4M6HA

Structure of the reduced, metal-free form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
190
Chain Sequence
IAGMVVFIDPGHNGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidoglycan Amidase Rv3717
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 75
structure length 190
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6hA00
4M6HA 3QAYA 4M6IA 3CZXA 1XOVA 2ODFA 4LQ6A 4BINA 4RN7A 4M6GA 2Q7SA 1JWQA 3NE8A 5EMIA
chains in the Genus database with same CATH superfamily
1Y7RA 1BPNA 4UF4A 3BJ7A 3FYNA 2YNCC 4U9ZA 2JBJA 4CGMA 1F57A 4CAEA 3S9NA 1IU8A 1M4GA 2CTCA 3ISZA 2JEWA 3CZXA 3B2YA 3FXTA 4QBJA 3FEEA 4OC0A 2Z3KA 2ZOFA 2WZNA 4F9VA 2QECA 3IU1A 2ZENA 1A2ZA 2WYRA 3KHZA 2DPSA 4OIDA 3TX8A 1OZPA 2PJ9A 2EUIA 2CY2A 2V8GA 3NH5A 4LUAA 2V8DA 1XOVA 4ZY2A 3SJEA 4DJLA 2PIZA 4NGTA 2OR4A 4DUKA 4MY0A 1QSMA 2OOTA 5GCNA 4MBUA 2CNTA 3KQXA 4C7IA 2HQYA 3FECA 2WPWA 2PJ5A 3VWDA 4KSFA 2PJ8A 2VXKA 5A28A 3D3SA 3TE4A 1J4JA 3EXNA 3PBEA 5K8OA 2D4PA 1ZO0A 3CXQA 2O53A 4B10A 2V77A 2EVNA 2ZOGA 3DNSA 2PVWA 3MRUA 4MHPA 4OMEA 4PSWA 1XIXA 2B4DA 4KS9A 5LYIA 3V7ZA 2B3UA 4PXEA 4CGOA 3SI0A 3PZJA 5F49A 2A4NA 2QJ8A 3NE8A 4MCPA 4ZYQA 2Y0MA 2EO8A 2PJ4A 3JRUA 5JH9A 4R3LA 4KOXA 5H86A 5BWAB 1R43A 3I9SA 4OC3A 2PQ8A 2CIJA 3W6XA 1VKCA 3MN8A 5C88A 2BSWA 4M6HA 4MFPA 4BMHA 3JVNA 4R8FA 2NSMA 1P0HA 2BUEA 4MY3A 1YSJA 3I3GA 4UEEA 3FNCA 1Q2YA 1ELLP 2B58A 4HNWB 4P4DA 2PSWA 4EMEA 4KOVA 2V8VA 3GLJA 1DTDA 1ARLA 3DDDA 1PYTB 1TXRA 1LCPA 3D66A 4PXDA 4OLLA 4UFWA 5EMIA 2Q0YA 4HNYB 4OC5A 1OBRA 4MFQA 2CNSA 4Q38A 1R3NA 2C6CA 2VZZA 5F48A 2J8RA 1IICA 4IUSA 1YR0A 1F2OA 4TWEA 4CYQA 4CGLA 1XF8A 3CDXA 2WSAA 4IHMA 4KSIA 1M1DA 2XEGA 4FD5A 1CBXA 4UBRA 1Y9KA 4F0XA 5G1ZA 4U9YA 4UFXA 2IL4A 4K3NA 2GFQA 1TKJA 3A9LA 1Z8TA 1NE9A 1VHSA 2PIYA 5IB9A 1U6MA 1X12A 3SJFA 3WR7A 2DXQA 4X8IA 4NJQA 4JWPA 2G3AA 1KUYA 2HB6A 1LAPA 2BO9A 4UEFA 3EC4A 1MK4A 4I49A 3LWUA 1IYKA 3CXSA 4UWIA 5AGEA 1HDUA 4JJXA 2RFHA 3IEHA 4NGNA 3UY5A 3W91A 4P10A 2PE3A 3H8FA 5LRGA 3PRTA 3LMSA 1FT7A 4YGOA 4ZI6A 1JWQA 3PBBA 1I12A 2P6EA 2BEIA 2FXFA 3BHXA 3PEIA 3ZZIA 4LQGA 2C27A 2J9AA 1CJWA 3KHXA 1CM0A 2GLFA 4HKFA 1Y9WA 4NSQA 4GM5A 4C7HA 3B3WA 1MJ9A 4NGSA 7CPAA 1S7FA 2PVVA 1B87A 4FUUA 4ZGYB 2GANA 3ZJ0A 1IY7A 2X7BA 4MMOA 3D7HA 2Q43A 4R7MA 5EBVA 2D4OA 3WT4A 2ZEPA 2AFOA 4XNHB 4PXBA 1XBUA 2JDDA 2XEIA 4OC4A 4YFJA 4AXVA 1CG2A 3DR6A 1K4JA 3GUXA 3IIBA 3WC6A 1DE4C 4CAWA 3PB7X 1CP6A 3MGDA 3G8WA 2CXAA 4E8OA 4L8AA 3TO9A 3EY5A 2ZELA 3S6FA 2XEFA 3K2KA 5JGFA 4DNCA 2NMTA 4M6IA 5HH1A 3IWGA 2PJ7A 1BPMA 2F7VA 1QQ9A 4MCRA 2EK8A 3SJXA 1S3ZA 2NYQA 1AYEA 2ZEHA 4OC2A 1IB1E 5D29A 3V38A 1ZG9A 4G1PA 4NGMA 2Z11A 2OB0A 4WJBA 1BOBA 2Q04A 2Q51A 1GYTA 4KOYA 1VHEA 2IMOA 1XEBA 1XFOA 1BLLE 2R98A 4OADA 4A95A 4F9UA 2HC9A 2PRQA 4X3RA 5DWNA 3R9GA 3B3TA 3HLPA 4H2KA 4MFZA 4GS4A 3IU2A 5HMNA 1YMEA 1ON0A 1Z4RA 3WABA 4Y49B 4F0YA 2I00A 5JPHA 3FEDA 4KOSA 1V0CA 3GY9A 3PB8X 4NF1A 2Q44A 3E0KA 2GU2A 2PJ2A 4P45A 1GHEA 4B5PA 2JEVA 2PJ6A 2RC4A 2Z10A 5A27A 4J3GA 2Q7SA 2EWBA 4PK3A 3VARA 4UA3A 1HDQA 1MJAA 4AB7A 4B14A 1SQHA 2OZHA 4H6UA 4RUHA 1JQGA 1Z5RA 2ZW5A 3BI1A 4JZ0A 2OZGA 5HXDA 2BOAA 1YVKA 3KR4A 5HVHA 3LD2A 4XNHC 3QNVA 5K8PA 4PPZA 4MRIA 5IX3A 1XMTA 1IIDA 4KUAA 4OIWA 2EBJA 2JLMA 3R9FA 4A94A 3W6SA 4B11A 4JXQA 1YQEA 2I3CA 4QC6A 1KWMA 3WC7A 1HEEA 3IJ3A 2ZPAA 2R1IA 3PFEA 2QIRA 4KVXA 3R95A 5JQ4A 4KOTA 4O23A 1S7LA 2VI7A 4NGQA 3OWCA 4UFVA 1VGYA 4NJRA 2ZW7A 1S5KA 3DR8A 3KKWA 4OKOA 1CX8A 5F46A 1XJOA 2G9DA 3F8KA 4W9YA 4EFDA 4KLWA 4CAXA 5CNPA 3B7IA 1CP7A 3S6HA 4H89A 2R8VA 1YK3A 4CS0B 2C1CA 4YU9A 2GLJA 3KI9A 2YNCA 3QAHA 1TF9A 1NSLA 2FT0A 3SHPA 5CPAA 1YREA 2ABZA 5CBMA 4ONWA 4B6ZA 1TF8A 4Q36A 1H8LA 4UEZA 3P2HA 1ELMP 3CT9A 4P6YA 4WWVA 3SI1A 3T9YA 2B4DB 2ZEFA 5ISVA 2KCWA 3FB3A 4PQAA 2POKA 2AFMA 3D2PA 3K9UA 2VBQA 5EC4A 3KR5A 3TTHA 3TO6A 1ARMA 3C26A 2G0BA 4QB9A 4ONUA 1Z8WA 4CYNA 1YVOA 2HV2A 2ZEOA 4FD7A 3TCVA 4MHZA 3B35A 1LAMA 4HPSA 3TOAA 1P4NA 1RXTA 3R1KA 1M4IA 5K8NA 3GYAA 3FIXA 1KUVA 2AJ6A 2FS5A 3BJ8A 3LODA 4LQ6A 5E96A 4KVOE 2GE3A 4UIAA 4Z65A 2PJ1A 4ZY1A 4B12A 4FD6A 2Q4YA 4ZX9A 4KSAA 4PSXA 3IGRA 3IWEA 5F47A 5G22A 4FWUA 5LYFA 1RO5A 4UIBA 4F8ZA 4P4BA 3L2NA 2PDOA 4NFRA 1R57A 3D7FA 2ZEDA 3D2MA 3LACA 3CXPA 3FVLA 4MXUA 1B6BA 4E0AA 1TKFA 4CAFA 4NGRA 3TC8A 1QSTA 3PP9A 2ZEGA 3RYOA 1Q7LA 3IFEA 3SXOA 3TFYA 1X10A 4ZBGA 2JBKA 3NA6A 2PCUA 1XE4A 2Z3MA 2Q4VA 4X2TA 2ZXVA 2FVGA 3D67A 6CPAA 2B5GA 4IK2A 2PC1A 1S7NA 1FY7A 3H5ZA 4CGNA 3HUVA 5LRJA 2CF4A 4A38A 5G20A 2FSRA 3PFOA 4XPDB 3FMCA 4BD9A 2Z3OA 3D68A 5AG6A 4CYOA 3V8IA 1ZG8A 2CTBA 2QMLA 5J8CA 3R9EA 3DSBA 4PXCA 1AMPA 3T8WA 4H6ZA 2FCKA 1PUAA 3KQZA 1S7KA 4E2AA 4ZX8A 4CGPA 4A30A 3QB8A 8CPAA 3B8GA 3BLNA 2QVPA 3EFAA 3GKRA 4K30A 3VATA 4MFJA 1KUXA 1YX0A 3TO7A 1VHOA 2B5GB 3QAYA 4NXYA 4A2ZA 3FF3A 2Q7BA 1QSRA 2OH1A 1BO4A 3KZWA 4R76A 3FRMA 4NEXA 5HVGA 3G3SA 3RNZA 4EVYA 1M4DA 4DYOA 2PRBA 1I21A 4MHNA 1QSNA 2K5TA 4AVBA 4BBHA 2ZEMA 4PK2A 4IAVA 3S6KA 2Z3PA 5J8FA 2CNMA 5C82A 4KORA 2REFA 2YGWA 2OU2A 3IO1A 1Q2DA 3DLJA 2AFSA 4PV6A 1ZLHA 3NFZA 5ELYA 4A39A 2PJ3A 1UWYA 3T90A 2PR1A 4MJ8A 4NGPA 4KOUA 2REEA 1QSOA 3GIUA 3IC1A 2AFZA 2ANPA 3JUWA 4QVTA 1MJBA 4OP4A 2DPTA 2EK9A 4B13A 1Y0RA 3NE7A 4UWJA 5KTCA 1BAVA 5D8NA 2DF5A 3CPXA 1AUGA 2J8NA 2Z0ZA 2F8HA 2B4BA 4L89A 4A37A 1YW6A 1NMTA 2Z3NA 4MHYA 3S6GA 3H4QA 1Q2CA 2ODFA 3SJGA 4XPDC 4II9A 3RO0A 2YNDA 5IB0A 1ZG7A 4OC1A 2AE6A 5LRKA 3RZAA 4RI1A 2GREA 1XMBA 4MI4A 5LYLA 3B3VA 2F5IA 3H8GA 3KL9A 4KOWA 4B5PB 1LOKA 2QYVA 3PGPA 3H8EA 4R9MA 4IF5A 3EO4A 4AVAA 3SXNA 3P2FA 4QUSA 4R87A 3RAMA 2FE7A 2H5MA 3BXMA 5FVJA 3GB0A 3WC5A 1Z4EA 4KZTA 1YGHA 5F09A 2FIWA 1M44A 2ZW6A 2PJAA 1IOIA 3D7GA 3B3CA 4A32A 2PJCA 4FBEA 3VH9A 1IOFA 1Y0YA 4A31A 2AFWA 2PR8A 5H84A 2FL4A 4P44A 2FIAA 2GIVA 2VZYA 3K9TA 1I1DA 4U5YA 4Y49C 5AG7A 1M4LA 5AG4A 5JM6A 5KTAA 1PU9A 2C6GA 4MCSA 4YWYA 1Z8XA 5I0CA 3I1UA 4NCZA 1EE3P 4C68A 2JDCA 1IYLA 1TKHA 1NSAA 4LX9A 2DEAA 2BL1A 4A33A 2AFXA 4ORFA 5I4MA 1KZFA 4MFLA 3FBUA 4M3SA 4M85A 4CYPA 1IGBA 1LRZA 3S9MA 1WK4A 2P0WA 3CPAA 2IQ6A 3FH4A 4RN7A 2AFUA 3IWWA 3S9LA 1CPXA 1N71A 4B5OA 2ARHA 4P4JA 2Z3LA 4YRHA 1Y7EA 2P6FA 4C2YA 2I79A 5LYDA 2VEZA 2J8MA 3NH4A 4AVCA 4ZY0A 2O4HA 4CRYB 1FNOA 5THWA 4FAIA 3D7DA 4Q7AA 4KLVA 1XRYA 3D8PA 4X5KA 5IV0A 4M6GA 5J1QA 2IJZA 5AG5A 4C2XA 4CRZB 3B3SA 3PB4X 2WPXA 1LANA 3R96A 3TT2A 2PJBA 2RB7A 3KASA 4R3KA 3VWEA 4MCQA 3SI2A 2PJ0A 4XPLA 2O28A 2ATRA 1RTQA 3D4UA 4P4IA 1VIXA 2XEJA 3JTKA 4GXHA 1F2PA 4JD6A 4JLYA 2C6PA 4XPKA 4CAVA 2WUUA 2YNEA 3FX6A 2BCOA 2VQYA 5G21A 4AG9A 5KTDA 1YW4A 1PCAA 3N7ZA 1TIQA 2OZUA 2R7HA 4P4EA 3RBUA 2P6GA 2V8HA 4P4FA 2ZEEA 3BI0A 1S60A 2Q4ZA 1WWZA 2B3VA 4C2ZA 3F5BA 4RS2A 5HVFA 5K8MA 4MFKA 4UCMA 3PB6X 4JXRA 4KVME 2ZW4A 3N5FA 4R6TA 1QMUA 2HUZA 2VL1A 4BINA 2G3TA 1L0CA 3NH8A 3TOBA 4UCNA 4AG7A 1LFWA 4HNXB 3FJUA 3ISXA 4JYWA 3PB9X 1YLOA 1Z2LA 4KUBA 4OAEA 4FD4A 4EWTA 4F6AA 1CPSA 1Z9UA 1ZLIA 1UFHA 4UCPA 3F0AA 4R57A 4TNUA 5DWMA 5DS0A 4MHDA 4CPAA 3DGVA 1YLEA 1Z8LA 3KGQA
chains in the Genus database with same CATH topology
4M6HA 3QAYA 4M6IA 3CZXA 2HC9A 1XOVA 2ODFA 4LQ6A 4BINA 4RN7A 4M6GA 2Q7SA 2HB6A 1JWQA 3NE8A 4EFDA 5EMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M6H A;  3QAY A;  4M6I A;  3CZX A;  1XOV A;  2ODF A;  4LQ6 A;  4BIN A;  4RN7 A;  4M6G A;  2Q7S A;  1JWQ A;  3NE8 A;  5EMI A; 
#chains in the Genus database with same CATH topology
 1Y7R A;  1BPN A;  4UF4 A;  3BJ7 A;  3FYN A;  2YNC C;  4U9Z A;  2JBJ A;  4CGM A;  1F57 A;  4CAE A;  3S9N A;  1IU8 A;  1M4G A;  2CTC A;  3ISZ A;  2JEW A;  3CZX A;  3B2Y A;  3FXT A;  4QBJ A;  3FEE A;  4OC0 A;  2Z3K A;  2ZOF A;  2WZN A;  4F9V A;  2QEC A;  3IU1 A;  2ZEN A;  1A2Z A;  2WYR A;  3KHZ A;  2DPS A;  4OID A;  3TX8 A;  1OZP A;  2PJ9 A;  2EUI A;  2CY2 A;  2V8G A;  3NH5 A;  4LUA A;  2V8D A;  1XOV A;  4ZY2 A;  3SJE A;  4DJL A;  2PIZ A;  4NGT A;  2OR4 A;  4DUK A;  4MY0 A;  1QSM A;  2OOT A;  5GCN A;  4MBU A;  2CNT A;  3KQX A;  4C7I A;  2HQY A;  3FEC A;  2WPW A;  2PJ5 A;  3VWD A;  4KSF A;  2PJ8 A;  2VXK A;  5A28 A;  3D3S A;  3TE4 A;  1J4J A;  3EXN A;  3PBE A;  5K8O A;  2D4P A;  1ZO0 A;  3CXQ A;  2O53 A;  4B10 A;  2V77 A;  2EVN A;  2ZOG A;  3DNS A;  2PVW A;  3MRU A;  4MHP A;  4OME A;  4PSW A;  1XIX A;  2B4D A;  4KS9 A;  5LYI A;  3V7Z A;  2B3U A;  4PXE A;  4CGO A;  3SI0 A;  3PZJ A;  5F49 A;  2A4N A;  2QJ8 A;  3NE8 A;  4MCP A;  4ZYQ A;  2Y0M A;  2EO8 A;  2PJ4 A;  3JRU A;  5JH9 A;  4R3L A;  4KOX A;  5H86 A;  5BWA B;  1R43 A;  3I9S A;  4OC3 A;  2PQ8 A;  2CIJ A;  3W6X A;  1VKC A;  3MN8 A;  5C88 A;  2BSW A;  4M6H A;  4MFP A;  4BMH A;  3JVN A;  4R8F A;  2NSM A;  1P0H A;  2BUE A;  4MY3 A;  1YSJ A;  3I3G A;  4UEE A;  3FNC A;  1Q2Y A;  1ELL P;  2B58 A;  4HNW B;  4P4D A;  2PSW A;  4EME A;  4KOV A;  2V8V A;  3GLJ A;  1DTD A;  1ARL A;  3DDD A;  1PYT B;  1TXR A;  1LCP A;  3D66 A;  4PXD A;  4OLL A;  4UFW A;  5EMI A;  2Q0Y A;  4HNY B;  4OC5 A;  1OBR A;  4MFQ A;  2CNS A;  4Q38 A;  1R3N A;  2C6C A;  2VZZ A;  5F48 A;  2J8R A;  1IIC A;  4IUS A;  1YR0 A;  1F2O A;  4TWE A;  4CYQ A;  4CGL A;  1XF8 A;  3CDX A;  2WSA A;  4IHM A;  4KSI A;  1M1D A;  2XEG A;  4FD5 A;  1CBX A;  4UBR A;  1Y9K A;  4F0X A;  5G1Z A;  4U9Y A;  4UFX A;  2IL4 A;  4K3N A;  2GFQ A;  1TKJ A;  3A9L A;  1Z8T A;  1NE9 A;  1VHS A;  2PIY A;  5IB9 A;  1U6M A;  1X12 A;  3SJF A;  3WR7 A;  2DXQ A;  4X8I A;  4NJQ A;  4JWP A;  2G3A A;  1KUY A;  2HB6 A;  1LAP A;  2BO9 A;  4UEF A;  3EC4 A;  1MK4 A;  4I49 A;  3LWU A;  1IYK A;  3CXS A;  4UWI A;  5AGE A;  1HDU A;  4JJX A;  2RFH A;  3IEH A;  4NGN A;  3UY5 A;  3W91 A;  4P10 A;  2PE3 A;  3H8F A;  5LRG A;  3PRT A;  3LMS A;  1FT7 A;  4YGO A;  4ZI6 A;  1JWQ A;  3PBB A;  1I12 A;  2P6E A;  2BEI A;  2FXF A;  3BHX A;  3PEI A;  3ZZI A;  4LQG A;  2C27 A;  2J9A A;  1CJW A;  3KHX A;  1CM0 A;  2GLF A;  4HKF A;  1Y9W A;  4NSQ A;  4GM5 A;  4C7H A;  3B3W A;  1MJ9 A;  4NGS A;  7CPA A;  1S7F A;  2PVV A;  1B87 A;  4FUU A;  4ZGY B;  2GAN A;  3ZJ0 A;  1IY7 A;  2X7B A;  4MMO A;  3D7H A;  2Q43 A;  4R7M A;  5EBV A;  2D4O A;  3WT4 A;  2ZEP A;  2AFO A;  4XNH B;  4PXB A;  1XBU A;  2JDD A;  2XEI A;  4OC4 A;  4YFJ A;  4AXV A;  1CG2 A;  3DR6 A;  1K4J A;  3GUX A;  3IIB A;  3WC6 A;  1DE4 C;  4CAW A;  3PB7 X;  1CP6 A;  3MGD A;  3G8W A;  2CXA A;  4E8O A;  4L8A A;  3TO9 A;  3EY5 A;  2ZEL A;  3S6F A;  2XEF A;  3K2K A;  5JGF A;  4DNC A;  2NMT A;  4M6I A;  5HH1 A;  3IWG A;  2PJ7 A;  1BPM A;  2F7V A;  1QQ9 A;  4MCR A;  2EK8 A;  3SJX A;  1S3Z A;  2NYQ A;  1AYE A;  2ZEH A;  4OC2 A;  1IB1 E;  5D29 A;  3V38 A;  1ZG9 A;  4G1P A;  4NGM A;  2Z11 A;  2OB0 A;  4WJB A;  1BOB A;  2Q04 A;  2Q51 A;  1GYT A;  4KOY A;  1VHE A;  2IMO A;  1XEB A;  1XFO A;  1BLL E;  2R98 A;  4OAD A;  4A95 A;  4F9U A;  2HC9 A;  2PRQ A;  4X3R A;  5DWN A;  3R9G A;  3B3T A;  3HLP A;  4H2K A;  4MFZ A;  4GS4 A;  3IU2 A;  5HMN A;  1YME A;  1ON0 A;  1Z4R A;  3WAB A;  4Y49 B;  4F0Y A;  2I00 A;  5JPH A;  3FED A;  4KOS A;  1V0C A;  3GY9 A;  3PB8 X;  4NF1 A;  2Q44 A;  3E0K A;  2GU2 A;  2PJ2 A;  4P45 A;  1GHE A;  4B5P A;  2JEV A;  2PJ6 A;  2RC4 A;  2Z10 A;  5A27 A;  4J3G A;  2Q7S A;  2EWB A;  4PK3 A;  3VAR A;  4UA3 A;  1HDQ A;  1MJA A;  4AB7 A;  4B14 A;  1SQH A;  2OZH A;  4H6U A;  4RUH A;  1JQG A;  1Z5R A;  2ZW5 A;  3BI1 A;  4JZ0 A;  2OZG A;  5HXD A;  2BOA A;  1YVK A;  3KR4 A;  5HVH A;  3LD2 A;  4XNH C;  3QNV A;  5K8P A;  4PPZ A;  4MRI A;  5IX3 A;  1XMT A;  1IID A;  4KUA A;  4OIW A;  2EBJ A;  2JLM A;  3R9F A;  4A94 A;  3W6S A;  4B11 A;  4JXQ A;  1YQE A;  2I3C A;  4QC6 A;  1KWM A;  3WC7 A;  1HEE A;  3IJ3 A;  2ZPA A;  2R1I A;  3PFE A;  2QIR A;  4KVX A;  3R95 A;  5JQ4 A;  4KOT A;  4O23 A;  1S7L A;  2VI7 A;  4NGQ A;  3OWC A;  4UFV A;  1VGY A;  4NJR A;  2ZW7 A;  1S5K A;  3DR8 A;  3KKW A;  4OKO A;  1CX8 A;  5F46 A;  1XJO A;  2G9D A;  3F8K A;  4W9Y A;  4EFD A;  4KLW A;  4CAX A;  5CNP A;  3B7I A;  1CP7 A;  3S6H A;  4H89 A;  2R8V A;  1YK3 A;  4CS0 B;  2C1C A;  4YU9 A;  2GLJ A;  3KI9 A;  2YNC A;  3QAH A;  1TF9 A;  1NSL A;  2FT0 A;  3SHP A;  5CPA A;  1YRE A;  2ABZ A;  5CBM A;  4ONW A;  4B6Z A;  1TF8 A;  4Q36 A;  1H8L A;  4UEZ A;  3P2H A;  1ELM P;  3CT9 A;  4P6Y A;  4WWV A;  3SI1 A;  3T9Y A;  2B4D B;  2ZEF A;  5ISV A;  2KCW A;  3FB3 A;  4PQA A;  2POK A;  2AFM A;  3D2P A;  3K9U A;  2VBQ A;  5EC4 A;  3KR5 A;  3TTH A;  3TO6 A;  1ARM A;  3C26 A;  2G0B A;  4QB9 A;  4ONU A;  1Z8W A;  4CYN A;  1YVO A;  2HV2 A;  2ZEO A;  4FD7 A;  3TCV A;  4MHZ A;  3B35 A;  1LAM A;  4HPS A;  3TOA A;  1P4N A;  1RXT A;  3R1K A;  1M4I A;  5K8N A;  3GYA A;  3FIX A;  1KUV A;  2AJ6 A;  2FS5 A;  3BJ8 A;  3LOD A;  4LQ6 A;  5E96 A;  4KVO E;  2GE3 A;  4UIA A;  4Z65 A;  2PJ1 A;  4ZY1 A;  4B12 A;  4FD6 A;  2Q4Y A;  4ZX9 A;  4KSA A;  4PSX A;  3IGR A;  3IWE A;  5F47 A;  5G22 A;  4FWU A;  5LYF A;  1RO5 A;  4UIB A;  4F8Z A;  4P4B A;  3L2N A;  2PDO A;  4NFR A;  1R57 A;  3D7F A;  2ZED A;  3D2M A;  3LAC A;  3CXP A;  3FVL A;  4MXU A;  1B6B A;  4E0A A;  1TKF A;  4CAF A;  4NGR A;  3TC8 A;  1QST A;  3PP9 A;  2ZEG A;  3RYO A;  1Q7L A;  3IFE A;  3SXO A;  3TFY A;  1X10 A;  4ZBG A;  2JBK A;  3NA6 A;  2PCU A;  1XE4 A;  2Z3M A;  2Q4V A;  4X2T A;  2ZXV A;  2FVG A;  3D67 A;  6CPA A;  2B5G A;  4IK2 A;  2PC1 A;  1S7N A;  1FY7 A;  3H5Z A;  4CGN A;  3HUV A;  5LRJ A;  2CF4 A;  4A38 A;  5G20 A;  2FSR A;  3PFO A;  4XPD B;  3FMC A;  4BD9 A;  2Z3O A;  3D68 A;  5AG6 A;  4CYO A;  3V8I A;  1ZG8 A;  2CTB A;  2QML A;  5J8C A;  3R9E A;  3DSB A;  4PXC A;  1AMP A;  3T8W A;  4H6Z A;  2FCK A;  1PUA A;  3KQZ A;  1S7K A;  4E2A A;  4ZX8 A;  4CGP A;  4A30 A;  3QB8 A;  8CPA A;  3B8G A;  3BLN A;  2QVP A;  3EFA A;  3GKR A;  4K30 A;  3VAT A;  4MFJ A;  1KUX A;  1YX0 A;  3TO7 A;  1VHO A;  2B5G B;  3QAY A;  4NXY A;  4A2Z A;  3FF3 A;  2Q7B A;  1QSR A;  2OH1 A;  1BO4 A;  3KZW A;  4R76 A;  3FRM A;  4NEX A;  5HVG A;  3G3S A;  3RNZ A;  4EVY A;  1M4D A;  4DYO A;  2PRB A;  1I21 A;  4MHN A;  1QSN A;  2K5T A;  4AVB A;  4BBH A;  2ZEM A;  4PK2 A;  4IAV A;  3S6K A;  2Z3P A;  5J8F A;  2CNM A;  5C82 A;  4KOR A;  2REF A;  2YGW A;  2OU2 A;  3IO1 A;  1Q2D A;  3DLJ A;  2AFS A;  4PV6 A;  1ZLH A;  3NFZ A;  5ELY A;  4A39 A;  2PJ3 A;  1UWY A;  3T90 A;  2PR1 A;  4MJ8 A;  4NGP A;  4KOU A;  2REE A;  1QSO A;  3GIU A;  3IC1 A;  2AFZ A;  2ANP A;  3JUW A;  4QVT A;  1MJB A;  4OP4 A;  2DPT A;  2EK9 A;  4B13 A;  1Y0R A;  3NE7 A;  4UWJ A;  5KTC A;  1BAV A;  5D8N A;  2DF5 A;  3CPX A;  1AUG A;  2J8N A;  2Z0Z A;  2F8H A;  2B4B A;  4L89 A;  4A37 A;  1YW6 A;  1NMT A;  2Z3N A;  4MHY A;  3S6G A;  3H4Q A;  1Q2C A;  2ODF A;  3SJG A;  4XPD C;  4II9 A;  3RO0 A;  2YND A;  5IB0 A;  1ZG7 A;  4OC1 A;  2AE6 A;  5LRK A;  3RZA A;  4RI1 A;  2GRE A;  1XMB A;  4MI4 A;  5LYL A;  3B3V A;  2F5I A;  3H8G A;  3KL9 A;  4KOW A;  4B5P B;  1LOK A;  2QYV A;  3PGP A;  3H8E A;  4R9M A;  4IF5 A;  3EO4 A;  4AVA A;  3SXN A;  3P2F A;  4QUS A;  4R87 A;  3RAM A;  2FE7 A;  2H5M A;  3BXM A;  5FVJ A;  3GB0 A;  3WC5 A;  1Z4E A;  4KZT A;  1YGH A;  5F09 A;  2FIW A;  1M44 A;  2ZW6 A;  2PJA A;  1IOI A;  3D7G A;  3B3C A;  4A32 A;  2PJC A;  4FBE A;  3VH9 A;  1IOF A;  1Y0Y A;  4A31 A;  2AFW A;  2PR8 A;  5H84 A;  2FL4 A;  4P44 A;  2FIA A;  2GIV A;  2VZY A;  3K9T A;  1I1D A;  4U5Y A;  4Y49 C;  5AG7 A;  1M4L A;  5AG4 A;  5JM6 A;  5KTA A;  1PU9 A;  2C6G A;  4MCS A;  4YWY A;  1Z8X A;  5I0C A;  3I1U A;  4NCZ A;  1EE3 P;  4C68 A;  2JDC A;  1IYL A;  1TKH A;  1NSA A;  4LX9 A;  2DEA A;  2BL1 A;  4A33 A;  2AFX A;  4ORF A;  5I4M A;  1KZF A;  4MFL A;  3FBU A;  4M3S A;  4M85 A;  4CYP A;  1IGB A;  1LRZ A;  3S9M A;  1WK4 A;  2P0W A;  3CPA A;  2IQ6 A;  3FH4 A;  4RN7 A;  2AFU A;  3IWW A;  3S9L A;  1CPX A;  1N71 A;  4B5O A;  2ARH A;  4P4J A;  2Z3L A;  4YRH A;  1Y7E A;  2P6F A;  4C2Y A;  2I79 A;  5LYD A;  2VEZ A;  2J8M A;  3NH4 A;  4AVC A;  4ZY0 A;  2O4H A;  4CRY B;  1FNO A;  5THW A;  4FAI A;  3D7D A;  4Q7A A;  4KLV A;  1XRY A;  3D8P A;  4X5K A;  5IV0 A;  4M6G A;  5J1Q A;  2IJZ A;  5AG5 A;  4C2X A;  4CRZ B;  3B3S A;  3PB4 X;  2WPX A;  1LAN A;  3R96 A;  3TT2 A;  2PJB A;  2RB7 A;  3KAS A;  4R3K A;  3VWE A;  4MCQ A;  3SI2 A;  2PJ0 A;  4XPL A;  2O28 A;  2ATR A;  1RTQ A;  3D4U A;  4P4I A;  1VIX A;  2XEJ A;  3JTK A;  4GXH A;  1F2P A;  4JD6 A;  4JLY A;  2C6P A;  4XPK A;  4CAV A;  2WUU A;  2YNE A;  3FX6 A;  2BCO A;  2VQY A;  5G21 A;  4AG9 A;  5KTD A;  1YW4 A;  1PCA A;  3N7Z A;  1TIQ A;  2OZU A;  2R7H A;  4P4E A;  3RBU A;  2P6G A;  2V8H A;  4P4F A;  2ZEE A;  3BI0 A;  1S60 A;  2Q4Z A;  1WWZ A;  2B3V A;  4C2Z A;  3F5B A;  4RS2 A;  5HVF A;  5K8M A;  4MFK A;  4UCM A;  3PB6 X;  4JXR A;  4KVM E;  2ZW4 A;  3N5F A;  4R6T A;  1QMU A;  2HUZ A;  2VL1 A;  4BIN A;  2G3T A;  1L0C A;  3NH8 A;  3TOB A;  4UCN A;  4AG7 A;  1LFW A;  4HNX B;  3FJU A;  3ISX A;  4JYW A;  3PB9 X;  1YLO A;  1Z2L A;  4KUB A;  4OAE A;  4FD4 A;  4EWT A;  4F6A A;  1CPS A;  1Z9U A;  1ZLI A;  1UFH A;  4UCP A;  3F0A A;  4R57 A;  4TNU A;  5DWM A;  5DS0 A;  4MHD A;  4CPA A;  3DGV A;  1YLE A;  1Z8L A;  3KGQ A; 
#chains in the Genus database with same CATH homology
 4M6H A;  3QAY A;  4M6I A;  3CZX A;  2HC9 A;  1XOV A;  2ODF A;  4LQ6 A;  4BIN A;  4RN7 A;  4M6G A;  2Q7S A;  2HB6 A;  1JWQ A;  3NE8 A;  4EFD A;  5EMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...