4M6HA

Structure of the reduced, metal-free form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
190
Chain Sequence
IAGMVVFIDPGHNGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan Amidase Rv3717
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 75
structure length 190
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6hA00
1JWQA 3NE8A 4M6HA 4M6GA 5EMIA 4LQ6A 3CZXA 4BINA 2Q7SA 3QAYA 2ODFA 4M6IA 4RN7A 1XOVA
chains in the Genus database with same CATH superfamily
4XPLA 3SJGA 5G21A 3D8PA 2ZEDA 4CGNA 5K8NA 1XMTA 4K30A 1Z4EA 3D67A 1Z8LA 4KOWA 4R3KA 2REFA 3LODA 5THWA 3FBUA 3LWUA 3PFOA 4OC4A 4CRYB 2J8RA 4B10A 1Z9UA 3H8GA 4JXRA 3UY5A 5J8CA 2PRQA 2G3AA 2ZEHA 3SI0A 3WC7A 1YW6A 5JQ4A 2ZENA 1OBRA 2JDCA 3BLNA 1M4GA 2J8MA 2ODFA 4Q38A 3IWWA 1CM0A 3JRUA 4UBRA 3VH9A 2HB6A 2WYRA 4Q7AA 2X7BA 4RS2A 4ZX9A 3WC5A 5K8PA 4PSXA 1ON0A 1FT7A 4KORA 2NYQA 5LYDA 4B12A 2AFUA 2AE6A 4A37A 1PU9A 1BLLE 1CG2A 3KASA 5HVGA 3F5BA 1YGHA 3A9LA 2FT0A 2REEA 2CNMA 4A38A 3BI1A 2FXFA 2ZEEA 1DE4C 2OZUA 3OWCA 5IX3A 4UCMA 1KUVA 4I49A 4ONWA 1QSOA 5ISVA 3FNCA 3VWEA 4A94A 2JEWA 3BHXA 5F46A 4ONUA 4UWIA 4Y49C 3TO9A 4KZTA 2PCUA 2I79A 2PJAA 5I4MA 4BINA 5EC4A 4NGMA 2V77A 3SXOA 5GCNA 2R7HA 3G8WA 3D2MA 2C6CA 2JLMA 1ELMP 2RFHA 1GHEA 3DDDA 3B3CA 5LRJA 2Z3PA 1Y0YA 3BI0A 5HMNA 1SQHA 2B3UA 1CP6A 3IU1A 3KHXA 1ELLP 4MXUA 1EE3P 4KSFA 5AG5A 3S9NA 3IU2A 3FMCA 4CYNA 2KCWA 2CIJA 4X8IA 1MJBA 1IICA 4J3GA 4ZX8A 4NXYA 2PR8A 1YW4A 2FSRA 4HNWB 5DWMA 4B11A 2FCKA 3G3SA 1Q7LA 2Z3NA 2BCOA 3ISXA 2CTBA 3GUXA 4B5OA 2CNTA 1IOFA 1YR0A 2CY2A 2BOAA 4XPDC 4UFVA 1VHSA 4UCNA 1BO4A 1F2PA 2G0BA 2ARHA 4OLLA 2QMLA 1YSJA 3GYAA 1YK3A 4EWTA 4YRHA 4OP4A 2Q4YA 1R3NA 3MGDA 1A2ZA 1CPXA 3T90A 4LX9A 1LAPA 1Z2LA 1QMUA 3C26A 3D4UA 3RZAA 2PJ5A 2EK9A 2QJ8A 2ZEPA 4NEXA 2WPXA 3R96A 2GFQA 2EWBA 1K4JA 1AMPA 2YNCA 1YLEA 2Z11A 2ZXVA 3IJ3A 3NH4A 2WUUA 2B4DB 1IB1E 3FJUA 4UIAA 5H84A 2G9DA 1U6MA 4IUSA 5J8FA 4DYOA 3SJXA 4CGPA 2RC4A 2NSMA 1VHOA 1Z8XA 4A39A 4ZYQA 4UEEA 2AJ6A 3D3SA 4OC5A 1HDUA 2Z3KA 1AUGA 1MJ9A 3D7GA 2WSAA 3PB7X 1X10A 3FXTA 1XF8A 2D4PA 3SI2A 2ANPA 4AVCA 4P4JA 1ZO0A 1BPNA 3R9FA 1Z8WA 1B6BA 4CAWA 3D68A 4E8OA 4CYOA 3CPXA 1XE4A 4PQAA 4O23A 4NGTA 4M6HA 1JQGA 2G3TA 2YGWA 4LUAA 4MFJA 4HNXB 5F09A 2ZELA 4GM5A 1PYTB 4KOTA 3S6FA 1LAMA 4FWUA 1HEEA 4HPSA 4JD6A 1Q2DA 3P2HA 4R3LA 4KUBA 4RN7A 4CS0B 1NMTA 1RTQA 5G1ZA 4E2AA 4OC2A 5E96A 4OC0A 1QSNA 1Z5RA 2PJ6A 2PJ0A 1WK4A 1BOBA 2VXKA 3FX6A 1S3ZA 1XRYA 3D7DA 1IIDA 2R98A 3I9SA 4NF1A 2PSWA 4FAIA 3FIXA 4MHNA 4CYQA 4PV6A 1Q2YA 4B14A 1LFWA 5AG6A 3PZJA 3SI1A 4DUKA 4F8ZA 2FIAA 2ATRA 3D7HA 5DS0A 1M44A 5CNPA 4KVXA 3QAHA 4JXQA 1BPMA 3BJ8A 1ZG7A 1XJOA 2VQYA 4OIDA 1UFHA 5DWNA 1ZLIA 5K8MA 4CPAA 5LYFA 4F9UA 3H8FA 1VIXA 4P4EA 4A32A 2Q44A 1PUAA 4UWJA 4XPDB 3CT9A 5EMIA 3CXSA 2F5IA 4YU9A 2AFSA 2PE3A 3B3TA 3CXPA 1J4JA 1TF8A 3LD2A 3FEEA 4FD7A 2CXAA 4WWVA 4CAVA 1Y9WA 2JBJA 5HXDA 1I12A 1KZFA 4NGNA 4DNCA 4PXCA 2C27A 1CP7A 4JJXA 4MRIA 3TOBA 4F0XA 4UF4A 2D4OA 2A4NA 3QB8A 4P6YA 3CPAA 4MY0A 4P45A 3FYNA 3WT4A 4KOUA 4FD6A 4GS4A 2XEFA 1XEBA 1QSTA 4PK2A 2AFXA 4BBHA 2JBKA 3B3SA 2CTCA 4KUAA 2IL4A 2QYVA 2ZEMA 4MFPA 3W91A 5EBVA 2ZEFA 3GIUA 2DXQA 2C6GA 2BL1A 2DEAA 2F7VA 3DGVA 3VARA 4ZY2A 1I21A 3GKRA 2AFOA 2Q04A 2OZHA 3K2KA 3PB6X 4B5PA 3TX8A 5JM6A 1QSMA 3KR4A 3KL9A 5KTDA 3WABA 1XIXA 3F8KA 3GB0A 4HNYB 3B3WA 4UFXA 3FB3A 4YWYA 4NGQA 2PJ3A 2VEZA 3R1KA 3CDXA 3N5FA 4U9ZA 2VZZA 3PP9A 3T9YA 2Z3LA 4PXDA 3EO4A 3CZXA 1I1DA 4Z65A 2OU2A 4R57A 1N71A 5F47A 1TF9A 2Q7BA 3NH8A 1P0HA 4C2ZA 5LRGA 2DF5A 2FL4A 5IB0A 4MBUA 3B35A 2F8HA 1X12A 2Q0YA 4H89A 1CBXA 3IC1A 4NJQA 4PSWA 1F57A 4BD9A 2EBJA 5JH9A 4LQ6A 5AG4A 4JZ0A 3V7ZA 4RUHA 2B3VA 3DNSA 1IOIA 2ZW6A 1Y7EA 1PCAA 4EMEA 2AFZA 1S7FA 4R7MA 2BO9A 3TFYA 4MFZA 3TT2A 3EFAA 3PEIA 5JGFA 4QC6A 3L2NA 4IF5A 1R57A 3GY9A 1VGYA 3KI9A 4ORFA 2ZPAA 2B4BA 2YNEA 1Y0RA 1M1DA 2PIYA 3DLJA 3RAMA 3S9LA 1Z8TA 2I3CA 4B6ZA 2R1IA 3TCVA 1XBUA 5IV0A 4QBJA 1NE9A 2XEJA 4P10A 4E0AA 4PPZA 2OR4A 4ZBGA 2EUIA 4C2XA 3GLJA 4A33A 4CAXA 3IFEA 4CAFA 3PBEA 4M85A 2V8VA 2B5GA 2ZOFA 1F2OA 4AB7A 4EVYA 2B58A 2P0WA 2BUEA 3KGQA 4ZY1A 4X3RA 3R95A 3TE4A 2HV2A 3TC8A 1Z4RA 3F0AA 4G1PA 3QAYA 5LYIA 2EVNA 4JLYA 1RXTA 3S6GA 2FE7A 4P4BA 4YFJA 2CF4A 1P4NA 2Q43A 4U5YA 4XPKA 3WC6A 3ZJ0A 2EO8A 1Y9KA 2Z3OA 1IGBA 4MHYA 4FBEA 3W6SA 3LACA 4A30A 3FF3A 3BXMA 3EXNA 5AG7A 3R9GA 2BEIA 2PJ4A 4MCPA 4P4DA 3D66A 4FD4A 2PJ7A 4H2KA 5CPAA 4KVME 4UCPA 2V8HA 2PJ1A 4CGMA 1B87A 3PBBA 1LRZA 2IJZA 1TXRA 1QSRA 2O53A 3H8EA 2RB7A 4EFDA 5BWAB 2HC9A 2PJ9A 4AXVA 4R9MA 3R9EA 3SJFA 1YLOA 4F6AA 1S7LA 2IQ6A 4H6UA 3KZWA 2GU2A 4RI1A 3RYOA 4PXEA 2Z0ZA 4CGLA 4OAEA 1NSLA 1S7NA 4OC1A 2ZW4A 2Q51A 4MCQA 1GYTA 5LYLA 3IIBA 2CNSA 3NE8A 2HUZA 1ARLA 3PB4X 4FD5A 2J8NA 3FRMA 4UEZA 2PIZA 2PVWA 4TNUA 3W6XA 2PC1A 1VHEA 1YX0A 4B13A 3MRUA 4R76A 2B5GB 1H8LA 3CXQA 2J9AA 3KQZA 4YGOA 1V0CA 1WWZA 1HDQA 4MJ8A 5HVFA 4KS9A 4OIWA 4AVAA 1JWQA 7CPAA 3BJ7A 3D2PA 3IO1A 3SJEA 4LQGA 3RNZA 2Q4VA 3EY5A 4C68A 1CJWA 4MHPA 4Q36A 2WZNA 3QNVA 4AVBA 4CRZB 5CBMA 5JPHA 3IWEA 2VBQA 4MMOA 2DPTA 2Q7SA 6CPAA 4UIBA 4PXBA 4M6IA 4C7IA 2GANA 4IAVA 2O28A 4KOSA 3DR6A 4NGRA 1CPSA 1MJAA 4U9YA 2O4HA 1OZPA 5HVHA 3FH4A 4CYPA 3B7IA 2GE3A 4MY3A 4NGSA 2FS5A 3IWGA 3ZZIA 1LCPA 1ZG8A 4M3SA 4MFQA 2PR1A 1KWMA 3I1UA 4R8FA 3VWDA 1TKJA 2QIRA 1DTDA 2P6EA 3KHZA 3NH5A 4XNHC 1KUYA 4ZI6A 1BAVA 4TWEA 4KSIA 5HH1A 2BSWA 2PVVA 3JUWA 4WJBA 4KOYA 1AYEA 4MI4A 1LANA 2ZEGA 2EK8A 2VL1A 3P2FA 2PJBA 4FUUA 4F0YA 3N7ZA 4MHZA 4IK2A 4MFLA 1FNOA 2B4DA 4AG9A 2OB0A 3T8WA 1TKHA 4IHMA 3NFZA 4AG7A 4MFKA 3NA6A 2YNCC 4NGPA 3EC4A 1Y7RA 3JTKA 4P44A 4P4FA 4MCRA 4MCSA 4R87A 3NE7A 3DR8A 2JDDA 3FEDA 8CPAA 1YVKA 4OMEA 4C7HA 3H5ZA 1YQEA 4KSAA 1YVOA 2FVGA 1ZLHA 3D7FA 4OADA 3TOAA 5I0CA 4F9VA 1L0CA 2PJCA 4OKOA 3PB9X 3WR7A 1IY7A 1LOKA 5K8OA 5G22A 5D8NA 4L8AA 5A28A 2PJ8A 1RO5A 1YMEA 5C82A 4BMHA 2Q4ZA 4NFRA 5C88A 4OC3A 4P4IA 1XMBA 3MN8A 2K5TA 3E0KA 4W9YA 3FECA 1M4LA 2WPWA 1XOVA 3S9MA 2R8VA 4MHDA 3V38A 3K9UA 1TIQA 4X5KA 2I00A 2ZW7A 2C1CA 4CGOA 5A27A 1NSAA 3KKWA 2ZW5A 2XEGA 1FY7A 2VZYA 4QUSA 3B3VA 3TO6A 2H5MA 5ELYA 2P6FA 4NCZA 2PRBA 1M4DA 5FVJA 2OOTA 3B2YA 4UFWA 2FIWA 3H4QA 3PB8X 4QB9A 3I3GA 1MK4A 4B5PB 3TO7A 1R43A 5H86A 4UEFA 3SXNA 3HLPA 1QQ9A 2XEIA 4K3NA 1IU8A 1S60A 4GXHA 1Q2CA 4M6GA 4KOVA 2Z10A 2VI7A 2Y0MA 2PDOA 2QECA 3S6KA 2AFMA 2ZEOA 1YREA 2GLFA 2POKA 4CAEA 3SHPA 2AFWA 4JYWA 4ZY0A 3KQXA 2GREA 2HQYA 4KLVA 4DJLA 3PFEA 4R6TA 3PRTA 3FVLA 1ZG9A 2QVPA 4JWPA 5F48A 2GIVA 4KLWA 5KTAA 4KOXA 4II9A 1UWYA 4UA3A 2C6PA 5J1QA 1M4IA 4A2ZA 4XNHB 5AGEA 3RO0A 1CX8A 2DPSA 3HUVA 5F49A 2P6GA 3ISZA 3B8GA 4A31A 5LRKA 1TKFA 2PQ8A 1ARMA 3TTHA 2JEVA 5D29A 5IB9A 3LMSA 2IMOA 4KVOE 4PK3A 4H6ZA 2ABZA 2OH1A 5G20A 4NJRA 2ZOGA 3KR5A 4Y49B 2NMTA 3V8IA 3S6HA 2Z3MA 2V8GA 1XFOA 1VKCA 2OZGA 3IGRA 3VATA 4C2YA 1S5KA 4X2TA 2GLJA 3K9TA 2YNDA 1IYLA 4QVTA 3RBUA 4ZGYB 4A95A 5KTCA 3PGPA 1IYKA 4L89A 3JVNA 4HKFA 3DSBA 2V8DA 3IEHA 2PJ2A 1S7KA 4NSQA 1KUXA
chains in the Genus database with same CATH topology
2HB6A 2HC9A 1JWQA 3NE8A 4M6HA 4M6GA 5EMIA 4LQ6A 3CZXA 4BINA 2Q7SA 3QAYA 2ODFA 4M6IA 4RN7A 1XOVA 4EFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWQ A;  3NE8 A;  4M6H A;  4M6G A;  5EMI A;  4LQ6 A;  3CZX A;  4BIN A;  2Q7S A;  3QAY A;  2ODF A;  4M6I A;  4RN7 A;  1XOV A; 
#chains in the Genus database with same CATH topology
 4XPL A;  3SJG A;  5G21 A;  3D8P A;  2ZED A;  4CGN A;  5K8N A;  1XMT A;  4K30 A;  1Z4E A;  3D67 A;  1Z8L A;  4KOW A;  4R3K A;  2REF A;  3LOD A;  5THW A;  3FBU A;  3LWU A;  3PFO A;  4OC4 A;  4CRY B;  2J8R A;  4B10 A;  1Z9U A;  3H8G A;  4JXR A;  3UY5 A;  5J8C A;  2PRQ A;  2G3A A;  2ZEH A;  3SI0 A;  3WC7 A;  1YW6 A;  5JQ4 A;  2ZEN A;  1OBR A;  2JDC A;  3BLN A;  1M4G A;  2J8M A;  2ODF A;  4Q38 A;  3IWW A;  1CM0 A;  3JRU A;  4UBR A;  3VH9 A;  2HB6 A;  2WYR A;  4Q7A A;  2X7B A;  4RS2 A;  4ZX9 A;  3WC5 A;  5K8P A;  4PSX A;  1ON0 A;  1FT7 A;  4KOR A;  2NYQ A;  5LYD A;  4B12 A;  2AFU A;  2AE6 A;  4A37 A;  1PU9 A;  1BLL E;  1CG2 A;  3KAS A;  5HVG A;  3F5B A;  1YGH A;  3A9L A;  2FT0 A;  2REE A;  2CNM A;  4A38 A;  3BI1 A;  2FXF A;  2ZEE A;  1DE4 C;  2OZU A;  3OWC A;  5IX3 A;  4UCM A;  1KUV A;  4I49 A;  4ONW A;  1QSO A;  5ISV A;  3FNC A;  3VWE A;  4A94 A;  2JEW A;  3BHX A;  5F46 A;  4ONU A;  4UWI A;  4Y49 C;  3TO9 A;  4KZT A;  2PCU A;  2I79 A;  2PJA A;  5I4M A;  4BIN A;  5EC4 A;  4NGM A;  2V77 A;  3SXO A;  5GCN A;  2R7H A;  3G8W A;  3D2M A;  2C6C A;  2JLM A;  1ELM P;  2RFH A;  1GHE A;  3DDD A;  3B3C A;  5LRJ A;  2Z3P A;  1Y0Y A;  3BI0 A;  5HMN A;  1SQH A;  2B3U A;  1CP6 A;  3IU1 A;  3KHX A;  1ELL P;  4MXU A;  1EE3 P;  4KSF A;  5AG5 A;  3S9N A;  3IU2 A;  3FMC A;  4CYN A;  2KCW A;  2CIJ A;  4X8I A;  1MJB A;  1IIC A;  4J3G A;  4ZX8 A;  4NXY A;  2PR8 A;  1YW4 A;  2FSR A;  4HNW B;  5DWM A;  4B11 A;  2FCK A;  3G3S A;  1Q7L A;  2Z3N A;  2BCO A;  3ISX A;  2CTB A;  3GUX A;  4B5O A;  2CNT A;  1IOF A;  1YR0 A;  2CY2 A;  2BOA A;  4XPD C;  4UFV A;  1VHS A;  4UCN A;  1BO4 A;  1F2P A;  2G0B A;  2ARH A;  4OLL A;  2QML A;  1YSJ A;  3GYA A;  1YK3 A;  4EWT A;  4YRH A;  4OP4 A;  2Q4Y A;  1R3N A;  3MGD A;  1A2Z A;  1CPX A;  3T90 A;  4LX9 A;  1LAP A;  1Z2L A;  1QMU A;  3C26 A;  3D4U A;  3RZA A;  2PJ5 A;  2EK9 A;  2QJ8 A;  2ZEP A;  4NEX A;  2WPX A;  3R96 A;  2GFQ A;  2EWB A;  1K4J A;  1AMP A;  2YNC A;  1YLE A;  2Z11 A;  2ZXV A;  3IJ3 A;  3NH4 A;  2WUU A;  2B4D B;  1IB1 E;  3FJU A;  4UIA A;  5H84 A;  2G9D A;  1U6M A;  4IUS A;  5J8F A;  4DYO A;  3SJX A;  4CGP A;  2RC4 A;  2NSM A;  1VHO A;  1Z8X A;  4A39 A;  4ZYQ A;  4UEE A;  2AJ6 A;  3D3S A;  4OC5 A;  1HDU A;  2Z3K A;  1AUG A;  1MJ9 A;  3D7G A;  2WSA A;  3PB7 X;  1X10 A;  3FXT A;  1XF8 A;  2D4P A;  3SI2 A;  2ANP A;  4AVC A;  4P4J A;  1ZO0 A;  1BPN A;  3R9F A;  1Z8W A;  1B6B A;  4CAW A;  3D68 A;  4E8O A;  4CYO A;  3CPX A;  1XE4 A;  4PQA A;  4O23 A;  4NGT A;  4M6H A;  1JQG A;  2G3T A;  2YGW A;  4LUA A;  4MFJ A;  4HNX B;  5F09 A;  2ZEL A;  4GM5 A;  1PYT B;  4KOT A;  3S6F A;  1LAM A;  4FWU A;  1HEE A;  4HPS A;  4JD6 A;  1Q2D A;  3P2H A;  4R3L A;  4KUB A;  4RN7 A;  4CS0 B;  1NMT A;  1RTQ A;  5G1Z A;  4E2A A;  4OC2 A;  5E96 A;  4OC0 A;  1QSN A;  1Z5R A;  2PJ6 A;  2PJ0 A;  1WK4 A;  1BOB A;  2VXK A;  3FX6 A;  1S3Z A;  1XRY A;  3D7D A;  1IID A;  2R98 A;  3I9S A;  4NF1 A;  2PSW A;  4FAI A;  3FIX A;  4MHN A;  4CYQ A;  4PV6 A;  1Q2Y A;  4B14 A;  1LFW A;  5AG6 A;  3PZJ A;  3SI1 A;  4DUK A;  4F8Z A;  2FIA A;  2ATR A;  3D7H A;  5DS0 A;  1M44 A;  5CNP A;  4KVX A;  3QAH A;  4JXQ A;  1BPM A;  3BJ8 A;  1ZG7 A;  1XJO A;  2VQY A;  4OID A;  1UFH A;  5DWN A;  1ZLI A;  5K8M A;  4CPA A;  5LYF A;  4F9U A;  3H8F A;  1VIX A;  4P4E A;  4A32 A;  2Q44 A;  1PUA A;  4UWJ A;  4XPD B;  3CT9 A;  5EMI A;  3CXS A;  2F5I A;  4YU9 A;  2AFS A;  2PE3 A;  3B3T A;  3CXP A;  1J4J A;  1TF8 A;  3LD2 A;  3FEE A;  4FD7 A;  2CXA A;  4WWV A;  4CAV A;  1Y9W A;  2JBJ A;  5HXD A;  1I12 A;  1KZF A;  4NGN A;  4DNC A;  4PXC A;  2C27 A;  1CP7 A;  4JJX A;  4MRI A;  3TOB A;  4F0X A;  4UF4 A;  2D4O A;  2A4N A;  3QB8 A;  4P6Y A;  3CPA A;  4MY0 A;  4P45 A;  3FYN A;  3WT4 A;  4KOU A;  4FD6 A;  4GS4 A;  2XEF A;  1XEB A;  1QST A;  4PK2 A;  2AFX A;  4BBH A;  2JBK A;  3B3S A;  2CTC A;  4KUA A;  2IL4 A;  2QYV A;  2ZEM A;  4MFP A;  3W91 A;  5EBV A;  2ZEF A;  3GIU A;  2DXQ A;  2C6G A;  2BL1 A;  2DEA A;  2F7V A;  3DGV A;  3VAR A;  4ZY2 A;  1I21 A;  3GKR A;  2AFO A;  2Q04 A;  2OZH A;  3K2K A;  3PB6 X;  4B5P A;  3TX8 A;  5JM6 A;  1QSM A;  3KR4 A;  3KL9 A;  5KTD A;  3WAB A;  1XIX A;  3F8K A;  3GB0 A;  4HNY B;  3B3W A;  4UFX A;  3FB3 A;  4YWY A;  4NGQ A;  2PJ3 A;  2VEZ A;  3R1K A;  3CDX A;  3N5F A;  4U9Z A;  2VZZ A;  3PP9 A;  3T9Y A;  2Z3L A;  4PXD A;  3EO4 A;  3CZX A;  1I1D A;  4Z65 A;  2OU2 A;  4R57 A;  1N71 A;  5F47 A;  1TF9 A;  2Q7B A;  3NH8 A;  1P0H A;  4C2Z A;  5LRG A;  2DF5 A;  2FL4 A;  5IB0 A;  4MBU A;  3B35 A;  2F8H A;  1X12 A;  2Q0Y A;  4H89 A;  1CBX A;  3IC1 A;  4NJQ A;  4PSW A;  1F57 A;  4BD9 A;  2EBJ A;  5JH9 A;  4LQ6 A;  5AG4 A;  4JZ0 A;  3V7Z A;  4RUH A;  2B3V A;  3DNS A;  1IOI A;  2ZW6 A;  1Y7E A;  1PCA A;  4EME A;  2AFZ A;  1S7F A;  4R7M A;  2BO9 A;  3TFY A;  4MFZ A;  3TT2 A;  3EFA A;  3PEI A;  5JGF A;  4QC6 A;  3L2N A;  4IF5 A;  1R57 A;  3GY9 A;  1VGY A;  3KI9 A;  4ORF A;  2ZPA A;  2B4B A;  2YNE A;  1Y0R A;  1M1D A;  2PIY A;  3DLJ A;  3RAM A;  3S9L A;  1Z8T A;  2I3C A;  4B6Z A;  2R1I A;  3TCV A;  1XBU A;  5IV0 A;  4QBJ A;  1NE9 A;  2XEJ A;  4P10 A;  4E0A A;  4PPZ A;  2OR4 A;  4ZBG A;  2EUI A;  4C2X A;  3GLJ A;  4A33 A;  4CAX A;  3IFE A;  4CAF A;  3PBE A;  4M85 A;  2V8V A;  2B5G A;  2ZOF A;  1F2O A;  4AB7 A;  4EVY A;  2B58 A;  2P0W A;  2BUE A;  3KGQ A;  4ZY1 A;  4X3R A;  3R95 A;  3TE4 A;  2HV2 A;  3TC8 A;  1Z4R A;  3F0A A;  4G1P A;  3QAY A;  5LYI A;  2EVN A;  4JLY A;  1RXT A;  3S6G A;  2FE7 A;  4P4B A;  4YFJ A;  2CF4 A;  1P4N A;  2Q43 A;  4U5Y A;  4XPK A;  3WC6 A;  3ZJ0 A;  2EO8 A;  1Y9K A;  2Z3O A;  1IGB A;  4MHY A;  4FBE A;  3W6S A;  3LAC A;  4A30 A;  3FF3 A;  3BXM A;  3EXN A;  5AG7 A;  3R9G A;  2BEI A;  2PJ4 A;  4MCP A;  4P4D A;  3D66 A;  4FD4 A;  2PJ7 A;  4H2K A;  5CPA A;  4KVM E;  4UCP A;  2V8H A;  2PJ1 A;  4CGM A;  1B87 A;  3PBB A;  1LRZ A;  2IJZ A;  1TXR A;  1QSR A;  2O53 A;  3H8E A;  2RB7 A;  4EFD A;  5BWA B;  2HC9 A;  2PJ9 A;  4AXV A;  4R9M A;  3R9E A;  3SJF A;  1YLO A;  4F6A A;  1S7L A;  2IQ6 A;  4H6U A;  3KZW A;  2GU2 A;  4RI1 A;  3RYO A;  4PXE A;  2Z0Z A;  4CGL A;  4OAE A;  1NSL A;  1S7N A;  4OC1 A;  2ZW4 A;  2Q51 A;  4MCQ A;  1GYT A;  5LYL A;  3IIB A;  2CNS A;  3NE8 A;  2HUZ A;  1ARL A;  3PB4 X;  4FD5 A;  2J8N A;  3FRM A;  4UEZ A;  2PIZ A;  2PVW A;  4TNU A;  3W6X A;  2PC1 A;  1VHE A;  1YX0 A;  4B13 A;  3MRU A;  4R76 A;  2B5G B;  1H8L A;  3CXQ A;  2J9A A;  3KQZ A;  4YGO A;  1V0C A;  1WWZ A;  1HDQ A;  4MJ8 A;  5HVF A;  4KS9 A;  4OIW A;  4AVA A;  1JWQ A;  7CPA A;  3BJ7 A;  3D2P A;  3IO1 A;  3SJE A;  4LQG A;  3RNZ A;  2Q4V A;  3EY5 A;  4C68 A;  1CJW A;  4MHP A;  4Q36 A;  2WZN A;  3QNV A;  4AVB A;  4CRZ B;  5CBM A;  5JPH A;  3IWE A;  2VBQ A;  4MMO A;  2DPT A;  2Q7S A;  6CPA A;  4UIB A;  4PXB A;  4M6I A;  4C7I A;  2GAN A;  4IAV A;  2O28 A;  4KOS A;  3DR6 A;  4NGR A;  1CPS A;  1MJA A;  4U9Y A;  2O4H A;  1OZP A;  5HVH A;  3FH4 A;  4CYP A;  3B7I A;  2GE3 A;  4MY3 A;  4NGS A;  2FS5 A;  3IWG A;  3ZZI A;  1LCP A;  1ZG8 A;  4M3S A;  4MFQ A;  2PR1 A;  1KWM A;  3I1U A;  4R8F A;  3VWD A;  1TKJ A;  2QIR A;  1DTD A;  2P6E A;  3KHZ A;  3NH5 A;  4XNH C;  1KUY A;  4ZI6 A;  1BAV A;  4TWE A;  4KSI A;  5HH1 A;  2BSW A;  2PVV A;  3JUW A;  4WJB A;  4KOY A;  1AYE A;  4MI4 A;  1LAN A;  2ZEG A;  2EK8 A;  2VL1 A;  3P2F A;  2PJB A;  4FUU A;  4F0Y A;  3N7Z A;  4MHZ A;  4IK2 A;  4MFL A;  1FNO A;  2B4D A;  4AG9 A;  2OB0 A;  3T8W A;  1TKH A;  4IHM A;  3NFZ A;  4AG7 A;  4MFK A;  3NA6 A;  2YNC C;  4NGP A;  3EC4 A;  1Y7R A;  3JTK A;  4P44 A;  4P4F A;  4MCR A;  4MCS A;  4R87 A;  3NE7 A;  3DR8 A;  2JDD A;  3FED A;  8CPA A;  1YVK A;  4OME A;  4C7H A;  3H5Z A;  1YQE A;  4KSA A;  1YVO A;  2FVG A;  1ZLH A;  3D7F A;  4OAD A;  3TOA A;  5I0C A;  4F9V A;  1L0C A;  2PJC A;  4OKO A;  3PB9 X;  3WR7 A;  1IY7 A;  1LOK A;  5K8O A;  5G22 A;  5D8N A;  4L8A A;  5A28 A;  2PJ8 A;  1RO5 A;  1YME A;  5C82 A;  4BMH A;  2Q4Z A;  4NFR A;  5C88 A;  4OC3 A;  4P4I A;  1XMB A;  3MN8 A;  2K5T A;  3E0K A;  4W9Y A;  3FEC A;  1M4L A;  2WPW A;  1XOV A;  3S9M A;  2R8V A;  4MHD A;  3V38 A;  3K9U A;  1TIQ A;  4X5K A;  2I00 A;  2ZW7 A;  2C1C A;  4CGO A;  5A27 A;  1NSA A;  3KKW A;  2ZW5 A;  2XEG A;  1FY7 A;  2VZY A;  4QUS A;  3B3V A;  3TO6 A;  2H5M A;  5ELY A;  2P6F A;  4NCZ A;  2PRB A;  1M4D A;  5FVJ A;  2OOT A;  3B2Y A;  4UFW A;  2FIW A;  3H4Q A;  3PB8 X;  4QB9 A;  3I3G A;  1MK4 A;  4B5P B;  3TO7 A;  1R43 A;  5H86 A;  4UEF A;  3SXN A;  3HLP A;  1QQ9 A;  2XEI A;  4K3N A;  1IU8 A;  1S60 A;  4GXH A;  1Q2C A;  4M6G A;  4KOV A;  2Z10 A;  2VI7 A;  2Y0M A;  2PDO A;  2QEC A;  3S6K A;  2AFM A;  2ZEO A;  1YRE A;  2GLF A;  2POK A;  4CAE A;  3SHP A;  2AFW A;  4JYW A;  4ZY0 A;  3KQX A;  2GRE A;  2HQY A;  4KLV A;  4DJL A;  3PFE A;  4R6T A;  3PRT A;  3FVL A;  1ZG9 A;  2QVP A;  4JWP A;  5F48 A;  2GIV A;  4KLW A;  5KTA A;  4KOX A;  4II9 A;  1UWY A;  4UA3 A;  2C6P A;  5J1Q A;  1M4I A;  4A2Z A;  4XNH B;  5AGE A;  3RO0 A;  1CX8 A;  2DPS A;  3HUV A;  5F49 A;  2P6G A;  3ISZ A;  3B8G A;  4A31 A;  5LRK A;  1TKF A;  2PQ8 A;  1ARM A;  3TTH A;  2JEV A;  5D29 A;  5IB9 A;  3LMS A;  2IMO A;  4KVO E;  4PK3 A;  4H6Z A;  2ABZ A;  2OH1 A;  5G20 A;  4NJR A;  2ZOG A;  3KR5 A;  4Y49 B;  2NMT A;  3V8I A;  3S6H A;  2Z3M A;  2V8G A;  1XFO A;  1VKC A;  2OZG A;  3IGR A;  3VAT A;  4C2Y A;  1S5K A;  4X2T A;  2GLJ A;  3K9T A;  2YND A;  1IYL A;  4QVT A;  3RBU A;  4ZGY B;  4A95 A;  5KTC A;  3PGP A;  1IYK A;  4L89 A;  3JVN A;  4HKF A;  3DSB A;  2V8D A;  3IEH A;  2PJ2 A;  1S7K A;  4NSQ A;  1KUX A; 
#chains in the Genus database with same CATH homology
 2HB6 A;  2HC9 A;  1JWQ A;  3NE8 A;  4M6H A;  4M6G A;  5EMI A;  4LQ6 A;  3CZX A;  4BIN A;  2Q7S A;  3QAY A;  2ODF A;  4M6I A;  4RN7 A;  1XOV A;  4EFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...