4M6HA

Structure of the reduced, metal-free form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
190
Chain Sequence
IAGMVVFIDPGHNGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan Amidase Rv3717
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 75
structure length 190
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6hA00
1JWQA 3CZXA 1XOVA 5EMIA 2ODFA 3QAYA 4LQ6A 2Q7SA 4M6HA 4BINA 4RN7A 4M6GA 3NE8A 4M6IA
chains in the Genus database with same CATH superfamily
4NCZA 4P4BA 4JXRA 2AFOA 3IU1A 5EMIA 2VZYA 3VATA 4AXVA 4PXDA 4M3SA 1YVOA 2GFQA 2J8MA 2POKA 2I00A 4HKFA 3KGQA 2OB0A 4NF1A 4U5YA 3JVNA 1A2ZA 3QAYA 2X7BA 2ZEHA 5G22A 4A95A 1KWMA 2HQYA 2PJ4A 3B3TA 4KZTA 4OLLA 1CP7A 5F47A 1Z8XA 3R95A 3MRUA 4CRZB 2BO9A 2C27A 1ELMP 5HMNA 4MY0A 4MFLA 2R7HA 2ARHA 3FRMA 3SHPA 1XMBA 3B35A 4Q7AA 5IX3A 4Y49B 3B8GA 1IIDA 4UIAA 2AFUA 2ZW7A 2WSAA 3FEEA 4JXQA 1Y9WA 4PSXA 4ONUA 1TKHA 5DWNA 2Z3KA 2Z0ZA 1CP6A 4HNXB 4MHDA 5K8NA 1JWQA 3LD2A 4MHNA 2P6GA 2DPTA 3D7HA 2Q4YA 3QAHA 4GS4A 4IK2A 4XPKA 4MRIA 2H5MA 3PRTA 2VEZA 2PJ5A 4F0YA 1BAVA 5A27A 4UCMA 4RN7A 4JLYA 1AYEA 2PR1A 5IV0A 1BO4A 2C6GA 2DXQA 2Z3LA 3KR4A 3SJGA 3B3SA 3EC4A 2FIAA 1R57A 3SJXA 1LAPA 1MJAA 1Y7EA 4MFQA 4P4FA 3VH9A 3FIXA 4UA3A 4X2TA 1M4LA 4B14A 3DGVA 2ZEFA 1TF9A 3W6SA 4F8ZA 1NE9A 3ZJ0A 1F57A 2EK9A 4OC4A 2BSWA 2GLFA 3LWUA 2VQYA 4R3KA 4KVOE 5KTAA 3CXSA 5JM6A 2NMTA 1MJ9A 4R8FA 4KORA 1CX8A 2FXFA 3WC6A 4W9YA 3PZJA 2PQ8A 2WPXA 5AG7A 1JQGA 1TKFA 3CPXA 5LRJA 2PJAA 1WWZA 4R87A 4EWTA 4MJ8A 2IJZA 1UWYA 4KSAA 3NE7A 3ISZA 3RBUA 4OMEA 1PU9A 4R9MA 2Q4VA 3KZWA 2PRBA 2ZXVA 1TF8A 2RFHA 4JYWA 4PXEA 5DWMA 1XMTA 2FSRA 1XF8A 4UFWA 1PCAA 3RZAA 4CAEA 5JGFA 5A28A 3D8PA 4DUKA 2KCWA 4P4JA 2NSMA 4H89A 2ODFA 1CJWA 1PUAA 4FD6A 2PSWA 2F8HA 3S6KA 5J1QA 2CTBA 1X10A 4J3GA 1ARLA 4MCPA 5LYFA 4MMOA 2Q43A 1YGHA 1IGBA 1HDUA 3D3SA 4OC5A 2AFSA 2JBKA 2V8VA 1NSAA 4KOXA 1Z5RA 4DYOA 5C88A 2B3UA 3CDXA 1Q2DA 3PFEA 4L89A 3TOBA 4QBJA 4FD4A 4MY3A 2AFZA 4NGNA 3RYOA 3TX8A 4P6YA 1QMUA 1Z8LA 2G9DA 3B3WA 3IJ3A 2OR4A 5JPHA 1YLOA 4NJQA 3BLNA 3B3VA 1DE4C 2HV2A 2B3VA 5AG5A 4OP4A 1SQHA 2FCKA 3DSBA 4IF5A 2EVNA 3CZXA 2GLJA 3FB3A 3BHXA 5AG4A 2PC1A 3LACA 1YK3A 3SJEA 1UFHA 3DDDA 2PJ0A 3KR5A 4KOYA 3D4UA 5JH9A 1KUYA 2ZW5A 1LOKA 2YNEA 3MGDA 4HPSA 4YRHA 2EBJA 4ZX8A 2P6FA 1M4GA 2YNCA 4BBHA 1H8LA 1YLEA 4H2KA 4MFJA 4TNUA 4YWYA 1FT7A 1U6MA 2Z3MA 4OC2A 2OZGA 5LYDA 3TC8A 2VI7A 1YSJA 4E8OA 4IUSA 3JUWA 3WC7A 1LAMA 1VHEA 2FT0A 3EY5A 3GYAA 5CPAA 3EO4A 2PJ3A 4LUAA 1VKCA 2Q7BA 1Y0RA 4M85A 2CF4A 3KHXA 4P4DA 1ZG9A 2REEA 2EUIA 4EVYA 1CM0A 1B6BA 1Z4EA 2BOAA 3KQXA 4R76A 1Q2CA 2Z3OA 4A39A 3FECA 1QSNA 1ARMA 4CRYB 2EWBA 2B5GB 2Q4ZA 3S6GA 4FBEA 4Q38A 4ZYQA 3BJ8A 3JTKA 4P4IA 2I3CA 4MBUA 5LYIA 1YVKA 2REFA 2JEWA 5G21A 4OC0A 4K3NA 3F0AA 2ZEOA 3I9SA 3NE8A 5ELYA 2BUEA 4DNCA 4NGQA 1KUVA 2OH1A 4BMHA 1PYTB 4H6UA 4AVBA 2V8HA 1ZG7A 2PRQA 1MK4A 2PJBA 2RC4A 3G3SA 1P4NA 3PB9X 2OZUA 2PJ9A 2ATRA 4PK3A 1IOFA 4OC3A 3B7IA 1P0HA 4PXBA 2R1IA 3IC1A 4PK2A 4TWEA 2DEAA 3OWCA 4JZ0A 5F49A 4YFJA 2VL1A 4L8AA 4B5OA 5C82A 4NGRA 3SXOA 3B3CA 1DTDA 1ZLHA 2CNTA 3TT2A 2G3TA 3FBUA 4H6ZA 5HVFA 1BPNA 4F6AA 3S9LA 1S7LA 3BI0A 2XEFA 1M44A 2G3AA 1YX0A 3GLJA 3IEHA 2YGWA 3L2NA 4UBRA 2ZOGA 5D8NA 4CYOA 4OC1A 1I21A 2ABZA 3ISXA 5F46A 4ZY1A 1Y9KA 4XNHC 1M4IA 4C7HA 3PB6X 3GUXA 3F8KA 2ZELA 4MXUA 2YNCC 4MI4A 4A33A 4CAXA 1S3ZA 5CBMA 1HEEA 3GB0A 2XEJA 4ORFA 4CGPA 2ZW4A 1R3NA 5IB0A 3GY9A 1HDQA 4M6HA 1LFWA 4MHZA 2IQ6A 4B5PB 1QQ9A 1TXRA 4FD5A 3WR7A 2PVVA 3K2KA 4F9VA 1FNOA 1Q7LA 3CT9A 4PXCA 3IIBA 4ZX9A 2QIRA 2CNMA 2EO8A 1QSOA 4P44A 4MHYA 5FVJA 5LRKA 2K5TA 4OKOA 3MN8A 3FF3A 4NGMA 2R8VA 3TO9A 4CAWA 5I0CA 3IWGA 4NJRA 1IOIA 1S7FA 2B58A 2JLMA 2GANA 2VXKA 3HUVA 1IICA 4R57A 4YGOA 2QECA 5K8OA 4UWIA 5DS0A 3RO0A 2EK8A 3R96A 4MCSA 4EFDA 4P45A 4XPDC 1RO5A 2FVGA 3D66A 1YR0A 4ZI6A 4JJXA 1Z8TA 4KOUA 2FIWA 4A37A 1KZFA 3IWWA 3D67A 3FXTA 3S6HA 3IU2A 3EFAA 1S5KA 1CPSA 2XEGA 1I12A 2OU2A 1IYKA 1ELLP 3BXMA 3E0KA 4MFZA 3R1KA 1XE4A 3B2YA 2OOTA 3DNSA 3GIUA 4AVAA 4EMEA 4MFKA 4A38A 4LQGA 2AFXA 1YREA 4UFVA 3FNCA 4BINA 2FE7A 2Z11A 4UCNA 4UIBA 2Q44A 3IFEA 3R9FA 5HVGA 4IHMA 5F48A 2FL4A 1IU8A 3H8EA 4ZGYB 5J8CA 4Y49C 2JDDA 4ZY2A 3PBEA 1QSTA 4CGLA 1Z9UA 4NEXA 4CGOA 2ZW6A 2PDOA 5HVHA 2PVWA 5I4MA 3W6XA 1TKJA 3PBBA 4A30A 4CS0B 3PP9A 5KTCA 4QVTA 1XJOA 4FWUA 4PPZA 5E96A 2V8GA 4C2YA 2WYRA 1TIQA 2B4DB 3SI2A 1YQEA 3FVLA 4NGSA 4NFRA 2GE3A 3KKWA 8CPAA 4KSFA 1IB1E 1S60A 2ZEDA 2JDCA 3NH5A 2C1CA 4CGNA 1I1DA 3DLJA 2PJCA 3SI1A 4OAEA 3NH8A 4R3LA 3D7FA 2D4OA 1EE3P 2RB7A 3T8WA 2PJ1A 5AGEA 4B11A 1Y7RA 1Z4RA 2HC9A 3DR8A 4B13A 2AFWA 1AMPA 5CNPA 2GIVA 2QVPA 3P2HA 3WT4A 1QSMA 1GHEA 3CXQA 4RUHA 6CPAA 5IB9A 2Y0MA 1VGYA 5THWA 2VZZA 4CYQA 5KTDA 4AG9A 4B6ZA 4MFPA 4QB9A 3TTHA 1QSRA 1CBXA 4OADA 4E0AA 2PJ2A 2F7VA 3QB8A 3D7DA 4NSQA 4XPDB 4P10A 2BL1A 2ZEPA 3PB7X 2BEIA 4LQ6A 3F5BA 2J9AA 4MHPA 3HLPA 2C6CA 5JQ4A 2O28A 2PIYA 4A32A 3KHZA 2PIZA 4UCPA 4A31A 3TE4A 1XOVA 5ISVA 1Z2LA 3KL9A 4KLWA 3PGPA 4C68A 2ZENA 7CPAA 1YMEA 2JBJA 2CIJA 3FH4A 1IYLA 4NXYA 5H86A 4C7IA 4U9ZA 2PE3A 2A4NA 2Z3NA 4FUUA 1GYTA 2CY2A 1X12A 3GKRA 2Z10A 3K9UA 3QNVA 4YU9A 2OZHA 5F09A 3IO1A 3R9EA 2B5GA 3N5FA 2Q0YA 1S7NA 2DF5A 3CXPA 4HNWB 3TOAA 4MCQA 1XEBA 2V77A 3PB8X 4Z65A 1BPMA 1RXTA 2PJ8A 1YW4A 1ZLIA 4CYPA 4UEEA 3FMCA 4UFXA 3DR6A 2F5IA 3I1UA 3NA6A 4OIWA 4NGPA 1R43A 4JWPA 4K30A 5G20A 4G1PA 4B12A 3P2FA 1BLLE 3I3GA 3D68A 2ZEGA 3S9MA 4UEZA 2CTCA 3D7GA 3A9LA 2P6EA 1NSLA 2J8RA 4KLVA 5EBVA 1KUXA 4P4EA 2JEVA 4CGMA 4CYNA 3W91A 3N7ZA 2Q51A 4QUSA 3S9NA 2IMOA 4M6GA 1F2PA 1M4DA 3WC5A 3FYNA 2D4PA 3WABA 4B10A 5G1ZA 1BOBA 1NMTA 1FY7A 1RTQA 3K9TA 2O4HA 2V8DA 3TO6A 4C2XA 4DJLA 1XIXA 4LX9A 2ZEMA 3IWEA 3C26A 2Z3PA 2O53A 2CXAA 1M1DA 3FX6A 4KOTA 1MJBA 2G0BA 2Q7SA 3VWDA 1VHSA 4HNYB 2PJ6A 5D29A 3FEDA 4R7MA 4CPAA 3H5ZA 1ZG8A 3D2MA 3KASA 2P0WA 1F2OA 2ANPA 2B4BA 4GM5A 3PEIA 4B5PA 5LYLA 4KOWA 3V8IA 3ZZIA 4R6TA 3T9YA 4ONWA 4QC6A 3NH4A 1CG2A 2R98A 4KSIA 3H8FA 2AJ6A 3FJUA 3H8GA 1J4JA 5BWAB 4X5KA 3JRUA 1XFOA 4KS9A 2PJ7A 2ZEEA 1XBUA 4NGTA 2I79A 3T90A 3TFYA 2WZNA 2PCUA 3VWEA 2GREA 3LODA 2WPWA 3PB4X 1IY7A 1AUGA 4E2AA 3BJ7A 2ZOFA 2CNSA 4CAVA 5GCNA 2BCOA 3V38A 1N71A 4CAFA 1OBRA 2XEIA 4WWVA 4X8IA 1S7KA 1Q2YA 4II9A 2YNDA 4UEFA 4ZBGA 4GXHA 5EC4A 3SXNA 4RI1A 4IAVA 3R9GA 3TO7A 2DPSA 3RNZA 5LRGA 3CPAA 5H84A 2QMLA 2J8NA 5J8FA 2NYQA 4XNHB 3G8WA 3KQZA 3VARA 4A2ZA 3BI1A 3NFZA 4KVME 4Q36A 3UY5A 1CPXA 1LRZA 2QYVA 2Q04A 4MCRA 4M6IA 3EXNA 1ON0A 3PFOA 4OIDA 2IL4A 1XRYA 3LMSA 4U9YA 4KOVA 4C2ZA 2HUZA 2VBQA 4KOSA 4F0XA 4FAIA 5K8MA 4O23A 4ZY0A 1VIXA 4BD9A 4UWJA 2AFMA 3IGRA 1K4JA 4F9UA 2GU2A 5K8PA 1Y0YA 2AE6A 4KUBA 5HH1A 2QJ8A 4PSWA 2HB6A 2FS5A 4X3RA 1L0CA 1ZO0A 4UF4A 4I49A 1V0CA 1WK4A 4FD7A 3H4QA 5HXDA 4WJBA 4JD6A 2PR8A 1LANA 2B4DA 4AVCA 3SI0A 4KVXA 3D2PA 4AG7A 3KI9A 3S6FA 4KUAA 4A94A 4RS2A 1VHOA 1LCPA 1B87A 1OZPA 3SJFA 3TCVA 3V7ZA 2C6PA 4PQAA 4XPLA 3RAMA 1YW6A 5AG6A 2ZPAA 4AB7A 1Z8WA 4PV6A 2WUUA
chains in the Genus database with same CATH topology
1JWQA 3CZXA 1XOVA 5EMIA 4EFDA 2ODFA 3QAYA 4LQ6A 2Q7SA 2HB6A 4M6HA 4BINA 3NE8A 4RN7A 4M6GA 2HC9A 4M6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWQ A;  3CZX A;  1XOV A;  5EMI A;  2ODF A;  3QAY A;  4LQ6 A;  2Q7S A;  4M6H A;  4BIN A;  4RN7 A;  4M6G A;  3NE8 A;  4M6I A; 
#chains in the Genus database with same CATH topology
 4NCZ A;  4P4B A;  4JXR A;  2AFO A;  3IU1 A;  5EMI A;  2VZY A;  3VAT A;  4AXV A;  4PXD A;  4M3S A;  1YVO A;  2GFQ A;  2J8M A;  2POK A;  2I00 A;  4HKF A;  3KGQ A;  2OB0 A;  4NF1 A;  4U5Y A;  3JVN A;  1A2Z A;  3QAY A;  2X7B A;  2ZEH A;  5G22 A;  4A95 A;  1KWM A;  2HQY A;  2PJ4 A;  3B3T A;  4KZT A;  4OLL A;  1CP7 A;  5F47 A;  1Z8X A;  3R95 A;  3MRU A;  4CRZ B;  2BO9 A;  2C27 A;  1ELM P;  5HMN A;  4MY0 A;  4MFL A;  2R7H A;  2ARH A;  3FRM A;  3SHP A;  1XMB A;  3B35 A;  4Q7A A;  5IX3 A;  4Y49 B;  3B8G A;  1IID A;  4UIA A;  2AFU A;  2ZW7 A;  2WSA A;  3FEE A;  4JXQ A;  1Y9W A;  4PSX A;  4ONU A;  1TKH A;  5DWN A;  2Z3K A;  2Z0Z A;  1CP6 A;  4HNX B;  4MHD A;  5K8N A;  1JWQ A;  3LD2 A;  4MHN A;  2P6G A;  2DPT A;  3D7H A;  2Q4Y A;  3QAH A;  4GS4 A;  4IK2 A;  4XPK A;  4MRI A;  2H5M A;  3PRT A;  2VEZ A;  2PJ5 A;  4F0Y A;  1BAV A;  5A27 A;  4UCM A;  4RN7 A;  4JLY A;  1AYE A;  2PR1 A;  5IV0 A;  1BO4 A;  2C6G A;  2DXQ A;  2Z3L A;  3KR4 A;  3SJG A;  3B3S A;  3EC4 A;  2FIA A;  1R57 A;  3SJX A;  1LAP A;  1MJA A;  1Y7E A;  4MFQ A;  4P4F A;  3VH9 A;  3FIX A;  4UA3 A;  4X2T A;  1M4L A;  4B14 A;  3DGV A;  2ZEF A;  1TF9 A;  3W6S A;  4F8Z A;  1NE9 A;  3ZJ0 A;  1F57 A;  2EK9 A;  4OC4 A;  2BSW A;  2GLF A;  3LWU A;  2VQY A;  4R3K A;  4KVO E;  5KTA A;  3CXS A;  5JM6 A;  2NMT A;  1MJ9 A;  4R8F A;  4KOR A;  1CX8 A;  2FXF A;  3WC6 A;  4W9Y A;  3PZJ A;  2PQ8 A;  2WPX A;  5AG7 A;  1JQG A;  1TKF A;  3CPX A;  5LRJ A;  2PJA A;  1WWZ A;  4R87 A;  4EWT A;  4MJ8 A;  2IJZ A;  1UWY A;  4KSA A;  3NE7 A;  3ISZ A;  3RBU A;  4OME A;  1PU9 A;  4R9M A;  2Q4V A;  3KZW A;  2PRB A;  2ZXV A;  1TF8 A;  2RFH A;  4JYW A;  4PXE A;  5DWM A;  1XMT A;  2FSR A;  1XF8 A;  4UFW A;  1PCA A;  3RZA A;  4CAE A;  5JGF A;  5A28 A;  3D8P A;  4DUK A;  2KCW A;  4P4J A;  2NSM A;  4H89 A;  2ODF A;  1CJW A;  1PUA A;  4FD6 A;  2PSW A;  2F8H A;  3S6K A;  5J1Q A;  2CTB A;  1X10 A;  4J3G A;  1ARL A;  4MCP A;  5LYF A;  4MMO A;  2Q43 A;  1YGH A;  1IGB A;  1HDU A;  3D3S A;  4OC5 A;  2AFS A;  2JBK A;  2V8V A;  1NSA A;  4KOX A;  1Z5R A;  4DYO A;  5C88 A;  2B3U A;  3CDX A;  1Q2D A;  3PFE A;  4L89 A;  3TOB A;  4QBJ A;  4FD4 A;  4MY3 A;  2AFZ A;  4NGN A;  3RYO A;  3TX8 A;  4P6Y A;  1QMU A;  1Z8L A;  2G9D A;  3B3W A;  3IJ3 A;  2OR4 A;  5JPH A;  1YLO A;  4NJQ A;  3BLN A;  3B3V A;  1DE4 C;  2HV2 A;  2B3V A;  5AG5 A;  4OP4 A;  1SQH A;  2FCK A;  3DSB A;  4IF5 A;  2EVN A;  3CZX A;  2GLJ A;  3FB3 A;  3BHX A;  5AG4 A;  2PC1 A;  3LAC A;  1YK3 A;  3SJE A;  1UFH A;  3DDD A;  2PJ0 A;  3KR5 A;  4KOY A;  3D4U A;  5JH9 A;  1KUY A;  2ZW5 A;  1LOK A;  2YNE A;  3MGD A;  4HPS A;  4YRH A;  2EBJ A;  4ZX8 A;  2P6F A;  1M4G A;  2YNC A;  4BBH A;  1H8L A;  1YLE A;  4H2K A;  4MFJ A;  4TNU A;  4YWY A;  1FT7 A;  1U6M A;  2Z3M A;  4OC2 A;  2OZG A;  5LYD A;  3TC8 A;  2VI7 A;  1YSJ A;  4E8O A;  4IUS A;  3JUW A;  3WC7 A;  1LAM A;  1VHE A;  2FT0 A;  3EY5 A;  3GYA A;  5CPA A;  3EO4 A;  2PJ3 A;  4LUA A;  1VKC A;  2Q7B A;  1Y0R A;  4M85 A;  2CF4 A;  3KHX A;  4P4D A;  1ZG9 A;  2REE A;  2EUI A;  4EVY A;  1CM0 A;  1B6B A;  1Z4E A;  2BOA A;  3KQX A;  4R76 A;  1Q2C A;  2Z3O A;  4A39 A;  3FEC A;  1QSN A;  1ARM A;  4CRY B;  2EWB A;  2B5G B;  2Q4Z A;  3S6G A;  4FBE A;  4Q38 A;  4ZYQ A;  3BJ8 A;  3JTK A;  4P4I A;  2I3C A;  4MBU A;  5LYI A;  1YVK A;  2REF A;  2JEW A;  5G21 A;  4OC0 A;  4K3N A;  3F0A A;  2ZEO A;  3I9S A;  3NE8 A;  5ELY A;  2BUE A;  4DNC A;  4NGQ A;  1KUV A;  2OH1 A;  4BMH A;  1PYT B;  4H6U A;  4AVB A;  2V8H A;  1ZG7 A;  2PRQ A;  1MK4 A;  2PJB A;  2RC4 A;  3G3S A;  1P4N A;  3PB9 X;  2OZU A;  2PJ9 A;  2ATR A;  4PK3 A;  1IOF A;  4OC3 A;  3B7I A;  1P0H A;  4PXB A;  2R1I A;  3IC1 A;  4PK2 A;  4TWE A;  2DEA A;  3OWC A;  4JZ0 A;  5F49 A;  4YFJ A;  2VL1 A;  4L8A A;  4B5O A;  5C82 A;  4NGR A;  3SXO A;  3B3C A;  1DTD A;  1ZLH A;  2CNT A;  3TT2 A;  2G3T A;  3FBU A;  4H6Z A;  5HVF A;  1BPN A;  4F6A A;  3S9L A;  1S7L A;  3BI0 A;  2XEF A;  1M44 A;  2G3A A;  1YX0 A;  3GLJ A;  3IEH A;  2YGW A;  3L2N A;  4UBR A;  2ZOG A;  5D8N A;  4CYO A;  4OC1 A;  1I21 A;  2ABZ A;  3ISX A;  5F46 A;  4ZY1 A;  1Y9K A;  4XNH C;  1M4I A;  4C7H A;  3PB6 X;  3GUX A;  3F8K A;  2ZEL A;  4MXU A;  2YNC C;  4MI4 A;  4A33 A;  4CAX A;  1S3Z A;  5CBM A;  1HEE A;  3GB0 A;  2XEJ A;  4ORF A;  4CGP A;  2ZW4 A;  1R3N A;  5IB0 A;  3GY9 A;  1HDQ A;  4M6H A;  1LFW A;  4MHZ A;  2IQ6 A;  4B5P B;  1QQ9 A;  1TXR A;  4FD5 A;  3WR7 A;  2PVV A;  3K2K A;  4F9V A;  1FNO A;  1Q7L A;  3CT9 A;  4PXC A;  3IIB A;  4ZX9 A;  2QIR A;  2CNM A;  2EO8 A;  1QSO A;  4P44 A;  4MHY A;  5FVJ A;  5LRK A;  2K5T A;  4OKO A;  3MN8 A;  3FF3 A;  4NGM A;  2R8V A;  3TO9 A;  4CAW A;  5I0C A;  3IWG A;  4NJR A;  1IOI A;  1S7F A;  2B58 A;  2JLM A;  2GAN A;  2VXK A;  3HUV A;  1IIC A;  4R57 A;  4YGO A;  2QEC A;  5K8O A;  4UWI A;  5DS0 A;  3RO0 A;  2EK8 A;  3R96 A;  4MCS A;  4EFD A;  4P45 A;  4XPD C;  1RO5 A;  2FVG A;  3D66 A;  1YR0 A;  4ZI6 A;  4JJX A;  1Z8T A;  4KOU A;  2FIW A;  4A37 A;  1KZF A;  3IWW A;  3D67 A;  3FXT A;  3S6H A;  3IU2 A;  3EFA A;  1S5K A;  1CPS A;  2XEG A;  1I12 A;  2OU2 A;  1IYK A;  1ELL P;  3BXM A;  3E0K A;  4MFZ A;  3R1K A;  1XE4 A;  3B2Y A;  2OOT A;  3DNS A;  3GIU A;  4AVA A;  4EME A;  4MFK A;  4A38 A;  4LQG A;  2AFX A;  1YRE A;  4UFV A;  3FNC A;  4BIN A;  2FE7 A;  2Z11 A;  4UCN A;  4UIB A;  2Q44 A;  3IFE A;  3R9F A;  5HVG A;  4IHM A;  5F48 A;  2FL4 A;  1IU8 A;  3H8E A;  4ZGY B;  5J8C A;  4Y49 C;  2JDD A;  4ZY2 A;  3PBE A;  1QST A;  4CGL A;  1Z9U A;  4NEX A;  4CGO A;  2ZW6 A;  2PDO A;  5HVH A;  2PVW A;  5I4M A;  3W6X A;  1TKJ A;  3PBB A;  4A30 A;  4CS0 B;  3PP9 A;  5KTC A;  4QVT A;  1XJO A;  4FWU A;  4PPZ A;  5E96 A;  2V8G A;  4C2Y A;  2WYR A;  1TIQ A;  2B4D B;  3SI2 A;  1YQE A;  3FVL A;  4NGS A;  4NFR A;  2GE3 A;  3KKW A;  8CPA A;  4KSF A;  1IB1 E;  1S60 A;  2ZED A;  2JDC A;  3NH5 A;  2C1C A;  4CGN A;  1I1D A;  3DLJ A;  2PJC A;  3SI1 A;  4OAE A;  3NH8 A;  4R3L A;  3D7F A;  2D4O A;  1EE3 P;  2RB7 A;  3T8W A;  2PJ1 A;  5AGE A;  4B11 A;  1Y7R A;  1Z4R A;  2HC9 A;  3DR8 A;  4B13 A;  2AFW A;  1AMP A;  5CNP A;  2GIV A;  2QVP A;  3P2H A;  3WT4 A;  1QSM A;  1GHE A;  3CXQ A;  4RUH A;  6CPA A;  5IB9 A;  2Y0M A;  1VGY A;  5THW A;  2VZZ A;  4CYQ A;  5KTD A;  4AG9 A;  4B6Z A;  4MFP A;  4QB9 A;  3TTH A;  1QSR A;  1CBX A;  4OAD A;  4E0A A;  2PJ2 A;  2F7V A;  3QB8 A;  3D7D A;  4NSQ A;  4XPD B;  4P10 A;  2BL1 A;  2ZEP A;  3PB7 X;  2BEI A;  4LQ6 A;  3F5B A;  2J9A A;  4MHP A;  3HLP A;  2C6C A;  5JQ4 A;  2O28 A;  2PIY A;  4A32 A;  3KHZ A;  2PIZ A;  4UCP A;  4A31 A;  3TE4 A;  1XOV A;  5ISV A;  1Z2L A;  3KL9 A;  4KLW A;  3PGP A;  4C68 A;  2ZEN A;  7CPA A;  1YME A;  2JBJ A;  2CIJ A;  3FH4 A;  1IYL A;  4NXY A;  5H86 A;  4C7I A;  4U9Z A;  2PE3 A;  2A4N A;  2Z3N A;  4FUU A;  1GYT A;  2CY2 A;  1X12 A;  3GKR A;  2Z10 A;  3K9U A;  3QNV A;  4YU9 A;  2OZH A;  5F09 A;  3IO1 A;  3R9E A;  2B5G A;  3N5F A;  2Q0Y A;  1S7N A;  2DF5 A;  3CXP A;  4HNW B;  3TOA A;  4MCQ A;  1XEB A;  2V77 A;  3PB8 X;  4Z65 A;  1BPM A;  1RXT A;  2PJ8 A;  1YW4 A;  1ZLI A;  4CYP A;  4UEE A;  3FMC A;  4UFX A;  3DR6 A;  2F5I A;  3I1U A;  3NA6 A;  4OIW A;  4NGP A;  1R43 A;  4JWP A;  4K30 A;  5G20 A;  4G1P A;  4B12 A;  3P2F A;  1BLL E;  3I3G A;  3D68 A;  2ZEG A;  3S9M A;  4UEZ A;  2CTC A;  3D7G A;  3A9L A;  2P6E A;  1NSL A;  2J8R A;  4KLV A;  5EBV A;  1KUX A;  4P4E A;  2JEV A;  4CGM A;  4CYN A;  3W91 A;  3N7Z A;  2Q51 A;  4QUS A;  3S9N A;  2IMO A;  4M6G A;  1F2P A;  1M4D A;  3WC5 A;  3FYN A;  2D4P A;  3WAB A;  4B10 A;  5G1Z A;  1BOB A;  1NMT A;  1FY7 A;  1RTQ A;  3K9T A;  2O4H A;  2V8D A;  3TO6 A;  4C2X A;  4DJL A;  1XIX A;  4LX9 A;  2ZEM A;  3IWE A;  3C26 A;  2Z3P A;  2O53 A;  2CXA A;  1M1D A;  3FX6 A;  4KOT A;  1MJB A;  2G0B A;  2Q7S A;  3VWD A;  1VHS A;  4HNY B;  2PJ6 A;  5D29 A;  3FED A;  4R7M A;  4CPA A;  3H5Z A;  1ZG8 A;  3D2M A;  3KAS A;  2P0W A;  1F2O A;  2ANP A;  2B4B A;  4GM5 A;  3PEI A;  4B5P A;  5LYL A;  4KOW A;  3V8I A;  3ZZI A;  4R6T A;  3T9Y A;  4ONW A;  4QC6 A;  3NH4 A;  1CG2 A;  2R98 A;  4KSI A;  3H8F A;  2AJ6 A;  3FJU A;  3H8G A;  1J4J A;  5BWA B;  4X5K A;  3JRU A;  1XFO A;  4KS9 A;  2PJ7 A;  2ZEE A;  1XBU A;  4NGT A;  2I79 A;  3T90 A;  3TFY A;  2WZN A;  2PCU A;  3VWE A;  2GRE A;  3LOD A;  2WPW A;  3PB4 X;  1IY7 A;  1AUG A;  4E2A A;  3BJ7 A;  2ZOF A;  2CNS A;  4CAV A;  5GCN A;  2BCO A;  3V38 A;  1N71 A;  4CAF A;  1OBR A;  2XEI A;  4WWV A;  4X8I A;  1S7K A;  1Q2Y A;  4II9 A;  2YND A;  4UEF A;  4ZBG A;  4GXH A;  5EC4 A;  3SXN A;  4RI1 A;  4IAV A;  3R9G A;  3TO7 A;  2DPS A;  3RNZ A;  5LRG A;  3CPA A;  5H84 A;  2QML A;  2J8N A;  5J8F A;  2NYQ A;  4XNH B;  3G8W A;  3KQZ A;  3VAR A;  4A2Z A;  3BI1 A;  3NFZ A;  4KVM E;  4Q36 A;  3UY5 A;  1CPX A;  1LRZ A;  2QYV A;  2Q04 A;  4MCR A;  4M6I A;  3EXN A;  1ON0 A;  3PFO A;  4OID A;  2IL4 A;  1XRY A;  3LMS A;  4U9Y A;  4KOV A;  4C2Z A;  2HUZ A;  2VBQ A;  4KOS A;  4F0X A;  4FAI A;  5K8M A;  4O23 A;  4ZY0 A;  1VIX A;  4BD9 A;  4UWJ A;  2AFM A;  3IGR A;  1K4J A;  4F9U A;  2GU2 A;  5K8P A;  1Y0Y A;  2AE6 A;  4KUB A;  5HH1 A;  2QJ8 A;  4PSW A;  2HB6 A;  2FS5 A;  4X3R A;  1L0C A;  1ZO0 A;  4UF4 A;  4I49 A;  1V0C A;  1WK4 A;  4FD7 A;  3H4Q A;  5HXD A;  4WJB A;  4JD6 A;  2PR8 A;  1LAN A;  2B4D A;  4AVC A;  3SI0 A;  4KVX A;  3D2P A;  4AG7 A;  3KI9 A;  3S6F A;  4KUA A;  4A94 A;  4RS2 A;  1VHO A;  1LCP A;  1B87 A;  1OZP A;  3SJF A;  3TCV A;  3V7Z A;  2C6P A;  4PQA A;  4XPL A;  3RAM A;  1YW6 A;  5AG6 A;  2ZPA A;  4AB7 A;  1Z8W A;  4PV6 A;  2WUU A; 
#chains in the Genus database with same CATH homology
 1JWQ A;  3CZX A;  1XOV A;  5EMI A;  4EFD A;  2ODF A;  3QAY A;  4LQ6 A;  2Q7S A;  2HB6 A;  4M6H A;  4BIN A;  3NE8 A;  4RN7 A;  4M6G A;  2HC9 A;  4M6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...