4MJ8A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with polyamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title Crystal structure of spermidine N-acetyltransferase from Vibrio cholerae in complex with polyamine
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 56
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mj8A00
1UFHA 4H6ZA 1WK4A 3P2HA 5JQ4A 4AVCA 2CNMA 1KZFA 2AJ6A 2G0BA 3S6KA 2JLMA 2A4NA 3NE7A 4KVOE 4QBJA 4NXYA 2GE3A 2P0WA 4CAVA 2I79A 1M44A 4XPDB 2OZUA 4XPLA 5F48A 5KTAA 1PU9A 2OH1A 5F46A 2BUEA 3C26A 3FNCA 1IB1E 1YK3A 3EXNA 4AG9A 1YX0A 4MY0A 1WWZA 4QUSA 4KVXA 2ZW4A 2B5GA 2REFA 1MJAA 4NEXA 3LD2A 1Z4EA 2R98A 1XF8A 2FCKA 3SXNA 2Q7BA 2P6GA 3TE4A 5HMNA 4FD7A 3T9YA 1SQHA 2B4BA 3BJ8A 1KUYA 3LODA 4KZTA 3G8WA 2B3UA 4II9A 2C27A 5EC4A 3F8KA 3VWEA 4CS0B 5HH1A 3D8PA 4ONUA 4JWPA 2FE7A 2QECA 1GHEA 1YVKA 3R1KA 1S3ZA 3W6SA 3D2MA 4KOXA 4UWIA 2G3TA 3WR7A 2BL1A 4RI1A 2JDDA 4NF1A 3EO4A 2CNTA 2B5GB 2Q4VA 4FD4A 2VEZA 4LX9A 2DXQA 2B3VA 4L8AA 4ORFA 5ISVA 1I1DA 4JXQA 3E0KA 1KUXA 3D2PA 4U9YA 5IV0A 2D4OA 4YRHA 1B6BA 1IYLA 5C82A 5DWMA 2VZYA 5FVJA 1I21A 3IGRA 3TFYA 4MJ8A 4HKFA 4YGOA 5H86A 2J8MA 3TTHA 1QSTA 2JEVA 2ZXVA 1YGHA 4IUSA 4R87A 3R95A 3ZZIA 3ZJ0A 2Y0MA 2R7HA 5CNPA 4KLVA 2F5IA 4Y49B 1NMTA 4PK3A 2G3AA 1XEBA 3DDDA 3CXSA 1PUAA 3F0AA 2FL4A 5GCNA 2GIVA 4GS4A 3RYOA 4KUAA 3QB8A 3FIXA 2ARHA 3VWDA 2J8RA 2HUZA 1BOBA 2HQYA 4B5OA 1YREA 1NSLA 1XE4A 3B8GA 4JLYA 2PSWA 2J8NA 2WPXA 3TO6A 4EVYA 3FXTA 2P6FA 2PDOA 4H89A 4NSQA 1XMTA 2GANA 3MGDA 1IYKA 3SHPA 4KOSA 4MI4A 2EVNA 2FIAA 1TIQA 4OAEA 4BMHA 4I49A 3TOAA 3FRMA 4XPDC 4HNYB 4F0YA 4XNHB 4CAXA 1S7NA 2HV2A 2EUIA 3IWGA 2KCWA 3R9EA 2FXFA 4FD6A 2IL4A 2FIWA 4MHDA 4KORA 4PV6A 1ON0A 4AG7A 1L0CA 2OZHA 4KOTA 1V0CA 1BO4A 4R3KA 3T90A 4KOUA 2JDCA 2VXKA 5J8FA 4KOWA 3DNSA 1Z9UA 3EY5A 1R57A 4ZBGA 1Y9KA 2H5MA 2ZPAA 2ATRA 2ZW5A 4KOYA 1S7KA 2BEIA 3JUWA 1QSMA 2O28A 2PRBA 3FBUA 1Q2DA 2RC4A 4E2AA 1P4NA 1Q2CA 4FD5A 3V8IA 2Z10A 3JVNA 3DR6A 4AVBA 5E96A 2ZW7A 2BSWA 4U9ZA 1U6MA 4F6AA 3I3GA 2WPWA 3TCVA 1Z4RA 4CRZB 4KOVA 4CRYB 4M3SA 4OLLA 4QVTA 4IF5A 5J8CA 1S5KA 4HNWB 4E0AA 3PGPA 3PP9A 1VHSA 2QMLA 2Z0ZA 3CXQA 4PK2A 1M4IA 2NMTA 1QSNA 2X7BA 3EC4A 4KVME 1Y7RA 4UA3A 4OADA 2ZW6A 2OB0A 4R9MA 2P6EA 2REEA 1IIDA 1YVOA 1Y9WA 1K4JA 3KKWA 3R9GA 3DSBA 3N7ZA 2Q04A 2I00A 1CM0A 1M1DA 3S6GA 2PR1A 4PSWA 4JD6A 3BLNA 2R8VA 3TO7A 3GYAA 5EBVA 3H4QA 3TO9A 2OU2A 4Y49C 2D4PA 1Q2YA 4MBUA 4L89A 3EFAA 4KUBA 4B5PA 4XPKA 5H84A 2Q44A 4R3LA 3UY5A 5C88A 3CXPA 4H6UA 1NE9A 4JXRA 2CNSA 3R96A 4UWJA 1M4GA 4KLWA 4RS2A 5F47A 1N71A 2AE6A 4YFJA 3G3SA 1M4DA 3TT2A 1QSRA 3K9UA 1J4JA 2PR8A 1S60A 4U5YA 5JPHA 1FY7A 3S6FA 4J3GA 3GY9A 2B58A 4PSXA 4R57A 3PZJA 4UBRA 5IX3A 3SXOA 4QB9A 1KUVA 2B4DA 1RXTA 1S7LA 4CAWA 5DWNA 4JJXA 1MJBA 4XNHC 2VI7A 3FYNA 2K5TA 2VQYA 5F49A 2CY2A 2FT0A 4LUAA 3TOBA 2VZZA 1LRZA 3GKRA 1S7FA 2OZGA 3W91A 4B5PB 1VKCA 1MK4A 3S6HA 2PQ8A 4AVAA 2R1IA 1CJWA 3I9SA 3BJ7A 2Q0YA 2Q4YA 1RO5A 4DNCA 5I0CA 1XIXA 2VBQA 5IB0A 4AB7A 3R9FA 1B87A 1YLEA 3QAHA 4M85A 2QIRA 5KTDA 4HNXB 1OZPA 3OWCA 1QSOA 1IICA 4NCZA 3D3SA 2Z11A 1P0HA 4X5KA 3FB3A 4K30A 4E8OA 2FSRA 5KTCA 1YR0A 1I12A 2B4DB 3P2FA 4QC6A 3W6XA 4MY3A 1MJ9A 2FS5A 2PC1A 3F5BA 3DR8A
chains in the Genus database with same CATH superfamily
4LQGA 1UFHA 4H6ZA 1WK4A 3P2HA 5JQ4A 3BHXA 3PBEA 1LAPA 4YU9A 2Q7SA 1Z8WA 3RO0A 4EMEA 4AVCA 4NJQA 2EK9A 4NGQA 2CNMA 1KZFA 2AJ6A 2G0BA 3S6KA 4CGMA 4PXBA 2JLMA 1CX8A 3D66A 4MCQA 3TX8A 2A4NA 4Q36A 4B11A 4A31A 3NE7A 4KVOE 3D67A 4QBJA 3K9TA 4MFJA 2GE3A 2P0WA 4NXYA 4CAVA 1ELLP 4B12A 2V8DA 4MHYA 4P6YA 4C7HA 2I79A 4TNUA 4CYPA 5A28A 5JH9A 4UIAA 2Q51A 2NYQA 2CTBA 2PCUA 1ELMP 1LANA 2AFSA 1M44A 4XPDB 4OIDA 2OZUA 4XPLA 4MFLA 5F48A 5LYDA 5KTAA 1PU9A 2OH1A 5F46A 2I3CA 3GLJA 2BUEA 5G20A 2JEWA 2PJ2A 3C26A 1IB1E 2GLJA 3FNCA 5LYLA 1YK3A 3EXNA 4AG9A 4NGNA 3LACA 3WC6A 1YX0A 2ZEGA 4MY0A 1F2OA 1WWZA 2C1CA 2XEFA 4QUSA 1CPXA 4KVXA 2ANPA 4UFWA 2ZW4A 3WC7A 5AGEA 1YMEA 3WC5A 2B5GA 2REFA 1MJAA 2RFHA 4NEXA 3LD2A 3WT4A 1Z4EA 2GLFA 2R98A 4NGPA 5D8NA 1XF8A 2FCKA 3SXNA 2Q7BA 1F2PA 2EWBA 3KQZA 4MFZA 2P6GA 3IO1A 4CGOA 5HMNA 3CDXA 3TE4A 4C7IA 1BAVA 1X12A 1H8LA 2PJ0A 4FD7A 3T9YA 1AMPA 1SQHA 4X8IA 1XFOA 3FF3A 2B4BA 3BJ8A 1KUYA 1Z5RA 3LODA 4KZTA 3G8WA 2B3UA 4UF4A 4II9A 2C27A 5EC4A 3F8KA 3VWEA 4CS0B 3KQXA 2HB6A 3D8PA 5HH1A 2ABZA 4WWVA 4MHZA 4UIBA 3PBBA 4ONUA 4A33A 4JWPA 3KZWA 2FE7A 4NGSA 2QECA 1GHEA 1DTDA 2PJ6A 1YVKA 1IOFA 3R1KA 4MXUA 1S3ZA 4EWTA 3W6SA 3D2MA 4UFVA 4MRIA 4KOXA 3RBUA 4WJBA 4UWIA 2G3TA 1IY7A 4FWUA 4RUHA 2PVVA 2YNCA 4OP4A 5K8MA 4OC3A 2AFWA 3B35A 3WR7A 2BL1A 2XEIA 3FJUA 4DYOA 4RI1A 5HXDA 2C6GA 2PJ9A 2JDDA 4OC0A 1LOKA 2ZEPA 4NF1A 3VARA 1PCAA 3EO4A 2CNTA 2B5GB 2Q4VA 4FD4A 1YSJA 2VEZA 1CG2A 4LX9A 2DXQA 1JWQA 2B3VA 3H8GA 4L8AA 5AG7A 4C2ZA 3K2KA 4ORFA 4Z65A 3IEHA 1M4LA 5ISVA 4EFDA 2CXAA 1VHOA 1UWYA 4CPAA 3KI9A 4P4EA 1I1DA 3DGVA 2WSAA 4IAVA 4Q7AA 5AG6A 1JQGA 4JXQA 3E0KA 4BD9A 4KSAA 1Q7LA 3SJGA 4UEEA 1KUXA 1Z8LA 4IK2A 3D2PA 3NH5A 4U9YA 2Z3PA 2NSMA 5IV0A 4UEZA 3SI1A 2D4OA 4YRHA 1B6BA 5G22A 1IYLA 5C82A 5DWMA 3VH9A 2ZENA 2VZYA 2PIYA 3CPXA 5FVJA 1I21A 1R43A 3PB7X 3IGRA 1CBXA 3TFYA 2PE3A 4MJ8A 4HKFA 4YGOA 5H86A 2J8MA 3IWWA 3TTHA 1QSTA 2F7VA 2JEVA 4F8ZA 3IIBA 5AG5A 4CGNA 3MN8A 2ZXVA 2PJ7A 1YGHA 4IUSA 4R87A 3R95A 4C2XA 3ZZIA 1BPNA 3ZJ0A 4OC2A 3LMSA 3A9LA 4GM5A 1OBRA 3IFEA 1Y0YA 3T8WA 2Q4ZA 2Y0MA 4P44A 5F09A 2ZEEA 4M6IA 2R7HA 3MRUA 5CNPA 1BPMA 1CP7A 4KLVA 2F5IA 4Y49B 4IHMA 1NMTA 4PK3A 4CYNA 2Z3KA 2G3AA 1XEBA 3S9NA 3DDDA 3CXSA 1PUAA 3PRTA 2QJ8A 3F0AA 4NGRA 2Z3OA 2FL4A 3GB0A 5GCNA 1FT7A 2GIVA 1R3NA 2YNDA 4GS4A 3IU1A 4NJRA 4CAEA 3RYOA 4KUAA 1XRYA 4JZ0A 3QB8A 3DLJA 1YW4A 3FIXA 2ARHA 3ISZA 3VWDA 2J8RA 2HUZA 1BOBA 1ARMA 2HQYA 3BI1A 3H5ZA 3KASA 4B5OA 1YREA 4FUUA 4CYOA 1NSLA 1XE4A 2DPTA 1VHEA 3KR4A 1ZG9A 5AG4A 1TF9A 4OKOA 5HVFA 3B8GA 3D7DA 4JLYA 2PSWA 2J8NA 2WPXA 3TO6A 3JRUA 4EVYA 3FXTA 2CIJA 2P6FA 2PDOA 4H89A 4NSQA 4F0XA 3B2YA 2JBJA 2ZOFA 4ZY1A 1AUGA 1XMTA 2GANA 3MGDA 1IYKA 4NGMA 3RNZA 3SHPA 3B3TA 3PB9X 4KOSA 4MI4A 3SJXA 4CAFA 3N5FA 4PQAA 4X2TA 3PB6X 1ZG7A 3B7IA 2EVNA 2FIAA 1TIQA 2XEJA 4OAEA 4BMHA 4UCMA 4I49A 3SI2A 8CPAA 3TOAA 1ZLHA 3FRMA 3H8FA 3KHZA 4A32A 4ZI6A 2GFQA 4XPDC 2V8GA 4HNYB 2FVGA 2AFMA 4A37A 4F0YA 4P45A 1X10A 4XNHB 3VATA 1CP6A 3RZAA 3KR5A 1S7NA 2AFOA 2EUIA 2HV2A 1XMBA 3IWGA 4CAXA 5JGFA 3SJEA 2KCWA 3R9EA 2FXFA 4FD6A 4O23A 1AYEA 3KGQA 3D7HA 2IL4A 2FIWA 1YQEA 1LFWA 5LYIA 4MCPA 4FBEA 4MHDA 3PFEA 3V38A 4KORA 1QMUA 5THWA 2OOTA 2PJ4A 4PV6A 3PFOA 1ON0A 4AG7A 4ZX9A 1FNOA 1L0CA 5G21A 3D7GA 2OZHA 4KOTA 1V0CA 1TKJA 3GUXA 1BO4A 4F9UA 4R3KA 3T90A 4KOUA 1EE3P 4ZY0A 2JDCA 2VXKA 1GYTA 5J8FA 5D29A 4KOWA 4MHPA 3LWUA 3DNSA 5LRKA 1Z9UA 4R6TA 3EY5A 4KS9A 4ONWA 1R57A 2V8VA 1Y9KA 2Z3LA 4MFKA 4NFRA 1ZLIA 2H5MA 4ZBGA 2Z3NA 4M6HA 3GIUA 4UCNA 2ZPAA 2ATRA 2PRQA 2ZW5A 2AFUA 1XBUA 1ARLA 1DE4C 4P4IA 4KOYA 3D4UA 1S7KA 2BEIA 5LRGA 3JUWA 1QSMA 2O28A 2PRBA 1NSAA 1TKHA 3D7FA 3FBUA 1Q2DA 2OR4A 2RC4A 4KSIA 1P4NA 4E2AA 1Q2CA 1YLOA 3FMCA 4FD5A 4MFQA 5K8NA 2IMOA 3V8IA 1HDUA 2Z10A 3HLPA 3JVNA 3DR6A 1VIXA 4AVBA 1PYTB 3QNVA 4H2KA 5E96A 3H8EA 2PJAA 2ZW7A 2BSWA 4U9ZA 1U6MA 3PEIA 1HDQA 3NFZA 4F6AA 4DUKA 3I3GA 2WPWA 4C2YA 3TCVA 1Z4RA 4CRZB 4KOVA 4CRYB 4M3SA 4NGTA 4OLLA 4A2ZA 7CPAA 3S9MA 5IB9A 4QVTA 4PXEA 4IF5A 5J8CA 3RAMA 2HC9A 1S5KA 2JBKA 4RN7A 4HNWB 4E0AA 2VL1A 3PGPA 4PPZA 3PP9A 4Q38A 1RTQA 4HPSA 4P4FA 1ZG8A 1VHSA 2QMLA 2PIZA 2Z0ZA 3CXQA 4PK2A 4R76A 2EBJA 4UCPA 4A38A 3I1UA 1M4IA 2NMTA 1QSNA 1VGYA 2X7BA 3EC4A 4KVME 1Y7RA 4P4JA 4UA3A 4UEFA 4MCRA 2ZW6A 4OADA 4UFXA 4MHNA 2C6PA 2DF5A 3SI0A 2OB0A 4R9MA 2P6EA 2IJZA 2REEA 1IIDA 1YVOA 2PJ3A 1Y9WA 4OC5A 1K4JA 1QQ9A 3B3VA 4W9YA 2YNCC 2ZEHA 3KKWA 3R9GA 3DSBA 3N7ZA 4A39A 4A94A 4PXDA 2PJ8A 4CGLA 2Q04A 2BCOA 4YWYA 2I00A 5I4MA 1CM0A 5ELYA 1Z2LA 1M1DA 3IWEA 3S6GA 4BBHA 2PR1A 1F57A 4PSWA 4JD6A 2V77A 3ISXA 3BLNA 2R8VA 3TO7A 3BI0A 3IJ3A 3KHXA 3GYAA 5EBVA 3H4QA 5CPAA 5A27A 2O4HA 3V7ZA 1A2ZA 3TO9A 2OU2A 4Y49C 4A30A 2PJCA 2D4PA 3NH8A 1IOIA 5DS0A 1Q2YA 1TF8A 4MBUA 5HVGA 4L89A 3FECA 1HEEA 2ZEFA 2ZEOA 3EFAA 4PXCA 2C6CA 4MFPA 1ZO0A 4KUBA 4C68A 4B5PA 3JTKA 1YW6A 4XPKA 2EO8A 5H84A 2Q44A 2ZELA 3B3SA 4R3LA 2BOAA 3UY5A 3L2NA 5C88A 3CXPA 3NE8A 1NE9A 4H6UA 4JXRA 2CNSA 3R96A 4UWJA 5G1ZA 4X3RA 4R7MA 3PB8X 1M4GA 2BO9A 4KLWA 4RS2A 5F47A 1N71A 2AE6A 4YFJA 2XEGA 3FX6A 3G3SA 5CBMA 5HVHA 3NA6A 3S9LA 2ZOGA 1M4DA 3PB4X 4G1PA 3TT2A 1QSRA 2AFXA 1TKFA 2O53A 1J4JA 3IU2A 3K9UA 2YGWA 2PR8A 1S60A 3FH4A 4U5YA 4OC4A 3TC8A 4ZGYB 1FY7A 5JPHA 4R8FA 3S6FA 2PJ5A 2GU2A 3QAYA 4J3GA 3GY9A 4ZX8A 2B58A 4PSXA 4R57A 3PZJA 4UBRA 2F8HA 3SXOA 4P4DA 4QB9A 5IX3A 1IGBA 2QYVA 1KUVA 1XJOA 4BINA 2B4DA 1RXTA 5K8OA 4AXVA 1S7LA 2PJ1A 1LAMA 4CAWA 4CGPA 5LYFA 1TXRA 3BXMA 5DWNA 4JJXA 3CPAA 3FVLA 1MJBA 1LCPA 2VI7A 4M6GA 4XNHC 3FYNA 2K5TA 5LRJA 2VQYA 5F49A 4CYQA 5K8PA 2CY2A 2FT0A 4LUAA 3TOBA 2VZZA 1LRZA 3B3CA 4B13A 3GKRA 4JYWA 1S7FA 2OZGA 3W91A 4OMEA 5JM6A 2Z3MA 4K3NA 4LQ6A 4B5PB 2V8HA 1VKCA 2DEAA 1MK4A 3S6HA 2EK8A 2PQ8A 4AVAA 3FEDA 4F9VA 2R1IA 1CJWA 2ZEDA 4B10A 3SJFA 1Y0RA 4OC1A 2Q43A 3I9SA 3BJ7A 1BLLE 2Q0YA 2Q4YA 1Y7EA 4B14A 2PVWA 2ZEMA 1RO5A 1XOVA 4MCSA 4A95A 3IC1A 4DNCA 3CZXA 2G9DA 4P4BA 5I0CA 1XIXA 2VBQA 2PJBA 5IB0A 1IU8A 2POKA 3B3WA 2IQ6A 3D68A 4AB7A 3CT9A 2WUUA 4ZY2A 1B87A 3R9FA 1YLEA 3QAHA 4M85A 1Z8XA 2QIRA 5KTDA 1OZPA 3OWCA 4HNXB 1QSOA 1IICA 4NCZA 2GREA 3D3SA 2Z11A 2AFZA 2RB7A 2CF4A 5EMIA 4DJLA 1P0HA 2YNEA 2QVPA 4X5KA 3FB3A 4K30A 4E8OA 4P10A 2J9AA 2FSRA 5KTCA 1YR0A 5J1QA 2WZNA 5BWAB 1I12A 2B4DB 4GXHA 3P2FA 4QC6A 3HUVA 3W6XA 4MY3A 2DPSA 3WABA 4ZYQA 4B6ZA 2CTCA 6CPAA 3KL9A 1CPSA 1MJ9A 2ODFA 3NH4A 2WYRA 4KSFA 4TWEA 1Z8TA 4FAIA 2FS5A 2PC1A 3F5BA 1KWMA 3DR8A 3FEEA 4OIWA 4MMOA
chains in the Genus database with same CATH topology
1UFHA 4H6ZA 1WK4A 3P2HA 5JQ4A 4AVCA 2CNMA 1KZFA 2AJ6A 2G0BA 3S6KA 4CGMA 2JLMA 2A4NA 4Q36A 4B11A 4A31A 3NE7A 4KVOE 4QBJA 4NXYA 4MFJA 2GE3A 2P0WA 4CAVA 4B12A 4C7HA 4CYPA 5A28A 2I79A 1M44A 4XPDB 2OZUA 4XPLA 4MFLA 5F48A 5KTAA 1PU9A 2OH1A 5F46A 2BUEA 5G20A 3C26A 3FNCA 1IB1E 1YK3A 3EXNA 4AG9A 1YX0A 4MY0A 1WWZA 4QUSA 4KVXA 4UFWA 2ZW4A 5AGEA 2B5GA 2REFA 1MJAA 4NEXA 3LD2A 1Z4EA 2R98A 1XF8A 2FCKA 3SXNA 2Q7BA 4MFZA 2P6GA 4CGOA 5HMNA 3TE4A 4C7IA 4FD7A 3T9YA 1SQHA 2B4BA 3BJ8A 1KUYA 3LODA 4KZTA 3G8WA 2B3UA 4II9A 2C27A 5EC4A 3F8KA 3VWEA 4CS0B 5HH1A 3D8PA 4ONUA 4A33A 4JWPA 2FE7A 2QECA 1GHEA 1YVKA 3R1KA 1S3ZA 3W6SA 3D2MA 4UFVA 4KOXA 4UWIA 2G3TA 2YNCA 3WR7A 2BL1A 4RI1A 2JDDA 4NF1A 3EO4A 2CNTA 2B5GB 2Q4VA 4FD4A 2VEZA 4LX9A 2DXQA 2B3VA 4L8AA 5AG7A 4C2ZA 4ORFA 5ISVA 2CXAA 1I1DA 2WSAA 5AG6A 4JXQA 3E0KA 4KSAA 1KUXA 3D2PA 4U9YA 2Z3PA 5IV0A 2D4OA 4YRHA 1B6BA 5G22A 1IYLA 5C82A 5DWMA 2VZYA 5FVJA 1I21A 3IGRA 3TFYA 4MJ8A 4HKFA 4YGOA 5H86A 2J8MA 3TTHA 1QSTA 2JEVA 4CGNA 5AG5A 2ZXVA 1YGHA 4IUSA 4R87A 3R95A 4C2XA 3ZZIA 3ZJ0A 3A9LA 2Y0MA 2R7HA 5CNPA 4KLVA 2F5IA 4Y49B 1NMTA 4PK3A 4CYNA 2Z3KA 2G3AA 1XEBA 3DDDA 3CXSA 1PUAA 3F0AA 2Z3OA 2FL4A 5GCNA 2GIVA 2YNDA 4GS4A 3IU1A 4CAEA 3RYOA 4KUAA 3QB8A 3FIXA 2ARHA 3VWDA 2J8RA 2HUZA 1BOBA 3H5ZA 2HQYA 4B5OA 4CYOA 1YREA 1NSLA 1XE4A 2DPTA 5AG4A 3B8GA 4JLYA 2PSWA 2J8NA 2WPXA 3TO6A 4EVYA 3FXTA 2P6FA 2PDOA 4H89A 4NSQA 4F0XA 1XMTA 2GANA 3MGDA 1IYKA 3SHPA 4KOSA 4CAFA 4MI4A 2EVNA 2FIAA 1TIQA 4OAEA 4BMHA 4UCMA 4I49A 3TOAA 3FRMA 4A32A 4XPDC 4HNYB 4F0YA 4XNHB 4CAXA 1S7NA 2HV2A 2EUIA 3IWGA 2KCWA 3R9EA 2FXFA 4FD6A 2IL4A 2FIWA 4MHDA 4KORA 4PV6A 1ON0A 4AG7A 1L0CA 5G21A 2OZHA 4KOTA 1V0CA 1BO4A 4R3KA 3T90A 4KOUA 2JDCA 2VXKA 5J8FA 4KOWA 3DNSA 1Z9UA 3EY5A 4KS9A 1R57A 2Z3LA 1Y9KA 4MFKA 4ZBGA 2H5MA 2Z3NA 4UCNA 2ZPAA 2ATRA 2ZW5A 4KOYA 1S7KA 2BEIA 3JUWA 1QSMA 2O28A 2PRBA 3FBUA 1Q2DA 2RC4A 4E2AA 1P4NA 1Q2CA 4MFQA 4FD5A 3V8IA 2Z10A 3JVNA 3DR6A 4AVBA 5E96A 2ZW7A 2BSWA 4U9ZA 1U6MA 4F6AA 3I3GA 2WPWA 4C2YA 3TCVA 1Z4RA 4CRZB 4KOVA 4CRYB 4M3SA 4OLLA 4A2ZA 4QVTA 4IF5A 5J8CA 1S5KA 4HNWB 4E0AA 3PGPA 3PP9A 4Q38A 1VHSA 2QMLA 2Z0ZA 3CXQA 4PK2A 4UCPA 1M4IA 2NMTA 1QSNA 2X7BA 3EC4A 4KVME 1Y7RA 4UA3A 4UFXA 4OADA 2ZW6A 2OB0A 4R9MA 2P6EA 2REEA 1IIDA 1YVOA 1Y9WA 1K4JA 2YNCC 3KKWA 3R9GA 3DSBA 3N7ZA 4CGLA 2Q04A 2I00A 1CM0A 1M1DA 3IWEA 3S6GA 4BBHA 2PR1A 4PSWA 4JD6A 3BLNA 2R8VA 3TO7A 3GYAA 5EBVA 3H4QA 5A27A 3TO9A 2OU2A 4Y49C 4A30A 2D4PA 1Q2YA 4MBUA 4L89A 3EFAA 4MFPA 1ZO0A 4KUBA 4C68A 4B5PA 3JTKA 4XPKA 5H84A 2Q44A 4R3LA 3UY5A 5C88A 3CXPA 4H6UA 1NE9A 4JXRA 2CNSA 3R96A 4UWJA 5G1ZA 1M4GA 4KLWA 4RS2A 5F47A 1N71A 2AE6A 4YFJA 3G3SA 1M4DA 3TT2A 1QSRA 3K9UA 1J4JA 3IU2A 2YGWA 2PR8A 1S60A 4U5YA 5JPHA 4ZGYB 1FY7A 3S6FA 4J3GA 3GY9A 2B58A 4PSXA 4R57A 3PZJA 4UBRA 5IX3A 3SXOA 4QB9A 1KUVA 2B4DA 1RXTA 1S7LA 4CAWA 4CGPA 5DWNA 4JJXA 1MJBA 4XNHC 2VI7A 3FYNA 2K5TA 2VQYA 5F49A 4CYQA 2CY2A 2FT0A 4LUAA 3TOBA 2VZZA 1LRZA 4B13A 3GKRA 1S7FA 2OZGA 3W91A 2Z3MA 4B5PB 1VKCA 1MK4A 3S6HA 2PQ8A 4AVAA 2R1IA 1CJWA 4B10A 3I9SA 3BJ7A 4B14A 2Q0YA 2Q4YA 1RO5A 4A95A 4DNCA 5I0CA 1XIXA 2VBQA 5IB0A 4AB7A 3R9FA 2WUUA 1B87A 1YLEA 3QAHA 4M85A 2QIRA 5KTDA 4HNXB 1OZPA 3OWCA 1QSOA 1IICA 4NCZA 3D3SA 2Z11A 1P0HA 2YNEA 4X5KA 3FB3A 4K30A 4E8OA 2FSRA 5KTCA 1YR0A 5BWAB 1I12A 2B4DB 3P2FA 4QC6A 3W6XA 4MY3A 2DPSA 1MJ9A 4KSFA 2FS5A 2PC1A 3F5BA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFH A;  4H6Z A;  1WK4 A;  3P2H A;  5JQ4 A;  4AVC A;  2CNM A;  1KZF A;  2AJ6 A;  2G0B A;  3S6K A;  2JLM A;  2A4N A;  3NE7 A;  4KVO E;  4QBJ A;  4NXY A;  2GE3 A;  2P0W A;  4CAV A;  2I79 A;  1M44 A;  4XPD B;  2OZU A;  4XPL A;  5F48 A;  5KTA A;  1PU9 A;  2OH1 A;  5F46 A;  2BUE A;  3C26 A;  3FNC A;  1IB1 E;  1YK3 A;  3EXN A;  4AG9 A;  1YX0 A;  4MY0 A;  1WWZ A;  4QUS A;  4KVX A;  2ZW4 A;  2B5G A;  2REF A;  1MJA A;  4NEX A;  3LD2 A;  1Z4E A;  2R98 A;  1XF8 A;  2FCK A;  3SXN A;  2Q7B A;  2P6G A;  3TE4 A;  5HMN A;  4FD7 A;  3T9Y A;  1SQH A;  2B4B A;  3BJ8 A;  1KUY A;  3LOD A;  4KZT A;  3G8W A;  2B3U A;  4II9 A;  2C27 A;  5EC4 A;  3F8K A;  3VWE A;  4CS0 B;  5HH1 A;  3D8P A;  4ONU A;  4JWP A;  2FE7 A;  2QEC A;  1GHE A;  1YVK A;  3R1K A;  1S3Z A;  3W6S A;  3D2M A;  4KOX A;  4UWI A;  2G3T A;  3WR7 A;  2BL1 A;  4RI1 A;  2JDD A;  4NF1 A;  3EO4 A;  2CNT A;  2B5G B;  2Q4V A;  4FD4 A;  2VEZ A;  4LX9 A;  2DXQ A;  2B3V A;  4L8A A;  4ORF A;  5ISV A;  1I1D A;  4JXQ A;  3E0K A;  1KUX A;  3D2P A;  4U9Y A;  5IV0 A;  2D4O A;  4YRH A;  1B6B A;  1IYL A;  5C82 A;  5DWM A;  2VZY A;  5FVJ A;  1I21 A;  3IGR A;  3TFY A;  4MJ8 A;  4HKF A;  4YGO A;  5H86 A;  2J8M A;  3TTH A;  1QST A;  2JEV A;  2ZXV A;  1YGH A;  4IUS A;  4R87 A;  3R95 A;  3ZZI A;  3ZJ0 A;  2Y0M A;  2R7H A;  5CNP A;  4KLV A;  2F5I A;  4Y49 B;  1NMT A;  4PK3 A;  2G3A A;  1XEB A;  3DDD A;  3CXS A;  1PUA A;  3F0A A;  2FL4 A;  5GCN A;  2GIV A;  4GS4 A;  3RYO A;  4KUA A;  3QB8 A;  3FIX A;  2ARH A;  3VWD A;  2J8R A;  2HUZ A;  1BOB A;  2HQY A;  4B5O A;  1YRE A;  1NSL A;  1XE4 A;  3B8G A;  4JLY A;  2PSW A;  2J8N A;  2WPX A;  3TO6 A;  4EVY A;  3FXT A;  2P6F A;  2PDO A;  4H89 A;  4NSQ A;  1XMT A;  2GAN A;  3MGD A;  1IYK A;  3SHP A;  4KOS A;  4MI4 A;  2EVN A;  2FIA A;  1TIQ A;  4OAE A;  4BMH A;  4I49 A;  3TOA A;  3FRM A;  4XPD C;  4HNY B;  4F0Y A;  4XNH B;  4CAX A;  1S7N A;  2HV2 A;  2EUI A;  3IWG A;  2KCW A;  3R9E A;  2FXF A;  4FD6 A;  2IL4 A;  2FIW A;  4MHD A;  4KOR A;  4PV6 A;  1ON0 A;  4AG7 A;  1L0C A;  2OZH A;  4KOT A;  1V0C A;  1BO4 A;  4R3K A;  3T90 A;  4KOU A;  2JDC A;  2VXK A;  5J8F A;  4KOW A;  3DNS A;  1Z9U A;  3EY5 A;  1R57 A;  4ZBG A;  1Y9K A;  2H5M A;  2ZPA A;  2ATR A;  2ZW5 A;  4KOY A;  1S7K A;  2BEI A;  3JUW A;  1QSM A;  2O28 A;  2PRB A;  3FBU A;  1Q2D A;  2RC4 A;  4E2A A;  1P4N A;  1Q2C A;  4FD5 A;  3V8I A;  2Z10 A;  3JVN A;  3DR6 A;  4AVB A;  5E96 A;  2ZW7 A;  2BSW A;  4U9Z A;  1U6M A;  4F6A A;  3I3G A;  2WPW A;  3TCV A;  1Z4R A;  4CRZ B;  4KOV A;  4CRY B;  4M3S A;  4OLL A;  4QVT A;  4IF5 A;  5J8C A;  1S5K A;  4HNW B;  4E0A A;  3PGP A;  3PP9 A;  1VHS A;  2QML A;  2Z0Z A;  3CXQ A;  4PK2 A;  1M4I A;  2NMT A;  1QSN A;  2X7B A;  3EC4 A;  4KVM E;  1Y7R A;  4UA3 A;  4OAD A;  2ZW6 A;  2OB0 A;  4R9M A;  2P6E A;  2REE A;  1IID A;  1YVO A;  1Y9W A;  1K4J A;  3KKW A;  3R9G A;  3DSB A;  3N7Z A;  2Q04 A;  2I00 A;  1CM0 A;  1M1D A;  3S6G A;  2PR1 A;  4PSW A;  4JD6 A;  3BLN A;  2R8V A;  3TO7 A;  3GYA A;  5EBV A;  3H4Q A;  3TO9 A;  2OU2 A;  4Y49 C;  2D4P A;  1Q2Y A;  4MBU A;  4L89 A;  3EFA A;  4KUB A;  4B5P A;  4XPK A;  5H84 A;  2Q44 A;  4R3L A;  3UY5 A;  5C88 A;  3CXP A;  4H6U A;  1NE9 A;  4JXR A;  2CNS A;  3R96 A;  4UWJ A;  1M4G A;  4KLW A;  4RS2 A;  5F47 A;  1N71 A;  2AE6 A;  4YFJ A;  3G3S A;  1M4D A;  3TT2 A;  1QSR A;  3K9U A;  1J4J A;  2PR8 A;  1S60 A;  4U5Y A;  5JPH A;  1FY7 A;  3S6F A;  4J3G A;  3GY9 A;  2B58 A;  4PSX A;  4R57 A;  3PZJ A;  4UBR A;  5IX3 A;  3SXO A;  4QB9 A;  1KUV A;  2B4D A;  1RXT A;  1S7L A;  4CAW A;  5DWN A;  4JJX A;  1MJB A;  4XNH C;  2VI7 A;  3FYN A;  2K5T A;  2VQY A;  5F49 A;  2CY2 A;  2FT0 A;  4LUA A;  3TOB A;  2VZZ A;  1LRZ A;  3GKR A;  1S7F A;  2OZG A;  3W91 A;  4B5P B;  1VKC A;  1MK4 A;  3S6H A;  2PQ8 A;  4AVA A;  2R1I A;  1CJW A;  3I9S A;  3BJ7 A;  2Q0Y A;  2Q4Y A;  1RO5 A;  4DNC A;  5I0C A;  1XIX A;  2VBQ A;  5IB0 A;  4AB7 A;  3R9F A;  1B87 A;  1YLE A;  3QAH A;  4M85 A;  2QIR A;  5KTD A;  4HNX B;  1OZP A;  3OWC A;  1QSO A;  1IIC A;  4NCZ A;  3D3S A;  2Z11 A;  1P0H A;  4X5K A;  3FB3 A;  4K30 A;  4E8O A;  2FSR A;  5KTC A;  1YR0 A;  1I12 A;  2B4D B;  3P2F A;  4QC6 A;  3W6X A;  4MY3 A;  1MJ9 A;  2FS5 A;  2PC1 A;  3F5B A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 4LQG A;  1UFH A;  4H6Z A;  1WK4 A;  3P2H A;  5JQ4 A;  3BHX A;  3PBE A;  1LAP A;  4YU9 A;  2Q7S A;  1Z8W A;  3RO0 A;  4EME A;  4AVC A;  4NJQ A;  2EK9 A;  4NGQ A;  2CNM A;  1KZF A;  2AJ6 A;  2G0B A;  3S6K A;  4CGM A;  4PXB A;  2JLM A;  1CX8 A;  3D66 A;  4MCQ A;  3TX8 A;  2A4N A;  4Q36 A;  4B11 A;  4A31 A;  3NE7 A;  4KVO E;  3D67 A;  4QBJ A;  3K9T A;  4MFJ A;  2GE3 A;  2P0W A;  4NXY A;  4CAV A;  1ELL P;  4B12 A;  2V8D A;  4MHY A;  4P6Y A;  4C7H A;  2I79 A;  4TNU A;  4CYP A;  5A28 A;  5JH9 A;  4UIA A;  2Q51 A;  2NYQ A;  2CTB A;  2PCU A;  1ELM P;  1LAN A;  2AFS A;  1M44 A;  4XPD B;  4OID A;  2OZU A;  4XPL A;  4MFL A;  5F48 A;  5LYD A;  5KTA A;  1PU9 A;  2OH1 A;  5F46 A;  2I3C A;  3GLJ A;  2BUE A;  5G20 A;  2JEW A;  2PJ2 A;  3C26 A;  1IB1 E;  2GLJ A;  3FNC A;  5LYL A;  1YK3 A;  3EXN A;  4AG9 A;  4NGN A;  3LAC A;  3WC6 A;  1YX0 A;  2ZEG A;  4MY0 A;  1F2O A;  1WWZ A;  2C1C A;  2XEF A;  4QUS A;  1CPX A;  4KVX A;  2ANP A;  4UFW A;  2ZW4 A;  3WC7 A;  5AGE A;  1YME A;  3WC5 A;  2B5G A;  2REF A;  1MJA A;  2RFH A;  4NEX A;  3LD2 A;  3WT4 A;  1Z4E A;  2GLF A;  2R98 A;  4NGP A;  5D8N A;  1XF8 A;  2FCK A;  3SXN A;  2Q7B A;  1F2P A;  2EWB A;  3KQZ A;  4MFZ A;  2P6G A;  3IO1 A;  4CGO A;  5HMN A;  3CDX A;  3TE4 A;  4C7I A;  1BAV A;  1X12 A;  1H8L A;  2PJ0 A;  4FD7 A;  3T9Y A;  1AMP A;  1SQH A;  4X8I A;  1XFO A;  3FF3 A;  2B4B A;  3BJ8 A;  1KUY A;  1Z5R A;  3LOD A;  4KZT A;  3G8W A;  2B3U A;  4UF4 A;  4II9 A;  2C27 A;  5EC4 A;  3F8K A;  3VWE A;  4CS0 B;  3KQX A;  2HB6 A;  3D8P A;  5HH1 A;  2ABZ A;  4WWV A;  4MHZ A;  4UIB A;  3PBB A;  4ONU A;  4A33 A;  4JWP A;  3KZW A;  2FE7 A;  4NGS A;  2QEC A;  1GHE A;  1DTD A;  2PJ6 A;  1YVK A;  1IOF A;  3R1K A;  4MXU A;  1S3Z A;  4EWT A;  3W6S A;  3D2M A;  4UFV A;  4MRI A;  4KOX A;  3RBU A;  4WJB A;  4UWI A;  2G3T A;  1IY7 A;  4FWU A;  4RUH A;  2PVV A;  2YNC A;  4OP4 A;  5K8M A;  4OC3 A;  2AFW A;  3B35 A;  3WR7 A;  2BL1 A;  2XEI A;  3FJU A;  4DYO A;  4RI1 A;  5HXD A;  2C6G A;  2PJ9 A;  2JDD A;  4OC0 A;  1LOK A;  2ZEP A;  4NF1 A;  3VAR A;  1PCA A;  3EO4 A;  2CNT A;  2B5G B;  2Q4V A;  4FD4 A;  1YSJ A;  2VEZ A;  1CG2 A;  4LX9 A;  2DXQ A;  1JWQ A;  2B3V A;  3H8G A;  4L8A A;  5AG7 A;  4C2Z A;  3K2K A;  4ORF A;  4Z65 A;  3IEH A;  1M4L A;  5ISV A;  4EFD A;  2CXA A;  1VHO A;  1UWY A;  4CPA A;  3KI9 A;  4P4E A;  1I1D A;  3DGV A;  2WSA A;  4IAV A;  4Q7A A;  5AG6 A;  1JQG A;  4JXQ A;  3E0K A;  4BD9 A;  4KSA A;  1Q7L A;  3SJG A;  4UEE A;  1KUX A;  1Z8L A;  4IK2 A;  3D2P A;  3NH5 A;  4U9Y A;  2Z3P A;  2NSM A;  5IV0 A;  4UEZ A;  3SI1 A;  2D4O A;  4YRH A;  1B6B A;  5G22 A;  1IYL A;  5C82 A;  5DWM A;  3VH9 A;  2ZEN A;  2VZY A;  2PIY A;  3CPX A;  5FVJ A;  1I21 A;  1R43 A;  3PB7 X;  3IGR A;  1CBX A;  3TFY A;  2PE3 A;  4MJ8 A;  4HKF A;  4YGO A;  5H86 A;  2J8M A;  3IWW A;  3TTH A;  1QST A;  2F7V A;  2JEV A;  4F8Z A;  3IIB A;  5AG5 A;  4CGN A;  3MN8 A;  2ZXV A;  2PJ7 A;  1YGH A;  4IUS A;  4R87 A;  3R95 A;  4C2X A;  3ZZI A;  1BPN A;  3ZJ0 A;  4OC2 A;  3LMS A;  3A9L A;  4GM5 A;  1OBR A;  3IFE A;  1Y0Y A;  3T8W A;  2Q4Z A;  2Y0M A;  4P44 A;  5F09 A;  2ZEE A;  4M6I A;  2R7H A;  3MRU A;  5CNP A;  1BPM A;  1CP7 A;  4KLV A;  2F5I A;  4Y49 B;  4IHM A;  1NMT A;  4PK3 A;  4CYN A;  2Z3K A;  2G3A A;  1XEB A;  3S9N A;  3DDD A;  3CXS A;  1PUA A;  3PRT A;  2QJ8 A;  3F0A A;  4NGR A;  2Z3O A;  2FL4 A;  3GB0 A;  5GCN A;  1FT7 A;  2GIV A;  1R3N A;  2YND A;  4GS4 A;  3IU1 A;  4NJR A;  4CAE A;  3RYO A;  4KUA A;  1XRY A;  4JZ0 A;  3QB8 A;  3DLJ A;  1YW4 A;  3FIX A;  2ARH A;  3ISZ A;  3VWD A;  2J8R A;  2HUZ A;  1BOB A;  1ARM A;  2HQY A;  3BI1 A;  3H5Z A;  3KAS A;  4B5O A;  1YRE A;  4FUU A;  4CYO A;  1NSL A;  1XE4 A;  2DPT A;  1VHE A;  3KR4 A;  1ZG9 A;  5AG4 A;  1TF9 A;  4OKO A;  5HVF A;  3B8G A;  3D7D A;  4JLY A;  2PSW A;  2J8N A;  2WPX A;  3TO6 A;  3JRU A;  4EVY A;  3FXT A;  2CIJ A;  2P6F A;  2PDO A;  4H89 A;  4NSQ A;  4F0X A;  3B2Y A;  2JBJ A;  2ZOF A;  4ZY1 A;  1AUG A;  1XMT A;  2GAN A;  3MGD A;  1IYK A;  4NGM A;  3RNZ A;  3SHP A;  3B3T A;  3PB9 X;  4KOS A;  4MI4 A;  3SJX A;  4CAF A;  3N5F A;  4PQA A;  4X2T A;  3PB6 X;  1ZG7 A;  3B7I A;  2EVN A;  2FIA A;  1TIQ A;  2XEJ A;  4OAE A;  4BMH A;  4UCM A;  4I49 A;  3SI2 A;  8CPA A;  3TOA A;  1ZLH A;  3FRM A;  3H8F A;  3KHZ A;  4A32 A;  4ZI6 A;  2GFQ A;  4XPD C;  2V8G A;  4HNY B;  2FVG A;  2AFM A;  4A37 A;  4F0Y A;  4P45 A;  1X10 A;  4XNH B;  3VAT A;  1CP6 A;  3RZA A;  3KR5 A;  1S7N A;  2AFO A;  2EUI A;  2HV2 A;  1XMB A;  3IWG A;  4CAX A;  5JGF A;  3SJE A;  2KCW A;  3R9E A;  2FXF A;  4FD6 A;  4O23 A;  1AYE A;  3KGQ A;  3D7H A;  2IL4 A;  2FIW A;  1YQE A;  1LFW A;  5LYI A;  4MCP A;  4FBE A;  4MHD A;  3PFE A;  3V38 A;  4KOR A;  1QMU A;  5THW A;  2OOT A;  2PJ4 A;  4PV6 A;  3PFO A;  1ON0 A;  4AG7 A;  4ZX9 A;  1FNO A;  1L0C A;  5G21 A;  3D7G A;  2OZH A;  4KOT A;  1V0C A;  1TKJ A;  3GUX A;  1BO4 A;  4F9U A;  4R3K A;  3T90 A;  4KOU A;  1EE3 P;  4ZY0 A;  2JDC A;  2VXK A;  1GYT A;  5J8F A;  5D29 A;  4KOW A;  4MHP A;  3LWU A;  3DNS A;  5LRK A;  1Z9U A;  4R6T A;  3EY5 A;  4KS9 A;  4ONW A;  1R57 A;  2V8V A;  1Y9K A;  2Z3L A;  4MFK A;  4NFR A;  1ZLI A;  2H5M A;  4ZBG A;  2Z3N A;  4M6H A;  3GIU A;  4UCN A;  2ZPA A;  2ATR A;  2PRQ A;  2ZW5 A;  2AFU A;  1XBU A;  1ARL A;  1DE4 C;  4P4I A;  4KOY A;  3D4U A;  1S7K A;  2BEI A;  5LRG A;  3JUW A;  1QSM A;  2O28 A;  2PRB A;  1NSA A;  1TKH A;  3D7F A;  3FBU A;  1Q2D A;  2OR4 A;  2RC4 A;  4KSI A;  1P4N A;  4E2A A;  1Q2C A;  1YLO A;  3FMC A;  4FD5 A;  4MFQ A;  5K8N A;  2IMO A;  3V8I A;  1HDU A;  2Z10 A;  3HLP A;  3JVN A;  3DR6 A;  1VIX A;  4AVB A;  1PYT B;  3QNV A;  4H2K A;  5E96 A;  3H8E A;  2PJA A;  2ZW7 A;  2BSW A;  4U9Z A;  1U6M A;  3PEI A;  1HDQ A;  3NFZ A;  4F6A A;  4DUK A;  3I3G A;  2WPW A;  4C2Y A;  3TCV A;  1Z4R A;  4CRZ B;  4KOV A;  4CRY B;  4M3S A;  4NGT A;  4OLL A;  4A2Z A;  7CPA A;  3S9M A;  5IB9 A;  4QVT A;  4PXE A;  4IF5 A;  5J8C A;  3RAM A;  2HC9 A;  1S5K A;  2JBK A;  4RN7 A;  4HNW B;  4E0A A;  2VL1 A;  3PGP A;  4PPZ A;  3PP9 A;  4Q38 A;  1RTQ A;  4HPS A;  4P4F A;  1ZG8 A;  1VHS A;  2QML A;  2PIZ A;  2Z0Z A;  3CXQ A;  4PK2 A;  4R76 A;  2EBJ A;  4UCP A;  4A38 A;  3I1U A;  1M4I A;  2NMT A;  1QSN A;  1VGY A;  2X7B A;  3EC4 A;  4KVM E;  1Y7R A;  4P4J A;  4UA3 A;  4UEF A;  4MCR A;  2ZW6 A;  4OAD A;  4UFX A;  4MHN A;  2C6P A;  2DF5 A;  3SI0 A;  2OB0 A;  4R9M A;  2P6E A;  2IJZ A;  2REE A;  1IID A;  1YVO A;  2PJ3 A;  1Y9W A;  4OC5 A;  1K4J A;  1QQ9 A;  3B3V A;  4W9Y A;  2YNC C;  2ZEH A;  3KKW A;  3R9G A;  3DSB A;  3N7Z A;  4A39 A;  4A94 A;  4PXD A;  2PJ8 A;  4CGL A;  2Q04 A;  2BCO A;  4YWY A;  2I00 A;  5I4M A;  1CM0 A;  5ELY A;  1Z2L A;  1M1D A;  3IWE A;  3S6G A;  4BBH A;  2PR1 A;  1F57 A;  4PSW A;  4JD6 A;  2V77 A;  3ISX A;  3BLN A;  2R8V A;  3TO7 A;  3BI0 A;  3IJ3 A;  3KHX A;  3GYA A;  5EBV A;  3H4Q A;  5CPA A;  5A27 A;  2O4H A;  3V7Z A;  1A2Z A;  3TO9 A;  2OU2 A;  4Y49 C;  4A30 A;  2PJC A;  2D4P A;  3NH8 A;  1IOI A;  5DS0 A;  1Q2Y A;  1TF8 A;  4MBU A;  5HVG A;  4L89 A;  3FEC A;  1HEE A;  2ZEF A;  2ZEO A;  3EFA A;  4PXC A;  2C6C A;  4MFP A;  1ZO0 A;  4KUB A;  4C68 A;  4B5P A;  3JTK A;  1YW6 A;  4XPK A;  2EO8 A;  5H84 A;  2Q44 A;  2ZEL A;  3B3S A;  4R3L A;  2BOA A;  3UY5 A;  3L2N A;  5C88 A;  3CXP A;  3NE8 A;  1NE9 A;  4H6U A;  4JXR A;  2CNS A;  3R96 A;  4UWJ A;  5G1Z A;  4X3R A;  4R7M A;  3PB8 X;  1M4G A;  2BO9 A;  4KLW A;  4RS2 A;  5F47 A;  1N71 A;  2AE6 A;  4YFJ A;  2XEG A;  3FX6 A;  3G3S A;  5CBM A;  5HVH A;  3NA6 A;  3S9L A;  2ZOG A;  1M4D A;  3PB4 X;  4G1P A;  3TT2 A;  1QSR A;  2AFX A;  1TKF A;  2O53 A;  1J4J A;  3IU2 A;  3K9U A;  2YGW A;  2PR8 A;  1S60 A;  3FH4 A;  4U5Y A;  4OC4 A;  3TC8 A;  4ZGY B;  1FY7 A;  5JPH A;  4R8F A;  3S6F A;  2PJ5 A;  2GU2 A;  3QAY A;  4J3G A;  3GY9 A;  4ZX8 A;  2B58 A;  4PSX A;  4R57 A;  3PZJ A;  4UBR A;  2F8H A;  3SXO A;  4P4D A;  4QB9 A;  5IX3 A;  1IGB A;  2QYV A;  1KUV A;  1XJO A;  4BIN A;  2B4D A;  1RXT A;  5K8O A;  4AXV A;  1S7L A;  2PJ1 A;  1LAM A;  4CAW A;  4CGP A;  5LYF A;  1TXR A;  3BXM A;  5DWN A;  4JJX A;  3CPA A;  3FVL A;  1MJB A;  1LCP A;  2VI7 A;  4M6G A;  4XNH C;  3FYN A;  2K5T A;  5LRJ A;  2VQY A;  5F49 A;  4CYQ A;  5K8P A;  2CY2 A;  2FT0 A;  4LUA A;  3TOB A;  2VZZ A;  1LRZ A;  3B3C A;  4B13 A;  3GKR A;  4JYW A;  1S7F A;  2OZG A;  3W91 A;  4OME A;  5JM6 A;  2Z3M A;  4K3N A;  4LQ6 A;  4B5P B;  2V8H A;  1VKC A;  2DEA A;  1MK4 A;  3S6H A;  2EK8 A;  2PQ8 A;  4AVA A;  3FED A;  4F9V A;  2R1I A;  1CJW A;  2ZED A;  4B10 A;  3SJF A;  1Y0R A;  4OC1 A;  2Q43 A;  3I9S A;  3BJ7 A;  1BLL E;  2Q0Y A;  2Q4Y A;  1Y7E A;  4B14 A;  2PVW A;  2ZEM A;  1RO5 A;  1XOV A;  4MCS A;  4A95 A;  3IC1 A;  4DNC A;  3CZX A;  2G9D A;  4P4B A;  5I0C A;  1XIX A;  2VBQ A;  2PJB A;  5IB0 A;  1IU8 A;  2POK A;  3B3W A;  2IQ6 A;  3D68 A;  4AB7 A;  3CT9 A;  2WUU A;  4ZY2 A;  1B87 A;  3R9F A;  1YLE A;  3QAH A;  4M85 A;  1Z8X A;  2QIR A;  5KTD A;  1OZP A;  3OWC A;  4HNX B;  1QSO A;  1IIC A;  4NCZ A;  2GRE A;  3D3S A;  2Z11 A;  2AFZ A;  2RB7 A;  2CF4 A;  5EMI A;  4DJL A;  1P0H A;  2YNE A;  2QVP A;  4X5K A;  3FB3 A;  4K30 A;  4E8O A;  4P10 A;  2J9A A;  2FSR A;  5KTC A;  1YR0 A;  5J1Q A;  2WZN A;  5BWA B;  1I12 A;  2B4D B;  4GXH A;  3P2F A;  4QC6 A;  3HUV A;  3W6X A;  4MY3 A;  2DPS A;  3WAB A;  4ZYQ A;  4B6Z A;  2CTC A;  6CPA A;  3KL9 A;  1CPS A;  1MJ9 A;  2ODF A;  3NH4 A;  2WYR A;  4KSF A;  4TWE A;  1Z8T A;  4FAI A;  2FS5 A;  2PC1 A;  3F5B A;  1KWM A;  3DR8 A;  3FEE A;  4OIW A;  4MMO A; 
#chains in the Genus database with same CATH homology
 1UFH A;  4H6Z A;  1WK4 A;  3P2H A;  5JQ4 A;  4AVC A;  2CNM A;  1KZF A;  2AJ6 A;  2G0B A;  3S6K A;  4CGM A;  2JLM A;  2A4N A;  4Q36 A;  4B11 A;  4A31 A;  3NE7 A;  4KVO E;  4QBJ A;  4NXY A;  4MFJ A;  2GE3 A;  2P0W A;  4CAV A;  4B12 A;  4C7H A;  4CYP A;  5A28 A;  2I79 A;  1M44 A;  4XPD B;  2OZU A;  4XPL A;  4MFL A;  5F48 A;  5KTA A;  1PU9 A;  2OH1 A;  5F46 A;  2BUE A;  5G20 A;  3C26 A;  3FNC A;  1IB1 E;  1YK3 A;  3EXN A;  4AG9 A;  1YX0 A;  4MY0 A;  1WWZ A;  4QUS A;  4KVX A;  4UFW A;  2ZW4 A;  5AGE A;  2B5G A;  2REF A;  1MJA A;  4NEX A;  3LD2 A;  1Z4E A;  2R98 A;  1XF8 A;  2FCK A;  3SXN A;  2Q7B A;  4MFZ A;  2P6G A;  4CGO A;  5HMN A;  3TE4 A;  4C7I A;  4FD7 A;  3T9Y A;  1SQH A;  2B4B A;  3BJ8 A;  1KUY A;  3LOD A;  4KZT A;  3G8W A;  2B3U A;  4II9 A;  2C27 A;  5EC4 A;  3F8K A;  3VWE A;  4CS0 B;  5HH1 A;  3D8P A;  4ONU A;  4A33 A;  4JWP A;  2FE7 A;  2QEC A;  1GHE A;  1YVK A;  3R1K A;  1S3Z A;  3W6S A;  3D2M A;  4UFV A;  4KOX A;  4UWI A;  2G3T A;  2YNC A;  3WR7 A;  2BL1 A;  4RI1 A;  2JDD A;  4NF1 A;  3EO4 A;  2CNT A;  2B5G B;  2Q4V A;  4FD4 A;  2VEZ A;  4LX9 A;  2DXQ A;  2B3V A;  4L8A A;  5AG7 A;  4C2Z A;  4ORF A;  5ISV A;  2CXA A;  1I1D A;  2WSA A;  5AG6 A;  4JXQ A;  3E0K A;  4KSA A;  1KUX A;  3D2P A;  4U9Y A;  2Z3P A;  5IV0 A;  2D4O A;  4YRH A;  1B6B A;  5G22 A;  1IYL A;  5C82 A;  5DWM A;  2VZY A;  5FVJ A;  1I21 A;  3IGR A;  3TFY A;  4MJ8 A;  4HKF A;  4YGO A;  5H86 A;  2J8M A;  3TTH A;  1QST A;  2JEV A;  4CGN A;  5AG5 A;  2ZXV A;  1YGH A;  4IUS A;  4R87 A;  3R95 A;  4C2X A;  3ZZI A;  3ZJ0 A;  3A9L A;  2Y0M A;  2R7H A;  5CNP A;  4KLV A;  2F5I A;  4Y49 B;  1NMT A;  4PK3 A;  4CYN A;  2Z3K A;  2G3A A;  1XEB A;  3DDD A;  3CXS A;  1PUA A;  3F0A A;  2Z3O A;  2FL4 A;  5GCN A;  2GIV A;  2YND A;  4GS4 A;  3IU1 A;  4CAE A;  3RYO A;  4KUA A;  3QB8 A;  3FIX A;  2ARH A;  3VWD A;  2J8R A;  2HUZ A;  1BOB A;  3H5Z A;  2HQY A;  4B5O A;  4CYO A;  1YRE A;  1NSL A;  1XE4 A;  2DPT A;  5AG4 A;  3B8G A;  4JLY A;  2PSW A;  2J8N A;  2WPX A;  3TO6 A;  4EVY A;  3FXT A;  2P6F A;  2PDO A;  4H89 A;  4NSQ A;  4F0X A;  1XMT A;  2GAN A;  3MGD A;  1IYK A;  3SHP A;  4KOS A;  4CAF A;  4MI4 A;  2EVN A;  2FIA A;  1TIQ A;  4OAE A;  4BMH A;  4UCM A;  4I49 A;  3TOA A;  3FRM A;  4A32 A;  4XPD C;  4HNY B;  4F0Y A;  4XNH B;  4CAX A;  1S7N A;  2HV2 A;  2EUI A;  3IWG A;  2KCW A;  3R9E A;  2FXF A;  4FD6 A;  2IL4 A;  2FIW A;  4MHD A;  4KOR A;  4PV6 A;  1ON0 A;  4AG7 A;  1L0C A;  5G21 A;  2OZH A;  4KOT A;  1V0C A;  1BO4 A;  4R3K A;  3T90 A;  4KOU A;  2JDC A;  2VXK A;  5J8F A;  4KOW A;  3DNS A;  1Z9U A;  3EY5 A;  4KS9 A;  1R57 A;  2Z3L A;  1Y9K A;  4MFK A;  4ZBG A;  2H5M A;  2Z3N A;  4UCN A;  2ZPA A;  2ATR A;  2ZW5 A;  4KOY A;  1S7K A;  2BEI A;  3JUW A;  1QSM A;  2O28 A;  2PRB A;  3FBU A;  1Q2D A;  2RC4 A;  4E2A A;  1P4N A;  1Q2C A;  4MFQ A;  4FD5 A;  3V8I A;  2Z10 A;  3JVN A;  3DR6 A;  4AVB A;  5E96 A;  2ZW7 A;  2BSW A;  4U9Z A;  1U6M A;  4F6A A;  3I3G A;  2WPW A;  4C2Y A;  3TCV A;  1Z4R A;  4CRZ B;  4KOV A;  4CRY B;  4M3S A;  4OLL A;  4A2Z A;  4QVT A;  4IF5 A;  5J8C A;  1S5K A;  4HNW B;  4E0A A;  3PGP A;  3PP9 A;  4Q38 A;  1VHS A;  2QML A;  2Z0Z A;  3CXQ A;  4PK2 A;  4UCP A;  1M4I A;  2NMT A;  1QSN A;  2X7B A;  3EC4 A;  4KVM E;  1Y7R A;  4UA3 A;  4UFX A;  4OAD A;  2ZW6 A;  2OB0 A;  4R9M A;  2P6E A;  2REE A;  1IID A;  1YVO A;  1Y9W A;  1K4J A;  2YNC C;  3KKW A;  3R9G A;  3DSB A;  3N7Z A;  4CGL A;  2Q04 A;  2I00 A;  1CM0 A;  1M1D A;  3IWE A;  3S6G A;  4BBH A;  2PR1 A;  4PSW A;  4JD6 A;  3BLN A;  2R8V A;  3TO7 A;  3GYA A;  5EBV A;  3H4Q A;  5A27 A;  3TO9 A;  2OU2 A;  4Y49 C;  4A30 A;  2D4P A;  1Q2Y A;  4MBU A;  4L89 A;  3EFA A;  4MFP A;  1ZO0 A;  4KUB A;  4C68 A;  4B5P A;  3JTK A;  4XPK A;  5H84 A;  2Q44 A;  4R3L A;  3UY5 A;  5C88 A;  3CXP A;  4H6U A;  1NE9 A;  4JXR A;  2CNS A;  3R96 A;  4UWJ A;  5G1Z A;  1M4G A;  4KLW A;  4RS2 A;  5F47 A;  1N71 A;  2AE6 A;  4YFJ A;  3G3S A;  1M4D A;  3TT2 A;  1QSR A;  3K9U A;  1J4J A;  3IU2 A;  2YGW A;  2PR8 A;  1S60 A;  4U5Y A;  5JPH A;  4ZGY B;  1FY7 A;  3S6F A;  4J3G A;  3GY9 A;  2B58 A;  4PSX A;  4R57 A;  3PZJ A;  4UBR A;  5IX3 A;  3SXO A;  4QB9 A;  1KUV A;  2B4D A;  1RXT A;  1S7L A;  4CAW A;  4CGP A;  5DWN A;  4JJX A;  1MJB A;  4XNH C;  2VI7 A;  3FYN A;  2K5T A;  2VQY A;  5F49 A;  4CYQ A;  2CY2 A;  2FT0 A;  4LUA A;  3TOB A;  2VZZ A;  1LRZ A;  4B13 A;  3GKR A;  1S7F A;  2OZG A;  3W91 A;  2Z3M A;  4B5P B;  1VKC A;  1MK4 A;  3S6H A;  2PQ8 A;  4AVA A;  2R1I A;  1CJW A;  4B10 A;  3I9S A;  3BJ7 A;  4B14 A;  2Q0Y A;  2Q4Y A;  1RO5 A;  4A95 A;  4DNC A;  5I0C A;  1XIX A;  2VBQ A;  5IB0 A;  4AB7 A;  3R9F A;  2WUU A;  1B87 A;  1YLE A;  3QAH A;  4M85 A;  2QIR A;  5KTD A;  4HNX B;  1OZP A;  3OWC A;  1QSO A;  1IIC A;  4NCZ A;  3D3S A;  2Z11 A;  1P0H A;  2YNE A;  4X5K A;  3FB3 A;  4K30 A;  4E8O A;  2FSR A;  5KTC A;  1YR0 A;  5BWA B;  1I12 A;  2B4D B;  3P2F A;  4QC6 A;  3W6X A;  4MY3 A;  2DPS A;  1MJ9 A;  4KSF A;  2FS5 A;  2PC1 A;  3F5B A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...