWA 5DWNA 3PZJA 1YVOA 4OADA 1CJWA 4CAVA 4Y49C 5G1ZA 1B87A 1S7LA 3TTHA 4JXQA 3MGDA 4A32A 4L8AA 2QECA 2B4DB 3F0AA 2RC4A 4CAXA 5H86A 2VZZA 5DWMA 2WPWA 2REEA 2Z3OA 4UCNA 2WSAA 4F6AA 5F49A 2CNTA 2ZW4A 5AG4A 3F5BA 1NMTA 4M3SA 3FYNA 3R9FA 1IYLA 3H4QA 4QVTA 5G22A 3UY5A 1XIXA 5CNPA 4CYNA 2OZUA 4CS0B 2VI7A 2VEZA 4KVME 2VBQA 4AVAA 3EC4A 3D8PA 3JUWA 4CGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCZ A;  3GKR A;  2REF A;  3VWD A;  2VQY A;  4JLY A;  1TIQ A;  1Y9W A;  1Z9U A;  3BJ8 A;  2D4P A;  1B6B A;  2B4B A;  3JVN A;  4HNX B;  1QSM A;  4XPD C;  2R1I A;  3ZZI A;  4HNW B;  3P2H A;  1PUA A;  2F5I A;  4ONU A;  4H6U A;  2B3U A;  1I12 A;  2BEI A;  2Z11 A;  2OZH A;  4E8O A;  3TOA A;  5KTC A;  1IID A;  2GIV A;  4KOY A;  2Q4V A;  3EO4 A;  5FVJ A;  1PU9 A;  1KZF A;  4YGO A;  1MJA A;  3C26 A;  2GAN A;  2B5G A;  4H89 A;  4B5P A;  1S3Z A;  4KZT A;  1VHS A;  1CM0 A;  4JJX A;  3D3S A;  1ON0 A;  2EVN A;  1S60 A;  3LOD A;  1BOB A;  1IB1 E;  1QSR A;  4KOX A;  2Q4Y A;  2CY2 A;  3S6G A;  4QBJ A;  2Q7B A;  2OU2 A;  2OH1 A;  2FCK A;  2AE6 A;  4CAW A;  1Y9K A;  2HUZ A;  4FD4 A;  2CNM A;  1YRE A;  1UFH A;  4KOS A;  3SXN A;  5C88 A;  2J8N A;  4J3G A;  2J8R A;  2PRB A;  2PSW A;  4OAE A;  2PC1 A;  4QC6 A;  4R9M A;  4II9 A;  3TE4 A;  3R9E A;  4PK3 A;  2G3A A;  1GHE A;  1QSN A;  2ARH A;  2BSW A;  2FIA A;  5H84 A;  4XNH B;  3R95 A;  5J8F A;  1QST A;  3S6H A;  3FNC A;  2B5G B;  3GYA A;  1MJB A;  4B5P B;  1U6M A;  1RXT A;  1YK3 A;  2KCW A;  4PSW A;  3CXS A;  1I1D A;  2DXQ A;  4NF1 A;  4ZBG A;  2PQ8 A;  4LX9 A;  2Z0Z A;  3WR7 A;  3IWG A;  3BJ7 A;  2J8M A;  3R9G A;  3T9Y A;  1KUY A;  5E96 A;  5IV0 A;  1NE9 A;  3CXQ A;  2FXF A;  3TCV A;  2B58 A;  2FIW A;  2FL4 A;  1S7K A;  3D2P A;  1XMT A;  3DNS A;  2PR8 A;  2CNS A;  3G8W A;  4B5O A;  2A4N A;  2R8V A;  1S7N A;  4JXR A;  4QUS A;  4NSQ A;  4M85 A;  2NMT A;  4PSX A;  3W6S A;  4HKF A;  3TT2 A;  3EXN A;  4LUA A;  2JDD A;  1Q2D A;  1XEB A;  2OZG A;  4KOT A;  3LD2 A;  1MK4 A;  2JEV A;  5JQ4 A;  2VZY A;  2ZPA A;  4AVC A;  3TOB A;  4NXY A;  4XPK A;  4X5K A;  4R3K A;  4KOR A;  2FT0 A;  1IIC A;  5KTA A;  2VXK A;  5IX3 A;  1L0C A;  5IB0 A;  3I3G A;  2Q04 A;  1KUX A;  4E2A A;  1RO5 A;  1R57 A;  3BLN A;  1M4I A;  1M1D A;  3DR8 A;  3EY5 A;  4MHD A;  1LRZ A;  4IUS A;  5C82 A;  4CRZ B;  5F46 A;  5HH1 A;  1KUV A;  2QIR A;  3D2M A;  4DNC A;  1J4J A;  4BMH A;  2QML A;  4UWJ A;  1I21 A;  4R57 A;  4YFJ A;  1XF8 A;  3W91 A;  4RS2 A;  2Q44 A;  2GE3 A;  4Y49 B;  4KOU A;  4MI4 A;  2FE7 A;  1N71 A;  4AG9 A;  5ISV A;  2ATR A;  3OWC A;  3CXP A;  5HMN A;  2FSR A;  5JPH A;  1YLE A;  4CRY B;  3QAH A;  4ORF A;  3TFY A;  1Z4R A;  1YGH A;  4F0Y A;  3VWE A;  2ZW7 A;  4GS4 A;  4YRH A;  1M44 A;  1Z4E A;  3DSB A;  2HQY A;  5I0C A;  4MY0 A;  5KTD A;  3PP9 A;  2EUI A;  4E0A A;  4AVB A;  2R98 A;  1SQH A;  4K30 A;  1M4G A;  3RYO A;  2BL1 A;  4XNH C;  3S6F A;  3T90 A;  2G0B A;  4FD6 A;  4MJ8 A;  2P6F A;  2G3T A;  2O28 A;  2R7H A;  4KVO E;  2ZW5 A;  1V0C A;  1M4D A;  1WWZ A;  1P0H A;  3IGR A;  3SHP A;  4FD5 A;  4UWI A;  4OLL A;  1FY7 A;  4U9Y A;  5EBV A;  4L89 A;  2WPX A;  4MY3 A;  2I79 A;  4XPD B;  3DDD A;  3FRM A;  3W6X A;  4NEX A;  4KVX A;  3G3S A;  4KOV A;  1S5K A;  4RI1 A;  3QB8 A;  3K9U A;  3V8I A;  4UA3 A;  4UBR A;  4U5Y A;  3PGP A;  1IYK A;  4KUB A;  3FIX A;  2OB0 A;  4PK2 A;  5J8C A;  3F8K A;  2Y0M A;  1Q2Y A;  2JDC A;  4IF5 A;  1YX0 A;  3GY9 A;  2D4O A;  3DR6 A;  1NSL A;  1BO4 A;  5GCN A;  4FD7 A;  3FXT A;  1YVK A;  2B3V A;  4MBU A;  3I9S A;  4HNY B;  1S7F A;  2B4D A;  1YR0 A;  2PR1 A;  3TO7 A;  1XE4 A;  2PDO A;  3R96 A;  2AJ6 A;  2Q0Y A;  3TO9 A;  2K5T A;  3TO6 A;  2JLM A;  4KOW A;  2ZW6 A;  2P0W A;  2ZXV A;  2H5M A;  4JWP A;  4H6Z A;  4PV6 A;  1VKC A;  1Q2C A;  4XPL A;  3P2F A;  4JD6 A;  5F47 A;  2BUE A;  3FB3 A;  3E0K A;  4I49 A;  2P6E A;  2I00 A;  5F48 A;  2Z10 A;  4KLW A;  4KLV A;  4AB7 A;  3N7Z A;  2C27 A;  4R3L A;  2IL4 A;  1WK4 A;  4R87 A;  2P6G A;  3R1K A;  1Y7R A;  1OZP A;  3SXO A;  1P4N A;  4AG7 A;  4EVY A;  3ZJ0 A;  2FS5 A;  4QB9 A;  3NE7 A;  2HV2 A;  1MJ9 A;  5EC4 A;  3S6K A;  3B8G A;  3KKW A;  1QSO A;  1K4J A;  4KUA A;  2X7B A;  3FBU A;  3EFA A;  4U9Z A;  5DWN A;  3PZJ A;  1YVO A;  4OAD A;  1CJW A;  4CAV A;  4Y49 C;  1B87 A;  1S7L A;  3TTH A;  4JXQ A;  3MGD A;  4L8A A;  2QEC A;  2B4D B;  3F0A A;  2RC4 A;  4CAX A;  5H86 A;  2VZZ A;  5DWM A;  2WPW A;  2REE A;  4F6A A;  5F49 A;  2CNT A;  2ZW4 A;  3F5B A;  1NMT A;  4M3S A;  3FYN A;  3R9F A;  1IYL A;  3H4Q A;  4QVT A;  3UY5 A;  1XIX A;  5CNP A;  2OZU A;  4CS0 B;  2VI7 A;  2VEZ A;  4KVM E;  2VBQ A;  4AVA A;  3EC4 A;  3D8P A;  3JUW A; 
#chains in the Genus database with same CATH topology
 2Q7S A;  1CPS A;  3GKR A;  2REF A;  4KSI A;  4NCZ A;  2VQY A;  4MCR A;  1XFO A;  4P44 A;  1YSJ A;  3V7Z A;  2AFM A;  3VWD A;  4ZX8 A;  4JLY A;  1UWY A;  1TIQ A;  1Y9W A;  1Z9U A;  2ODF A;  3BJ8 A;  3SJE A;  4M6H A;  1H8L A;  2D4P A;  1B6B A;  3KZW A;  3WC7 A;  2CIJ A;  5CPA A;  1ELM P;  1VHO A;  2PJ2 A;  1CP7 A;  1CG2 A;  1YQE A;  2B4B A;  2V8D A;  4C2Y A;  2VL1 A;  1DTD A;  3CDX A;  3JVN A;  4ZI6 A;  3RAM A;  2Z3M A;  5I4M A;  4HNX B;  1OBR A;  3D7G A;  1QSM A;  2PE3 A;  4XPD C;  5LYD A;  2R1I A;  3ZZI A;  4HNW B;  3KI9 A;  3NA6 A;  3P2H A;  2RB7 A;  1M4L A;  1PUA A;  5LRG A;  2F7V A;  4C2Z A;  2F5I A;  4ONU A;  4H6U A;  3SJX A;  2B3U A;  3FVL A;  1I12 A;  2BEI A;  2Z11 A;  2V77 A;  3PBE A;  2OZH A;  1QMU A;  4E8O A;  3TOA A;  4X2T A;  3GUX A;  4G1P A;  3VH9 A;  1IID A;  1LAM A;  5HVH A;  5KTC A;  4NJR A;  4OC1 A;  2GIV A;  2WUU A;  4KOY A;  4OC5 A;  2Q4V A;  3EO4 A;  5FVJ A;  3KR4 A;  1ZO0 A;  1PU9 A;  1KZF A;  2C6G A;  4YGO A;  1MJA A;  3C26 A;  1TKF A;  2GAN A;  4UEF A;  2B5G A;  4H89 A;  4B5P A;  1S3Z A;  1Y7E A;  4A37 A;  4KZT A;  1VHS A;  1CM0 A;  4FWU A;  4JJX A;  3BHX A;  3D3S A;  3QNV A;  2Q51 A;  4MFP A;  1ON0 A;  1TKH A;  2EVN A;  4YWY A;  1XMB A;  4DUK A;  3H8G A;  4F9U A;  2YNC A;  1S60 A;  3LOD A;  4CGO A;  2PJ5 A;  1BOB A;  1IB1 E;  1QSR A;  3IWE A;  4KOX A;  4UEE A;  2Q4Y A;  3WAB A;  2CY2 A;  3S6G A;  4QBJ A;  2Q7B A;  2OU2 A;  2GU2 A;  1Z8X A;  2OH1 A;  4NJQ A;  2FCK A;  2AE6 A;  4EME A;  4MCS A;  4CAW A;  4UFX A;  1Y9K A;  2ANP A;  2HUZ A;  4FD4 A;  2CNM A;  1YRE A;  2IQ6 A;  1UFH A;  4IAV A;  3BI0 A;  4UIA A;  4KOS A;  4MFZ A;  2O4H A;  2ABZ A;  3H8E A;  3SXN A;  4Z65 A;  4F0Y A;  5C88 A;  7CPA A;  2J8N A;  4J3G A;  2J8R A;  2PRB A;  3NFZ A;  2PSW A;  2PJC A;  4FUU A;  4BBH A;  4OAE A;  3PB8 X;  2PC1 A;  2ZEN A;  5LYL A;  4QC6 A;  4HPS A;  4R9M A;  3D4U A;  1HEE A;  5G20 A;  4II9 A;  1LOK A;  2ZOF A;  3SI0 A;  3TE4 A;  3R9E A;  4A33 A;  4PK3 A;  2F8H A;  2G3A A;  1GHE A;  5K8N A;  4KSA A;  2PJ9 A;  1QSN A;  2ARH A;  2BSW A;  3PFO A;  2FIA A;  5A28 A;  5H84 A;  4BD9 A;  4XNH B;  4CGM A;  3R95 A;  5J8F A;  4PXC A;  1ZG9 A;  4FBE A;  2GLJ A;  2O53 A;  2EO8 A;  1QST A;  3SJG A;  4YU9 A;  3S6H A;  1F57 A;  1TF9 A;  3FNC A;  3H5Z A;  4IK2 A;  4P4D A;  2XEF A;  4A30 A;  3NH4 A;  2B5G B;  3GYA A;  1MJB A;  2C6P A;  4B5P B;  2Z3N A;  1U6M A;  4UCM A;  1RXT A;  5D8N A;  1VGY A;  1YK3 A;  2CF4 A;  2KCW A;  4MXU A;  4PSW A;  3CXS A;  1I1D A;  2DXQ A;  2XEJ A;  3JUW A;  4NF1 A;  4CYP A;  2NYQ A;  4ZBG A;  4PXB A;  5K8P A;  2AFZ A;  2PQ8 A;  3ISZ A;  4LX9 A;  5LRJ A;  3NH8 A;  1CPX A;  2Z0Z A;  3WR7 A;  5K8O A;  3IWG A;  4PXE A;  3BJ7 A;  2J8M A;  3R9G A;  5BWA B;  4OC3 A;  3T9Y A;  3SI1 A;  1KUY A;  5E96 A;  3DLJ A;  4ZY1 A;  1Z2L A;  5THW A;  1BLL E;  3IU2 A;  5IV0 A;  2CTC A;  1NE9 A;  4NGM A;  2G9D A;  2FXF A;  3CXQ A;  3TCV A;  3V38 A;  4CPA A;  3S9N A;  4LQG A;  2B58 A;  4R6T A;  5ELY A;  2FIW A;  3A9L A;  1GYT A;  2FL4 A;  1S7K A;  3D2P A;  4CAF A;  1XMT A;  3DNS A;  3KQZ A;  4R7M A;  2PR8 A;  2CNS A;  3G8W A;  4B5O A;  2A4N A;  3B3W A;  3PRT A;  2R8V A;  1S7N A;  1QQ9 A;  4K3N A;  2DEA A;  3IWW A;  4JXR A;  3JRU A;  4QUS A;  4GM5 A;  1CP6 A;  4NSQ A;  4M85 A;  2NMT A;  4PSX A;  3W6S A;  1BAV A;  1NSA A;  4A95 A;  4CGN A;  1F2O A;  4HKF A;  3TT2 A;  4CGP A;  5CBM A;  3EXN A;  1JWQ A;  4LUA A;  5AGE A;  2JDD A;  1KWM A;  1YLO A;  2C1C A;  3QAY A;  3N5F A;  3MN8 A;  1Q2D A;  3FEC A;  3IJ3 A;  3PB7 X;  1XEB A;  2OZG A;  2WZN A;  4KOT A;  3LD2 A;  4MRI A;  1MK4 A;  2JEV A;  4WWV A;  2VZY A;  4ZX9 A;  3KQX A;  2Z3L A;  4OID A;  3FF3 A;  2ZPA A;  4C68 A;  5HVF A;  4LQ6 A;  1XRY A;  4AVC A;  2PVW A;  2PJ4 A;  1R43 A;  1CBX A;  2JEW A;  4X8I A;  3TOB A;  4NXY A;  4XPK A;  4KSF A;  1Z5R A;  3PFE A;  4X5K A;  3KL9 A;  3K2K A;  4R3K A;  5A27 A;  1XBU A;  4KOR A;  2FT0 A;  3SI2 A;  1X10 A;  2GRE A;  4OP4 A;  1IIC A;  1TXR A;  3L2N A;  3RO0 A;  2VXK A;  5IX3 A;  5KTA A;  2QJ8 A;  3NH5 A;  3S9L A;  1L0C A;  3LAC A;  5IB0 A;  2OR4 A;  2RFH A;  3I3G A;  2QVP A;  3HLP A;  2Q04 A;  1KUX A;  4E2A A;  5J1Q A;  4P6Y A;  1EE3 P;  3KAS A;  4O23 A;  4P4E A;  1RO5 A;  3TX8 A;  3VAT A;  4B10 A;  1R57 A;  2OOT A;  2JBK A;  2GFQ A;  4A94 A;  5HXD A;  3BLN A;  1M4I A;  4A39 A;  1M1D A;  1Q7L A;  3DR8 A;  3EY5 A;  4MHD A;  4NFR A;  5AG6 A;  5EMI A;  1LRZ A;  2PJ0 A;  4IUS A;  2Q43 A;  2Z3K A;  2ZEE A;  5C82 A;  1HDU A;  4CRZ B;  5F46 A;  5HH1 A;  1KUV A;  2AFX A;  4MFJ A;  4B14 A;  2QIR A;  8CPA A;  3D2M A;  4DNC A;  1J4J A;  2ZEF A;  4BMH A;  2QML A;  1Y0Y A;  1X12 A;  1I21 A;  4R57 A;  4UWJ A;  4YFJ A;  1XF8 A;  4H2K A;  5D29 A;  5G21 A;  3CZX A;  3W91 A;  4F9V A;  2WYR A;  4RS2 A;  3K9T A;  1XOV A;  3RNZ A;  2Q44 A;  4A31 A;  2GE3 A;  4TNU A;  5DS0 A;  4Y49 B;  2V8G A;  4IHM A;  4KOU A;  1AMP A;  4MI4 A;  2FE7 A;  1N71 A;  2PJ7 A;  3IIB A;  1F2P A;  4AG9 A;  5ISV A;  2ATR A;  2QYV A;  3OWC A;  4R8F A;  4OC4 A;  2CTB A;  4X3R A;  3CT9 A;  4ONW A;  3WC6 A;  3SJF A;  3B3C A;  3CXP A;  5HMN A;  2FSR A;  4CAE A;  5LYI A;  5JPH A;  1CX8 A;  1YLE A;  2BOA A;  4Q36 A;  3QAH A;  4ORF A;  4B6Z A;  4CRY B;  1Z4R A;  3TFY A;  2YND A;  1YGH A;  2V8V A;  3VWE A;  1Y0R A;  2ZW7 A;  3FJU A;  2XEI A;  4GS4 A;  4YRH A;  2J9A A;  1M44 A;  1Z4E A;  3DSB A;  2HQY A;  2BCO A;  4MHP A;  3CPX A;  4MY0 A;  5I0C A;  1BPN A;  2JBJ A;  2PJ3 A;  2AFW A;  2PVV A;  3PP9 A;  4B11 A;  5KTD A;  2EUI A;  3PB9 X;  4GXH A;  4E0A A;  4AVB A;  2R98 A;  1SQH A;  3ISX A;  2IJZ A;  4K30 A;  1ELL P;  4P4B A;  4PQA A;  1M4G A;  2ZEO A;  4ZY0 A;  4AXV A;  2Z3P A;  2DPT A;  3GIU A;  3FMC A;  4DYO A;  3RYO A;  2GLF A;  1DE4 C;  2BL1 A;  4XNH C;  2C6C A;  2G0B A;  3S6F A;  3T90 A;  4FD6 A;  4MJ8 A;  2P6F A;  5JQ4 A;  4EWT A;  1ARM A;  1Z8T A;  2G3T A;  2O28 A;  3D7H A;  2R7H A;  4KVO E;  2ZW5 A;  1V0C A;  4DJL A;  1M4D A;  4Q38 A;  4C2X A;  1WWZ A;  3D67 A;  2AFS A;  1LFW A;  1P0H A;  3IGR A;  4MFK A;  4NGN A;  3SHP A;  4C7H A;  1ZLI A;  1BPM A;  3KHX A;  1AYE A;  4FD5 A;  4UWI A;  4OLL A;  4F0X A;  1FY7 A;  2Q4Z A;  3PBB A;  4U9Y A;  2YNC C;  5EBV A;  3IO1 A;  1YME A;  4B12 A;  3HUV A;  3FED A;  4ZYQ A;  5AG7 A;  5JH9 A;  4OKO A;  3FH4 A;  4L89 A;  2AFO A;  2WPX A;  2DF5 A;  3IEH A;  4MY3 A;  4TWE A;  3T8W A;  2I79 A;  4XPD B;  3DDD A;  3FRM A;  4MCQ A;  3W6X A;  1FNO A;  3KHZ A;  4MHY A;  2YGW A;  4NEX A;  4KVX A;  3IU1 A;  4MFL A;  3G3S A;  4KOV A;  4M6I A;  1S5K A;  3I1U A;  4RI1 A;  3LWU A;  2PIY A;  4UF4 A;  3QB8 A;  2DPS A;  3K9U A;  1IU8 A;  3V8I A;  3CPA A;  3PB6 X;  4UA3 A;  4UBR A;  3TC8 A;  6CPA A;  4U5Y A;  3H8F A;  4KS9 A;  2CXA A;  2EBJ A;  1PCA A;  3PGP A;  1IYK A;  2YNE A;  3FX6 A;  4KUB A;  4A38 A;  3FIX A;  2OB0 A;  4PK2 A;  4ZGY B;  5J8C A;  4CYQ A;  4ZY2 A;  3F8K A;  2Y0M A;  1Q2Y A;  4UEZ A;  1Z8L A;  2JDC A;  4C7I A;  4IF5 A;  1IGB A;  1YX0 A;  3BXM A;  3RZA A;  3EC4 A;  4P4F A;  3GY9 A;  2D4O A;  3JTK A;  3DR6 A;  1JQG A;  3B35 A;  4RN7 A;  1NSL A;  1BO4 A;  3KR5 A;  3PB4 X;  3B2Y A;  4P4I A;  5GCN A;  5JGF A;  1LAN A;  4FD7 A;  3WC5 A;  3GB0 A;  1ZG8 A;  2ZEH A;  3FXT A;  4OC2 A;  2XEG A;  1YVK A;  2EK8 A;  3KGQ A;  2B3V A;  4MBU A;  4NGT A;  3I9S A;  4HNY B;  1S7F A;  2POK A;  2PCU A;  2B4D A;  4MFQ A;  1YR0 A;  5HVG A;  2PR1 A;  1IOF A;  1XE4 A;  2PDO A;  3R96 A;  2AJ6 A;  3TO7 A;  2Q0Y A;  4NGQ A;  2IMO A;  3TO9 A;  1ARL A;  1IOI A;  3D68 A;  4Q7A A;  2ZED A;  2K5T A;  3TO6 A;  1VIX A;  4M6G A;  2HB6 A;  2JLM A;  4A2Z A;  4KOW A;  2ZW6 A;  2P0W A;  1TF8 A;  2ZXV A;  2H5M A;  3IC1 A;  4JWP A;  4H6Z A;  4PV6 A;  1VKC A;  4PXD A;  5LYF A;  1LCP A;  4UFV A;  1Q2C A;  1IY7 A;  3P2F A;  2PRQ A;  4JD6 A;  4XPL A;  5F47 A;  4EFD A;  1TKJ A;  2BUE A;  3FB3 A;  3E0K A;  2PJ1 A;  4I49 A;  1AUG A;  2P6E A;  2I00 A;  5F48 A;  2Z10 A;  4KLW A;  4B13 A;  4KLV A;  4OC0 A;  1XJO A;  5LRK A;  1Z8W A;  4UCP A;  2PJB A;  4AB7 A;  4PPZ A;  3N7Z A;  2C27 A;  4P45 A;  4R3L A;  4JZ0 A;  1WK4 A;  1ZG7 A;  4R87 A;  3B3S A;  2P6G A;  2HC9 A;  5AG5 A;  3R1K A;  1Y7R A;  1OZP A;  3SXO A;  1P4N A;  4AG7 A;  3FEE A;  1R3N A;  2AFU A;  4NGR A;  3ZJ0 A;  4EVY A;  4R76 A;  4OME A;  2FS5 A;  4UIB A;  2PJ8 A;  4QB9 A;  3NE7 A;  2HV2 A;  1MJ9 A;  4NGP A;  1HDQ A;  3B8G A;  3KKW A;  5EC4 A;  3S6K A;  1QSO A;  1K4J A;  1FT7 A;  1PYT B;  4CYO A;  4KUA A;  2X7B A;  3FBU A;  3EFA A;  4U9Z A;  4UFW A;  5DWN A;  3PZJ A;  1YVO A;  3PEI A;  4OAD A;  3LMS A;  3MRU A;  1CJW A;  5IB9 A;  4CAV A;  2I3C A;  4W9Y A;  4Y49 C;  5G1Z A;  3NE8 A;  4OIW A;  1B87 A;  1A2Z A;  1S7L A;  3TTH A;  2EK9 A;  4BIN A;  5JM6 A;  4JYW A;  3D66 A;  2NSM A;  2BO9 A;  4JXQ A;  3MGD A;  4A32 A;  4RUH A;  4L8A A;  2QEC A;  2B4D B;  4MHZ A;  3DGV A;  3F0A A;  4F8Z A;  2RC4 A;  2ZEP A;  4CAX A;  5K8M A;  5H86 A;  2VZZ A;  3S9M A;  5DWM A;  3VAR A;  2WPW A;  2REE A;  2Z3O A;  3B7I A;  4P4J A;  2PJ6 A;  4UCN A;  1RTQ A;  2WSA A;  4F6A A;  2ZEM A;  2ZOG A;  4NGS A;  4MCP A;  2CNT A;  2PJA A;  2ZW4 A;  1VHE A;  5F49 A;  5AG4 A;  3RBU A;  3F5B A;  1NMT A;  1YW6 A;  1ZLH A;  4M3S A;  2V8H A;  3FYN A;  2ZEG A;  4MMO A;  2PIZ A;  3B3V A;  3R9F A;  1IYL A;  3WT4 A;  3BI1 A;  4P10 A;  5F09 A;  3H4Q A;  4MHN A;  2ZEL A;  1LAP A;  4QVT A;  4WJB A;  5G22 A;  3UY5 A;  1XIX A;  5CNP A;  3B3T A;  4CYN A;  2OZU A;  3D7F A;  4CS0 B;  3IFE A;  2VEZ A;  4KVM E;  3GLJ A;  1YW4 A;  3D7D A;  2FVG A;  2VBQ A;  4AVA A;  2VI7 A;  2EWB A;  3D8P A;  2IL4 A;  4FAI A;  4CGL A; 
#chains in the Genus database with same CATH homology
 4NCZ A;  3GKR A;  2REF A;  4UFV A;  3VWD A;  2VQY A;  4JLY A;  1TIQ A;  1Y9W A;  1Z9U A;  3BJ8 A;  2D4P A;  1B6B A;  2B4B A;  4C2Y A;  3JVN A;  2Z3M A;  4HNX B;  1QSM A;  4XPD C;  2R1I A;  3ZZI A;  4HNW B;  3P2H A;  1PUA A;  4C2Z A;  2F5I A;  4ONU A;  4H6U A;  2B3U A;  1I12 A;  2BEI A;  2Z11 A;  2OZH A;  4E8O A;  3TOA A;  5KTC A;  1IID A;  2GIV A;  2WUU A;  4KOY A;  2Q4V A;  3EO4 A;  5FVJ A;  1ZO0 A;  1PU9 A;  1KZF A;  4YGO A;  1MJA A;  3C26 A;  2GAN A;  2B5G A;  4H89 A;  4B5P A;  1S3Z A;  4KZT A;  1VHS A;  1CM0 A;  4JJX A;  3D3S A;  4MFP A;  1ON0 A;  2EVN A;  2YNC A;  1S60 A;  3LOD A;  4CGO A;  1BOB A;  1IB1 E;  1QSR A;  3IWE A;  4KOX A;  2Q4Y A;  2CY2 A;  3S6G A;  4QBJ A;  2Q7B A;  2OU2 A;  2OH1 A;  2FCK A;  2AE6 A;  4CAW A;  4UFX A;  1Y9K A;  2HUZ A;  4FD4 A;  2CNM A;  1YRE A;  1UFH A;  4KOS A;  4MFZ A;  3SXN A;  5C88 A;  2J8N A;  4J3G A;  2J8R A;  2PRB A;  2PSW A;  4BBH A;  4OAE A;  2PC1 A;  4QC6 A;  4R9M A;  5G20 A;  4II9 A;  3TE4 A;  3R9E A;  4A33 A;  4PK3 A;  2G3A A;  1GHE A;  4KSA A;  1QSN A;  2ARH A;  2BSW A;  2FIA A;  5A28 A;  5H84 A;  4XNH B;  4CGM A;  3R95 A;  5J8F A;  1QST A;  3S6H A;  3FNC A;  3H5Z A;  4A30 A;  2B5G B;  3GYA A;  1MJB A;  4B5P B;  2Z3N A;  1U6M A;  4UCM A;  1RXT A;  1YK3 A;  2KCW A;  4PSW A;  3CXS A;  1I1D A;  2DXQ A;  4NF1 A;  4CYP A;  4ZBG A;  2PQ8 A;  4LX9 A;  2Z0Z A;  3WR7 A;  3IWG A;  3BJ7 A;  2J8M A;  3R9G A;  5BWA B;  3T9Y A;  1KUY A;  5E96 A;  3IU2 A;  5IV0 A;  1NE9 A;  3CXQ A;  2FXF A;  3TCV A;  2B58 A;  3A9L A;  2FIW A;  4CAF A;  2FL4 A;  1S7K A;  3D2P A;  1XMT A;  3DNS A;  2PR8 A;  2CNS A;  3G8W A;  4B5O A;  2A4N A;  2R8V A;  1S7N A;  4JXR A;  4QUS A;  4NSQ A;  4M85 A;  2NMT A;  4PSX A;  3W6S A;  4A95 A;  4CGN A;  4HKF A;  3TT2 A;  4CGP A;  3EXN A;  4LUA A;  5AGE A;  2JDD A;  1Q2D A;  1XEB A;  2OZG A;  4KOT A;  3LD2 A;  1MK4 A;  2JEV A;  5JQ4 A;  2VZY A;  4C68 A;  2Z3L A;  2ZPA A;  4AVC A;  3TOB A;  4NXY A;  4XPK A;  4KSF A;  4X5K A;  4R3K A;  5A27 A;  4KOR A;  2FT0 A;  1IIC A;  5KTA A;  2VXK A;  5IX3 A;  1L0C A;  5IB0 A;  3I3G A;  2Q04 A;  1KUX A;  4E2A A;  1RO5 A;  4B10 A;  1R57 A;  3BLN A;  1M4I A;  1M1D A;  3DR8 A;  3EY5 A;  4MHD A;  5AG6 A;  1LRZ A;  4IUS A;  2Z3K A;  5C82 A;  4CRZ B;  5F46 A;  5HH1 A;  1KUV A;  4MFJ A;  4B14 A;  2QIR A;  3D2M A;  4DNC A;  1J4J A;  4BMH A;  2QML A;  4UWJ A;  1I21 A;  4R57 A;  4YFJ A;  1XF8 A;  3W91 A;  5G21 A;  4RS2 A;  2Q44 A;  4A31 A;  2GE3 A;  4Y49 B;  4KOU A;  4MI4 A;  2FE7 A;  1N71 A;  4AG9 A;  5ISV A;  2ATR A;  3OWC A;  3CXP A;  5HMN A;  2FSR A;  4CAE A;  5JPH A;  1YLE A;  4Q36 A;  4CRY B;  3QAH A;  4ORF A;  3TFY A;  1Z4R A;  2YND A;  1YGH A;  4F0Y A;  3VWE A;  2ZW7 A;  4GS4 A;  4YRH A;  1M44 A;  1Z4E A;  3DSB A;  2HQY A;  5I0C A;  4MY0 A;  4B11 A;  3PP9 A;  5KTD A;  2EUI A;  4E0A A;  4AVB A;  2R98 A;  1SQH A;  4K30 A;  1M4G A;  2Z3P A;  2DPT A;  3RYO A;  2BL1 A;  4XNH C;  3S6F A;  3T90 A;  2G0B A;  4FD6 A;  4MJ8 A;  2P6F A;  2G3T A;  2O28 A;  2R7H A;  4KVO E;  2ZW5 A;  1V0C A;  1M4D A;  4Q38 A;  4C2X A;  1WWZ A;  1P0H A;  3IGR A;  4MFK A;  3SHP A;  4C7H A;  4FD5 A;  4UWI A;  4F0X A;  4OLL A;  1FY7 A;  4U9Y A;  2YNC C;  5EBV A;  4B12 A;  5AG7 A;  4L89 A;  2WPX A;  4MY3 A;  2I79 A;  4XPD B;  3DDD A;  3FRM A;  3W6X A;  2YGW A;  4NEX A;  4KVX A;  3IU1 A;  4MFL A;  3G3S A;  4KOV A;  1S5K A;  4RI1 A;  3QB8 A;  2DPS A;  3K9U A;  3V8I A;  4UA3 A;  4UBR A;  4U5Y A;  4KS9 A;  2CXA A;  3PGP A;  1IYK A;  2YNE A;  4KUB A;  3FIX A;  2OB0 A;  4PK2 A;  4ZGY B;  5J8C A;  4CYQ A;  3F8K A;  2Y0M A;  1Q2Y A;  2JDC A;  4C7I A;  4IF5 A;  1YX0 A;  3GY9 A;  2D4O A;  3JTK A;  3DR6 A;  1NSL A;  1BO4 A;  5GCN A;  4FD7 A;  3FXT A;  1YVK A;  2B3V A;  4MBU A;  3I9S A;  4HNY B;  1S7F A;  4MFQ A;  2B4D A;  1YR0 A;  2PR1 A;  3TO7 A;  1XE4 A;  2PDO A;  3R96 A;  2AJ6 A;  2Q0Y A;  3TO9 A;  2K5T A;  3TO6 A;  2JLM A;  4A2Z A;  4KOW A;  2ZW6 A;  2P0W A;  2ZXV A;  2H5M A;  4JWP A;  4H6Z A;  4PV6 A;  1VKC A;  1Q2C A;  4XPL A;  3P2F A;  4JD6 A;  5F47 A;  2BUE A;  3FB3 A;  3E0K A;  4I49 A;  2P6E A;  2I00 A;  5F48 A;  2Z10 A;  4KLW A;  4B13 A;  4KLV A;  4UCP A;  4AB7 A;  3N7Z A;  2C27 A;  4R3L A;  2IL4 A;  1WK4 A;  4R87 A;  2P6G A;  5AG5 A;  3R1K A;  1Y7R A;  1OZP A;  3SXO A;  1P4N A;  4AG7 A;  4EVY A;  3ZJ0 A;  2FS5 A;  4QB9 A;  3NE7 A;  2HV2 A;  1MJ9 A;  5EC4 A;  3S6K A;  3B8G A;  3KKW A;  1QSO A;  1K4J A;  4CYO A;  4KUA A;  2X7B A;  3FBU A;  3EFA A;  4U9Z A;  4UFW A;  5DWN A;  3PZJ A;  1YVO A;  4OAD A;  1CJW A;  4CAV A;  4Y49 C;  5G1Z A;  1B87 A;  1S7L A;  3TTH A;  4JXQ A;  3MGD A;  4A32 A;  4L8A A;  2QEC A;  2B4D B;  3F0A A;  2RC4 A;  4CAX A;  5H86 A;  2VZZ A;  5DWM A;  2WPW A;  2REE A;  2Z3O A;  4UCN A;  2WSA A;  4F6A A;  5F49 A;  2CNT A;  2ZW4 A;  5AG4 A;  3F5B A;  1NMT A;  4M3S A;  3FYN A;  3R9F A;  1IYL A;  3H4Q A;  4QVT A;  5G22 A;  3UY5 A;  1XIX A;  5CNP A;  4CYN A;  2OZU A;  4CS0 B;  2VI7 A;  2VEZ A;  4KVM E;  2VBQ A;  4AVA A;  3EC4 A;  3D8P A;  3JUW A;  4CGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...