4M6HA

Structure of the reduced, metal-free form of mycobacterium tuberculosis peptidoglycan amidase rv3717
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
214
structure length
190
Chain Sequence
IAGMVVFIDPGHNGTSTNSGYPEHTFTWETGLRLRAALNALGVRTALSRGNDNALGPCVDERANMANALRPNAIVSLHADGGPASGRGFHVNYSAPPLNAIQAGPSVQFARIMRDQLQASGIPKANYIGQDGLYGRSDLAGLNLAQYPSILVELGNMKNPADSALMESAEGRQKYANALVRGVAGFLATQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Analyses of Mycobacterium tuberculosis N-Acetylmuramyl-L-alanine Amidase Rv3717 Point to a Role in Peptidoglycan Fragment Recycling.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
molecule keywords Peptidoglycan Amidase Rv3717
total genus 75
structure length 190
sequence length 214
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4m6hA00
4RN7A 1XOVA 3CZXA 3NE8A 5EMIA 4LQ6A 4BINA 4M6GA 3QAYA 1JWQA 4M6HA 2Q7SA 4M6IA 2ODFA
chains in the Genus database with same CATH superfamily
5EBVA 4KS9A 5IB9A 3P2HA 2POKA 2Z3PA 2PSWA 2XEGA 2ABZA 4UCPA 2ZOFA 3CT9A 2XEFA 1Q2DA 1UFHA 4R87A 2PJ9A 3K9UA 5J8FA 4HNWB 4KSFA 1LFWA 2VEZA 4XPLA 2PVVA 4KLVA 2HV2A 2ZEDA 4MFPA 5LRGA 3I3GA 2Q04A 1MJ9A 3TFYA 2GREA 3GIUA 3TOAA 4UIBA 3PZJA 2ARHA 5E96A 2ZXVA 1YX0A 1TF8A 2GLFA 3F5BA 4KZTA 3KR5A 3B35A 2VQYA 4RI1A 5CPAA 3HLPA 1R43A 1LAMA 4IHMA 1OBRA 4G1PA 3VWEA 3DDDA 3A9LA 1WWZA 4CYNA 2NMTA 2NYQA 4KVOE 1M4DA 1R57A 2PIYA 1ARMA 3MGDA 1BAVA 5K8OA 4R3LA 5I0CA 2R1IA 4P45A 4R76A 4FWUA 3NFZA 4PSXA 4CGPA 2B4DA 4CAVA 5IX3A 4CYQA 4UF4A 1B87A 1ZG7A 2Y0MA 4DNCA 5HVHA 4UIAA 1QSMA 3R9FA 1I12A 3D7HA 2IL4A 4P44A 3TO7A 4A30A 4PK2A 1P4NA 2CNSA 3BI1A 2FS5A 5AG6A 1CP7A 4A38A 1N71A 2PJ5A 6CPAA 3IJ3A 4F8ZA 3PRTA 5G20A 4NEXA 5I4MA 2PJBA 1VHSA 4XNHC 4F0YA 4NGMA 2Q7SA 1MJBA 3T9YA 3G8WA 3NE8A 3SI0A 4MRIA 2PJ7A 2Q4VA 4JLYA 3PB6X 4UWIA 3TO9A 4ORFA 3JVNA 2VBQA 4M85A 3LACA 4MJ8A 3TOBA 2V77A 4L8AA 4P4FA 4C7IA 5HVGA 5J1QA 4KOWA 2VI7A 2V8DA 1CPXA 3PFEA 4M6IA 4KSAA 1Q2YA 4XPKA 2B4DB 4CGMA 2ZEHA 5LRJA 1YQEA 2ZOGA 1XEBA 4LQ6A 1S60A 7CPAA 4MY0A 2PE3A 3EXNA 5FVJA 2I00A 2GANA 4OP4A 3HUVA 4U9ZA 2QVPA 4A31A 1QSRA 1NMTA 3KHZA 3KASA 2Z3NA 1DE4C 4UCNA 4X5KA 5LYIA 1ARLA 3CXSA 1QMUA 3FXTA 1S7LA 1ZLHA 1IGBA 3FEDA 5H86A 2GLJA 1PYTB 4CS0B 4RUHA 4YU9A 2BL1A 3UY5A 2PC1A 4P4JA 4UFWA 1F2OA 2C6PA 4HPSA 3RZAA 2RFHA 2Z0ZA 3B3SA 4F9UA 3FNCA 1IICA 2GIVA 2PVWA 3VARA 1BPMA 1XF8A 1XMTA 4HNYB 1RXTA 2OOTA 2YNCC 4R7MA 4KOXA 4B10A 2PJ4A 3S6HA 3VATA 1XOVA 3PB4X 4KORA 2ATRA 4XNHB 4IK2A 2ZEOA 1IYLA 4B11A 3FBUA 3BLNA 3GKRA 5HVFA 2ZW5A 2R8VA 4MHZA 4CRYB 5AG7A 1RTQA 3RYOA 1K4JA 4MFLA 4C68A 4JWPA 3EO4A 2B4BA 4MCPA 2C6GA 4FD6A 4YWYA 4PV6A 3TT2A 4C2XA 3IO1A 3IEHA 3KL9A 4QUSA 1JWQA 3SJXA 4FAIA 4DJLA 2FSRA 1I1DA 3D7DA 2I79A 2X7BA 2PJ1A 3DLJA 2OU2A 1CBXA 3KQXA 4OIDA 1CJWA 1FY7A 1ZG9A 2H5MA 5AG4A 3WC7A 3D3SA 3NH5A 4B13A 5AGEA 4KUAA 2HQYA 3PB7X 4E8OA 3FYNA 4AG9A 3H8GA 3V7ZA 2ZEPA 1KUYA 2OZHA 3V8IA 1MK4A 4IF5A 1GYTA 2BCOA 2BSWA 4UBRA 3OWCA 2O4HA 5AG5A 1TIQA 3FJUA 3JUWA 4OAEA 3ISZA 1Z8WA 4MHNA 1NSLA 4MHYA 3PFOA 2V8GA 2Z3KA 1CP6A 1F2PA 4GM5A 4E2AA 3B3WA 2PCUA 4JXRA 4LQGA 4R57A 4A33A 1YLOA 3MN8A 4U5YA 2EUIA 2J8NA 1EE3P 3CPAA 2AFUA 4CGOA 1QQ9A 2CXAA 2FXFA 4K30A 1BPNA 4OC4A 3CDXA 1YREA 3DSBA 1Z9UA 4ZBGA 4AB7A 2BEIA 4X2TA 3KQZA 1AUGA 1YVOA 1M1DA 2F8HA 5DS0A 2ZEFA 1IY7A 2REEA 4O23A 5JH9A 2EWBA 5KTCA 2PR8A 1XE4A 4CAEA 3SXOA 4YRHA 4EMEA 2R7HA 3RBUA 1XBUA 1Z5RA 4H6ZA 2QMLA 1IIDA 5F48A 1J4JA 2B3UA 4OC3A 5F49A 5HH1A 3SXNA 4A37A 5IV0A 4KLWA 4NXYA 5CNPA 4KOTA 3FEEA 1YW6A 3IU1A 4KUBA 2CIJA 2Z3OA 3R1KA 2PJ6A 4MHDA 4OKOA 4B12A 4ZGYB 5JM6A 5HMNA 1CM0A 1V0CA 4H2KA 1ZLIA 2PRQA 2Z11A 3SI2A 4MI4A 1Y7EA 1VHEA 3SJEA 3S9MA 3T8WA 5EMIA 1M4GA 4M6GA 1YK3A 3CPXA 3H5ZA 4P4DA 3VH9A 4OADA 3TC8A 3QNVA 1IYKA 4MCSA 3S6KA 4ZI6A 4FD5A 5HXDA 2D4OA 4MXUA 1RO5A 4F6AA 2Q4YA 4H6UA 5C88A 2RB7A 4EVYA 2AE6A 3B2YA 4Q38A 2JEWA 4UA3A 5GCNA 5JQ4A 4NFRA 2PJ0A 5A27A 2PJ2A 4MFJA 4BD9A 1YGHA 2CTCA 2DXQA 2F7VA 3BHXA 1QSTA 3SJFA 5F46A 1XFOA 1S3ZA 1Z4EA 4MFQA 2ZEGA 1VKCA 2PDOA 2WYRA 4PSWA 4YGOA 2DPTA 4ZY0A 4B5PA 1XJOA 4TWEA 3SHPA 3RO0A 2DPSA 4A2ZA 2J8RA 3B3CA 2OZUA 3FECA 4Q7AA 4WWVA 1ON0A 1Y9WA 2PIZA 1LRZA 1Y0YA 1Y9KA 4NGPA 3ISXA 1I21A 4EFDA 4JJXA 4F0XA 1M44A 1UWYA 4M3SA 3C26A 3B3TA 2YGWA 3NH4A 1LANA 1NE9A 2Z3MA 4FBEA 2GFQA 2CTBA 3EY5A 2ZENA 2EK9A 3NE7A 3SJGA 3GUXA 1AYEA 1BLLE 3FVLA 1TKHA 2C1CA 5D29A 1S7NA 2QIRA 2IQ6A 4NGTA 1MJAA 1M4IA 3GB0A 1IB1E 1OZPA 3CXPA 4ONWA 2VZZA 5DWMA 5G22A 4OC0A 4QC6A 2XEIA 3D8PA 4MMOA 4AG7A 1CPSA 3QB8A 1XRYA 4K3NA 3WR7A 4CAXA 1H8LA 5DWNA 4CRZB 5LYDA 5LRKA 3JTKA 3S6GA 2ZEMA 1SQHA 2FE7A 4TNUA 1ZG8A 4LUAA 2WUUA 3H8EA 2P0WA 4OIWA 4A95A 3S9NA 2ANPA 4A32A 2HUZA 5LYLA 1R3NA 2G3TA 4Z65A 1F57A 3IWEA 5K8NA 2ZW4A 1BOBA 2G9DA 4E0AA 3RAMA 3RNZA 3TCVA 4C2ZA 2O28A 4Y49B 2G0BA 4NCZA 2Q7BA 3PB8X 1IU8A 5JGFA 1HEEA 2ZELA 5G21A 4AVCA 2GE3A 2F5IA 3EFAA 4OMEA 5THWA 2P6FA 5G1ZA 4A39A 3H4QA 4B5OA 4MFKA 2JBJA 1Z2LA 2REFA 1ELLP 3DR6A 2DF5A 4R6TA 4DUKA 1YSJA 4CGNA 4JD6A 2CF4A 3DR8A 2EO8A 4JXQA 5ISVA 2Q0YA 1DTDA 2A4NA 3T90A 4OC5A 2C27A 3PBBA 4NGQA 3W91A 4BBHA 4KVXA 4PK3A 4UEEA 2RC4A 2P6GA 4JZ0A 4L89A 1FNOA 3S6FA 2ZEEA 3IU2A 3BJ8A 4P10A 2AFXA 2B58A 1GHEA 1LAPA 3D7FA 3FB3A 3FX6A 4OC2A 4AVAA 1VHOA 1Q2CA 2QJ8A 2XEJA 4CPAA 3WC5A 5H84A 3SI1A 2VXKA 2FT0A 4R3KA 2NSMA 1S7KA 4PXEA 4F9VA 2JDCA 2JLMA 4QVTA 2JBKA 2OZGA 1TKFA 2V8HA 3IWWA 4DYOA 2WZNA 4OC1A 2V8VA 4P6YA 2FIWA 2J8MA 4NSQA 3FMCA 1ZO0A 2I3CA 4HKFA 3JRUA 4GS4A 1KUXA 3W6XA 1YVKA 2BUEA 3BI0A 4UEFA 3D2MA 3N5FA 1YW4A 3MRUA 5F47A 1IOIA 8CPAA 2WSAA 3DNSA 4NGNA 3TTHA 1M4LA 4B14A 3D4UA 1B6BA 1PCAA 2OH1A 2YNEA 3D2PA 4LX9A 1XIXA 3F8KA 2ZW7A 5ELYA 3TO6A 4HNXB 4UFXA 3IWGA 4PXDA 5EC4A 4CYPA 5KTDA 2J9AA 3IC1A 3TX8A 2ODFA 3KGQA 2QECA 5C82A 4QB9A 1Z8XA 5LYFA 3R96A 3ZZIA 2EBJA 1Z4RA 2Q51A 4A94A 1NSAA 3G3SA 3GLJA 4NGRA 5A28A 4FUUA 4RN7A 1VGYA 2OB0A 4W9YA 3BJ7A 4B5PB 1PU9A 2B5GB 3K2KA 4P4IA 3D7GA 3KI9A 2K5TA 3K9TA 2HB6A 4KOUA 4BINA 2PJCA 4C2YA 4M6HA 3LODA 3PBEA 4PXCA 1XMBA 3GY9A 2ZPAA 1LCPA 4ZX9A 4I49A 4P4EA 1HDQA 2P6EA 3NA6A 3WT4A 1Q7LA 4CYOA 2QYVA 4ZY1A 1QSNA 1VIXA 4NJRA 1Y7RA 2FCKA 2FVGA 3CZXA 1ELMP 3LD2A 4NF1A 2WPXA 4RS2A 1JQGA 3EC4A 4KOSA 1KWMA 1LOKA 3CXQA 4UEZA 3ZJ0A 3FF3A 4YFJA 4U9YA 3KZWA 3FH4A 4CAFA 1KZFA 2PQ8A 3I9SA 4MHPA 4AXVA 5JPHA 1YR0A 2YNDA 3V38A 2EVNA 4NJQA 5CBMA 4BMHA 1CG2A 4CGLA 1PUAA 1TF9A 2Q43A 1YLEA 4H89A 3R9GA 1FT7A 4IUSA 4KOVA 5BWAB 4ZY2A 4P4BA 2PJ8A 3IGRA 4C7HA 3GYAA 2JEVA 2Z10A 2DEAA 2IMOA 4ZYQA 1BO4A 3H8FA 2AJ6A 4ONUA 1IOFA 3PB9X 4OLLA 4X3RA 3W6SA 4AVBA 3QAYA 4UCMA 2AFMA 3PEIA 4PQAA 3LWUA 5K8PA 2Q4ZA 2AFWA 4KVME 4JYWA 2BO9A 2PRBA 2JDDA 3L2NA 4FD4A 1TKJA 2YNCA 3NH8A 1CX8A 5IB0A 3KKWA 2CY2A 3WABA 4R8FA 4IAVA 4R9MA 1QSOA 2PR1A 2EK8A 3B3VA 2PJ3A 1KUVA 1HDUA 2VZYA 4MCRA 2KCWA 3S9LA 2C6CA 2G3AA 3I1UA 2WPWA 3KR4A 1S5KA 2AFSA 2AFZA 3PP9A 4J3GA 4CAWA 1YMEA 5F09A 3IIBA 1AMPA 3P2FA 4Q36A 4NGSA 2O53A 2BOAA 3WC6A 4QBJA 3D67A 2CNTA 3D68A 2FL4A 4XPDB 3R95A 4WJBA 2R98A 3VWDA 3BXMA 4ZX8A 5KTAA 2B5GA 4GXHA 4MBUA 4B6ZA 3E0KA 4MCQA 1X10A 1P0HA 2HC9A 1TXRA 2OR4A 1U6MA 3QAHA 4FD7A 4KOYA 3FRMA 2B3VA 3R9EA 2FIAA 1Z8LA 4MFZA 3DGVA 4Y49C 4UWJA 1Y0RA 3B8GA 5D8NA 4XPDC 1Z8TA 3TE4A 4II9A 4PXBA 5J8CA 4EWTA 1A2ZA 2Q44A 3F0AA 2VL1A 1S7FA 3PGPA 4KSIA 2ZW6A 3LMSA 4PPZA 3KHXA 4UFVA 1X12A 2CNMA 3D66A 2PJAA 3N7ZA 4X8IA 2IJZA 1WK4A 1L0CA 2Z3LA 4MY3A 2AFOA 3FIXA 5K8MA 2GU2A 3B7IA 3IFEA 2D4PA
chains in the Genus database with same CATH topology
2HC9A 4RN7A 1XOVA 3CZXA 3NE8A 5EMIA 4LQ6A 4BINA 2HB6A 4M6GA 3QAYA 4EFDA 1JWQA 4M6HA 2Q7SA 4M6IA 2ODFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RN7 A;  1XOV A;  3CZX A;  3NE8 A;  5EMI A;  4LQ6 A;  4BIN A;  4M6G A;  3QAY A;  1JWQ A;  4M6H A;  2Q7S A;  4M6I A;  2ODF A; 
#chains in the Genus database with same CATH topology
 5EBV A;  4KS9 A;  5IB9 A;  3P2H A;  2POK A;  2Z3P A;  2PSW A;  2XEG A;  2ABZ A;  4UCP A;  2ZOF A;  3CT9 A;  2XEF A;  1Q2D A;  1UFH A;  4R87 A;  2PJ9 A;  3K9U A;  5J8F A;  4HNW B;  4KSF A;  1LFW A;  2VEZ A;  4XPL A;  2PVV A;  4KLV A;  2HV2 A;  2ZED A;  4MFP A;  5LRG A;  3I3G A;  2Q04 A;  1MJ9 A;  3TFY A;  2GRE A;  3GIU A;  3TOA A;  4UIB A;  3PZJ A;  2ARH A;  5E96 A;  2ZXV A;  1YX0 A;  1TF8 A;  2GLF A;  3F5B A;  4KZT A;  3KR5 A;  3B35 A;  2VQY A;  4RI1 A;  5CPA A;  3HLP A;  1R43 A;  1LAM A;  4IHM A;  1OBR A;  4G1P A;  3VWE A;  3DDD A;  3A9L A;  1WWZ A;  4CYN A;  2NMT A;  2NYQ A;  4KVO E;  1M4D A;  1R57 A;  2PIY A;  1ARM A;  3MGD A;  1BAV A;  5K8O A;  4R3L A;  5I0C A;  2R1I A;  4P45 A;  4R76 A;  4FWU A;  3NFZ A;  4PSX A;  4CGP A;  2B4D A;  4CAV A;  5IX3 A;  4CYQ A;  4UF4 A;  1B87 A;  1ZG7 A;  2Y0M A;  4DNC A;  5HVH A;  4UIA A;  1QSM A;  3R9F A;  1I12 A;  3D7H A;  2IL4 A;  4P44 A;  3TO7 A;  4A30 A;  4PK2 A;  1P4N A;  2CNS A;  3BI1 A;  2FS5 A;  5AG6 A;  1CP7 A;  4A38 A;  1N71 A;  2PJ5 A;  6CPA A;  3IJ3 A;  4F8Z A;  3PRT A;  5G20 A;  4NEX A;  5I4M A;  2PJB A;  1VHS A;  4XNH C;  4F0Y A;  4NGM A;  2Q7S A;  1MJB A;  3T9Y A;  3G8W A;  3NE8 A;  3SI0 A;  4MRI A;  2PJ7 A;  2Q4V A;  4JLY A;  3PB6 X;  4UWI A;  3TO9 A;  4ORF A;  3JVN A;  2VBQ A;  4M85 A;  3LAC A;  4MJ8 A;  3TOB A;  2V77 A;  4L8A A;  4P4F A;  4C7I A;  5HVG A;  5J1Q A;  4KOW A;  2VI7 A;  2V8D A;  1CPX A;  3PFE A;  4M6I A;  4KSA A;  1Q2Y A;  4XPK A;  2B4D B;  4CGM A;  2ZEH A;  5LRJ A;  1YQE A;  2ZOG A;  1XEB A;  4LQ6 A;  1S60 A;  7CPA A;  4MY0 A;  2PE3 A;  3EXN A;  5FVJ A;  2I00 A;  2GAN A;  4OP4 A;  3HUV A;  4U9Z A;  2QVP A;  4A31 A;  1QSR A;  1NMT A;  3KHZ A;  3KAS A;  2Z3N A;  1DE4 C;  4UCN A;  4X5K A;  5LYI A;  1ARL A;  3CXS A;  1QMU A;  3FXT A;  1S7L A;  1ZLH A;  1IGB A;  3FED A;  5H86 A;  2GLJ A;  1PYT B;  4CS0 B;  4RUH A;  4YU9 A;  2BL1 A;  3UY5 A;  2PC1 A;  4P4J A;  4UFW A;  1F2O A;  2C6P A;  4HPS A;  3RZA A;  2RFH A;  2Z0Z A;  3B3S A;  4F9U A;  3FNC A;  1IIC A;  2GIV A;  2PVW A;  3VAR A;  1BPM A;  1XF8 A;  1XMT A;  4HNY B;  1RXT A;  2OOT A;  2YNC C;  4R7M A;  4KOX A;  4B10 A;  2PJ4 A;  3S6H A;  3VAT A;  1XOV A;  3PB4 X;  4KOR A;  2ATR A;  4XNH B;  4IK2 A;  2ZEO A;  1IYL A;  4B11 A;  3FBU A;  3BLN A;  3GKR A;  5HVF A;  2ZW5 A;  2R8V A;  4MHZ A;  4CRY B;  5AG7 A;  1RTQ A;  3RYO A;  1K4J A;  4MFL A;  4C68 A;  4JWP A;  3EO4 A;  2B4B A;  4MCP A;  2C6G A;  4FD6 A;  4YWY A;  4PV6 A;  3TT2 A;  4C2X A;  3IO1 A;  3IEH A;  3KL9 A;  4QUS A;  1JWQ A;  3SJX A;  4FAI A;  4DJL A;  2FSR A;  1I1D A;  3D7D A;  2I79 A;  2X7B A;  2PJ1 A;  3DLJ A;  2OU2 A;  1CBX A;  3KQX A;  4OID A;  1CJW A;  1FY7 A;  1ZG9 A;  2H5M A;  5AG4 A;  3WC7 A;  3D3S A;  3NH5 A;  4B13 A;  5AGE A;  4KUA A;  2HQY A;  3PB7 X;  4E8O A;  3FYN A;  4AG9 A;  3H8G A;  3V7Z A;  2ZEP A;  1KUY A;  2OZH A;  3V8I A;  1MK4 A;  4IF5 A;  1GYT A;  2BCO A;  2BSW A;  4UBR A;  3OWC A;  2O4H A;  5AG5 A;  1TIQ A;  3FJU A;  3JUW A;  4OAE A;  3ISZ A;  1Z8W A;  4MHN A;  1NSL A;  4MHY A;  3PFO A;  2V8G A;  2Z3K A;  1CP6 A;  1F2P A;  4GM5 A;  4E2A A;  3B3W A;  2PCU A;  4JXR A;  4LQG A;  4R57 A;  4A33 A;  1YLO A;  3MN8 A;  4U5Y A;  2EUI A;  2J8N A;  1EE3 P;  3CPA A;  2AFU A;  4CGO A;  1QQ9 A;  2CXA A;  2FXF A;  4K30 A;  1BPN A;  4OC4 A;  3CDX A;  1YRE A;  3DSB A;  1Z9U A;  4ZBG A;  4AB7 A;  2BEI A;  4X2T A;  3KQZ A;  1AUG A;  1YVO A;  1M1D A;  2F8H A;  5DS0 A;  2ZEF A;  1IY7 A;  2REE A;  4O23 A;  5JH9 A;  2EWB A;  5KTC A;  2PR8 A;  1XE4 A;  4CAE A;  3SXO A;  4YRH A;  4EME A;  2R7H A;  3RBU A;  1XBU A;  1Z5R A;  4H6Z A;  2QML A;  1IID A;  5F48 A;  1J4J A;  2B3U A;  4OC3 A;  5F49 A;  5HH1 A;  3SXN A;  4A37 A;  5IV0 A;  4KLW A;  4NXY A;  5CNP A;  4KOT A;  3FEE A;  1YW6 A;  3IU1 A;  4KUB A;  2CIJ A;  2Z3O A;  3R1K A;  2PJ6 A;  4MHD A;  4OKO A;  4B12 A;  4ZGY B;  5JM6 A;  5HMN A;  1CM0 A;  1V0C A;  4H2K A;  1ZLI A;  2PRQ A;  2Z11 A;  3SI2 A;  4MI4 A;  1Y7E A;  1VHE A;  3SJE A;  3S9M A;  3T8W A;  5EMI A;  1M4G A;  4M6G A;  1YK3 A;  3CPX A;  3H5Z A;  4P4D A;  3VH9 A;  4OAD A;  3TC8 A;  3QNV A;  1IYK A;  4MCS A;  3S6K A;  4ZI6 A;  4FD5 A;  5HXD A;  2D4O A;  4MXU A;  1RO5 A;  4F6A A;  2Q4Y A;  4H6U A;  5C88 A;  2RB7 A;  4EVY A;  2AE6 A;  3B2Y A;  4Q38 A;  2JEW A;  4UA3 A;  5GCN A;  5JQ4 A;  4NFR A;  2PJ0 A;  5A27 A;  2PJ2 A;  4MFJ A;  4BD9 A;  1YGH A;  2CTC A;  2DXQ A;  2F7V A;  3BHX A;  1QST A;  3SJF A;  5F46 A;  1XFO A;  1S3Z A;  1Z4E A;  4MFQ A;  2ZEG A;  1VKC A;  2PDO A;  2WYR A;  4PSW A;  4YGO A;  2DPT A;  4ZY0 A;  4B5P A;  1XJO A;  4TWE A;  3SHP A;  3RO0 A;  2DPS A;  4A2Z A;  2J8R A;  3B3C A;  2OZU A;  3FEC A;  4Q7A A;  4WWV A;  1ON0 A;  1Y9W A;  2PIZ A;  1LRZ A;  1Y0Y A;  1Y9K A;  4NGP A;  3ISX A;  1I21 A;  4EFD A;  4JJX A;  4F0X A;  1M44 A;  1UWY A;  4M3S A;  3C26 A;  3B3T A;  2YGW A;  3NH4 A;  1LAN A;  1NE9 A;  2Z3M A;  4FBE A;  2GFQ A;  2CTB A;  3EY5 A;  2ZEN A;  2EK9 A;  3NE7 A;  3SJG A;  3GUX A;  1AYE A;  1BLL E;  3FVL A;  1TKH A;  2C1C A;  5D29 A;  1S7N A;  2QIR A;  2IQ6 A;  4NGT A;  1MJA A;  1M4I A;  3GB0 A;  1IB1 E;  1OZP A;  3CXP A;  4ONW A;  2VZZ A;  5DWM A;  5G22 A;  4OC0 A;  4QC6 A;  2XEI A;  3D8P A;  4MMO A;  4AG7 A;  1CPS A;  3QB8 A;  1XRY A;  4K3N A;  3WR7 A;  4CAX A;  1H8L A;  5DWN A;  4CRZ B;  5LYD A;  5LRK A;  3JTK A;  3S6G A;  2ZEM A;  1SQH A;  2FE7 A;  4TNU A;  1ZG8 A;  4LUA A;  2WUU A;  3H8E A;  2P0W A;  4OIW A;  4A95 A;  3S9N A;  2ANP A;  4A32 A;  2HUZ A;  5LYL A;  1R3N A;  2G3T A;  4Z65 A;  1F57 A;  3IWE A;  5K8N A;  2ZW4 A;  1BOB A;  2G9D A;  4E0A A;  3RAM A;  3RNZ A;  3TCV A;  4C2Z A;  2O28 A;  4Y49 B;  2G0B A;  4NCZ A;  2Q7B A;  3PB8 X;  1IU8 A;  5JGF A;  1HEE A;  2ZEL A;  5G21 A;  4AVC A;  2GE3 A;  2F5I A;  3EFA A;  4OME A;  5THW A;  2P6F A;  5G1Z A;  4A39 A;  3H4Q A;  4B5O A;  4MFK A;  2JBJ A;  1Z2L A;  2REF A;  1ELL P;  3DR6 A;  2DF5 A;  4R6T A;  4DUK A;  1YSJ A;  4CGN A;  4JD6 A;  2CF4 A;  3DR8 A;  2EO8 A;  4JXQ A;  5ISV A;  2Q0Y A;  1DTD A;  2A4N A;  3T90 A;  4OC5 A;  2C27 A;  3PBB A;  4NGQ A;  3W91 A;  4BBH A;  4KVX A;  4PK3 A;  4UEE A;  2RC4 A;  2P6G A;  4JZ0 A;  4L89 A;  1FNO A;  3S6F A;  2ZEE A;  3IU2 A;  3BJ8 A;  4P10 A;  2AFX A;  2B58 A;  1GHE A;  1LAP A;  3D7F A;  3FB3 A;  3FX6 A;  4OC2 A;  4AVA A;  1VHO A;  1Q2C A;  2QJ8 A;  2XEJ A;  4CPA A;  3WC5 A;  5H84 A;  3SI1 A;  2VXK A;  2FT0 A;  4R3K A;  2NSM A;  1S7K A;  4PXE A;  4F9V A;  2JDC A;  2JLM A;  4QVT A;  2JBK A;  2OZG A;  1TKF A;  2V8H A;  3IWW A;  4DYO A;  2WZN A;  4OC1 A;  2V8V A;  4P6Y A;  2FIW A;  2J8M A;  4NSQ A;  3FMC A;  1ZO0 A;  2I3C A;  4HKF A;  3JRU A;  4GS4 A;  1KUX A;  3W6X A;  1YVK A;  2BUE A;  3BI0 A;  4UEF A;  3D2M A;  3N5F A;  1YW4 A;  3MRU A;  5F47 A;  1IOI A;  8CPA A;  2WSA A;  3DNS A;  4NGN A;  3TTH A;  1M4L A;  4B14 A;  3D4U A;  1B6B A;  1PCA A;  2OH1 A;  2YNE A;  3D2P A;  4LX9 A;  1XIX A;  3F8K A;  2ZW7 A;  5ELY A;  3TO6 A;  4HNX B;  4UFX A;  3IWG A;  4PXD A;  5EC4 A;  4CYP A;  5KTD A;  2J9A A;  3IC1 A;  3TX8 A;  2ODF A;  3KGQ A;  2QEC A;  5C82 A;  4QB9 A;  1Z8X A;  5LYF A;  3R96 A;  3ZZI A;  2EBJ A;  1Z4R A;  2Q51 A;  4A94 A;  1NSA A;  3G3S A;  3GLJ A;  4NGR A;  5A28 A;  4FUU A;  4RN7 A;  1VGY A;  2OB0 A;  4W9Y A;  3BJ7 A;  4B5P B;  1PU9 A;  2B5G B;  3K2K A;  4P4I A;  3D7G A;  3KI9 A;  2K5T A;  3K9T A;  2HB6 A;  4KOU A;  4BIN A;  2PJC A;  4C2Y A;  4M6H A;  3LOD A;  3PBE A;  4PXC A;  1XMB A;  3GY9 A;  2ZPA A;  1LCP A;  4ZX9 A;  4I49 A;  4P4E A;  1HDQ A;  2P6E A;  3NA6 A;  3WT4 A;  1Q7L A;  4CYO A;  2QYV A;  4ZY1 A;  1QSN A;  1VIX A;  4NJR A;  1Y7R A;  2FCK A;  2FVG A;  3CZX A;  1ELM P;  3LD2 A;  4NF1 A;  2WPX A;  4RS2 A;  1JQG A;  3EC4 A;  4KOS A;  1KWM A;  1LOK A;  3CXQ A;  4UEZ A;  3ZJ0 A;  3FF3 A;  4YFJ A;  4U9Y A;  3KZW A;  3FH4 A;  4CAF A;  1KZF A;  2PQ8 A;  3I9S A;  4MHP A;  4AXV A;  5JPH A;  1YR0 A;  2YND A;  3V38 A;  2EVN A;  4NJQ A;  5CBM A;  4BMH A;  1CG2 A;  4CGL A;  1PUA A;  1TF9 A;  2Q43 A;  1YLE A;  4H89 A;  3R9G A;  1FT7 A;  4IUS A;  4KOV A;  5BWA B;  4ZY2 A;  4P4B A;  2PJ8 A;  3IGR A;  4C7H A;  3GYA A;  2JEV A;  2Z10 A;  2DEA A;  2IMO A;  4ZYQ A;  1BO4 A;  3H8F A;  2AJ6 A;  4ONU A;  1IOF A;  3PB9 X;  4OLL A;  4X3R A;  3W6S A;  4AVB A;  3QAY A;  4UCM A;  2AFM A;  3PEI A;  4PQA A;  3LWU A;  5K8P A;  2Q4Z A;  2AFW A;  4KVM E;  4JYW A;  2BO9 A;  2PRB A;  2JDD A;  3L2N A;  4FD4 A;  1TKJ A;  2YNC A;  3NH8 A;  1CX8 A;  5IB0 A;  3KKW A;  2CY2 A;  3WAB A;  4R8F A;  4IAV A;  4R9M A;  1QSO A;  2PR1 A;  2EK8 A;  3B3V A;  2PJ3 A;  1KUV A;  1HDU A;  2VZY A;  4MCR A;  2KCW A;  3S9L A;  2C6C A;  2G3A A;  3I1U A;  2WPW A;  3KR4 A;  1S5K A;  2AFS A;  2AFZ A;  3PP9 A;  4J3G A;  4CAW A;  1YME A;  5F09 A;  3IIB A;  1AMP A;  3P2F A;  4Q36 A;  4NGS A;  2O53 A;  2BOA A;  3WC6 A;  4QBJ A;  3D67 A;  2CNT A;  3D68 A;  2FL4 A;  4XPD B;  3R95 A;  4WJB A;  2R98 A;  3VWD A;  3BXM A;  4ZX8 A;  5KTA A;  2B5G A;  4GXH A;  4MBU A;  4B6Z A;  3E0K A;  4MCQ A;  1X10 A;  1P0H A;  2HC9 A;  1TXR A;  2OR4 A;  1U6M A;  3QAH A;  4FD7 A;  4KOY A;  3FRM A;  2B3V A;  3R9E A;  2FIA A;  1Z8L A;  4MFZ A;  3DGV A;  4Y49 C;  4UWJ A;  1Y0R A;  3B8G A;  5D8N A;  4XPD C;  1Z8T A;  3TE4 A;  4II9 A;  4PXB A;  5J8C A;  4EWT A;  1A2Z A;  2Q44 A;  3F0A A;  2VL1 A;  1S7F A;  3PGP A;  4KSI A;  2ZW6 A;  3LMS A;  4PPZ A;  3KHX A;  4UFV A;  1X12 A;  2CNM A;  3D66 A;  2PJA A;  3N7Z A;  4X8I A;  2IJZ A;  1WK4 A;  1L0C A;  2Z3L A;  4MY3 A;  2AFO A;  3FIX A;  5K8M A;  2GU2 A;  3B7I A;  3IFE A;  2D4P A; 
#chains in the Genus database with same CATH homology
 2HC9 A;  4RN7 A;  1XOV A;  3CZX A;  3NE8 A;  5EMI A;  4LQ6 A;  4BIN A;  2HB6 A;  4M6G A;  3QAY A;  4EFD A;  1JWQ A;  4M6H A;  2Q7S A;  4M6I A;  2ODF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...